BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18177_g2_i1 len=1948 path=[1926:0-1821 3748:1822-1845
3772:1846-1947]

Length=1948
                                                                      Score     E

ref|XP_009794572.1|  PREDICTED: wall-associated receptor kinase-l...    903   0.0      
ref|XP_009616014.1|  PREDICTED: wall-associated receptor kinase-l...    902   0.0      
ref|XP_004238203.1|  PREDICTED: wall-associated receptor kinase-l...    884   0.0      
emb|CDP07589.1|  unnamed protein product                                874   0.0      
ref|XP_006366440.1|  PREDICTED: wall-associated receptor kinase-l...    864   0.0      
ref|XP_011083766.1|  PREDICTED: wall-associated receptor kinase-l...    843   0.0      
ref|XP_007017425.1|  Kinase superfamily protein                         775   0.0      
ref|XP_010664629.1|  PREDICTED: wall-associated receptor kinase-l...    763   0.0      
ref|XP_003527703.1|  PREDICTED: wall-associated receptor kinase-l...    753   0.0      
gb|KHN04540.1|  Wall-associated receptor kinase-like 14                 741   0.0      
ref|XP_003523885.1|  PREDICTED: wall-associated receptor kinase-l...    739   0.0      
gb|KHG01141.1|  Wall-associated receptor kinase-like 14                 735   0.0      
ref|XP_006578002.1|  PREDICTED: wall-associated receptor kinase-l...    735   0.0      
gb|KDO79395.1|  hypothetical protein CISIN_1g005522mg                   732   0.0      
ref|XP_006425789.1|  hypothetical protein CICLE_v10025043mg             731   0.0      
gb|KDP38442.1|  hypothetical protein JCGZ_04367                         729   0.0      
ref|XP_008339009.1|  PREDICTED: wall-associated receptor kinase-l...    730   0.0      
ref|XP_010255034.1|  PREDICTED: wall-associated receptor kinase-l...    727   0.0      
ref|XP_009379148.1|  PREDICTED: wall-associated receptor kinase-l...    727   0.0      
ref|XP_009379147.1|  PREDICTED: wall-associated receptor kinase-l...    725   0.0      
ref|XP_002522378.1|  kinase, putative                                   724   0.0      Ricinus communis
ref|XP_004501050.1|  PREDICTED: wall-associated receptor kinase-l...    723   0.0      
gb|KDP31840.1|  hypothetical protein JCGZ_12301                         722   0.0      
ref|XP_004291924.1|  PREDICTED: wall-associated receptor kinase-l...    722   0.0      
ref|XP_011017268.1|  PREDICTED: wall-associated receptor kinase-l...    720   0.0      
ref|XP_006473409.1|  PREDICTED: wall-associated receptor kinase-l...    718   0.0      
ref|XP_008220730.1|  PREDICTED: wall-associated receptor kinase-l...    717   0.0      
gb|AES73970.2|  wall associated kinase-like protein                     718   0.0      
ref|XP_009376468.1|  PREDICTED: wall-associated receptor kinase-l...    717   0.0      
ref|XP_009341914.1|  PREDICTED: wall-associated receptor kinase-l...    717   0.0      
ref|XP_011031029.1|  PREDICTED: wall-associated receptor kinase-l...    716   0.0      
ref|XP_008790198.1|  PREDICTED: wall-associated receptor kinase-l...    716   0.0      
ref|XP_011017269.1|  PREDICTED: wall-associated receptor kinase-l...    715   0.0      
ref|XP_011031055.1|  PREDICTED: wall-associated receptor kinase-l...    715   0.0      
ref|XP_009364200.1|  PREDICTED: wall-associated receptor kinase-l...    713   0.0      
ref|XP_010263819.1|  PREDICTED: wall-associated receptor kinase-l...    712   0.0      
ref|XP_009630314.1|  PREDICTED: wall-associated receptor kinase-l...    711   0.0      
ref|XP_004511986.1|  PREDICTED: wall-associated receptor kinase-l...    710   0.0      
ref|XP_006375036.1|  hypothetical protein POPTR_0014s03810g             709   0.0      
ref|XP_009341926.1|  PREDICTED: wall-associated receptor kinase-l...    709   0.0      
ref|XP_008338207.1|  PREDICTED: wall-associated receptor kinase-l...    704   0.0      
ref|XP_006434895.1|  hypothetical protein CICLE_v10000511mg             706   0.0      
ref|XP_009789522.1|  PREDICTED: wall-associated receptor kinase-l...    706   0.0      
gb|KHN22281.1|  Wall-associated receptor kinase-like 14                 701   0.0      
ref|XP_008367960.1|  PREDICTED: wall-associated receptor kinase-l...    704   0.0      
ref|XP_007226546.1|  hypothetical protein PRUPE_ppa024936mg             702   0.0      
ref|XP_010070472.1|  PREDICTED: wall-associated receptor kinase-l...    702   0.0      
ref|XP_002310180.1|  hypothetical protein POPTR_0007s11990g             702   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_008377371.1|  PREDICTED: wall-associated receptor kinase-l...    701   0.0      
ref|XP_010906921.1|  PREDICTED: wall-associated receptor kinase-l...    701   0.0      
ref|XP_011004593.1|  PREDICTED: wall-associated receptor kinase-l...    701   0.0      
ref|XP_007204625.1|  hypothetical protein PRUPE_ppa002163mg             699   0.0      
ref|XP_003611850.1|  Kinase-like protein                                698   0.0      
gb|EYU45087.1|  hypothetical protein MIMGU_mgv1a002843mg                694   0.0      
gb|ABK96380.1|  unknown                                                 696   0.0      Populus trichocarpa x Populus deltoides
ref|XP_011025667.1|  PREDICTED: wall-associated receptor kinase-l...    694   0.0      
ref|XP_006338251.1|  PREDICTED: wall-associated receptor kinase-l...    694   0.0      
gb|AAS45124.1|  WAK-like kinase                                         692   0.0      Solanum lycopersicum
ref|XP_009365635.1|  PREDICTED: wall-associated receptor kinase-l...    692   0.0      
ref|XP_006856200.1|  hypothetical protein AMTR_s00059p00192290          689   0.0      
ref|NP_001234504.1|  wall-associated receptor kinase-like 14 prec...    689   0.0      
ref|XP_004300571.1|  PREDICTED: wall-associated receptor kinase-l...    688   0.0      
ref|XP_004152788.1|  PREDICTED: wall-associated receptor kinase-l...    685   0.0      
ref|XP_007156857.1|  hypothetical protein PHAVU_002G023400g             682   0.0      
ref|XP_009415309.1|  PREDICTED: wall-associated receptor kinase-l...    682   0.0      
ref|XP_008241591.1|  PREDICTED: wall-associated receptor kinase-l...    681   0.0      
ref|XP_007047100.1|  Kinase superfamily protein                         680   0.0      
gb|KCW67772.1|  hypothetical protein EUGRSUZ_F01504                     679   0.0      
ref|XP_002307237.1|  hypothetical protein POPTR_0005s13920g             679   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_008444664.1|  PREDICTED: wall-associated receptor kinase-l...    678   0.0      
ref|XP_010060884.1|  PREDICTED: wall-associated receptor kinase-l...    679   0.0      
ref|XP_010548399.1|  PREDICTED: wall-associated receptor kinase-l...    677   0.0      
ref|XP_002301212.2|  hypothetical protein POPTR_0002s13210g             675   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010089008.1|  Wall-associated receptor kinase-like 14            679   0.0      
ref|XP_011085521.1|  PREDICTED: wall-associated receptor kinase-l...    677   0.0      
ref|XP_003517271.1|  PREDICTED: wall-associated receptor kinase-l...    676   0.0      
ref|XP_002510319.1|  kinase, putative                                   671   0.0      Ricinus communis
ref|XP_010646389.1|  PREDICTED: wall-associated receptor kinase-l...    670   0.0      
ref|XP_002275295.1|  PREDICTED: wall-associated receptor kinase-l...    669   0.0      Vitis vinifera
ref|XP_010531234.1|  PREDICTED: wall-associated receptor kinase-l...    668   0.0      
ref|XP_010531235.1|  PREDICTED: wall-associated receptor kinase-l...    666   0.0      
ref|XP_010028331.1|  PREDICTED: wall-associated receptor kinase-l...    667   0.0      
gb|KDO84381.1|  hypothetical protein CISIN_1g007442mg                   660   0.0      
gb|KHG05164.1|  Wall-associated receptor kinase-like 14                 663   0.0      
ref|XP_008792620.1|  PREDICTED: wall-associated receptor kinase-l...    660   0.0      
ref|XP_006404832.1|  hypothetical protein EUTSA_v10000066mg             655   0.0      
gb|KHG04381.1|  Wall-associated receptor kinase-like 14                 655   0.0      
ref|XP_009117279.1|  PREDICTED: wall-associated receptor kinase-l...    652   0.0      
gb|KHG13439.1|  Wall-associated receptor kinase-like 14                 651   0.0      
ref|XP_004509198.1|  PREDICTED: wall-associated receptor kinase-l...    650   0.0      
ref|XP_007155987.1|  hypothetical protein PHAVU_003G249300g             649   0.0      
ref|XP_010908096.1|  PREDICTED: wall-associated receptor kinase-l...    647   0.0      
ref|XP_010680965.1|  PREDICTED: wall-associated receptor kinase-l...    647   0.0      
gb|KHN13357.1|  Wall-associated receptor kinase-like 14                 647   0.0      
emb|CDY68677.1|  BnaCnng60020D                                          645   0.0      
ref|XP_003548009.1|  PREDICTED: wall-associated receptor kinase-l...    646   0.0      
ref|XP_009389437.1|  PREDICTED: wall-associated receptor kinase-l...    645   0.0      
ref|XP_009140464.1|  PREDICTED: wall-associated receptor kinase-l...    644   0.0      
emb|CDY46073.1|  BnaA09g41970D                                          645   0.0      
ref|XP_006293370.1|  hypothetical protein CARUB_v10022765mg             642   0.0      
emb|CDX89573.1|  BnaC04g35920D                                          642   0.0      
gb|KHN00584.1|  Wall-associated receptor kinase-like 14                 643   0.0      
emb|CDY38944.1|  BnaA04g13650D                                          641   0.0      
gb|KEH20472.1|  wall associated kinase-like protein                     640   0.0      
ref|XP_010472340.1|  PREDICTED: wall-associated receptor kinase-l...    640   0.0      
ref|XP_006574720.1|  PREDICTED: wall-associated receptor kinase-l...    639   0.0      
ref|XP_010417096.1|  PREDICTED: wall-associated receptor kinase-l...    633   0.0      
ref|XP_010429293.1|  PREDICTED: wall-associated receptor kinase-l...    632   0.0      
ref|XP_008440186.1|  PREDICTED: wall-associated receptor kinase-l...    627   0.0      
ref|NP_565552.1|  wall-associated receptor kinase-like 14               626   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AAL91622.1|  At2g23450/F26B6.10                                      625   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002880505.1|  kinase family protein                              624   0.0      
gb|KGN48469.1|  hypothetical protein Csa_6G488880                       623   0.0      
ref|XP_009392373.1|  PREDICTED: wall-associated receptor kinase-l...    622   0.0      
gb|EPS73768.1|  hypothetical protein M569_00987                         604   0.0      
ref|XP_006649661.1|  PREDICTED: wall-associated receptor kinase-l...    597   0.0      
ref|XP_009412515.1|  PREDICTED: wall-associated receptor kinase-l...    596   0.0      
ref|NP_001049435.1|  Os03g0225700                                       591   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EAY89102.1|  hypothetical protein OsI_10590                          589   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_004142024.1|  PREDICTED: wall-associated receptor kinase-l...    575   0.0      
ref|XP_002468238.1|  hypothetical protein SORBIDRAFT_01g042280          567   0.0      Sorghum bicolor [broomcorn]
ref|XP_008652965.1|  PREDICTED: wall-associated receptor kinase-l...    566   0.0      
ref|XP_004985141.1|  PREDICTED: wall-associated receptor kinase-l...    565   0.0      
ref|XP_010550388.1|  PREDICTED: wall-associated receptor kinase-l...    549   0.0      
dbj|BAK05177.1|  predicted protein                                      553   0.0      
gb|EEE58629.1|  hypothetical protein OsJ_09989                          548   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_006393874.1|  hypothetical protein EUTSA_v10003840mg             535   3e-179   
ref|XP_002866737.1|  predicted protein                                  534   9e-179   
emb|CDY53844.1|  BnaA07g37390D                                          532   3e-178   
ref|XP_008347439.1|  PREDICTED: wall-associated receptor kinase-l...    527   1e-177   
ref|XP_006280180.1|  hypothetical protein CARUB_v10026084mg             530   4e-177   
emb|CDY54167.1|  BnaC07g48570D                                          528   2e-176   
ref|XP_003558447.1|  PREDICTED: wall-associated receptor kinase-l...    531   2e-176   
ref|XP_009103485.1|  PREDICTED: wall-associated receptor kinase-l...    527   3e-176   
ref|XP_010464869.1|  PREDICTED: LOW QUALITY PROTEIN: wall-associa...    526   1e-175   
ref|XP_004160512.1|  PREDICTED: wall-associated receptor kinase-l...    513   1e-172   
ref|XP_008347440.1|  PREDICTED: wall-associated receptor kinase-l...    508   6e-172   
ref|XP_010106074.1|  Wall-associated receptor kinase-like 14            504   1e-170   
gb|KFK28363.1|  hypothetical protein AALP_AA8G505700                    511   4e-170   
dbj|BAC42322.1|  unknown protein                                        506   7e-168   Arabidopsis thaliana [mouse-ear cress]
ref|NP_201480.3|  wall-associated receptor kinase-like 21               503   9e-167   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008674033.1|  PREDICTED: WAK-like kinase isoform X1              454   2e-146   
tpg|DAA47345.1|  TPA: putative WAK-related receptor-like protein ...    443   3e-142   
ref|NP_001147438.1|  WAK-like kinase precursor                          443   4e-142   Zea mays [maize]
dbj|BAJ96733.1|  predicted protein                                      436   2e-139   
dbj|BAJ96357.1|  predicted protein                                      432   3e-138   
gb|EAY83755.1|  hypothetical protein OsI_38972                          432   5e-138   Oryza sativa Indica Group [Indian rice]
gb|KFK28362.1|  hypothetical protein AALP_AA8G505700                    427   1e-137   
ref|NP_001067182.1|  Os12g0595800                                       431   2e-137   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004963056.1|  PREDICTED: wall-associated receptor kinase-l...    431   2e-137   
gb|EMT09586.1|  Wall-associated receptor kinase-like 14                 424   5e-135   
ref|XP_004963055.1|  PREDICTED: wall-associated receptor kinase-l...    424   2e-134   
gb|ABG22068.1|  Protein kinase domain containing protein, expressed     421   1e-133   
ref|XP_003577672.1|  PREDICTED: wall-associated receptor kinase-l...    416   6e-132   
ref|XP_002442442.1|  hypothetical protein SORBIDRAFT_08g020100          417   7e-132   Sorghum bicolor [broomcorn]
ref|XP_010535318.1|  PREDICTED: wall-associated receptor kinase-l...    387   1e-126   
ref|XP_009419441.1|  PREDICTED: wall-associated receptor kinase-l...    386   7e-125   
gb|ABA99190.2|  Protein kinase domain containing protein, expressed     394   2e-124   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002993997.1|  hypothetical protein SELMODRAFT_25054              353   2e-113   
emb|CBI38365.3|  unnamed protein product                                359   5e-111   
ref|XP_002979084.1|  hypothetical protein SELMODRAFT_25174              347   1e-110   
gb|ACN87687.1|  kinase-like protein                                     325   9e-104   Corylus avellana [European hazelnut]
gb|ACN87686.1|  kinase-like protein                                     325   9e-104   Corylus avellana [European hazelnut]
gb|ACN87688.1|  kinase-like protein                                     322   1e-102   Corylus avellana [European hazelnut]
gb|ACN87685.1|  kinase-like protein                                     322   2e-102   Corylus avellana [European hazelnut]
gb|ACI05974.1|  kinase-like protein pac.W.ArB.305                       317   1e-100   Platanus x hispanica [London plane tree]
ref|XP_002960238.1|  hypothetical protein SELMODRAFT_139490             319   5e-99    
ref|XP_002967476.1|  hypothetical protein SELMODRAFT_87751              319   5e-99    
gb|ACN87689.1|  kinase-like protein                                     309   8e-98    Corylus avellana [European hazelnut]
ref|XP_001774205.1|  predicted protein                                  309   3e-96    
gb|KCW58874.1|  hypothetical protein EUGRSUZ_H01501                     319   1e-95    
ref|XP_010026226.1|  PREDICTED: L-type lectin-domain containing r...    318   4e-94    
ref|XP_002966230.1|  hypothetical protein SELMODRAFT_25022              300   9e-93    
gb|ACN87690.1|  kinase-like protein                                     295   3e-92    Corylus avellana [European hazelnut]
ref|XP_006842370.1|  hypothetical protein AMTR_s00079p00188790          308   3e-92    
ref|XP_011076378.1|  PREDICTED: probable serine/threonine-protein...    310   3e-92    
emb|CDP00659.1|  unnamed protein product                                301   2e-91    
gb|KDO63212.1|  hypothetical protein CISIN_1g013686mg                   300   1e-90    
ref|XP_010070227.1|  PREDICTED: L-type lectin-domain containing r...    305   3e-90    
ref|XP_002980244.1|  hypothetical protein SELMODRAFT_112637             293   4e-90    
ref|XP_006482215.1|  PREDICTED: probable serine/threonine-protein...    300   4e-90    
ref|XP_010264788.1|  PREDICTED: probable serine/threonine-protein...    305   4e-90    
gb|EPS62302.1|  hypothetical protein M569_12488                         294   4e-90    
ref|XP_002963090.1|  hypothetical protein SELMODRAFT_78793              294   4e-90    
ref|NP_001170444.1|  uncharacterized protein LOC100384436               298   1e-89    Zea mays [maize]
gb|KDO76913.1|  hypothetical protein CISIN_1g0479691mg                  295   1e-89    
dbj|BAK03500.1|  predicted protein                                      296   3e-89    
ref|XP_009394439.1|  PREDICTED: probable serine/threonine-protein...    293   3e-89    
ref|XP_010279341.1|  PREDICTED: probable serine/threonine-protein...    302   5e-89    
dbj|BAG89943.1|  unnamed protein product                                292   6e-89    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010279338.1|  PREDICTED: probable serine/threonine-protein...    302   1e-88    
ref|XP_009600764.1|  PREDICTED: probable serine/threonine-protein...    301   1e-88    
ref|XP_010279339.1|  PREDICTED: probable serine/threonine-protein...    301   1e-88    
ref|XP_006344161.1|  PREDICTED: probable serine/threonine-protein...    297   1e-88    
gb|EYU40786.1|  hypothetical protein MIMGU_mgv11b002117mg               301   1e-88    
ref|XP_011070774.1|  PREDICTED: probable serine/threonine-protein...    301   1e-88    
ref|XP_009405140.1|  PREDICTED: probable serine/threonine-protein...    294   2e-88    
ref|XP_010279340.1|  PREDICTED: probable serine/threonine-protein...    301   3e-88    
ref|XP_010279337.1|  PREDICTED: probable serine/threonine-protein...    301   3e-88    
ref|XP_007044246.1|  Kinase superfamily protein, putative isoform 2     300   3e-88    
ref|XP_008782360.1|  PREDICTED: probable serine/threonine-protein...    293   4e-88    
ref|XP_009801718.1|  PREDICTED: probable serine/threonine-protein...    300   4e-88    
ref|XP_010922266.1|  PREDICTED: probable serine/threonine-protein...    292   5e-88    
gb|KCW58869.1|  hypothetical protein EUGRSUZ_H01495                     298   5e-88    
ref|XP_004252723.1|  PREDICTED: wall-associated receptor kinase-l...    298   6e-88    
ref|XP_010922259.1|  PREDICTED: probable serine/threonine-protein...    292   6e-88    
ref|XP_002527017.1|  wall-associated kinase, putative                   300   7e-88    Ricinus communis
ref|XP_004300506.1|  PREDICTED: probable serine/threonine-protein...    298   2e-87    
ref|XP_006344163.1|  PREDICTED: probable serine/threonine-protein...    295   2e-87    
ref|XP_007158796.1|  hypothetical protein PHAVU_002G182500g             298   2e-87    
gb|KFK34631.1|  hypothetical protein AALP_AA5G171200                    291   2e-87    
ref|XP_007044245.1|  Kinase superfamily protein, putative isoform 1     300   2e-87    
ref|XP_010551255.1|  PREDICTED: probable serine/threonine-protein...    297   3e-87    
ref|XP_004308840.1|  PREDICTED: wall-associated receptor kinase-l...    296   3e-87    
ref|XP_006482214.1|  PREDICTED: probable serine/threonine-protein...    299   3e-87    
ref|XP_009396367.1|  PREDICTED: probable serine/threonine-protein...    298   3e-87    
ref|XP_004300505.1|  PREDICTED: probable serine/threonine-protein...    298   4e-87    
ref|XP_010660405.1|  PREDICTED: probable serine/threonine-protein...    297   5e-87    
ref|XP_004238904.1|  PREDICTED: probable serine/threonine-protein...    297   5e-87    
ref|XP_009360135.1|  PREDICTED: probable serine/threonine-protein...    293   5e-87    
ref|XP_006430730.1|  hypothetical protein CICLE_v10011179mg             298   5e-87    
ref|XP_004167016.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...    295   5e-87    
ref|XP_002314842.2|  hypothetical protein POPTR_0010s13080g             288   5e-87    Populus trichocarpa [western balsam poplar]
ref|XP_006344312.1|  PREDICTED: probable serine/threonine-protein...    305   6e-87    
ref|XP_011034941.1|  PREDICTED: wall-associated receptor kinase-l...    296   6e-87    
ref|XP_010456187.1|  PREDICTED: putative receptor-like protein ki...    296   7e-87    
ref|XP_009600768.1|  PREDICTED: probable serine/threonine-protein...    295   8e-87    
ref|XP_004238901.1|  PREDICTED: probable serine/threonine-protein...    296   9e-87    
ref|XP_010660404.1|  PREDICTED: probable serine/threonine-protein...    297   1e-86    
gb|KDO39222.1|  hypothetical protein CISIN_1g017232mg                   287   1e-86    
tpg|DAA58038.1|  TPA: putative WAK receptor-like protein kinase f...    296   1e-86    
ref|XP_010660403.1|  PREDICTED: probable serine/threonine-protein...    296   2e-86    
ref|XP_001776649.1|  predicted protein                                  284   2e-86    
ref|XP_010660402.1|  PREDICTED: probable serine/threonine-protein...    296   2e-86    
ref|XP_010910519.1|  PREDICTED: probable serine/threonine-protein...    287   2e-86    
ref|XP_008673287.1|  PREDICTED: uncharacterized protein LOC100384...    296   2e-86    
ref|XP_006344162.1|  PREDICTED: probable serine/threonine-protein...    295   3e-86    
ref|XP_009759507.1|  PREDICTED: probable serine/threonine-protein...    295   3e-86    
ref|XP_007009294.1|  Kinase, putative                                   294   3e-86    
ref|XP_009759506.1|  PREDICTED: probable serine/threonine-protein...    295   3e-86    
ref|XP_010916447.1|  PREDICTED: probable serine/threonine-protein...    295   3e-86    
ref|XP_009759505.1|  PREDICTED: probable serine/threonine-protein...    290   4e-86    
ref|XP_009775398.1|  PREDICTED: probable serine/threonine-protein...    294   4e-86    
ref|XP_006387971.1|  hypothetical protein POPTR_0442s00200g             294   4e-86    
ref|XP_006388422.1|  hypothetical protein POPTR_0188s00200g             294   5e-86    
tpg|DAA38848.1|  TPA: putative WAK receptor-like protein kinase f...    285   5e-86    
ref|XP_010098860.1|  Wall-associated receptor kinase-like 20            293   5e-86    
ref|XP_010232164.1|  PREDICTED: probable serine/threonine-protein...    295   6e-86    
ref|XP_004150517.1|  PREDICTED: probable serine/threonine-protein...    295   6e-86    
ref|XP_010540003.1|  PREDICTED: probable serine/threonine-protein...    294   6e-86    
gb|KGN54630.1|  hypothetical protein Csa_4G410830                       294   7e-86    
gb|KHN23761.1|  Putative serine/threonine-protein kinase                290   7e-86    
dbj|BAJ85706.1|  predicted protein                                      295   7e-86    
ref|XP_006468738.1|  PREDICTED: probable serine/threonine-protein...    294   7e-86    
ref|XP_008243423.1|  PREDICTED: probable serine/threonine-protein...    294   7e-86    
ref|XP_006448414.1|  hypothetical protein CICLE_v10014492mg             294   8e-86    
dbj|BAJ94271.1|  predicted protein                                      295   9e-86    
gb|KGN63838.1|  hypothetical protein Csa_1G024230                       288   1e-85    
ref|XP_010654013.1|  PREDICTED: wall-associated receptor kinase-l...    293   1e-85    
gb|KDP35039.1|  hypothetical protein JCGZ_09327                         294   1e-85    
ref|XP_009381737.1|  PREDICTED: probable serine/threonine-protein...    285   1e-85    
ref|XP_004239409.1|  PREDICTED: probable serine/threonine-protein...    292   1e-85    
ref|XP_008444082.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...    293   1e-85    
ref|XP_009767974.1|  PREDICTED: probable serine/threonine-protein...    293   1e-85    
ref|XP_006383414.1|  hypothetical protein POPTR_0005s15270g             294   1e-85    
ref|XP_006470647.1|  PREDICTED: wall-associated receptor kinase-l...    293   2e-85    
emb|CDP02756.1|  unnamed protein product                                286   2e-85    
ref|XP_009407357.1|  PREDICTED: probable serine/threonine-protein...    292   2e-85    
ref|XP_009600759.1|  PREDICTED: probable serine/threonine-protein...    293   2e-85    
ref|XP_002962688.1|  hypothetical protein SELMODRAFT_23147              281   2e-85    
ref|XP_011007437.1|  PREDICTED: probable serine/threonine-protein...    292   2e-85    
ref|NP_001238417.1|  serine/threonine protein kinase family protein     293   2e-85    
ref|XP_002980407.1|  hypothetical protein SELMODRAFT_12987              281   2e-85    
ref|XP_006435611.1|  hypothetical protein CICLE_v10030949mg             291   2e-85    
ref|XP_009600758.1|  PREDICTED: probable serine/threonine-protein...    292   2e-85    
ref|XP_009600763.1|  PREDICTED: probable serine/threonine-protein...    288   3e-85    
ref|XP_011035095.1|  PREDICTED: probable serine/threonine-protein...    291   3e-85    
ref|XP_010540002.1|  PREDICTED: probable serine/threonine-protein...    293   3e-85    
ref|XP_006486417.1|  PREDICTED: wall-associated receptor kinase-l...    291   3e-85    
ref|XP_009407341.1|  PREDICTED: probable serine/threonine-protein...    292   3e-85    
ref|XP_006366426.1|  PREDICTED: wall-associated receptor kinase-l...    291   3e-85    
ref|XP_009407350.1|  PREDICTED: probable serine/threonine-protein...    292   3e-85    
ref|XP_010922245.1|  PREDICTED: probable serine/threonine-protein...    292   3e-85    
ref|XP_006387946.1|  hypothetical protein POPTR_0463s00220g             293   3e-85    
ref|XP_010922253.1|  PREDICTED: probable serine/threonine-protein...    291   3e-85    
ref|XP_010320744.1|  PREDICTED: probable serine/threonine-protein...    292   3e-85    
gb|KHG23448.1|  Wall-associated receptor kinase-like 20                 291   4e-85    
gb|EAZ13153.1|  hypothetical protein OsJ_03072                          292   4e-85    
ref|XP_004135082.1|  PREDICTED: probable serine/threonine-protein...    286   4e-85    
ref|XP_004238903.1|  PREDICTED: probable serine/threonine-protein...    292   4e-85    
dbj|BAK03553.1|  predicted protein                                      293   4e-85    
ref|NP_001043925.2|  Os01g0689900                                       293   5e-85    
ref|XP_011035098.1|  PREDICTED: probable serine/threonine-protein...    292   5e-85    
ref|XP_010477015.1|  PREDICTED: probable serine/threonine-protein...    291   5e-85    
ref|XP_010922240.1|  PREDICTED: probable serine/threonine-protein...    292   5e-85    
ref|XP_010916449.1|  PREDICTED: probable serine/threonine-protein...    291   5e-85    
gb|EAY75432.1|  hypothetical protein OsI_03334                          292   5e-85    
ref|XP_002305830.2|  hypothetical protein POPTR_0004s09640g             291   5e-85    
ref|XP_008671496.1|  PREDICTED: probable serine/threonine-protein...    285   5e-85    
ref|XP_009360133.1|  PREDICTED: probable serine/threonine-protein...    292   5e-85    
gb|KCW68952.1|  hypothetical protein EUGRSUZ_F025172                    291   5e-85    
dbj|BAD82479.1|  wall-associated kinase 4-like                          292   5e-85    
ref|XP_009391159.1|  PREDICTED: probable serine/threonine-protein...    285   6e-85    
ref|XP_010068892.1|  PREDICTED: wall-associated receptor kinase-l...    290   6e-85    
ref|XP_011045830.1|  PREDICTED: probable serine/threonine-protein...    291   6e-85    
ref|XP_009759504.1|  PREDICTED: probable serine/threonine-protein...    291   7e-85    
ref|XP_007142946.1|  hypothetical protein PHAVU_007G0307001g            283   7e-85    
ref|XP_011035096.1|  PREDICTED: probable serine/threonine-protein...    292   7e-85    
ref|XP_010654012.1|  PREDICTED: wall-associated receptor kinase-l...    292   7e-85    
gb|ACN32143.1|  unknown                                                 282   8e-85    
ref|XP_011045829.1|  PREDICTED: probable serine/threonine-protein...    291   8e-85    
ref|XP_009801720.1|  PREDICTED: probable serine/threonine-protein...    285   8e-85    
ref|XP_002524904.1|  wall-associated kinase, putative                   292   8e-85    
ref|XP_009759502.1|  PREDICTED: probable serine/threonine-protein...    291   8e-85    
ref|XP_011035099.1|  PREDICTED: probable serine/threonine-protein...    291   8e-85    
ref|XP_004239410.1|  PREDICTED: probable serine/threonine-protein...    291   8e-85    
ref|XP_001765010.1|  predicted protein                                  281   8e-85    
ref|XP_010320750.1|  PREDICTED: probable serine/threonine-protein...    291   8e-85    
ref|XP_006353811.1|  PREDICTED: probable serine/threonine-protein...    283   8e-85    
ref|XP_010477016.1|  PREDICTED: probable serine/threonine-protein...    290   1e-84    
ref|XP_010916448.1|  PREDICTED: probable serine/threonine-protein...    291   1e-84    
ref|XP_010459452.1|  PREDICTED: probable serine/threonine-protein...    290   2e-84    
ref|XP_006446164.1|  hypothetical protein CICLE_v10017557mg             290   2e-84    
ref|XP_002318540.2|  hypothetical protein POPTR_0012s05090g             281   2e-84    
ref|XP_002322064.2|  hypothetical protein POPTR_0015s03880g             290   2e-84    
ref|XP_006388551.1|  hypothetical protein POPTR_0160s002401g            286   2e-84    
ref|XP_011038759.1|  PREDICTED: probable serine/threonine-protein...    290   2e-84    
gb|KDP32982.1|  hypothetical protein JCGZ_13013                         291   2e-84    
ref|XP_010459451.1|  PREDICTED: probable serine/threonine-protein...    290   2e-84    
ref|XP_009613901.1|  PREDICTED: probable serine/threonine-protein...    290   2e-84    
ref|XP_009600762.1|  PREDICTED: probable serine/threonine-protein...    288   2e-84    
ref|XP_010108877.1|  putative serine/threonine-protein kinase           290   2e-84    
ref|XP_009600761.1|  PREDICTED: probable serine/threonine-protein...    289   2e-84    
ref|XP_002455236.1|  hypothetical protein SORBIDRAFT_03g006850          283   2e-84    
ref|XP_006344306.1|  PREDICTED: probable serine/threonine-protein...    286   2e-84    
ref|XP_004968019.1|  PREDICTED: probable serine/threonine-protein...    290   3e-84    
gb|ACN32080.1|  unknown                                                 281   3e-84    
ref|XP_011038756.1|  PREDICTED: probable serine/threonine-protein...    291   3e-84    
ref|XP_011085014.1|  PREDICTED: wall-associated receptor kinase-l...    288   3e-84    
ref|XP_002516765.1|  wall-associated kinase, putative                   290   3e-84    
gb|KHN47232.1|  Putative serine/threonine-protein kinase                290   3e-84    
ref|XP_011038758.1|  PREDICTED: probable serine/threonine-protein...    290   3e-84    
ref|XP_006381343.1|  hypothetical protein POPTR_0006s12000g             289   3e-84    
ref|XP_011038755.1|  PREDICTED: probable serine/threonine-protein...    291   3e-84    
ref|XP_006477786.1|  PREDICTED: probable serine/threonine-protein...    289   4e-84    
ref|XP_009600760.1|  PREDICTED: probable serine/threonine-protein...    289   4e-84    
ref|XP_011038757.1|  PREDICTED: probable serine/threonine-protein...    291   4e-84    
ref|XP_009793145.1|  PREDICTED: probable serine/threonine-protein...    289   4e-84    
gb|KCW64691.1|  hypothetical protein EUGRSUZ_G02279                     282   4e-84    
ref|XP_010320749.1|  PREDICTED: probable serine/threonine-protein...    288   4e-84    
ref|XP_004290450.1|  PREDICTED: probable serine/threonine-protein...    290   4e-84    
ref|XP_008374780.1|  PREDICTED: probable serine/threonine-protein...    289   4e-84    
ref|XP_006477785.1|  PREDICTED: probable serine/threonine-protein...    289   4e-84    
ref|XP_010042926.1|  PREDICTED: probable serine/threonine-protein...    281   4e-84    
ref|XP_004290448.1|  PREDICTED: probable serine/threonine-protein...    290   5e-84    
ref|XP_010105421.1|  Wall-associated receptor kinase-like 20            288   5e-84    
ref|XP_004238899.1|  PREDICTED: probable serine/threonine-protein...    289   5e-84    
ref|XP_009793146.1|  PREDICTED: probable serine/threonine-protein...    289   5e-84    
ref|XP_006344164.1|  PREDICTED: probable serine/threonine-protein...    289   5e-84    
gb|KHG17350.1|  hypothetical protein F383_10059                         281   5e-84    
emb|CDM80800.1|  unnamed protein product                                283   5e-84    
ref|XP_006384188.1|  hypothetical protein POPTR_0004s09610g             289   5e-84    
ref|XP_009347440.1|  PREDICTED: probable serine/threonine-protein...    288   6e-84    
ref|XP_010262628.1|  PREDICTED: wall-associated receptor kinase-l...    288   6e-84    
gb|KCW48772.1|  hypothetical protein EUGRSUZ_K02415                     287   6e-84    
ref|XP_006646222.1|  PREDICTED: probable serine/threonine-protein...    295   6e-84    
ref|XP_006574838.1|  PREDICTED: probable serine/threonine-protein...    289   6e-84    
gb|KCW45663.1|  hypothetical protein EUGRSUZ_L00560                     280   7e-84    
ref|XP_009600766.1|  PREDICTED: probable serine/threonine-protein...    282   7e-84    
ref|XP_006603051.1|  PREDICTED: probable serine/threonine-protein...    289   7e-84    
ref|XP_007163467.1|  hypothetical protein PHAVU_001G236600g             288   7e-84    
ref|XP_009600757.1|  PREDICTED: probable serine/threonine-protein...    287   7e-84    
ref|XP_006306154.1|  hypothetical protein CARUB_v10011668mg             287   7e-84    
ref|XP_006603050.1|  PREDICTED: probable serine/threonine-protein...    290   8e-84    
ref|XP_007033203.1|  Wall-associated kinase, putative isoform 2         289   8e-84    
ref|XP_006388060.1|  hypothetical protein POPTR_0373s00210g             289   8e-84    
ref|XP_004238902.1|  PREDICTED: probable serine/threonine-protein...    288   8e-84    
ref|XP_010039876.1|  PREDICTED: probable serine/threonine-protein...    280   9e-84    
ref|XP_004290449.1|  PREDICTED: probable serine/threonine-protein...    289   1e-83    
ref|XP_010528497.1|  PREDICTED: probable serine/threonine-protein...    288   1e-83    
gb|KHN12475.1|  Putative serine/threonine-protein kinase                288   1e-83    
emb|CDP10679.1|  unnamed protein product                                287   1e-83    
ref|XP_006605928.1|  PREDICTED: probable serine/threonine-protein...    288   1e-83    
gb|KDP29220.1|  hypothetical protein JCGZ_16609                         285   1e-83    
ref|XP_010528496.1|  PREDICTED: probable serine/threonine-protein...    288   1e-83    
ref|XP_011008307.1|  PREDICTED: probable serine/threonine-protein...    288   1e-83    
ref|XP_009357791.1|  PREDICTED: probable serine/threonine-protein...    288   1e-83    
ref|XP_010528498.1|  PREDICTED: probable serine/threonine-protein...    288   1e-83    
ref|XP_008381274.1|  PREDICTED: probable serine/threonine-protein...    288   1e-83    
ref|XP_008782316.1|  PREDICTED: probable serine/threonine-protein...    281   1e-83    
gb|EAZ10454.1|  hypothetical protein OsJ_00287                          287   1e-83    
ref|XP_006357829.1|  PREDICTED: probable serine/threonine-protein...    289   1e-83    
ref|NP_173275.4|  probable serine/threonine-protein kinase              287   2e-83    
ref|XP_010666486.1|  PREDICTED: wall-associated receptor kinase-l...    279   2e-83    
ref|XP_006344314.1|  PREDICTED: probable serine/threonine-protein...    289   2e-83    
ref|NP_001154349.1|  probable serine/threonine-protein kinase           287   2e-83    
ref|XP_006403646.1|  hypothetical protein EUTSA_v10011109mg             287   2e-83    
ref|XP_008381276.1|  PREDICTED: probable serine/threonine-protein...    288   2e-83    
emb|CDP00139.1|  unnamed protein product                                288   2e-83    
gb|KCW65575.1|  hypothetical protein EUGRSUZ_G02969                     285   2e-83    
ref|XP_006585075.1|  PREDICTED: probable serine/threonine-protein...    287   2e-83    
ref|XP_009775397.1|  PREDICTED: probable serine/threonine-protein...    286   2e-83    
ref|XP_010926518.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...    280   2e-83    
emb|CDY65028.1|  BnaC05g50050D                                          281   2e-83    
ref|XP_008809170.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...    288   2e-83    
ref|XP_010037107.1|  PREDICTED: wall-associated receptor kinase-l...    287   2e-83    
ref|XP_008374779.1|  PREDICTED: probable serine/threonine-protein...    288   2e-83    
gb|AAK97715.1|  At1g25390/F2J7_14                                       281   2e-83    
ref|XP_010528494.1|  PREDICTED: probable serine/threonine-protein...    288   2e-83    
ref|XP_007027545.1|  Kinase family protein                              286   2e-83    
ref|XP_008229261.1|  PREDICTED: probable serine/threonine-protein...    288   2e-83    
ref|XP_010528495.1|  PREDICTED: probable serine/threonine-protein...    288   2e-83    
ref|XP_010498225.1|  PREDICTED: probable serine/threonine-protein...    287   2e-83    
ref|XP_006339279.1|  PREDICTED: putative receptor-like protein ki...    298   2e-83    
gb|KCW64689.1|  hypothetical protein EUGRSUZ_G02277                     281   2e-83    
gb|KDP44885.1|  hypothetical protein JCGZ_01385                         286   2e-83    
ref|XP_002968448.1|  hypothetical protein SELMODRAFT_89809              277   2e-83    
ref|XP_011008306.1|  PREDICTED: probable serine/threonine-protein...    287   3e-83    
ref|XP_002458339.1|  hypothetical protein SORBIDRAFT_03g031640          288   3e-83    
ref|NP_001041960.2|  Os01g0136800                                       287   3e-83    
ref|XP_008446631.1|  PREDICTED: probable serine/threonine-protein...    285   3e-83    
ref|XP_010032176.1|  PREDICTED: probable serine/threonine-protein...    281   3e-83    
ref|XP_006357830.1|  PREDICTED: probable serine/threonine-protein...    288   3e-83    
emb|CAN72920.1|  hypothetical protein VITISV_022322                     296   3e-83    
ref|XP_006383412.1|  hypothetical protein POPTR_0005s15240g             287   3e-83    
ref|XP_007203270.1|  hypothetical protein PRUPE_ppa019811mg             286   3e-83    
ref|XP_010032168.1|  PREDICTED: probable serine/threonine-protein...    281   3e-83    
ref|XP_006357831.1|  PREDICTED: probable serine/threonine-protein...    287   3e-83    
ref|XP_009600755.1|  PREDICTED: probable serine/threonine-protein...    286   3e-83    
gb|KCW45668.1|  hypothetical protein EUGRSUZ_L00569                     279   3e-83    
emb|CDY03856.1|  BnaC07g10810D                                          286   3e-83    
ref|XP_009600756.1|  PREDICTED: probable serine/threonine-protein...    286   3e-83    
gb|KCW45665.1|  hypothetical protein EUGRSUZ_L00566                     278   3e-83    
ref|XP_011021278.1|  PREDICTED: probable serine/threonine-protein...    288   3e-83    
ref|XP_008654578.1|  PREDICTED: uncharacterized protein LOC100273...    288   3e-83    
ref|XP_010039882.1|  PREDICTED: probable serine/threonine-protein...    280   3e-83    
ref|XP_004137545.1|  PREDICTED: probable serine/threonine-protein...    287   3e-83    
ref|XP_010316315.1|  PREDICTED: probable serine/threonine-protein...    288   4e-83    
ref|XP_010099273.1|  putative serine/threonine-protein kinase           288   4e-83    
gb|KFK44520.1|  hypothetical protein AALP_AA1G267300                    286   4e-83    
ref|XP_004160450.1|  PREDICTED: probable serine/threonine-protein...    287   4e-83    
ref|XP_008229259.1|  PREDICTED: probable serine/threonine-protein...    287   4e-83    
ref|XP_002519414.1|  serine-threonine protein kinase, plant-type,...    287   4e-83    
ref|XP_008229260.1|  PREDICTED: probable serine/threonine-protein...    287   4e-83    
gb|KCW64661.1|  hypothetical protein EUGRSUZ_G02246                     280   4e-83    
ref|XP_006344296.1|  PREDICTED: probable serine/threonine-protein...    286   4e-83    
ref|XP_010068748.1|  PREDICTED: probable serine/threonine-protein...    282   4e-83    
ref|XP_010498226.1|  PREDICTED: probable serine/threonine-protein...    286   4e-83    
gb|KGN52101.1|  hypothetical protein Csa_5G610360                       286   4e-83    
ref|XP_007217639.1|  hypothetical protein PRUPE_ppa002429mg             287   4e-83    
ref|XP_008229263.1|  PREDICTED: probable serine/threonine-protein...    287   4e-83    
ref|XP_002305832.2|  hypothetical protein POPTR_0004s09580g             292   5e-83    
ref|XP_006416610.1|  hypothetical protein EUTSA_v10007020mg             286   5e-83    
ref|XP_008446632.1|  PREDICTED: probable serine/threonine-protein...    285   5e-83    
ref|XP_011021277.1|  PREDICTED: probable serine/threonine-protein...    288   5e-83    
ref|XP_008229262.1|  PREDICTED: probable serine/threonine-protein...    287   5e-83    
ref|XP_008441628.1|  PREDICTED: probable serine/threonine-protein...    287   5e-83    
ref|XP_002982423.1|  hypothetical protein SELMODRAFT_116212             285   5e-83    
ref|XP_009390229.1|  PREDICTED: probable serine/threonine-protein...    279   5e-83    
ref|XP_006303925.1|  hypothetical protein CARUB_v10008544mg             286   5e-83    
ref|XP_008446630.1|  PREDICTED: probable serine/threonine-protein...    285   5e-83    
ref|XP_010064777.1|  PREDICTED: probable serine/threonine-protein...    292   6e-83    
ref|NP_001141425.1|  uncharacterized protein LOC100273535 precursor     287   6e-83    
ref|XP_004232335.1|  PREDICTED: probable serine/threonine-protein...    287   7e-83    
gb|AES80591.2|  wall associated kinase-like protein                     286   7e-83    
ref|NP_001235056.1|  protein kinase-related protein precursor           285   7e-83    
ref|XP_009775396.1|  PREDICTED: probable serine/threonine-protein...    286   7e-83    
ref|XP_009775395.1|  PREDICTED: probable serine/threonine-protein...    286   7e-83    
ref|XP_011096985.1|  PREDICTED: probable serine/threonine-protein...    284   7e-83    
gb|AFW83621.1|  putative WAK receptor-like protein kinase family ...    287   7e-83    
ref|XP_010316317.1|  PREDICTED: probable serine/threonine-protein...    286   7e-83    
gb|AES80593.2|  wall associated kinase-like protein                     286   7e-83    
ref|XP_008446629.1|  PREDICTED: probable serine/threonine-protein...    285   8e-83    
ref|XP_004968018.1|  PREDICTED: probable serine/threonine-protein...    286   8e-83    
gb|EAY72439.1|  hypothetical protein OsI_00293                          286   8e-83    
ref|XP_004969604.1|  PREDICTED: probable serine/threonine-protein...    286   8e-83    
ref|XP_004969606.1|  PREDICTED: probable serine/threonine-protein...    286   9e-83    
ref|XP_004969605.1|  PREDICTED: probable serine/threonine-protein...    286   1e-82    
ref|XP_011018851.1|  PREDICTED: wall-associated receptor kinase-l...    285   1e-82    
gb|KGN64141.1|  hypothetical protein Csa_1G042520                       278   1e-82    
ref|XP_004968022.1|  PREDICTED: probable serine/threonine-protein...    283   1e-82    
ref|XP_009801719.1|  PREDICTED: probable serine/threonine-protein...    286   1e-82    
ref|XP_010045665.1|  PREDICTED: probable serine/threonine-protein...    285   1e-82    
gb|KCW64663.1|  hypothetical protein EUGRSUZ_G02248                     280   1e-82    
ref|XP_010316316.1|  PREDICTED: probable serine/threonine-protein...    286   1e-82    
ref|XP_004968021.1|  PREDICTED: probable serine/threonine-protein...    284   1e-82    
gb|KDP29454.1|  hypothetical protein JCGZ_18375                         280   2e-82    
gb|KCW86142.1|  hypothetical protein EUGRSUZ_B02841                     275   2e-82    
ref|NP_001167990.1|  uncharacterized LOC100381711 precursor             285   2e-82    
ref|XP_008352632.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...    286   2e-82    
ref|XP_004512900.1|  PREDICTED: probable serine/threonine-protein...    286   2e-82    
ref|XP_008797678.1|  PREDICTED: uncharacterized protein LOC103712818    295   2e-82    
ref|XP_004512901.1|  PREDICTED: probable serine/threonine-protein...    285   2e-82    
ref|XP_009343916.1|  PREDICTED: wall-associated receptor kinase-l...    284   2e-82    
gb|ACN32177.1|  unknown                                                 282   2e-82    
ref|XP_006605927.1|  PREDICTED: wall-associated receptor kinase-l...    285   2e-82    
ref|XP_004968020.1|  PREDICTED: probable serine/threonine-protein...    284   2e-82    
gb|KHN17885.1|  Wall-associated receptor kinase-like 20                 277   2e-82    
ref|XP_009344732.1|  PREDICTED: probable serine/threonine-protein...    285   2e-82    
gb|ACN33695.1|  unknown                                                 284   2e-82    



>ref|XP_009794572.1| PREDICTED: wall-associated receptor kinase-like 14 [Nicotiana 
sylvestris]
Length=682

 Score =   903 bits (2333),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/657 (70%), Positives = 535/657 (81%), Gaps = 13/657 (2%)
 Frame = -3

Query  1946  KMIPVLILLLLQSAMVFGSSTCNRSCGDGLKQLPFPFGFSSGCEILLNCTSNGTMSIGEF  1767
             + I  L +L++ S +V GS+ C  SCG    Q  +PFGFSSGC I LNCTS+G M I +F
Sbjct  10    RRILCLFILIISSNIVLGSTNCTHSCGKSFLQ--YPFGFSSGCPIQLNCTSHGAMVINKF  67

Query  1766  PVYQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMI  1587
             PV  +T +TI+IN+ AKC R   A+  LF  N+APTS NGIL QNCS  +  C+IPSTMI
Sbjct  68    PVQAITSETILINLLAKCSRPFSAIHNLFSSNYAPTSRNGILFQNCSFSQSSCLIPSTMI  127

Query  1586  QTQFELQDCGKDNISCFSEPHMTGGFIGYENLTGTGCKSLFSAISSPAAAANTTAVSLDI  1407
             QT FEL DCGK+N+SC+SEP+    FI   NL+ TGC SLFSAIS   +  N +AVSLD+
Sbjct  128   QTHFELLDCGKENMSCYSEPNSESNFIDLRNLSRTGCHSLFSAISV-ESTLNGSAVSLDV  186

Query  1406  QVIELGWWLQGHCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTRC  1227
             QV++LGWWLQG+C+CS NA+C  + +P DGK G+RCQCSEGF GDG+  GSGCR+DDT C
Sbjct  187   QVVQLGWWLQGNCQCSSNANCTKILSPIDGKLGYRCQCSEGFIGDGFLAGSGCRKDDTTC  246

Query  1226  NPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAMKNWNRRRRELRETT  1047
             NP+ YL G+CGG TR+GVL+GG+ AGA+LMVS+GLICC IRRRL  +N +RR REL ETT
Sbjct  247   NPSNYLSGKCGGTTRVGVLVGGIAAGASLMVSIGLICCFIRRRLNFQNRSRRSRELCETT  306

Query  1046  GITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQ  867
             GITIP+Y YK++EKAT+ FS+KRRLG+GAYGTVYSGKL  +D WVAIKRI +R TDSIEQ
Sbjct  307   GITIPIYPYKEMEKATDFFSEKRRLGNGAYGTVYSGKLQ-SDNWVAIKRIMNRHTDSIEQ  365

Query  866   VTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLG  687
             V NEIKLLSSVNHPNLVRLLGC IEKGEQILVYEFMP+GTLSQHLQREKG+ LPWPVRL 
Sbjct  366   VINEIKLLSSVNHPNLVRLLGCCIEKGEQILVYEFMPHGTLSQHLQREKGNALPWPVRLT  425

Query  686   IVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAP  507
             I +ET+QAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSR G+IESSHISTAP
Sbjct  426   IAAETAQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRLGIIESSHISTAP  485

Query  506   QGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIG  327
             QGTPGYLDPQYHQ+F LSDKSDVYSFGVVL EIITGLKAVDF RPQ+E+NLAALA+D+IG
Sbjct  486   QGTPGYLDPQYHQNFQLSDKSDVYSFGVVLAEIITGLKAVDFARPQDEINLAALAIDRIG  545

Query  326   KGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKW  147
             KG L E+IDP IE   D WTLSSV+KVAE+AFRCLAFHRDMRPSMMEVAIELEQ+RLSKW
Sbjct  546   KGNLDEVIDPSIEPHMDAWTLSSVHKVAELAFRCLAFHRDMRPSMMEVAIELEQLRLSKW  605

Query  146   GIsedsiitassssssrsssdasEKPLSFSTMK---------PSEKVTESSPVSVQD  3
              ISED+I  +S  SS  S+SD SEKPL+ S  K          +EK+ + SPVS+QD
Sbjct  606   AISEDNITASSEGSSISSASDVSEKPLNLSIKKREMDIKAIFSTEKIKDYSPVSIQD  662



>ref|XP_009616014.1| PREDICTED: wall-associated receptor kinase-like 14 [Nicotiana 
tomentosiformis]
Length=683

 Score =   902 bits (2331),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 462/658 (70%), Positives = 534/658 (81%), Gaps = 14/658 (2%)
 Frame = -3

Query  1946  KMIPVLILLLLQSAMVFGSSTCNRSCGDGLKQLPFPFGFSSGCEILLNCTSNGTMSIGEF  1767
             + I  L + ++ S +V GS+ C  SCG  + Q  +PFGFSSGC I L+CTSNG M I +F
Sbjct  10    RRILCLSIFIISSNLVLGSTNCTHSCGKNILQ--YPFGFSSGCPIQLSCTSNGAMVINKF  67

Query  1766  PVYQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMI  1587
             PV  +T +TI+IN+ A C R   A+  LF  N+APTS NGIL QNCS  +  C+IPSTMI
Sbjct  68    PVQAITSETILINLLANCSRPFAAIHNLFSSNYAPTSRNGILFQNCSFSQSSCLIPSTMI  127

Query  1586  QTQFELQDCGKDNISCFSEPHMTGGFIGYENLTGTGCKSLFSAISSPAAAANTTAVSLDI  1407
             QT FEL DCGK+N+ C+SEP+    FI   NL+ TGC SLFSAIS   +  N++AVSLD+
Sbjct  128   QTHFELLDCGKENMICYSEPNSENNFIDLRNLSRTGCHSLFSAISV-ESTLNSSAVSLDV  186

Query  1406  QVIELGWWLQGHCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTRC  1227
             QV++LGWWL+GHC+CS NA+C  + +P DGK G+RCQCSEGF GDG+  GSGCR+DDT C
Sbjct  187   QVVQLGWWLKGHCQCSSNANCTKISSPIDGKLGYRCQCSEGFVGDGFLAGSGCRKDDTTC  246

Query  1226  NPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAMKNWNRRRRELRETT  1047
             NP+ YL G+CGG TR+GVL+GG+ AGA+LMVSVGLICC IRRRL  +N +RR REL ETT
Sbjct  247   NPSNYLSGKCGGTTRVGVLVGGIAAGASLMVSVGLICCFIRRRLNYQNRSRRSRELCETT  306

Query  1046  GITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQ  867
             GITIPVY YK++EKAT+ FS+KRRLG+GAYGTVYSGKL  +D WVAIKRI +R TDSIEQ
Sbjct  307   GITIPVYPYKEMEKATDFFSEKRRLGNGAYGTVYSGKLQ-SDNWVAIKRIMNRHTDSIEQ  365

Query  866   VTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLG  687
             V NEIKLLSSVNHPNLVRLLGC IEKGEQILVYEFMPNGTLSQHLQREKG+ LPWPVRL 
Sbjct  366   VINEIKLLSSVNHPNLVRLLGCCIEKGEQILVYEFMPNGTLSQHLQREKGNALPWPVRLT  425

Query  686   IVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAP  507
             I +ET+QAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSR G+IESSHISTAP
Sbjct  426   IAAETAQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRLGIIESSHISTAP  485

Query  506   QGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIG  327
             QGTPGYLDPQYHQ+F LSDKSDVYSFGVVL EIITGLKAVDF RPQ+E+NLAALA+D+IG
Sbjct  486   QGTPGYLDPQYHQNFQLSDKSDVYSFGVVLAEIITGLKAVDFARPQDEINLAALAIDRIG  545

Query  326   KGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKW  147
             KG L E+IDP IE   D WTLSSV+KVAE+AFRCLAFHRDMRPSMMEVAIELEQ+RLSKW
Sbjct  546   KGNLDEVIDPSIEPHMDAWTLSSVHKVAELAFRCLAFHRDMRPSMMEVAIELEQLRLSKW  605

Query  146   GIsedsiitassssssrsssdasEKPLSFSTMKP----------SEKVTESSPVSVQD  3
              ISED+I  +S  SS  S+SD SEKPL+ S  K           +EK+ + SPVSVQD
Sbjct  606   AISEDNITASSEGSSISSASDVSEKPLNLSIKKREIDIKANIFLTEKIKDYSPVSVQD  663



>ref|XP_004238203.1| PREDICTED: wall-associated receptor kinase-like 14 [Solanum lycopersicum]
Length=679

 Score =   884 bits (2285),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/655 (70%), Positives = 533/655 (81%), Gaps = 14/655 (2%)
 Frame = -3

Query  1940  IPVLILLLLQSAMVFGSSTCNRSCGDGLKQLPFPFGFSSGCEILLNCTSNGTMSIGEFPV  1761
             I  L +L   S  V GS+ C  SCG+  + LPFPFGFS GC I LNCTSN  + + +FPV
Sbjct  10    ILCLFILKFSSNTVLGSN-CTHSCGN--RFLPFPFGFSHGCPIQLNCTSNEEIFMKDFPV  66

Query  1760  YQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMIQT  1581
               +T DTI+IN+ AKC R   A+  LF  N+APTS NGIL QNCSS +  C+IPSTMIQT
Sbjct  67    QSVTSDTILINLLAKCSRPFSAIHNLFSPNYAPTSKNGILFQNCSSSQSSCLIPSTMIQT  126

Query  1580  QFELQDCGKDNISCFSEPHMTGGFIGYENLTGTGCKSLFSAISSPAAAANTTAVSLDIQV  1401
              F++ DCGK+N+SC+SEP+    FI  +NL+ TGC SLFSAIS   +  N++AVSLD+Q+
Sbjct  127   HFDILDCGKENMSCYSEPNSENNFINLKNLSKTGCGSLFSAISV-ESTVNSSAVSLDVQM  185

Query  1400  IELGWWLQGHCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTRCNP  1221
             ++LGWW+ GHCRCS NA+C  + +P +GK G+RCQC EGF GDG+  GSGCR+D+T CNP
Sbjct  186   VQLGWWVHGHCRCSSNANCTKISSPINGKQGYRCQCFEGFIGDGFLAGSGCRKDETTCNP  245

Query  1220  AKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAMKNWNRRRRELRETTGI  1041
             +KYL G+CGG TR+GVL+GG++AGA+LMVSVGLICC IRRRL  +N  RR REL ETTGI
Sbjct  246   SKYLSGKCGGTTRVGVLVGGIVAGASLMVSVGLICCFIRRRLNFQNRTRRSRELCETTGI  305

Query  1040  TIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVT  861
             +IPVY YK++EKAT+ FS+KRRLG+GAYGTVYSGKL   D WVAIKRIRHRDTDSIEQ  
Sbjct  306   SIPVYQYKEMEKATDFFSEKRRLGNGAYGTVYSGKLQ-TDNWVAIKRIRHRDTDSIEQFI  364

Query  860   NEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIV  681
             NEIKLLSSVNHPNLVRLLGCSIE GEQILVYE+MPNGTLSQH+QREKG+GLPWPVRL I 
Sbjct  365   NEIKLLSSVNHPNLVRLLGCSIENGEQILVYEYMPNGTLSQHIQREKGNGLPWPVRLTIG  424

Query  680   SETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQG  501
             +ET+QAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSR GL+ESSHISTAPQG
Sbjct  425   AETAQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRLGLVESSHISTAPQG  484

Query  500   TPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKG  321
             TPGYLDPQYHQ+F LSDKSDVYSFGVVL EIITGLKAVDF RPQ+E+NLAALA+D+IGKG
Sbjct  485   TPGYLDPQYHQNFQLSDKSDVYSFGVVLAEIITGLKAVDFARPQDEINLAALAIDRIGKG  544

Query  320   GLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKWGI  141
              L EIIDP IE   D WTLSS+++VAE+AFRCLAFHRDMRPSMMEVAIELEQ+RLS+W  
Sbjct  545   NLDEIIDPFIELHMDAWTLSSIHRVAELAFRCLAFHRDMRPSMMEVAIELEQLRLSRWTN  604

Query  140   sedsiitassssssrsssdasEKPLSFSTMKPSE---------KVTESSPVSVQD  3
             SED+I  +S  SS  S+SDASEKPL+ S  K  E          + + SPVSVQD
Sbjct  605   SEDNITGSSEGSSISSTSDASEKPLNLSINKKQEIDIFSTECKIIKDYSPVSVQD  659



>emb|CDP07589.1| unnamed protein product [Coffea canephora]
Length=692

 Score =   874 bits (2259),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/598 (70%), Positives = 499/598 (83%), Gaps = 5/598 (1%)
 Frame = -3

Query  1925  LLLLQSAMVFGSSTCNRSCGD-GLKQLPFPFGFSSGCEILLNCTSNGTMSIGEFPVYQLT  1749
             +L   S++   S+ C +SCG      +PFPFGFSSGC+I LNCTSNGTM+I +FP+  ++
Sbjct  13    VLYRLSSLGNASAICQKSCGAVSYNHIPFPFGFSSGCQIQLNCTSNGTMAIHDFPILDIS  72

Query  1748  PDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMIQTQFEL  1569
              ++IM+N+ A+CGR + A+  LFG N+APTS+NGIL++NC++P   C+IP+TM+ T FEL
Sbjct  73    QESIMVNLQAQCGRSMSAIDDLFGPNYAPTSHNGILMENCTAPVPTCVIPTTMVLTHFEL  132

Query  1568  QDCGKDN---ISCFSEPHMTGGFIGYENLTGTGCKSLFSAISSPAAAANTTAVSLDIQVI  1398
              DCG  N   +SC+SEP     F+ Y +L    C SLFSAIS  +   N+++VSL +Q++
Sbjct  133   LDCGAQNSGNLSCYSEPSKQSLFMNYNSLVKNRCSSLFSAISIESYGTNSSSVSLTVQLV  192

Query  1397  ELGWWLQGHCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTRCNPA  1218
             +LGWWLQGHC CS +A+C  + +P D KPG+RCQC +G+ GDGY  G GCRRD TRCNPA
Sbjct  193   QLGWWLQGHCHCSMHANCTKIWSPTDEKPGYRCQCLDGYVGDGYIAGVGCRRDSTRCNPA  252

Query  1217  KYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAMKNWNRRRRELRETTGIT  1038
             KYL G+CGG TR+GVL+GGVIAGAALMVS+GL+CC +RRR  +K  N+ +REL   TGIT
Sbjct  253   KYLSGQCGGTTRVGVLVGGVIAGAALMVSIGLVCCFVRRRSRLKTRNKTKRELCRATGIT  312

Query  1037  IPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTN  858
             IPVY YK++EKAT +FS+KRRLG GAYGTVYSGKLH NDEWVAIKRIRHRDT+S EQV N
Sbjct  313   IPVYHYKEVEKATESFSEKRRLGTGAYGTVYSGKLH-NDEWVAIKRIRHRDTESTEQVLN  371

Query  857   EIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVS  678
             EIKL+S+V+HPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKG+GLPW VR+ I +
Sbjct  372   EIKLISTVSHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGNGLPWAVRITIAA  431

Query  677   ETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGT  498
             ET+QAIAYLHNA+HPPIYHRD+KSSNILLDYNYKSKVADFGLSR G++ESSHISTAPQGT
Sbjct  432   ETAQAIAYLHNAVHPPIYHRDIKSSNILLDYNYKSKVADFGLSRLGMVESSHISTAPQGT  491

Query  497   PGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGG  318
             PGYLDPQYHQ FHLSDKSDVYSFGVVL+EIITGLKAVDF RPQNE+NLA LAVD+IGKG 
Sbjct  492   PGYLDPQYHQHFHLSDKSDVYSFGVVLLEIITGLKAVDFNRPQNEINLANLAVDRIGKGC  551

Query  317   LLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKWG  144
             L EIIDP +E  KD WT+SS +KVAE+AFRCLAFHRDMRPSMMEVAIELEQ+RLSKW 
Sbjct  552   LHEIIDPFLEPHKDPWTISSTHKVAELAFRCLAFHRDMRPSMMEVAIELEQIRLSKWA  609



>ref|XP_006366440.1| PREDICTED: wall-associated receptor kinase-like 14-like [Solanum 
tuberosum]
Length=677

 Score =   864 bits (2232),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/655 (70%), Positives = 534/655 (82%), Gaps = 12/655 (2%)
 Frame = -3

Query  1946  KMIPVLILLLLQSAMVFGSSTCNRSCGDGLKQLPFPFGFSSGCEILLNCTSNGTMSIGEF  1767
             + I  L +    S +V GS+ C  SCG+  + LPFPFGFS GC I LNCTSN  + + +F
Sbjct  8     RTILCLFIFNFSSNIVLGSN-CTHSCGN--RFLPFPFGFSHGCPIQLNCTSNEEIFMNDF  64

Query  1766  PVYQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMI  1587
             PV  +T DTI+IN+ AKC R   A+  LF  N+APTS NGIL QNCSS +  C+IPSTMI
Sbjct  65    PVQSVTSDTILINLLAKCSRPFSAIHNLFSPNYAPTSRNGILFQNCSSSQSSCLIPSTMI  124

Query  1586  QTQFELQDCGKDNISCFSEPHMTGGFIGYENLTGTGCKSLFSAISSPAAAANTTAVSLDI  1407
             QT F++ DCGK+N+SC+SEP+    FI  +NL+ TGC SLFSAIS   +  N+++VSLD+
Sbjct  125   QTHFDILDCGKENMSCYSEPNSENNFINLKNLSKTGCGSLFSAISV-ESTVNSSSVSLDV  183

Query  1406  QVIELGWWLQGHCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTRC  1227
             QV++LGWW+ GHCRCS NA+C  + +P +GK G+RCQC EGF GDG+  GSGCR+D+T C
Sbjct  184   QVVQLGWWIHGHCRCSSNANCTKISSPINGKRGYRCQCFEGFIGDGFLAGSGCRKDETSC  243

Query  1226  NPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAMKNWNRRRRELRETT  1047
             NP+KYL G+CGG TR+GVL+GG++AGA+LMVS+GLICC IRRRL  +N  RR REL ETT
Sbjct  244   NPSKYLSGKCGGTTRVGVLVGGIVAGASLMVSIGLICCFIRRRLNFQNRRRRNRELCETT  303

Query  1046  GITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQ  867
             GI+IPVY YK++EKAT+ FS+KRRLG+GAYGTVYSGKL  ND WVAIKRIRHRDTDSIEQ
Sbjct  304   GISIPVYQYKEMEKATDFFSEKRRLGNGAYGTVYSGKLQ-NDNWVAIKRIRHRDTDSIEQ  362

Query  866   VTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLG  687
               NEIKLLSSVNHPNLVRLLGCSIE GEQILVYE+MPNGTLSQH+QREKG+GLPWPVRL 
Sbjct  363   FINEIKLLSSVNHPNLVRLLGCSIENGEQILVYEYMPNGTLSQHIQREKGNGLPWPVRLT  422

Query  686   IVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAP  507
             I +ET+QAIAYLHNA HPPIYHRDVKSSNILLDYNYKSKVADFGLSR G++ESSHISTAP
Sbjct  423   IGAETAQAIAYLHNATHPPIYHRDVKSSNILLDYNYKSKVADFGLSRLGMVESSHISTAP  482

Query  506   QGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIG  327
             QGTPGYLDPQYHQ+F LSDKSDVYSFGVVL EIITGLKAVDF RPQ+E+NLAALA+D+IG
Sbjct  483   QGTPGYLDPQYHQNFQLSDKSDVYSFGVVLAEIITGLKAVDFARPQDEINLAALAIDRIG  542

Query  326   KGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKW  147
             KG L EIIDP IE   D WTLSS++KVAE+AFRCLAFHRDMRPSMMEVAIELEQ+RLS+W
Sbjct  543   KGNLDEIIDPFIELHMDAWTLSSIHKVAELAFRCLAFHRDMRPSMMEVAIELEQLRLSRW  602

Query  146   GIsedsiitassssssrsssdasEKPLSFSTMK-------PSEKVTESSPVSVQD  3
               SED+I  +S  SS  S+SDASEKPL+ S  K          K+ + SPVSVQD
Sbjct  603   TNSEDNITGSSEGSSISSTSDASEKPLNLSIKKQEMDIFSTDSKIKDYSPVSVQD  657



>ref|XP_011083766.1| PREDICTED: wall-associated receptor kinase-like 14 [Sesamum indicum]
Length=684

 Score =   843 bits (2178),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/601 (68%), Positives = 493/601 (82%), Gaps = 10/601 (2%)
 Frame = -3

Query  1931  LILLLLQSAMVF---GSSTCNRSCGDGLKQLPFPFGFSSGCEILLNCTSNGTMSIGEFPV  1761
              I L+L + +V     ++ CN +CG   ++LPFPFGFS GC I LNCTSNGT+   EFPV
Sbjct  8     FIFLILTTILVRYTPAAAWCNHACGG--RKLPFPFGFSPGCPIQLNCTSNGTILAAEFPV  65

Query  1760  YQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMIQT  1581
               ++ DTI++N+P  CGR +EA++ LF  NFAPTS+N ILLQNC +    C IPSTM+QT
Sbjct  66    QSVSVDTILVNLPPMCGRPVEALRRLFTSNFAPTSHNAILLQNCRNSSSGCFIPSTMVQT  125

Query  1580  QFELQDC--GKDNISCFSEPHMTGGFIGYENLTGTGCKSLFSAISSPAAAANTTAVSLDI  1407
              FEL +C    D+ISC+SE +    FI Y NLT +GC+SLFSAIS   + AN+++VSLD+
Sbjct  126   HFELLECEVKNDSISCYSETNNATSFIDYNNLTRSGCRSLFSAISM-ESFANSSSVSLDV  184

Query  1406  QVIELGWWLQGHCRCSKNADCNTMRTPGDGK-PGFRCQCSEGFTGDGYQGGSGCRRDDTR  1230
             Q++ +GWWL G CRCS+NA C  +  P +G  P +RC+C EGF GDG++ G GCR++   
Sbjct  185   QIVRVGWWLHGACRCSENAKCIPVTPPAEGSSPAYRCECLEGFAGDGFRDGLGCRKESLG  244

Query  1229  CNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAMKNWNRRRRELRET  1050
             CNP+KYL GECGG TR+GVL+GGV AGA+LM+ +GL+ C IR+R  +++ +R+ R+L ET
Sbjct  245   CNPSKYLSGECGGTTRVGVLVGGVAAGASLMIGLGLVICFIRKRSKLRSRSRKSRQLCET  304

Query  1049  TGITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIE  870
             TGIT+P+Y YK++EKAT+ FS+KRRLG+GAYGTVYSGKL +NDEWVAIKRIRHRD+ SIE
Sbjct  305   TGITVPIYPYKEMEKATDFFSEKRRLGNGAYGTVYSGKL-NNDEWVAIKRIRHRDSGSIE  363

Query  869   QVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRL  690
             QV NEIKLLSSV+HPNLVRLLGCSIE  EQILVYEFMPNGTLSQHLQREKGS LPWPVRL
Sbjct  364   QVINEIKLLSSVSHPNLVRLLGCSIENDEQILVYEFMPNGTLSQHLQREKGSALPWPVRL  423

Query  689   GIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTA  510
              + +ET+QAI+YLHNAMHPPIYHRD+KSSNILLDYN+KSKVADFGLSR G+ ESSHISTA
Sbjct  424   TVAAETAQAISYLHNAMHPPIYHRDIKSSNILLDYNFKSKVADFGLSRLGMAESSHISTA  483

Query  509   PQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKI  330
             PQGTPGYLDPQYHQ FHLSDKSDVYSFGVVL+EIIT LK VDF+RPQNEVNLAALAVD+I
Sbjct  484   PQGTPGYLDPQYHQHFHLSDKSDVYSFGVVLIEIITALKVVDFSRPQNEVNLAALAVDRI  543

Query  329   GKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSK  150
             G+G L EIIDP +E   D WTL SV KVAE+AFRCLAFH+DMRPSMMEVAIELEQ+RLSK
Sbjct  544   GRGHLDEIIDPFLETTDDAWTLLSVQKVAELAFRCLAFHKDMRPSMMEVAIELEQIRLSK  603

Query  149   W  147
             W
Sbjct  604   W  604



>ref|XP_007017425.1| Kinase superfamily protein [Theobroma cacao]
 gb|EOY14650.1| Kinase superfamily protein [Theobroma cacao]
Length=687

 Score =   775 bits (2001),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/603 (64%), Positives = 475/603 (79%), Gaps = 14/603 (2%)
 Frame = -3

Query  1937  PVLILL--LLQSAMVFGSSTCNRSCGDGLKQLPFPFGFSSGCEILLNCTSNGTMSIGEFP  1764
             PV++ L   L S +   +S CNRSCGD  + +P+PFGFS+GC+I LNC+S+    I  FP
Sbjct  4     PVVLFLAIFLLSLITAQASKCNRSCGD--QTVPYPFGFSAGCQIPLNCSSSSQKLIAGFP  61

Query  1763  VYQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMIQ  1584
             +  +  D I I+I A C R ++A+  L+G N+APTS N ILLQNC+SP   CMIPSTM+ 
Sbjct  62    ILTINADRIKISIEATCNRPLQALHRLYGPNYAPTSRNAILLQNCTSPA-PCMIPSTMVY  120

Query  1583  TQFELQDCGKD--NISCFSEPHMTGGFIGYENLTGTGCKSLFSAISSPAAAANTTAVSLD  1410
             T FE   C  D  NISC+SE ++  GF  Y  +T T CKS  S+IS  A + N +AV L+
Sbjct  121   THFEALACSPDSSNISCYSENNV-NGFADYTKVTRTNCKSFLSSIS--AESFNESAV-LE  176

Query  1409  IQVIELGWWLQGHCR--CSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDD  1236
             ++V+ELGWWLQG C   CS+NA C+ + +P  GKPGFRC+C  GFTGDGY+ G GCR+  
Sbjct  177   VRVVELGWWLQGQCSDFCSENAICDEIVSPFSGKPGFRCKCKHGFTGDGYRAGDGCRKAP  236

Query  1235  TRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAMKNWNRRRRELR  1056
             + CN A+Y+ G+CGG TR+ VL+GG+ AGA+LM+   L+CC ++R+   K  +  +R L 
Sbjct  237   SDCNLARYISGKCGGTTRVAVLVGGIAAGASLMICAVLLCCFVQRQSNSKARHSTKRFLC  296

Query  1055  ETTGITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDS  876
             E + I+IP+Y+YK+IEKATN+FS+K+RLG GA+GTVY+GKLH+N  WVAIKR++HRDTD 
Sbjct  297   EASDISIPIYTYKEIEKATNSFSEKQRLGTGAFGTVYAGKLHNNS-WVAIKRLKHRDTDC  355

Query  875   IEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPV  696
             IEQV NEIKL+SSV+HPNLVRLLGCSIE  EQILVYEFMPNGTL QHLQRE+G GL WPV
Sbjct  356   IEQVMNEIKLISSVSHPNLVRLLGCSIENSEQILVYEFMPNGTLCQHLQRERGDGLAWPV  415

Query  695   RLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHIS  516
             RL I +ET+QAIA+LH+A+ PPIYHRD+KSSNILLDYN++SKVADFGLSR G  E SHIS
Sbjct  416   RLTIAAETAQAIAHLHSAIDPPIYHRDIKSSNILLDYNFRSKVADFGLSRLGRTEISHIS  475

Query  515   TAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVD  336
             TAPQGTPGYLDPQYHQ+FHLSDKSDVYSFGVVL+EIIT LK VDF+RP NEVNLAA+A D
Sbjct  476   TAPQGTPGYLDPQYHQNFHLSDKSDVYSFGVVLIEIITALKVVDFSRPPNEVNLAAVATD  535

Query  335   KIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRL  156
             +I KG L EIIDPLIE   D WTLSS++KVAE+AFRCL+FHRDMRP+MMEVA+ELEQ+RL
Sbjct  536   RISKGRLDEIIDPLIEPNSDSWTLSSIHKVAELAFRCLSFHRDMRPTMMEVAVELEQIRL  595

Query  155   SKW  147
             S+W
Sbjct  596   SRW  598



>ref|XP_010664629.1| PREDICTED: wall-associated receptor kinase-like 14 [Vitis vinifera]
 ref|XP_010664630.1| PREDICTED: wall-associated receptor kinase-like 14 [Vitis vinifera]
 emb|CBI19615.3| unnamed protein product [Vitis vinifera]
Length=694

 Score =   763 bits (1969),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/593 (62%), Positives = 463/593 (78%), Gaps = 15/593 (3%)
 Frame = -3

Query  1904  MVFGSSTCNRSCGDG--LKQLPFPF-GFSSGCEILLNCTSNGTMSIGEFPVYQLTPDTIM  1734
             +   SS C++ CG    +K   FPF G SS C+I LNC+++G + +GEFPV  + P++I+
Sbjct  21    IAHSSSKCHQECGHNKTVKHRRFPFIGTSSACQIRLNCSTDGDIMVGEFPVRSIFPESIL  80

Query  1733  INIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMIQTQFELQDCGK  1554
             +N+  +C R I+++  LF  N+APT+ NGILL++C SP   C IP+T + T FE  DCG 
Sbjct  81    VNLEVRCNRSIKSLDHLFNTNYAPTTRNGILLKHCKSPASTCTIPTTKVNTHFESIDCGS  140

Query  1553  DN--ISCFSEPHMTGGFIGYENLTGTGCKSLFSAISSPAAAANTTAVSLDIQVIELGWWL  1380
             DN  ISC+SE H   GF+   N++ + C+ L S+IS    A NT++V LD+ +++LGWWL
Sbjct  141   DNYSISCYSEEH-ENGFLSQANVSKSHCQYLLSSIS--VDAFNTSSVVLDVGIVQLGWWL  197

Query  1379  QGHCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTRCNPAKYLLGE  1200
              G C+C + A C  ++TP  G+ GFRC+C +GF GDGYQ G GCR+  + CNP++Y+ G+
Sbjct  198   LGECKCHQEATCTEIQTPVAGQQGFRCKCRDGFDGDGYQAGVGCRKASSGCNPSRYISGQ  257

Query  1199  CGGKTRigvliggviagaaLMVSVGLICCIIRRRLAMKNWNRRRRELRETTG-ITIPVYS  1023
             CGG +R  VL GG+      M+S+  ICC +RR L  K  N  RR L E TG  +IP+Y 
Sbjct  258   CGGPSRFFVLAGGIAL----MISISAICCFMRRCLTSKARNSTRRRLSEATGKCSIPIYP  313

Query  1022  YKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIKLL  843
             Y+ IEKAT++FS+K+RLG GAYGTVYSGKLH+  +WVAIKRI+HRDTDSIE+V NEIKL+
Sbjct  314   YRAIEKATSSFSEKQRLGTGAYGTVYSGKLHN--QWVAIKRIKHRDTDSIEEVLNEIKLI  371

Query  842   SSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVSETSQA  663
             SSV+HPNLVRLLGCSIEKGEQILVYEFM NGTLSQHLQRE+G+GL W VRL I ++T+QA
Sbjct  372   SSVSHPNLVRLLGCSIEKGEQILVYEFMANGTLSQHLQRERGNGLVWAVRLSIATQTAQA  431

Query  662   IAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGTPGYLD  483
             IA+LH+A++PPIYHRD+KSSNILLD+N+  K+ADFGLSR G+ ESSHISTAPQGTPGYLD
Sbjct  432   IAHLHSALNPPIYHRDIKSSNILLDHNFIPKLADFGLSRLGMAESSHISTAPQGTPGYLD  491

Query  482   PQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLEII  303
             PQYHQ+FHLSDKSDVYSFGVVLVEIIT LK VDF+RPQNEVNLAALA+D+IGKG L EII
Sbjct  492   PQYHQNFHLSDKSDVYSFGVVLVEIITALKVVDFSRPQNEVNLAALAIDRIGKGRLDEII  551

Query  302   DPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKWG  144
             DP +E  +D W+LSS++KVAE+AFRCLAFHRDMRPSMMEVA ELEQ++L KW 
Sbjct  552   DPFLEPHRDAWSLSSLHKVAELAFRCLAFHRDMRPSMMEVAAELEQIKLCKWA  604



>ref|XP_003527703.1| PREDICTED: wall-associated receptor kinase-like 14-like [Glycine 
max]
Length=709

 Score =   753 bits (1944),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/617 (61%), Positives = 473/617 (77%), Gaps = 23/617 (4%)
 Frame = -3

Query  1946  KMIPVLILLLLQSAMVFGSST--------CNRSCGDGLKQLPFPFGFSSGCEILLNCTSN  1791
             +++  +I+ +L     F  +T        C ++CG   K +P+PFGFSSGC I L CT+ 
Sbjct  9     QLLLFIIIFVLGKITFFIPTTNAQVNHHECRQTCGSS-KPVPYPFGFSSGCAIRLKCTA-  66

Query  1790  GTMSIGEFPVYQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELK  1611
             G  S+GEFPV ++  D+++++I A+C R  +++  LF   +APTS N ILL+NC+   L 
Sbjct  67    GVASVGEFPV-KVNTDSMIVSIEAQCNRPFDSLHHLFSHKYAPTSRNVILLENCTGTPLP  125

Query  1610  CMIPSTMIQTQFELQDC----GKDNISCFSEPHMTGGFIGYENLTGTGCKSLFSAISSPA  1443
             C IP T+++T FE   C    G   +SC+ E + T GF+    L   GCK   S++++P 
Sbjct  126   CFIPETLVRTHFESVGCNNASGTGELSCYFE-NRTNGFVDRRTLDEIGCKYFMSSLAAPD  184

Query  1442  AAANTTA-VSLDIQVIELGWWLQG-HCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDG  1269
                 + A +SLD+ +I+LGWWLQG  C CS +A+C T+++P DGKPGFRC+C +GF GDG
Sbjct  185   IKNISGAPLSLDVNIIQLGWWLQGDQCLCSDHANCTTLQSPMDGKPGFRCRCRDGFVGDG  244

Query  1268  YQGGSGCRRDDTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAM  1089
             +  G+GCR+  + CNPAKY+ G CGG TR  VLIGG + G +LMV++G +CC  RRR  +
Sbjct  245   FLAGTGCRKASS-CNPAKYISGRCGGTTRFIVLIGGFVVGVSLMVTLGSLCCFYRRRSKL  303

Query  1088  KNWNRRRRELRETTGI-TIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWV  912
             +  N  +R L E TG  ++P+Y YKDIEKATN+FS+K+RLG GAYGTVY+GKL++N EWV
Sbjct  304   RVTNSTKRRLTEATGKNSVPIYPYKDIEKATNSFSEKQRLGTGAYGTVYAGKLYNN-EWV  362

Query  911   AIKRIRHRDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHL  732
             AIKRI+HRDTDSIEQV NEIKLLSSV+H NLVRLLGCSIE GEQILVYEFMPNGTLSQHL
Sbjct  363   AIKRIKHRDTDSIEQVMNEIKLLSSVSHTNLVRLLGCSIEYGEQILVYEFMPNGTLSQHL  422

Query  731   QREKGSGLPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGL  552
             Q+E+GSGLPWP+RL I +ET+QAIAYLH+A+ PPIYHRD+KSSNILLDYN++SKVADFGL
Sbjct  423   QKERGSGLPWPIRLTIATETAQAIAYLHSAICPPIYHRDIKSSNILLDYNFRSKVADFGL  482

Query  551   SRFGLIESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRP  372
             SR G+ E SHIST PQGTPGY+DPQYHQDFHLSDKSDVYS GVVLVEIITGLK VDF+RP
Sbjct  483   SRLGMTEISHISTTPQGTPGYVDPQYHQDFHLSDKSDVYSLGVVLVEIITGLKVVDFSRP  542

Query  371   QNEVNLAALAVDKIGKGGLLEIIDPLIEAE--KDVWTLSSVNKVAEIAFRCLAFHRDMRP  198
              NEVNLA+LA DKIGKG L EIIDP +E E   D WTLSS++KVAE+AFRC+AFHRDMRP
Sbjct  543   HNEVNLASLAADKIGKGLLNEIIDPFLEPEVRSDAWTLSSIHKVAELAFRCIAFHRDMRP  602

Query  197   SMMEVAIELEQMRLSKW  147
             SM EVA ELEQ+RLS+W
Sbjct  603   SMTEVASELEQLRLSRW  619



>gb|KHN04540.1| Wall-associated receptor kinase-like 14 [Glycine soja]
Length=712

 Score =   741 bits (1913),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/589 (63%), Positives = 458/589 (78%), Gaps = 16/589 (3%)
 Frame = -3

Query  1883  CNRSCGDGLKQLPFPFGFSSGCEILLNCTSNGTMSIGEFPVYQLTPDTIMINIPAKCGRR  1704
             C ++CG   K +P+PFGFSSGC I LNCT+ G  S+GEFPV ++  D+++++I A+C R 
Sbjct  39    CRQTCGSS-KPVPYPFGFSSGCAIRLNCTA-GVASVGEFPV-KVNTDSLIVSIEAQCNRS  95

Query  1703  IEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMIQTQFELQDCGKDN----ISCF  1536
              ++   LF   +APTS N ILL NC++  L C IP T+++T FE   CG  +    +SC+
Sbjct  96    FDSFHHLFSHKYAPTSRNVILLDNCTATPLPCSIPETLVRTHFESVGCGNASGTGELSCY  155

Query  1535  SEPHMTGGFIGYENLTGTGCKSLFSAISSP--AAAANTTAVSLDIQVIELGWWLQG-HCR  1365
              E  +T GF+    L    CK   S++S P     + T  +SL + VIELGWWLQG  C 
Sbjct  156   FE-KITNGFMDQRMLDEIRCKYFMSSLSVPDIKNISGTAPLSLGVNVIELGWWLQGDRCL  214

Query  1364  CSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTRCNPAKYLLGECGGKT  1185
             CS +A+C T+++P D KPGFRC+C +GF GDG+  G+GC++  + CNPAKY+ G CGG T
Sbjct  215   CSDHANCTTLQSPVDRKPGFRCRCRDGFVGDGFLVGTGCQKASS-CNPAKYMSGRCGGTT  273

Query  1184  RigvliggviagaaLMVSVGLICCIIRRRLAMKNWNRRRRELRETTGI-TIPVYSYKDIE  1008
             R  VLIGG + G +LMV++G +CC  RRR  ++     +R L E TG  ++P+Y YKDIE
Sbjct  274   RFIVLIGGFVIGVSLMVTLGSLCCFYRRRSKLRVTKSTKRRLTEATGNNSVPIYPYKDIE  333

Query  1007  KATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIKLLSSVNH  828
             KATN+FS+K+RLG GAYGTVY+GKL+ NDEWVAIKRI+HRDTDSIEQV NEIKLLSSV+H
Sbjct  334   KATNSFSEKQRLGTGAYGTVYAGKLY-NDEWVAIKRIKHRDTDSIEQVMNEIKLLSSVSH  392

Query  827   PNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVSETSQAIAYLH  648
              NLVRLLGCSIE GEQILVYEFMPNGTLSQHLQ+E+GSGLPWPVRL I +ET+QAIA+LH
Sbjct  393   TNLVRLLGCSIEYGEQILVYEFMPNGTLSQHLQKERGSGLPWPVRLTIATETAQAIAHLH  452

Query  647   NAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGTPGYLDPQYHQ  468
             +A+ PPIYHRD+KSSNILLDYN++SKVADFGLSR G+ E SHISTAPQGTPGY+DPQYHQ
Sbjct  453   SAICPPIYHRDIKSSNILLDYNFRSKVADFGLSRLGMTEISHISTAPQGTPGYVDPQYHQ  512

Query  467   DFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLEIIDPLIE  288
             DFHLSDKSDVYS GVVLVEIITG K VDF+RP NEVNLA+LA D+IGKG L EIIDP +E
Sbjct  513   DFHLSDKSDVYSLGVVLVEIITGQKVVDFSRPHNEVNLASLAADRIGKGLLNEIIDPFLE  572

Query  287   AE--KDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKW  147
             AE   D WTLSS++KVAE+AFRCLAFHRDMRPSM EVA ELEQ+ LS+W
Sbjct  573   AEARSDAWTLSSIHKVAELAFRCLAFHRDMRPSMTEVASELEQLSLSRW  621



>ref|XP_003523885.1| PREDICTED: wall-associated receptor kinase-like 14-like isoform 
X1 [Glycine max]
Length=712

 Score =   739 bits (1907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/589 (63%), Positives = 457/589 (78%), Gaps = 16/589 (3%)
 Frame = -3

Query  1883  CNRSCGDGLKQLPFPFGFSSGCEILLNCTSNGTMSIGEFPVYQLTPDTIMINIPAKCGRR  1704
             C ++CG   K +P+PFGFSSGC I LNCT+ G  S+GEFPV ++  D+++++I A+C R 
Sbjct  39    CRQTCGSS-KPVPYPFGFSSGCAIRLNCTA-GVASVGEFPV-KVNTDSLIVSIEAQCNRS  95

Query  1703  IEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMIQTQFELQDCGKDN----ISCF  1536
              ++   LF   +APTS N ILL NC++  L C IP T+++T FE   CG  +    +SC+
Sbjct  96    FDSFHHLFSHKYAPTSRNVILLDNCTATPLPCSIPETLVRTHFESVGCGNASGTGELSCY  155

Query  1535  SEPHMTGGFIGYENLTGTGCKSLFSAISSP--AAAANTTAVSLDIQVIELGWWLQG-HCR  1365
              E  +T GF+    L    CK   S++S P     + T  +SL + VIELGWWLQG  C 
Sbjct  156   FE-KITNGFMDQRMLDEIRCKYFMSSLSVPDIKNISGTAPLSLGVNVIELGWWLQGDRCL  214

Query  1364  CSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTRCNPAKYLLGECGGKT  1185
             CS +A+C T+++P D KPGFRC+C +GF GDG+  G+GC++  + CNPAKY+ G CGG T
Sbjct  215   CSDHANCTTLQSPVDRKPGFRCRCRDGFVGDGFLVGTGCQKASS-CNPAKYMSGRCGGTT  273

Query  1184  RigvliggviagaaLMVSVGLICCIIRRRLAMKNWNRRRRELRETTGI-TIPVYSYKDIE  1008
             R  VLIGG + G +LMV++G +CC  RRR  ++     +R L E TG  ++P+Y YKDIE
Sbjct  274   RFIVLIGGFVIGVSLMVTLGSLCCFYRRRSKLRVTKSTKRRLTEATGNNSVPIYPYKDIE  333

Query  1007  KATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIKLLSSVNH  828
             KATN+FS+K+RLG GAYGTVY+GKL+ NDEWVAIKRI+HRDTDSIEQV NEIKLLSSV+H
Sbjct  334   KATNSFSEKQRLGTGAYGTVYAGKLY-NDEWVAIKRIKHRDTDSIEQVMNEIKLLSSVSH  392

Query  827   PNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVSETSQAIAYLH  648
              NLVRLLGCSIE GEQILVYEFMPNGT SQHLQ+E+GSGLPWPVRL I +ET+QAIA+LH
Sbjct  393   TNLVRLLGCSIEYGEQILVYEFMPNGTRSQHLQKERGSGLPWPVRLTIATETAQAIAHLH  452

Query  647   NAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGTPGYLDPQYHQ  468
             +A+ PPIYHRD+KSSNILLDYN++SKVADFGLSR G+ E SHISTAPQGTPGY+DPQYHQ
Sbjct  453   SAICPPIYHRDIKSSNILLDYNFRSKVADFGLSRLGMTEISHISTAPQGTPGYVDPQYHQ  512

Query  467   DFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLEIIDPLIE  288
             DFHLSDKSDVYS GVVLVEIITG K VDF+RP NEVNLA+LA D+IGKG L EIIDP +E
Sbjct  513   DFHLSDKSDVYSLGVVLVEIITGQKVVDFSRPHNEVNLASLAADRIGKGLLNEIIDPFLE  572

Query  287   AE--KDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKW  147
             AE   D WTLSS++KVAE+AFRCLAFHRDMRPSM EVA ELEQ+ LS+W
Sbjct  573   AEARSDAWTLSSIHKVAELAFRCLAFHRDMRPSMTEVASELEQLSLSRW  621



>gb|KHG01141.1| Wall-associated receptor kinase-like 14 [Gossypium arboreum]
Length=700

 Score =   735 bits (1898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/601 (60%), Positives = 460/601 (77%), Gaps = 16/601 (3%)
 Frame = -3

Query  1925  LLLLQSAMVFGSSTCNRSCGDGLKQLPFPFGFSSGCEILLNCT---SNGTMSIGEFPVYQ  1755
             +L+L    +  SS CNRSCG     +P+PFGFS+ C+I LNCT    +    I  FP+  
Sbjct  16    ILILSFPFIIQSSICNRSCGG--NHVPYPFGFSTTCQIPLNCTITAHHHHRHIAGFPILN  73

Query  1754  LTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMIQTQF  1575
             +  + I I+I A C R ++A++ L+ +N+APTS N ILLQNC+ P   CMIPSTM+ T F
Sbjct  74    INQNHIKISIEATCDRPLQALRRLYTQNYAPTSRNAILLQNCTLPS-PCMIPSTMVYTHF  132

Query  1574  ELQDCGKDN--ISCFSEPHMTGGFIGYENLTGTGCKSLFSAISSPAAAANTTAVSLDIQV  1401
             E   C  +N  ISC+SE   + GF+ Y+ + GT C S  S+IS+   + N + V L++QV
Sbjct  133   ESLTCSPNNSNISCYSEKK-SNGFLDYDKVIGTNCGSFLSSIST--ESFNESGV-LEVQV  188

Query  1400  IELGWWLQGHCR--CSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTRC  1227
             +EL WW++G C   CSKNA C+ + +P + +PG  C+C  GF GDGY+ G GCR+  + C
Sbjct  189   VELRWWIEGRCSELCSKNAVCDEIVSPVNRRPGSYCRCRNGFVGDGYRAGDGCRKASSNC  248

Query  1226  NPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAMKNWNRRRRELRETT  1047
             NPA+Y+ GECGG  R+ +LIGG+  GA+ M+ V L CC++R++ + +  +  +R   + +
Sbjct  249   NPARYVSGECGGTARVIMLIGGIAVGASFMICVVLKCCLVRKQSSSRTKHSMKRLFSDAS  308

Query  1046  GITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQ  867
             GI IP+Y+YK+IEKATN FS+K+RLG GA+GTVY+GKLH N  WVAIKRI+HRDTD IEQ
Sbjct  309   GINIPIYTYKEIEKATNGFSEKQRLGTGAFGTVYAGKLHTNS-WVAIKRIKHRDTDCIEQ  367

Query  866   VTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLG  687
             V NEIKL+S+V+HPNLVRLLGCS+E GEQILVYEFMPNGTL QHLQRE+G GLPWPVRL 
Sbjct  368   VVNEIKLISAVSHPNLVRLLGCSMENGEQILVYEFMPNGTLCQHLQRERGDGLPWPVRLT  427

Query  686   IVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAP  507
             I +ET+QAIA+LH+A+ PPIYHRD+KSSNILLDYN+KSKVADFGLSR G  E+SHISTAP
Sbjct  428   IATETAQAIAHLHSAIDPPIYHRDIKSSNILLDYNFKSKVADFGLSRLGKTETSHISTAP  487

Query  506   QGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIG  327
             QGTPGYLDPQYHQ+FHLSDKSDVYSFGVVL+EIIT LK +DF+RP NE NLA++A D+I 
Sbjct  488   QGTPGYLDPQYHQNFHLSDKSDVYSFGVVLIEIITALKVIDFSRPPNEANLASIATDRIS  547

Query  326   KGGLLEIIDPLIEA-EKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSK  150
             KG L EIIDP +     D WTLSS++KVAE+AFRCL+FHRDMRP+MMEVA+ELEQ++LSK
Sbjct  548   KGRLDEIIDPFLNPNNNDPWTLSSIHKVAELAFRCLSFHRDMRPTMMEVAMELEQIKLSK  607

Query  149   W  147
             W
Sbjct  608   W  608



>ref|XP_006578002.1| PREDICTED: wall-associated receptor kinase-like 14-like isoform 
X2 [Glycine max]
Length=711

 Score =   735 bits (1898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/589 (63%), Positives = 455/589 (77%), Gaps = 17/589 (3%)
 Frame = -3

Query  1883  CNRSCGDGLKQLPFPFGFSSGCEILLNCTSNGTMSIGEFPVYQLTPDTIMINIPAKCGRR  1704
             C ++CG   K +P+PFGFSSGC I LNCT+ G  S+GEFPV ++  D+++++I A+C R 
Sbjct  39    CRQTCGSS-KPVPYPFGFSSGCAIRLNCTA-GVASVGEFPV-KVNTDSLIVSIEAQCNRS  95

Query  1703  IEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMIQTQFELQDCGKDN----ISCF  1536
              ++   LF   +APTS N ILL NC++  L C IP T+++T FE   CG  +    +SC+
Sbjct  96    FDSFHHLFSHKYAPTSRNVILLDNCTATPLPCSIPETLVRTHFESVGCGNASGTGELSCY  155

Query  1535  SEPHMTGGFIGYENLTGTGCKSLFSAISSP--AAAANTTAVSLDIQVIELGWWLQG-HCR  1365
              E  +T GF+    L    CK   S++S P     + T  +SL + VIELGWWLQG  C 
Sbjct  156   FE-KITNGFMDQRMLDEIRCKYFMSSLSVPDIKNISGTAPLSLGVNVIELGWWLQGDRCL  214

Query  1364  CSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTRCNPAKYLLGECGGKT  1185
             CS +A+C T+++P D KPGFRC+C +GF GDG+  G+GC++  + CNPAKY+ G CGG T
Sbjct  215   CSDHANCTTLQSPVDRKPGFRCRCRDGFVGDGFLVGTGCQKASS-CNPAKYMSGRCGGTT  273

Query  1184  RigvliggviagaaLMVSVGLICCIIRRRLAMKNWNRRRRELRETTGI-TIPVYSYKDIE  1008
             R  VLIG VI  +  MV++G +CC  RRR  ++     +R L E TG  ++P+Y YKDIE
Sbjct  274   RFIVLIGFVIGVSL-MVTLGSLCCFYRRRSKLRVTKSTKRRLTEATGNNSVPIYPYKDIE  332

Query  1007  KATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIKLLSSVNH  828
             KATN+FS+K+RLG GAYGTVY+GKL+ NDEWVAIKRI+HRDTDSIEQV NEIKLLSSV+H
Sbjct  333   KATNSFSEKQRLGTGAYGTVYAGKLY-NDEWVAIKRIKHRDTDSIEQVMNEIKLLSSVSH  391

Query  827   PNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVSETSQAIAYLH  648
              NLVRLLGCSIE GEQILVYEFMPNGT SQHLQ+E+GSGLPWPVRL I +ET+QAIA+LH
Sbjct  392   TNLVRLLGCSIEYGEQILVYEFMPNGTRSQHLQKERGSGLPWPVRLTIATETAQAIAHLH  451

Query  647   NAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGTPGYLDPQYHQ  468
             +A+ PPIYHRD+KSSNILLDYN++SKVADFGLSR G+ E SHISTAPQGTPGY+DPQYHQ
Sbjct  452   SAICPPIYHRDIKSSNILLDYNFRSKVADFGLSRLGMTEISHISTAPQGTPGYVDPQYHQ  511

Query  467   DFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLEIIDPLIE  288
             DFHLSDKSDVYS GVVLVEIITG K VDF+RP NEVNLA+LA D+IGKG L EIIDP +E
Sbjct  512   DFHLSDKSDVYSLGVVLVEIITGQKVVDFSRPHNEVNLASLAADRIGKGLLNEIIDPFLE  571

Query  287   AE--KDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKW  147
             AE   D WTLSS++KVAE+AFRCLAFHRDMRPSM EVA ELEQ+ LS+W
Sbjct  572   AEARSDAWTLSSIHKVAELAFRCLAFHRDMRPSMTEVASELEQLSLSRW  620



>gb|KDO79395.1| hypothetical protein CISIN_1g005522mg [Citrus sinensis]
 gb|KDO79396.1| hypothetical protein CISIN_1g005522mg [Citrus sinensis]
Length=692

 Score =   732 bits (1889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/613 (60%), Positives = 469/613 (77%), Gaps = 19/613 (3%)
 Frame = -3

Query  1943  MIPVLILLLLQSAMVF----GSSTCNRSCGDG--LKQLPFPFGFSSGCEILLNCTSNGTM  1782
             MIP L L LL S  +      +  C+R+C +G   K++P+PFGFS GC I L C +N T+
Sbjct  1     MIPQLSLSLLISICILYLANAADLCDRTCRNGKSTKRVPYPFGFSPGCAIRLTC-ANATV  59

Query  1781  SIGEFPVYQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMI  1602
              IGEF V  +T D+I +N+P KC R+I ++ PLFG N+  T  N +LLQNC++ +  C+I
Sbjct  60    KIGEFEVQNVTADSIFVNLPTKCHRQITSLHPLFGPNYGMTRQNSLLLQNCTTHQNGCVI  119

Query  1601  PSTMIQTQFELQDCG--KDNISCFSEPH---MTGGFIGYENLTGTGCKSLFSAISSPAAA  1437
             P+++++ +F L+ CG   DNI+CFS P+    +  F+ + +L+ TGC  LFS+++    +
Sbjct  120   PTSLVEQRFNLKTCGVGSDNITCFSWPYNENKSASFMSFNDLSRTGCNYLFSSLA--FNS  177

Query  1436  ANTTAVSLDIQVIELGWWLQGHCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGG  1257
                +A SL+ Q++ELGW L G C CSKNADC    T  +G  G RC+C EGF GDG+  G
Sbjct  178   GGNSAGSLEFQLLELGWGLNGSCNCSKNADCTRNFTFANGISGHRCRCQEGFEGDGFVAG  237

Query  1256  SGCRRDDTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLIC-CIIRRRLAMKNW  1080
              GCRR  + CN +KYL G+CGG TRIG L+GG+IAGA+++  V L+C C  +R  +++N 
Sbjct  238   DGCRRT-SDCNASKYLSGKCGG-TRIGALVGGLIAGASIVAVVALLCYCFRKRSTSLRNQ  295

Query  1079  NRRRRELRETTG-ITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIK  903
                +R L +  G  ++P Y YK+IEKAT+ FS+K RLG GAYGTVY+GKLH ND+WVAIK
Sbjct  296   LSAKRLLCQAAGNSSVPFYPYKEIEKATSFFSEKHRLGTGAYGTVYAGKLH-NDDWVAIK  354

Query  902   RIRHRDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQRE  723
             R R+RDTDSI+QV NEIKLLSSV+HPNL+RLLGC IE+GE ILVYEFMPNGTL QHLQRE
Sbjct  355   RFRYRDTDSIDQVMNEIKLLSSVSHPNLLRLLGCCIEEGEPILVYEFMPNGTLCQHLQRE  414

Query  722   KGSGLPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRF  543
             +GSGLPW +R+ I +ET+QAIAYLH+AM+PPIYHRD+KSSNILLDYNY+SKVADFGLSR 
Sbjct  415   RGSGLPWTIRITIATETAQAIAYLHSAMNPPIYHRDIKSSNILLDYNYRSKVADFGLSRL  474

Query  542   GLIESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNE  363
             G+ ESSHISTAPQGTPGYLDPQYHQ FHLSDKSDVYSFGVVL+EIIT LK VDF+RP +E
Sbjct  475   GMTESSHISTAPQGTPGYLDPQYHQYFHLSDKSDVYSFGVVLIEIITALKVVDFSRPHSE  534

Query  362   VNLAALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEV  183
             VNLAALA+D+IG+G + EIIDP +E  +D WTLSS++ VAE+AFRCLAFHRDMRP+MMEV
Sbjct  535   VNLAALAIDRIGRGCVDEIIDPYLEPHRDAWTLSSIHNVAELAFRCLAFHRDMRPTMMEV  594

Query  182   AIELEQMRLSKWG  144
             A ELE +R+S W 
Sbjct  595   AEELEHIRVSSWA  607



>ref|XP_006425789.1| hypothetical protein CICLE_v10025043mg [Citrus clementina]
 ref|XP_006425790.1| hypothetical protein CICLE_v10025043mg [Citrus clementina]
 ref|XP_006466678.1| PREDICTED: wall-associated receptor kinase-like 14-like isoform 
X1 [Citrus sinensis]
 ref|XP_006466679.1| PREDICTED: wall-associated receptor kinase-like 14-like isoform 
X2 [Citrus sinensis]
 ref|XP_006466680.1| PREDICTED: wall-associated receptor kinase-like 14-like isoform 
X3 [Citrus sinensis]
 gb|ESR39029.1| hypothetical protein CICLE_v10025043mg [Citrus clementina]
 gb|ESR39030.1| hypothetical protein CICLE_v10025043mg [Citrus clementina]
Length=692

 Score =   731 bits (1886),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/613 (60%), Positives = 469/613 (77%), Gaps = 19/613 (3%)
 Frame = -3

Query  1943  MIPVLILLLLQSAMVF----GSSTCNRSCGDG--LKQLPFPFGFSSGCEILLNCTSNGTM  1782
             MIP L L LL S  +      +  C+R+C +G   K++P+PFGFS GC I L C +N T+
Sbjct  1     MIPQLSLSLLISICILYLANAADLCDRTCRNGKSTKRVPYPFGFSPGCAIRLTC-ANATV  59

Query  1781  SIGEFPVYQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMI  1602
              IGEF V  +T D+I +N+P KC R+I ++ PLFG N+  T  N +LLQNC++ +  C+I
Sbjct  60    KIGEFEVQNVTADSIFVNLPTKCHRQITSLHPLFGPNYGMTRQNSLLLQNCTTHQNGCVI  119

Query  1601  PSTMIQTQFELQDCG--KDNISCFSEPH---MTGGFIGYENLTGTGCKSLFSAISSPAAA  1437
             P+++++ +F L+ CG   DNI+CFS P+    +  F+ + +L+ TGC  LFS+++    +
Sbjct  120   PTSLVEQRFNLKTCGVGSDNITCFSWPYNENKSASFMSFNDLSRTGCNYLFSSLA--FNS  177

Query  1436  ANTTAVSLDIQVIELGWWLQGHCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGG  1257
                +A SL+ Q++ELGW L G C CSKNADC    T  +G  G RC+C EGF GDG+  G
Sbjct  178   GGNSAGSLEFQLLELGWGLNGSCNCSKNADCTPNVTLANGISGHRCRCQEGFEGDGFVAG  237

Query  1256  SGCRRDDTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLIC-CIIRRRLAMKNW  1080
              GCRR  + C+ +KYL G+CGG TRIG L+GG+IAGA+++  V L+C C  +R  +++N 
Sbjct  238   DGCRRT-SDCSASKYLSGKCGG-TRIGALVGGLIAGASIVAVVALLCYCFRKRSTSLRNQ  295

Query  1079  NRRRRELRETTG-ITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIK  903
                +R L +  G  ++P Y YK+IEKAT+ FS+K RLG GAYGTVY+GKLH ND+WVAIK
Sbjct  296   LSAKRLLCQAAGNSSVPFYPYKEIEKATSFFSEKHRLGTGAYGTVYAGKLH-NDDWVAIK  354

Query  902   RIRHRDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQRE  723
             R R+RDTDSI+QV NEIKLLSSV+HPNL+RLLGC IE+GE ILVYEFMPNGTL QHLQRE
Sbjct  355   RFRYRDTDSIDQVMNEIKLLSSVSHPNLLRLLGCCIEEGEPILVYEFMPNGTLCQHLQRE  414

Query  722   KGSGLPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRF  543
             +GSGLPW +R+ I +ET+QAIAYLH+AM+PPIYHRD+KSSNILLDYNY+SKVADFGLSR 
Sbjct  415   RGSGLPWTIRITIATETAQAIAYLHSAMNPPIYHRDIKSSNILLDYNYRSKVADFGLSRL  474

Query  542   GLIESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNE  363
             G+ ESSHISTAPQGTPGYLDPQYHQ FHLSDKSDVYSFGVVL+EIIT LK VDF+RP +E
Sbjct  475   GMTESSHISTAPQGTPGYLDPQYHQYFHLSDKSDVYSFGVVLIEIITALKVVDFSRPHSE  534

Query  362   VNLAALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEV  183
             VNLAALA+D+IG+G + EIIDP +E  +D WTLSS++ VAE+AFRCLAFHRDMRPSMMEV
Sbjct  535   VNLAALAIDRIGRGCVDEIIDPYLEPHRDAWTLSSIHNVAELAFRCLAFHRDMRPSMMEV  594

Query  182   AIELEQMRLSKWG  144
             A ELE +R+S W 
Sbjct  595   AEELEHIRVSSWA  607



>gb|KDP38442.1| hypothetical protein JCGZ_04367 [Jatropha curcas]
Length=681

 Score =   729 bits (1883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/600 (62%), Positives = 445/600 (74%), Gaps = 15/600 (3%)
 Frame = -3

Query  1925  LLLLQSAMVFG---SSTCNRSCGDGLKQLPFPFGFSSGCEILLNCTSNGTMSIGE-FPVY  1758
             +LLL S  +     +  CN++CG   +Q P+PFGFSS C I LNC+  G + I + FPV 
Sbjct  9     VLLLSSIFILSLITTQACNQTCGG--QQFPYPFGFSSDCPIHLNCSPEGQILINQQFPVQ  66

Query  1757  QLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPEL-KCMIPSTMIQT  1581
             ++T + I IN+   C R I+A K LF +NFAP S N ILL NCSS  L  C IP+  ++T
Sbjct  67    KVTQEKIRINLEPNCNRSIQAFKSLFTRNFAPKSTNAILLHNCSSSTLLPCNIPAMSVET  126

Query  1580  QFELQDCGKDN-ISCFSEPHMTGGFIGYENLTGTGCKSLFSAISSPAAAANTTAVSLDIQ  1404
              FE   C  ++ +SC  +     GF    +     C++L S+ISS   A    +VSLD+Q
Sbjct  127   HFESLKCSNNSKMSCLFDL-TPDGFFHRNDTQLNQCRNLLSSISS---APLEGSVSLDVQ  182

Query  1403  VIELGWWLQGHCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTRCN  1224
             ++ELGWWL G C CS +ADCN  +TP  G  G++CQC +GF GDGY  G+GCR+    C 
Sbjct  183   MMELGWWLLGDCHCSDHADCNRFKTPHRGLMGYQCQCKDGFDGDGYAAGAGCRQ--ASCG  240

Query  1223  PAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAMKNWNRRRRELRETTG  1044
                YL G+CGG   + +LIGG+ A A  ++++GL+CC IRRR   K    R+ +L E TG
Sbjct  241   VVNYLSGKCGGAAGLAILIGGISAAAGSLMAMGLVCCFIRRRSTSKAKGLRKLQLSEATG  300

Query  1043  ITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQV  864
             I IP+Y YK+IEKATN+FS+ +RLG GAYGTVY+GKLH ND WVAIKRI+ RDTDS  QV
Sbjct  301   IDIPIYHYKEIEKATNSFSENQRLGTGAYGTVYAGKLH-NDLWVAIKRIKPRDTDSTTQV  359

Query  863   TNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGI  684
              NEIKL+SSVNHPNLVRLLGCSIE GEQILVYEFMPNGTL QHLQREKG GL WP+RL I
Sbjct  360   LNEIKLISSVNHPNLVRLLGCSIENGEQILVYEFMPNGTLCQHLQREKGEGLAWPIRLTI  419

Query  683   VSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQ  504
              +ET+QAIAYLH+A+ PPIYHRD+KSSNILLDYNY+SKVADFGLSR G  E SHISTAPQ
Sbjct  420   ATETAQAIAYLHSAIDPPIYHRDIKSSNILLDYNYRSKVADFGLSRLGRTEISHISTAPQ  479

Query  503   GTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGK  324
             GTPGYLDPQYHQ+FHLSDKSDVYSFGVVLVEIITGLK VDF RP N+VNLAALA D+IGK
Sbjct  480   GTPGYLDPQYHQNFHLSDKSDVYSFGVVLVEIITGLKVVDFNRPTNDVNLAALATDRIGK  539

Query  323   GGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKWG  144
             G L EIIDP ++   D WTLSSV KVAE+AFRCLAF RD+RPSM+EVA EL+Q+R+S+W 
Sbjct  540   GKLEEIIDPFLDVHNDNWTLSSVYKVAEVAFRCLAFDRDVRPSMIEVAAELDQIRISRWA  599



>ref|XP_008339009.1| PREDICTED: wall-associated receptor kinase-like 14 [Malus domestica]
Length=706

 Score =   730 bits (1884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/611 (59%), Positives = 462/611 (76%), Gaps = 16/611 (3%)
 Frame = -3

Query  1943  MIPVLILLLLQS-----AMVFGSSTCNRSCGDG--LKQLPFPFGFSSGCEILLNCTSNGT  1785
             +I V+ +L+L +     A    SS+C  +CG G   K + +PFGFS  C+I LNC+ N  
Sbjct  13    LITVVTVLILSTSTAAIAKAQNSSSCIHTCGSGKSAKTVRYPFGFSPSCQIRLNCSENNE  72

Query  1784  MSIGEFPVYQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCM  1605
             + +G+F V  +TP+ + +N+PA C RR E++  LFG NF PT NN +LLQNCS+P+  C+
Sbjct  73    IRLGKFRVLNVTPNAVFVNLPAICNRRFESVIELFGPNFGPTWNNSLLLQNCSAPQNGCL  132

Query  1604  IPSTMIQTQFELQDC--GKDNISCFSEPHMTGGFIGYENLTGTGCKSLFSAISSPAAAAN  1431
             IP+  +Q QF L+ C    DNISC S+PH     + +E+L+ TGCK+LF +IS    +  
Sbjct  133   IPADFVQKQFNLESCRSSADNISCLSQPHNQSEVMRFEDLSRTGCKNLFGSIS--VQSDG  190

Query  1430  TTAVSLDIQVIELGWWLQGHCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSG  1251
              + +SL+ + +ELGWW+ G C C  NA C  ++  G+   G++C+C +GF GDG+  GSG
Sbjct  191   ESPLSLEFETVELGWWVGGLCDCDPNATCTRVKL-GERTDGYQCRCVDGFDGDGFNHGSG  249

Query  1250  CRRDDTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRR-LAMKNWNR  1074
             CRR  ++CNP+KY+ G CGG TR+GVLIGGVIAGA +M  +  IC  +RRR   ++N   
Sbjct  250   CRRV-SKCNPSKYMSGRCGGTTRVGVLIGGVIAGAFIMAGLFFICHFVRRRSTCLRNQMS  308

Query  1073  RRRELRETTG-ITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRI  897
              RR L E  G  ++P+Y YK+IE+ATN F++K+RLG GA+GTVY+GKLH NDEWVAIK+I
Sbjct  309   ARRLLSEAAGNSSVPLYPYKEIERATNCFAEKQRLGTGAFGTVYAGKLH-NDEWVAIKKI  367

Query  896   RHRDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKG  717
               RDT+ I+QV NEIKLLSSV+HPNLVRLLGC IE GEQILVYE+MPNGTLS+HLQRE+G
Sbjct  368   NRRDTNGIDQVMNEIKLLSSVSHPNLVRLLGCCIEGGEQILVYEYMPNGTLSEHLQRERG  427

Query  716   SGLPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGL  537
              GLPW +RL I SET+ AIAYLH+ M+PPIYHRD+KS+NILLDYNYKSKVADFGLSR G+
Sbjct  428   QGLPWTIRLTIASETANAIAYLHSEMNPPIYHRDIKSNNILLDYNYKSKVADFGLSRLGM  487

Query  536   IESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVN  357
              ESS++STAPQGTPGY+DPQYHQ+FHLSD+SDVYSFGVVLVEIIT +K VDF RPQ++VN
Sbjct  488   TESSYVSTAPQGTPGYVDPQYHQNFHLSDRSDVYSFGVVLVEIITAMKVVDFARPQSDVN  547

Query  356   LAALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAI  177
             LAALA+D+IGKG L EI+DP +E  +D WTL SVNKV E+AFRCLAFH DMRPSM EVA 
Sbjct  548   LAALAIDRIGKGSLDEIVDPFLEPNRDAWTLYSVNKVGELAFRCLAFHSDMRPSMKEVAE  607

Query  176   ELEQMRLSKWG  144
             ELE +R S W 
Sbjct  608   ELEYVRCSGWA  618



>ref|XP_010255034.1| PREDICTED: wall-associated receptor kinase-like 14 [Nelumbo nucifera]
Length=685

 Score =   727 bits (1877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/587 (62%), Positives = 456/587 (78%), Gaps = 17/587 (3%)
 Frame = -3

Query  1889  STCNRSCGDGLKQLPFPFGFSSGCEILLNCTSNGTMSIGEFPVYQLTPDTIMINIPAKCG  1710
             S C+ +CG  L + P+P GFS  C I LNCT NG   IGEF V  +T D+I++++P KC 
Sbjct  26    SPCSSTCG--LVKFPYPLGFSKDCPISLNCT-NGEAFIGEFKVKNVTSDSILVHLPPKCK  82

Query  1709  RRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMIQTQFELQDCGKD--NISCF  1536
             R IE +K LF  N+A T  NG+LL+NC+ P   C IP+ +++  FE Q C K+  NI CF
Sbjct  83    RPIENLKQLFQANYALTWQNGLLLENCTLPVNGCSIPAPLMEIHFEKQVCSKNRTNIKCF  142

Query  1535  SEPHMTGG--FIGYENLTGTGCKSLFSAISSPAAAANTTAVSLDIQVIELGWWLQGHCRC  1362
             ++    GG  F+ Y+++    CK LFS+I+  + + +++    + Q +++GWWL+G C C
Sbjct  143   AK----GGKDFMKYDDVNEVNCKYLFSSIAIDSNSNSSSLSL-EFQTVQVGWWLEGKCDC  197

Query  1361  SKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTRCNPAKYLLGECGGKTR  1182
             SKNA+  T + P +G  G RCQC++GF GDG++ G GCR+   +CNP+KY+ G CGG TR
Sbjct  198   SKNANLTTFKIPNNGT-GCRCQCNKGFEGDGFKAGVGCRK--VKCNPSKYMSGRCGGTTR  254

Query  1181  igvliggviagaaLMVSVGLICCIIRRRL-AMKNWNRRRRELRETTGITIPVYSYKDIEK  1005
             + VLIGG+IAGA+LM  + L+C  IRRR  ++K W  +R       G+T+P Y YK+IE+
Sbjct  255   VVVLIGGIIAGASLMAGLSLLCYFIRRRFTSLKTWKSKRLLSEAAGGLTVPFYPYKEIER  314

Query  1004  ATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIKLLSSVNHP  825
             ATN FS+K+RLG GAYGTVY+GKLH NDEWVAIK+IRHRDT+ +EQV NEIKLLSSV+HP
Sbjct  315   ATNCFSEKQRLGTGAYGTVYAGKLH-NDEWVAIKKIRHRDTEGMEQVMNEIKLLSSVSHP  373

Query  824   NLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVSETSQAIAYLHN  645
             NLVRLLGC IE+GEQILVYEFMPNGTLSQHLQRE+G+GLPW +RL I +ET+ AIAYLH+
Sbjct  374   NLVRLLGCCIERGEQILVYEFMPNGTLSQHLQRERGNGLPWTIRLTIATETAHAIAYLHS  433

Query  644   AMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGTPGYLDPQYHQD  465
              M+PPIYHRD+KSSNILLDYNY SKVADFGLSR G+ ESSHISTAPQGTPGY+DPQYHQ+
Sbjct  434   TMNPPIYHRDIKSSNILLDYNYNSKVADFGLSRLGMTESSHISTAPQGTPGYVDPQYHQN  493

Query  464   FHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLEIIDPLIEA  285
             FHLSDKSDVYSFGVVLVEIIT +K VDF+RP +++NLAALA+D+IGKG + EIIDP +E 
Sbjct  494   FHLSDKSDVYSFGVVLVEIITAMKVVDFSRPHSDINLAALAIDRIGKGCVDEIIDPFLEP  553

Query  284   EKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKWG  144
              +D WTLSSV+KVAE+AFRCLAFHRDMRPSMMEVA ELE +RLS W 
Sbjct  554   HRDAWTLSSVHKVAELAFRCLAFHRDMRPSMMEVATELENIRLSGWA  600



>ref|XP_009379148.1| PREDICTED: wall-associated receptor kinase-like 14 isoform X2 
[Pyrus x bretschneideri]
Length=706

 Score =   727 bits (1877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/609 (60%), Positives = 465/609 (76%), Gaps = 15/609 (2%)
 Frame = -3

Query  1943  MIPVLILLLLQSAMVFGSSTCNR--SCGDG--LKQLPFPFGFSSGCEILLNCTSNGTMSI  1776
             ++ VLIL    SA+    ++ +R  +CG G   K + +PFGFS  C+I LNC +N  +++
Sbjct  16    VVTVLILSTSTSAIAKAQNSSSRMLTCGSGKSAKTVRYPFGFSPSCKIPLNCENN-EITL  74

Query  1775  GEFPVYQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPS  1596
             G+F V  +TP+ I +N+PA C RR E++  LFG NF PT NN +LLQNCS+P+  C+IP+
Sbjct  75    GKFRVQNVTPNAIFVNLPASCNRRFESVFGLFGPNFGPTWNNSLLLQNCSAPQNGCLIPA  134

Query  1595  TMIQTQFELQDC--GKDNISCFSEPHMTGGFIGYENLTGTGCKSLFSAISSPAAAANTTA  1422
               ++ QF L+ C    DNISC S+PH     + +E+LT TGCK+LF +IS    +   + 
Sbjct  135   DFVRKQFNLESCKSSADNISCLSQPHNQSEVMRFEDLTRTGCKNLFGSIS--FRSDGESP  192

Query  1421  VSLDIQVIELGWWLQGHCRCSKNADCNTMRTPGDGKPG-FRCQCSEGFTGDGYQGGSGCR  1245
             +SL+ + +ELGWW++G C+C  NA C  ++  G+ KPG +RC C +GF GDG+  GSGCR
Sbjct  193   LSLEFETVELGWWVEGPCQCHPNATCTRVKL-GERKPGGYRCSCVDGFDGDGFNHGSGCR  251

Query  1244  RDDTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRR-LAMKNWNRRR  1068
             R  ++CNP+KY+ G CGG TR+GVLIGGVIAGA +M  +  IC  +R R   ++N    R
Sbjct  252   RA-SKCNPSKYMSGRCGGTTRVGVLIGGVIAGAFIMAGLFFICYFVRHRSTCLRNQMSAR  310

Query  1067  RELRETTG-ITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRH  891
             R L E  G  ++P+Y YK+IE+ATN F++K+RLG GA+GTVY+GKLH NDEWVAIK+I  
Sbjct  311   RLLSEAAGNSSVPLYPYKEIERATNCFAEKQRLGTGAFGTVYAGKLH-NDEWVAIKKINR  369

Query  890   RDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSG  711
             RDT+ I+QV NEIKLLSSV+HPNLVRLLGC IE GEQILVYE+MPNGTLS+HLQRE+G G
Sbjct  370   RDTNGIDQVMNEIKLLSSVSHPNLVRLLGCCIEGGEQILVYEYMPNGTLSEHLQRERGQG  429

Query  710   LPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIE  531
             LPW +RL I SET+ AIAYLH+ M+PPIYHRD+KS+NILLDYNYKSKVADFGLSR G+ E
Sbjct  430   LPWTIRLTIASETANAIAYLHSEMNPPIYHRDIKSNNILLDYNYKSKVADFGLSRLGMTE  489

Query  530   SSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLA  351
             SS++STAPQGTPGY+DPQYHQ+FHLSD+SDVYSFGVVLVEIIT +K VDF RPQ++VNLA
Sbjct  490   SSYVSTAPQGTPGYVDPQYHQNFHLSDRSDVYSFGVVLVEIITAMKVVDFARPQSDVNLA  549

Query  350   ALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIEL  171
             ALA+D+IGKG L EI+DP +E  +D WTL SVNKVAE+AFRCLAFH DMRPSM EVA EL
Sbjct  550   ALAIDRIGKGSLDEIVDPFLEPNRDAWTLYSVNKVAELAFRCLAFHSDMRPSMTEVAEEL  609

Query  170   EQMRLSKWG  144
             E +R S W 
Sbjct  610   EYVRRSGWA  618



>ref|XP_009379147.1| PREDICTED: wall-associated receptor kinase-like 14 isoform X1 
[Pyrus x bretschneideri]
Length=712

 Score =   725 bits (1872),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/614 (60%), Positives = 465/614 (76%), Gaps = 19/614 (3%)
 Frame = -3

Query  1943  MIPVLILLLLQSAMVFGSSTCNR--SCGDG--LKQLPFPFGFSSGCEILLNCTSNGTMSI  1776
             ++ VLIL    SA+    ++ +R  +CG G   K + +PFGFS  C+I LNC +N  +++
Sbjct  16    VVTVLILSTSTSAIAKAQNSSSRMLTCGSGKSAKTVRYPFGFSPSCKIPLNCENN-EITL  74

Query  1775  GEFPVYQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPS  1596
             G+F V  +TP+ I +N+PA C RR E++  LFG NF PT NN +LLQNCS+P+  C+IP+
Sbjct  75    GKFRVQNVTPNAIFVNLPASCNRRFESVFGLFGPNFGPTWNNSLLLQNCSAPQNGCLIPA  134

Query  1595  TMIQTQFELQDC--GKDNISCFSEPHMTGGFIGYENLTGTGCKSLFSAISSPAAAANTTA  1422
               ++ QF L+ C    DNISC S+PH     + +E+LT TGCK+LF +IS    +   + 
Sbjct  135   DFVRKQFNLESCKSSADNISCLSQPHNQSEVMRFEDLTRTGCKNLFGSIS--FRSDGESP  192

Query  1421  VSLDIQVIELGWWLQGHCRCSKNADCNTMRTPGDGKPG-FRCQCSEGFTGDGYQGGSGCR  1245
             +SL+ + +ELGWW++G C+C  NA C  ++  G+ KPG +RC C +GF GDG+  GSGCR
Sbjct  193   LSLEFETVELGWWVEGPCQCHPNATCTRVKL-GERKPGGYRCSCVDGFDGDGFNHGSGCR  251

Query  1244  RD-----DTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRR-LAMKN  1083
             R       ++CNP+KY+ G CGG TR+GVLIGGVIAGA +M  +  IC  +R R   ++N
Sbjct  252   RVVAVSLASKCNPSKYMSGRCGGTTRVGVLIGGVIAGAFIMAGLFFICYFVRHRSTCLRN  311

Query  1082  WNRRRRELRETTG-ITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAI  906
                 RR L E  G  ++P+Y YK+IE+ATN F++K+RLG GA+GTVY+GKLH NDEWVAI
Sbjct  312   QMSARRLLSEAAGNSSVPLYPYKEIERATNCFAEKQRLGTGAFGTVYAGKLH-NDEWVAI  370

Query  905   KRIRHRDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQR  726
             K+I  RDT+ I+QV NEIKLLSSV+HPNLVRLLGC IE GEQILVYE+MPNGTLS+HLQR
Sbjct  371   KKINRRDTNGIDQVMNEIKLLSSVSHPNLVRLLGCCIEGGEQILVYEYMPNGTLSEHLQR  430

Query  725   EKGSGLPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSR  546
             E+G GLPW +RL I SET+ AIAYLH+ M+PPIYHRD+KS+NILLDYNYKSKVADFGLSR
Sbjct  431   ERGQGLPWTIRLTIASETANAIAYLHSEMNPPIYHRDIKSNNILLDYNYKSKVADFGLSR  490

Query  545   FGLIESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQN  366
              G+ ESS++STAPQGTPGY+DPQYHQ+FHLSD+SDVYSFGVVLVEIIT +K VDF RPQ+
Sbjct  491   LGMTESSYVSTAPQGTPGYVDPQYHQNFHLSDRSDVYSFGVVLVEIITAMKVVDFARPQS  550

Query  365   EVNLAALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMME  186
             +VNLAALA+D+IGKG L EI+DP +E  +D WTL SVNKVAE+AFRCLAFH DMRPSM E
Sbjct  551   DVNLAALAIDRIGKGSLDEIVDPFLEPNRDAWTLYSVNKVAELAFRCLAFHSDMRPSMTE  610

Query  185   VAIELEQMRLSKWG  144
             VA ELE +R S W 
Sbjct  611   VAEELEYVRRSGWA  624



>ref|XP_002522378.1| kinase, putative [Ricinus communis]
 gb|EEF40062.1| kinase, putative [Ricinus communis]
Length=701

 Score =   724 bits (1869),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/591 (62%), Positives = 454/591 (77%), Gaps = 18/591 (3%)
 Frame = -3

Query  1883  CNRSCG--DGLKQLPFPFGFSSGCEILLNCTSN-GTMSIGEFPVYQLTPDTIMINIPAKC  1713
             C  SCG  + +K + +PFGFS GCEI LNC  + G + IGEF V  +TP+ I++++PAKC
Sbjct  31    CRNSCGVDESIKWVSYPFGFSDGCEIQLNCRQDTGDIGIGEFVVQNITPNGILVSLPAKC  90

Query  1712  GRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMIQTQFELQDCG--KDNISC  1539
              R +EA+ PLFG ++AP   NG+LLQNC+     C IP++    Q  +  C    DNI+C
Sbjct  91    NRSLEAISPLFGDHYAPAWRNGLLLQNCTRTLSSCYIPTSSFANQLHIPSCNPRSDNITC  150

Query  1538  FSEPHMTGGFIGYENLTGTGCKSLFSAISSPAAAANTTAVSLDIQVIELGWWLQGHCR--  1365
             +S   +    + Y NL   GCK LFS+    A  +N  +VSL+ + +EL WWL G C+  
Sbjct  151   YSRERLGMDVLSYNNLNSAGCKFLFSSF---AVGSNNPSVSLEFERVELDWWLDGSCKLN  207

Query  1364  ---CSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTRCNPAKYLLGECG  1194
                CSK+A+C  ++  GDGK GFRC C EGFTGDG++ G GCR   + CN +KY+ G+CG
Sbjct  208   RSNCSKHANCTDIKL-GDGKGGFRCWCQEGFTGDGFRNGDGCR-SVSGCNASKYINGQCG  265

Query  1193  GKTRigvliggviagaaLMVSVGLICCIIRRR-LAMKNWNRRRRELRETTG-ITIPVYSY  1020
             G TR+GVL+GG+IAGA+LM  + LI   +R+R  +++N    +R L E  G  ++P Y Y
Sbjct  266   GTTRVGVLVGGIIAGASLMAGLALIWYFVRQRSTSLRNRLSAKRLLCEAAGNSSVPFYPY  325

Query  1019  KDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIKLLS  840
             ++IEKATN FS+K+RLG GAYGTVY+GKLH N+EWVAIK+IRHRDTDSI+QV NEIKLLS
Sbjct  326   REIEKATNGFSEKQRLGIGAYGTVYAGKLH-NEEWVAIKKIRHRDTDSIDQVMNEIKLLS  384

Query  839   SVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVSETSQAI  660
             SV+HPNLVRLLGC IE+GE ILVYEFMP+GTL QHLQRE+G GLPW +RL I +ET+ AI
Sbjct  385   SVSHPNLVRLLGCCIEEGEPILVYEFMPHGTLCQHLQRERGKGLPWTIRLTIAAETANAI  444

Query  659   AYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGTPGYLDP  480
             AYLH+AM+PPIYHRD+KSSNILLDYNYKSKVADFGLSR G+ ESSHISTAPQGTPGYLDP
Sbjct  445   AYLHSAMNPPIYHRDIKSSNILLDYNYKSKVADFGLSRLGMTESSHISTAPQGTPGYLDP  504

Query  479   QYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLEIID  300
             QYHQ FHLSDKSDVYSFGVVLVEIITGLK VDF+RP +EVNLAALA+D+IG+G + EIID
Sbjct  505   QYHQYFHLSDKSDVYSFGVVLVEIITGLKVVDFSRPHSEVNLAALAIDRIGRGCVDEIID  564

Query  299   PLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKW  147
             P ++  +D WTLSS++ VAE+AFRCLAFHRDMRP+MMEVA ELE +RLS W
Sbjct  565   PYLDPNRDAWTLSSIHNVAELAFRCLAFHRDMRPTMMEVAEELEHIRLSAW  615



>ref|XP_004501050.1| PREDICTED: wall-associated receptor kinase-like 14-like [Cicer 
arietinum]
Length=710

 Score =   723 bits (1867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/659 (58%), Positives = 478/659 (73%), Gaps = 35/659 (5%)
 Frame = -3

Query  1883  CNRSCGDGLKQLPFPFGFSSGCEILLNCTSNGTMSIGEFPVYQLTPDTIMINIPAKCGRR  1704
             C++SCG   K  P+PFGFSSGC I LNCT +G + IGEFPV  +  ++I +NI A+C R 
Sbjct  29    CHQSCG-STKPFPYPFGFSSGCSIRLNCTPDGEIFIGEFPVQSVNSNSITVNIKAQCNRP  87

Query  1703  IEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMIQTQFELQD----CGKDNISCF  1536
              E    LF   +APTS N ILLQNC+   + C IP  ++ + FE Q      G   +SC+
Sbjct  88    FEKFHQLFSHKYAPTSGNVILLQNCTETLIPCSIPEALLPSHFESQSNGCGGGGGKLSCY  147

Query  1535  SEPHMTGGFIGYENLTGTGCKSLFSAISSPAAAANT-TAVSLDIQVIELGWWLQG-HCRC  1362
              E + T  F+  + L   GC+   S+ISS     N+  AVSL++  IELGWW+ G  C C
Sbjct  148   FE-NNTRSFVNEKKLDRIGCEFFMSSISSEDLTNNSDAAVSLEVATIELGWWIHGDQCLC  206

Query  1361  SKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTRCNPAKYLLGECGGKTR  1182
             S +A+C  + +P DGKPGFRC C++GF GDG+  G GCR+  + CNP KY+ G CGG  R
Sbjct  207   SDHANCTQIESPIDGKPGFRCSCNDGFVGDGFLAGVGCRKASSTCNPKKYMSGRCGGTAR  266

Query  1181  igvliggviagaaLMVSVGLICCIIRRRLAMKNWNRRRRELRETTG-ITIPVYSYKDIEK  1005
               VLIGG + GA+LMV++G +CC  RRR  ++     +R   ETT   ++P+YSYKDIE+
Sbjct  267   FIVLIGGFVLGASLMVTLGSVCCFFRRRTKLRVTKSTKRRFTETTNNYSVPIYSYKDIER  326

Query  1004  ATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIKLLSSVNHP  825
             AT++FS+K+RLG GAYGTVY+GKL+ NDE+VAIKRI+HRD +SIEQV NEIKL+SSV+HP
Sbjct  327   ATHSFSEKQRLGTGAYGTVYAGKLY-NDEYVAIKRIKHRDNESIEQVMNEIKLISSVSHP  385

Query  824   NLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVSETSQAIAYLHN  645
             NLVRLLGCSIE GEQILVYEFMPNGTLSQHLQRE+G+GL WPVRL I +ET+QAI++LH+
Sbjct  386   NLVRLLGCSIEYGEQILVYEFMPNGTLSQHLQRERGNGLSWPVRLKIATETAQAISHLHS  445

Query  644   AMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLI-ESSHISTAPQGTPGYLDPQYHQ  468
              ++PPIYHRD+KSSNILLD N+ SKVADFGLSR G++ E SH+STAPQGTPGY+DPQYHQ
Sbjct  446   EINPPIYHRDIKSSNILLDNNFGSKVADFGLSRLGILTEISHVSTAPQGTPGYVDPQYHQ  505

Query  467   DFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLEIIDPLI-  291
             DFHLSDKSDVYSFGVVLVEIITGLK VDF+RP NEVNLA+L +DKI KG L++IIDP+  
Sbjct  506   DFHLSDKSDVYSFGVVLVEIITGLKVVDFSRPHNEVNLASLFIDKIRKGLLVDIIDPIFL  565

Query  290   --EAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKW-GIsedsiit  120
               +   D WTLSS++KVAE+AF CLAFHRDMRP M EVA ELEQ+RLSKW  + E++   
Sbjct  566   DPQVTNDEWTLSSIHKVAEVAFTCLAFHRDMRPCMTEVATELEQLRLSKWKSVDENNCFV  625

Query  119   assssssrsssdasEKPLSFST--------------------MKPSEKVTESSPVSVQD  3
             +   SS  SSS  SEKPLS +T                    +K  +++  SSPVSVQD
Sbjct  626   SIELSSCSSSSSESEKPLSNTTLKNVGPKGKGLIKLDTGPVSLKSVDRLNSSSPVSVQD  684



>gb|KDP31840.1| hypothetical protein JCGZ_12301 [Jatropha curcas]
Length=698

 Score =   722 bits (1864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/611 (60%), Positives = 461/611 (75%), Gaps = 22/611 (4%)
 Frame = -3

Query  1931  LILLLLQSAMVFGSST------CNRSCGDG--LKQLPFPFGFSSGCEILLNCT-SNGTMS  1779
             L+L++L S  +   S       C  SCG G   K++P PFGFS GC+I LNC    G + 
Sbjct  8     LVLIILTSIFLRAHSHHNSSIPCQNSCGIGNSTKRVPHPFGFSDGCKIRLNCNRETGDVK  67

Query  1778  IGEFPVYQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIP  1599
             IGEF V  +TP  I I +PAKC R +E+++ LFG N+AP   NG+LLQNC+S    C+IP
Sbjct  68    IGEFIVQNITPSGIFIYLPAKCNRSLESIESLFGHNYAPAWRNGLLLQNCNSSLSTCVIP  127

Query  1598  STMIQTQFELQDCG--KDNISCFSEPHMTGGFIGYENLTGTGCKSLFSAISSPAAAANTT  1425
             ++    Q  +Q+C    DNISC+S        + Y NL+ T CK +FS+    A  +N+ 
Sbjct  128   TSSFSDQLPIQNCDAKSDNISCYSRERSGMDVLNYGNLSSTHCKFVFSSF---AIGSNSR  184

Query  1424  AVSLDIQVIELGWWLQGHCR---CSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGS  1254
              +SL+ + +EL WWL+G C    CS N +C +++    GK GFRC+C++G+TGDG++ G 
Sbjct  185   VISLEFERVELDWWLEGFCNNDSCSHNGNCTSVKY-DHGKVGFRCRCNDGYTGDGFKDGE  243

Query  1253  GCRRDDTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRR-LAMKNWN  1077
             GCR   + CNP+KY+ G+CGG  R+GVL+GGVIAGA LM  +  +C  IRRR  +++N  
Sbjct  244   GCR-SVSGCNPSKYINGQCGGTARVGVLVGGVIAGALLMCGLAFMCYFIRRRSTSLRNRL  302

Query  1076  RRRRELRETTG-ITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKR  900
               RR L +T G  ++P Y++K+IEKATN FS+K+RLG GAYGTVY+GKLH +DEWVAIK+
Sbjct  303   SARRLLYQTAGNSSVPFYAFKEIEKATNGFSEKQRLGTGAYGTVYAGKLH-SDEWVAIKK  361

Query  899   IRHRDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREK  720
             IRHRDTDSI+QV NEIKLLSSV+HPNLVRLLGC IE+GE ILVYEFMPNGTL +HLQRE+
Sbjct  362   IRHRDTDSIDQVMNEIKLLSSVSHPNLVRLLGCCIEEGEPILVYEFMPNGTLCEHLQRER  421

Query  719   GSGLPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFG  540
             G GLPW +RL I +ET+ AIAYLH+ M+PPIYHRD+KSSNILLDYNYKSKVADFGLSR G
Sbjct  422   GKGLPWTIRLTIAAETANAIAYLHSVMNPPIYHRDIKSSNILLDYNYKSKVADFGLSRLG  481

Query  539   LIESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEV  360
             + ESSHISTAPQGTPGYLDPQYHQ FHLSDKSDVYSFGVVLVEIIT L+ VDF+RP +EV
Sbjct  482   MTESSHISTAPQGTPGYLDPQYHQYFHLSDKSDVYSFGVVLVEIITALRVVDFSRPHSEV  541

Query  359   NLAALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVA  180
             NLAALA+D+IG+G + EIIDP ++  +D WTLSS++ VAE+AFRCLAFHRDMRPSMMEVA
Sbjct  542   NLAALAIDRIGRGCVDEIIDPHLDPHRDAWTLSSIHNVAELAFRCLAFHRDMRPSMMEVA  601

Query  179   IELEQMRLSKW  147
              ELE +RLS W
Sbjct  602   EELEHIRLSAW  612



>ref|XP_004291924.1| PREDICTED: wall-associated receptor kinase-like 14-like [Fragaria 
vesca subsp. vesca]
Length=704

 Score =   722 bits (1863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/608 (60%), Positives = 462/608 (76%), Gaps = 16/608 (3%)
 Frame = -3

Query  1934  VLILLLLQSAMVFGSSTCNRSCGD----GLKQLPFPFGFSSGCEILLNCTSNGTMSIGEF  1767
              ++LL++         +CNRSC +    G  +LP+PFG S+GCEI LNC+  G   IGEF
Sbjct  13    AILLLIVDRTNALTHQSCNRSCPNPASFGRDRLPYPFGCSAGCEIQLNCSKAGIF-IGEF  71

Query  1766  PVYQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELK--CMIPST  1593
             P+  +  ++I IN+ ++C R    +  L+  N APTS N ILL+NC+  ++   C+IPS 
Sbjct  72    PIQSINYESIRINLQSRCDRPSHTLHQLYSNNHAPTSRNAILLRNCTDEQVSSSCVIPSI  131

Query  1592  MIQTQFEL-QDCGKD-NISCFSEPHMTGGFIGYENLTGTGCKSLFSAISSPAAAANTTAV  1419
              ++ +F+  QDC  + +++C++E      F+ Y ++   GCK L S+IS+    ++T  V
Sbjct  132   NVEARFQAPQDCKTNKSLTCYAEGEKNATFLEYGSVEKKGCKYLLSSISAQILNSSTQVV  191

Query  1418  ---SLDIQVIELGWWLQGHCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGC  1248
                +LD++V EL WWL G C C K+A C  + TP +G  G+RC C++GF GDG++ G GC
Sbjct  192   PLVTLDVEVAELLWWLPGVCNCDKHAKCIPVLTP-NGTDGYRCNCTKGFIGDGFRDGFGC  250

Query  1247  RRDDTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAMKNWNRRR  1068
             R+D   CNPAK+L G+CGGKTRI VLIGGV+ GA LM+S+GL+CC IRR+  +K  +  +
Sbjct  251   RKDSQDCNPAKFLSGQCGGKTRIIVLIGGVVLGALLMISLGLLCCFIRRQSKLKARHSTK  310

Query  1067  RELRETTG-ITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRH  891
             R L E TG   IP+Y YK+IEKATN FSDK+RLG GAYGTVY+GKL   DEWVAIK+I++
Sbjct  311   RLLSEATGNCNIPIYPYKEIEKATNGFSDKQRLGTGAYGTVYAGKLQA-DEWVAIKKIKN  369

Query  890   RDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSG  711
             RD D+IEQV NEI+L+SSV HPNLVRLLGCSIE+G+QILVYEFM NGTL QHLQRE+G G
Sbjct  370   RD-DTIEQVMNEIRLISSVRHPNLVRLLGCSIERGQQILVYEFMANGTLCQHLQRERGDG  428

Query  710   LPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIE  531
             L WP+RL I +ET+QAIA+LH+A+ PPIYHRD+KSSNILLD N+KSKVADFGLSR G+ E
Sbjct  429   LSWPIRLTIATETAQAIAHLHSAIKPPIYHRDIKSSNILLDCNFKSKVADFGLSRLGIAE  488

Query  530   SSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLA  351
             +SHISTAPQGTPGYLDPQYHQ+FHLSDKSDVYSFGVVLVEIITGLKAVDF+RPQNEVNLA
Sbjct  489   TSHISTAPQGTPGYLDPQYHQNFHLSDKSDVYSFGVVLVEIITGLKAVDFSRPQNEVNLA  548

Query  350   ALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIEL  171
             ALA  KIGKG L EIIDP +E  +D WT SS++KVAE+AFRCLAFHRD RPSMMEV  EL
Sbjct  549   ALATVKIGKGCLNEIIDPSLEPFEDDWTASSIHKVAELAFRCLAFHRDARPSMMEVKAEL  608

Query  170   EQMRLSKW  147
             E ++LS+W
Sbjct  609   EDIKLSRW  616



>ref|XP_011017268.1| PREDICTED: wall-associated receptor kinase-like 14 isoform X1 
[Populus euphratica]
Length=687

 Score =   720 bits (1859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/581 (62%), Positives = 437/581 (75%), Gaps = 10/581 (2%)
 Frame = -3

Query  1883  CNRSCGDGLKQLPFPFGFSSGCEILLNCTSNGTMSIGEFPVYQLTPDTIMINIPAKCGRR  1704
             CNR+CG     LP+PFGFS+ C+I LNC+ NG M I EFPV  +  ++I I +  KC R 
Sbjct  29    CNRTCGTN--HLPYPFGFSADCDIRLNCSPNGEMLINEFPVQIVGLNSIKIILEPKCNRP  86

Query  1703  IEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMIQTQFELQDCGKDN-ISCFSEP  1527
             +EA+  LF K++AP S N ILL NC+S    C IPS  +QT FE   C  ++ +SCFS+ 
Sbjct  87    LEALDNLFTKHYAPKSTNAILLHNCTSAVSPCNIPSINVQTHFESLKCSNNSSLSCFSKE  146

Query  1526  HMTGGFIGYENLTGTGCKSLFSAISSPAAAANTTAVSLDIQVIELGWWLQGHCRCSKNAD  1347
                 GF  Y     + C+ L S+IS  A +   + VSL+IQ++EL WWLQG CRCSK+A 
Sbjct  147   VTANGFFDYNMANISQCQYLLSSIS--AESFTGSGVSLEIQMMELWWWLQGDCRCSKDAI  204

Query  1346  CNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTRCNPAKYLLGECGGKTRigvli  1167
             C  + +P     GFRCQC +G  GDGY  G GCR+    CNPAKYL G+CGG +   VL+
Sbjct  205   CTQVESPAGS--GFRCQCRDGLIGDGYLAGVGCRKASAGCNPAKYLSGQCGGGSGAAVLL  262

Query  1166  ggviagaaLMVSVGLICCIIRRRLAMKNWNRRRRELRETTGITIPVYSYKDIEKATNNFS  987
             GGV+AG    VS+GL CCIIRR    K    R+  L E   I IP+Y YK+IEKATN+FS
Sbjct  263   GGVVAGV--GVSLGLFCCIIRRNSESKAKRFRKLHLAEAADINIPIYPYKEIEKATNSFS  320

Query  986   DKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIKLLSSVNHPNLVRLL  807
             +K+R+G GAYGTVY+GKL ++D WVAIKRI+H D D+IEQV NEIKL+SSV+HPNLVRLL
Sbjct  321   EKQRIGTGAYGTVYAGKL-NSDSWVAIKRIKHGDMDNIEQVMNEIKLISSVSHPNLVRLL  379

Query  806   GCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVSETSQAIAYLHNAMHPPI  627
             GCSIE GEQILVYEFMPNGTL QHLQRE+G GL WPVRL I ++T++AIA+LH+AM PPI
Sbjct  380   GCSIENGEQILVYEFMPNGTLCQHLQRERGDGLDWPVRLAIATDTAKAIAHLHSAMDPPI  439

Query  626   YHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGTPGYLDPQYHQDFHLSDK  447
             YHRD+KSSNILLDY+++SKVADFGLSR G+ E SHIST PQGTPGYLDPQYH +FHLSDK
Sbjct  440   YHRDIKSSNILLDYHFRSKVADFGLSRHGMTEISHISTVPQGTPGYLDPQYHLNFHLSDK  499

Query  446   SDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLEIIDPLIEAEKDVWT  267
             SDVYSFGVVLVEIIT  K VDF+RPQNEVNLAA+A D+IG+G L EIIDP ++   D WT
Sbjct  500   SDVYSFGVVLVEIITAKKVVDFSRPQNEVNLAAIATDRIGRGRLDEIIDPFLDLHSDAWT  559

Query  266   LSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKWG  144
              SSV+KVAE+AFRCLAFH+DMRPSMMEVA ELEQ+ LS+W 
Sbjct  560   FSSVHKVAEVAFRCLAFHKDMRPSMMEVATELEQVLLSRWA  600



>ref|XP_006473409.1| PREDICTED: wall-associated receptor kinase-like 14-like [Citrus 
sinensis]
Length=674

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/665 (58%), Positives = 473/665 (71%), Gaps = 40/665 (6%)
 Frame = -3

Query  1943  MIPVLILLLLQSAMVFGSSTCNRSCGDGLKQLPFPFGFSSGCEILLNCTS---NGTMSIG  1773
              +P+LI+  L +    G   CNR+CG G  Q+P+PFGFS+GC I LNC+S   N  +SIG
Sbjct  10    FLPILIIFPLITGTTHG---CNRACGRGTNQVPYPFGFSTGCPIRLNCSSSSNNAQISIG  66

Query  1772  EFPVYQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELK-CMIPS  1596
             EFP+  +  D I I +   C R I+ +  LFG N+APTS NGILL +C+S ++  C IPS
Sbjct  67    EFPIQTMESDRIKIIMEPICNRSIQTLHQLFGPNYAPTSRNGILLSSCNSSKVAACKIPS  126

Query  1595  TMIQTQFELQDCGKDNISCFS----EPHMTGGFIGYENLTGTGCKSLFSAISS-----PA  1443
               ++TQF    C   + S       E      FI YEN T   CK L SAISS      A
Sbjct  127   IDVRTQFNSIKCDSSSNSSSISCYSEEKNDREFIDYENATTQQCKFLLSAISSELFNTSA  186

Query  1442  AAANTTAVSLDIQVIELGWWLQGHCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQ  1263
             A+ N +AVSLD++V+E+GWWL G C CS+NA+C  + TP  G+ GFRC C++GF GDGY 
Sbjct  187   ASINISAVSLDVKVLEVGWWLNGPCHCSQNANCTPVLTP-HGR-GFRCGCNKGFEGDGYP  244

Query  1262  GGSGCRRDDTRCNPAKYLLGECGGKTRigvliggviagaaLMV-SVGLICCIIRRRLAMK  1086
              GSGCR+    CN AKY+ G+CGG+TRI VLI G     A ++ S+ L+CC++RRR   +
Sbjct  245   AGSGCRK--ASCNAAKYISGQCGGRTRIAVLIIGGSTAGASLIISMRLLCCLMRRRSYYR  302

Query  1085  NWNRRRRELRETTGIT-IPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVA  909
                  +R L+E  GI+ IP+Y Y++IEKAT  FS+K+RLG GA+GTVY+GKL  ND  VA
Sbjct  303   ARKSTKRCLKEARGISNIPIYPYREIEKATIGFSEKQRLGTGAFGTVYAGKLQ-NDLLVA  361

Query  908   IKRIRHRDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQ  729
             IKRI+HRDTD I+QV NEIKL+S V+HPNLVRLLGCSIE+GEQILVYEFMPNGTL QHLQ
Sbjct  362   IKRIKHRDTDGIQQVVNEIKLISCVSHPNLVRLLGCSIERGEQILVYEFMPNGTLCQHLQ  421

Query  728   REKGSGLPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLS  549
             RE+G GL WP+RL +  ET+QAIA+LH+A++PPIYHRD+KSSNILLDYN+KSKVADFGLS
Sbjct  422   RERGDGLSWPIRLTVAMETAQAIAHLHSAINPPIYHRDIKSSNILLDYNFKSKVADFGLS  481

Query  548   RFGLIESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQ  369
             R G+ E SHISTAPQGTPGYLDPQYHQ+FHLSDKSDVYSFGVVLVEIIT LK VDF+RP 
Sbjct  482   RLGMTEISHISTAPQGTPGYLDPQYHQNFHLSDKSDVYSFGVVLVEIITALKVVDFSRPP  541

Query  368   NEVNLAALAVDKIGKGGLLEIIDPLI---EAEKDVWTLSSVNKVAEIAFRCLAFHRDMRP  198
             NEVNLAALA D+I KG L EIIDPLI       D  TL+SV+KVAE+AFRCLAFHRDMRP
Sbjct  542   NEVNLAALAADRISKGRLDEIIDPLIIEHRGHSDAGTLASVHKVAELAFRCLAFHRDMRP  601

Query  197   SMMEVAIELEQMRLSKWGIsedsiitassssssrsssdasEKPLSFSTMKPSEKVTESSP  18
             SM EVA ELE +R              + +    + + + E  L  S+   SE++ ++SP
Sbjct  602   SMTEVATELEHIR--------------TRTMEDINCTASLEASLCSSSYNASERMKDNSP  647

Query  17    VSVQD  3
              SVQD
Sbjct  648   PSVQD  652



>ref|XP_008220730.1| PREDICTED: wall-associated receptor kinase-like 14 [Prunus mume]
Length=707

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/608 (60%), Positives = 454/608 (75%), Gaps = 13/608 (2%)
 Frame = -3

Query  1940  IPVLILLLLQSAMVFGSSTCNRSC-GDGLKQLPFPFGFSSGCEILLNCTSNGTMSIGEFP  1764
             I  L +L+  ++     S CNRSC G G + + +PFGFS GCEI L CT +  + IGEFP
Sbjct  14    IFALSVLIANTSHASIPSPCNRSCPGVGTEPVQYPFGFSPGCEIRLKCTPHTGIFIGEFP  73

Query  1763  VYQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCS--SPELKCMIPSTM  1590
             +  +TPD+I + + ++C R +  ++ L+   +APTS N ILLQNC+   P   C IP+ +
Sbjct  74    IQTITPDSIRVTLQSRCNRPLRTLRQLYSPRYAPTSRNAILLQNCTDGQPSSSCEIPNIL  133

Query  1589  IQTQFEL--QDCGKDNISCFSEPHMTGGFIGYENLTGTGCKSLFSAIS-SPAAAANTTAV  1419
             +Q +F+         ++SC++E      F+ +E +    CK L S+IS SP    N++A 
Sbjct  134   VQARFDAPPNCSSNSSLSCYAETGKDVRFLDFEKVERRDCKFLLSSISASPPQLLNSSAA  193

Query  1418  S---LDIQVIELGWWLQGHCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGC  1248
                 L+++V+ELGWWL+G C C KNA+C T+ +P +G  GF C+C+ G  GDGY  GSGC
Sbjct  194   PPLFLEVEVVELGWWLEGTCGCHKNANCTTVVSP-NGTQGFTCKCNNGLLGDGYVAGSGC  252

Query  1247  RRDDTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAMKNWNRRR  1068
              +    CNPAKYL G+CGGKTR  VLIG V  GA+LM+S+ LICC IRR+  +K     +
Sbjct  253   WKGSLVCNPAKYLSGQCGGKTRFIVLIGAVFVGASLMISLALICCFIRRQSKLKARLCTK  312

Query  1067  RELRETTG-ITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRH  891
             R L E TG   IP Y YK+IEKATN FS+K+RLG GAYGTVY+GKLHD  EWVAIKRI+H
Sbjct  313   RLLSEATGNCNIPFYPYKEIEKATNGFSEKQRLGTGAYGTVYAGKLHD--EWVAIKRIKH  370

Query  890   RDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSG  711
             R  DSIEQV NEI+L+SSV H NLVRLLGCSIE+GEQILVYEFM NGTL QHLQRE+G+G
Sbjct  371   RGNDSIEQVMNEIRLISSVRHQNLVRLLGCSIERGEQILVYEFMANGTLCQHLQRERGAG  430

Query  710   LPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIE  531
             L WP+RL I ++T+QAIA+LH+A+ PPIYHRD+KSSNILLD N+K+K+ADFGLSR G+ E
Sbjct  431   LSWPIRLTIATQTAQAIAHLHSAVKPPIYHRDIKSSNILLDCNFKAKLADFGLSRLGMAE  490

Query  530   SSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLA  351
             SSHISTAPQGTPGYLDPQYHQ+FHLSDKSDVYSFGVVLVEIITGLKAVDF RPQNEVNLA
Sbjct  491   SSHISTAPQGTPGYLDPQYHQNFHLSDKSDVYSFGVVLVEIITGLKAVDFNRPQNEVNLA  550

Query  350   ALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIEL  171
             ALA D+IG+G L EIIDP +E   D WTL SV+KV E+AFRCLAFHRDMRPSMMEV  EL
Sbjct  551   ALATDRIGRGCLNEIIDPFLEPHMDAWTLLSVHKVGELAFRCLAFHRDMRPSMMEVTAEL  610

Query  170   EQMRLSKW  147
             E ++LS+W
Sbjct  611   ELIKLSRW  618



>gb|AES73970.2| wall associated kinase-like protein [Medicago truncatula]
Length=727

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/595 (61%), Positives = 448/595 (75%), Gaps = 19/595 (3%)
 Frame = -3

Query  1883  CNRSCGDGLKQLPFPFGFSSGCEILLNCTSNGTMSIGEFPVYQLTPDTIMINIPAKCGRR  1704
             C++SCG   K  P+PFGFSSGCEI LNCT +G + IGEFPV  +  ++I++NI ++C R 
Sbjct  30    CHQSCGSH-KPFPYPFGFSSGCEIRLNCTVDGEIFIGEFPVQSVNSNSIIVNIESQCNRS  88

Query  1703  IEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMIQTQFELQD-----CGKDNISC  1539
              +    LF    APTS N ILLQNC+   L C IP T++ +QFE +       G   +SC
Sbjct  89    FDTFHQLFSHKHAPTSGNVILLQNCTENLLPCSIPETLLPSQFESESDGCGGAGSGKLSC  148

Query  1538  FSEPHMTGGFIGYENLTGTGCKSLFSAIS-SPAAAANTTAVSLDIQVIELGWWLQG-HCR  1365
             + E + T  F+    L   GCK   S+IS      ++ +A+SL++  IELGWW+ G  C 
Sbjct  149   YFE-NTTSRFVNETKLERIGCKYFMSSISIEDLRKSSDSAISLEVATIELGWWIHGDQCL  207

Query  1364  CSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRD-DTRCNPAKYLLGECGGK  1188
             CS +A+C  + +P D KPGFRCQC E F GDG+  G+GCR+   + CNPAKY+ G CGG 
Sbjct  208   CSDHANCTKIVSPIDRKPGFRCQCDEEFVGDGFLAGTGCRKKASSTCNPAKYMSGRCGGT  267

Query  1187  TRigvliggviagaaLMVSVGLICCIIRRRLAMKNWNRRRRELRETTG-ITIPVYSYKDI  1011
             TR  VLIGG + G +LM+++  +CC  RRR  ++     +R   ETT   ++P+Y YKDI
Sbjct  268   TRFIVLIGGFVFGVSLMITLASVCCYFRRRTKLRVTKSTKRRFTETTNNYSVPIYPYKDI  327

Query  1010  EKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIKLLSSVN  831
             EKATN+FS+K+RLG GAYGTVYSGKL+ NDE+VAIKRI+HRD +SIEQV NEIKL+SSV+
Sbjct  328   EKATNSFSEKQRLGTGAYGTVYSGKLY-NDEYVAIKRIKHRDNESIEQVMNEIKLISSVS  386

Query  830   HPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVSETSQAIAYL  651
             HPNLVRLLGCSIE GEQILVYEFM NGTL+QHLQRE G+GL WPVRL I +ET+QAI++L
Sbjct  387   HPNLVRLLGCSIEYGEQILVYEFMSNGTLNQHLQRETGNGLSWPVRLKIATETAQAISHL  446

Query  650   HNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIE---SSHISTAPQGTPGYLDP  480
             H+A+ PPIYHRD+KSSNILLD N+ SKVADFGLSR G+ E   +SH+STAPQGTPGY+DP
Sbjct  447   HSAIDPPIYHRDIKSSNILLDQNFGSKVADFGLSRLGITEISHASHVSTAPQGTPGYVDP  506

Query  479   QYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLEIID  300
             QYHQD+HLSDKSDVYSFGVVLVEIITGLK VDF+RP NEVNLA+LAVD+I KG L +IID
Sbjct  507   QYHQDYHLSDKSDVYSFGVVLVEIITGLKVVDFSRPHNEVNLASLAVDRIRKGLLDDIID  566

Query  299   PLI----EAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKW  147
             P+I    +A  + WTLSS++KVAE+AFRCLAFHRDMRP M EVA ELEQ+RL+KW
Sbjct  567   PIIFLHSQATSEGWTLSSIHKVAELAFRCLAFHRDMRPCMTEVATELEQLRLNKW  621



>ref|XP_009376468.1| PREDICTED: wall-associated receptor kinase-like 14 [Pyrus x bretschneideri]
Length=706

 Score =   717 bits (1851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/609 (59%), Positives = 461/609 (76%), Gaps = 14/609 (2%)
 Frame = -3

Query  1943  MIPVLILLLLQSAMVFG--SSTCNRSCGDG--LKQLPFPFGFSSGCEILLNCTSNGTMSI  1776
             ++ VL L +  +A+     SS+C  +CG G   K + +PFGFS  CEI LNC     ++I
Sbjct  16    VVSVLTLSISIAAIAKAQNSSSCIPTCGSGKSAKIVRYPFGFSPSCEIPLNCYDKNEITI  75

Query  1775  GEFPVYQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPS  1596
             G F V ++TP+ I +N+PAKC RR+E++  LFG NF+PT NN +LLQNCS+P+  C+IP+
Sbjct  76    GNFRVQKVTPNGIFVNLPAKCNRRVESVTILFGSNFSPTWNNSLLLQNCSAPQNGCLIPA  135

Query  1595  TMIQTQFELQDC--GKDNISCFSEPHMTGGFIGYENLTGTGCKSLFSAISSPAAAANTTA  1422
               +Q QF L+ C    DNISC S+PH     I  ++LT TGCK+LF + +    +     
Sbjct  136   NFVQKQFNLESCRSSADNISCLSQPHNQSEVIRIKDLTRTGCKNLFGSFA--VQSGGEWP  193

Query  1421  VSLDIQVIELGWWLQGHCRCSKNADCNTMRTPGDGKP-GFRCQCSEGFTGDGYQGGSGCR  1245
             +SL+ + +ELGWW++G C C  NA C T++  GDG P G+RC+C++GF GDG+  G GCR
Sbjct  194   LSLEFETVELGWWVRGPCDCDANATCTTVKF-GDGMPEGYRCRCNDGFDGDGFNLGRGCR  252

Query  1244  RDDTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRR-LAMKNWNRRR  1068
             R  + CNP+KY+ G CGG TR+GVLIGGVIAGA LM  + L+C   +RR   ++N    R
Sbjct  253   RV-SECNPSKYMSGRCGGTTRVGVLIGGVIAGAFLMAGLFLLCYFFQRRSTCLRNQTSAR  311

Query  1067  RELRETTGIT-IPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRH  891
             R L E  G + + ++ YK+IE+ TN F++++RLG GA+GTVY+GKLH NDEWVAIK+I  
Sbjct  312   RLLSEAAGNSNVSLFPYKEIERGTNCFAEEQRLGTGAFGTVYAGKLH-NDEWVAIKKINR  370

Query  890   RDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSG  711
             RDT+ I+QV NEIKLLSSV+HPNLVRLLGC IE GEQILVYE+MPNGTLS+HLQ+E+G G
Sbjct  371   RDTNGIDQVMNEIKLLSSVSHPNLVRLLGCCIEGGEQILVYEYMPNGTLSEHLQQERGQG  430

Query  710   LPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIE  531
              PW +RL I SET+ AIAYLH+ M+PPIYHRD+KS+NILLDYNYKSKVADFGLSR G+ E
Sbjct  431   FPWTIRLTIASETANAIAYLHSEMNPPIYHRDIKSTNILLDYNYKSKVADFGLSRLGMTE  490

Query  530   SSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLA  351
             SS+ISTAPQGTPGY+DPQYHQ+FHLSDKSDVYSFGVVLVEIIT +K VDF RPQ EVNLA
Sbjct  491   SSYISTAPQGTPGYVDPQYHQNFHLSDKSDVYSFGVVLVEIITAMKVVDFARPQCEVNLA  550

Query  350   ALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIEL  171
             ALA+D+IGKG + +I+DP +E ++D WTL S+NK AE+AFRCLAFH DMRPSM EVA EL
Sbjct  551   ALAIDRIGKGCVDKIVDPFLEQDRDAWTLYSINKAAELAFRCLAFHSDMRPSMTEVAEEL  610

Query  170   EQMRLSKWG  144
             + ++ S+W 
Sbjct  611   QNIQRSEWA  619



>ref|XP_009341914.1| PREDICTED: wall-associated receptor kinase-like 14 [Pyrus x bretschneideri]
Length=706

 Score =   717 bits (1851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/609 (59%), Positives = 460/609 (76%), Gaps = 14/609 (2%)
 Frame = -3

Query  1943  MIPVLILLLLQSAMVFG--SSTCNRSCGDG--LKQLPFPFGFSSGCEILLNCTSNGTMSI  1776
             ++ VL L +  +A+     SS+C  +CG G   K + +PFGFS  CEI LNC     +++
Sbjct  16    VVSVLTLSISIAAIAKAQNSSSCIPTCGSGKSAKTVRYPFGFSPSCEIPLNCYDKNEITL  75

Query  1775  GEFPVYQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPS  1596
             G+F V ++TP+ I +N+PAKC RR+E++  LFG NF+PT NN +LLQNCS+P+  C+IP+
Sbjct  76    GDFRVQKVTPNGIFVNLPAKCNRRVESVTRLFGSNFSPTWNNSLLLQNCSAPQNGCLIPA  135

Query  1595  TMIQTQFELQDC--GKDNISCFSEPHMTGGFIGYENLTGTGCKSLFSAISSPAAAANTTA  1422
               +Q QF L+ C    DNISC S+PH     I  ++LT TGCK+LF + +    +     
Sbjct  136   NFVQKQFNLESCRSSADNISCLSQPHNQSEVIRIKDLTRTGCKNLFGSFA--VQSGGEWP  193

Query  1421  VSLDIQVIELGWWLQGHCRCSKNADCNTMRTPGDGKP-GFRCQCSEGFTGDGYQGGSGCR  1245
             +SL+ + +ELGWW+ G C C  NA C T++  GDG P G+RC+C++GF GDG+  G GCR
Sbjct  194   LSLEFETVELGWWVGGTCDCDANATCTTVKL-GDGMPEGYRCRCNDGFDGDGFNLGRGCR  252

Query  1244  RDDTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRR-LAMKNWNRRR  1068
             R  + CNP+KY+ G CGG TR+GVLIGGVIAGA LM  + L+C   +RR   ++N    R
Sbjct  253   RV-SECNPSKYMSGRCGGTTRVGVLIGGVIAGAFLMAGLFLLCYFFQRRSTCLRNQMSAR  311

Query  1067  RELRETTG-ITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRH  891
             R L E  G   + ++ YK+IE+ TN F++++RLG GA+GTVY+GKLH NDEWVAIK+I  
Sbjct  312   RLLSEAAGNANVSLFPYKEIERGTNCFAEEQRLGTGAFGTVYAGKLH-NDEWVAIKKINR  370

Query  890   RDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSG  711
             RDT+ I+QV NEIKLLS V+HPNLVRLLGC IE GEQILVYE+MPNGTLS+HLQ+E+G G
Sbjct  371   RDTNGIDQVMNEIKLLSCVSHPNLVRLLGCCIEGGEQILVYEYMPNGTLSEHLQQERGQG  430

Query  710   LPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIE  531
             LPW +RL I SET+ AIAYLH+ M+PPIYHRD+KS+NILLDYNYKSKVADFGLSR G+ E
Sbjct  431   LPWTIRLTIASETANAIAYLHSEMNPPIYHRDIKSTNILLDYNYKSKVADFGLSRLGMTE  490

Query  530   SSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLA  351
             SS+ISTAPQGTPGY+DPQYHQ+FHLSDKSDVYSFGVVLVEIIT +K VDF RPQ EVNLA
Sbjct  491   SSYISTAPQGTPGYVDPQYHQNFHLSDKSDVYSFGVVLVEIITAMKVVDFARPQCEVNLA  550

Query  350   ALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIEL  171
             ALA+D+IGKG +  I+DP +E ++D WTL SVNKVAE+AFRCLAFH DMRPSM EVA EL
Sbjct  551   ALAIDRIGKGCVDNIVDPFLEPDRDAWTLYSVNKVAELAFRCLAFHSDMRPSMTEVAEEL  610

Query  170   EQMRLSKWG  144
             + ++ S+W 
Sbjct  611   QNIQCSEWA  619



>ref|XP_011031029.1| PREDICTED: wall-associated receptor kinase-like 14 isoform X1 
[Populus euphratica]
 ref|XP_011031039.1| PREDICTED: wall-associated receptor kinase-like 14 isoform X2 
[Populus euphratica]
 ref|XP_011031047.1| PREDICTED: wall-associated receptor kinase-like 14 isoform X3 
[Populus euphratica]
Length=686

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/601 (59%), Positives = 444/601 (74%), Gaps = 15/601 (2%)
 Frame = -3

Query  1934  VLILLLLQSAMVFGSST----CNRSCGDGLKQLPFPFGFSSGCEILLNCTSNGTMSIGEF  1767
             +L L +   +++ G ++    CNR+CG     LP+PFGFS+ C+I LNC+ NG M I EF
Sbjct  8     ILFLAIFVISLIGGHASIKFSCNRTCGPS--HLPYPFGFSANCDIHLNCSLNGEMLINEF  65

Query  1766  PVYQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMI  1587
             PV  +  DTI IN+  +C R +EA+  L  KN+AP S N ILL NC+S    C IPS  +
Sbjct  66    PVQIVGQDTIKINLEPRCDRPVEALYNLSTKNYAPKSTNAILLNNCTSGFSPCNIPSISV  125

Query  1586  QTQFELQDCGKDN-ISCFSEPHMTGGFIGYENLTGTGCKSLFSAISSPAAAANTTAVSLD  1410
             +T FE  +C  ++ +SCFS+   T GF  Y     + CK L S+IS  A +   + VSL+
Sbjct  126   RTHFESLNCSNNSSVSCFSKADTTNGFFDYNMANISQCKYLLSSIS--AESFTGSGVSLE  183

Query  1409  IQVIELGWWLQGHCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTR  1230
              Q++EL WWLQG CRCSK+A C  + +P     GFRCQC +G  GDGY  G GCR+    
Sbjct  184   TQMMELWWWLQGDCRCSKDAICTKVESPAGS--GFRCQCRDGLIGDGYLAGVGCRKA-AG  240

Query  1229  CNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAMKNWNRRRRELRET  1050
             CNPAKYL G+CG   R  VL+GG++A     V +GL CC+ RR    K  + R+    E 
Sbjct  241   CNPAKYLSGQCGAGARPAVLLGGIVAAVG--VGLGLFCCLARRNSISKAKSFRKLHRAEA  298

Query  1049  TGITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIE  870
               I+IP+Y YK+IEKATNNFS+K+R+G GAYGTVY+GKL  +D WVAIKRI+HRD DSIE
Sbjct  299   ADISIPIYPYKEIEKATNNFSEKQRIGTGAYGTVYAGKL-SSDSWVAIKRIKHRDVDSIE  357

Query  869   QVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRL  690
             QV NEIKL+SSV+HPNLVRLLGCSIE  EQILVYEFMPNGTL QHLQR +G GL WPVRL
Sbjct  358   QVINEIKLISSVSHPNLVRLLGCSIENDEQILVYEFMPNGTLCQHLQRVRGDGLDWPVRL  417

Query  689   GIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTA  510
              I +ET++AIA+LH+A+ PPIYHRD+KSSNILLD+ +KSKVADFGLSR G+ + SHIST 
Sbjct  418   AIATETAKAIAHLHSAIDPPIYHRDIKSSNILLDFEFKSKVADFGLSRHGMTDISHISTV  477

Query  509   PQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKI  330
             PQGTPGYLDPQYHQ+FHLSDK+DVYSFGVVL+EIIT  K +DF+RPQ+EVNLA+LA+DKI
Sbjct  478   PQGTPGYLDPQYHQNFHLSDKTDVYSFGVVLIEIITAKKVLDFSRPQDEVNLASLAIDKI  537

Query  329   GKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSK  150
             G+G L EIIDP ++   D WT SSV+KVAE+AFRCLAFH+D+RPSMMEVA ELEQ+ L++
Sbjct  538   GRGLLDEIIDPFLDLHSDAWTFSSVHKVAELAFRCLAFHKDIRPSMMEVAAELEQIMLTR  597

Query  149   W  147
             W
Sbjct  598   W  598



>ref|XP_008790198.1| PREDICTED: wall-associated receptor kinase-like 14 [Phoenix dactylifera]
Length=684

 Score =   716 bits (1847),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/590 (60%), Positives = 450/590 (76%), Gaps = 9/590 (2%)
 Frame = -3

Query  1901  VFGSSTCNRSCGDGLKQLPFPFGFSSGCEILLNCT-SNGTMSIGEFPVYQLTPDTIMINI  1725
             +F S  C+R+CG     +PFPFGFS GCEI LNCT +   + +GEF V  +TPD +++++
Sbjct  25    LFSSPDCSRTCGS--ITVPFPFGFSEGCEITLNCTRARSEIRVGEFQVRNITPDILLVDV  82

Query  1724  PAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMIQTQFELQDCGKDNI  1545
             P +C R + A+  LFGKN+A TS NG+ L++C++   +C+IP++++  + +L  CG D+ 
Sbjct  83    PPRCDRPVHAVASLFGKNYALTSRNGLFLRHCTTSSSECLIPTSLLSRE-DLNSCG-DSA  140

Query  1544  SCFSEPHMTGGFIGYENLTGTGCKSLFSAI--SSPAAAANTTAVSLDIQVIELGWWLQGH  1371
              CFS+   TGGF+  +N+T  GC SLF++I       + +   + L +Q   + WW +G 
Sbjct  141   RCFSDVGSTGGFLAAKNITTAGCSSLFTSIGFEPELESQDPHMLPLVLQTAVVEWWREGG  200

Query  1370  CRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRR-DDTRCNPAKYLLGECG  1194
             CRCS +A C    +P  GKPGFRC+C  GF GDG+  G+ C +  D++CNP+KY+ G CG
Sbjct  201   CRCSPHAKCTNFTSPSTGKPGFRCKCLGGFQGDGFADGARCEKVTDSKCNPSKYISGSCG  260

Query  1193  GKTRigvliggviagaaLMVSVGLICCIIRRRLAMKNWNRRRRELRETTGITIPVYSYKD  1014
             G  R+ VLIGG++AGA +M  V L+C +IRRR +     +  + L      T+P+Y YKD
Sbjct  261   GTARVAVLIGGIVAGAFIMAGVVLVCYLIRRRSSFSRIRKSTKRLLSEASCTVPLYPYKD  320

Query  1013  IEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIKLLSSV  834
             IEKAT+ FS+ +RLG GAYGTVY+GKL  ND+ VAIK+I+HRD D I QV NEIKLLSSV
Sbjct  321   IEKATDAFSESQRLGTGAYGTVYAGKL-GNDKLVAIKKIKHRDADGIVQVMNEIKLLSSV  379

Query  833   NHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVSETSQAIAY  654
             +HPNLVRLLGC IE+GEQILVYEFMPNGTL+QHLQRE+G  LPW VRLGI +ET+QAIAY
Sbjct  380   SHPNLVRLLGCCIERGEQILVYEFMPNGTLAQHLQRERGPALPWTVRLGIAAETAQAIAY  439

Query  653   LHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGTPGYLDPQY  474
             LH+A+HPPIYHRD+KSSNILLD+NYKSKVADFGLSR  + ESSHISTAPQGTPGYLDPQY
Sbjct  440   LHSAIHPPIYHRDIKSSNILLDFNYKSKVADFGLSRIAMTESSHISTAPQGTPGYLDPQY  499

Query  473   HQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLEIIDPL  294
             HQ+FHLSDKSDVYSFGVVLVEIIT LKAVDF R Q+EVNLAALA+DKIG+G + EIIDP 
Sbjct  500   HQNFHLSDKSDVYSFGVVLVEIITALKAVDFNRVQSEVNLAALAIDKIGRGSVDEIIDPC  559

Query  293   IEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKWG  144
             ++  +D WTLSS++KVAE+AFRCLAFHRDMRPSM EVA ELEQ+RLS W 
Sbjct  560   LDPNRDAWTLSSIHKVAELAFRCLAFHRDMRPSMTEVADELEQIRLSGWA  609



>ref|XP_011017269.1| PREDICTED: wall-associated receptor kinase-like 14 isoform X2 
[Populus euphratica]
Length=684

 Score =   715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/581 (62%), Positives = 437/581 (75%), Gaps = 13/581 (2%)
 Frame = -3

Query  1883  CNRSCGDGLKQLPFPFGFSSGCEILLNCTSNGTMSIGEFPVYQLTPDTIMINIPAKCGRR  1704
             CNR+CG     LP+PFGFS+ C+I LNC+ NG M I EFPV  +  ++I I +  KC R 
Sbjct  29    CNRTCGTN--HLPYPFGFSADCDIRLNCSPNGEMLINEFPVQIVGLNSIKIILEPKCNRP  86

Query  1703  IEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMIQTQFELQDCGKDN-ISCFSEP  1527
             +EA+  LF K++AP S N ILL NC+S    C IPS  +QT FE   C  ++ +SCFS+ 
Sbjct  87    LEALDNLFTKHYAPKSTNAILLHNCTSAVSPCNIPSINVQTHFESLKCSNNSSLSCFSKE  146

Query  1526  HMTGGFIGYENLTGTGCKSLFSAISSPAAAANTTAVSLDIQVIELGWWLQGHCRCSKNAD  1347
                 GF  Y     + C+ L S+IS  A +   + VSL+IQ++EL WWLQG CRCSK+A 
Sbjct  147   VTANGFFDYNMANISQCQYLLSSIS--AESFTGSGVSLEIQMMELWWWLQGDCRCSKDAI  204

Query  1346  CNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTRCNPAKYLLGECGGKTRigvli  1167
             C  + +P     GFRCQC +G  GDGY  G GCR+    CNPAKYL G+CGG +   VL+
Sbjct  205   CTQVESPAGS--GFRCQCRDGLIGDGYLAGVGCRKG---CNPAKYLSGQCGGGSGAAVLL  259

Query  1166  ggviagaaLMVSVGLICCIIRRRLAMKNWNRRRRELRETTGITIPVYSYKDIEKATNNFS  987
             GGV+AG    VS+GL CCIIRR    K    R+  L E   I IP+Y YK+IEKATN+FS
Sbjct  260   GGVVAGV--GVSLGLFCCIIRRNSESKAKRFRKLHLAEAADINIPIYPYKEIEKATNSFS  317

Query  986   DKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIKLLSSVNHPNLVRLL  807
             +K+R+G GAYGTVY+GKL ++D WVAIKRI+H D D+IEQV NEIKL+SSV+HPNLVRLL
Sbjct  318   EKQRIGTGAYGTVYAGKL-NSDSWVAIKRIKHGDMDNIEQVMNEIKLISSVSHPNLVRLL  376

Query  806   GCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVSETSQAIAYLHNAMHPPI  627
             GCSIE GEQILVYEFMPNGTL QHLQRE+G GL WPVRL I ++T++AIA+LH+AM PPI
Sbjct  377   GCSIENGEQILVYEFMPNGTLCQHLQRERGDGLDWPVRLAIATDTAKAIAHLHSAMDPPI  436

Query  626   YHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGTPGYLDPQYHQDFHLSDK  447
             YHRD+KSSNILLDY+++SKVADFGLSR G+ E SHIST PQGTPGYLDPQYH +FHLSDK
Sbjct  437   YHRDIKSSNILLDYHFRSKVADFGLSRHGMTEISHISTVPQGTPGYLDPQYHLNFHLSDK  496

Query  446   SDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLEIIDPLIEAEKDVWT  267
             SDVYSFGVVLVEIIT  K VDF+RPQNEVNLAA+A D+IG+G L EIIDP ++   D WT
Sbjct  497   SDVYSFGVVLVEIITAKKVVDFSRPQNEVNLAAIATDRIGRGRLDEIIDPFLDLHSDAWT  556

Query  266   LSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKWG  144
              SSV+KVAE+AFRCLAFH+DMRPSMMEVA ELEQ+ LS+W 
Sbjct  557   FSSVHKVAEVAFRCLAFHKDMRPSMMEVATELEQVLLSRWA  597



>ref|XP_011031055.1| PREDICTED: wall-associated receptor kinase-like 14 isoform X4 
[Populus euphratica]
Length=684

 Score =   715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/601 (59%), Positives = 444/601 (74%), Gaps = 17/601 (3%)
 Frame = -3

Query  1934  VLILLLLQSAMVFGSST----CNRSCGDGLKQLPFPFGFSSGCEILLNCTSNGTMSIGEF  1767
             +L L +   +++ G ++    CNR+CG     LP+PFGFS+ C+I LNC+ NG M I EF
Sbjct  8     ILFLAIFVISLIGGHASIKFSCNRTCGPS--HLPYPFGFSANCDIHLNCSLNGEMLINEF  65

Query  1766  PVYQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMI  1587
             PV  +  DTI IN+  +C R +EA+  L  KN+AP S N ILL NC+S    C IPS  +
Sbjct  66    PVQIVGQDTIKINLEPRCDRPVEALYNLSTKNYAPKSTNAILLNNCTSGFSPCNIPSISV  125

Query  1586  QTQFELQDCGKDN-ISCFSEPHMTGGFIGYENLTGTGCKSLFSAISSPAAAANTTAVSLD  1410
             +T FE  +C  ++ +SCFS+   T GF  Y     + CK L S+IS  A +   + VSL+
Sbjct  126   RTHFESLNCSNNSSVSCFSKADTTNGFFDYNMANISQCKYLLSSIS--AESFTGSGVSLE  183

Query  1409  IQVIELGWWLQGHCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTR  1230
              Q++EL WWLQG CRCSK+A C  + +P     GFRCQC +G  GDGY  G GCR+    
Sbjct  184   TQMMELWWWLQGDCRCSKDAICTKVESPAGS--GFRCQCRDGLIGDGYLAGVGCRKG---  238

Query  1229  CNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAMKNWNRRRRELRET  1050
             CNPAKYL G+CG   R  VL+GG++A     V +GL CC+ RR    K  + R+    E 
Sbjct  239   CNPAKYLSGQCGAGARPAVLLGGIVAAVG--VGLGLFCCLARRNSISKAKSFRKLHRAEA  296

Query  1049  TGITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIE  870
               I+IP+Y YK+IEKATNNFS+K+R+G GAYGTVY+GKL  +D WVAIKRI+HRD DSIE
Sbjct  297   ADISIPIYPYKEIEKATNNFSEKQRIGTGAYGTVYAGKL-SSDSWVAIKRIKHRDVDSIE  355

Query  869   QVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRL  690
             QV NEIKL+SSV+HPNLVRLLGCSIE  EQILVYEFMPNGTL QHLQR +G GL WPVRL
Sbjct  356   QVINEIKLISSVSHPNLVRLLGCSIENDEQILVYEFMPNGTLCQHLQRVRGDGLDWPVRL  415

Query  689   GIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTA  510
              I +ET++AIA+LH+A+ PPIYHRD+KSSNILLD+ +KSKVADFGLSR G+ + SHIST 
Sbjct  416   AIATETAKAIAHLHSAIDPPIYHRDIKSSNILLDFEFKSKVADFGLSRHGMTDISHISTV  475

Query  509   PQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKI  330
             PQGTPGYLDPQYHQ+FHLSDK+DVYSFGVVL+EIIT  K +DF+RPQ+EVNLA+LA+DKI
Sbjct  476   PQGTPGYLDPQYHQNFHLSDKTDVYSFGVVLIEIITAKKVLDFSRPQDEVNLASLAIDKI  535

Query  329   GKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSK  150
             G+G L EIIDP ++   D WT SSV+KVAE+AFRCLAFH+D+RPSMMEVA ELEQ+ L++
Sbjct  536   GRGLLDEIIDPFLDLHSDAWTFSSVHKVAELAFRCLAFHKDIRPSMMEVAAELEQIMLTR  595

Query  149   W  147
             W
Sbjct  596   W  596



>ref|XP_009364200.1| PREDICTED: wall-associated receptor kinase-like 14 [Pyrus x bretschneideri]
Length=696

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/610 (59%), Positives = 456/610 (75%), Gaps = 17/610 (3%)
 Frame = -3

Query  1943  MIPVLILLLLQSAMVFGSSTCNRSC-GDGLKQLPFPFGFSSGCEILLNCTSNGTMSIGEF  1767
             ++ VL++ LL    V  ++ CN++C G     + +PFGFSSGCEI LNC  NG ++IGEF
Sbjct  7     IVSVLVIPLL---TVHAANRCNQACPGYRPSPIQYPFGFSSGCEIRLNCIPNGGIAIGEF  63

Query  1766  PVYQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCS--SPELKCMIPST  1593
             P+  +  D+I IN+ + C R +  ++  + + +APTS N ILLQNC+  +    C IP+ 
Sbjct  64    PIQSINQDSIRINLQSHCNRPLHTLRNFYSRKYAPTSRNAILLQNCTEGTASSSCEIPNL  123

Query  1592  MIQTQFELQ-DCGKD-NISCFSEPHMTGGFIGYENLTGTGCKSLFSAISSPAAAANTTA-  1422
              +Q +F+   +C  + ++SC++E      F+ + ++    CK L S+IS+P    N++  
Sbjct  124   QVQARFDAPPNCSSNRSLSCYAETRNDVPFLDFGSVERKDCKFLLSSISAPPQLLNSSTP  183

Query  1421  ---VSLDIQVIELGWWLQGHCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSG  1251
                V L+++V++LGWWL+G C C KNA+C T+ +P +G  G+RC C EGF GDGY  GSG
Sbjct  184   AAPVMLEVEVLDLGWWLEGTCGCDKNANCTTVVSP-NGTEGYRCNCKEGFRGDGYVAGSG  242

Query  1250  CRRDDTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAMKNWNRR  1071
             C +  + CNPAKYL G+CGGKTR  +LIG V  GA+LM+SV L+CC IRRR  +K  +  
Sbjct  243   CWKVSSTCNPAKYLSGQCGGKTRFILLIGAVFVGASLMISVALLCCFIRRRSKLKERHST  302

Query  1070  RRELRETTG-ITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIR  894
             +R L   TG   IP YSYK+IEKATN+F+DK+RLG GAYGTVY+GKLHD  EWVAIKRI+
Sbjct  303   KRLLSAATGNCNIPFYSYKEIEKATNSFADKQRLGTGAYGTVYAGKLHD--EWVAIKRIK  360

Query  893   HRDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGS  714
             HR  +S++QV NEIKL+SSV HPNLV+LLGCSIE GEQILVYEFM NGTL QHLQRE+G 
Sbjct  361   HRGHESMDQVMNEIKLISSVRHPNLVQLLGCSIEHGEQILVYEFMENGTLCQHLQRERGE  420

Query  713   GLPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLI  534
             GL WP RL I +ET+QAI++LH+A  PPIYHRD+KSSNILLD  ++SKVADFGLSR G+ 
Sbjct  421   GLSWPSRLNIAAETAQAISHLHSAADPPIYHRDIKSSNILLDCKFRSKVADFGLSRLGMA  480

Query  533   ESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNL  354
             E+SHISTAPQGTPGYLDPQYHQ+FHLSDKSDVYSFGVVL EII+GLKAVDF RP +EVNL
Sbjct  481   ETSHISTAPQGTPGYLDPQYHQNFHLSDKSDVYSFGVVLAEIISGLKAVDFNRPPDEVNL  540

Query  353   AALAVDKIGKGGLLEIIDPLIE-AEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAI  177
             AALA D+IG+  L EIIDP +E    D WTLSSV KVAE+AFRCLAFHRDMRP+M+EV  
Sbjct  541   AALATDRIGRACLNEIIDPFLEPCMDDAWTLSSVQKVAELAFRCLAFHRDMRPTMIEVTA  600

Query  176   ELEQMRLSKW  147
             ELE ++LS+W
Sbjct  601   ELELIKLSRW  610



>ref|XP_010263819.1| PREDICTED: wall-associated receptor kinase-like 14 [Nelumbo nucifera]
Length=696

 Score =   712 bits (1839),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/605 (60%), Positives = 461/605 (76%), Gaps = 16/605 (3%)
 Frame = -3

Query  1937  PVLILLLLQSAMVFGSST--CNRSCG--DGLKQLPFPFGFSSGCEILLNCTSNGTMSIGE  1770
             PVL L++    ++       CN++CG     K+ P+PFGFS GC I LNC   G   IG+
Sbjct  8     PVLYLVICLLPLIATQPLPRCNQTCGFRGREKRFPYPFGFSDGCPIRLNCI-RGVAFIGQ  66

Query  1769  FPVYQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTM  1590
             F V  +T D+I IN+PA+C R I+ ++ LF   FA T  NG+LL+NCSS    C IP+T+
Sbjct  67    FRVENVTADSIFINLPARCNRPIQDLRQLFNGTFALTKQNGLLLENCSSLVSMCTIPTTL  126

Query  1589  IQTQFELQDCGKD--NISCFSEPHMTGGFIGYENLTGTGCKSLFSAISSPAAAANTTAVS  1416
             ++  F+LQ C +   N+SCF++  M   F+ + +L    CK LFS+++    +   +++S
Sbjct  127   LENHFDLQHCDRRERNLSCFAKEDMD--FMTFNDLKRANCKFLFSSVA--VDSNKNSSLS  182

Query  1415  LDIQVIELGWWLQGHCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDD  1236
             L+ Q ++LGWWL+  C CS NA+   ++   +G  G  C C +GF GDG+Q GSGCRR  
Sbjct  183   LEFQTVQLGWWLE-ECNCSLNANNKIVQLRNNGT-GCLCHCKDGFEGDGFQAGSGCRRAT  240

Query  1235  TRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRR-LAMKNWNRRRREL  1059
             + CNP+KY+ G CGG TR+GVLIGG+IAGA+L+  + L+C  ++RR  ++K   R +R L
Sbjct  241   SNCNPSKYMKGRCGGTTRVGVLIGGIIAGASLVAGLVLLCYFVQRRSTSLKTRKRTQRLL  300

Query  1058  RETTGI-TIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDT  882
              E  G+ ++P Y YK+IE+ATN FSDK+RLG GAYGTVY+GKLH +DEWVAIK+IRHRD 
Sbjct  301   SEAAGVCSVPFYPYKEIERATNGFSDKQRLGTGAYGTVYAGKLH-SDEWVAIKKIRHRDN  359

Query  881   DSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPW  702
             D +EQV NEIKLLSSV+HP+LVRLLG  IE+GEQILVYEFMPNGTLS+HLQRE+G+GLPW
Sbjct  360   DGMEQVMNEIKLLSSVSHPHLVRLLGFCIERGEQILVYEFMPNGTLSEHLQRERGNGLPW  419

Query  701   PVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSH  522
              +RL I  ET+QAIA+LH+A++PPIYHRD+KSSNILLDYN+ SKVADFGLSR GL+ESSH
Sbjct  420   TIRLTIACETAQAIAHLHSAINPPIYHRDIKSSNILLDYNFNSKVADFGLSRLGLMESSH  479

Query  521   ISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALA  342
             ISTAPQGTPGY+DPQYHQ+FHLSDKSDVYSFGVVLVEIIT LK VDF+RP NEVNLAALA
Sbjct  480   ISTAPQGTPGYVDPQYHQNFHLSDKSDVYSFGVVLVEIITALKVVDFSRPHNEVNLAALA  539

Query  341   VDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQM  162
             V+KIGKG + EIIDP +E  +D WTLSSV+KVAE+AFRCLAFHRDMRPSM EVA ELE +
Sbjct  540   VEKIGKGCVDEIIDPFLEPHRDAWTLSSVHKVAELAFRCLAFHRDMRPSMKEVATELENI  599

Query  161   RLSKW  147
             RLS W
Sbjct  600   RLSGW  604



>ref|XP_009630314.1| PREDICTED: wall-associated receptor kinase-like 14 [Nicotiana 
tomentosiformis]
 ref|XP_009630315.1| PREDICTED: wall-associated receptor kinase-like 14 [Nicotiana 
tomentosiformis]
Length=704

 Score =   711 bits (1836),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/590 (60%), Positives = 457/590 (77%), Gaps = 13/590 (2%)
 Frame = -3

Query  1892  SSTCNRSCGDG--LKQLPFPFGFSSGCEILLNCTSNGTMSIGEFPVYQLTPDTIMINIPA  1719
             S+ CN+ CG G  ++++P+PFGFS GC I LNCT +G + IGE+ +  +T DT+M+N P 
Sbjct  31    STQCNQYCGAGSNVQRVPYPFGFSEGCTIRLNCTRSGEIGIGEYLIQNVTSDTLMVNFPV  90

Query  1718  KCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMIQTQFELQDCG--KDNI  1545
              C R IE +K   G N+  T  NG+LLQNC+ P+ +C IPS ++  +  +  C    +N+
Sbjct  91    NCSRPIEDLKQFSGTNYGMTWRNGLLLQNCTVPKSECTIPSYLLSARLNIPSCDSKNENV  150

Query  1544  SCFSEPHMTGGFIGYENLTGTGCKSLFSAI--SSPAAAANTTAVSLDIQVIELGWWLQGH  1371
             SC+SE   +G ++ Y  L   GC  + S+I          ++++ L+ Q IEL W L+G 
Sbjct  151   SCYSEA--SGDYLDYWKLKNIGCGLVVSSILVGMDNNTKKSSSMYLEFQTIELEWGLEGD  208

Query  1370  CRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTRCNPAKYLLGECGG  1191
             C C ++A+C  +  PG+ + GFRC+C +GF GDG++ G GCR+  ++CNP+KYL G CGG
Sbjct  209   CACDEHANCTNIFLPGN-RNGFRCRCKDGFVGDGFRNGDGCRKV-SKCNPSKYLSGRCGG  266

Query  1190  KTRigvliggviagaaLMVSVGLIC-CIIRRRLAMKNWNRRRRELRETTGIT-IPVYSYK  1017
              TRIGVL+GG+IAGA LM ++ ++C CI RR  ++K     +R L E  G + +P++ YK
Sbjct  267   TTRIGVLVGGIIAGAGLMAALAILCYCIRRRSASLKKRMSAKRLLSEAAGSSSVPMFQYK  326

Query  1016  DIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIKLLSS  837
             +IEKATN+FS+K+RLG GAYGTVY+GKLH +DEWVAIK++RHRD D +EQV NEIKLLSS
Sbjct  327   EIEKATNSFSEKQRLGIGAYGTVYAGKLH-SDEWVAIKKLRHRDPDGVEQVMNEIKLLSS  385

Query  836   VNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVSETSQAIA  657
             V+HPNLVRLLGC IE GEQILVYEFMPNGTL+QHLQRE+GSGLPW +RL   +ET+QAIA
Sbjct  386   VSHPNLVRLLGCCIENGEQILVYEFMPNGTLAQHLQRERGSGLPWTIRLTTATETAQAIA  445

Query  656   YLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGTPGYLDPQ  477
             +LH+AM+PPIYHRD+KSSNILLDYN+ SKVADFGLSRFG+ + SHISTAPQGTPGY+DPQ
Sbjct  446   HLHSAMNPPIYHRDIKSSNILLDYNFNSKVADFGLSRFGMTDDSHISTAPQGTPGYVDPQ  505

Query  476   YHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLEIIDP  297
             YHQ++HLSDKSDVYSFGVVL+EIIT LK VDF+RP +E+NLAALA+D+IGKG + EIIDP
Sbjct  506   YHQNYHLSDKSDVYSFGVVLIEIITALKVVDFSRPHSEINLAALAIDRIGKGRVDEIIDP  565

Query  296   LIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKW  147
              +E  +D WTLSSV++VAE+AFRCLAFHRDMRPSM+EVA ELEQ+RLS W
Sbjct  566   FLEPHRDAWTLSSVHRVAELAFRCLAFHRDMRPSMIEVADELEQIRLSSW  615



>ref|XP_004511986.1| PREDICTED: wall-associated receptor kinase-like 14-like [Cicer 
arietinum]
Length=694

 Score =   710 bits (1833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/607 (58%), Positives = 446/607 (73%), Gaps = 18/607 (3%)
 Frame = -3

Query  1940  IPVLILLLLQSAMVFGSSTCNRSCGDGLKQLPFPFGFSSGCEILLNCTSNGTMSIGEFPV  1761
             I ++ + LL +     ++ C+  CGD +  L +PFGFS GC I L C  N  + +GEF +
Sbjct  11    ITIIAIFLLNTTRAQNNTICDNRCGDEI--LQYPFGFSEGCGIKLKCFQN-KVQVGEFLI  67

Query  1760  YQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIP-STMIQ  1584
               LT ++I I +PAKC R +E ++PLF +NFAPT NN  L+Q CS P   C+IP S+   
Sbjct  68    QNLTKNSIFIYLPAKCNRSMETIQPLFSENFAPTRNNSFLVQGCSVPLGGCVIPASSFFG  127

Query  1583  TQFELQDCGK--DNISCFSEPHMTGG---FIGYENLTGTGCKSLFSAISSPAAAANTTAV  1419
              Q E++ C +   NISCFS+     G    + YE L  T C  LFSA+    A      +
Sbjct  128   NQIEVESCDRKSSNISCFSQKQREEGERDVLTYEELNQTKCNYLFSAV----AVEQNKEI  183

Query  1418  SLDIQVIELGWWLQGHCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRD  1239
             SL  Q +ELGWWLQG C+CS NA C+T+   GD   GFRCQC +GF GDG+  G+GCR+ 
Sbjct  184   SLQFQAVELGWWLQGLCQCSSNATCSTVNLQGDSL-GFRCQCFDGFIGDGFANGTGCRKA  242

Query  1238  DTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLA-MKNWNRRRRE  1062
              + C+ +    G CG  T+IGV+IG  + G  ++ ++ L+C   RRR   ++   R +R 
Sbjct  243   PS-CSASTLTSGGCGNATKIGVVIGVAVTGVVIVAALILLCYCARRRFTWLRKHTRVKRL  301

Query  1061  LRETTG-ITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRD  885
             LRE  G  T+P+Y Y+DIEKATN+FSDK+RLG GA+GTVY+GKLH ND+WVAIK+IRHRD
Sbjct  302   LREAAGNSTVPLYPYRDIEKATNSFSDKQRLGTGAFGTVYAGKLH-NDDWVAIKKIRHRD  360

Query  884   TDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLP  705
             T+S++Q+ NEIKLLSSV+HPNLVRLLGC IE+GEQILVYEFMPNGTLSQHLQRE+G GLP
Sbjct  361   TNSVDQIMNEIKLLSSVSHPNLVRLLGCCIEEGEQILVYEFMPNGTLSQHLQRERGKGLP  420

Query  704   WPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESS  525
             W +RL I SET+ AIAYLH+A++PPIYHRD+KSSNILLDY++KSKVADFGLSR G+IE+S
Sbjct  421   WTIRLTIASETANAIAYLHSAIYPPIYHRDIKSSNILLDYSFKSKVADFGLSRLGMIETS  480

Query  524   HISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAAL  345
             HISTAPQGTPGY+DPQYHQ+FHLSDKSDVYSFGVVLVEIIT +K VDF RPQ+E+NLAAL
Sbjct  481   HISTAPQGTPGYVDPQYHQNFHLSDKSDVYSFGVVLVEIITAMKVVDFGRPQSEINLAAL  540

Query  344   AVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQ  165
             AVD+I +G + EI+DP +E   D WTL S++KVAE+AFRCLAFH D RP+MME A ELE 
Sbjct  541   AVDRIRRGSIDEIVDPFLEPHSDAWTLYSIHKVAELAFRCLAFHSDTRPTMMEAAEELEY  600

Query  164   MRLSKWG  144
             +R   W 
Sbjct  601   IRRRAWA  607



>ref|XP_006375036.1| hypothetical protein POPTR_0014s03810g [Populus trichocarpa]
 gb|ERP52833.1| hypothetical protein POPTR_0014s03810g [Populus trichocarpa]
Length=686

 Score =   709 bits (1830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/601 (59%), Positives = 444/601 (74%), Gaps = 15/601 (2%)
 Frame = -3

Query  1934  VLILLLLQSAMVFGSST----CNRSCGDGLKQLPFPFGFSSGCEILLNCTSNGTMSIGEF  1767
             +L L +   +++ G ++    CNR+CG     LP+PFGFS+ C+I LNC+ NG M I +F
Sbjct  8     ILFLAIFVISLIGGHASIKFSCNRTCGTS--HLPYPFGFSANCDIHLNCSLNGEMLINDF  65

Query  1766  PVYQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMI  1587
             PV  +  DTI IN+  +C R +EA+  L  KN+AP S N ILL NC+S    C IPS  +
Sbjct  66    PVQIVGQDTIKINLEPRCYRPVEALYNLSTKNYAPKSTNAILLNNCTSGFSPCNIPSISV  125

Query  1586  QTQFELQDCGKDN-ISCFSEPHMTGGFIGYENLTGTGCKSLFSAISSPAAAANTTAVSLD  1410
             +T FE  +C  ++ +SCFS+     GF  Y     + CK L S+IS  A +   + VSL+
Sbjct  126   RTHFESLNCSNNSSVSCFSKADTANGFFDYNMANISQCKYLLSSIS--AESFTGSGVSLE  183

Query  1409  IQVIELGWWLQGHCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTR  1230
              Q++EL WWLQG C+CSK+A C  + +P     GFRCQC +G  GDGY  G GCR+    
Sbjct  184   TQMMELWWWLQGDCQCSKDAICTKVESPAGS--GFRCQCRDGLIGDGYLAGVGCRKA-AG  240

Query  1229  CNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAMKNWNRRRRELRET  1050
             CNPAKYL G+CG   R  VL+GG++A     V +GL CC+ RR    K  + R+    E 
Sbjct  241   CNPAKYLSGQCGAGARPAVLLGGIVAAVG--VGLGLFCCLTRRNSISKAKSFRKLHRAEA  298

Query  1049  TGITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIE  870
               I+IP+Y YK+IEKATN+FS+K+R+G GAYGTVY+GKL  +D WVAIKRI+HRD DSIE
Sbjct  299   ADISIPIYPYKEIEKATNSFSEKQRIGTGAYGTVYAGKL-SSDSWVAIKRIKHRDVDSIE  357

Query  869   QVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRL  690
             QV NEIKL+SSV+HPNLVRLLGCSIE  EQILVYEFMPNGTL QHLQR +G GL WPVRL
Sbjct  358   QVINEIKLISSVSHPNLVRLLGCSIENDEQILVYEFMPNGTLCQHLQRVRGDGLDWPVRL  417

Query  689   GIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTA  510
              I +ET++AIA+LH+A+ PPIYHRD+KSSNILLD+++KSKVADFGLSR G+ + SHIST 
Sbjct  418   AIATETAKAIAHLHSAIDPPIYHRDIKSSNILLDFDFKSKVADFGLSRHGMTDMSHISTV  477

Query  509   PQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKI  330
             PQGTPGYLDPQYHQ+FHLSDK+DVYSFGVVL+EIIT  K +DF+RPQ+EVNLA+LA+DKI
Sbjct  478   PQGTPGYLDPQYHQNFHLSDKTDVYSFGVVLIEIITAKKVLDFSRPQDEVNLASLAIDKI  537

Query  329   GKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSK  150
             G+G L EIIDP ++   D WT SSV+KVAE+AFRCLAFH+D+RPSMMEVA ELEQ+ L++
Sbjct  538   GRGLLDEIIDPFLDLHSDAWTFSSVHKVAELAFRCLAFHKDIRPSMMEVAAELEQIMLTR  597

Query  149   W  147
             W
Sbjct  598   W  598



>ref|XP_009341926.1| PREDICTED: wall-associated receptor kinase-like 14 [Pyrus x bretschneideri]
Length=714

 Score =   709 bits (1831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/617 (59%), Positives = 460/617 (75%), Gaps = 22/617 (4%)
 Frame = -3

Query  1943  MIPVLILLLLQSAMVFG--SSTCNRSCGDG--LKQLPFPFGFSSGCEILLNCTSNGTMSI  1776
             ++ VL L +  +A+     SS+C  +CG G   K + +PFGFS  CEI LNC     +++
Sbjct  16    VVSVLTLSISIAAIAKAQNSSSCIPTCGSGKSAKTVRYPFGFSPSCEIPLNCYDKNEITL  75

Query  1775  GEFPVYQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPS  1596
             G+F V ++TP+ I +N+PAKC RR+E++  LFG NF+PT NN +LLQNCS+P+  C+IP+
Sbjct  76    GDFRVQKVTPNGIFVNLPAKCNRRVESVTRLFGSNFSPTWNNSLLLQNCSAPQNGCLIPA  135

Query  1595  TMIQTQFELQDC--GKDNISCFS--------EPHMTGGFIGYENLTGTGCKSLFSAISSP  1446
               +Q QF L+ C    DNISC S        +PH     I  ++LT TGCK+LF + +  
Sbjct  136   NFVQKQFNLESCRSSADNISCLSPPHNQSESQPHNQSEVIRIKDLTRTGCKNLFGSFA--  193

Query  1445  AAAANTTAVSLDIQVIELGWWLQGHCRCSKNADCNTMRTPGDGKP-GFRCQCSEGFTGDG  1269
               +     +SL+ + +ELGWW+ G C C  NA C T++  GDG P G+RC+C++GF GDG
Sbjct  194   VQSGGEWPLSLEFETVELGWWVGGTCDCDANATCTTVKL-GDGMPEGYRCRCNDGFDGDG  252

Query  1268  YQGGSGCRRDDTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRR-LA  1092
             +  G GCRR  + CNP+KY+ G CGG TR+GVLIGGVIAGA LM  + L+C   +RR   
Sbjct  253   FNLGRGCRRV-SECNPSKYMSGRCGGTTRVGVLIGGVIAGAFLMAGLFLLCYFFQRRSTC  311

Query  1091  MKNWNRRRRELRETTG-ITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEW  915
             ++N    RR L E  G   + ++ YK+IE+ TN F++++RLG GA+GTVY+GKLH NDEW
Sbjct  312   LRNQMSARRLLSEAAGNANVSLFPYKEIERGTNCFAEEQRLGTGAFGTVYAGKLH-NDEW  370

Query  914   VAIKRIRHRDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQH  735
             VAIK+I  RDT+ I+QV NEIKLLS V+HPNLVRLLGC IE GEQILVYE+MPNGTLS+H
Sbjct  371   VAIKKINRRDTNGIDQVMNEIKLLSCVSHPNLVRLLGCCIEGGEQILVYEYMPNGTLSEH  430

Query  734   LQREKGSGLPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFG  555
             LQ+E+G GLPW +RL I SET+ AIAYLH+ M+PPIYHRD+KS+NILLDYNYKSKVADFG
Sbjct  431   LQQERGQGLPWTIRLTIASETANAIAYLHSEMNPPIYHRDIKSTNILLDYNYKSKVADFG  490

Query  554   LSRFGLIESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTR  375
             LSR G+ ESS+ISTAPQGTPGY+DPQYHQ+FHLSDKSDVYSFGVVLVEIIT +K VDF R
Sbjct  491   LSRLGMTESSYISTAPQGTPGYVDPQYHQNFHLSDKSDVYSFGVVLVEIITAMKVVDFAR  550

Query  374   PQNEVNLAALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPS  195
             PQ EVNLAALA+D+IGKG +  I+DP +E ++D WTL SVNKVAE+AFRCLAFH DMRPS
Sbjct  551   PQCEVNLAALAIDRIGKGCVDNIVDPFLEPDRDAWTLYSVNKVAELAFRCLAFHSDMRPS  610

Query  194   MMEVAIELEQMRLSKWG  144
             M EVA EL+ ++ S+W 
Sbjct  611   MTEVAEELQNIQCSEWA  627



>ref|XP_008338207.1| PREDICTED: wall-associated receptor kinase-like 14, partial [Malus 
domestica]
Length=621

 Score =   704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/603 (59%), Positives = 454/603 (75%), Gaps = 17/603 (3%)
 Frame = -3

Query  1943  MIPVLILLLLQSAMVF-----GSSTCNRSCGDG--LKQLPFPFGFSSGCEILLNCTSNGT  1785
              I V+ +L L +++        SS+C  +CG G   K + +PFGFS  C I LNC+    
Sbjct  24    FITVVSVLTLSTSIAAIAKAQNSSSCIPTCGSGKSAKTVRYPFGFSPSCAIPLNCSDKNE  83

Query  1784  MSIGEFPVYQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCM  1605
             +++G+F V  +TP+ I +N+PAKC RR+E++  LF  NF+PT NN +LLQNCS+P+  C+
Sbjct  84    ITLGKFRVQNVTPNGIFVNLPAKCNRRVESVARLFSSNFSPTWNNSLLLQNCSAPQNGCI  143

Query  1604  IPSTMIQTQFELQDC--GKDNISCFSEPHMTGGFIGYENLTGTGCKSLFSAISSPAAAAN  1431
             IP+  ++ QF L+ C    DNISC S+ H     I   +LT TGCK+LF + +    +  
Sbjct  144   IPADFVRKQFNLESCRSSADNISCLSQQHNQSEVIRISDLTRTGCKNLFGSFA--VQSGG  201

Query  1430  TTAVSLDIQVIELGWWLQGHCRCSKNADCNTMRTPGDGKP-GFRCQCSEGFTGDGYQGGS  1254
                +SL+ + +ELGWW++G C C  NA C T++  GDG P G+RC+C++GF GDG+  G 
Sbjct  202   EWPLSLEFETVELGWWVEGPCDCDANATCTTVKL-GDGMPEGYRCRCNDGFDGDGFNLGW  260

Query  1253  GCRRDDTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRR-LAMKNWN  1077
             GCRR  + C+P+KY+ G CGG TR+G LIGGVIAGA LM  + ++C  +RRR   ++N  
Sbjct  261   GCRRV-SECSPSKYMSGRCGGTTRVGALIGGVIAGAFLMAGLFVLCYFVRRRSTCLRNRM  319

Query  1076  RRRRELRETTGIT-IPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKR  900
               RR L E  G + + ++ YK+I +ATN F++K+RLG GA+GTVY+GKLH NDEWVAIK+
Sbjct  320   SARRLLSEAAGNSNVSLFPYKEIARATNCFAEKQRLGTGAFGTVYAGKLH-NDEWVAIKK  378

Query  899   IRHRDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREK  720
             I  RDT+ ++QV NEIKLLSSV+HPNLVRLLGC IE GEQILVYE+MPNGTLS+HLQRE+
Sbjct  379   INRRDTNGVDQVMNEIKLLSSVSHPNLVRLLGCCIEGGEQILVYEYMPNGTLSEHLQRER  438

Query  719   GSGLPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFG  540
             G GLPW +RL I SET+ AIAYLH+ M+PPIYHRD+KS+NILLDYNYKSKVADFGLSR G
Sbjct  439   GQGLPWTIRLTIASETANAIAYLHSEMNPPIYHRDIKSTNILLDYNYKSKVADFGLSRLG  498

Query  539   LIESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEV  360
             + ESS+ISTAPQGTPGY+DPQYHQ+FHLSDKSDVYSFGVVLVEIIT +K VDF RPQ EV
Sbjct  499   MTESSYISTAPQGTPGYVDPQYHQNFHLSDKSDVYSFGVVLVEIITAMKVVDFARPQCEV  558

Query  359   NLAALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVA  180
             NLAALA+D+IGKG + EI+DP +E ++D WTL SVNKVAE+AFRCLAFH DMRPSM EVA
Sbjct  559   NLAALAIDRIGKGCVDEIVDPFLEPDRDAWTLYSVNKVAELAFRCLAFHSDMRPSMTEVA  618

Query  179   IEL  171
              EL
Sbjct  619   EEL  621



>ref|XP_006434895.1| hypothetical protein CICLE_v10000511mg [Citrus clementina]
 gb|ESR48135.1| hypothetical protein CICLE_v10000511mg [Citrus clementina]
Length=673

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/666 (57%), Positives = 471/666 (71%), Gaps = 41/666 (6%)
 Frame = -3

Query  1937  PVLILL--LLQSAMVFGSST-CNRSCGDGLKQLPFPFGFSSGCEILLNCTS---NGTMSI  1776
             P+L  L  L+   ++ G++  CNR+CG     +P+PFGFS+ C I LNC+S   +  +SI
Sbjct  6     PILFFLRILIIFPLITGTTHGCNRACGSN--PVPYPFGFSADCLIRLNCSSPSNDAQISI  63

Query  1775  GEFPVYQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPEL-KCMIP  1599
             GEFP+  +  D I I +   C R I+ +  LF +N+APTS NGILL +C+S ++  C IP
Sbjct  64    GEFPIQIMKSDHIKIIMEPICNRSIQTLHQLFSQNYAPTSRNGILLSSCNSSKVTACKIP  123

Query  1598  STMIQTQFELQDCGKDNISCFS----EPHMTGGFIGYENLTGTGCKSLFSAISS-----P  1446
                ++TQF    C   + S       E      FI YEN T   CK L SAISS      
Sbjct  124   LIDVRTQFNSIKCDSSSNSSSISCYSEEKNDREFIDYENATKQQCKFLLSAISSELFNTS  183

Query  1445  AAAANTTAVSLDIQVIELGWWLQGHCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGY  1266
             AA+ N +A SLD++V+E+GWWL GHC CS+NA+C  + TP  G+ GFRC C++GF GDGY
Sbjct  184   AASINISAASLDVKVLEVGWWLNGHCHCSQNANCTPVLTP-HGRSGFRCGCNKGFEGDGY  242

Query  1265  QGGSGCRRDDTRCNPAKYLLGECGGKTRigvliggviagaaLMV-SVGLICCIIRRRLAM  1089
               GSGCR+    CN AKY+ G+CGGKTRI VLI G     A ++ S+ L+CC++RRR   
Sbjct  243   PAGSGCRK--ASCNAAKYISGQCGGKTRIAVLIIGGSTAGASLIISMRLLCCLMRRRSYY  300

Query  1088  KNWNRRRRELRETTGIT-IPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWV  912
             +     +R L+E  GI+ IP+Y YK+IEKAT  FS+K+RLG GA+GTVY+GKL  ND  V
Sbjct  301   RARKSTKRCLKEARGISNIPIYPYKEIEKATIGFSEKQRLGTGAFGTVYAGKLQ-NDLLV  359

Query  911   AIKRIRHRDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHL  732
             AIKRI+HRDTD I+QV NEIKL+S V+HPNLVRLLGCSIE+GEQILVYEFMPNGTL QHL
Sbjct  360   AIKRIKHRDTDGIQQVVNEIKLISCVSHPNLVRLLGCSIERGEQILVYEFMPNGTLCQHL  419

Query  731   QREKGSGLPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGL  552
             QRE+G GL WP+RL I  ET+QAIA+LH+A++PPIYHRD+KSSNILLDYN+KSKVADFGL
Sbjct  420   QRERGDGLSWPIRLTIAMETAQAIAHLHSAINPPIYHRDIKSSNILLDYNFKSKVADFGL  479

Query  551   SRFGLIESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRP  372
             SR G+ E SHISTAPQGTPGYLDPQYHQ+FHLSDKSDVYSFGVVLVEIIT LK VDF+RP
Sbjct  480   SRLGMTEISHISTAPQGTPGYLDPQYHQNFHLSDKSDVYSFGVVLVEIITALKVVDFSRP  539

Query  371   QNEVNLAALAVDKIGKGGLLEIIDPLI---EAEKDVWTLSSVNKVAEIAFRCLAFHRDMR  201
              NEVNLAALA D+I KG L EIIDPLI       D  TL+SV+KVAE+AFRCLAFHRDMR
Sbjct  540   PNEVNLAALAADRISKGRLDEIIDPLIIEHRGHSDAGTLASVHKVAELAFRCLAFHRDMR  599

Query  200   PSMMEVAIELEQMRLSKWGIsedsiitassssssrsssdasEKPLSFSTMKPSEKVTESS  21
             PSM EVA ELE +R              + +    + + + E  L  S+   SE++ ++S
Sbjct  600   PSMTEVATELEHIR--------------TRTMEDINCTASLEASLCSSSYNASERMKDNS  645

Query  20    PVSVQD  3
             P SVQD
Sbjct  646   PPSVQD  651



>ref|XP_009789522.1| PREDICTED: wall-associated receptor kinase-like 14 [Nicotiana 
sylvestris]
Length=701

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/607 (59%), Positives = 462/607 (76%), Gaps = 16/607 (3%)
 Frame = -3

Query  1934  VLILLLLQSAMVFG---SSTCNRSCGDGL--KQLPFPFGFSSGCEILLNCTSNGTMSIGE  1770
             V  +LL+ S+   G   S+ CN+  G     +++P+PFGFS GC I LNCT +G + IGE
Sbjct  11    VFSILLVWSSSSVGAANSTQCNQYSGAASNGQRVPYPFGFSEGCTIRLNCTQSGEIRIGE  70

Query  1769  FPVYQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTM  1590
             + +  +T DT+M+N P  C R IE +K   G N+  T  NG+LLQNC+ P+ +C IPS +
Sbjct  71    YLIQNVTSDTLMVNFPVNCRRPIEDLKQFSGTNYGMTWRNGLLLQNCTVPKSECTIPSDL  130

Query  1589  IQTQFELQDCG--KDNISCFSEPHMTGGFIGYENLTGTGCKSLFSAI--SSPAAAANTTA  1422
             +  +  +  C    +N+SC+SE   T  ++ Y  L   GC  + S+I          +++
Sbjct  131   LSARLNIPSCDSKNENVSCYSEA--TADYLDYWKLKNIGCGLVVSSILVGMDNNTKKSSS  188

Query  1421  VSLDIQVIELGWWLQGHCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRR  1242
             + L+ Q IEL W L+G C C ++A+C  +  PG+ + GFRC+C +GF GDG++ G GCR+
Sbjct  189   MYLEFQTIELEWGLEGDCACDEHANCTNIFLPGN-RNGFRCRCKDGFVGDGFRDGDGCRK  247

Query  1241  DDTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLIC-CIIRRRLAMKNWNRRRR  1065
               ++CNP++YL G CGG TRIGVLIGG+IAGA LM ++ ++C CI RR  ++K     +R
Sbjct  248   V-SKCNPSRYLSGRCGGTTRIGVLIGGIIAGAGLMAALAILCYCIRRRSASLKKRMSAKR  306

Query  1064  ELRETTGIT-IPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHR  888
              L E  G + +P++ YK+IEKATN+FS+K+RLG GAYGTVY+GKLH +DEWVAIK++RHR
Sbjct  307   LLSEAAGSSSVPMFQYKEIEKATNSFSEKQRLGIGAYGTVYAGKLH-SDEWVAIKKLRHR  365

Query  887   DTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGL  708
             D D +EQV NEIKLLSSV+HPNLVRLLGC IE GEQILVYEFMPNGTL+QHLQRE+GSGL
Sbjct  366   DPDGVEQVMNEIKLLSSVSHPNLVRLLGCCIENGEQILVYEFMPNGTLAQHLQRERGSGL  425

Query  707   PWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIES  528
             PW +RL I +ET+QAIA+LH+AM+PPIYHRD+KSSNILLDYN+ SKVADFGLSRFG+ + 
Sbjct  426   PWTIRLTIATETAQAIAHLHSAMNPPIYHRDIKSSNILLDYNFNSKVADFGLSRFGMTDD  485

Query  527   SHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAA  348
             SHISTAPQGTPGY+DPQYHQ++HLSDKSDVYSFGVVL+EIIT LK VDF+RP +E+NLAA
Sbjct  486   SHISTAPQGTPGYVDPQYHQNYHLSDKSDVYSFGVVLIEIITALKVVDFSRPHSEINLAA  545

Query  347   LAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELE  168
             LA+D+IGKG + EIIDP +E  +D WTLSSV+++AE+AFRCLAFHRDMRPSM+EVA ELE
Sbjct  546   LAIDRIGKGRVDEIIDPFLEPHRDAWTLSSVHRIAELAFRCLAFHRDMRPSMIEVADELE  605

Query  167   QMRLSKW  147
             Q+RLS W
Sbjct  606   QIRLSSW  612



>gb|KHN22281.1| Wall-associated receptor kinase-like 14 [Glycine soja]
Length=629

 Score =   701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/610 (60%), Positives = 460/610 (75%), Gaps = 34/610 (6%)
 Frame = -3

Query  1739  IMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMIQTQFELQDC  1560
             ++++I A+C R  +++  LF   +APTS N ILL+NC+   L C IP T+++T FE   C
Sbjct  1     MIVSIEAQCNRPFDSLHHLFSHKYAPTSRNVILLENCTGTPLPCFIPETLVRTHFESVGC  60

Query  1559  ----GKDNISCFSEPHMTGGFIGYENLTGTGCKSLFSAISSPAAAANTTA-VSLDIQVIE  1395
                 G   +SC+ E + T GF+    L   GCK   S++++P     + A +SLD+ +I+
Sbjct  61    NNASGTGELSCYFE-NRTNGFVDRRTLDEIGCKYFMSSLAAPDIKNISGAPLSLDVNIIQ  119

Query  1394  LGWWLQG-HCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTRCNPA  1218
             LGWWLQG  C CS +A+C T+++P DGKPGFRC+C +GF GDG+  G+GCR+  + CNPA
Sbjct  120   LGWWLQGDQCLCSDHANCTTLQSPMDGKPGFRCRCRDGFVGDGFLAGTGCRKASS-CNPA  178

Query  1217  KYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAMKNWNRRRRELRETTGI-  1041
             KY+ G CGG TR  VLIGG + G +LMV++G +CC  RRR  ++  N  +R L E TG  
Sbjct  179   KYISGRCGGTTRFIVLIGGFVVGVSLMVTLGSLCCFYRRRSKLRVTNSTKRRLTEATGKN  238

Query  1040  TIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVT  861
             ++P+Y YKDIEKATN+FS+K+RLG GAYGTVY+GKL++N EWVAIKRI+HRDTDSIEQV 
Sbjct  239   SVPIYPYKDIEKATNSFSEKQRLGTGAYGTVYAGKLYNN-EWVAIKRIKHRDTDSIEQVM  297

Query  860   NEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIV  681
             NEIKLLSSV+H NLVRLLGCSIE GEQILVYEFMPNGTLSQHLQ+E+GSGLPWP+RL I 
Sbjct  298   NEIKLLSSVSHTNLVRLLGCSIEYGEQILVYEFMPNGTLSQHLQKERGSGLPWPIRLTIA  357

Query  680   SETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYK--SKVADFGLSRFGLIESSHISTAP  507
             +ET+QAIAYLH+A+ PPIYHRD+KSSNILLDYN++  SKVADFGLSR G+ E SHIST P
Sbjct  358   TETAQAIAYLHSAICPPIYHRDIKSSNILLDYNFRHESKVADFGLSRLGMTEISHISTTP  417

Query  506   QGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIG  327
             QGTPGY+DPQYHQDFHLSDKSDVYS GVVLVEIITGLK VDF+RP NEVNLA+LA DKIG
Sbjct  418   QGTPGYVDPQYHQDFHLSDKSDVYSLGVVLVEIITGLKVVDFSRPHNEVNLASLAADKIG  477

Query  326   KGGLLEIIDPLIEAE--KDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLS  153
             KG L EIIDP +E E   D WTLSS++KVAE+AFRC+AFHRDMRPSM EVA ELEQ+RLS
Sbjct  478   KGLLNEIIDPFLEPEVRSDAWTLSSIHKVAELAFRCIAFHRDMRPSMTEVASELEQLRLS  537

Query  152   KW-GIsedsiitassssssrsssdasEKPLSFST-------------------MKPSEKV  33
             +W  + +++  T++  SS  SSS+  EKPLS +T                   +K  ++ 
Sbjct  538   RWTTLGDNNCATSTELSSCSSSSNECEKPLSIATRNFGAKGKGHLKLQTGPINLKSLQRP  597

Query  32    TESSPVSVQD  3
               +SPVSVQD
Sbjct  598   NSNSPVSVQD  607



>ref|XP_008367960.1| PREDICTED: wall-associated receptor kinase-like 14 [Malus domestica]
Length=707

 Score =   704 bits (1817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/612 (58%), Positives = 454/612 (74%), Gaps = 17/612 (3%)
 Frame = -3

Query  1943  MIPVLILLLLQSAMVF-----GSSTCNRSCGDG--LKQLPFPFGFSSGCEILLNCTSNGT  1785
              I V+ +L L +++        SS+C  +CG G   K + +PFGFS  C I LNC+    
Sbjct  13    FITVVSVLTLSTSIAAIAKAQNSSSCIPTCGSGKSAKTVRYPFGFSPSCAIPLNCSDKNE  72

Query  1784  MSIGEFPVYQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCM  1605
             +++G+F V  +TP+ I +N+PAKC RR+E++  LF  NF+PT NN +LLQNCS+P+  C+
Sbjct  73    ITLGKFRVQNVTPNGIFVNLPAKCNRRVESVARLFSSNFSPTWNNSLLLQNCSAPQNGCI  132

Query  1604  IPSTMIQTQFELQDC--GKDNISCFSEPHMTGGFIGYENLTGTGCKSLFSAISSPAAAAN  1431
             IP+  ++ QF L+ C    DNISC S+ H     I   +LT TGCK+LF + +    +  
Sbjct  133   IPADFVRKQFNLESCRSSADNISCLSQXHNQSEXIRISDLTRTGCKNLFGSFA--VQSGG  190

Query  1430  TTAVSLDIQVIELGWWLQGHCRCSKNADCNTMRTPGDGKP-GFRCQCSEGFTGDGYQGGS  1254
                +SL+ + +ELGWW++G C C  NA C T++  G G P G+RC+C++GF GDG+  G 
Sbjct  191   EWPLSLEFETVELGWWVEGPCDCDANATCTTVKL-GXGMPEGYRCRCNDGFDGDGFNLGW  249

Query  1253  GCRRDDTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRR-LAMKNWN  1077
             GCRR  + C+P+KY+ G CGG TR+G LIGGVIAGA LM  +  +C  +RRR   ++N  
Sbjct  250   GCRRV-SECSPSKYMSGRCGGTTRVGALIGGVIAGAFLMAGLFXLCYFVRRRSTCLRNRM  308

Query  1076  RRRRELRETTGIT-IPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKR  900
               RR L E  G + + ++ YK+I +ATN F++K+RLG GA+GTVY+GKLH NDEWVAIK+
Sbjct  309   SARRLLSEAAGNSNVSLFPYKEIARATNCFAEKQRLGTGAFGTVYAGKLH-NDEWVAIKK  367

Query  899   IRHRDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREK  720
             I  RDT+  +QV NEIKLLSSV+HPNLVRL GC IE GEQILVYE+MPNGTLS+HLQRE+
Sbjct  368   INRRDTNGXDQVMNEIKLLSSVSHPNLVRLXGCCIEGGEQILVYEYMPNGTLSEHLQRER  427

Query  719   GSGLPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFG  540
             G GLPW +RL I SET+ AIAYLH+ M+PPIYHRD+K +NILLDYNYKSKVADFGLSR G
Sbjct  428   GQGLPWTIRLTIASETANAIAYLHSEMNPPIYHRDIKXTNILLDYNYKSKVADFGLSRLG  487

Query  539   LIESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEV  360
             + ESS+ISTAPQGTPGY+DPQYHQ+FHLSDKSDVYSFGVVLVEIIT +K VDF RPQ EV
Sbjct  488   MTESSYISTAPQGTPGYVDPQYHQNFHLSDKSDVYSFGVVLVEIITAMKVVDFARPQCEV  547

Query  359   NLAALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVA  180
             NLAALA+D+IGKG + EI+DP +E ++D WTL SVNKVAE+AFRCLAFH DMRPSM EVA
Sbjct  548   NLAALAIDRIGKGCVDEIVDPFLEPDRDAWTLYSVNKVAELAFRCLAFHSDMRPSMTEVA  607

Query  179   IELEQMRLSKWG  144
              ELE +R S W 
Sbjct  608   EELEFVRRSGWA  619



>ref|XP_007226546.1| hypothetical protein PRUPE_ppa024936mg, partial [Prunus persica]
 gb|EMJ27745.1| hypothetical protein PRUPE_ppa024936mg, partial [Prunus persica]
Length=663

 Score =   702 bits (1811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/581 (61%), Positives = 436/581 (75%), Gaps = 17/581 (3%)
 Frame = -3

Query  1862  GLKQLPFPFGFSSGCEILLNCTSNGTMSIGEFPVYQLTPDTIMINIPAKCGRRIEAMKPL  1683
             G   + +PFGFS GCEI LNCT +  + IGEFP+  +TPD+I + + ++C R +  ++ L
Sbjct  2     GTDPIHYPFGFSHGCEIRLNCTPHTGIFIGEFPIQTITPDSIRVTLQSRCNRPLHTLRQL  61

Query  1682  FGKNFAPTSNNGILLQNCS--SPELKCMIPSTMIQTQFEL--QDCGKDNISCFSEPHMTG  1515
             +   +APTS N ILLQNC+   P   C IP+ ++Q +F+         ++SC++E     
Sbjct  62    YSPRYAPTSRNAILLQNCTDGQPSSSCEIPNILVQARFDAPPNCSSNSSLSCYAETGKDV  121

Query  1514  GFIGYENLTGTGCKSLFSAIS-SPAAAANTTA---VSLDIQVIELGWWLQGHCRCSKNAD  1347
              F+ +E +    CK L S+IS SP    N++A   + L+++V+ELGWWL+G C C KNA+
Sbjct  122   RFLDFEKVEHRDCKFLLSSISASPPQLLNSSAPPPLFLEVEVVELGWWLEGTCGCHKNAN  181

Query  1346  CNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTRCNPAKYLLGECGGKTRigvli  1167
             C T+ +P +G  GF C+C+ G  GDGY  GSGC +    CNPAKYL G+CGGKTR  VLI
Sbjct  182   CTTVVSP-NGTQGFTCKCNNGLLGDGYVAGSGCWKGSQVCNPAKYLSGQCGGKTRFIVLI  240

Query  1166  ggviagaaLMVSVGLICCIIRRRLAMKNWNRRRRELRETTG-ITIPVYSYKDIEKATNNF  990
             G  +     M+S+ LICC IRR+  +K     +R L E TG   IP Y YK+IEKATN F
Sbjct  241   GASL-----MISLALICCFIRRQSKLKARLCTKRLLSEATGNCNIPFYPYKEIEKATNGF  295

Query  989   SDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIKLLSSVNHPNLVRL  810
             S+K+ LG GAYGTVY+GKLHD  EWVAIKRI+HR  DSIEQV NEI+L+SSV H NLVRL
Sbjct  296   SEKQGLGTGAYGTVYAGKLHD--EWVAIKRIKHRGNDSIEQVMNEIRLISSVRHQNLVRL  353

Query  809   LGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVSETSQAIAYLHNAMHPP  630
             LGCSIE+GEQILVYEFM NGTL QHLQRE+G GL WP+RL I ++T+QAIA+LH+A+ PP
Sbjct  354   LGCSIERGEQILVYEFMANGTLCQHLQRERGDGLSWPIRLTIATQTAQAIAHLHSAIKPP  413

Query  629   IYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGTPGYLDPQYHQDFHLSD  450
             IYHRD+KSSNILLD N+K+K+ADFGLSR G+ ESSHISTAPQGTPGYLDPQYHQ+FHLSD
Sbjct  414   IYHRDIKSSNILLDCNFKAKLADFGLSRLGMAESSHISTAPQGTPGYLDPQYHQNFHLSD  473

Query  449   KSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLEIIDPLIEAEKDVW  270
             KSDVYSFGVVLVEIITGLKAVDF RPQNEVNLAALA D+IG+G L EIIDPL+E   D W
Sbjct  474   KSDVYSFGVVLVEIITGLKAVDFKRPQNEVNLAALATDRIGRGCLNEIIDPLLEPHMDAW  533

Query  269   TLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKW  147
             TL SV+KV E+AFRCLAFHRDMRPSMMEV  ELE ++LS+W
Sbjct  534   TLLSVHKVGELAFRCLAFHRDMRPSMMEVTAELELIKLSRW  574



>ref|XP_010070472.1| PREDICTED: wall-associated receptor kinase-like 14 [Eucalyptus 
grandis]
 gb|KCW59266.1| hypothetical protein EUGRSUZ_H01943 [Eucalyptus grandis]
 gb|KCW59267.1| hypothetical protein EUGRSUZ_H01943 [Eucalyptus grandis]
Length=695

 Score =   702 bits (1811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/590 (59%), Positives = 444/590 (75%), Gaps = 15/590 (3%)
 Frame = -3

Query  1889  STCNRSCGDG--LKQLPFPFGFSSGCEILLNCTSNGTMSIGEFPVYQLTPDTIMINIPAK  1716
             + CNRSCG G  +K++ +PFGFSS CEI L C  N  + +  F V  LT  +I++++PAK
Sbjct  26    ANCNRSCGTGTSVKRVNYPFGFSSDCEIQLGCADNSEIRVEGFRVLNLTTYSIIVDLPAK  85

Query  1715  CGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELK-CMIPSTMIQTQFELQDCGKDNISC  1539
             C RR+ ++  LFGKN+APT  NG L + C    L  C++P++ ++ +F+ + C  +NI+C
Sbjct  86    CNRRVASIHSLFGKNYAPTWTNGFLFRKCEGAHLSGCLVPTSFVKNRFQNETCRGENITC  145

Query  1538  FSEPHMTG-GFIGYENLTGTGCKSLFSAISSPAAAANTTAVSLDIQVIELGWWLQGHCRC  1362
             +S+    G   I Y +L  TGC+ LFS+I    AA +    S + Q +ELGWWL G C C
Sbjct  146   YSKESKEGVDLIEYGSLNHTGCEFLFSSI----AAVDPEKNSFEFQALELGWWLNGSCNC  201

Query  1361  SKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTRCNPAKYLLGECGGKTR  1182
             +KNA C  +    DG  GFRC+C  GF GDG+  G GCRR  + C  + Y    CG   R
Sbjct  202   TKNATCVRVSLV-DGGKGFRCKCDHGFEGDGFVHGEGCRRASS-CGTSNYFFRPCGRSRR  259

Query  1181  igvliggviagaaLMVSVGLICCIIRRR-LAMKNWNRRRRELRETTG-ITIPVYSYKDIE  1008
             IG+LIGG+ AGA+LM ++ +IC    RR    +N    +R LR+  G  ++P+Y YKDIE
Sbjct  260   IGILIGGLTAGASLMATLAVICFFAHRRSTTQRNQISAKRLLRDAAGNSSLPLYQYKDIE  319

Query  1007  KATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIKLLSSVNH  828
             ++TN FS+ +RLG GAYGTVY+G +H NDEWVAIK+IRHRDTDSI+QV NEIKLLSSV+H
Sbjct  320   RSTNGFSEGQRLGTGAYGTVYAGNIH-NDEWVAIKKIRHRDTDSIDQVLNEIKLLSSVSH  378

Query  827   PNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVSETSQAIAYLH  648
             PNLVRLLGC IE+GEQILVYE+MPNGTLSQHLQRE+G GLPW  RL I +ET++AIAYLH
Sbjct  379   PNLVRLLGCCIEQGEQILVYEYMPNGTLSQHLQRERGKGLPWTTRLTIAAETARAIAYLH  438

Query  647   NAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIES--SHISTAPQGTPGYLDPQY  474
             +A++PPIYHRD+KSSNILLDY Y+SKVADFGLSR G+ E+  SHISTAPQGTPGYLDPQY
Sbjct  439   SAVNPPIYHRDIKSSNILLDYQYRSKVADFGLSRLGMTETGDSHISTAPQGTPGYLDPQY  498

Query  473   HQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLEIIDPL  294
             HQ+FHLSDKSDVYSFGVVLVEI+T LK VDF+RP +EVNLAALAVD+IG+G + +IIDP 
Sbjct  499   HQNFHLSDKSDVYSFGVVLVEILTALKVVDFSRPHSEVNLAALAVDRIGRGCVDDIIDPF  558

Query  293   IEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKWG  144
             ++ ++D WTLSS++KVAE+AFRCLAFH+DMRPSM EVA ELEQ+RLS W 
Sbjct  559   LDPQRDAWTLSSIHKVAELAFRCLAFHKDMRPSMTEVAEELEQIRLSGWA  608



>ref|XP_002310180.1| hypothetical protein POPTR_0007s11990g [Populus trichocarpa]
 gb|EEE90630.1| hypothetical protein POPTR_0007s11990g [Populus trichocarpa]
Length=715

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/605 (59%), Positives = 454/605 (75%), Gaps = 29/605 (5%)
 Frame = -3

Query  1892  SSTCNRSCGDG--LKQLPFPFGFSSGCEILLNCTSN-GTMSIGEFPVYQLTPDTIMINIP  1722
             SS C  SCG G   K +P+PFGFS GC I+L C    G + IGEF V  +TP+ IMINI 
Sbjct  33    SSDCESSCGTGKSAKVVPYPFGFSRGCPIILQCNHTVGDVKIGEFQVQNITPNVIMINIL  92

Query  1721  AKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMIQTQFELQDCGK-DNI  1545
             A C R IE +KPLFGKNF P+SNN +LLQNC  P   C+IP++ ++   +L +C K DN+
Sbjct  93    ADCNRSIERIKPLFGKNFGPSSNNSLLLQNCDKPLNSCVIPTSSLRRDLKLTNCDKNDNL  152

Query  1544  SCFSEPHMTGGFIGYENLTGTGCKSLFSAISSPAAAANTTAVSLDIQVIELGWWLQG--H  1371
             +C+S+       +GY+N+T T CKS+FS++         +AVS     +EL WWL+G  +
Sbjct  153   NCYSQVPRDFDTLGYDNMTSTSCKSVFSSL---FLGWEGSAVSFQFGRVELEWWLEGGYN  209

Query  1370  CRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTRCNPAKYLLGECGG  1191
               CS NA+   ++   +G+ GFRC C++GF GDG+  G+GCR+  ++C+ +KY+ GECGG
Sbjct  210   NLCSNNANSTKVKL-WNGRVGFRCHCADGFAGDGFAAGNGCRK-VSKCSASKYMSGECGG  267

Query  1190  KTRigvliggviagaaLMVSV---GLI------------CCIIRRR-LAMKNWNRRRREL  1059
              TR+GVL+G     A   ++V   GLI            C  +RR+  +++N    +R L
Sbjct  268   TTRVGVLVGVFAVTAPAFLAVHFSGLIAGALLMAGLAFLCYYVRRKSTSLRNRLSAKRLL  327

Query  1058  RETTG-ITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDT  882
              E  G  ++P + YK+IEKATN FS+K RLG GAYGTVY+GKL ++D+ VAIK++RHRDT
Sbjct  328   CEAAGNSSVPFFQYKEIEKATNGFSEKHRLGIGAYGTVYAGKL-NSDDLVAIKKLRHRDT  386

Query  881   DSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPW  702
             DSI+QV NEIKLLSSV+HPNLVRLLGC IE+GE ILVYEFMPNGTL QHLQ+E+G+GLPW
Sbjct  387   DSIDQVMNEIKLLSSVSHPNLVRLLGCCIEEGEPILVYEFMPNGTLCQHLQQERGTGLPW  446

Query  701   PVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSH  522
              VRL + +ET++AIAYLH+AM+PPIYHRD+KSSNILLDYNY+SKVADFGLSR G++ESSH
Sbjct  447   TVRLTVATETAKAIAYLHSAMNPPIYHRDIKSSNILLDYNYRSKVADFGLSRLGMVESSH  506

Query  521   ISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALA  342
             ISTAPQGTPGYLDPQYHQ FHLSDKSDVYSFGVVLVEIIT LKAVDF+RP +EVNLAALA
Sbjct  507   ISTAPQGTPGYLDPQYHQYFHLSDKSDVYSFGVVLVEIITALKAVDFSRPHSEVNLAALA  566

Query  341   VDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQM  162
             +D+IG+G + EIIDP ++  +D WTL+S+  VAE+AFRCLAFHRDMRP+M+EVA ELEQ+
Sbjct  567   IDRIGRGCVDEIIDPYLDPNRDAWTLTSILSVAELAFRCLAFHRDMRPTMLEVAGELEQI  626

Query  161   RLSKW  147
              LS W
Sbjct  627   MLSAW  631



>ref|XP_008377371.1| PREDICTED: wall-associated receptor kinase-like 14 [Malus domestica]
Length=694

 Score =   701 bits (1810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/605 (61%), Positives = 457/605 (76%), Gaps = 12/605 (2%)
 Frame = -3

Query  1934  VLILLLLQSAMVFGSSTCNRSCGD-GLKQLPFPFGFSSGCEILLNCTSNGTMSIGEFPVY  1758
             +L +L+     +  ++ CN+SC   G   + +PFGFSSGCEI LNCT N   +IGEFP+ 
Sbjct  7     ILSVLVFPLLTIHAANHCNQSCPSFGPIPIQYPFGFSSGCEIQLNCTPNSGFAIGEFPIQ  66

Query  1757  QLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSS--PELKCMIPSTMIQ  1584
              +T D+I IN+ ++C R +  +  L+ +N+APTS N ILLQNC+   P   C IP+ ++Q
Sbjct  67    SITQDSIRINLQSRCNRPLHTLLHLYSRNYAPTSRNAILLQNCTDGRPSSSCEIPNILVQ  126

Query  1583  TQFELQ-DCGKDN-ISCFSEPHMTGGFIGYENLTGTGCKSLFSAIS--SPAAAANTTAVS  1416
              +F+   +C  ++ +SC++E      F+ + ++    CK L S+IS  SP    ++T + 
Sbjct  127   ARFDAPPNCSANSSLSCYAEARKDVQFLNFGSVEQKDCKFLLSSISAXSPQLLNSSTPLL  186

Query  1415  LDIQVIELGWWLQGHCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDD  1236
             L+++V+EL WWL+G C C KNA+C T+ +P +G  G+RC C EGF GDGY  G GCR+  
Sbjct  187   LEVEVVELEWWLEGTCGCDKNANCTTVVSP-NGTEGYRCNCKEGFDGDGYVAGLGCRKVS  245

Query  1235  TRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAMKNWNRRRRELR  1056
             + CNPAKYL GECGGKTR  VLIG V  GA+LM+S+ LICC IRR   +K  +  +R L 
Sbjct  246   STCNPAKYLSGECGGKTRFIVLIGAVFVGASLMISLALICCFIRRXSKLKARHSTKRLLS  305

Query  1055  ETTG-ITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTD  879
             E TG   IP YSYK+IEKAT +FSDK+RLG GAYGTVY+GKLHD  EWVAIKRI+HR  +
Sbjct  306   EATGNCNIPFYSYKEIEKATXSFSDKQRLGTGAYGTVYAGKLHD--EWVAIKRIKHRGHE  363

Query  878   SIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWP  699
             SI+QV NEIKL+SSV HPNLVRLLGCSIE+GEQILVYEFM NGTL QHLQRE+G GL W 
Sbjct  364   SIDQVMNEIKLISSVRHPNLVRLLGCSIERGEQILVYEFMGNGTLCQHLQRERGEGLSWL  423

Query  698   VRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHI  519
              RL I +ET++AI++LH+A+ PPIYHRD+KSSNILLD   KSKVADFGLSR G+ E+SHI
Sbjct  424   TRLTIAAETAKAISHLHSAVKPPIYHRDIKSSNILLDCKXKSKVADFGLSRLGMAETSHI  483

Query  518   STAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAV  339
             STAPQGTPGYLDPQYHQ+FHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALA 
Sbjct  484   STAPQGTPGYLDPQYHQNFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAT  543

Query  338   DKIGKGGLLEIIDPLIEA-EKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQM  162
             D+IG+G L EIIDP +E    D W LSSV+KVAE+AFRCLAF RDMRP+M+EV  ELE +
Sbjct  544   DRIGRGCLNEIIDPFLEPLLDDAWXLSSVHKVAELAFRCLAFQRDMRPTMIEVTAELELI  603

Query  161   RLSKW  147
             +LSKW
Sbjct  604   KLSKW  608



>ref|XP_010906921.1| PREDICTED: wall-associated receptor kinase-like 14 [Elaeis guineensis]
Length=683

 Score =   701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/588 (60%), Positives = 442/588 (75%), Gaps = 12/588 (2%)
 Frame = -3

Query  1883  CNRSCGDGLKQLPFPFGFSSGCEILLNCTS-NGTMSIGEFPVYQLTPDTIMINIPAKCGR  1707
             C R+CG     +PFPFGFS GC+I LNCT    T+ +G F V  +TPD+++I+IP  C R
Sbjct  26    CQRTCGS--TTVPFPFGFSQGCQIPLNCTGLPPTIRVGNFQVRNITPDSLLIDIPPVCNR  83

Query  1706  RIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMIQTQFELQDCGK--DNISCFS  1533
              + A++ LFGKN+A T  NG+ L+NC+S    C++P++++ +Q +L+ CG   DN +CFS
Sbjct  84    SVRAVESLFGKNYALTRRNGLFLRNCTSSSSGCLVPTSLL-SQKDLKSCGDKTDNTTCFS  142

Query  1532  EPHMTGGFIGYENLTGTGCKSLFSAI--SSPAAAANTTAVSLDIQVIELGWWLQGHCRCS  1359
             +   T GF+   N+   GC   +++I       A +   + L +Q   + WWL+G C CS
Sbjct  143   DDGSTDGFLAANNIINFGCNFFYTSIGFEQDGEAPDPKMLPLMLQTAVVDWWLEGRCWCS  202

Query  1358  KNADCNTMRTPGDGKPGFRCQCSEGFTGDGY--QGGSGCRR-DDTRCNPAKYLLGECGGK  1188
             K+A+C  + +P  GKPGFRC C  GF GDG+   G  GC++  D++CNP+KY+ G CG  
Sbjct  203   KHANCTNITSPSTGKPGFRCNCQGGFQGDGFADNGARGCQKVTDSKCNPSKYMSGSCGET  262

Query  1187  TRigvliggviagaaLMVSVGLICCIIRRRLAMKNWNRRRRELRETTGITIPVYSYKDIE  1008
              R+GVLIGG+ AGA +M  + L+CC+IRRR +     R  + L      T+P+Y YKDIE
Sbjct  263   ARVGVLIGGIAAGACVMAGLALVCCLIRRRSSSSRIRRSTKRLLSEASCTVPLYPYKDIE  322

Query  1007  KATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIKLLSSVNH  828
             KAT+ FSD RRLG GAYGTVY+GKL  ND+ VAIK+I+HRD D IEQV NEIKLLS V+H
Sbjct  323   KATDGFSDCRRLGTGAYGTVYAGKL-SNDKLVAIKKIKHRDADGIEQVINEIKLLSLVSH  381

Query  827   PNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVSETSQAIAYLH  648
             PNLVRLLGC IE+GEQILVYEFMPNGTL QHLQRE+G  LPW VRL I +ET+QAIAYLH
Sbjct  382   PNLVRLLGCCIERGEQILVYEFMPNGTLGQHLQRERGPALPWTVRLAIAAETAQAIAYLH  441

Query  647   NAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGTPGYLDPQYHQ  468
             +A+HPPI+HRD+KSSNILLD++YKSKVADFGLSR G+ ESSHISTAPQGTPGYLDPQYHQ
Sbjct  442   SAIHPPIFHRDIKSSNILLDFHYKSKVADFGLSRMGMTESSHISTAPQGTPGYLDPQYHQ  501

Query  467   DFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLEIIDPLIE  288
             +FHLSDKSDVYSFGVVLVEIIT LK VDF R Q+EVNLAALA+DKIG+G + EIIDP ++
Sbjct  502   NFHLSDKSDVYSFGVVLVEIITALKVVDFNRVQSEVNLAALAIDKIGRGCVDEIIDPYLD  561

Query  287   AEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKWG  144
               +D WTLSS++KVAE+AFRCLAFHRDMRPSM EVA ELE++R S W 
Sbjct  562   PNRDAWTLSSIHKVAELAFRCLAFHRDMRPSMTEVADELERIRRSGWA  609



>ref|XP_011004593.1| PREDICTED: wall-associated receptor kinase-like 14 [Populus euphratica]
Length=702

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/659 (56%), Positives = 481/659 (73%), Gaps = 39/659 (6%)
 Frame = -3

Query  1889  STCNRSCGDG--LKQLPFPFGFSSGCEILLNCTSN-GTMSIGEFPVYQLTPDTIMINIPA  1719
             S C  SCG G   + +P+PFGFS+GC I LNC S  G + IGEF V  +TP  I++N+PA
Sbjct  33    SNCASSCGIGKSARVVPYPFGFSNGCPIQLNCESTEGEIKIGEFQVQNITPKGILVNLPA  92

Query  1718  KCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMIQTQFELQDC---GKDN  1548
              C R IE ++PLF  N+ P+  N +LLQ+CS     C+I  + +Q +   ++C     DN
Sbjct  93    DCNRSIETIRPLFSLNYGPSWQNSLLLQDCSKLLNSCVISRSPLQGELHSKNCEAAKNDN  152

Query  1547  ISCFSEPHMTGGFIGYENLTGTGCKSLFSAISSPAAAANTTAVSLDIQVIELGWWLQGHC  1368
             +SC+S+P+     + YE +  T C+S+FS++   A  +++  VS   + IEL WW++GHC
Sbjct  153   LSCYSQPYSGFDTLSYEGVNSTQCRSVFSSL---ALGSDSPVVSFQYETIELEWWIEGHC  209

Query  1367  R---CSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTRCNPAKYLLGEC  1197
             R   CSKN +C+ ++   +G  G+RC C +GF GDG+  G+GCRR  ++CN ++Y+ G C
Sbjct  210   RDNVCSKNGNCSQVKLQ-NGSVGYRCHCYDGFDGDGFTTGNGCRRV-SKCNASRYMSGHC  267

Query  1196  GGKTRigvliggviagaaLMVSVGLICCIIRRR-LAMKNWNRRRRELRETTG-ITIPVYS  1023
             GG TR+ VL+GG++AGA+LM    L+C  ++++  +M+N +  +R L E  G  ++P + 
Sbjct  268   GGTTRVVVLVGGLVAGASLMAVFALLCYFVKKKSTSMRNRSSAKRLLCEAAGNSSVPFFQ  327

Query  1022  YKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIKLL  843
             YK+IE+ATN FS+K+RLG GAYGTVYSGKLH ND+ VAIK+I+ RDTDS++ V NEIKLL
Sbjct  328   YKEIERATNGFSEKQRLGTGAYGTVYSGKLH-NDDLVAIKKIKQRDTDSLDLVMNEIKLL  386

Query  842   SSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVSETSQA  663
             SSV+HPNLVRLLGC +E+GE ILVYEFMPNGTL QHLQRE+G+GLPW VRL + +ET+ A
Sbjct  387   SSVSHPNLVRLLGCCLEEGEPILVYEFMPNGTLCQHLQRERGNGLPWTVRLTVAAETANA  446

Query  662   IAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGTPGYLD  483
             IAYLH+ ++PPIYHRD+KSSNILLDYNY+SKVADFGLSR G+ ESSHISTAPQGTPGYLD
Sbjct  447   IAYLHSVVNPPIYHRDIKSSNILLDYNYRSKVADFGLSRLGMEESSHISTAPQGTPGYLD  506

Query  482   PQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLEII  303
             PQYHQ FHLSDKSDVYSFGVVLVEIIT  K VDF+RP +EVNLAALA+D+IG+G + EI+
Sbjct  507   PQYHQYFHLSDKSDVYSFGVVLVEIITAQKVVDFSRPHSEVNLAALAIDRIGRGCVDEIV  566

Query  302   DPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKWGIsedsii  123
             DP ++ ++D WTLSS++ VAE+AFRCLAFHRDMRP+MMEVA ELEQ+RLS W     ++ 
Sbjct  567   DPYLDPDRDAWTLSSIHSVAELAFRCLAFHRDMRPTMMEVAEELEQIRLSAW---VPTMY  623

Query  122   tassssssrsssdasEKPLSFSTMKPS-------------------EKVTESSPVSVQD  3
              AS SSSS  S   S+K LS S  K +                   E+V +SSPVSVQD
Sbjct  624   MASPSSSSHFSDHGSQKSLSVSVGKKAAVASRRLLVPQRTDSLTSLEEVKDSSPVSVQD  682



>ref|XP_007204625.1| hypothetical protein PRUPE_ppa002163mg [Prunus persica]
 gb|EMJ05824.1| hypothetical protein PRUPE_ppa002163mg [Prunus persica]
Length=707

 Score =   699 bits (1805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/592 (60%), Positives = 444/592 (75%), Gaps = 15/592 (3%)
 Frame = -3

Query  1892  SSTCNRSCGDG--LKQLPFPFGFSSGCEILLNCTSNGTMSIGEFPVYQLTPDTIMINIPA  1719
             SS+CN +CG G   K + +PFGFS GC I LNC+    + +GEF V  +T  +I +++PA
Sbjct  32    SSSCNPTCGSGKSAKSVQYPFGFSKGCVIPLNCSDKNEIKLGEFTVQDVTRSSIFVHLPA  91

Query  1718  KCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMIQTQFELQDCGKDNISC  1539
             KC R+ +++ PLFG NF P+ NN +L QNC+SP   C IP+  +Q +F L  C  DNI+C
Sbjct  92    KCNRKYQSIAPLFGLNFGPSWNNSLLFQNCTSPLPGCQIPAEFVQKRFNLSSC--DNITC  149

Query  1538  FSEPHMTGGFIGYENLTGTGCKSLFSAISSPAAAANTTAVSLDIQVIELGWWLQGHC-RC  1362
              S+P      + +E+L  T CK LF + S    +   + +SL+ + ++LGWW+      C
Sbjct  150   MSQPPNGSDIMTFEDLNRTRCKYLFGSFS--VQSGRDSLLSLEFETLQLGWWVNTSLGEC  207

Query  1361  SKNADCNTMRTPGDGKP-GFRCQCSEGFTGDGYQGGSGCR---RDDTRCNPAKYLLGECG  1194
               NA   T++ PG GKP G RC C+ GF GDG++ GSGC+   +  + CN +KY+ G CG
Sbjct  208   HSNAMSTTVK-PGGGKPPGCRCSCNAGFDGDGFKLGSGCQPVSQPVSHCNASKYMSGRCG  266

Query  1193  GKTRigvliggviagaaLMVSVGLICCIIRRR-LAMKNWNRRRRELRETTG-ITIPVYSY  1020
             G TR+ VLIGG +AGA LM  + L+C  +RRR   ++N    RR L E  G  ++P+Y Y
Sbjct  267   GTTRVAVLIGGFVAGAFLMAGLFLLCYFVRRRSTCLRNQLCARRLLSEAAGNSSVPLYPY  326

Query  1019  KDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIKLLS  840
             K+IE+ATN F++K+RLG GA+G VY+GKLH NDEWVAIK+I  RDT+SI+QV NEIKLLS
Sbjct  327   KEIERATNCFAEKQRLGTGAFGIVYAGKLH-NDEWVAIKKINRRDTNSIDQVMNEIKLLS  385

Query  839   SVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVSETSQAI  660
             SV+HPNLVRLLGC IE GEQILVYE+MPNGTLS+HLQRE+G GLPW +RL I +ET+ AI
Sbjct  386   SVSHPNLVRLLGCCIEGGEQILVYEYMPNGTLSEHLQRERGQGLPWTIRLTIAAETANAI  445

Query  659   AYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGTPGYLDP  480
             AYLH+AM+PPIYHRD+KSSNILLDYNYKSKVADFGLSR G+ ESS+ISTAPQGTPGY+DP
Sbjct  446   AYLHSAMNPPIYHRDIKSSNILLDYNYKSKVADFGLSRLGMTESSYISTAPQGTPGYVDP  505

Query  479   QYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLEIID  300
             QYHQ+FHLSDKSDVYSFGVVLVEIIT +K VDF RPQ+EVNLAALA+D+IGKG + EI+D
Sbjct  506   QYHQNFHLSDKSDVYSFGVVLVEIITAMKVVDFARPQSEVNLAALAIDRIGKGCVDEIVD  565

Query  299   PLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKWG  144
             P +E  +D WTL SVNKVAE+AFRCLAFH DMRPSM+EVA ELE +R S W 
Sbjct  566   PFLEPNRDAWTLYSVNKVAELAFRCLAFHSDMRPSMIEVAEELEYVRRSGWA  617



>ref|XP_003611850.1| Kinase-like protein [Medicago truncatula]
 gb|AES94808.1| wall associated kinase-like protein [Medicago truncatula]
Length=700

 Score =   698 bits (1802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/607 (59%), Positives = 448/607 (74%), Gaps = 17/607 (3%)
 Frame = -3

Query  1943  MIPVLILLLLQSAMVFGSSTCNRSCGDGLKQLPFPFGFSSGCEILLNCTSNGTMSIGEFP  1764
             +I + +L   ++     ++TC   CGD  + L +PFG S GC I LNCT+N  + I +F 
Sbjct  15    IITIFLLSKTRAQNNSNNTTCLNRCGD--ETLQYPFGISEGCGIKLNCTNN-KVQIDDFL  71

Query  1763  VYQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMI-  1587
             +  LT ++I I +PAKC R I +++PLF  NFAPT NN  L+Q+CS+    C+IP++   
Sbjct  72    IQNLTKNSIFIYLPAKCNRSIASIRPLFNDNFAPTRNNSFLVQDCSASLGGCVIPASSFG  131

Query  1586  --QTQFELQDCGKDNISCFSEPHMTGGF--IGYENLTGTGCKSLFSAISSPAAAANTTAV  1419
               Q + E  D    NISCF++ +  G    + Y+ L  T C  LFSAI    A      +
Sbjct  132   GNQIEVESCDSKSSNISCFTQEYHEGDVDVLSYDELNKTKCNYLFSAI----AVEQNKEI  187

Query  1418  SLDIQVIELGWWLQGHCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRD  1239
             SL  Q IELGWWLQG C CS NA C+T+   G+G  GFRCQC +GF GDG+  G+GCR+ 
Sbjct  188   SLQFQAIELGWWLQGSCECSNNATCSTVNLQGNGT-GFRCQCVDGFRGDGFASGTGCRKA  246

Query  1238  DTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLA-MKNWNRRRRE  1062
              + C+ +    G CG  T+IGV++G V+AG  ++ ++ LI    RRR   ++   R +R 
Sbjct  247   PS-CSASTITSGGCGSATKIGVVVGAVVAGVVIVAALILIWYCARRRFTWLRKHTRVKRL  305

Query  1061  LRETTGITI-PVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRD  885
             LRE  G +I P+Y+YKDIEKATN+FSDK  LG GA+GTVY+GKLH NDE+VAIK+IRHRD
Sbjct  306   LREAAGNSIVPLYAYKDIEKATNSFSDKHMLGTGAFGTVYAGKLH-NDEFVAIKKIRHRD  364

Query  884   TDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLP  705
             T+S++QV NEIKLLSSV+HPNLVRLLGC IE+GEQILVYE+MP+GTLSQHLQRE+G GLP
Sbjct  365   TNSVDQVMNEIKLLSSVSHPNLVRLLGCCIEEGEQILVYEYMPHGTLSQHLQRERGKGLP  424

Query  704   WPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESS  525
             W +RL I SET+ AIAYLH+A+HPPIYHRD+KSSNILLDYNYKSKVADFGLSR GL+E+S
Sbjct  425   WTIRLTIASETANAIAYLHSAIHPPIYHRDIKSSNILLDYNYKSKVADFGLSRLGLMETS  484

Query  524   HISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAAL  345
             HISTAPQGTPGY+DPQYHQ+FHLSDKSDVYSFGVVLVEIIT +K VDF RPQ+E+NLAAL
Sbjct  485   HISTAPQGTPGYVDPQYHQNFHLSDKSDVYSFGVVLVEIITAMKVVDFGRPQSEINLAAL  544

Query  344   AVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQ  165
             AVD+I +G + EI+DP +E  +D WTL S++KVAE+AFRCLAFH D RP+MMEVA ELE 
Sbjct  545   AVDRIRRGSVDEIVDPFLEPNRDAWTLYSIHKVAELAFRCLAFHSDTRPTMMEVAEELEY  604

Query  164   MRLSKWG  144
             +R   W 
Sbjct  605   IRRRAWA  611



>gb|EYU45087.1| hypothetical protein MIMGU_mgv1a002843mg [Erythranthe guttata]
Length=631

 Score =   694 bits (1792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/550 (65%), Positives = 430/550 (78%), Gaps = 28/550 (5%)
 Frame = -3

Query  1715  CGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPE-LKCMIPSTMIQTQFELQDCG------  1557
             CGR +EA++ L+  NFAPT++N ILL++C++ +   C IP+TM+QT FEL +C       
Sbjct  2     CGRPVEALRRLYAGNFAPTAHNAILLRDCAASQSTGCFIPTTMVQTHFELLECAAGGGGG  61

Query  1556  --KDNISCFSEPHMTGGFIGYENLTGTGCKSLFSAISSPAAAANTTAVSLDIQVIELGWW  1383
                 ++SC+SE   T  FI Y NLT +GC++LFSAIS   + AN+++VSLD+Q++ LGWW
Sbjct  62    GKNASVSCYSEQDNTTSFIDYRNLTRSGCRTLFSAISM-ESFANSSSVSLDMQIVRLGWW  120

Query  1382  LQGHCRCSKNADCNTMRTPGDGKP---GFRCQCSEGFTGDGYQGGSGCRRDDTRCNPAKY  1212
             L G CRCS+NA C  +  P    P    +RC+C +GF GDG+  G GCR++   CNP+KY
Sbjct  121   LHGKCRCSENAKCVHVSPPSGRNPPPAAYRCECLDGFAGDGFLDGIGCRKESLACNPSKY  180

Query  1211  LLGECGGKTRigvli--------ggviagaaLMVSVGLICCIIRRRLAMKNWNRRRRELR  1056
             L G+CGG TR+GVL+         GV AGA+LMV +GL+ C IR++   +  +R+ R+L 
Sbjct  181   LSGQCGGTTRVGVLVGVIGPPVLSGVAAGASLMVGLGLVFCFIRKKSKSRRISRKSRKLC  240

Query  1055  ETTGITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDND-EWVAIKRIRHRDTD  879
             ET GITIP+Y++K+IEKATN+FS+KRRLG+GA+GTVYSGKL     +WVAIKRIR RD +
Sbjct  241   ETKGITIPIYTHKEIEKATNSFSEKRRLGNGAHGTVYSGKLTGGGGDWVAIKRIRRRDAE  300

Query  878   SIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGE-QILVYEFMPNGTLSQHLQREK----GS  714
             S +QV NE+KLLSSVNHPNLVRLLGCSIE  E QILVYE+MPNGTLSQHL  EK    G 
Sbjct  301   STDQVINEVKLLSSVNHPNLVRLLGCSIEDHEEQILVYEYMPNGTLSQHLHGEKRGGGGG  360

Query  713   GLPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLI  534
             GLPWPVRL + SET+QA+AYLHNA HPPIYHRD+KSSNILLDYNYKSKVADFGLSR GL 
Sbjct  361   GLPWPVRLAVASETAQAVAYLHNATHPPIYHRDIKSSNILLDYNYKSKVADFGLSRLGLT  420

Query  533   ESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNL  354
             ESSHISTAPQGTPGYLDPQYHQ FHLSDKSDVYSFGVVLVEIIT L+ VDF RPQNEVNL
Sbjct  421   ESSHISTAPQGTPGYLDPQYHQHFHLSDKSDVYSFGVVLVEIITALRVVDFDRPQNEVNL  480

Query  353   AALAVDKIGKGGLLEIIDPLIE-AEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAI  177
             A+LAVD+IG+G L EIIDP +E A  D WT SS++KVAE+AFRCLAFHRDMRPSMMEVA+
Sbjct  481   ASLAVDRIGRGCLDEIIDPFLERAGLDSWTRSSIHKVAELAFRCLAFHRDMRPSMMEVAV  540

Query  176   ELEQMRLSKW  147
             ELE +R SKW
Sbjct  541   ELELIRQSKW  550



>gb|ABK96380.1| unknown [Populus trichocarpa x Populus deltoides]
Length=703

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/593 (60%), Positives = 452/593 (76%), Gaps = 17/593 (3%)
 Frame = -3

Query  1892  SSTCNRSCGDG--LKQLPFPFGFSSGCEILLNCTSN-GTMSIGEFPVYQLTPDTIMINIP  1722
             SS C  SCG G   K +P+PFGFS GC I+L C    G + IGEF V  +TP+ IMINI 
Sbjct  33    SSDCESSCGSGKSAKVVPYPFGFSIGCPIILQCNHTVGDVKIGEFQVQNITPNVIMINIL  92

Query  1721  AKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMIQTQFELQDCGKDN--  1548
             A C R IE +KPLFGKNF P+S N +LLQNC  P   C+I ++ ++   +L +CG  N  
Sbjct  93    ADCNRSIERIKPLFGKNFCPSSKNSLLLQNCDKPLNSCVIRTSSLRRDLKLTNCGDKNYD  152

Query  1547  ISCFSEPHMTGGFIGYENLTGTGCKSLFSAISSPAAAANTTAVSLDIQVIELGWWLQGHC  1368
             ++C+S+       +GY+N+T T CKS+FS++         +AVS   + +EL WWL+G  
Sbjct  153   LNCYSQVPRDFDTLGYDNMTSTRCKSVFSSL---FRGWEGSAVSFQFERVELEWWLEGDS  209

Query  1367  R--CSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTRCNPAKYLLGECG  1194
                CS NA+   ++   +G+ GFRC C++GF GDG+  G+GCR+  ++C+ +KY+ GECG
Sbjct  210   NNLCSNNANSTKVKL-WNGRGGFRCHCADGFAGDGFAAGNGCRKV-SKCSASKYMSGECG  267

Query  1193  GKTRigvliggviagaaLMVSVGLICCIIRRR---LAMKNWNRRRRELRETTG-ITIPVY  1026
             G TR+GVL+GG+IAGA LM  +  +C  + R+    + +N    +R L E  G  ++P +
Sbjct  268   GTTRVGVLVGGLIAGALLMAGLAFLCYYVWRKSTSTSSRNRLSAKRLLCEAAGNSSVPFF  327

Query  1025  SYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIKL  846
              YK+IEKATN FS+K RLG GAYGTVY+GKL ++D+ VAIK++RHRDTDSI+QV NEIKL
Sbjct  328   QYKEIEKATNGFSEKHRLGIGAYGTVYAGKL-NSDDLVAIKKLRHRDTDSIDQVMNEIKL  386

Query  845   LSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVSETSQ  666
             LSSV+HPNLVRLLGC IE+GE ILVYEFMPNGTL QHLQ+E+G+GLPW VRL + +ET++
Sbjct  387   LSSVSHPNLVRLLGCCIEEGEPILVYEFMPNGTLCQHLQQERGTGLPWTVRLTVAAETAK  446

Query  665   AIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGTPGYL  486
             AIAYLH+AM+PPIYHRD+KSSNILLDYNY+SKVADFGLSR G++ESSHISTAPQGTPGYL
Sbjct  447   AIAYLHSAMNPPIYHRDIKSSNILLDYNYRSKVADFGLSRLGMVESSHISTAPQGTPGYL  506

Query  485   DPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLEI  306
             DPQYHQ FHLSDKSDVYSFGVVLVEIIT LKAVDF+RP ++VNLAALA+D+IG+G + EI
Sbjct  507   DPQYHQYFHLSDKSDVYSFGVVLVEIITALKAVDFSRPHSDVNLAALAIDRIGRGCVDEI  566

Query  305   IDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKW  147
             IDP ++  +D WTL+S+  VAE+AFRCLAFHRDMRP+M+EVA ELEQ+ LS W
Sbjct  567   IDPYLDPNRDAWTLTSILSVAELAFRCLAFHRDMRPTMLEVAGELEQIMLSAW  619



>ref|XP_011025667.1| PREDICTED: wall-associated receptor kinase-like 14 [Populus euphratica]
Length=701

 Score =   694 bits (1792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/591 (60%), Positives = 449/591 (76%), Gaps = 15/591 (3%)
 Frame = -3

Query  1892  SSTCNRSCGDG--LKQLPFPFGFSSGCEILLNCTSN-GTMSIGEFPVYQLTPDTIMINIP  1722
             SS C  SCG G   K +P+PFGFS GC I L C    G + IGEF V  +TP+ I+IN  
Sbjct  33    SSDCESSCGTGKSAKVVPYPFGFSRGCPIFLQCNHTVGDVKIGEFQVQNITPNVIVINFL  92

Query  1721  AKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMIQTQFELQDCGKDN--  1548
             A C R IE +KPLFGKNF P+SNN +LLQNC  P   C+I ++ +Q   +L +C   N  
Sbjct  93    ADCDRSIERIKPLFGKNFGPSSNNSLLLQNCDKPLNSCVITTSSLQRDLKLTNCDDKNYD  152

Query  1547  ISCFSEPHMTGGFIGYENLTGTGCKSLFSAISSPAAAANTTAVSLDIQVIELGWWLQGHC  1368
             ++C+S+       +GY+N+T T CKS+FS++         +AVS   + +EL WWL+G  
Sbjct  153   LNCYSQVPREFDTLGYDNMTSTRCKSVFSSL---FLGWEGSAVSFQFERVELEWWLEGDS  209

Query  1367  R--CSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTRCNPAKYLLGECG  1194
                CS NA+   ++    G  GFRC C++GF GDG+  G+GCR+  ++C+ +KY+ GECG
Sbjct  210   NHLCSNNANSTKVKL-WHGGVGFRCHCADGFAGDGFANGNGCRKV-SKCSASKYMSGECG  267

Query  1193  GKTRigvliggviagaaLMVSVGLICCIIRRR-LAMKNWNRRRRELRETTG-ITIPVYSY  1020
             G TR+GVL+GG+IAGA LM  +  +C  +RR+  +++N    +R L E  G  ++P + Y
Sbjct  268   GTTRVGVLVGGLIAGALLMAGLAFLCYYVRRKSTSLRNRLSAKRLLCEAAGNSSVPFFQY  327

Query  1019  KDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIKLLS  840
             K+IEKATN FS+K RLG GAYGTVY+GKL ++D+ VAIK++RHRDTDSI+QV NEIKLLS
Sbjct  328   KEIEKATNGFSEKHRLGIGAYGTVYAGKL-NSDDLVAIKKLRHRDTDSIDQVMNEIKLLS  386

Query  839   SVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVSETSQAI  660
             SV+HPNLVRLLGC IE+GE ILVYEFMPNGTL QHLQ+E+G+GLPW VRL + +ET++AI
Sbjct  387   SVSHPNLVRLLGCCIEEGEPILVYEFMPNGTLCQHLQQERGTGLPWTVRLTVATETAKAI  446

Query  659   AYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGTPGYLDP  480
             AYLH+ M+PPIYHRD+KSSNILLDY+Y+SKVADFGLSR G++ESSHISTAPQGTPGYLDP
Sbjct  447   AYLHSVMNPPIYHRDIKSSNILLDYSYRSKVADFGLSRLGMVESSHISTAPQGTPGYLDP  506

Query  479   QYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLEIID  300
             QYHQ FHLSDKSDVYSFGVVLVEIIT LKAVDF+RP +EVNLAALA+D+IG+G + EIID
Sbjct  507   QYHQYFHLSDKSDVYSFGVVLVEIITALKAVDFSRPHSEVNLAALAIDRIGRGCVDEIID  566

Query  299   PLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKW  147
             P ++  +D WTL+S+  VAE+AFRCLAFHRDMRP+M+EVA ELEQ+ LS W
Sbjct  567   PYLDPCRDAWTLTSILSVAELAFRCLAFHRDMRPTMLEVAEELEQIMLSAW  617



>ref|XP_006338251.1| PREDICTED: wall-associated receptor kinase-like 14-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006338252.1| PREDICTED: wall-associated receptor kinase-like 14-like isoform 
X2 [Solanum tuberosum]
Length=703

 Score =   694 bits (1790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/610 (58%), Positives = 454/610 (74%), Gaps = 15/610 (2%)
 Frame = -3

Query  1943  MIPVLILLLLQSAMVFGSSTCNRSCGDGLKQLP---FPFGFSSGCEILLNCT-SNGTMSI  1776
             +  +L+  L  S     S+ CN+ CG      P   +PFGFS GC I L+CT S+G + I
Sbjct  12    VFSILLGWLSSSVEATNSTKCNQYCGAAGSNGPRVSYPFGFSDGCGIRLDCTESSGEIRI  71

Query  1775  GEFPVYQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPS  1596
             GE+ +  +T +T+M+N P  C R IE ++     NF  T  NG+LL NC  P  +C IPS
Sbjct  72    GEYIIQNVTSETLMVNFPMNCSRPIEDLQEFDRTNFGMTWRNGLLLHNCKVPRSECTIPS  131

Query  1595  TMIQTQFELQDCG--KDNISCFSEPHMTGGFIGYENLTGTGCKSLFSAI--SSPAAAANT  1428
              ++ T+  +Q C   K+N+SC+SE      ++ Y+ L  TGC ++ S+I          +
Sbjct  132   EILSTRLNIQSCDSKKENVSCYSEAR--ADYLDYQKLKNTGCGTVVSSILIGMDNDTMKS  189

Query  1427  TAVSLDIQVIELGWWLQGHCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGC  1248
             +A+ L+ Q +EL W L G C C  +A+C  +  PG+ K GFRC+C +GF GDG++ G GC
Sbjct  190   SAMFLEFQTMELAWGLVGDCACHDDANCTIVSLPGNRK-GFRCRCKDGFVGDGFRDGDGC  248

Query  1247  RRDDTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLIC-CIIRRRLAMKNWNRR  1071
             R+  +RCNP++YL G CGG TRIGVL+GG+IAGA LM ++ ++C CI RR  ++K     
Sbjct  249   RKV-SRCNPSRYLSGRCGGTTRIGVLVGGIIAGAGLMAALAVLCYCIRRRSTSLKKRMSA  307

Query  1070  RRELRETTGI-TIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIR  894
             RR L E  G  ++ V+ YK+IE+ATN+FS+K+RLG GAYGTVY+GKLH +DEWVAIK++R
Sbjct  308   RRLLSEAAGSNSVHVFQYKEIERATNSFSEKQRLGIGAYGTVYAGKLH-SDEWVAIKKLR  366

Query  893   HRDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGS  714
             HRD D +EQV NE+KLLSSV+HPNLVRLLGC IE GEQILVYEFMPNGT++QHLQRE+GS
Sbjct  367   HRDPDGVEQVMNEVKLLSSVSHPNLVRLLGCCIENGEQILVYEFMPNGTVAQHLQRERGS  426

Query  713   GLPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLI  534
             GLPW +RL I +ET+ AIA+LH+AM+PPIYHRD+KSSNILLDYN+ SKVADFGLSRFG+ 
Sbjct  427   GLPWTIRLTIATETAHAIAHLHSAMNPPIYHRDIKSSNILLDYNFNSKVADFGLSRFGMT  486

Query  533   ESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNL  354
             + SHISTAPQGTPGY+DPQYHQ++HLSDKSDVYSFGVVLVEIIT +K VDF+R  +E+NL
Sbjct  487   DDSHISTAPQGTPGYVDPQYHQNYHLSDKSDVYSFGVVLVEIITAMKVVDFSRSHSEINL  546

Query  353   AALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIE  174
             AALA+D+IGKG + EIIDP +E  +D WTLSSV++VAE+AFRCLAFH+DMRPSM EVA E
Sbjct  547   AALAIDRIGKGRVDEIIDPFLEPHRDAWTLSSVHRVAELAFRCLAFHKDMRPSMTEVADE  606

Query  173   LEQMRLSKWG  144
             LEQ+RLS W 
Sbjct  607   LEQVRLSSWA  616



>gb|AAS45124.1| WAK-like kinase [Solanum lycopersicum]
Length=703

 Score =   692 bits (1787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/610 (58%), Positives = 452/610 (74%), Gaps = 15/610 (2%)
 Frame = -3

Query  1943  MIPVLILLLLQSAMVFGSSTCNRSCGDGLKQLP---FPFGFSSGCEILLNCT-SNGTMSI  1776
             +  +L+  L  S     S+ CN+ CG      P   +PFGFS GC I L+CT S G + I
Sbjct  12    VFSILLGWLSSSVEATNSTKCNQYCGAAGSYSPRVSYPFGFSEGCGIRLDCTESTGEIRI  71

Query  1775  GEFPVYQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPS  1596
             GE+ +  +T +T+M+N    C R IE ++     NF  T  NG+LL NC  P+ +C IPS
Sbjct  72    GEYIIQNVTSETLMVNFSMNCSRPIEDLQQFDRTNFGMTWRNGLLLHNCKVPKSECTIPS  131

Query  1595  TMIQTQFELQDCG--KDNISCFSEPHMTGGFIGYENLTGTGCKSLFSAI--SSPAAAANT  1428
              ++ T+  +Q C   K+N+SC+SE      ++ Y+ L  TGC ++ S+I          +
Sbjct  132   EILSTRLNIQSCDSKKENVSCYSEAR--ADYLDYQKLKNTGCGTVISSILIGMDNDTMKS  189

Query  1427  TAVSLDIQVIELGWWLQGHCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGC  1248
             +A+ ++ Q +EL W L+G C C  +A+C  +  PG+ K GFRC+C +GF GDG+  G GC
Sbjct  190   SAMFIEFQTMELAWGLEGDCACHNDANCTNVSLPGNRK-GFRCRCKDGFVGDGFSDGDGC  248

Query  1247  RRDDTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLIC-CIIRRRLAMKNWNRR  1071
             R+  +RCNP++YL G CGG TRIGVL+GG+IAGA LM ++ ++C CI RR  ++K     
Sbjct  249   RKV-SRCNPSRYLSGRCGGTTRIGVLVGGIIAGAGLMAALAVLCYCIRRRSASLKKRMSA  307

Query  1070  RRELRETTGI-TIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIR  894
             RR L E  G  ++ V+ YK+IE+ATN+FS+K+RLG GAYGTVY+GKLH +DEWVAIK++R
Sbjct  308   RRLLSEAAGSNSVHVFQYKEIERATNSFSEKQRLGIGAYGTVYAGKLH-SDEWVAIKKLR  366

Query  893   HRDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGS  714
             HRD D +EQV NE+KLLSSV+HPNLVRLLGC IE GEQILVYEFMPNGTL+QHLQRE+ S
Sbjct  367   HRDPDGVEQVMNEVKLLSSVSHPNLVRLLGCCIENGEQILVYEFMPNGTLAQHLQRERSS  426

Query  713   GLPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLI  534
             GLPW +RL I +ET+ AIA+LH+AM+PPIYHRD+KSSNILLDYN+ SKVADFGLSRFG+ 
Sbjct  427   GLPWTIRLTIATETAHAIAHLHSAMNPPIYHRDIKSSNILLDYNFNSKVADFGLSRFGMT  486

Query  533   ESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNL  354
             + SHISTAPQGTPGY+DPQYHQ++HLSDKSDVYSFGVVLVEIIT +K VDF+R  +E+NL
Sbjct  487   DDSHISTAPQGTPGYVDPQYHQNYHLSDKSDVYSFGVVLVEIITAMKVVDFSRSHSEINL  546

Query  353   AALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIE  174
             AALA+D+IGKG + EIIDP +E  +D WTLSSV++VAE+AFRCLAFHRDMRPSM EVA E
Sbjct  547   AALAIDRIGKGRVDEIIDPFLEPHRDAWTLSSVHRVAELAFRCLAFHRDMRPSMTEVADE  606

Query  173   LEQMRLSKWG  144
             LEQ+RLS W 
Sbjct  607   LEQIRLSSWA  616



>ref|XP_009365635.1| PREDICTED: wall-associated receptor kinase-like 14 [Pyrus x bretschneideri]
Length=697

 Score =   692 bits (1786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/608 (61%), Positives = 456/608 (75%), Gaps = 12/608 (2%)
 Frame = -3

Query  1943  MIPVLILLLLQSAMVFGSSTCNRSCGDGLK-QLPFPFGFSSGCEILLNCTSNGTMSIGEF  1767
             ++ VL+  LL       S+ CN+SC   +   + +PFGFSSGCEI LNC  N   +IGEF
Sbjct  7     ILSVLVFPLLTIHASNDSNHCNQSCPSFVPGPIQYPFGFSSGCEIQLNCPPNSGFAIGEF  66

Query  1766  PVYQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSS--PELKCMIPST  1593
             P+  +T D I IN+ + C R +  ++ L+ +N+APTS N ILL+NC+   P   C IP  
Sbjct  67    PIQSITQDNIRINLQSSCNRPLHTLRHLYSRNYAPTSRNAILLRNCTDGRPSSSCEIPDI  126

Query  1592  MIQTQFELQ-DCGKDN-ISCFSEPHMTGGFIGYENLTGTGCKSLFSAISSPAAAA-NTTA  1422
             ++Q +F+   +C  ++ +SC++E      F+   ++    CK L S+IS+P+    N++A
Sbjct  127   LVQARFDAPPNCSANSSLSCYAETRKDVRFLDVGSVERKDCKFLLSSISAPSPQLLNSSA  186

Query  1421  -VSLDIQVIELGWWLQGHCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCR  1245
              + L+++V+EL WWL+G C C KNA+C T+ +P +G  G+RC C EGF GDGY  G GCR
Sbjct  187   PLLLEVEVVELEWWLEGTCGCDKNANCTTVVSP-NGTEGYRCNCKEGFGGDGYVAGLGCR  245

Query  1244  RDDTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAMKNWNRRRR  1065
             +  + CNPAKYL GECGGK R  VLIG V  GA+LM+S+ LICC IRR+  +K  +  +R
Sbjct  246   KVSSTCNPAKYLSGECGGKARFIVLIGAVFVGASLMISLALICCFIRRQSKLKARHSTKR  305

Query  1064  ELRETTG-ITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHR  888
              L E TG   IP YSYK IEKATN+FSDK+RLG GAYGTVY+GKLHD  EWVAIKRI+HR
Sbjct  306   LLSEATGNCDIPFYSYKQIEKATNSFSDKQRLGTGAYGTVYAGKLHD--EWVAIKRIKHR  363

Query  887   DTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGL  708
               +SI+QV NEIKL+SSV HPNLVRLLGCSIE+GEQILVYEFM NGTL QHLQ E+G GL
Sbjct  364   GHESIDQVMNEIKLISSVRHPNLVRLLGCSIERGEQILVYEFMGNGTLCQHLQGERGEGL  423

Query  707   PWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIES  528
              W  RL I +ET +AI++LH+A+ PPIYHRD+KSSNILLD  +KSKVADFGLSR G+ E+
Sbjct  424   SWLTRLTIAAETGKAISHLHSAVKPPIYHRDIKSSNILLDCKFKSKVADFGLSRLGMAET  483

Query  527   SHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAA  348
             SHISTAPQGTPGYLDPQYHQ+FHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAA
Sbjct  484   SHISTAPQGTPGYLDPQYHQNFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAA  543

Query  347   LAVDKIGKGGLLEIIDPLIEA-EKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIEL  171
             LA D+IG+G L EIIDP +E    D WTLSSV+KVAE+AFRCLAF RDMRP+M+EV  EL
Sbjct  544   LATDRIGRGCLNEIIDPFLEPLLDDAWTLSSVHKVAELAFRCLAFQRDMRPTMIEVTAEL  603

Query  170   EQMRLSKW  147
             E ++LSKW
Sbjct  604   ELIKLSKW  611



>ref|XP_006856200.1| hypothetical protein AMTR_s00059p00192290 [Amborella trichopoda]
 gb|ERN17667.1| hypothetical protein AMTR_s00059p00192290 [Amborella trichopoda]
Length=698

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/588 (58%), Positives = 438/588 (74%), Gaps = 13/588 (2%)
 Frame = -3

Query  1889  STCNRSCGDGLKQLPFPFGFSSGCEILLNCTSNGTMSIGEFPVYQLTPDTIMINIPAKCG  1710
             S C+R CG   K+LPFPFGFSS C I LNC+  G +++ +F +  +T D I++  PA C 
Sbjct  30    SPCHRFCGG--KKLPFPFGFSSNCPIPLNCSIKGDITLHDFKILNITVDGILLEYPAICN  87

Query  1709  RRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMIQTQFELQDCG-KDNISCFS  1533
             R++  +  LFG NFA +S NG+LLQ+C      C+I S+++  +F +  C    NISCFS
Sbjct  88    RKVSDLNRLFGPNFAISSRNGLLLQDCKKSVSDCLISSSLLHDRFNISQCRVSGNISCFS  147

Query  1532  EPHMTGGFIGYENLTGTGCKSLFSAISSPAAAANTTAVSLDIQVIELGWWLQGHC---RC  1362
                   G++ ++ + G+GC SL S+ +     + +  +SLD +V+EL WW+ G+C    C
Sbjct  148   ANDH--GYLKWKEINGSGCGSLLSSFA--LDQSRSPKISLDFEVLELSWWMTGNCDNTSC  203

Query  1361  SKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTRCNPAKYLLGECGGKTR  1182
             S+ ++C+    P  G+ GFRC C  GF GDG++ G GC +D  +CNP+ Y+ G CGG TR
Sbjct  204   SEESNCSEFEIPVTGRHGFRCSCRHGFHGDGFKRGDGCHKDSFKCNPSNYIKGRCGGTTR  263

Query  1181  igvliggviagaaLMVSVGLICCIIRRRLAMKNWNRRRRELRETTG--ITIPVYSYKDIE  1008
             + VLIGG++AGA++M  + ++   +RR+       +  + L        T+P+Y Y+++E
Sbjct  264   VVVLIGGLLAGASIMAGLAVLFYCLRRQPTCFRTRKSNKHLISAAAHSFTVPLYPYREVE  323

Query  1007  KATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIKLLSSVNH  828
             +AT  FS+K+RLG GAYGTVY+GKLH NDEWVA+K+IRH+DT+ IEQV NEIKLLSSV+H
Sbjct  324   RATKGFSEKQRLGTGAYGTVYAGKLH-NDEWVAVKKIRHKDTEGIEQVMNEIKLLSSVSH  382

Query  827   PNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVSETSQAIAYLH  648
             PNLVRLLGC IE+ EQILVYE+MPNGT++QHLQRE+G GL W VRL I SET+ AIA+LH
Sbjct  383   PNLVRLLGCCIERDEQILVYEYMPNGTVAQHLQRERGQGLSWNVRLAIASETAHAIAHLH  442

Query  647   NAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGTPGYLDPQYHQ  468
             +A++PPIYHRD+KSSNILLDYN+ SKVADFGLSR  L ESSHISTAPQGTPGYLDPQYHQ
Sbjct  443   SAINPPIYHRDIKSSNILLDYNFNSKVADFGLSRLVLSESSHISTAPQGTPGYLDPQYHQ  502

Query  467   DFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLEIIDPLIE  288
             +FHLSDKSDVYSFGVVLVEIIT LK VDF R Q+EVNLAALA+DKIGKG + EIIDP +E
Sbjct  503   NFHLSDKSDVYSFGVVLVEIITALKVVDFNRSQSEVNLAALAIDKIGKGLVDEIIDPFLE  562

Query  287   AEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKWG  144
                D WTLSSV+KVAE+AFRCLAFHRD+RPSMMEV+ EL+Q+R+S W 
Sbjct  563   PHSDAWTLSSVHKVAELAFRCLAFHRDVRPSMMEVSTELDQIRMSGWA  610



>ref|NP_001234504.1| wall-associated receptor kinase-like 14 precursor [Solanum lycopersicum]
Length=703

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/610 (57%), Positives = 451/610 (74%), Gaps = 15/610 (2%)
 Frame = -3

Query  1943  MIPVLILLLLQSAMVFGSSTCNRSCGDGLKQLP---FPFGFSSGCEILLNCT-SNGTMSI  1776
             +  +L+  L  S     S+ CN+ CG      P   +PFGFS GC I L+CT S G + I
Sbjct  12    VFSILLGWLSSSVEATNSTKCNQYCGAAGSYSPRVSYPFGFSEGCGIRLDCTESTGEIRI  71

Query  1775  GEFPVYQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPS  1596
             GE+ +  +T +T+M+N    C R IE ++     NF  T  NG+LL NC  P+ +C I S
Sbjct  72    GEYIIQNVTSETLMVNFSMNCSRPIEDLQQFDRTNFGMTWRNGLLLHNCKVPKSECTILS  131

Query  1595  TMIQTQFELQDCG--KDNISCFSEPHMTGGFIGYENLTGTGCKSLFSAI--SSPAAAANT  1428
              ++ T+  +Q C   K+N+SC+SE      ++ Y+ L  TGC ++ S+I          +
Sbjct  132   EILSTRLNIQSCDSKKENVSCYSEAR--ADYLDYKKLKNTGCGTVISSILIGMDNDTMKS  189

Query  1427  TAVSLDIQVIELGWWLQGHCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGC  1248
             +A+ ++ Q +EL W L+G C C  +A+C  +  PG+ K GFRC+C +GF GDG+  G GC
Sbjct  190   SAMFIEFQTMELAWGLEGDCACHNDANCTNVSLPGNRK-GFRCRCKDGFVGDGFSDGDGC  248

Query  1247  RRDDTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLIC-CIIRRRLAMKNWNRR  1071
             R+  +RCNP++YL G CGG TRIGVL+GG+IAGA LM ++ ++C CI RR  ++K     
Sbjct  249   RKV-SRCNPSRYLSGRCGGTTRIGVLVGGIIAGAGLMAALAVLCYCIRRRSASLKKRMSA  307

Query  1070  RRELRETTGI-TIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIR  894
             RR L E  G  ++ V+ YK+IE+ATN+FS+K+RLG GAYGTVY+GKLH +DEWVAIK++R
Sbjct  308   RRLLSEAAGSNSVHVFQYKEIERATNSFSEKQRLGIGAYGTVYAGKLH-SDEWVAIKKLR  366

Query  893   HRDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGS  714
             HRD D +EQV NE+KLLSSV+HPNLVRLLGC IE GEQILVYEFMPNGTL+QHLQRE+ S
Sbjct  367   HRDPDGVEQVMNEVKLLSSVSHPNLVRLLGCCIENGEQILVYEFMPNGTLAQHLQRERSS  426

Query  713   GLPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLI  534
             GLPW +RL I +ET+ AIA+LH+AM+PPIYHRD+KSSNILLDYN+ SKVADFGLSRFG+ 
Sbjct  427   GLPWTIRLTIATETAHAIAHLHSAMNPPIYHRDIKSSNILLDYNFNSKVADFGLSRFGMT  486

Query  533   ESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNL  354
             + SHISTAPQGTPGY+DPQYHQ++HLSDKSDVYSFGVVLVEIIT +K VDF+R  +E+NL
Sbjct  487   DDSHISTAPQGTPGYVDPQYHQNYHLSDKSDVYSFGVVLVEIITAMKVVDFSRSHSEINL  546

Query  353   AALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIE  174
             AALA+D+IGKG + EIIDP +E  +D WTLSSV++VAE+AFRCLAFHRDMRPSM EVA E
Sbjct  547   AALAIDRIGKGRVDEIIDPFLEPHRDAWTLSSVHRVAELAFRCLAFHRDMRPSMTEVADE  606

Query  173   LEQMRLSKWG  144
             LEQ+RLS W 
Sbjct  607   LEQIRLSSWA  616



>ref|XP_004300571.1| PREDICTED: wall-associated receptor kinase-like 14-like [Fragaria 
vesca subsp. vesca]
Length=689

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/594 (59%), Positives = 441/594 (74%), Gaps = 14/594 (2%)
 Frame = -3

Query  1907  AMVFGSSTCNRSCGDGLKQLPFPFGFSSGCEILLNCTSNGTMSIGEFPVYQLTPDTIMIN  1728
             A +  S  C  +CG   K + +PFGFS GC+I LNC S+  +SIG F V  +T  +I +N
Sbjct  16    ASIAKSQNCTTTCGS--KSVQYPFGFSDGCKIRLNC-SDPHISIGNFTVQNITSTSIFLN  72

Query  1727  IPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMIQTQFELQDC--GK  1554
             +PAKC R + +M  LFG NF PT NN +L Q+C + +  C IP+  ++ QF L+ C    
Sbjct  73    LPAKCKRPVRSMIELFGPNFGPTWNNSLLFQHCPNSQNGCYIPAAFVEKQFALESCKGNN  132

Query  1553  DNISCFSEPHMTGG-FIGYENLTGTGCKSLFSAISSPAAAANTTAVSLDIQVIELGWWLQ  1377
             D+ISCF+E        + Y+ L+   CK LF +I+  +   N+  +SL+ + I+LGWW+ 
Sbjct  133   DSISCFAEERSNSSEIVEYDYLSKKNCKYLFGSIAVRSGDQNS-PLSLEFETIQLGWWVN  191

Query  1376  GH-CRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTRCNPAKYLLGE  1200
             G  C C+ NA C  +  PG    GFRCQC EGF GDG++ GSGCRR  + CN + Y+ G 
Sbjct  192   GSSCECAANATCTHVELPGVNPQGFRCQCLEGFHGDGFRKGSGCRRV-SECNASGYMSGR  250

Query  1199  CGGKTRigvliggviagaaLMVSVGLICCIIRRR-LAMKNWNRRRRELRETTG-ITIPVY  1026
             CGG  R+G+LI GVIAGA LM  + +IC  +R+R   +KN    RR L E  G  ++P+Y
Sbjct  251   CGG--RVGILIAGVIAGALLMAGLVIICYYLRKRSTCLKNQLSARRLLSEAAGNSSVPLY  308

Query  1025  SYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIKL  846
              YK+IE+ATN F++K+RLG GA+GTVY+GKLH NDEWVAIK+I++RD++SI+QV NEIKL
Sbjct  309   PYKEIERATNCFAEKQRLGTGAFGTVYAGKLH-NDEWVAIKKIKYRDSNSIDQVMNEIKL  367

Query  845   LSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVSETSQ  666
             LSSV+HPNLVRLLGC IE GEQILVYE+MPNGTLS+HLQRE+G GLPW +RL I SET+ 
Sbjct  368   LSSVSHPNLVRLLGCCIEGGEQILVYEYMPNGTLSEHLQRERGKGLPWTIRLTIASETAN  427

Query  665   AIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGTPGYL  486
             AIAYLH+ M+PPIYHRD+KSSNILLDYNY SKVADFGLSR G+ E+S ISTAPQGTPGY+
Sbjct  428   AIAYLHSEMNPPIYHRDIKSSNILLDYNYNSKVADFGLSRLGMTETSCISTAPQGTPGYV  487

Query  485   DPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLEI  306
             DPQYHQ+FHLSD+SDVYSFGVVLVEIIT +K VDF RPQ E+NLAALA+D+IGKG + E+
Sbjct  488   DPQYHQNFHLSDRSDVYSFGVVLVEIITAMKVVDFARPQTEINLAALAIDRIGKGCVDEM  547

Query  305   IDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKWG  144
             +DP +E  +D WTL S+NKVAE+AFRCLAFH +MRPSM EVA ELE +R S W 
Sbjct  548   VDPFLEPNRDAWTLYSINKVAELAFRCLAFHSEMRPSMTEVAEELEYVRRSGWA  601



>ref|XP_004152788.1| PREDICTED: wall-associated receptor kinase-like 14-like [Cucumis 
sativus]
 ref|XP_004160050.1| PREDICTED: wall-associated receptor kinase-like 14-like [Cucumis 
sativus]
 gb|KGN62560.1| hypothetical protein Csa_2G360770 [Cucumis sativus]
Length=678

 Score =   685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/613 (56%), Positives = 448/613 (73%), Gaps = 21/613 (3%)
 Frame = -3

Query  1931  LILLLLQSAMVFGSSTCNRSCGDGLK--QLPFPFGFSSGCEILLNCTSNGTMSIGEFPVY  1758
             L  L+L S +    + C++SC         P+PFGFS+GC I LNC+ +G   IGEFPV 
Sbjct  13    LFFLVLISTLK-TEAKCSKSCTSDQTPYDFPYPFGFSAGCPIRLNCSHDGAAMIGEFPVE  71

Query  1757  QLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMIQTQ  1578
              +  D I + I AKC R+   +   F  N+AP +NN +LLQNCSSP   C +P+TM+QT+
Sbjct  72    SINSDHIKVVIKAKCNRKFHTIHQFFSPNYAPRANNAVLLQNCSSPISPCFLPTTMVQTK  131

Query  1577  FELQDCG--KDNISCFSEPHM-TGGFIGYENLTGTGCKSLFSAISSPAAAANTTA-VSLD  1410
             FE  DC   + +ISC+++    + GF+ ++NLT T C  L S+ISS    +N +A +SL+
Sbjct  132   FESPDCSVNRSSISCYTQNATGSAGFLDFKNLTRTHCDYLLSSISSEELNSNISAGISLE  191

Query  1409  IQVIELGWWLQGHCR--CSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDD  1236
             IQ ++LGWWLQG C   C ++A+C  +++P DG    RC+C EG  GDGY  G+GCR+  
Sbjct  192   IQTVDLGWWLQGGCHQSCHEDANCTELKSPIDGMLSHRCRCREGLVGDGYLAGTGCRKA-  250

Query  1235  TRCNPAKYLLGECGGKT---RigvliggviagaaLMVSVGLICCIIRRRLAMKNWNRRR-  1068
               C   KY++GECG  T   R  +LIG +I GAA+++++GL C  IRRR  +++ +  + 
Sbjct  251   LNCYTTKYIIGECGTSTTATRTAILIGTLIGGAAVLLALGLFCFFIRRRSNLQSIHLNKI  310

Query  1067  --RELRETTG----ITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAI  906
               R L E T      TI +Y++K+I+KAT++FSD   LG GAY TVY+GKL  N EWVAI
Sbjct  311   TKRRLSEATAGAGKSTIHLYTHKEIQKATHSFSDDYHLGAGAYATVYAGKLR-NGEWVAI  369

Query  905   KRIRHRDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQR  726
             KR+++RD D+I QV NEI L+SSV+HPNLVRLLGCS+E G+QILVYEFMPNGTLSQHLQ+
Sbjct  370   KRLKNRDPDTIHQVLNEISLISSVSHPNLVRLLGCSMESGDQILVYEFMPNGTLSQHLQK  429

Query  725   EKGSGLPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSR  546
             ++G+GLPW VRL I  ET+ AIA+LH+A++PPI+HRD+KSSNILLD N KSKVADFGLSR
Sbjct  430   QRGTGLPWLVRLDIAVETANAIAHLHSAINPPIFHRDIKSSNILLDENLKSKVADFGLSR  489

Query  545   FGLIESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQN  366
              G+ E SHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVE+IT +K VDF R + 
Sbjct  490   LGMAEISHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVELITAMKVVDFCRAKE  549

Query  365   EVNLAALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMME  186
             EVNLAALA D+IG G + EI+DPL++ E D W +SSV KV E+AFRCLAFHRD+RPSM+E
Sbjct  550   EVNLAALAADRIGNGRVREIVDPLMDMEGDEWGISSVEKVGEVAFRCLAFHRDVRPSMVE  609

Query  185   VAIELEQMRLSKW  147
             VA ELE++R S+W
Sbjct  610   VAAELEEIRRSRW  622



>ref|XP_007156857.1| hypothetical protein PHAVU_002G023400g [Phaseolus vulgaris]
 gb|ESW28851.1| hypothetical protein PHAVU_002G023400g [Phaseolus vulgaris]
Length=681

 Score =   682 bits (1761),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/604 (59%), Positives = 438/604 (73%), Gaps = 21/604 (3%)
 Frame = -3

Query  1943  MIPVLILLLLQSAMVFGSSTCNRSCGDGLKQLPFPFGFSSGCEILLNCTSNGTMSIGEFP  1764
             ++ VL +L+  +A    + TCNR CG   + L FPFGFS GCEI LNC  N  + I EF 
Sbjct  9     LVIVLTILMACTARA-QNVTCNRQCGK--QSLQFPFGFSEGCEIRLNCFDN-QVQIYEFL  64

Query  1763  VYQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMIQ  1584
             V  +T   I +N+P KC RR+E+++PLF  NFAP+ NN  L+QNCS     C+IP++   
Sbjct  65    VQNVTDSNIFVNLPGKCNRRMESIEPLFQSNFAPSVNNSFLVQNCSEQFGGCVIPASNFG  124

Query  1583  TQFELQDCGKDNISCFSEPHMTGGFIGYENLTGTGCKSLFSAISSPAAAANTTAVSLDIQ  1404
                E  D    NISCFS+       + Y +L GT CK LFSA+S       +    L  Q
Sbjct  125   ---ESCDKKSGNISCFSKQD-GADVVKYTDLNGTKCKYLFSAVS----FGQSHETVLQFQ  176

Query  1403  VIELGWWLQGHC-RCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTRC  1227
             ++ELGWWL G C  CS N+ C    TP   + GFRCQC  GFTGDG++ G+GCR+     
Sbjct  177   MVELGWWLHGQCDECSDNSTC----TPVPLQGGFRCQCIHGFTGDGFRMGTGCRKTSASS  232

Query  1226  NPAKYLL-GECGGKTRigvliggviagaaLMVSVGLIC-CIIRRRLAMKNWNRRRRELRE  1053
               A  L  G CG  T+IGV +G +IAGA +M  + L+C C  RR + +    R +R+LRE
Sbjct  233   CSASTLTSGGCGKATKIGVAVGAIIAGALVMAGLFLLCYCARRRSIWLGKHTRVKRQLRE  292

Query  1052  TTG-ITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDS  876
               G  +IP Y YK++EKATN+FS+K RLG GA+GTVY+GKLH NDEWVAIK++R RDT+S
Sbjct  293   AAGNSSIPFYPYKEVEKATNSFSEKHRLGTGAFGTVYAGKLH-NDEWVAIKKLRQRDTNS  351

Query  875   IEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPV  696
              +QV NEIKLL+SV+HPNLVRLLGC +EKGEQILVYEFM NGTLSQHLQRE+  GLPW V
Sbjct  352   ADQVMNEIKLLTSVSHPNLVRLLGCCVEKGEQILVYEFMQNGTLSQHLQRERSEGLPWTV  411

Query  695   RLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHIS  516
             RL I +ET+ AIAYLH+ +HPPIYHRD+KSSNILLDY +KSK+ADFGLSR GL E+SHIS
Sbjct  412   RLTIATETANAIAYLHSEIHPPIYHRDIKSSNILLDYQFKSKIADFGLSRLGLTETSHIS  471

Query  515   TAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVD  336
             TAPQGTPGY+DPQYHQ+FHLSDKSDVYSFGVVLVEIIT +KAVDF+RP+ EVNLAALAVD
Sbjct  472   TAPQGTPGYVDPQYHQNFHLSDKSDVYSFGVVLVEIITAMKAVDFSRPRTEVNLAALAVD  531

Query  335   KIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRL  156
             +I +G + EIIDP +E  +D WTL S++KVAE+AFRCLAFH DMRP+MMEVA ELE ++ 
Sbjct  532   RIRRGAVDEIIDPFLEPHRDAWTLYSIHKVAELAFRCLAFHSDMRPTMMEVAEELEHIKR  591

Query  155   SKWG  144
             S W 
Sbjct  592   SGWA  595



>ref|XP_009415309.1| PREDICTED: wall-associated receptor kinase-like 14 [Musa acuminata 
subsp. malaccensis]
Length=693

 Score =   682 bits (1761),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/642 (56%), Positives = 453/642 (71%), Gaps = 20/642 (3%)
 Frame = -3

Query  1883  CNRSCGDGLKQLPFPFGFSSGCEILLNC--TSNGTMSIGEFPVYQLTPDTIMINIPAKCG  1710
             C R+CG      P+PFGFS GC I L C   S  ++ IGEF V  +T D++++++P  C 
Sbjct  37    CKRTCGS--YTAPYPFGFSVGCPIRLECFNPSKSSVRIGEFTVRNITDDSLLVDVPPACN  94

Query  1709  RRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMIQTQFELQDCGK--DNISCF  1536
             R I+A+K LFG N+A T  NG+ L NC+    K +     + T      CG   DN +CF
Sbjct  95    RSIDAVKSLFGHNYALTERNGLFLSNCTPVANKSLSERCAVNTILFDGSCGPRYDNATCF  154

Query  1535  SEPHMTGGFIGYENLTGTGCKSLFSAISSPAAAANTTAVSLDIQVIELGWWLQGHCRCSK  1356
                    GF   +++  +GC   F++I        +   SL+++  EL WWL G CRCS 
Sbjct  155   YNA-TREGFFDEDSVAASGCSFFFTSIGYDDVGGASVP-SLNLRTAELAWWLNGTCRCSA  212

Query  1355  NADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRD---DTRCNPAKYLLGECGGKT  1185
             NA C  +  P    PGFRC+CSEGF GDG+ GG GCR+    + RCNP +Y+ G+CGG T
Sbjct  213   NASCTAVMAPVTHMPGFRCRCSEGFQGDGFIGGQGCRKVSKFNQRCNPTRYMTGDCGGST  272

Query  1184  -RigvliggviagaaLMVSVGLICCIIRRRLAMKNWNRRRRELRETTGITIPVYSYKDIE  1008
              R GVL+GG+IAGA+ M ++ L+CC I+R  +     +  R L      T+P+YSYKDIE
Sbjct  273   SRYGVLVGGIIAGASAMAALVLVCCFIKRHSSSTRKRKSMRRLLCEASCTVPLYSYKDIE  332

Query  1007  KATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIKLLSSVNH  828
             KATN FS+ + LG GAYGTVY+GK   N   VA+K+I++RD DSIEQV NEI+LLSSV+H
Sbjct  333   KATNGFSEDQILGTGAYGTVYAGKF-SNHRLVAVKKIKNRDHDSIEQVINEIRLLSSVSH  391

Query  827   PNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVSETSQAIAYLH  648
             PNLVRLLGC +E+GEQILVYE+MP+GTL+QHLQRE+G  LPW VRL I +ET++AIAYLH
Sbjct  392   PNLVRLLGCCVEQGEQILVYEYMPHGTLAQHLQRERGPALPWTVRLAIATETAKAIAYLH  451

Query  647   NAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGTPGYLDPQYHQ  468
             +A+HPPIYHRD+KSSNILLD+NY SKVADFGLSR G+ E+SHISTAPQGTPGY+DPQYHQ
Sbjct  452   SAVHPPIYHRDIKSSNILLDFNYNSKVADFGLSRMGMTETSHISTAPQGTPGYVDPQYHQ  511

Query  467   DFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLEIIDPLIE  288
             +FHLSDKSDVYSFGVVLVEIIT LKAVDF+R Q+EVNLAALA+DKIG G + EIIDP +E
Sbjct  512   NFHLSDKSDVYSFGVVLVEIITALKAVDFSRAQSEVNLAALAIDKIGGGRVEEIIDPYLE  571

Query  287   AEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKWGIsedsiitasss  108
               +D WTL+S+ KVAE+AFRCLAFHRDMRPSM EVA ELEQ++LS W  ++D +  +++S
Sbjct  572   PHRDAWTLASIRKVAELAFRCLAFHRDMRPSMTEVADELEQIKLSGWAPTDDGMFLSTAS  631

Query  107   sssrsssdasEKPLSFSTMKP-------SEKVTESSPVSVQD  3
             S   S S  +EKP + S  K         E+    SPVSVQD
Sbjct  632   SFCSSPSSCNEKPRAGSKSKRLVLVNSMREEAEVESPVSVQD  673



>ref|XP_008241591.1| PREDICTED: wall-associated receptor kinase-like 14 [Prunus mume]
Length=713

 Score =   681 bits (1757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/598 (58%), Positives = 439/598 (73%), Gaps = 21/598 (4%)
 Frame = -3

Query  1892  SSTCNRSCGDG--LKQLPFPFGFSSGCEILLNCTSNGTMSIGEFPVYQLTPDTIMINIPA  1719
             SS C  +CG G   K + +PFGFS GC I  NC+    + +G+F V  +T  +I +++PA
Sbjct  32    SSFCETTCGSGKSAKSVQYPFGFSEGCTIPFNCSDKNEIKLGKFTVQNVTGVSIFVHLPA  91

Query  1718  KCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSP-ELKCMIPSTMIQTQFELQDCGKDNIS  1542
             +C R+ +++ PLFG+ F P+ NN +L QNC+SP    C IP+  +Q +F L  C  DNI+
Sbjct  92    QCNRKYQSIAPLFGQYFGPSWNNSLLFQNCTSPPHPGCQIPAEFVQKRFNLSRC--DNIT  149

Query  1541  CFSEPHMTGG-FIGYENLTGTGCKSLFSAISSPAAAANTTAVSLDIQVIELGWWLQ----  1377
             C S+    G   +  E+L  + C  LF + S    +   + +SL+ + ++LGWWL     
Sbjct  150   CMSQQAPNGSDIMTIEDLNRSRCNYLFGSFS--VQSGRDSLLSLEFETLQLGWWLNTSQA  207

Query  1376  -GHCRCSKNADCNTMRTPGDGKP-GFRCQCSEGFTGDGYQGGSGCR---RDDTRCNPAKY  1212
                C C  NA   T++  G+GKP G RC C+ GF GDG++ GSGC+   +  + CN +KY
Sbjct  208   TNRCECHSNATSTTVKL-GEGKPPGCRCSCNAGFHGDGFKSGSGCKTVSQPVSHCNASKY  266

Query  1211  LLGECGGKTRigvliggviagaaLMVSVGLICCIIRRR-LAMKNWNRRRRELRETTG-IT  1038
             + G CGG TR+ VLIGG +AGA LM  + L+C  +RRR   ++N    RR L E  G  +
Sbjct  267   MSGRCGGTTRVAVLIGGFVAGAFLMAGLFLLCYFVRRRSTCLRNQMSARRLLSEAAGNSS  326

Query  1037  IPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTN  858
             +P+Y YK+IE+ATN F++K+RLG GA+G VY+GKLH NDEWVAIK+I  RDT+SI+QV N
Sbjct  327   VPLYPYKEIERATNCFAEKQRLGTGAFGIVYAGKLH-NDEWVAIKKINRRDTNSIDQVMN  385

Query  857   EIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVS  678
             EIKLLSSV+HPNLVRLLGC IE GEQILVYE+MPNGTLS+HLQRE+G GLPW +RL I +
Sbjct  386   EIKLLSSVSHPNLVRLLGCCIEGGEQILVYEYMPNGTLSEHLQRERGQGLPWTIRLTIAA  445

Query  677   ETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGT  498
             ET+ AIAYLH+AM+PPIYHRD+KSSNILLDYNYKSKVADFGLSR G+ ESS+ISTAPQGT
Sbjct  446   ETANAIAYLHSAMNPPIYHRDIKSSNILLDYNYKSKVADFGLSRLGMTESSYISTAPQGT  505

Query  497   PGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGG  318
             PGY+DPQYHQ+FHLSDKSDVYSFGVVLVEIIT +K VDF RPQ+EVNLAALA D+IGKG 
Sbjct  506   PGYVDPQYHQNFHLSDKSDVYSFGVVLVEIITAMKVVDFARPQSEVNLAALATDRIGKGC  565

Query  317   LLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKWG  144
             + EI+DP ++  +D WTL SVNKVAE+AFRCLAFH DMRPSM+EVA ELE +R S W 
Sbjct  566   VDEIVDPFLDPNRDAWTLYSVNKVAELAFRCLAFHSDMRPSMIEVAEELEYIRRSGWA  623



>ref|XP_007047100.1| Kinase superfamily protein [Theobroma cacao]
 gb|EOX91257.1| Kinase superfamily protein [Theobroma cacao]
Length=700

 Score =   680 bits (1755),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/611 (58%), Positives = 452/611 (74%), Gaps = 23/611 (4%)
 Frame = -3

Query  1940  IPVLILLLLQSAMVFGS--STCNRSCGDG--LKQLPFPFGFSSGCEILLNCTSNGTMSIG  1773
             I + ILL++  A    S  + C   CG G     LPFPFGFS GC I LNC+S+G + IG
Sbjct  12    ITIAILLVISQAKSVNSEKNRCQGFCGKGNFPTTLPFPFGFSPGCPIQLNCSSDG-VRIG  70

Query  1772  EFPVYQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSP-ELKCMIPS  1596
             EF V  +T   I+I +P +CGRR+ ++  LFG+N+A +  N +LLQNC+      C I S
Sbjct  71    EFLVLNVTSTDIIIKLPVECGRRLASLSVLFGENYAVSVANNLLLQNCTKQLPAPCEIRS  130

Query  1595  TMIQTQFELQDC--GKDNISCFSEPHMTGG----FIGYENLTGTGCKSLFSAISSPAAAA  1434
               ++  F    C    DNI+CF+     GG     + ++ ++ T C+ LFS+ S    +A
Sbjct  131   KFLERSFLPNSCIDKSDNITCFA-----GGDGEQLLNFKEVSNTQCRFLFSSTSIVVNSA  185

Query  1433  NTTAVSLDIQVIELGWWLQGHCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGS  1254
             + + VSL+++ ++L WW++G C C  NA+C  ++  G+   GF C C +G+ GDG++ G 
Sbjct  186   SNSVVSLELERVKLAWWVEGTCSCDANANCTNVKK-GNRTLGFTCLCHKGYEGDGFKAGG  244

Query  1253  GCRRDDTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAMKNWN-  1077
             GCRR    CNP+KY+ G+CGG TR+GVL+GG+IAGA L   V L+CC +RRR +  N   
Sbjct  245   GCRRV-PHCNPSKYISGKCGGTTRVGVLVGGLIAGALLTGGVALLCCYVRRRSSSLNKQM  303

Query  1076  RRRRELRETTG-ITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKR  900
               +R L E  G  ++P Y+Y++IE+ATN FSDK+RLG GAYGTVY+GKLH ND+WVAIKR
Sbjct  304   SAKRLLCEAAGNSSVPFYAYREIERATNCFSDKQRLGTGAYGTVYAGKLH-NDDWVAIKR  362

Query  899   IRHRDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREK  720
              R+RD DSI+QV NEIKLLSSV+HPNLVRLLGC IE+GE ILVYEFMPNGTLSQHLQRE+
Sbjct  363   FRYRDPDSIDQVMNEIKLLSSVSHPNLVRLLGCCIEEGEPILVYEFMPNGTLSQHLQRER  422

Query  719   GSGLPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFG  540
             G GLPW VRL I +ET++AIAYLH +++PPI+HRD+KSSNILLD++Y+SKVADFGLSR G
Sbjct  423   GEGLPWTVRLTIAAETAKAIAYLH-SVNPPIFHRDIKSSNILLDFSYRSKVADFGLSRLG  481

Query  539   LIESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEV  360
             + ESSHISTAPQGTPGYLDPQYHQ FHLSDKSDVYSFGVVLVEIIT LK VDF+RP +EV
Sbjct  482   MSESSHISTAPQGTPGYLDPQYHQYFHLSDKSDVYSFGVVLVEIITALKVVDFSRPHSEV  541

Query  359   NLAALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVA  180
             NLAALA D+IG+G + EI+DP +E  +D WTLSS++ VAE+AFRCLAFHRDMRP+M EVA
Sbjct  542   NLAALANDRIGRGCVDEILDPYLEPHRDAWTLSSIHNVAELAFRCLAFHRDMRPTMTEVA  601

Query  179   IELEQMRLSKW  147
              ELE +RLS W
Sbjct  602   EELEHIRLSAW  612



>gb|KCW67772.1| hypothetical protein EUGRSUZ_F01504 [Eucalyptus grandis]
Length=704

 Score =   679 bits (1752),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/615 (57%), Positives = 446/615 (73%), Gaps = 23/615 (4%)
 Frame = -3

Query  1943  MIPVLILLLLQSAMVFGSSTCNRSCGDGL---KQLPFPFGFSSGCEILLNCTSNGTMSIG  1773
             ++  ++L +L +A       C+++C +G    + L +PFGFS GC I LNCT +G   IG
Sbjct  12    LLAGVVLPILAAARKAIPPPCSQTCHNGKPAKQNLTYPFGFSPGCPIQLNCTDDGDALIG  71

Query  1772  EFPVYQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCS--SPELKCMIP  1599
             EF V   + +T+ + I A+C R  EA+  L+G+N+AP   N ILL NC+  SP   C +P
Sbjct  72    EFRVQAASSETVTVTIEAECDRSFEAIANLYGRNYAPMGKNAILLNNCTKISP---CDLP  128

Query  1598  ST-MIQTQF----ELQDCGKDNISCFSEP--HMTGGFIGYENLTGTGCKSLFSAISSPAA  1440
             +T +IQ +F    E ++     +SC+SE   + +  F+    L+  GCK   S+IS  A 
Sbjct  129   NTRVIQARFQSLCETKNKANTGMSCYSEKENNYSTKFLNRSRLSALGCKFFLSSIS--AE  186

Query  1439  AANTTAVSLDIQVIELGWWLQG-HCRCSKNADCNTMR-TPGDGKPGFRCQCSEGFTGDGY  1266
               N  +VSL +Q+++L WW+ G  C CS++ADC  +   P  G  GFRC+C +GF GDG+
Sbjct  187   DLNNVSVSLGVQMLQLAWWVNGDRCECSRDADCVRLSGLPNSGGNGFRCKCRDGFRGDGF  246

Query  1265  QGGSGCRRDDTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAMK  1086
               G+GCRRD   CNPAKYL G+CGG TRI VL+GGV+ GA+ M+S+GLIC   RRR   K
Sbjct  247   LAGTGCRRDAFMCNPAKYLSGQCGGATRIIVLVGGVVVGASFMISLGLICYFFRRRSKWK  306

Query  1085  NWNRRRRELRETTG-ITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVA  909
                  +R L E +G  +I  Y YK+IE+ATN F++K+RLG GA+GTVYSGKL+ +DEWVA
Sbjct  307   AQLEVQRRLSEASGKSSITFYPYKEIERATNYFAEKQRLGTGAFGTVYSGKLNGDDEWVA  366

Query  908   IKRIRHRDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQ  729
             IKRI+ RD  S+EQV NEIKLLSSV+HP+LV+LLGCSIEKGEQIL+YEFMPNGTL QHL 
Sbjct  367   IKRIKQRD--SVEQVMNEIKLLSSVSHPHLVKLLGCSIEKGEQILIYEFMPNGTLCQHLH  424

Query  728   REKGSGLPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLS  549
             RE+G GL WP+RL I SET+QAIA+LH ++ PPIYHRDVKSSNILLDY++ SKVADFGLS
Sbjct  425   RERGQGLSWPIRLKIASETAQAIAHLH-SIKPPIYHRDVKSSNILLDYSFTSKVADFGLS  483

Query  548   RFGLIESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQ  369
             R G++E SHISTAPQGTPGYLDPQYHQDFHLSDKSDVYS GVVL EIIT LK VDF+RPQ
Sbjct  484   RLGMLEDSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSLGVVLTEIITSLKVVDFSRPQ  543

Query  368   NEVNLAALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMM  189
             NEVNLA LA D+IG+  L EIIDP ++  KD WT  SV KVAE+AFRCLA HRDMRP+M 
Sbjct  544   NEVNLANLATDRIGRARLDEIIDPSLDVNKDEWTYLSVQKVAELAFRCLASHRDMRPTMK  603

Query  188   EVAIELEQMRLSKWG  144
             EVA EL+++  S+W 
Sbjct  604   EVADELDRLWFSRWA  618



>ref|XP_002307237.1| hypothetical protein POPTR_0005s13920g [Populus trichocarpa]
 gb|EEE94233.1| hypothetical protein POPTR_0005s13920g [Populus trichocarpa]
Length=695

 Score =   679 bits (1751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/593 (58%), Positives = 439/593 (74%), Gaps = 26/593 (4%)
 Frame = -3

Query  1889  STCNRSCGDG--LKQLPFPFGFSSGCEILLNCTSN-GTMSIGEFPVYQLTPDTIMINIPA  1719
             S C  SCG G   + +P+PFGFS+GC I LNC S  G + IGEF V  +TP+ I++N+PA
Sbjct  33    SNCASSCGIGKSARVVPYPFGFSNGCPIQLNCESTEGEIKIGEFQVQNITPNGILVNLPA  92

Query  1718  KCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMIQTQFELQDC---GKDN  1548
              C R IE ++PLFG N+ P+  N +LLQNCS P   C+I  +  Q +   ++C     DN
Sbjct  93    DCNRSIETIRPLFGLNYGPSWQNSLLLQNCSKPSNSCVISRSPFQGELHSKNCEAAKNDN  152

Query  1547  ISCFSEPHMTGGFIGYENLTGTGCKSLFSAISSPAAAANTTAVSLDIQVIELGWWLQGHC  1368
             +SC+S P+     + YE +  T C S+FS++   A  +++  VS   + IEL WWL+GHC
Sbjct  153   LSCYSLPYSGIDTLSYEGVNSTQCSSVFSSL---ALGSDSPVVSFQYERIELEWWLEGHC  209

Query  1367  R---CSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDD-TRCNPAKYLLGE  1200
             R   CSKNA+C+ ++   +G  GFRC C +GF GDG+  G+GCRR + T      +L   
Sbjct  210   RDTFCSKNANCSEVKLQ-NGTVGFRCHCYDGFAGDGFTTGNGCRRGEPTWLYICLHLF--  266

Query  1199  CGGKTRigvliggviagaaLMVSVGLICCIIRRR-LAMKNWNRRRRELRETTG-ITIPVY  1026
                     + I  +IAGA+LM    L+C  ++++  +M+N +  +R L E  G  ++P +
Sbjct  267   -------LLFIMRLIAGASLMAVFALLCYFVKKKSTSMRNRSSAKRLLCEAAGNSSVPFF  319

Query  1025  SYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIKL  846
              YK+IE+ATN FS+K+RLG GAYGTVYSGKLH ND+ VAIK+I+ RDTDS++ V NEIKL
Sbjct  320   QYKEIERATNGFSEKQRLGTGAYGTVYSGKLH-NDDLVAIKKIKQRDTDSLDLVMNEIKL  378

Query  845   LSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVSETSQ  666
             LSSV+HPNLVRLLGC +E+GE ILVYEFMPNGTL QHLQRE+G+GLPW VRL + +ET+ 
Sbjct  379   LSSVSHPNLVRLLGCCLEEGEPILVYEFMPNGTLCQHLQRERGNGLPWTVRLTVAAETAN  438

Query  665   AIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGTPGYL  486
             AIAYLH+ ++PPIYHRD+KSSNILLDYNY+SKVADFGLSR G+ ESSHISTAPQGTPGYL
Sbjct  439   AIAYLHSVVNPPIYHRDIKSSNILLDYNYRSKVADFGLSRLGMEESSHISTAPQGTPGYL  498

Query  485   DPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLEI  306
             DPQYHQ FHLSDKSDVYSFGVVLVEIIT  K VDF+RP +EVNLAALA+D+IG+G + EI
Sbjct  499   DPQYHQYFHLSDKSDVYSFGVVLVEIITAQKVVDFSRPHSEVNLAALAIDRIGRGCVDEI  558

Query  305   IDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKW  147
             +DP ++ ++D WTLSS++ VAE+AFRCLAFHRDMRP+MMEVA ELEQ+RLS W
Sbjct  559   VDPYLDPDRDAWTLSSIHSVAELAFRCLAFHRDMRPTMMEVAEELEQIRLSAW  611



>ref|XP_008444664.1| PREDICTED: wall-associated receptor kinase-like 14 [Cucumis melo]
Length=680

 Score =   678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/614 (56%), Positives = 448/614 (73%), Gaps = 20/614 (3%)
 Frame = -3

Query  1934  VLILLLLQSAMVFGSSTCNRSCGDGLK--QLPFPFGFSSGCEILLNCTSNGTMSIGEFPV  1761
             +L L+L+   +   +  C++SC         P+PFGFS+GC I LNC+ +G   IGEFPV
Sbjct  13    LLFLVLISITLKTEAKKCSKSCSSHQTPYDFPYPFGFSAGCPIRLNCSHDGAAMIGEFPV  72

Query  1760  YQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMIQT  1581
               +  D I + I AKC R    +   F  ++APT+NN +LLQNCSSP   C +P+TM+QT
Sbjct  73    EFINSDHIKVVIKAKCNRGFHTIHQFFSPHYAPTANNAVLLQNCSSPISTCFLPTTMVQT  132

Query  1580  QFELQDCG--KDNISCFSEPHM-TGGFIGYENLTGTGCKSLFSAISSPAAAAN-TTAVSL  1413
             +FE  DC   + +ISC+++    + GF+ ++NLTGT C  L S+IS+     N +T +SL
Sbjct  133   KFESPDCSVNRSSISCYTQNATGSAGFLDFKNLTGTHCDYLLSSISAEELNGNISTGISL  192

Query  1412  DIQVIELGWWLQGHCR--CSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRD  1239
             +IQ ++LGWWLQG C   C ++A+C  +++P +G    RC+C +G  GDGY  G+GCR+ 
Sbjct  193   EIQTVDLGWWLQGGCHHSCHEDANCTELKSPINGMLSHRCRCRKGLIGDGYLAGTGCRKA  252

Query  1238  DTRCNPAKYLLGECGGKT---RigvliggviagaaLMVSVGLICCIIRRRLAMKNWNRRR  1068
                C   KY +GECG  T   R  +LIG +I GA++++++ L+C  IRRR   K+ +  +
Sbjct  253   -LNCYTTKYAIGECGTSTTATRTAILIGTLIGGASVLLALALLCFFIRRRSNPKSIHLNK  311

Query  1067  ---RELRETTG----ITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVA  909
                R L E T      TI +Y+YK+I+KAT+NFSD  RLG GAY TVY+G+L  N EWVA
Sbjct  312   ITKRRLSEATAGAGKSTIHLYTYKEIQKATHNFSDDYRLGTGAYATVYAGRLR-NGEWVA  370

Query  908   IKRIRHRDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQ  729
             IKR+++RD D+I QV NEI L+SSV+HPNLVRLLGCS+E G+QILVYEFMPNGTLSQHLQ
Sbjct  371   IKRLKNRDPDTIHQVLNEINLISSVSHPNLVRLLGCSMESGDQILVYEFMPNGTLSQHLQ  430

Query  728   REKGSGLPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLS  549
             +++G+GLPW VRL I  ET+ AIA+LH+A++PPI+HRD+KSSNILLD N KSKVADFGLS
Sbjct  431   KQRGTGLPWLVRLDIAIETANAIAHLHSAINPPIFHRDIKSSNILLDQNLKSKVADFGLS  490

Query  548   RFGLIESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQ  369
             R G+ E SHISTAPQGTPGYLDPQYHQDFHLSDKSDVYS GVVLVE+IT +K VDF R +
Sbjct  491   RLGMAEISHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSLGVVLVELITAMKVVDFCRAK  550

Query  368   NEVNLAALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMM  189
              EVNLAALA D+IG G + EIIDPL++ E D W +SSV KVAE+AFRCLAFHRD+RPSM+
Sbjct  551   EEVNLAALAADRIGNGRVREIIDPLMDMEGDEWGISSVEKVAEVAFRCLAFHRDVRPSMV  610

Query  188   EVAIELEQMRLSKW  147
             EVA ELE++R S+W
Sbjct  611   EVAAELEEIRRSRW  624



>ref|XP_010060884.1| PREDICTED: wall-associated receptor kinase-like 14 [Eucalyptus 
grandis]
Length=706

 Score =   679 bits (1751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/615 (57%), Positives = 446/615 (73%), Gaps = 23/615 (4%)
 Frame = -3

Query  1943  MIPVLILLLLQSAMVFGSSTCNRSCGDGL---KQLPFPFGFSSGCEILLNCTSNGTMSIG  1773
             ++  ++L +L +A       C+++C +G    + L +PFGFS GC I LNCT +G   IG
Sbjct  12    LLAGVVLPILAAARKAIPPPCSQTCHNGKPAKQNLTYPFGFSPGCPIQLNCTDDGDALIG  71

Query  1772  EFPVYQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCS--SPELKCMIP  1599
             EF V   + +T+ + I A+C R  EA+  L+G+N+AP   N ILL NC+  SP   C +P
Sbjct  72    EFRVQAASSETVTVTIEAECDRSFEAIANLYGRNYAPMGKNAILLNNCTKISP---CDLP  128

Query  1598  ST-MIQTQF----ELQDCGKDNISCFSEP--HMTGGFIGYENLTGTGCKSLFSAISSPAA  1440
             +T +IQ +F    E ++     +SC+SE   + +  F+    L+  GCK   S+IS  A 
Sbjct  129   NTRVIQARFQSLCETKNKANTGMSCYSEKENNYSTKFLNRSRLSALGCKFFLSSIS--AE  186

Query  1439  AANTTAVSLDIQVIELGWWLQG-HCRCSKNADCNTMR-TPGDGKPGFRCQCSEGFTGDGY  1266
               N  +VSL +Q+++L WW+ G  C CS++ADC  +   P  G  GFRC+C +GF GDG+
Sbjct  187   DLNNVSVSLGVQMLQLAWWVNGDRCECSRDADCVRLSGLPNSGGNGFRCKCRDGFRGDGF  246

Query  1265  QGGSGCRRDDTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAMK  1086
               G+GCRRD   CNPAKYL G+CGG TRI VL+GGV+ GA+ M+S+GLIC   RRR   K
Sbjct  247   LAGTGCRRDAFMCNPAKYLSGQCGGATRIIVLVGGVVVGASFMISLGLICYFFRRRSKWK  306

Query  1085  NWNRRRRELRETTG-ITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVA  909
                  +R L E +G  +I  Y YK+IE+ATN F++K+RLG GA+GTVYSGKL+ +DEWVA
Sbjct  307   AQLEVQRRLSEASGKSSITFYPYKEIERATNYFAEKQRLGTGAFGTVYSGKLNGDDEWVA  366

Query  908   IKRIRHRDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQ  729
             IKRI+ RD  S+EQV NEIKLLSSV+HP+LV+LLGCSIEKGEQIL+YEFMPNGTL QHL 
Sbjct  367   IKRIKQRD--SVEQVMNEIKLLSSVSHPHLVKLLGCSIEKGEQILIYEFMPNGTLCQHLH  424

Query  728   REKGSGLPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLS  549
             RE+G GL WP+RL I SET+QAIA+LH ++ PPIYHRDVKSSNILLDY++ SKVADFGLS
Sbjct  425   RERGQGLSWPIRLKIASETAQAIAHLH-SIKPPIYHRDVKSSNILLDYSFTSKVADFGLS  483

Query  548   RFGLIESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQ  369
             R G++E SHISTAPQGTPGYLDPQYHQDFHLSDKSDVYS GVVL EIIT LK VDF+RPQ
Sbjct  484   RLGMLEDSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSLGVVLTEIITSLKVVDFSRPQ  543

Query  368   NEVNLAALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMM  189
             NEVNLA LA D+IG+  L EIIDP ++  KD WT  SV KVAE+AFRCLA HRDMRP+M 
Sbjct  544   NEVNLANLATDRIGRARLDEIIDPSLDVNKDEWTYLSVQKVAELAFRCLASHRDMRPTMK  603

Query  188   EVAIELEQMRLSKWG  144
             EVA EL+++  S+W 
Sbjct  604   EVADELDRLWFSRWA  618



>ref|XP_010548399.1| PREDICTED: wall-associated receptor kinase-like 14 [Tarenaya 
hassleriana]
 ref|XP_010548400.1| PREDICTED: wall-associated receptor kinase-like 14 [Tarenaya 
hassleriana]
Length=683

 Score =   677 bits (1748),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/603 (57%), Positives = 434/603 (72%), Gaps = 15/603 (2%)
 Frame = -3

Query  1928  ILLLLQSAMVFGSS---TCNRSCGDGLKQLPFPFGFSSGCEILLNCTSNGTMSIGEFPVY  1758
             +LL++     F S+   +C+  CG   K LP+PFGFS GC I  NC S G  +IGEF V 
Sbjct  12    LLLVIIGTAKFASTIADSCDGVCGR--KTLPYPFGFSPGCPIQFNC-SGGVANIGEFSVQ  68

Query  1757  QLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNC-SSPELKCMIPSTMIQT  1581
              +T ++I + +PA+C R IE +KPLFG+  APTS N  L++ C SS E  C I    +++
Sbjct  69    NVTEESIFVGVPAECRRSIEKLKPLFGELHAPTSENSFLVEQCKSSSEETCSIKQKFLES  128

Query  1580  QFELQDCGKD-NISCFSEPHMTGGFIGYENLTGTGCKSLFSAISSPAAAANTTAVSLDIQ  1404
             Q +L+ C  D NISC+S       F  +ENLT T C+SLFS+I+  +   N+ A++L+ +
Sbjct  129   QLKLRSCDSDGNISCYSLDTNITKFFSFENLTRTSCRSLFSSIAFESVGENS-AIALEFE  187

Query  1403  VIELGWWLQGHCR---CSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDT  1233
              + LGWWL+G CR   CS+ A+C  +    D   G RC C EG+ GDG+  G  CRR   
Sbjct  188   RLRLGWWLKGRCRKGTCSEGANCTDVAI-ADSYHGHRCSCPEGYIGDGFTNGVPCRRAPG  246

Query  1232  RCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAMKNWNRRRRELRE  1053
              C+ +K +   C G     ++ G V   + + V   LI CI RR ++ +N  R +R L E
Sbjct  247   DCHGSKLVSSHCRGAKFGILIGGTVAGASLMAVLALLIFCIRRRSISSRNLLRAKRLLNE  306

Query  1052  TTG-ITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDS  876
               G  ++P + YK+IEKAT+ FSDK+RLG GAYGTVY+GKL D DEWVA KR+R RD+DS
Sbjct  307   AAGNSSVPFFPYKEIEKATSGFSDKQRLGTGAYGTVYAGKLQD-DEWVAFKRLRQRDSDS  365

Query  875   IEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPV  696
             I+QV NEIKLLSSV+HPNLVRLLGC +E+GE +LVYEFMPNGTLSQHLQRE+G+GLPW V
Sbjct  366   IDQVKNEIKLLSSVSHPNLVRLLGCCVEQGEPVLVYEFMPNGTLSQHLQRERGNGLPWMV  425

Query  695   RLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHIS  516
             RL I ++T++ IAYLH+AM+PPIYHRD+KSSNILLDY+  SKVADFGLSR G+ ESSHIS
Sbjct  426   RLTIANQTAKGIAYLHSAMNPPIYHRDIKSSNILLDYDCNSKVADFGLSRMGMTESSHIS  485

Query  515   TAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVD  336
             TAPQGTPGYLDPQYHQ FHLSDKSDVYSFGVVLVEIIT LK VDF RP +E+NLAALA++
Sbjct  486   TAPQGTPGYLDPQYHQCFHLSDKSDVYSFGVVLVEIITALKVVDFNRPHSEINLAALAIE  545

Query  335   KIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRL  156
             KI  G + EIIDP++E   D WTLSS++ +AE+AFRCLAFHRDMRP+MMEVA ELEQ+ L
Sbjct  546   KIRSGCIDEIIDPILEPNLDDWTLSSIHSMAELAFRCLAFHRDMRPTMMEVADELEQLML  605

Query  155   SKW  147
               W
Sbjct  606   GSW  608



>ref|XP_002301212.2| hypothetical protein POPTR_0002s13210g [Populus trichocarpa]
 gb|EEE80485.2| hypothetical protein POPTR_0002s13210g [Populus trichocarpa]
Length=635

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/555 (61%), Positives = 414/555 (75%), Gaps = 15/555 (3%)
 Frame = -3

Query  1784  MSIGEFPVYQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCM  1605
             M I EFPV  +  ++I I +  KC R +EA+  LF KN+AP S N ILL NC+S    C 
Sbjct  1     MLINEFPVQIVGQNSIKIILEPKCNRPLEALDNLFTKNYAPKSTNAILLHNCTSAVSPCN  60

Query  1604  IPSTMIQTQFELQDCGKDN-ISCFSEPHMTGGFIGYENLTGTGCKSLFSAISSPAAAANT  1428
             IPS  +QT FE   C  ++ +SCFS+     GF  Y     + C+   S+IS  A +   
Sbjct  61    IPSINVQTHFESLKCSNNSSLSCFSKEVTANGFFDYNMANISQCQYFLSSIS--AESFTG  118

Query  1427  TAVSLDIQVIELGWWLQGHCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGC  1248
             + VSL+IQ++EL WWLQG CRCSK+A C  + +P     GFRCQC +G  GDGY  G GC
Sbjct  119   SGVSLEIQMMELWWWLQGDCRCSKDAICTQVESPAGS--GFRCQCRDGLIGDGYLAGVGC  176

Query  1247  RRD---DTR----CNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAM  1089
             R+    D +    CNPAKYL G+CGG +   VL+GGV+AG  + +   L CC++RR  A 
Sbjct  177   RKGSFLDVKASAGCNPAKYLSGQCGGGSGAAVLLGGVVAGVGVSLG--LFCCLVRRNSAS  234

Query  1088  KNWNRRRRELRETTGITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVA  909
             K  + R+  L E   I IP+Y YK+IEKATN+FS+K+R+G GAYGTVY+GKL ++D WVA
Sbjct  235   KAKSFRKLHLSEAADINIPIYPYKEIEKATNSFSEKQRIGTGAYGTVYAGKL-NSDSWVA  293

Query  908   IKRIRHRDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQ  729
             IKRI+H D D+IEQV NEIKL+SSV+HPNLVRLLGCSIE GEQILVYEFMPNGTL QHLQ
Sbjct  294   IKRIKHGDMDNIEQVMNEIKLISSVSHPNLVRLLGCSIENGEQILVYEFMPNGTLCQHLQ  353

Query  728   REKGSGLPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLS  549
             RE+G GL WPVRL I ++T++AIA+LH+AM PPIYHRD+KSSNILLDY+++SKVADFGLS
Sbjct  354   RERGDGLDWPVRLAIAADTAKAIAHLHSAMDPPIYHRDIKSSNILLDYHFRSKVADFGLS  413

Query  548   RFGLIESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQ  369
             R G+ E SHIST PQGTPGYLDPQYH +FHLSDKSDVYSFGVVLVEIIT  K VDF+RPQ
Sbjct  414   RHGMTEISHISTVPQGTPGYLDPQYHLNFHLSDKSDVYSFGVVLVEIITAKKVVDFSRPQ  473

Query  368   NEVNLAALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMM  189
             NEVNLAALA D+IG+G L EIIDP ++   D WT SSV+KVAE+AFRCLAFH+DMRPSMM
Sbjct  474   NEVNLAALATDRIGRGRLDEIIDPFLDLHSDAWTFSSVHKVAEVAFRCLAFHKDMRPSMM  533

Query  188   EVAIELEQMRLSKWG  144
             EVA ELEQ+ LS+W 
Sbjct  534   EVAAELEQILLSRWA  548



>ref|XP_010089008.1| Wall-associated receptor kinase-like 14 [Morus notabilis]
 gb|EXB37235.1| Wall-associated receptor kinase-like 14 [Morus notabilis]
Length=732

 Score =   679 bits (1751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/618 (57%), Positives = 438/618 (71%), Gaps = 41/618 (7%)
 Frame = -3

Query  1889  STCNRSC----GDGLKQLPFPFGFSSGCEILLNCTSNGTMSIGEFPVYQLTPDTIMINIP  1722
             + C+RSC    G     +PFPFGFS GCEI LNC+S G   IGEF V   T  ++ +N+ 
Sbjct  34    TICDRSCPSGNGKSPNTVPFPFGFSDGCEIRLNCSSFGETKIGEFVVQNFTASSVFVNLS  93

Query  1721  AKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELK-CMIPSTMIQTQFELQD-C----  1560
             AKC R IE++KPLFG+N+  T  N +LL +C S +L  C++P ++++ +  L+D C    
Sbjct  94    AKCDRPIESIKPLFGRNYGLTWENSLLLHDCESKKLNGCLVPMSVVEKRLRLEDNCSTSA  153

Query  1559  ---GKDNISCFSEPHMTGG-FIGYENLTGTGCKSLFSAISSPAAAANTTAVSLDIQVIEL  1392
                   +++CFS+        + +  +  T CKSLF++I+    +   +  SL+ Q +EL
Sbjct  154   SNKNDSSLNCFSQDSAAAADIMDFAEVNNTSCKSLFTSIA--VNSGGDSPYSLEFQRLEL  211

Query  1391  GWWLQGHCR------CSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGY---QGGSGCRRD  1239
             GWWL G CR      C  NA C  +  PG GK GFRC C + F GDG+   +GGSGC +D
Sbjct  212   GWWLNGLCRNKRAEFCHANATCANVTLPG-GKLGFRCYCPKDFNGDGFARSRGGSGCWKD  270

Query  1238  DTRCNPAKYLLGECGGKTRigvliggvi-----------agaaLMVSVGLICCIIRRR-L  1095
              + CNP KYL G+CGG +++ VL+               +GA LM  +  +C  +R R  
Sbjct  271   -SDCNPRKYLSGKCGGMSKVVVLVIDDTMCPIGWISGIISGAVLMAFLTCLCHFVRHRST  329

Query  1094  AMKNWNRRRRELRETTGIT-IPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDE  918
              +KN    +R L E  G + + +Y YK+IEKATN FS+ +RLG GA+G VY+GKLH NDE
Sbjct  330   CLKNRMSAKRLLSEAAGTSSVALYPYKEIEKATNGFSESQRLGTGAFGMVYAGKLH-NDE  388

Query  917   WVAIKRIRHRDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQ  738
             WVAIK+I+HRD D I+QV NEIKLLSSV+HPNLVRLLGC IE+GEQIL+YE+M NGTLSQ
Sbjct  389   WVAIKKIKHRDNDGIDQVLNEIKLLSSVSHPNLVRLLGCCIEQGEQILIYEYMANGTLSQ  448

Query  737   HLQREKGSGLPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADF  558
             HLQR++G GLPW  RL I +ET+ AIAYLH+A+HPPIYHRD+KSSNILLD+N+KSKVADF
Sbjct  449   HLQRQRGRGLPWTTRLTIAAETANAIAYLHSAVHPPIYHRDIKSSNILLDFNFKSKVADF  508

Query  557   GLSRFGLIESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFT  378
             GLSR G+ E SHISTAPQGTPGY+DPQYHQ+FHLSDKSDVYSFGVVLVEIIT LK VDF 
Sbjct  509   GLSRLGMTELSHISTAPQGTPGYVDPQYHQNFHLSDKSDVYSFGVVLVEIITSLKVVDFN  568

Query  377   RPQNEVNLAALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRP  198
             RPQ+EVNLAALAVD+IGKG + +IIDP IE  +D WTL SVNKVAE+AFRCLAFH D RP
Sbjct  569   RPQSEVNLAALAVDRIGKGCVDDIIDPFIEPHRDAWTLYSVNKVAELAFRCLAFHSDTRP  628

Query  197   SMMEVAIELEQMRLSKWG  144
             SMMEVA ELEQ+R S W 
Sbjct  629   SMMEVAEELEQIRRSGWA  646



>ref|XP_011085521.1| PREDICTED: wall-associated receptor kinase-like 14 [Sesamum indicum]
Length=708

 Score =   677 bits (1747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/619 (56%), Positives = 443/619 (72%), Gaps = 26/619 (4%)
 Frame = -3

Query  1943  MIPVL--ILLLLQSAMVFGSSTCNRSCGDGLKQLPFPFGFSSGCEILLNCTSN---GTMS  1779
             ++P L  +L L   A  F S+ C++ CG    ++P+PFGFS GC+I LNC+S+   GT+ 
Sbjct  9     IVPSLLSVLALTSLAQNFSSAGCDQFCG--TSRVPYPFGFSDGCKIKLNCSSDSGSGTIK  66

Query  1778  IGEFPVYQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIP  1599
             I +F V  +T D I+I +P KC RRIE +  LFG NFAPT  NGILL+NCS+    C+IP
Sbjct  67    INDFLVENVTSDQILIRVPPKCNRRIEELSGLFGANFAPTWRNGILLENCSARVNDCVIP  126

Query  1598  STMIQTQFELQDC----GKD--NISCFSEP-HMTGGFIGYENLTGTG-CKSLFSAI----  1455
             S +++++    +C    G D  N+SC+S        F+ +  +T  G C  LFS+I    
Sbjct  127   SRLVRSRIGF-NCNSGEGTDYYNVSCYSVGLDDVSEFLDFGKVTAKGNCSILFSSIMVDS  185

Query  1454  -SSPAAAANTTAVSLDIQVIELGWWLQGHCRCSKNADCNTMRTPGDGKPGFRCQCSEGFT  1278
               S  + + +  +SLD Q  ELGWW+ G C C  +A C   R    GK G+RC+C++G+ 
Sbjct  186   NDSGNSLSGSPPISLDFQTAELGWWVDGGCDCDPSARCT--RVTHGGKMGYRCKCNKGYA  243

Query  1277  GDGYQGGSGCRRDDTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRR  1098
             GDG+ GG  CR+  + C+   ++ G C G T   ++ G +     + V   +  C+ RR 
Sbjct  244   GDGFAGGKRCRKV-SDCSAGGFMSGRCRGSTLGILIGGIIAGVLLVAVLAVIWYCVKRRG  302

Query  1097  LAMKNWNRRRRELRETTGIT-IPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDND  921
               +K+    +  + E  G + IP Y YK+IE+ATN FS+K++LG GAYGTVY+GKLH ND
Sbjct  303   ATLKSRLSAKHLISEAAGSSNIPFYPYKEIERATNGFSEKQQLGTGAYGTVYAGKLH-ND  361

Query  920   EWVAIKRIRHRDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLS  741
             EWVAIK+IR+RD DSIEQV NEIKLLSSV+HPNLVRLLGC IE GEQILVYE+MPNGTLS
Sbjct  362   EWVAIKKIRYRDHDSIEQVMNEIKLLSSVSHPNLVRLLGCCIENGEQILVYEYMPNGTLS  421

Query  740   QHLQREKGSGLPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVAD  561
              HLQRE GS LPW +RL I +ET+ AIA+LH+A +PPIYHRD+KSSNILLDYN+ SKVAD
Sbjct  422   HHLQREGGSVLPWTIRLTIAAETAHAIAHLHSATNPPIYHRDIKSSNILLDYNFHSKVAD  481

Query  560   FGLSRFGLIESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDF  381
             FGLSRFG+ + SH+STAPQGTPGY+DPQYHQ+FHLSDKSDVYSFGVVLVEIIT  K VDF
Sbjct  482   FGLSRFGMTDDSHVSTAPQGTPGYVDPQYHQNFHLSDKSDVYSFGVVLVEIITAKKVVDF  541

Query  380   TRPQNEVNLAALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMR  201
             +RP +E+NLAALA+D+IGKG + EIIDP +E  +D WTLSSV+KVAE+AFRCLAFHRDMR
Sbjct  542   SRPHSEINLAALAIDRIGKGRVDEIIDPFLEPNRDAWTLSSVHKVAELAFRCLAFHRDMR  601

Query  200   PSMMEVAIELEQMRLSKWG  144
             PSMMEVA ELEQ+RLS W 
Sbjct  602   PSMMEVADELEQIRLSGWA  620



>ref|XP_003517271.1| PREDICTED: wall-associated receptor kinase-like 14-like [Glycine 
max]
 gb|KHN36193.1| Wall-associated receptor kinase-like 14 [Glycine soja]
Length=694

 Score =   676 bits (1744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/611 (56%), Positives = 436/611 (71%), Gaps = 31/611 (5%)
 Frame = -3

Query  1934  VLILLLLQSAMVFGSSTCNRSCGDGLKQLPFPFGFSSGCEILLNCTSNGTM---SIGEFP  1764
             VL + +  +      +TCN  CG+    L FPFGFS GC I L+C+++        GEF 
Sbjct  13    VLTIFIACTTRAQNLTTCNGKCGE--HTLQFPFGFSQGCPIQLDCSNDQVQLRSEFGEFL  70

Query  1763  VYQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMIQ  1584
             V  +T   I +N+PAKC R +E+++P+F +NFAPT NN  L+Q+C      C+IP++ + 
Sbjct  71    VQNVTNSNIFVNLPAKCNRTMESIQPIFTENFAPTINNSFLVQDCREVFGGCVIPASFVS  130

Query  1583  TQFELQDCGKD--NISCFSEPHMTGGFIGYENLTGTGCKSLFSAISSPAAAANTTAVSLD  1410
              Q ++++C     NISCFS+      F+ Y +L GT CK LFSA+S       +  + L 
Sbjct  131   NQIDVENCSNKSANISCFSKQDEV--FVTYADLNGTKCKYLFSAVS----FGQSKEIPLQ  184

Query  1409  IQVIELGWWLQGHC---RCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRD  1239
              QV+ELGWWL G C   +CS NA C T+      + GFRCQC EGFTGDG++ G GCR+ 
Sbjct  185   FQVVELGWWLPGQCDDHQCSNNATCTTV-----DRVGFRCQCIEGFTGDGFKNGIGCRKA  239

Query  1238  DTRCNPAKYLL-GECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAMKNWNRR---  1071
                   A  L  G CG  T+IGV++G +  GA ++  + L+C   RRR     W R+   
Sbjct  240   SASSCSASTLTSGGCGKATKIGVVVGVITTGALVVAGLFLLCYCARRR---STWLRKHTM  296

Query  1070  -RRELRETTG-ITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRI  897
              +R+LRE  G  ++P Y YK+IEKATN FS+K RLG GA+GTVY+GKLH NDEWVAIK++
Sbjct  297   VKRQLREAAGNSSVPFYPYKEIEKATNFFSEKHRLGTGAFGTVYAGKLH-NDEWVAIKKL  355

Query  896   RHRDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKG  717
             R RDT+S +QV NEI+LLSSV+HPNLVRLLGC IEKGE ILVYEFM NGTLSQHLQRE+ 
Sbjct  356   RQRDTNSADQVMNEIRLLSSVSHPNLVRLLGCCIEKGEHILVYEFMQNGTLSQHLQRERS  415

Query  716   SGLPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGL  537
              GLPW +RL I +ET+ AIAYLH+A+HPPIYHRD+KS+NILLDY +KSK+ADFGLSR  L
Sbjct  416   KGLPWTIRLTIATETANAIAYLHSAIHPPIYHRDIKSTNILLDYGFKSKIADFGLSRLAL  475

Query  536   IESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVN  357
              E+SHISTAPQGTPGY+DPQYHQ+F LSDKSDVYSFGVVLVEIIT +K VDF RP++E+N
Sbjct  476   TETSHISTAPQGTPGYVDPQYHQNFQLSDKSDVYSFGVVLVEIITAMKVVDFARPRSEIN  535

Query  356   LAALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAI  177
             LAALAVD+I +G + EIIDP +E  +D WTL S++KVAE+AFRCLAFH DMRP+MMEVA 
Sbjct  536   LAALAVDRIRRGAVDEIIDPFLEPHRDAWTLYSIHKVAELAFRCLAFHSDMRPTMMEVAE  595

Query  176   ELEQMRLSKWG  144
             ELE +R S W 
Sbjct  596   ELEHIRRSGWA  606



>ref|XP_002510319.1| kinase, putative [Ricinus communis]
 gb|EEF52506.1| kinase, putative [Ricinus communis]
Length=627

 Score =   671 bits (1732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/559 (62%), Positives = 412/559 (74%), Gaps = 31/559 (6%)
 Frame = -3

Query  1784  MSIGEFPVYQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCM  1605
             M + EFP+  +  + I I++  KC R I+  K LF KNFAP S N ILL NCSS  L C 
Sbjct  1     MVVNEFPIVYVNQEKIRIDLRPKCDRPIDTFKSLFTKNFAPMSTNAILLNNCSSTLLPCS  60

Query  1604  IPSTMIQTQFELQDCGKDNIS---CFSEPHMTGGFIGYENLTGTG--------CKSLFSA  1458
             IP   +QT FE  +C K + S   C          +  +N   +G        C    S+
Sbjct  61    IPDISVQTHFESLNCSKSSRSSISCLFN-------LTRDNFFDSGKYTDQLKYCDYFLSS  113

Query  1457  ISSPAAAANTTAVSLDIQVIELGWWLQGHCRCSKNADCNTMRTPGDGKPGFRCQCSEGFT  1278
             ISS   + N + VSLDI V++LGWWL G C+CS+ ADC  + +P    PG+RC+C +GF+
Sbjct  114   ISS--ESVNGSGVSLDILVLDLGWWLPGKCQCSEQADCIKIASPKG--PGYRCRCKDGFS  169

Query  1277  GDGYQGGSGCRRDDTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRR  1098
             GDGY  G+GCR+    CN  K+L G+CG   RI VLIGG       MV++GL+CC IRRR
Sbjct  170   GDGYSAGTGCRKGS--CNLEKHLSGQCGETIRIAVLIGGSAL----MVALGLVCCFIRRR  223

Query  1097  LAM-KNWNRRRRELRETTGITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDND  921
              +  K    R+  L E TGI IP+Y YK+IEKATN+FSDK+RLG GAYGTVY+GKLH ND
Sbjct  224   FSTSKAKGFRKLSLSEATGINIPIYPYKEIEKATNSFSDKQRLGTGAYGTVYAGKLH-ND  282

Query  920   EWVAIKRIRHRDTD-SIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTL  744
              WVAIKRI+HRD D S+EQV NEIKL+SSVNHP+LVRLLGCSIE GEQ+LVYEFMPNGTL
Sbjct  283   IWVAIKRIKHRDIDDSVEQVMNEIKLISSVNHPSLVRLLGCSIENGEQVLVYEFMPNGTL  342

Query  743   SQHLQREKGSGLPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVA  564
              QHLQREKG GL WPVRL I +ET+QAIAYLH+A+ PPIYHRD+KSSNILLDYN++SKVA
Sbjct  343   CQHLQREKGDGLAWPVRLTIAAETAQAIAYLHSAIDPPIYHRDIKSSNILLDYNFRSKVA  402

Query  563   DFGLSRFGLIESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVD  384
             DFGLSR G  E SHISTAPQGTPGYLDPQYHQ+FHLSDKSDVYSFGVVL+EIIT LK VD
Sbjct  403   DFGLSRLGRTEISHISTAPQGTPGYLDPQYHQNFHLSDKSDVYSFGVVLIEIITALKVVD  462

Query  383   FTRPQNEVNLAALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDM  204
             F+R  NEVNLAALA D+IGKG L EIIDPL++   D WT S+V+KVAE+AFRCLAF +D 
Sbjct  463   FSRQYNEVNLAALATDRIGKGRLAEIIDPLLDIHCDAWTFSTVHKVAELAFRCLAFDKDT  522

Query  203   RPSMMEVAIELEQMRLSKW  147
             RPSMMEVA ELEQ+R+S+W
Sbjct  523   RPSMMEVAAELEQLRISRW  541



>ref|XP_010646389.1| PREDICTED: wall-associated receptor kinase-like 14 isoform X2 
[Vitis vinifera]
Length=697

 Score =   670 bits (1729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/603 (60%), Positives = 449/603 (74%), Gaps = 21/603 (3%)
 Frame = -3

Query  1925  LLLLQSAMVFGSSTCNRSCGDG--LKQLPFPFGFSSGCEILLNCTSNGTMSIGEFPVYQL  1752
             +L L   +   S+  N SCG G   K++ +PFGFSS   I LNC+  G + I  F V  +
Sbjct  19    ILALICTVTLVSAIKNDSCGTGKSAKRVHYPFGFSSDSPIKLNCSKEGEIEIQNFKVQNV  78

Query  1751  TPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMIQTQFE  1572
             T D+I+IN+PA+C R I+ ++PLFGKN+A +S N +L QNCSS    C+IP+++   Q +
Sbjct  79    TTDSIIINLPAQCQREIQKIEPLFGKNYALSSKNSLLFQNCSSSSSGCVIPTSVFNGQNK  138

Query  1571  LQDC-GK--DNISCF---SEPHMTGGFIGYENLTGTGCKSLFSAISSPAAAANTTAVSLD  1410
             L +C GK  +NISCF   SE      F+ + N+TGTGCK  F  +S      N +AVSL+
Sbjct  139   LNNCNGKSDNNISCFPLDSESE----FMSFANVTGTGCK--FLLLSMAVEWRNNSAVSLE  192

Query  1409  IQVIELGWWLQGHCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTR  1230
             +   +LGWWL   C C+ NA    +  PG    G RC C EGF GDG++ G GC+ D   
Sbjct  193   LGTAQLGWWLDHPCHCAPNAKHTNLTVPGGF--GCRCSCKEGFDGDGFKDGDGCQED---  247

Query  1229  CNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAMKNWNRRRRELRET  1050
             CN +KY+ G CGG TR+ VL+GGVI GA+LM +V LIC  IRRR  ++     +R + E 
Sbjct  248   CNASKYMSGTCGGTTRVAVLVGGVIVGASLMSTVALICYCIRRRSYLRRRMSAKRLICEA  307

Query  1049  TG-ITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSI  873
              G  ++P+Y YK++E+ATN FS+K+RLG GAYGTV++GKLH NDEWVAIK+IR+RD DSI
Sbjct  308   AGNSSVPLYPYKEVERATNGFSEKQRLGTGAYGTVFAGKLH-NDEWVAIKKIRNRDNDSI  366

Query  872   EQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVR  693
             EQV NEIKL+SSVNHPNLVRLLGC IE GEQILVYEFM NGTLSQHLQ+E+G GLPW  R
Sbjct  367   EQVMNEIKLISSVNHPNLVRLLGCCIENGEQILVYEFMANGTLSQHLQKERGKGLPWTTR  426

Query  692   LGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHIST  513
             L I +ET+ AIA+LH+A+ PPI+HRD+KSSNILLD N+ SKVADFGLSR G+ ESSHIST
Sbjct  427   LNIATETANAIAHLHSAITPPIFHRDIKSSNILLDDNFNSKVADFGLSRLGMTESSHIST  486

Query  512   APQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDK  333
             APQGTPGYLDPQYHQ+FHLSDKSDVYSFGVVLVEII+ +K VDF+RP +EVNLAALA+D+
Sbjct  487   APQGTPGYLDPQYHQNFHLSDKSDVYSFGVVLVEIISAMKVVDFSRPHSEVNLAALAIDR  546

Query  332   IGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLS  153
             IG+G + EIIDP +E ++D WTL S++KVAE+AFRCLAFHRDMRPSMMEVA ELE +RLS
Sbjct  547   IGRGCVDEIIDPFLEPQRDAWTLCSIHKVAELAFRCLAFHRDMRPSMMEVADELEHVRLS  606

Query  152   KWG  144
              W 
Sbjct  607   GWA  609



>ref|XP_002275295.1| PREDICTED: wall-associated receptor kinase-like 14 isoform X1 
[Vitis vinifera]
Length=699

 Score =   669 bits (1727),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/603 (60%), Positives = 450/603 (75%), Gaps = 19/603 (3%)
 Frame = -3

Query  1925  LLLLQSAMVFGSSTCNRSCGDG--LKQLPFPFGFSSGCEILLNCTSNGTMSIGEFPVYQL  1752
             +L L   +   S+  N SCG G   K++ +PFGFSS   I LNC+  G + I  F V  +
Sbjct  19    ILALICTVTLVSAIKNDSCGTGKSAKRVHYPFGFSSDSPIKLNCSKEGEIEIQNFKVQNV  78

Query  1751  TPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMIQTQFE  1572
             T D+I+IN+PA+C R I+ ++PLFGKN+A +S N +L QNCSS    C+IP+++   Q +
Sbjct  79    TTDSIIINLPAQCQREIQKIEPLFGKNYALSSKNSLLFQNCSSSSSGCVIPTSVFNGQNK  138

Query  1571  LQDC-GK--DNISCF---SEPHMTGGFIGYENLTGTGCKSLFSAISSPAAAANTTAVSLD  1410
             L +C GK  +NISCF   SE      F+ + N+TGTGCK  F  +S      N +AVSL+
Sbjct  139   LNNCNGKSDNNISCFPLDSESE----FMSFANVTGTGCK--FLLLSMAVEWRNNSAVSLE  192

Query  1409  IQVIELGWWLQGHCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTR  1230
             +   +LGWWL   C C+ NA    +  PG    G RC C EGF GDG++ G GC+ + T 
Sbjct  193   LGTAQLGWWLDHPCHCAPNAKHTNLTVPGGF--GCRCSCKEGFDGDGFKDGDGCQ-EVTD  249

Query  1229  CNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAMKNWNRRRRELRET  1050
             CN +KY+ G CGG TR+ VL+GGVI GA+LM +V LIC  IRRR  ++     +R + E 
Sbjct  250   CNASKYMSGTCGGTTRVAVLVGGVIVGASLMSTVALICYCIRRRSYLRRRMSAKRLICEA  309

Query  1049  TG-ITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSI  873
              G  ++P+Y YK++E+ATN FS+K+RLG GAYGTV++GKLH NDEWVAIK+IR+RD DSI
Sbjct  310   AGNSSVPLYPYKEVERATNGFSEKQRLGTGAYGTVFAGKLH-NDEWVAIKKIRNRDNDSI  368

Query  872   EQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVR  693
             EQV NEIKL+SSVNHPNLVRLLGC IE GEQILVYEFM NGTLSQHLQ+E+G GLPW  R
Sbjct  369   EQVMNEIKLISSVNHPNLVRLLGCCIENGEQILVYEFMANGTLSQHLQKERGKGLPWTTR  428

Query  692   LGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHIST  513
             L I +ET+ AIA+LH+A+ PPI+HRD+KSSNILLD N+ SKVADFGLSR G+ ESSHIST
Sbjct  429   LNIATETANAIAHLHSAITPPIFHRDIKSSNILLDDNFNSKVADFGLSRLGMTESSHIST  488

Query  512   APQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDK  333
             APQGTPGYLDPQYHQ+FHLSDKSDVYSFGVVLVEII+ +K VDF+RP +EVNLAALA+D+
Sbjct  489   APQGTPGYLDPQYHQNFHLSDKSDVYSFGVVLVEIISAMKVVDFSRPHSEVNLAALAIDR  548

Query  332   IGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLS  153
             IG+G + EIIDP +E ++D WTL S++KVAE+AFRCLAFHRDMRPSMMEVA ELE +RLS
Sbjct  549   IGRGCVDEIIDPFLEPQRDAWTLCSIHKVAELAFRCLAFHRDMRPSMMEVADELEHVRLS  608

Query  152   KWG  144
              W 
Sbjct  609   GWA  611



>ref|XP_010531234.1| PREDICTED: wall-associated receptor kinase-like 14 isoform X1 
[Tarenaya hassleriana]
Length=696

 Score =   668 bits (1723),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/602 (57%), Positives = 435/602 (72%), Gaps = 14/602 (2%)
 Frame = -3

Query  1934  VLILLLLQSAMVFGSSTCNRSCGDGLKQLPFPFGFSSGCEILLNCTSNGTMSIGEFPVYQ  1755
             +L+++     M     +CN  CG     LP+PFGFS GC I   C S G   IGEF V  
Sbjct  20    ILVIIATDGIMSTAVGSCNGVCGQ--TTLPYPFGFSLGCPIRFEC-SGGVAKIGEFSVKN  76

Query  1754  LTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNC-SSPELKCMIPSTMIQTQ  1578
             +T +++ + IP  C R IE +KPLFG+  APTS N  L+++C  + E  C I    +++Q
Sbjct  77    VTDESVFVGIPINCSRSIEKLKPLFGELHAPTSENSFLVEHCGDTLEDSCSIKRKFLESQ  136

Query  1577  FELQDCGKD-NISCFSEPHMTGGFIGYENLTGTGCKSLFSAISSPAAAANTTAVSLDIQV  1401
              +LQ C  + N+SCFS       F  +E+L  T C+SLFS+I+  +   N+ A++L+ + 
Sbjct  137   LKLQSCDSNGNLSCFSLDTNITKFFTFEDLRQTRCRSLFSSIAFESVGENS-AIALEFER  195

Query  1400  IELGWWLQGHC---RCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTR  1230
             + LGWWL G C    CS+ A+CN + T  DG+ G RC C EG+ GDG+  GS CRR D  
Sbjct  196   VRLGWWLLGRCGNGTCSEGANCNDVNT-ADGEHGHRCSCPEGYIGDGFSNGSPCRRPD--  252

Query  1229  CNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAMKNWNRRRRELRET  1050
             C+  +  +  C G     ++ G V   + + V   L+ CI RR ++ +N    +R L E 
Sbjct  253   CHGFRLAMRHCKGAKFGIIIGGTVTGASLMAVLALLLFCIRRRSISTRNLTSAKRLLSEA  312

Query  1049  TG-ITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSI  873
              G  +IP + YK+IEKAT+ FSDK+RLG GAYGTVY+GKL  NDEWVAIKR+RHRD+DSI
Sbjct  313   AGNSSIPFFPYKEIEKATSGFSDKQRLGTGAYGTVYAGKLQ-NDEWVAIKRLRHRDSDSI  371

Query  872   EQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVR  693
             +QV NEIKLLSSV+HPNLVRLLGC IE+G+ +LVYEFMPNGTLSQHLQRE+G+GLPW +R
Sbjct  372   DQVMNEIKLLSSVSHPNLVRLLGCCIEQGDPVLVYEFMPNGTLSQHLQRERGNGLPWTMR  431

Query  692   LGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHIST  513
             L I ++T++AIAYLH++M+PPIYHRD+KSSNILLDY++ SKVADFGLSR GL ESSHIST
Sbjct  432   LTIATQTAKAIAYLHSSMNPPIYHRDIKSSNILLDYDFNSKVADFGLSRLGLTESSHIST  491

Query  512   APQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDK  333
             APQGTPGYLDPQYHQ FHLSDKSDVYSFGVVLVEIIT LK VDF RP +E+NLAALA+DK
Sbjct  492   APQGTPGYLDPQYHQCFHLSDKSDVYSFGVVLVEIITALKVVDFNRPHSEINLAALAIDK  551

Query  332   IGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLS  153
             IG G + EIIDP+IE   D WTLSS++ +AE+AFRCLAFHRDMRP+MMEVA ELEQ+RLS
Sbjct  552   IGSGCIDEIIDPIIEPNLDAWTLSSIHSMAELAFRCLAFHRDMRPTMMEVADELEQIRLS  611

Query  152   KW  147
              W
Sbjct  612   AW  613



>ref|XP_010531235.1| PREDICTED: wall-associated receptor kinase-like 14 isoform X2 
[Tarenaya hassleriana]
Length=695

 Score =   666 bits (1719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/602 (57%), Positives = 434/602 (72%), Gaps = 15/602 (2%)
 Frame = -3

Query  1934  VLILLLLQSAMVFGSSTCNRSCGDGLKQLPFPFGFSSGCEILLNCTSNGTMSIGEFPVYQ  1755
             +L+++     M     +CN  CG     LP+PFGFS GC I   C S G   IGEF V  
Sbjct  20    ILVIIATDGIMSTAVGSCNGVCGQ--TTLPYPFGFSLGCPIRFEC-SGGVAKIGEFSVKN  76

Query  1754  LTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNC-SSPELKCMIPSTMIQTQ  1578
             +T +++ + IP  C R IE +KPLFG+  APTS N  L+++C  + E  C I    +++Q
Sbjct  77    VTDESVFVGIPINCSRSIEKLKPLFGELHAPTSENSFLVEHCGDTLEDSCSIKRKFLESQ  136

Query  1577  FELQDCGKD-NISCFSEPHMTGGFIGYENLTGTGCKSLFSAISSPAAAANTTAVSLDIQV  1401
              +LQ C  + N+SCFS       F  +E+L  T C+SLFS+I+  +   N+ A++L+ + 
Sbjct  137   LKLQSCDSNGNLSCFSLDTNITKFFTFEDLRQTRCRSLFSSIAFESVGENS-AIALEFER  195

Query  1400  IELGWWLQGHC---RCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTR  1230
             + LGWWL G C    CS+ A+CN + T  DG+ G RC C EG+ GDG+  GS CRR    
Sbjct  196   VRLGWWLLGRCGNGTCSEGANCNDVNT-ADGEHGHRCSCPEGYIGDGFSNGSPCRR---H  251

Query  1229  CNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAMKNWNRRRRELRET  1050
             C+  +  +  C G     ++ G V   + + V   L+ CI RR ++ +N    +R L E 
Sbjct  252   CHGFRLAMRHCKGAKFGIIIGGTVTGASLMAVLALLLFCIRRRSISTRNLTSAKRLLSEA  311

Query  1049  TG-ITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSI  873
              G  +IP + YK+IEKAT+ FSDK+RLG GAYGTVY+GKL  NDEWVAIKR+RHRD+DSI
Sbjct  312   AGNSSIPFFPYKEIEKATSGFSDKQRLGTGAYGTVYAGKLQ-NDEWVAIKRLRHRDSDSI  370

Query  872   EQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVR  693
             +QV NEIKLLSSV+HPNLVRLLGC IE+G+ +LVYEFMPNGTLSQHLQRE+G+GLPW +R
Sbjct  371   DQVMNEIKLLSSVSHPNLVRLLGCCIEQGDPVLVYEFMPNGTLSQHLQRERGNGLPWTMR  430

Query  692   LGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHIST  513
             L I ++T++AIAYLH++M+PPIYHRD+KSSNILLDY++ SKVADFGLSR GL ESSHIST
Sbjct  431   LTIATQTAKAIAYLHSSMNPPIYHRDIKSSNILLDYDFNSKVADFGLSRLGLTESSHIST  490

Query  512   APQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDK  333
             APQGTPGYLDPQYHQ FHLSDKSDVYSFGVVLVEIIT LK VDF RP +E+NLAALA+DK
Sbjct  491   APQGTPGYLDPQYHQCFHLSDKSDVYSFGVVLVEIITALKVVDFNRPHSEINLAALAIDK  550

Query  332   IGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLS  153
             IG G + EIIDP+IE   D WTLSS++ +AE+AFRCLAFHRDMRP+MMEVA ELEQ+RLS
Sbjct  551   IGSGCIDEIIDPIIEPNLDAWTLSSIHSMAELAFRCLAFHRDMRPTMMEVADELEQIRLS  610

Query  152   KW  147
              W
Sbjct  611   AW  612



>ref|XP_010028331.1| PREDICTED: wall-associated receptor kinase-like 14 [Eucalyptus 
grandis]
 gb|KCW55048.1| hypothetical protein EUGRSUZ_I01022 [Eucalyptus grandis]
Length=725

 Score =   667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/605 (58%), Positives = 443/605 (73%), Gaps = 32/605 (5%)
 Frame = -3

Query  1883  CNRSCGDG--LKQLPFPFGFSSGCEILLNC--------TSNGTMSIGEFPVYQLTPDTIM  1734
             C+++CG G   K++ +PFGFSSGCEI LNC         +   ++IG F V  +T  +I+
Sbjct  39    CSQTCGTGKWAKRVDYPFGFSSGCEIELNCRAANATANATESEIAIGGFRVLNVTRSSIL  98

Query  1733  INIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELK---CMIPSTM-IQTQFELQ  1566
             +++PA C R +    PLF   +AP+  NG LLQNCS P +    C+IP++  +  +F   
Sbjct  99    VSLPAACNRSVGLALPLFAARYAPSWANGFLLQNCSHPPIGGGGCLIPTSFFMDDRFGAA  158

Query  1565  DCG--KDNISCFSEPHMTGGFIGYENLTG-TGCKSLFSAISSPAAAANTTAVSLDIQVIE  1395
              CG   DNISCFS        + Y+ + G T CK LFSA+S+     N    SL+ QVIE
Sbjct  159   GCGAESDNISCFSPADRPFDVMRYDAVLGVTECKILFSAVSAVGPDGN----SLEFQVIE  214

Query  1394  LGWWLQGHC----RCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTRC  1227
             L WWL+G C     C++NA+C  +R P  G  GFRC+C +GF GDG+  G GC+R  + C
Sbjct  215   LSWWLEGSCGGNRTCAENANCTAVRLPAGGH-GFRCECEDGFEGDGFAAGHGCKRVSS-C  272

Query  1226  NPAKYLLGECGGKTRigvliggviagaaLMVS-VGLICCIIRRRLAMKNWNRRRRELRET  1050
             N +KY  G+C G +R+ +L+GG+IAGA++M   VG    I RR  ++++    +R L E 
Sbjct  273   NASKYFSGDCKGSSRMRLLVGGLIAGASIMAGLVGTYFFIRRRSSSLRSQKSAKRLLDEA  332

Query  1049  TGIT-IPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSI  873
              G + IP+Y YK IEKATN FS+K+RLG+GAYGTVY+GKLH N EWVA+KRI++RDTDSI
Sbjct  333   AGSSSIPLYPYKYIEKATNGFSEKQRLGNGAYGTVYAGKLHSN-EWVAVKRIKNRDTDSI  391

Query  872   EQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVR  693
             EQV NEI+LLSSV+HPNLVRLLGC IE+ +QILVYE+MPNGTLSQHLQ+E+G GLPW VR
Sbjct  392   EQVMNEIRLLSSVSHPNLVRLLGCCIERDQQILVYEYMPNGTLSQHLQKERGKGLPWTVR  451

Query  692   LGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIES--SHI  519
             L I +ET+ AIAYLH+A++PPIYHRD+KSSNILLD NY SKVADFGLSR G++ES  SHI
Sbjct  452   LTIAAETANAIAYLHSAVNPPIYHRDIKSSNILLDVNYNSKVADFGLSRLGMVESELSHI  511

Query  518   STAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAV  339
             STAPQGTPGYLDPQYHQ+FHLSDKSDVYSFGVVLVEIITG K VDF+RP  E+NLAALA+
Sbjct  512   STAPQGTPGYLDPQYHQNFHLSDKSDVYSFGVVLVEIITGQKVVDFSRPHTEINLAALAI  571

Query  338   DKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMR  159
             D+IG+G + EIIDP ++  +D WTLSS+ KVAE+AFRCLAFH DMRPSM EVA ELE +R
Sbjct  572   DRIGRGCVDEIIDPFLDPHRDAWTLSSIYKVAELAFRCLAFHSDMRPSMTEVAEELEHVR  631

Query  158   LSKWG  144
              S W 
Sbjct  632   QSGWA  636



>gb|KDO84381.1| hypothetical protein CISIN_1g007442mg [Citrus sinensis]
Length=603

 Score =   660 bits (1704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/599 (59%), Positives = 429/599 (72%), Gaps = 33/599 (6%)
 Frame = -3

Query  1754  LTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPEL-KCMIPSTMIQTQ  1578
             +  D I I +   C R I+ +  LF +N+APTS NGILL +C+S ++  C IP   ++TQ
Sbjct  1     MKSDHIKIIMEPICNRSIQTLHQLFSQNYAPTSRNGILLSSCNSSKVTACKIPLIDVRTQ  60

Query  1577  FELQDCGKDNISCFS----EPHMTGGFIGYENLTGTGCKSLFSAISS-----PAAAANTT  1425
             F    C   + S       E      FI YEN T   CK L SAISS      AA+ N +
Sbjct  61    FNSIKCDSSSNSSSISCYSEEKNDREFIDYENATKQQCKFLLSAISSELFNTSAASINIS  120

Query  1424  AVSLDIQVIELGWWLQGHCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCR  1245
             A SLD++V+E+GWWL GHC CS+NA+C  + TP  G+ GFRC C++GF GDGY  GSGCR
Sbjct  121   AASLDVKVLEVGWWLNGHCHCSQNANCTPVLTP-HGRSGFRCGCNKGFEGDGYPAGSGCR  179

Query  1244  RDDTRCNPAKYLLGECGGKTRigvliggviagaaLMV-SVGLICCIIRRRLAMKNWNRRR  1068
             +    CN AKY+ G+CGGKTRI VLI G     A ++ S+ L+CC++RRR   +     +
Sbjct  180   K--ASCNAAKYISGQCGGKTRIAVLIIGGSTAGASLIISMRLLCCLMRRRSYYRARKSTK  237

Query  1067  RELRETTGIT-IPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRH  891
             R L+E  GI+ IP+Y Y++IEKAT  FS+K+RLG GA+GTVY+GKL  ND  VAIKRI+H
Sbjct  238   RCLKEARGISNIPIYPYREIEKATIGFSEKQRLGTGAFGTVYAGKLQ-NDLLVAIKRIKH  296

Query  890   RDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSG  711
             RDTD I+QV NEIKL+S V+HPNLVRLLGCSIE+GEQILVYEFMPNGTL QHLQRE+G G
Sbjct  297   RDTDGIQQVVNEIKLISCVSHPNLVRLLGCSIERGEQILVYEFMPNGTLCQHLQRERGDG  356

Query  710   LPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIE  531
             L WP+RL +  ET+QAIA+LH+A++PPIYHRD+KSSNILLDYN+KSKVADFGLSR G+ E
Sbjct  357   LSWPIRLTVAMETAQAIAHLHSAINPPIYHRDIKSSNILLDYNFKSKVADFGLSRLGMTE  416

Query  530   SSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLA  351
              SHISTAPQGTPGYLDPQYHQ+FHLSDKSDVYSFGVVLVEIIT LK VDF+RP NEVNLA
Sbjct  417   ISHISTAPQGTPGYLDPQYHQNFHLSDKSDVYSFGVVLVEIITALKVVDFSRPPNEVNLA  476

Query  350   ALAVDKIGKGGLLEIIDPLI---EAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVA  180
             ALA D+I KG L EIIDPLI       D  TL+SV+KVAE+AFRCLAFHRDMRPSM EVA
Sbjct  477   ALAADRISKGRLDEIIDPLIIEHRGHSDAGTLASVHKVAELAFRCLAFHRDMRPSMTEVA  536

Query  179   IELEQMRLSKWGIsedsiitassssssrsssdasEKPLSFSTMKPSEKVTESSPVSVQD  3
              ELE +R              + +    + + + E  L  S+   SE++ ++SP SVQD
Sbjct  537   TELEHIR--------------TRTMEDINCTASLEASLCSSSYNASERMKDNSPPSVQD  581



>gb|KHG05164.1| Wall-associated receptor kinase-like 14 [Gossypium arboreum]
Length=700

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/609 (57%), Positives = 442/609 (73%), Gaps = 17/609 (3%)
 Frame = -3

Query  1940  IPVLILLLLQSAMVFGSSTCNRSC------GDGLKQLPFPFGFSSGCEILLNCTSNGTMS  1779
             I + +L +        S   N  C      G+  + LPFPFGFSSGC I LNC+S G + 
Sbjct  10    ITITVLFVFSRVNSVKSENNNIKCNGSYVIGNTRRFLPFPFGFSSGCPIRLNCSSTG-VK  68

Query  1778  IGEFPVYQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSP-ELKCMI  1602
             IG+F V  +TP  I++++PAKC RR++++  LFG+N++  + N +LL+NCS      C +
Sbjct  69    IGDFHVLNVTPTNIIVDLPAKCNRRLDSIAVLFGENYSVWAANNLLLENCSKAVPTPCDL  128

Query  1601  PSTMIQTQFELQDC--GKDNISCFSEPHMTGGFIGYENLTGTGCKSLFSAISSPAAAANT  1428
               T ++  F+L+ C    D+ISC +  +  GG + Y  +  T C+ L S+ +        
Sbjct  129   SPTFLERSFKLKPCVAKSDDISCLNGGY-DGGLMNYNEVNNTQCRFLLSSTTILTEPERG  187

Query  1427  TAVSLDIQVIELGWWLQGHCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGC  1248
             +AVSL +  I L WW++G C C +NA+C  ++  G+   GF C C EGF GDG++ G GC
Sbjct  188   SAVSLVMGRINLKWWVKGECNCDENANCTKVKN-GNRTVGFTCLCREGFEGDGFKQGGGC  246

Query  1247  RRDDTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAMKNWNRR-  1071
             RR  + CN +K+L G+CG  TR+GVLIGG+I G+ L   + L+CC +RR     N   R 
Sbjct  247   RRVSS-CNFSKFLSGKCGRATRVGVLIGGLIVGSLLTGGLVLLCCYVRRCCNSSNKRARA  305

Query  1070  RRELRETTGIT-IPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIR  894
             +R L E  G + +P Y++++IE+ATN FSDK RLG GAYGTVY+GKLH NDE VAIKR R
Sbjct  306   KRRLCEAAGSSSVPFYAFREIERATNGFSDKNRLGTGAYGTVYAGKLH-NDELVAIKRFR  364

Query  893   HRDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGS  714
             +RD DSI+QV NEIKLLSSV+HPN VRLLGC IE+GE ILVYEFMPNGTLSQHLQRE+G 
Sbjct  365   YRDPDSIDQVMNEIKLLSSVSHPNHVRLLGCCIEEGEPILVYEFMPNGTLSQHLQRERGE  424

Query  713   GLPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLI  534
              LPW  RL I +ET++AIAYLH +++PPI+HRD+KSSNILLDYNY+SKVADFGLSR G+ 
Sbjct  425   ALPWMARLTIAAETAKAIAYLH-SVNPPIFHRDIKSSNILLDYNYRSKVADFGLSRLGMT  483

Query  533   ESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNL  354
             ESSHISTAPQGTPGYLDPQYHQ FHLSDKSDVYSFGVVLVEIIT LK VDF+RP +EVNL
Sbjct  484   ESSHISTAPQGTPGYLDPQYHQYFHLSDKSDVYSFGVVLVEIITALKVVDFSRPHSEVNL  543

Query  353   AALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIE  174
             AALA D+IGKG + EIIDP ++ + D WTLSS++KVAE+AFRCLAFH DMRP+M+EVA E
Sbjct  544   AALATDRIGKGCVDEIIDPYLDLDGDAWTLSSIHKVAELAFRCLAFHPDMRPTMLEVAEE  603

Query  173   LEQMRLSKW  147
             LE++RLS W
Sbjct  604   LERIRLSAW  612



>ref|XP_008792620.1| PREDICTED: wall-associated receptor kinase-like 14 [Phoenix dactylifera]
Length=648

 Score =   660 bits (1704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/598 (56%), Positives = 423/598 (71%), Gaps = 15/598 (3%)
 Frame = -3

Query  1943  MIPVLILLLLQSAMVFGSSTCNRSCGDGLKQLPFPFGFSSGCEILLNCTSNGTMSIGEFP  1764
             ++P L L    S +  G   CNR+CG     +P+PFGFSSGC I LNC+    + +G +P
Sbjct  8     LLPFLFLAAFSSILAEG---CNRTCGG--SSVPYPFGFSSGCPIRLNCSGTAAILLGGYP  62

Query  1763  VYQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMIQ  1584
             V  +T +TI+++IPA C R   A   LFG N+A T  N + L+NCS P   C+I + +I 
Sbjct  63    VVNITSETILLDIPANCTRPFGAALDLFGGNYAMTPRNSLFLRNCSPPSPACVISTEIIS  122

Query  1583  TQFELQDCGK--DNISCFSEPHMTGGFIGYENLTGTGCKSLFSAISSPAAAANTTAVSLD  1410
                +L+ CG+  DNISC+S  H   G++  E  +   C  LF+++    +  +T+   L 
Sbjct  123   EGLQLERCGRKGDNISCYSN-HTKDGYLSREETSEVKCGLLFTSLRY--SGNSTSQAELV  179

Query  1409  IQVIELGWWLQGHCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTR  1230
                 ELGWW+ G CRCS NA C  + T   GK G+RC C  GF GDG+  G GCR   + 
Sbjct  180   FGEAELGWWMNGDCRCSANATCAPVNTSVAGKMGYRCTCDPGFAGDGFAAGDGCRVQVSS  239

Query  1229  CNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCII-RRRLAMKNWNRRRRELRE  1053
             C+ +KY+ G C    R+G+L+ G+IAGA LM  +  +C +  RRR A K+     R L E
Sbjct  240   CSASKYISGRCA---RLGLLVTGIIAGALLMAGLAFLCHLFHRRRTASKSQETIERLLSE  296

Query  1052  TTGITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSI  873
              +  TIPVYSY+DIE+AT++FSD  R G GAYGTVY GKL  N   VA+KRI+ RDTDS+
Sbjct  297   AS-CTIPVYSYRDIEQATDHFSDANRRGTGAYGTVYVGKLPGNTGVVAVKRIQRRDTDSL  355

Query  872   EQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVR  693
             EQ+TNEIKL+SSV+HPNLVRLLGC +++GEQIL+YEFMPNGTLSQHL  E+  GL W  R
Sbjct  356   EQITNEIKLISSVSHPNLVRLLGCCMDRGEQILLYEFMPNGTLSQHLHGERDEGLSWTSR  415

Query  692   LGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHIST  513
             L I +ET+ AIAYLH+A+HPPIYHRD+KSSNIL+D+N+ +KVADFGLSR G+ ESSHIST
Sbjct  416   LSIAAETAHAIAYLHSAVHPPIYHRDIKSSNILIDHNFGAKVADFGLSRIGMTESSHIST  475

Query  512   APQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDK  333
             APQGTPGYLDPQYHQDFHLSDKSDVYSFGVVL E+ITG+KAVDF R   EVNLAALAVD+
Sbjct  476   APQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLAEMITGMKAVDFGRAPTEVNLAALAVDR  535

Query  332   IGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMR  159
             IGKG + EIIDP I+   D WTL S+ KVAE+AFRCLAFH+D+RPSM EVA ELE +R
Sbjct  536   IGKGRMEEIIDPFIKVNVDEWTLVSIRKVAELAFRCLAFHKDLRPSMKEVAEELEMLR  593



>ref|XP_006404832.1| hypothetical protein EUTSA_v10000066mg [Eutrema salsugineum]
 gb|ESQ46285.1| hypothetical protein EUTSA_v10000066mg [Eutrema salsugineum]
Length=694

 Score =   655 bits (1691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/588 (56%), Positives = 420/588 (71%), Gaps = 19/588 (3%)
 Frame = -3

Query  1883  CNRSCGDGLKQLPFPFGFSSGCEILLNCTSNGTMSIGEFPVYQLTPDTIMINIPAKCGRR  1704
             C+  CG  +  LP+PFGFS+GC I  +C++     IG FPV  +T ++I + +P  C R 
Sbjct  35    CDGKCGRWI--LPYPFGFSNGCPIKFDCSTTDVAQIGVFPVQNVTDESIFVGVPHNCNRS  92

Query  1703  IEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMIQTQFELQDCGKD-NISCFS-E  1530
             IEAM PLFG+++APTS N  L+++C +    C I  T ++ Q +L+ C +  N+SCFS +
Sbjct  93    IEAMNPLFGEHYAPTSENSFLMEDCKNTTDGCSIKQTYLERQLKLKSCDRQGNVSCFSTD  152

Query  1529  PHMTGGFIGYENLTGTGCKSLFSAISSPAAAANTTAVSLDIQVIELGWWLQGHCR---CS  1359
              + T  F    +L  + CK LFS+I+  +   N   ++L+ + + LGWWL+G C    CS
Sbjct  153   ANSTAMFFRMNDLRKSSCKLLFSSIAFESVGENA-GIALEFERVRLGWWLKGGCENSTCS  211

Query  1358  KNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTRCNPAKYLLGECGGKTRi  1179
              NA C  + TP DG  G RC C EG+ GDG+   S CR+    C+ ++ + G C    R 
Sbjct  212   ANASCKGVETP-DGAAGHRCSCPEGYHGDGFIK-SPCRKALPGCHGSRLVWGHC----RS  265

Query  1178  gvliggviagaaLMVSVGL---ICCIIRRRLAMKNWNRRRRELRETTG-ITIPVYSYKDI  1011
              + I          + VGL     C  R+  + ++    +R L E  G  ++  + YKDI
Sbjct  266   NLAIVVGGTVGGAFLLVGLAFLFVCKRRKSASFRSHLSAKRLLSEAAGNSSVAFFPYKDI  325

Query  1010  EKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIKLLSSVN  831
             EKATN+FS+K+RLG GAYGTVY GKL  NDEWVAIKR+RHRD++S++QV NEIKLLSSV+
Sbjct  326   EKATNSFSEKQRLGTGAYGTVYRGKLQ-NDEWVAIKRLRHRDSESVDQVMNEIKLLSSVS  384

Query  830   HPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVSETSQAIAYL  651
             HPNLVRLLGC IE+G+ +LVYEFMPNGTLS+HLQRE G+GLPW VRL + ++T++AIAYL
Sbjct  385   HPNLVRLLGCCIEQGDPVLVYEFMPNGTLSEHLQREIGTGLPWTVRLTVATQTAKAIAYL  444

Query  650   HNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGTPGYLDPQYH  471
             H+AM+PPIYHRD+KSSNILLDY++ SKVADFGLSR G+ E+SHISTAPQGTPGYLDPQYH
Sbjct  445   HSAMNPPIYHRDIKSSNILLDYDFNSKVADFGLSRLGMTETSHISTAPQGTPGYLDPQYH  504

Query  470   QDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLEIIDPLI  291
             Q FHLSDKSDVYSFGVVL EIITGLK VDFTRP  E+NLAALAVDKIG   L EIIDP++
Sbjct  505   QCFHLSDKSDVYSFGVVLAEIITGLKVVDFTRPHTEINLAALAVDKIGSNCLDEIIDPIL  564

Query  290   EAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKW  147
             ++  D WTLSS++ VAE+AFRCLAFH DMRP+M EVA ELEQ+RLS W
Sbjct  565   DSNLDAWTLSSIHTVAELAFRCLAFHSDMRPTMTEVADELEQIRLSGW  612



>gb|KHG04381.1| Wall-associated receptor kinase-like 14 [Gossypium arboreum]
Length=693

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/607 (57%), Positives = 436/607 (72%), Gaps = 15/607 (2%)
 Frame = -3

Query  1940  IPVLILLLLQSAMVFGS--STCNRSC--GDGLKQLPFPFGFSSGCEILLNCTSNGTMSIG  1773
             I V++L L   A    S  + C+ SC   +    LP+PFGFSSGC I L CT +G + IG
Sbjct  23    ITVIVLFLSSRAKSVHSEKNKCHGSCVTNNFTTPLPYPFGFSSGCPIRLRCTRSG-VRIG  81

Query  1772  EFPVYQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSP-ELKCMIPS  1596
              F V  +T   I++ +P KC R++ ++  LFG+N+A +++N +LLQ+CS P E  C I  
Sbjct  82    GFHVLNVTSTYIIVGLPTKCDRQVSSINALFGENYAVSTSNNLLLQSCSKPIEAPCEIRP  141

Query  1595  TMIQTQFELQDCGKD--NISCFSEPHMTGGFIGYENLTGTGCKSLFSAISSPAAAANTTA  1422
               ++  F L  C     NISCF+  +     + +E + GT C+ + S+ S    +A  ++
Sbjct  142   KFLEPSFNLNPCVSKGGNISCFAG-NPGEKLLSFEEVNGTQCRFVLSSTSFVVDSARNSS  200

Query  1421  VSLDIQVIELGWWLQGHCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRR  1242
             +SL++  + L WW++G   C +NA+   ++T G+   GF+C C +GF GDG++ G GCRR
Sbjct  201   ISLELDRVNLEWWMKGQPDCDRNANYEPVKT-GNTTVGFKCFCKDGFEGDGFRAGDGCRR  259

Query  1241  DDTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAM--KNWNRRR  1068
               ++CN +KY+ G+CGG TR+ VLIGG+  GA LM  V L+CC IRRR     K  N +R
Sbjct  260   V-SKCNASKYMSGKCGGTTRVVVLIGGLAVGALLMGGVALLCCYIRRRTNSINKRMNAKR  318

Query  1067  RELRETTGITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHR  888
                      ++P Y+Y++IEKATN FSDK+RLG GAYG VYSGKL + D WVAIKR R R
Sbjct  319   LIYEAAGNSSVPFYAYREIEKATNGFSDKQRLGIGAYGAVYSGKLQNVD-WVAIKRFRFR  377

Query  887   DTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGL  708
             D  SI+QV NEIKLLSSV+HPNLVRLLGC IE+GE ILVYEFMPNGTL QHLQR++G GL
Sbjct  378   DPASIDQVMNEIKLLSSVSHPNLVRLLGCCIEEGEPILVYEFMPNGTLLQHLQRDRGEGL  437

Query  707   PWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIES  528
             PW VRL I +ET++AIAYLH +++PPI+HRD+KSSNILLDYNY+SKVADFGLSR G+ ES
Sbjct  438   PWTVRLTIAAETAKAIAYLH-SVNPPIFHRDIKSSNILLDYNYRSKVADFGLSRLGMTES  496

Query  527   SHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAA  348
             SHISTAPQGTPGYLDPQYHQ FHLSDKSDVYSFGVVLVEIIT LK VDF R  +EVNLAA
Sbjct  497   SHISTAPQGTPGYLDPQYHQYFHLSDKSDVYSFGVVLVEIITALKVVDFARQHSEVNLAA  556

Query  347   LAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELE  168
             LA D+IG+G + EIIDP ++  KD WT+SS++ VAE+AFRCLAFH DMRPSM EVA ELE
Sbjct  557   LASDRIGRGCIDEIIDPFLDPHKDAWTMSSIHNVAELAFRCLAFHGDMRPSMSEVAEELE  616

Query  167   QMRLSKW  147
              +RLS W
Sbjct  617   HIRLSAW  623



>ref|XP_009117279.1| PREDICTED: wall-associated receptor kinase-like 14 [Brassica 
rapa]
Length=699

 Score =   652 bits (1683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/617 (55%), Positives = 435/617 (71%), Gaps = 30/617 (5%)
 Frame = -3

Query  1931  LILLLLQSAMVFGS-----STCNRSCGDGLKQLPFPFGFSSGCEILLNCTSNGTMSIGEF  1767
             L L L+ + ++ GS     S CN +C   +  +P+PFGFS GC I   C+      IG F
Sbjct  9     LNLFLILTVIIGGSVSSYSSPCNGTCRGII--MPYPFGFSHGCPIKFTCSGTEGAQIGGF  66

Query  1766  PVYQL--TPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPST  1593
              V  +  T  +I + +P  C R IEAM PLFG+ +APTS N  L++ C++    C I   
Sbjct  67    SVRNVNATEGSIFVAVPHDCNRSIEAMAPLFGEVYAPTSENSFLMEECTNATDGCSIKQK  126

Query  1592  MIQTQFELQDC---GKDNISCFS-----EPHMTGGFIGYENLTGTGCKSLFSAISSPAAA  1437
              ++T+  LQ C   GKDN+SCFS       + T  F   ++L  + CK LFS+++  +  
Sbjct  127   FLETKLNLQSCDPLGKDNVSCFSTETNSSSNGTARFFSMKDLRRSSCKKLFSSVAFESVG  186

Query  1436  ANTTAVSLDIQVIELGWWLQGHCR-----CSKNADCNTMRTPGDGKPGFRCQCSEGFTGD  1272
              N   ++L+ + + LGWW++G C      C  NA C  ++TP DG  G RC C EG+ GD
Sbjct  187   GNA-GIALEFERVRLGWWVKGECETRDSTCGANAMCTPVQTP-DGSAGHRCSCLEGYRGD  244

Query  1271  GYQGGSGCRRDDTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLA  1092
             GY   S CR+    C+ ++ + G C  ++ + +++GG + GA L+  V L+C   RRR A
Sbjct  245   GYIK-SPCRKATPNCHGSRLVRGHC--RSNLAIVVGGTVGGAFLLAGVALLCVCKRRRSA  301

Query  1091  -MKNWNRRRRELRETTGIT-IPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDE  918
              +++    +R L E TG T +  + YKD+EKATN FS+K+RLG GAYGTVY GKL  NDE
Sbjct  302   SLRSHLSAKRLLTEATGNTSVAFFPYKDVEKATNCFSEKQRLGTGAYGTVYKGKLQ-NDE  360

Query  917   WVAIKRIRHRDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQ  738
             WVAIKR++HRD++S+EQV NEIKLLSSV+HPNLVRLLGC I++G+ +LVYEFMP+GTLS+
Sbjct  361   WVAIKRLKHRDSESVEQVMNEIKLLSSVSHPNLVRLLGCCIDQGDPVLVYEFMPHGTLSE  420

Query  737   HLQREKGSGLPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADF  558
             HLQRE G GLPW VRL + ++T++AIAYLH+AM+PPIYHRD+KSSNILLDY++ SKVADF
Sbjct  421   HLQREIGDGLPWTVRLTVATQTAKAIAYLHSAMNPPIYHRDIKSSNILLDYDFNSKVADF  480

Query  557   GLSRFGLIESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFT  378
             GLSR G+ E+SHISTAPQGTPGYLDPQYHQ FHLSDKSDVYSFGVVL EIITGLK VDFT
Sbjct  481   GLSRLGMTETSHISTAPQGTPGYLDPQYHQCFHLSDKSDVYSFGVVLAEIITGLKVVDFT  540

Query  377   RPQNEVNLAALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRP  198
             RP  E+NLAALAVDKIG G L EIIDP+++   D WTLSS++ VAE+AFRCLAFH DMRP
Sbjct  541   RPHTEINLAALAVDKIGSGCLDEIIDPVLDLNLDAWTLSSIHSVAELAFRCLAFHSDMRP  600

Query  197   SMMEVAIELEQMRLSKW  147
             +M EVA ELEQ+RLS W
Sbjct  601   TMTEVADELEQIRLSGW  617



>gb|KHG13439.1| Wall-associated receptor kinase-like 14 [Gossypium arboreum]
Length=696

 Score =   651 bits (1679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/607 (57%), Positives = 444/607 (73%), Gaps = 17/607 (3%)
 Frame = -3

Query  1940  IPVLILLLLQSAMVFGSSTCNRSC--GDGLKQLPFPFGFSSGCEILLNCTSNGTMSIGEF  1767
             I  L ++   +++   ++ C  SC   +    LPFPFGF+ GC I LNC S G + IGEF
Sbjct  13    ITFLFVIYRANSVNSENNKCQGSCETSNFSSPLPFPFGFTPGCPIQLNCNSTG-VGIGEF  71

Query  1766  PVYQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSP-ELKCMIPSTM  1590
              V  +T   I+I++ AKC R + ++  LFG+N+A + +N +LLQNCS+P    C I    
Sbjct  72    LVLNITSKDIIIDLHAKCYRPLASLAVLFGENYALSVDNTLLLQNCSNPLPGPCEIRPMF  131

Query  1589  IQTQFELQDCG--KDNISCFSEPHMTGGFIGYENLTGTGCKSLFSAISSPAAAANTTAVS  1416
             ++  F+   C    DNISCFS        + +E +  T C+ LFS+ +     A  +AVS
Sbjct  132   LERSFQAGPCAARSDNISCFSSGGDGVRLLSFEEVNKTQCRFLFSSTAIVVDPARNSAVS  191

Query  1415  LDIQVIELGWWLQGHCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDD  1236
             +D++ ++L WW++  C C  NA    ++  G+   G +C C EGF GDG++ G GCRR  
Sbjct  192   VDLERVKLEWWVK-DCNCDPNASHTDVKN-GNKTVGCKCFCKEGFEGDGFKEGGGCRRVP  249

Query  1235  TRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAMKNWNRR---RR  1065
             + CN +KY+ G+CGG TR+GVL+GG++ GA LM  V L+C  +RRR    N N++   +R
Sbjct  250   S-CNASKYISGKCGGTTRVGVLVGGLVGGALLMGIVALVCFYLRRR--SNNINKQMSAKR  306

Query  1064  ELRETTG-ITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHR  888
              L E  G  +IP Y+Y++IE+ATN F DK+RLG GAYGTVY+GKLH +D WVAIKR R+R
Sbjct  307   LLSEAAGNSSIPCYAYREIERATNGFCDKQRLGTGAYGTVYAGKLH-SDNWVAIKRFRYR  365

Query  887   DTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGL  708
             D DSI+QV NEIKLLSSV+HPNLVRLLGC +E+GE +LVYEFMPNGTLSQ+LQRE+GSGL
Sbjct  366   DPDSIDQVMNEIKLLSSVSHPNLVRLLGCCMEEGEPMLVYEFMPNGTLSQYLQRERGSGL  425

Query  707   PWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIES  528
             PW VRL I +ET++AIAYLH +++PPI+HRD+KSSNILLDYNY+SKVADFGLSR G+ ES
Sbjct  426   PWTVRLTIAAETAKAIAYLH-SVNPPIFHRDIKSSNILLDYNYRSKVADFGLSRLGMAES  484

Query  527   SHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAA  348
             SHISTAPQGTPGYLDPQYHQ FHLSDKSDVYSFGVVLVEIIT LK VDF+R  NEVNLAA
Sbjct  485   SHISTAPQGTPGYLDPQYHQYFHLSDKSDVYSFGVVLVEIITALKVVDFSRAHNEVNLAA  544

Query  347   LAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELE  168
             LA+D+IG+G + EIIDP ++  +D WTLSS++ VAE+AFRCLA HRDMRP+M+EVA ELE
Sbjct  545   LAIDRIGRGCVDEIIDPYLDPHRDAWTLSSIHNVAELAFRCLASHRDMRPTMIEVAEELE  604

Query  167   QMRLSKW  147
              +RLS W
Sbjct  605   HIRLSAW  611



>ref|XP_004509198.1| PREDICTED: wall-associated receptor kinase-like 14-like [Cicer 
arietinum]
Length=691

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/614 (55%), Positives = 436/614 (71%), Gaps = 25/614 (4%)
 Frame = -3

Query  1943  MIPVLILLLLQSAMVFGSSTCNRSCGDGLKQLPFPFGFSSGCEILLNCTSNGTMSIGEFP  1764
             +   + +L   +     ++ C+R CGD  + + FPFGFS  CE+ LNCT N  + IGE  
Sbjct  12    LFTAIFILCSTATTSKNNNNCHRRCGD--QTVKFPFGFSDDCEVKLNCT-NKKVKIGELT  68

Query  1763  VYQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTM--  1590
             V ++  D+I I +PAKC R    + PLF KNFAPT NN  L+QNC+S    C+IP+++  
Sbjct  69    VQEVNSDSIFIYLPAKCNRSTSFITPLFSKNFAPTWNNSFLVQNCNSKLGGCVIPTSLFF  128

Query  1589  ---IQTQFELQDCGK--DNISCFSE---PHMTGGFIGYENLTGTGCKSLFSAISSPAAAA  1434
                I  +    D  +  DNI+CF++     +    +  E+    GCK LFSAI+      
Sbjct  129   GTKIDVEAGCDDSRRRNDNITCFTQLQRRRVREDVLTLEDWNRIGCKFLFSAIAV-VDRE  187

Query  1433  NTTAVSLDIQVIELGWWLQGHCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGS  1254
                 V + ++V+ELGWWLQG  RCS++A+   +   G+ K GFRC+C EGF GDG+  GS
Sbjct  188   RVQDVPIQLEVVELGWWLQGSPRCSQDANRTVVHLAGE-KQGFRCRCHEGFVGDGFSNGS  246

Query  1253  GCRRDDTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAMKNWNR  1074
             GC+R  + C+P     G CG   RIGVL+G +  GA++  ++ L+C   +RR     W  
Sbjct  247   GCQRA-SHCSPKTQGSGRCGKALRIGVLLGVITIGASVAAALFLLCYYAKRR---STWLT  302

Query  1073  R----RRELRETTGITI-PVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVA  909
             +    +R LRE  G  I P+Y YK+IEKATN FS+K RLG GAYGTVY+G LH NDE VA
Sbjct  303   KQLTVKRLLREAAGNHIVPLYPYKEIEKATNFFSEKHRLGTGAYGTVYAGNLH-NDELVA  361

Query  908   IKRIRHRDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQ  729
             IK+I++RDT+S++QV NEIKLLSSV+HPNLVRLLGC IEKGE ILVYE+MPNGTLSQHLQ
Sbjct  362   IKKIKYRDTNSVDQVMNEIKLLSSVSHPNLVRLLGCCIEKGEHILVYEYMPNGTLSQHLQ  421

Query  728   REKGSGLPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLS  549
             RE+G  LPW +RL I SET+ AIAYLH++ +PPIYHRD+KSSNILLD++++SKVADFGLS
Sbjct  422   RERGGTLPWTIRLTIASETANAIAYLHSSNNPPIYHRDIKSSNILLDFSFQSKVADFGLS  481

Query  548   RFGLIESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQ  369
             R G+ E+SHISTAPQGTPGY+DPQYHQ+FHLSDKSDVYSFGVVLVEIIT +K VDF+RPQ
Sbjct  482   RLGMTETSHISTAPQGTPGYVDPQYHQNFHLSDKSDVYSFGVVLVEIITAMKVVDFSRPQ  541

Query  368   NEVNLAALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMM  189
             +E+NLAALAV+KI KG   +IIDP ++  +D WTL SV+KVAE+AFRCLAFH + RPSM+
Sbjct  542   SEINLAALAVEKIRKGHTDDIIDPFLDLHRDAWTLYSVHKVAELAFRCLAFHSETRPSMI  601

Query  188   EVAIELEQMRLSKW  147
             E A EL+ +R S W
Sbjct  602   EAAEELDHIRRSGW  615



>ref|XP_007155987.1| hypothetical protein PHAVU_003G249300g [Phaseolus vulgaris]
 gb|ESW27981.1| hypothetical protein PHAVU_003G249300g [Phaseolus vulgaris]
Length=695

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/614 (55%), Positives = 441/614 (72%), Gaps = 23/614 (4%)
 Frame = -3

Query  1946  KMIPVLILLLLQSAMVFGSSTCNRSCGDGLKQLPFPFGFSSGCEILLNCTS-NGTMSIGE  1770
             K   +L + +  S +   ++ C RSCG     L +PFGFSSGC++ LNC++ N  + IGE
Sbjct  7     KFALILTIFVFCSTIAQTNTNCTRSCGQ--HSLQYPFGFSSGCKLKLNCSNDNIKIKIGE  64

Query  1769  FPVYQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIP-ST  1593
             F V  +T D+I++++P KC R +  + PLFG NFAPT NN  LLQ C S    C IP S+
Sbjct  65    FEVQNITSDSILVSLPVKCNRSMGIVDPLFGVNFAPTFNNSFLLQGCKSKLNGCDIPPSS  124

Query  1592  MIQTQFELQDCGKDNIS----CFSEPHMTGG---FIGYENLTGTGCKSLFSAISSPAAAA  1434
              +     ++ CG+ N S    CF++          +   +L G+GC  LFSA++   +  
Sbjct  125   FVGEHNPVEGCGRKNESEDFICFTQLQRNSSREDVLAQRDLKGSGCSFLFSALAYDKSKG  184

Query  1433  NTTAVSLDIQVIELGWWLQGHCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGS  1254
                 + L  Q++ELGWWL+G C CS NA C  ++  G  + G+RCQC EGF GDG++ G 
Sbjct  185   KELLLQL--QMLELGWWLKGSCNCSNNASCTKIKLAGR-EQGYRCQCHEGFVGDGFKDGD  241

Query  1253  GCRRDDTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAMKNWNR  1074
             GCR    +C  +    G C    +IGVL+GG+I    ++V++ L+C   RRR    +W R
Sbjct  242   GCRSIPPQCKASTLRSGGCRKAIKIGVLVGGIIIATTVVVALSLLCYFTRRR---SSWLR  298

Query  1073  R----RRELRETTG-ITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVA  909
             +    +R LRE  G  T+P+Y YK+IE+AT+ F +K RLG GA+GTVY+G LH NDE VA
Sbjct  299   KQLTVKRLLREAGGDSTVPLYPYKEIERATSFFDEKHRLGTGAFGTVYAGHLH-NDECVA  357

Query  908   IKRIRHRDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQ  729
             IK+I++RDT+S++QV NEIKLLSSV+HPNLVRLLGC IE GEQILVYEFMPNGTLSQHLQ
Sbjct  358   IKKIKYRDTNSVDQVINEIKLLSSVSHPNLVRLLGCCIEGGEQILVYEFMPNGTLSQHLQ  417

Query  728   REKGSGLPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLS  549
             RE+G  LPW VRL I +ET+ AIAYLH+A++PPIYHRD+KSSNILLDY+++SKVADFGLS
Sbjct  418   RERGGALPWTVRLTIATETANAIAYLHSAINPPIYHRDIKSSNILLDYSFQSKVADFGLS  477

Query  548   RFGLIESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQ  369
             R G+ E+SHISTAPQGTPGY+DPQYHQ+FHLSDKSDVYSFGVVLVEIIT +K VDF+RP+
Sbjct  478   RLGMSETSHISTAPQGTPGYVDPQYHQNFHLSDKSDVYSFGVVLVEIITAMKVVDFSRPK  537

Query  368   NEVNLAALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMM  189
             +E+NLAALAV++I +  L EIIDP +E  +D WTL SV+KV+E+AFRCL+FH DMRP+M+
Sbjct  538   SEINLAALAVERIRRACLDEIIDPFLEPHRDAWTLYSVHKVSELAFRCLSFHSDMRPTMI  597

Query  188   EVAIELEQMRLSKW  147
             EVA ELE +R S+W
Sbjct  598   EVAEELELLRRSEW  611



>ref|XP_010908096.1| PREDICTED: wall-associated receptor kinase-like 14 [Elaeis guineensis]
Length=648

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/579 (58%), Positives = 417/579 (72%), Gaps = 13/579 (2%)
 Frame = -3

Query  1883  CNRSCGDGLKQLPFPFGFSSGCEILLNCTSNGTMSIGEFPVYQLTPDTIMINIPAKCGRR  1704
             CNRSCG+    +P+PFGFS  C ILLNC S   + +G FPV   T  +++++IPA C R 
Sbjct  25    CNRSCGEN-SVVPYPFGFSHDCPILLNCNSTADILLGGFPVLNFTSKSVLVSIPASCDRP  83

Query  1703  IEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMIQTQFELQDCGK--DNISCFSE  1530
             I   + LFG N+A    NG+ L+NCS     C+IPS +I  + +L  CG   ++ISCFS 
Sbjct  84    IRDAQYLFGNNYAMMLGNGLFLRNCSPAASPCLIPSELISERLDLAKCGHKGESISCFSN  143

Query  1529  PHMTGGFIGYENLTGTGCKSLFSAISSPAAAANTTAVSLDIQVIELGWWLQG-HCRCSKN  1353
                  G++  + +T T C+SLF  I +       +   L     E+GWW+ G  CRCS N
Sbjct  144   -GTKDGYLSKDIITETKCESLF--IVARYNGIIKSQPELVFGEAEIGWWMDGGECRCSAN  200

Query  1352  ADCNT-MRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDD-TRCNPAKYLLGECGGKTRi  1179
             A C T ++T   GK G+RC C +GF GDG++ G GCR    +RC+ +KY+ G C   TRI
Sbjct  201   ATCTTSVKTAVPGKTGYRCSCDQGFLGDGFRAGDGCREVQVSRCSASKYISGRC---TRI  257

Query  1178  gvliggviagaaLMVSVGLICCIIRRRLAMKNWNRRRRELRETTGITIPVYSYKDIEKAT  999
             G+LI G+IAGA LM ++  +C + RRR          + L      TIPVYSY+DIE+AT
Sbjct  258   GLLISGIIAGALLMFALAFLCYVFRRRRTASKSQETCKRLLAEASCTIPVYSYRDIERAT  317

Query  998   NNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIKLLSSVNHPNL  819
             N+FSD  RLG GAYGTVY GK+  N+E VA+KRIR  DTDS++Q+TNEIKL+SSV+HPNL
Sbjct  318   NHFSDANRLGTGAYGTVYVGKI-PNNEVVAVKRIRRSDTDSMDQITNEIKLISSVSHPNL  376

Query  818   VRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVSETSQAIAYLHNAM  639
             VRLLGC +++GEQIL+YEFMPNGTLSQHL  E+G GL W  RL I  +T+ AIA+LH+A+
Sbjct  377   VRLLGCCMDRGEQILLYEFMPNGTLSQHLHGERGDGLSWTSRLSIAVQTAHAIAHLHSAI  436

Query  638   HPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGTPGYLDPQYHQDFH  459
             HPPIYHRD+KSSNILLDYN+ +KVADFGLSR G++ESSHISTAPQGTPGYLDPQYHQDFH
Sbjct  437   HPPIYHRDIKSSNILLDYNFGAKVADFGLSRIGMMESSHISTAPQGTPGYLDPQYHQDFH  496

Query  458   LSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLEIIDPLIEAEK  279
             LSDKSDVYS GVVLVE+ITG+K VDF R   EVNLAALAVD+IGKG + EIIDP+I+ + 
Sbjct  497   LSDKSDVYSLGVVLVEMITGMKVVDFGRAPTEVNLAALAVDRIGKGRIEEIIDPVIKVDG  556

Query  278   DVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQM  162
             D WTL S+ KVAE+AFRCLAFH+D+RPSM EVA ELE +
Sbjct  557   DEWTLVSIRKVAELAFRCLAFHKDVRPSMKEVAEELEML  595



>ref|XP_010680965.1| PREDICTED: wall-associated receptor kinase-like 14 [Beta vulgaris 
subsp. vulgaris]
Length=689

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/590 (56%), Positives = 428/590 (73%), Gaps = 18/590 (3%)
 Frame = -3

Query  1892  SSTCNRSCGDGLKQLPFPFGFSSGCEILLNCTSNGTMSIGEFPVYQLTPDTIMINIPAKC  1713
             S+TC R C      + +PFGFS+ CE  LNCT +G M    + +  +T ++I +N+ A C
Sbjct  24    STTCRRYCNG--TTVNYPFGFSNSCEFQLNCTYDGRMEFMGYQLRNITWNSISLNLTANC  81

Query  1712  GRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMIQTQFELQDCGKDNISCFS  1533
              R I  ++ LFGKN+A T+ NG+LLQ+CS+P   C++P+++++++F+  D  ++N+SCF+
Sbjct  82    SRPIRQIRRLFGKNYALTARNGLLLQHCSTPLNGCVLPASLVESRFQRCDERRENMSCFA  141

Query  1532  --EPHMTGGFIGYENLTGTGCKSLFSAIS-SPAAAANTTAVSLDIQVIELGWWLQGHCRC  1362
                P   GG + YE++  TGC  LFS+I    + A N +   L+ Q ++L WWL G C C
Sbjct  142   TENPIGGGGILRYEDVNSTGCTMLFSSIVVDDSGAVNDSDALLEFQTLQLSWWLTGTCLC  201

Query  1361  SKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTRCNPAKYLLGECGGKTR  1182
               NA CN +     G  G++C+C+ GF+GDG+  G GC  D       + +  E GG T 
Sbjct  202   DVNAVCNPV-----GASGYQCRCNTGFSGDGFVNGVGCHNDSMA--DTQPVANEVGGITY  254

Query  1181  igvliggviagaaLMVSVGLICCIIR-RRLAMKNWNRRRRELRETTGIT-IPVYSYKDIE  1008
               ++ G V   AA+ +    IC   R R +  K     R  L +  G T +P+Y YK+IE
Sbjct  255   PVLIGGIVAGAAAMAILAS-ICYFCRCRSIFSKRQTSARHLLSDAAGNTPVPLYPYKEIE  313

Query  1007  KATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIKLLSSVNH  828
             +AT+ FSDK+RLG GAYGTVY+G+LH++D +VAIK+++HRD DSI+ V NEIKLLSSV+H
Sbjct  314   RATHGFSDKQRLGTGAYGTVYAGRLHNSD-YVAIKKLKHRDMDSIDLVMNEIKLLSSVSH  372

Query  827   PNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSG--LPWPVRLGIVSETSQAIAY  654
             PNLVRLLGC IE GEQILVYE+M NGTLSQHLQRE+ +G  LPW VRL I SET+QAI+Y
Sbjct  373   PNLVRLLGCCIENGEQILVYEYMANGTLSQHLQRERENGKPLPWTVRLTIASETAQAISY  432

Query  653   LHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGTPGYLDPQY  474
             LH+AM+PPIYHRD+KSSNILLD++Y SKVADFGLSR G++E SHISTAPQGTPGY+DPQY
Sbjct  433   LHSAMNPPIYHRDIKSSNILLDFDYTSKVADFGLSRLGMMELSHISTAPQGTPGYVDPQY  492

Query  473   HQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLEIIDPL  294
             HQ+FHLSDKSDVYSFGVVLVEIIT +K VDF RP  E+NLAALA+D+IGKG + EIIDP 
Sbjct  493   HQNFHLSDKSDVYSFGVVLVEIITAMKVVDFNRPHTEINLAALAIDRIGKGRIDEIIDPF  552

Query  293   IEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKWG  144
             IE  +D WTL++V+KVAE+AFRCLA+HRDMRPSMMEVA ELEQ+R S W 
Sbjct  553   IELHRDAWTLATVHKVAELAFRCLAYHRDMRPSMMEVADELEQIRQSGWA  602



>gb|KHN13357.1| Wall-associated receptor kinase-like 14 [Glycine soja]
Length=702

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/596 (56%), Positives = 430/596 (72%), Gaps = 25/596 (4%)
 Frame = -3

Query  1892  SSTCNRSCGDGLKQLPFPFGFSSGCEILLNCTSNGTMSIGEFPVYQLTPDTIMINIPAKC  1713
             ++ C RSCG+    L +PFGFSS CE+ LNC+      IGE  V  +T D I +++P +C
Sbjct  30    NNNCERSCGE--HSLQYPFGFSSDCEVKLNCSKENKAEIGELEVQSVTSDGIFVSLPVQC  87

Query  1712  GRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIP-STMIQTQFELQDCGKDNISCF  1536
              R +  + PLF  NFAPT NN  L+Q+C      C+IP S+    + +++ C  +++SCF
Sbjct  88    NRSVSFIDPLFRDNFAPTWNNTFLVQSCKPKLDGCVIPTSSFAGGRKDVEGC--EDLSCF  145

Query  1535  SEPHMTGG-------FIGYENLTGTGCKSLFSAISSPAAAANTTAVSLDIQVIELGWWLQ  1377
             ++   +          + + +    GC+ LFSA++   +      +SL  Q++ELGWWLQ
Sbjct  146   TQLQKSKSNGSREDDVLTHSDWERVGCRFLFSALAFDRSKVK--ELSLQFQMVELGWWLQ  203

Query  1376  GHCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTRCNPAKYLLGEC  1197
             G+C CS NA C  + T G GK GFRC+C EGF GDG++ G GCRR  + C  +    G C
Sbjct  204   GNCSCSNNASCTEVNTDG-GKRGFRCRCDEGFIGDGFRAGDGCRRV-SECKASTLWSGGC  261

Query  1196  GGKTRigvliggviagaaLMVSVGLICCIIRRRLAMKNWNRR----RRELRETTG-ITIP  1032
                 +IGVL+GG+I G  L+ ++ L+C   RR+    +W R+    +R LRE  G  T+P
Sbjct  262   RKAVKIGVLVGGIIFGGILVAALFLVCYFNRRQ---SSWLRKQVTVKRLLREAAGDSTVP  318

Query  1031  VYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEI  852
             +Y YK+IE+AT+ FS+K RLG GA+GTVY+G LH NDE VAIK+I++RDT+S++QV NEI
Sbjct  319   LYPYKEIERATSFFSEKHRLGTGAFGTVYAGHLH-NDECVAIKKIKYRDTNSVDQVMNEI  377

Query  851   KLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVSET  672
             KLLSSV+HPNLVRLLGC IE GEQILVYE+MPNGTLSQHLQRE+G  LPW +RL I +ET
Sbjct  378   KLLSSVSHPNLVRLLGCCIEGGEQILVYEYMPNGTLSQHLQRERGGVLPWTIRLTIATET  437

Query  671   SQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGTPG  492
             + AIAYLH+A   PIYHRD+KSSNILLDYN++SKVADFGLSR G+ E+SHISTAPQGTPG
Sbjct  438   ANAIAYLHSANDHPIYHRDIKSSNILLDYNFQSKVADFGLSRLGMSETSHISTAPQGTPG  497

Query  491   YLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLL  312
             Y+DPQYHQ+FHLSDKSDVYSFGVVLVEIIT +K VDF RPQ+E+NLAALAVD+I KG + 
Sbjct  498   YVDPQYHQNFHLSDKSDVYSFGVVLVEIITAMKVVDFARPQSEINLAALAVDRIKKGCID  557

Query  311   EIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKWG  144
             +IIDP +E  +D WTL S+NKVAE+AFRCLAFH DMRP+M+EVA EL+ +R S W 
Sbjct  558   DIIDPFLEPHRDAWTLYSINKVAELAFRCLAFHSDMRPTMIEVAEELDLIRRSGWA  613



>emb|CDY68677.1| BnaCnng60020D, partial [Brassica napus]
Length=700

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/596 (56%), Positives = 429/596 (72%), Gaps = 25/596 (4%)
 Frame = -3

Query  1883  CNRSCGDGLKQLPFPFGFSSGCEILLNCTSNGTMSIGEFPV--YQLTPDTIMINIPAKCG  1710
             CN +C   +  LP+PFGFS GC I   C++     IG F V    +T  +I + +P  C 
Sbjct  36    CNGTCRGMI--LPYPFGFSHGCPIKFTCSATEGAQIGGFSVKNVNVTEGSIFVGVPHDCN  93

Query  1709  RRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMIQTQFELQDC---GKDNISC  1539
             R IEAMKPLFG+ +APTS N  L++ C++    C I    ++TQ  L+ C   GKDN+SC
Sbjct  94    RSIEAMKPLFGELYAPTSENSFLMEECTNATDGCSIKQKFLETQLNLRSCDPLGKDNVSC  153

Query  1538  FS-----EPHMTGGFIGYENLTGTGCKSLFSAISSPAAAANTTAVSLDIQVIELGWWLQG  1374
             FS       + +  F   ++L  + CK LFS+++  +  AN   ++L+ + + LGWW++G
Sbjct  154   FSTETNSSSNGSARFFSMKDLRRSSCKKLFSSVAFESVGANA-GIALEFERVRLGWWVKG  212

Query  1373  HCR-----CSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTRCNPAKYL  1209
              C      C  NA C  ++TPG G  G RC C EG+ GDGY   S CR+    C+ ++ +
Sbjct  213   ECETRDSTCGANALCTPVQTPG-GSAGHRCSCLEGYRGDGYIK-SPCRKAIPNCHGSRLV  270

Query  1208  LGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLA-MKNWNRRRRELRETTGIT-I  1035
              G+C  ++ + +++GG + GA L+  + L+C   RRR A +++    +R L E TG T +
Sbjct  271   RGDC--RSNLAIVVGGTVGGAFLLAGLALLCVCKRRRSASLRSHLSAKRLLTEATGNTSV  328

Query  1034  PVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNE  855
               + YKD+EKATN FS+K+RLG GAYGTVY GKL  NDEWVAIKR++HRD++S+EQV NE
Sbjct  329   AFFPYKDVEKATNCFSEKQRLGTGAYGTVYKGKLQ-NDEWVAIKRLKHRDSESVEQVMNE  387

Query  854   IKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVSE  675
             IKLLSSV+HPNLVRLLGC I++G+ +LVYEFMP+GTLS+HLQRE G GLPW VRL + ++
Sbjct  388   IKLLSSVSHPNLVRLLGCCIDQGDPVLVYEFMPHGTLSEHLQREIGDGLPWTVRLTVATQ  447

Query  674   TSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGTP  495
             T++AIAYLH+AM+PPIYHRD+KSSNILLDY++ SKVADFGLSR G+ E+SHISTAPQGTP
Sbjct  448   TAKAIAYLHSAMNPPIYHRDIKSSNILLDYDFNSKVADFGLSRLGMTETSHISTAPQGTP  507

Query  494   GYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGL  315
             GYLDPQYHQ FHLSDKSDVYSFGVVL EIITGLK VDFTRP  E+NLAALAVDKIG G L
Sbjct  508   GYLDPQYHQCFHLSDKSDVYSFGVVLAEIITGLKVVDFTRPHTEINLAALAVDKIGSGCL  567

Query  314   LEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKW  147
              EIIDP+++   D WTLSS++ VAE+AFRCLAFH DMRP+M EVA ELEQ+RLS W
Sbjct  568   DEIIDPVLDLNLDAWTLSSIHSVAELAFRCLAFHSDMRPTMTEVADELEQIRLSGW  623



>ref|XP_003548009.1| PREDICTED: wall-associated receptor kinase-like 14-like isoform 
X1 [Glycine max]
 ref|XP_006599402.1| PREDICTED: wall-associated receptor kinase-like 14-like isoform 
X2 [Glycine max]
 ref|XP_006599403.1| PREDICTED: wall-associated receptor kinase-like 14-like isoform 
X3 [Glycine max]
Length=716

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/596 (56%), Positives = 430/596 (72%), Gaps = 25/596 (4%)
 Frame = -3

Query  1892  SSTCNRSCGDGLKQLPFPFGFSSGCEILLNCTSNGTMSIGEFPVYQLTPDTIMINIPAKC  1713
             ++ C RSCG+    L +PFGFSS CE+ LNC+      IGE  V  +T D I +++P +C
Sbjct  44    NNNCERSCGE--HSLQYPFGFSSDCEVKLNCSKENKAEIGELEVQSVTSDGIFVSLPVQC  101

Query  1712  GRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIP-STMIQTQFELQDCGKDNISCF  1536
              R +  + PLF  NFAPT NN  L+Q+C      C+IP S+    + +++ C  +++SCF
Sbjct  102   NRSVSFIDPLFRDNFAPTWNNTFLVQSCKPKLDGCVIPTSSFAGGRKDVEGC--EDLSCF  159

Query  1535  SEPHMTGG-------FIGYENLTGTGCKSLFSAISSPAAAANTTAVSLDIQVIELGWWLQ  1377
             ++   +          + + +    GC+ LFSA++   +      +SL  Q++ELGWWLQ
Sbjct  160   TQLQKSKSNGSREDDVLTHSDWERVGCRFLFSALAFDRSKVK--ELSLQFQMVELGWWLQ  217

Query  1376  GHCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTRCNPAKYLLGEC  1197
             G+C CS NA C  + T G GK GFRC+C EGF GDG++ G GCRR  + C  +    G C
Sbjct  218   GNCSCSNNASCTEVNTDG-GKRGFRCRCDEGFIGDGFRAGDGCRRV-SECKASTLWSGGC  275

Query  1196  GGKTRigvliggviagaaLMVSVGLICCIIRRRLAMKNWNRR----RRELRETTG-ITIP  1032
                 +IGVL+GG+I G  L+ ++ L+C   RR+    +W R+    +R LRE  G  T+P
Sbjct  276   RKAVKIGVLVGGIIFGGILVAALFLVCYFNRRQ---SSWLRKQVTVKRLLREAAGDSTVP  332

Query  1031  VYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEI  852
             +Y YK+IE+AT+ FS+K RLG GA+GTVY+G LH NDE VAIK+I++RDT+S++QV NEI
Sbjct  333   LYPYKEIERATSFFSEKHRLGTGAFGTVYAGHLH-NDECVAIKKIKYRDTNSVDQVMNEI  391

Query  851   KLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVSET  672
             +LLSSV+HPNLVRLLGC IE GEQILVYE+MPNGTLSQHLQRE+G  LPW +RL I +ET
Sbjct  392   RLLSSVSHPNLVRLLGCCIEGGEQILVYEYMPNGTLSQHLQRERGGVLPWTIRLTIATET  451

Query  671   SQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGTPG  492
             + AIAYLH+A   PIYHRD+KSSNILLDYN++SKVADFGLSR G+ E+SHISTAPQGTPG
Sbjct  452   ANAIAYLHSANDHPIYHRDIKSSNILLDYNFQSKVADFGLSRLGMSETSHISTAPQGTPG  511

Query  491   YLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLL  312
             Y+DPQYHQ+FHLSDKSDVYSFGVVLVEIIT +K VDF RPQ+E+NLAALAVD+I KG + 
Sbjct  512   YVDPQYHQNFHLSDKSDVYSFGVVLVEIITAMKVVDFARPQSEINLAALAVDRIKKGCID  571

Query  311   EIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKWG  144
             +IIDP +E  +D WTL S+NKVAE+AFRCLAFH DMRP+M+EVA EL+ +R S W 
Sbjct  572   DIIDPFLEPHRDAWTLYSINKVAELAFRCLAFHSDMRPTMIEVAEELDLIRRSGWA  627



>ref|XP_009389437.1| PREDICTED: wall-associated receptor kinase-like 14 [Musa acuminata 
subsp. malaccensis]
Length=686

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/602 (54%), Positives = 434/602 (72%), Gaps = 13/602 (2%)
 Frame = -3

Query  1931  LILLLLQSAMVFGSSTCNRSCGDGLKQLPFPFGFSSGCEILLNCTS--NGTMSIGEFPVY  1758
             +++++L +     +S C  +CG     +P+PFGFS GC+I LNC+S  N ++ IGEF V 
Sbjct  19    IVVVVLPAVSAPATSHCEGTCGS--HTVPYPFGFSRGCQIPLNCSSALNSSIQIGEFTVR  76

Query  1757  QLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMIQTQ  1578
              +T D+++I++P  C R I + + L G N+A TS + + L NC++ + K +     I   
Sbjct  77    NITSDSLLIDVPPVCERSIYSARSLSGLNYALTSRSRLFLGNCTANKSKSVSGGCTINAT  136

Query  1577  FELQDCGK--DNISCFSEPHMTGGFIGYENLTGTGCKSLFSAISSPAAAANTTAVSLDIQ  1404
                  CG   DN +CF        + G  ++  +GC  L +++   + A+      L++ 
Sbjct  137   LFDGRCGPGFDNATCFYN-QTREYYFGLSSIVDSGCSFLVTSVGYVSGASVQL---LELW  192

Query  1403  VIELGWWLQGHCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRR-DDTRC  1227
               EL WWL+G C+CS NA+C  + +P   +PGFRC C EGF GDG+  GSGCR+   ++C
Sbjct  193   TAELAWWLEGQCQCSANANCTRITSPMTDRPGFRCSCHEGFQGDGFAHGSGCRKVSASKC  252

Query  1226  NPAKYLLGECGG-KTRigvliggviagaaLMVSVGLICCIIRRRLAMKNWNRRRRELRET  1050
             NP +Y+ G CGG ++++  L+GG+IAGA+ M ++  +CC I+R  +        R L   
Sbjct  253   NPTRYMSGACGGSRSKLAFLVGGIIAGASAMAALAFVCCFIKRYSSRMRKRSSMRRLLSE  312

Query  1049  TGITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIE  870
                T+P+YSYKDIEKAT+ FS+   LG G+YGTVY+GK   ND+ VA+K+I++RD DSI+
Sbjct  313   ASCTVPLYSYKDIEKATDGFSENHILGTGSYGTVYAGKF-SNDKQVAVKKIKNRDDDSID  371

Query  869   QVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRL  690
             QV NEI+L+SSV+HPNLVRLLGC +E+GEQILVYE+MP+GTL+QHLQ E+G  LPW VRL
Sbjct  372   QVMNEIRLVSSVSHPNLVRLLGCCVERGEQILVYEYMPHGTLAQHLQGERGPALPWTVRL  431

Query  689   GIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTA  510
              I +ET++AIAYLH+A+HPPIYHRD+KSSNILLD NY SKVADFGLSR G+ E+SHISTA
Sbjct  432   TIATETAKAIAYLHSAVHPPIYHRDIKSSNILLDDNYNSKVADFGLSRMGMTETSHISTA  491

Query  509   PQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKI  330
             PQGTPGYLDPQYHQ+FHLSDKSDVYSFGVVL+EIIT LK VDF+R Q+EVNLA LA+DKI
Sbjct  492   PQGTPGYLDPQYHQNFHLSDKSDVYSFGVVLLEIITALKVVDFSRVQSEVNLAVLAIDKI  551

Query  329   GKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSK  150
             G+G + EIIDP +EA +D WTL+S+++VAE+AFRCLAFHRDMRPSM EVA ELEQ++ + 
Sbjct  552   GRGCIDEIIDPYLEANRDAWTLASIHRVAELAFRCLAFHRDMRPSMTEVADELEQIKFTG  611

Query  149   WG  144
             W 
Sbjct  612   WA  613



>ref|XP_009140464.1| PREDICTED: wall-associated receptor kinase-like 14 [Brassica 
rapa]
Length=681

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/605 (54%), Positives = 428/605 (71%), Gaps = 16/605 (3%)
 Frame = -3

Query  1934  VLILLLLQSAMVFGSSTCNRSCGDGLKQLPFPFGFSSGCEILLNCTSNGTMSIGEFPVYQ  1755
             +LI++++  ++      C+ +CG  +  LP+PFGFS GC I  +C++ G   IG F V  
Sbjct  10    ILIVIVIGGSVSSSPERCDGACGGLI--LPYPFGFSHGCPIRFDCSAAGEARIGAFSVQN  67

Query  1754  LTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMIQTQF  1575
             +T ++I + +P  C R +EAMKPLFG+ +APTS N  L++ C++    C I    ++TQ 
Sbjct  68    VTGESIFVRVPHDCYRSVEAMKPLFGERYAPTSENSFLMEQCTNATDGCSIKQRFLETQL  127

Query  1574  ELQDCG-KDNISCFSEPHMTGG--FIGYENLTGTGCKSLFSAISSPAAAANTTAVSLDIQ  1404
             +LQ C  + N+SCFS    +    F   ++L  + CK LFS+I+  +  A +  ++L+ +
Sbjct  128   KLQSCEVQGNVSCFSADTNSSSTKFFSMKDLRKSSCKMLFSSIAFESVGA-SLGIALEFE  186

Query  1403  VIELGWWLQGHC-----RCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRD  1239
              + LGWWL+G C      C   A+C  + TP DG  G RC C EG+ GDG+   S C++ 
Sbjct  187   RVRLGWWLKGGCGAGNSTCEAIANCKEVDTP-DGNAGHRCSCPEGYLGDGFIE-SPCKKA  244

Query  1238  DTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAMKNWNRRRREL  1059
                C  +K + G C   +   V+ G V     L     L  C  +R  ++++    +R L
Sbjct  245   LPNCRGSKLVWGHCR-SSLAIVVGGTVGGAFLLAGLALLFACKQKRSASLRSHLNAKRFL  303

Query  1058  RETTGIT-IPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDT  882
              E TG + +  + YK++EKATN FS+K+RLG GAYGTVY GKL  NDEWVAIKR+RHRD+
Sbjct  304   SEATGNSNVAFFPYKEVEKATNGFSEKQRLGTGAYGTVYKGKLQ-NDEWVAIKRLRHRDS  362

Query  881   DSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPW  702
             +S++QV NEIKLLSSV+HPNLVRLLGC I++G+ +LVYEFMPNGTLS+HLQRE G+GLPW
Sbjct  363   ESVDQVMNEIKLLSSVSHPNLVRLLGCCIDQGDPVLVYEFMPNGTLSEHLQREIGNGLPW  422

Query  701   PVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSH  522
              VRL + ++T++AIAYLH+AM+PPIYHRD+KS+NILLDY+Y SKVADFGLSR G+ E+SH
Sbjct  423   TVRLTVATQTAKAIAYLHSAMNPPIYHRDIKSTNILLDYDYNSKVADFGLSRLGMTETSH  482

Query  521   ISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALA  342
             ISTAPQGTPGYLDPQYHQ FHLSDKSDVYSFGVVL EIITGLKAVDFTRP  ++NLAALA
Sbjct  483   ISTAPQGTPGYLDPQYHQCFHLSDKSDVYSFGVVLAEIITGLKAVDFTRPHTQINLAALA  542

Query  341   VDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQM  162
             VDKIG G L EIIDP+++   D WTLSS++ VAE+AFRCL+FH DMRP+M EVA ELEQ+
Sbjct  543   VDKIGSGCLDEIIDPILDVSLDAWTLSSMHTVAELAFRCLSFHSDMRPTMTEVADELEQI  602

Query  161   RLSKW  147
             RL  W
Sbjct  603   RLGGW  607



>emb|CDY46073.1| BnaA09g41970D [Brassica napus]
Length=735

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/613 (54%), Positives = 437/613 (71%), Gaps = 25/613 (4%)
 Frame = -3

Query  1934  VLILLLLQSAMVFGSSTCNRSCGDGLKQLPFPFGFSSGCEILLNCTSNGTMSIGEFPVYQ  1755
             +L ++++  ++   SS CN +C   +  +P+PFGFS GC I   C++     IG F V  
Sbjct  49    ILTVIIIGGSVSSYSSPCNGTCRGII--MPYPFGFSHGCPIKFTCSATEGAQIGGFSVRN  106

Query  1754  L--TPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMIQT  1581
             +  T  +I + +P  C R IEAM PLFG+ +APTS N  L++ C++    C I    ++T
Sbjct  107   VNATEGSIFVGVPHDCNRSIEAMTPLFGEVYAPTSENSFLMEECTNATDGCSIKQKFLET  166

Query  1580  QFELQDC---GKDNISCFS-----EPHMTGGFIGYENLTGTGCKSLFSAISSPAAAANTT  1425
             +  LQ C   GKDN+SCFS       + T  F    +L  + CK +FS+++  + + N  
Sbjct  167   KLNLQSCDPLGKDNVSCFSTETNSNSNGTARFFSMRDLRRSSCKKMFSSVAFESVSGNE-  225

Query  1424  AVSLDIQVIELGWWLQGHCR-----CSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQG  1260
              ++L+ + ++LGWW++G C      C  NA C  ++TP DG  G RC C EG+ GDGY  
Sbjct  226   GIALEFERVKLGWWVKGECETRDSTCGANAMCTPVQTP-DGSAGHRCSCMEGYRGDGYIK  284

Query  1259  GSGCRRDDTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLA-MKN  1083
              S CR+    C+ ++ + G C  ++ + +++GG + GA L+  + L+C   RRR A +++
Sbjct  285   -SPCRKATPNCHGSRLVRGHC--RSNLAIVVGGTVGGAFLLAGLALLCVCKRRRSASLRS  341

Query  1082  WNRRRRELRETTGIT-IPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAI  906
                 +R L E TG T +  + YKD+EKATN FS+K+RLG GAYGTVY GKL  NDEWVAI
Sbjct  342   HLSAKRLLTEATGNTSVAFFPYKDVEKATNCFSEKQRLGTGAYGTVYKGKLQ-NDEWVAI  400

Query  905   KRIRHRDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQR  726
             KR++HRD++S+EQV NEIKLLSSV+HPNLVRLLGC I++G+ +LVYEFMP+GTLS+HLQR
Sbjct  401   KRLKHRDSESVEQVMNEIKLLSSVSHPNLVRLLGCCIDQGDPVLVYEFMPHGTLSEHLQR  460

Query  725   EKGSGLPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSR  546
             E G GLPW VRL + ++T++AIAYLH+AM+PPIYHRD+KSSNILLDY++ SKVADFGLSR
Sbjct  461   EIGDGLPWTVRLTVATQTAKAIAYLHSAMNPPIYHRDIKSSNILLDYDFNSKVADFGLSR  520

Query  545   FGLIESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQN  366
              G+ E+SHISTAPQGTPGYLDPQYHQ FHLSDKSDVYSFGVVL EIITGLK VDFTRP  
Sbjct  521   LGMTETSHISTAPQGTPGYLDPQYHQCFHLSDKSDVYSFGVVLAEIITGLKVVDFTRPHT  580

Query  365   EVNLAALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMME  186
             E+NLAALAVDKIG G L EIIDP+++   D WTLSS++ VAE+AFRCLAFH DMRP+M E
Sbjct  581   EINLAALAVDKIGSGCLDEIIDPVLDLNLDAWTLSSIHSVAELAFRCLAFHSDMRPTMTE  640

Query  185   VAIELEQMRLSKW  147
             VA ELEQ+RLS W
Sbjct  641   VADELEQIRLSGW  653



>ref|XP_006293370.1| hypothetical protein CARUB_v10022765mg [Capsella rubella]
 gb|EOA26268.1| hypothetical protein CARUB_v10022765mg [Capsella rubella]
Length=693

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/662 (52%), Positives = 455/662 (69%), Gaps = 34/662 (5%)
 Frame = -3

Query  1919  LLQSAMVFGSSTCNRSCGDGLKQLPFPFGFSSGCEILLNCTSNGTMSIGEFPVYQLTPDT  1740
             +L+++    + TC  SCG+  K LP+PFGFSSGC I   C++ G   IG FPV  +T ++
Sbjct  23    VLRTSAANFTETCLGSCGE--KTLPYPFGFSSGCRIQFGCSAAGIAEIGGFPVQNVTENS  80

Query  1739  IMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMIQTQFELQDC  1560
             I + +P  C R++E M PLF ++FAPT+ N  L++ C+     C I    ++   +L+ C
Sbjct  81    IFVALPHNCTRKVEDMNPLFSEHFAPTAENSFLMEECNRTTDGCSIKQKFLEDVLKLESC  140

Query  1559  -GKDNISCFS-----EPHMTGGFIGYENLTGTGCKSLFSAISSPAAAANTTAVSLDIQVI  1398
                 NISCFS         +  F G + L  + C+ LFS+I+  +   N   ++L+   +
Sbjct  141   DATGNISCFSLDSNSSLKNSAKFFGMKELRNSTCRLLFSSIAFESVGVNA-GIALEFGRV  199

Query  1397  ELGWWLQGHCR---CSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTRC  1227
              LGWWL G C+   C  NA+C  + TP  GK G RC C EGF GDGY     CR+    C
Sbjct  200   RLGWWLNGDCKSNPCGINANCTVVDTP-HGKTGHRCSCLEGFHGDGYI----CRKALPHC  254

Query  1226  NPAKYLLGECGGKTRigvliggviagaaLMVSVGLIC-CIIRRRLAMKNWNRRRRELRET  1050
             + +K + G C  ++ +  ++GG + GA+++V + L+  C  RR   +++    +R L E 
Sbjct  255   HGSKLVWGHC--RSTLITILGGTVGGASILVGLALLFFCKRRRSTPLRSHLSAKRLLSEA  312

Query  1049  TG-ITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSI  873
              G  ++  + YK+IEKAT+ FS+K++LG GAYGTVY GKL  NDEWVAIKR+RHRD++S+
Sbjct  313   AGNSSVAFFPYKEIEKATDGFSEKQKLGIGAYGTVYRGKLQ-NDEWVAIKRLRHRDSESL  371

Query  872   EQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVR  693
             +QV NEIKLLSSV+HPNLVRLLGC IE+G+ +LVYE+MPNGTLS+HLQR++G+GLPW +R
Sbjct  372   DQVMNEIKLLSSVSHPNLVRLLGCCIEQGDPVLVYEYMPNGTLSEHLQRDRGTGLPWTLR  431

Query  692   LGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHIST  513
             L + ++T++AIAYLH+AM+PPIYHRD+KS+NILLDY++ SKVADFGLSR G+ E+SHIST
Sbjct  432   LTVATQTAKAIAYLHSAMNPPIYHRDIKSTNILLDYDFNSKVADFGLSRLGMTETSHIST  491

Query  512   APQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDK  333
             APQGTPGYLDPQYHQ FHLSDKSDVYSFGVVL EIITGLK VDFTRP  E+NLAALAVDK
Sbjct  492   APQGTPGYLDPQYHQCFHLSDKSDVYSFGVVLAEIITGLKVVDFTRPHTEINLAALAVDK  551

Query  332   IGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLS  153
             I  G L +IIDP+++ E D WTLSS++ VAE+AFRCLAFH DMRP+M EVA ELEQ+RLS
Sbjct  552   IRSGCLDQIIDPILDLELDAWTLSSIHTVAELAFRCLAFHSDMRPTMTEVADELEQIRLS  611

Query  152   KW-GIsedsiitassssssrsssdasEKPLSFS-----------TMKPSEKVTESSPVSV  9
              W         T S  SS   S  ++ KP + S           ++   E++ +SSPVSV
Sbjct  612   GWIPNMSLDSPTGSLRSSDMGSERSTRKPSAGSRRIVIPQKQPESLAAVEEINDSSPVSV  671

Query  8     QD  3
             QD
Sbjct  672   QD  673



>emb|CDX89573.1| BnaC04g35920D [Brassica napus]
Length=683

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/643 (53%), Positives = 442/643 (69%), Gaps = 23/643 (4%)
 Frame = -3

Query  1883  CNRSCGDGLKQLPFPFGFSSGCEILLNCTSNGTMSIGEFPVYQLTPDTIMINIPAKCGRR  1704
             C+ +CG  +  LP+PFGFS GC I  +C +     IG F V  +T D+I   +P  C R 
Sbjct  28    CDGACGGMI--LPYPFGFSHGCPIRFDCFAAKQARIGAFSVQNVTGDSIFARVPHDCSRS  85

Query  1703  IEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMIQTQFELQDCG-KDNISCFSEP  1527
             +EAMKPLFG+ +APTS N  L++ C++    C I    ++TQ +LQ C  + N+SCFS  
Sbjct  86    VEAMKPLFGERYAPTSENSFLMEQCTNQTDGCSIKQRFLETQLKLQSCEVQGNVSCFSAD  145

Query  1526  HMTGG--FIGYENLTGTGCKSLFSAISSPAAAANTTAVSLDIQVIELGWWLQGHC-----  1368
               +    F   ++L  + CK LFS+I+  +  A +  ++L+ + + LGWWL+G C     
Sbjct  146   TNSSSTKFFSMKDLRNSSCKMLFSSIAFESVGA-SLGIALEFERVRLGWWLKGGCGTGNS  204

Query  1367  RCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTRCNPAKYLLGECGGK  1188
              C+  A+C  + TP DG  G RC C EG+ GDG+   S C++    C  ++ +   C   
Sbjct  205   TCAAYANCKEVDTP-DGNAGHRCSCPEGYLGDGFIE-SPCKKALPNCRGSRLVWRHCRSS  262

Query  1187  TRigvliggviagaaLMVSVGLICCIIRRRLAMK-NWNRRRRELRETTGIT-IPVYSYKD  1014
               I V      A     +++ L  C  +R  +++ + + +RR L E TG + I  + YK+
Sbjct  263   LAIVVGGTVGGAFMLAGLAL-LFACKQKRSASLRSHLSAKRRLLSEATGNSNIAFFPYKE  321

Query  1013  IEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIKLLSSV  834
             +EKATN FS+K+RLG GAYGTVY GKL  NDEWVAIKR+RHRD++S++QV NEIKLLSSV
Sbjct  322   VEKATNAFSEKQRLGTGAYGTVYKGKLQ-NDEWVAIKRLRHRDSESVDQVMNEIKLLSSV  380

Query  833   NHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVSETSQAIAY  654
             +HPNLVRLLGC I++G+ +LVYEFMPNGTLS+HLQRE GSGLPW VRL + ++T++AIAY
Sbjct  381   SHPNLVRLLGCCIDQGDPVLVYEFMPNGTLSEHLQREIGSGLPWTVRLTVATQTAKAIAY  440

Query  653   LHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGTPGYLDPQY  474
             LH+AM+PPIYHRD+KS+NILLDY+Y SKVADFGLSR G+ E+SHISTAPQGTPGYLDPQY
Sbjct  441   LHSAMNPPIYHRDIKSTNILLDYDYNSKVADFGLSRLGITETSHISTAPQGTPGYLDPQY  500

Query  473   HQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLEIIDPL  294
             HQ FHLSDKSDVYSFGVVL EIITGLKAVDFTRP +++NLAALAVDKIG G L EIIDP+
Sbjct  501   HQCFHLSDKSDVYSFGVVLAEIITGLKAVDFTRPHSQINLAALAVDKIGSGCLDEIIDPI  560

Query  293   IEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKW-GIsedsiita  117
             ++   D WTLSS++ VAE+AFRCL+FH DMRP+M EVA ELEQ+RLS W         T 
Sbjct  561   LDVRLDAWTLSSMHTVAELAFRCLSFHSDMRPTMSEVADELEQIRLSGWIPTMSLDSPTG  620

Query  116   ssssssrsssdasEKPLSFSTMKPS-----EKVTESSPVSVQD  3
             S  S+S   + A  + L     +P      E+  +SSPVSVQD
Sbjct  621   SEKSASVKKASAGSRRLVVPPKQPDILAFVEEKDDSSPVSVQD  663



>gb|KHN00584.1| Wall-associated receptor kinase-like 14 [Glycine soja]
Length=708

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/598 (55%), Positives = 429/598 (72%), Gaps = 26/598 (4%)
 Frame = -3

Query  1889  STCNRSCGDGLKQLPFPFGFSSGCEILLNCTSNGTMSIGEFPVYQLTPDTIMINIPAKCG  1710
             + C RSCG+    L +PFGFSS CE+ LNC+    + IG+  V  +T D I +++P +C 
Sbjct  32    NNCERSCGE--HSLQYPFGFSSDCEVKLNCSKENKVKIGDLEVQSVTSDGIFVSLPVQCN  89

Query  1709  RRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMI---QTQFELQDCGKDNISC  1539
             R +  + PLF  NFAP+ +N  L+Q+C S    C+IP++     + + E  D   +++ C
Sbjct  90    RNVSFLDPLFRHNFAPSWSNTFLVQSCESNLSGCVIPTSSFAGGRNKVEGCDRESEDLHC  149

Query  1538  FSEPHMTGGFIGYEN--------LTGTGCKSLFSAISSPAAAANTTAVSLDIQVIELGWW  1383
             F++   +      E+            GCK LFSA++   +      +SL  Q++ELGWW
Sbjct  150   FTQMRKSKSNGSREDDDVLMRLDWERVGCKFLFSALAFDRSKVK--ELSLQFQMVELGWW  207

Query  1382  LQGHCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTRCNPAKYLLG  1203
             L+G+C CS NA C T    G GK GFRC+C EGF GDG++ G GCRR  + C  +    G
Sbjct  208   LEGNCSCSNNASC-TEVNHGGGKLGFRCRCDEGFVGDGFKDGDGCRRV-SECKASTLWSG  265

Query  1202  ECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAMKNWNRR----RRELRETTG-IT  1038
              C    +IGV +GG+I GA L+ ++ L+C   RRR    +W R+    +R LRE  G  T
Sbjct  266   GCRKAVKIGVFVGGIIVGAILVAALSLVCYFNRRR---SSWLRKQVTVKRLLREAAGDST  322

Query  1037  IPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTN  858
             +P+Y YK+IE+AT+ FS+K RLG GA+GTVY+G LH NDE VAIK+I++RDT+S++QV N
Sbjct  323   VPLYPYKEIERATSFFSEKHRLGTGAFGTVYAGHLH-NDECVAIKKIKYRDTNSVDQVMN  381

Query  857   EIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVS  678
             EIKLLSSV+HPNLVRLLGC IE GEQILVYE+MPNGTLSQHLQRE+G  LPW +RL I +
Sbjct  382   EIKLLSSVSHPNLVRLLGCCIEGGEQILVYEYMPNGTLSQHLQRERGGVLPWTIRLTIAT  441

Query  677   ETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGT  498
             ET+ AIAYLH+ ++PPIYHRD+KSSNILLDY+++SKVADFGLSR G+ E+SHISTAPQGT
Sbjct  442   ETANAIAYLHSEINPPIYHRDIKSSNILLDYSFQSKVADFGLSRLGMSETSHISTAPQGT  501

Query  497   PGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGG  318
             PGY+DPQYHQ+FHLSDKSDVYSFGVVLVEIIT +K VDF RPQ+E+NLAALAVD+I KG 
Sbjct  502   PGYVDPQYHQNFHLSDKSDVYSFGVVLVEIITAMKVVDFARPQSEINLAALAVDRIRKGC  561

Query  317   LLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKWG  144
             + +IIDP +E  +D WTL S++KVAE+AFRCLAFH DMRP+M+EVA ELE +R S W 
Sbjct  562   IDDIIDPFLEPHRDAWTLYSIHKVAELAFRCLAFHSDMRPTMIEVAEELELIRRSGWA  619



>emb|CDY38944.1| BnaA04g13650D [Brassica napus]
Length=681

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/605 (54%), Positives = 428/605 (71%), Gaps = 16/605 (3%)
 Frame = -3

Query  1934  VLILLLLQSAMVFGSSTCNRSCGDGLKQLPFPFGFSSGCEILLNCTSNGTMSIGEFPVYQ  1755
             +LI++++  ++      C+ +CG  +  LP+PFGFS GC I  +C++ G   IG F V  
Sbjct  10    ILIVIVIGGSVSSSPERCDGACGGLI--LPYPFGFSHGCPIRFDCSAAGEARIGAFSVQN  67

Query  1754  LTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMIQTQF  1575
             +T ++I + +P  C R +EAMKPLFG+ +APTS N  L++ C++    C I    ++TQ 
Sbjct  68    VTGESIFVRVPHDCYRSVEAMKPLFGERYAPTSENSFLMEQCTNATDGCSIKQRFLETQL  127

Query  1574  ELQDCG-KDNISCFSEPHMTGG--FIGYENLTGTGCKSLFSAISSPAAAANTTAVSLDIQ  1404
             +LQ C  + N+SCFS    +    F   ++L  + CK LFS+I+  +  A +  ++L+ +
Sbjct  128   KLQSCEVQGNVSCFSADTNSSSTKFFSMKDLRKSSCKMLFSSIAFESVGA-SLGIALEFE  186

Query  1403  VIELGWWLQG-----HCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRD  1239
              + LGWW++G     H  C   A+C  + TP DG  G RC C EG+ GDG+   S C++ 
Sbjct  187   RVRLGWWIKGGCGAGHSTCEAIANCKEVDTP-DGNAGHRCSCPEGYLGDGFIE-SPCKKA  244

Query  1238  DTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAMKNWNRRRREL  1059
                C  +K + G C   +   V+ G V     L     L  C  +R  ++++    +R L
Sbjct  245   LPNCRGSKLVWGHCR-SSLAIVVGGIVGGAFLLAGLALLFACKKKRSASLRSHLNAKRFL  303

Query  1058  RETTGIT-IPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDT  882
              E TG + +  + YK++EKATN FS+K+RLG GAYGTVY GKL  NDEWVAIKR+RHRD+
Sbjct  304   SEATGNSNVAFFPYKEVEKATNGFSEKQRLGTGAYGTVYKGKLQ-NDEWVAIKRLRHRDS  362

Query  881   DSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPW  702
             +S++QV NEIKLLSSV+HPNLVRLLGC I++G+ +LVYEFMPNGTLS+HLQRE G+GL W
Sbjct  363   ESVDQVMNEIKLLSSVSHPNLVRLLGCCIDQGDPVLVYEFMPNGTLSEHLQREIGNGLSW  422

Query  701   PVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSH  522
              VRL + ++T++AIAYLH+AM+PPIYHRD+KS+NILLDY+Y SKVADFGLSR G+ E+SH
Sbjct  423   TVRLTVATQTAKAIAYLHSAMNPPIYHRDIKSTNILLDYDYNSKVADFGLSRLGMTETSH  482

Query  521   ISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALA  342
             ISTAPQGTPGYLDPQYHQ FHLSDKSDVYSFGVVL EIITGLKAVDFTRP  ++NLAALA
Sbjct  483   ISTAPQGTPGYLDPQYHQCFHLSDKSDVYSFGVVLAEIITGLKAVDFTRPHTQINLAALA  542

Query  341   VDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQM  162
             VDKIG G L EIIDP+++   D WTLSS++ VAE+AFRCL+FH DMRP+M EVA ELEQ+
Sbjct  543   VDKIGSGCLDEIIDPILDVSLDAWTLSSMHTVAELAFRCLSFHSDMRPTMTEVADELEQI  602

Query  161   RLSKW  147
             RLS W
Sbjct  603   RLSGW  607



>gb|KEH20472.1| wall associated kinase-like protein [Medicago truncatula]
Length=697

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/593 (56%), Positives = 429/593 (72%), Gaps = 24/593 (4%)
 Frame = -3

Query  1883  CNRSCGDGLKQLPFPFGFSSGCEILLNCTSNGTMSIGEFPVYQLTPDTIMINIPAKCGRR  1704
             C + CG   + + +PFGFS GC+I LNC+ N  + IGE  V ++  D+I I++PAKC R 
Sbjct  36    CVQRCGK--QSVKYPFGFSEGCKIKLNCSINKELKIGELKVQEVNSDSIFISLPAKCNRS  93

Query  1703  IEAMKPLFGKNFAPTSNNGILLQNCSSPELK-CMIP-STMIQTQFELQDCGK--DNISCF  1536
             I  +  LF KN+APT NN  L+Q+CS+     C+IP S+ +  Q E  D  +  DNI+CF
Sbjct  94    ISFINQLFDKNYAPTWNNTFLVQDCSASNYSGCVIPASSFVGKQIEGCDGSRRSDNINCF  153

Query  1535  SEPHMT---GGFIGYENLTGTGCKSLFSAISSPAAAANTTAVSLDIQVIELGWWLQGHC-  1368
             ++          +  E+     C  LFSAI+   +  N     L  QV+ELGWWL+G C 
Sbjct  154   TQLQRRRPREDVLALEDWKKIECNFLFSAIAFDNSKVNEAP--LQFQVVELGWWLEGSCP  211

Query  1367  RCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTRCNPAKYLLGECGGK  1188
             RCS++A+C  +    +GK GFRC+C +GF GDG+  GS CRR  +RC+P+     +CG  
Sbjct  212   RCSRDANCTEVHL-AEGKQGFRCRCHKGFVGDGFVNGSRCRRV-SRCSPSTLGSSKCGKA  269

Query  1187  TRigvliggviagaaLMVSVGLICCIIRRRLAMKNWNRR----RRELRETTG-ITIPVYS  1023
              RIGVL+G +  GA++   + L+C   +RR    +W  +    +R LRE  G   +P+Y 
Sbjct  270   LRIGVLLGVITVGASITAVLSLLCYFAKRR---SSWLTKQLTVKRLLREAAGNYIVPLYP  326

Query  1022  YKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIKLL  843
             YK+IEKATN FS+K RLG GAYGTVY+G LH +DE VAIK+IR+RDT+S++QV NEIKLL
Sbjct  327   YKEIEKATNFFSEKHRLGTGAYGTVYAGNLH-SDELVAIKKIRYRDTNSVDQVMNEIKLL  385

Query  842   SSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVSETSQA  663
             SSV+HPNLVRLLGC IEKGE ILVYE+MPNGTLSQHLQRE+G  LPW +RL I SET+ A
Sbjct  386   SSVSHPNLVRLLGCCIEKGEHILVYEYMPNGTLSQHLQRERGGVLPWTIRLTIASETANA  445

Query  662   IAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGTPGYLD  483
             IA+LH++ +PPIYHRD+KSSNILLD+++ SKVADFGLSR G+ E+SHISTAPQGTPGY+D
Sbjct  446   IAFLHSS-NPPIYHRDIKSSNILLDFSFHSKVADFGLSRLGMTETSHISTAPQGTPGYVD  504

Query  482   PQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLEII  303
             PQYHQ+FHLSDKSDVYSFGVVLVEIIT +K VDF RPQ+E+NLAALAV+KI KG + +II
Sbjct  505   PQYHQNFHLSDKSDVYSFGVVLVEIITAMKVVDFGRPQSEINLAALAVEKIRKGRIDDII  564

Query  302   DPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKWG  144
             DP ++  +D WTL SV KVAE+AFRCLAFH D+RPSM+EVA EL+ +R S W 
Sbjct  565   DPFLDLNRDAWTLYSVQKVAELAFRCLAFHSDVRPSMIEVAEELDHIRRSGWA  617



>ref|XP_010472340.1| PREDICTED: wall-associated receptor kinase-like 14 [Camelina 
sativa]
Length=686

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/667 (51%), Positives = 457/667 (69%), Gaps = 29/667 (4%)
 Frame = -3

Query  1943  MIPVLILLLLQSAMVFGSSTCNRSCGDGLKQLPFPFGFSSGCEILLNCTSNGTMSIGEFP  1764
             +I V+++++  S+    +  CNR CG     LP+PFGFS GC I  NC++ G   IG F 
Sbjct  9     LILVIVIVIGASSSANFTKPCNRRCGR--LSLPYPFGFSPGCGIKFNCSAAGNAEIGSFS  66

Query  1763  VYQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMIQ  1584
             V  +T ++I +++P  C R+IE M PLF ++FAPT  N  L+++C      C I    ++
Sbjct  67    VQNVTENSIFVSLPHNCTRKIEDMTPLFSEHFAPTVENSFLMEDCKKTTDGCSIKQKFLE  126

Query  1583  TQFELQDCGKD-NISCFS--EPHMTGGFIGYENLTGTGCKSLFSAISSPAAAANTTAVSL  1413
                +L+ C    NISCFS      +  F     L  + C  LFSAI+  +   N   ++L
Sbjct  127   DVLKLESCDSTGNISCFSLDSNSSSKKFFVMNELRNSTCSLLFSAIAFESVGLNA-GIAL  185

Query  1412  DIQVIELGWWLQGHCR---CSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRR  1242
               + + LGWWL G C+   C+ NA+C  + TP DGK G+RC C EG+ GDGY   + C+R
Sbjct  186   QFERVRLGWWLNGDCKSNPCATNANCTHVDTP-DGKEGYRCSCHEGYHGDGYN--NICQR  242

Query  1241  DDTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLIC-CIIRRRLAMKNWNRRRR  1065
                 C  +K +   C  ++ +  ++GG I GA+L+V + L+  C  RR   +++    +R
Sbjct  243   VLPECRGSKLVWRHC--RSSLFTIVGGTIGGASLLVGLALLFFCKRRRSTPLRSHLSAKR  300

Query  1064  ELRETTG-ITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHR  888
              L E  G  ++  + YK+IEKAT+ FS+K++LG GAYGTVY GKL  NDEWVAIKR+RHR
Sbjct  301   LLSEAAGNSSVAFFPYKEIEKATDGFSEKQKLGIGAYGTVYRGKLQ-NDEWVAIKRLRHR  359

Query  887   DTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGL  708
             D++S++QV NEIKLLSSV+HPNLVRLLGC IE+G+ +LVYE+MPNGTLS+HLQR++G+GL
Sbjct  360   DSESLDQVMNEIKLLSSVSHPNLVRLLGCCIEQGDPVLVYEYMPNGTLSEHLQRDRGTGL  419

Query  707   PWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIES  528
             PW +RL + ++T++AIAYLH+ M+PPIYHRD+KS+NILLDY++ SKVADFGLSR G+ E+
Sbjct  420   PWTLRLTVATQTAKAIAYLHSEMNPPIYHRDIKSTNILLDYDFNSKVADFGLSRLGMTET  479

Query  527   SHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAA  348
             SHISTAPQGTPGYLDPQYHQ FHLSDKSDVYSFGVVL EIITGLK VDFTRP  E+NLAA
Sbjct  480   SHISTAPQGTPGYLDPQYHQCFHLSDKSDVYSFGVVLAEIITGLKVVDFTRPHTEINLAA  539

Query  347   LAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELE  168
             LAVDKIG G + EIIDP+++ E D WTLSS++ VAE+ FRCLAFH DMRP+M EVA ELE
Sbjct  540   LAVDKIGSGCIDEIIDPILDLELDAWTLSSIHTVAELTFRCLAFHSDMRPTMTEVADELE  599

Query  167   QMRLSKW-GIsedsiitassssssrsssdasEKPLSFS-----------TMKPSEKVTES  24
             Q+RLS W        +  S  SS + S  ++ KP + S           ++   E++++S
Sbjct  600   QIRLSGWIPNMSLDSLNGSLRSSDQGSERSTRKPSTGSRRVIIPQKQPESLASVEEISDS  659

Query  23    SPVSVQD  3
             SPVSVQD
Sbjct  660   SPVSVQD  666



>ref|XP_006574720.1| PREDICTED: wall-associated receptor kinase-like 14-like isoform 
X2 [Glycine max]
 ref|XP_006574721.1| PREDICTED: wall-associated receptor kinase-like 14-like isoform 
X3 [Glycine max]
 ref|XP_003519915.2| PREDICTED: wall-associated receptor kinase-like 14-like isoform 
X1 [Glycine max]
Length=708

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/598 (55%), Positives = 428/598 (72%), Gaps = 26/598 (4%)
 Frame = -3

Query  1889  STCNRSCGDGLKQLPFPFGFSSGCEILLNCTSNGTMSIGEFPVYQLTPDTIMINIPAKCG  1710
             + C RSCG+    L +PFGFSS CE+ LNC+    + IG+  V  +T D I +++P +C 
Sbjct  32    NNCERSCGE--HSLQYPFGFSSDCEVKLNCSKENKVKIGDLEVQSVTSDGIFVSLPVQCN  89

Query  1709  RRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMI---QTQFELQDCGKDNISC  1539
             R +  + PLF  NFAP+ +N  L+Q+C S    C+IP++     + + E  D   +++ C
Sbjct  90    RNVSFLDPLFRHNFAPSWSNTFLVQSCESNLSGCVIPTSSFAGGRNKVEGCDRESEDLHC  149

Query  1538  FSEPHMTGGFIGYEN--------LTGTGCKSLFSAISSPAAAANTTAVSLDIQVIELGWW  1383
             F++   +      E+            GCK LFSA++   +      +SL  Q++ELGWW
Sbjct  150   FTQMRKSKSNGSREDDDVLMRLDWERVGCKFLFSALAFDRSKVK--ELSLQFQMVELGWW  207

Query  1382  LQGHCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTRCNPAKYLLG  1203
             L+G+C CS NA C T    G GK GFRC+C EGF GDG++ G GCRR  + C  +     
Sbjct  208   LEGNCSCSNNASC-TEVNHGGGKLGFRCRCDEGFVGDGFKDGDGCRRV-SECKASTLWSR  265

Query  1202  ECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAMKNWNRR----RRELRETTG-IT  1038
              C    +IGV +GG+I GA L+ ++ L+C   RRR    +W R+    +R LRE  G  T
Sbjct  266   GCRKAVKIGVFVGGIIVGAILVAALSLVCYFNRRR---SSWLRKQVTVKRLLREAAGDST  322

Query  1037  IPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTN  858
             +P+Y YK+IE+AT+ FS+K RLG GA+GTVY+G LH NDE VAIK+I++RDT+S++QV N
Sbjct  323   VPLYPYKEIERATSFFSEKHRLGTGAFGTVYAGHLH-NDECVAIKKIKYRDTNSVDQVMN  381

Query  857   EIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVS  678
             EIKLLSSV+HPNLVRLLGC IE GEQILVYE+MPNGTLSQHLQRE+G  LPW +RL I +
Sbjct  382   EIKLLSSVSHPNLVRLLGCCIEGGEQILVYEYMPNGTLSQHLQRERGGVLPWTIRLTIAT  441

Query  677   ETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGT  498
             ET+ AIAYLH+ ++PPIYHRD+KSSNILLDY+++SKVADFGLSR G+ E+SHISTAPQGT
Sbjct  442   ETANAIAYLHSEINPPIYHRDIKSSNILLDYSFQSKVADFGLSRLGMSETSHISTAPQGT  501

Query  497   PGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGG  318
             PGY+DPQYHQ+FHLSDKSDVYSFGVVLVEIIT +K VDF RPQ+E+NLAALAVD+I KG 
Sbjct  502   PGYVDPQYHQNFHLSDKSDVYSFGVVLVEIITAMKVVDFARPQSEINLAALAVDRIRKGC  561

Query  317   LLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKWG  144
             + +IIDP +E  +D WTL S++KVAE+AFRCLAFH DMRP+M+EVA ELE +R S W 
Sbjct  562   IDDIIDPFLEPHRDAWTLYSIHKVAELAFRCLAFHSDMRPTMIEVAEELELIRRSGWA  619



>ref|XP_010417096.1| PREDICTED: wall-associated receptor kinase-like 14 [Camelina 
sativa]
Length=687

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/607 (52%), Positives = 422/607 (70%), Gaps = 16/607 (3%)
 Frame = -3

Query  1943  MIPVLILLLLQSAMVFGSSTCNRSCGDGLKQLPFPFGFSSGCEILLNCTSNGTMSIGEFP  1764
             +I V+++++  ++    +  C+  CG     LP+PFGF+ GC I  NC++ G   IG F 
Sbjct  9     LILVIVIVIGGTSAANFTEPCHGRCGKW--SLPYPFGFTPGCGIKFNCSAAGNAEIGGFS  66

Query  1763  VYQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMIQ  1584
             V  +T D+I +++P  C R+IE M PLF ++FAPT  N  L+++C+     C I    ++
Sbjct  67    VQNVTEDSIFVSLPHNCTRKIEDMNPLFSEHFAPTVYNSFLMEDCNKTTDGCSIKQKFLE  126

Query  1583  TQFELQDCGKD-NISCFSEPHMTGG---FIGYENLTGTGCKSLFSAISSPAAAANTTAVS  1416
                +L+ C    NISCFS    +     F G   L  + C  LFS+I+  +   N   ++
Sbjct  127   DVLKLESCDSTGNISCFSLDSNSSSKKKFFGMNELRNSTCTLLFSSIAFESVGLNA-GIA  185

Query  1415  LDIQVIELGWWLQGHCR---CSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCR  1245
             L+ + + LGWWL GHC+   C++NA+C  + TP DGK G+RC C EG+ GDGY   + C+
Sbjct  186   LEFERVRLGWWLNGHCKTNPCAENANCTHVDTP-DGKDGYRCSCLEGYHGDGYN--NLCQ  242

Query  1244  RDDTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAMKNWNRRRR  1065
             R    C  +K +   C       V      A     +++   C   RR   +++    +R
Sbjct  243   RVLPDCRGSKLVWRHCRSNLFTIVGGTIGGASLLAGLALLFFC-KRRRSTPLRSHLSAKR  301

Query  1064  ELRETTG-ITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHR  888
              L E  G  ++  + YK+IEKAT+ FS+K++LG GAYGTVY GKL  NDEWVAIKR+RHR
Sbjct  302   LLSEAAGNSSVAFFPYKEIEKATDGFSEKQKLGIGAYGTVYRGKLQ-NDEWVAIKRLRHR  360

Query  887   DTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGL  708
             D++S++QV NEIKLLSSV+HPNLVRLLGC IE+G+ +LVYE+MPNGTLS+HLQR++G+GL
Sbjct  361   DSESLDQVMNEIKLLSSVSHPNLVRLLGCCIEQGDPVLVYEYMPNGTLSEHLQRDRGTGL  420

Query  707   PWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIES  528
             PW +RL + ++T++AIAYLH+ M+PPIYHRD+KS+NILLDY++ SKVADFGLSR G+ E+
Sbjct  421   PWTLRLTVATQTAKAIAYLHSEMNPPIYHRDIKSTNILLDYDFNSKVADFGLSRLGMTET  480

Query  527   SHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAA  348
             SHISTAPQGTPGYLDPQYHQ FHLSDKSDVYSFGVVL EIITGLK VDFTRP  E+NLAA
Sbjct  481   SHISTAPQGTPGYLDPQYHQCFHLSDKSDVYSFGVVLAEIITGLKVVDFTRPHTEINLAA  540

Query  347   LAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELE  168
             LAVDKIG G + EIIDP+++ E D WTLSS++ VAE+ FRCLAFH DMRP+M EVA ELE
Sbjct  541   LAVDKIGSGCIDEIIDPILDLELDAWTLSSIHTVAELTFRCLAFHSDMRPTMTEVADELE  600

Query  167   QMRLSKW  147
             Q+RLS W
Sbjct  601   QIRLSGW  607



>ref|XP_010429293.1| PREDICTED: wall-associated receptor kinase-like 14 [Camelina 
sativa]
Length=689

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/590 (54%), Positives = 420/590 (71%), Gaps = 20/590 (3%)
 Frame = -3

Query  1883  CNRSCGDGLKQLPFPFGFSSGCEILLNCTSNGTMSIGEFPVYQLTPDTIMINIPAKCGRR  1704
             CN  CG     LP+PFGF+ GC I  NC++ G   IG F V  +T ++I +++P  C R+
Sbjct  29    CNGRCGR--LSLPYPFGFTPGCGIKFNCSAAGNAEIGGFSVQNVTENSIFVSLPHNCTRK  86

Query  1703  IEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMIQTQFELQDCGKD-NISCFSEP  1527
             IE M PLF + FAPT  N  L++ C+     C I    ++   +L+ C    NISCFS  
Sbjct  87    IEDMTPLFSEQFAPTVENSFLMEECNKTTDGCSIKQKFLEDVLKLESCDSTGNISCFSLD  146

Query  1526  HMTGG---FIGYENLTGTGCKSLFSAISSPAAAANTTAVSLDIQVIELGWWLQGHCR---  1365
               +     F G   L  + C  LFS+I+  +   N   ++L+ + + LGWWL G C+   
Sbjct  147   SNSSSKKFFFGMNELRNSTCSLLFSSIAFESVGLNE-GIALEFERVRLGWWLNGDCKNKN  205

Query  1364  --CSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTRCNPAKYLLGECGG  1191
               C+ NA+C  + TP DGK G+RC C EG+ GDGY   + C+R    C  +K +   C  
Sbjct  206   SPCAANANCTHVDTP-DGKAGYRCSCDEGYHGDGYT--NLCQRVLPECRGSKLVWRHC--  260

Query  1190  KTRigvliggviagaaLMVSVGLI-CCIIRRRLAMKNWNRRRRELRETTG-ITIPVYSYK  1017
             ++++  ++GG I GA+L+V + L+  C  RR   +++    +R L E  G  ++  + YK
Sbjct  261   RSKLFTIVGGTIGGASLLVGLALLYFCKRRRSTPLRSHLSAKRLLSEAAGNSSVAFFPYK  320

Query  1016  DIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIKLLSS  837
             +IEKAT+ FS+K++LG GAYGTVY GKL  NDEWVAIKR+RHRD++S++QV NEIKLLSS
Sbjct  321   EIEKATDGFSEKQKLGIGAYGTVYRGKLQ-NDEWVAIKRLRHRDSESLDQVMNEIKLLSS  379

Query  836   VNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVSETSQAIA  657
             V+HPNLVRLLGC IE+G+ +LVYE+MPNGTLS+HLQR++G+GLPW +RL + ++T++AIA
Sbjct  380   VSHPNLVRLLGCCIEQGDPVLVYEYMPNGTLSEHLQRDRGTGLPWTLRLTVATQTAKAIA  439

Query  656   YLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGTPGYLDPQ  477
             YLH+ M+PPIYHRD+KS+NILLDY++ SKVADFGLSR G+ E+SHISTAPQGTPGYLDPQ
Sbjct  440   YLHSEMNPPIYHRDIKSTNILLDYDFNSKVADFGLSRLGMTETSHISTAPQGTPGYLDPQ  499

Query  476   YHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLEIIDP  297
             YHQ FHLSDKSDVYSFGVVL EIITGLK VDFTRP  E+NLAALAVDKIG G + EIIDP
Sbjct  500   YHQCFHLSDKSDVYSFGVVLAEIITGLKVVDFTRPHTEINLAALAVDKIGSGCIDEIIDP  559

Query  296   LIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKW  147
             +++ E D WTLSS++ VAE+ FRCLAFH DMRP+M EVA ELEQ+RLS W
Sbjct  560   ILDLELDAWTLSSIHTVAELTFRCLAFHSDMRPTMTEVADELEQIRLSGW  609



>ref|XP_008440186.1| PREDICTED: wall-associated receptor kinase-like 14 [Cucumis melo]
Length=698

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/603 (54%), Positives = 421/603 (70%), Gaps = 17/603 (3%)
 Frame = -3

Query  1934  VLILLLLQSAMVFGSSTCNRSCGDGLKQLPFPFGFSSGCEILLNCTSNGTMSIGEFPVYQ  1755
             ++++ +  +++       +   G+ ++ L  PFGF+    I LNC+ NG + IG F V  
Sbjct  9     IVVIAIFSASLTIAEGLTSCETGNSVQFLRHPFGFTDVKPIKLNCSENGEIQIGRFQVQN  68

Query  1754  LTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMIQTQF  1575
             +   +I+I +P  C   I ++  L  KN+ PT  N + L NC+   L C +       Q 
Sbjct  69    INERSILIKLPTGCNIPINSLSELSSKNYKPTLRNSLFL-NCTEQPLPCGVMGNFTLNQ-  126

Query  1574  ELQDCG--KDNISCFSEPHMTGGFIGYENLTGTGCKSLFSAISSPAAAANTTAVSLDIQV  1401
                DCG   +NISCF++     GF+   N     C SL S++     + +TT   ++  V
Sbjct  127   -PTDCGFKSNNISCFTKTEQ-NGFLPPLN----KCHSLLSSVFVNFTSNSTTLFEVEFGV  180

Query  1400  IELGWWLQ--GHCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQG-GSGCRRDDTR  1230
             IEL WW+      +CSK A+   + T      GFRCQC EGF G+ Y   G GCR+   +
Sbjct  181   IELEWWVSPSSAAQCSKYANRENI-TSSKENLGFRCQCIEGFEGNAYDNVGGGCRKVSHK  239

Query  1229  CNPAKYLLGECGGKTRigvliggviagaaLMVSVGLIC-CIIRRRLAMKNWNRRRRELRE  1053
             CNP  Y+ G CGG++++  LI GV  GA LM  + LIC CI RR + +K     +R L E
Sbjct  240   CNPPTYITGRCGGESKVAALIAGVFVGAFLMAVLTLICYCIRRRSMCLKGQMSAKRLLSE  299

Query  1052  TTG-ITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDS  876
               G  ++ +Y YK+IE+ATN FS+K+RLG GA+GTVY+G+LH+ DEWVA+KRI++RD +S
Sbjct  300   AAGNSSVTLYPYKEIERATNGFSEKQRLGTGAFGTVYAGRLHE-DEWVAVKRIKYRDHNS  358

Query  875   IEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPV  696
             I+QV NEIKLLSSV+HPNLVRLLGC IE+G+QILVYEFMPNGTLSQHLQRE+G+GLPW  
Sbjct  359   IDQVMNEIKLLSSVSHPNLVRLLGCCIEEGQQILVYEFMPNGTLSQHLQRERGNGLPWTT  418

Query  695   RLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHIS  516
             RL I +ETS+AIAYLH+++HPPIYHRD+KSSNILLD+ +KSKVADFGLSR G+ E SHIS
Sbjct  419   RLTIAAETSRAIAYLHSSVHPPIYHRDIKSSNILLDHGFKSKVADFGLSRLGMTEISHIS  478

Query  515   TAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVD  336
             TAPQGTPGY+DPQYHQ+F+LSDKSDVYSFGVVLVEIIT LK VDFTRPQ+EVNLAALA+D
Sbjct  479   TAPQGTPGYVDPQYHQNFYLSDKSDVYSFGVVLVEIITALKVVDFTRPQSEVNLAALAID  538

Query  335   KIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRL  156
             +IG+  + E+IDP +E  +D WTL S++KVAE+AFRCLAFH DMRPSM EVA ELE +R 
Sbjct  539   RIGRNSVDELIDPFLEPHRDAWTLYSIHKVAELAFRCLAFHSDMRPSMTEVAEELESIRR  598

Query  155   SKW  147
             S W
Sbjct  599   SGW  601



>ref|NP_565552.1| wall-associated receptor kinase-like 14 [Arabidopsis thaliana]
 ref|NP_850041.1| wall-associated receptor kinase-like 14 [Arabidopsis thaliana]
 sp|Q8RY67.2|WAKLO_ARATH RecName: Full=Wall-associated receptor kinase-like 14; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAC23760.2| putative protein kinase [Arabidopsis thaliana]
 gb|AEC07456.1| wall-associated receptor kinase-like 14 [Arabidopsis thaliana]
 gb|AEC07457.1| wall-associated receptor kinase-like 14 [Arabidopsis thaliana]
Length=708

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/676 (50%), Positives = 447/676 (66%), Gaps = 36/676 (5%)
 Frame = -3

Query  1946  KMIPVLILLLLQSAMVFGSST------CNRSCGDGLKQLPFPFGFSSGCEILLNCTSNGT  1785
             K+  +L+ +++    +F   +      CN  CG GL  LP+PFGFS+GC I  +C++   
Sbjct  21    KLDLILVFIIVIGGSIFRRVSANFTVPCNGRCG-GLT-LPYPFGFSNGCSIRFDCSAAEK  78

Query  1784  MSIGEFPVYQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCM  1605
               IG+F V  +T ++I + +   C R+IE M PLFG+NFAPTS N  L++NC+     C 
Sbjct  79    PMIGDFSVQNVTENSIFVGLSHNCTRKIEDMNPLFGENFAPTSENSFLMENCNRTTDGCS  138

Query  1604  IPSTMIQTQFELQDC-GKDNISCFSEPHMT-----GGFIGYENLTGTGCKSLFSAISSPA  1443
             I    ++   +L+ C    NISCFS    +       F   + L  + C  LFS+I+  +
Sbjct  139   IKQKFLENVLKLKSCDATGNISCFSLDSNSSSKNSAKFFSMKTLRNSSCSLLFSSIAFES  198

Query  1442  AAANTTAVSLDIQVIELGWWLQGHCR---CSKNADCNTMRTPGDGKPGFRCQCSEGFTGD  1272
                N   ++L+ + + LGWWL+G C    C+ N DC  + TP  G  G RC C +GF GD
Sbjct  199   VGVNA-GIALEFERVRLGWWLKGGCESGTCAANTDCTDVETP-HGYAGHRCSCLDGFHGD  256

Query  1271  GYQGGSGCRRDDTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLA  1092
             GY   + C+R    C  +K +   C     I ++ G V     L        C  RR   
Sbjct  257   GYT--NPCQRALPECRGSKLVWRHCRSNL-ITIVGGTVGGAFLLAALAFFFFCKRRRSTP  313

Query  1091  MKNWNRRRRELRETTG-ITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEW  915
             +++    +R L E  G  ++  + YK+IEKAT+ FS+K++LG GAYGTVY GKL  NDEW
Sbjct  314   LRSHLSAKRLLSEAAGNSSVAFFPYKEIEKATDGFSEKQKLGIGAYGTVYRGKLQ-NDEW  372

Query  914   VAIKRIRHRDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQH  735
             VAIKR+RHRD++S++QV NEIKLLSSV+HPNLVRLLGC IE+G+ +LVYE+MPNGTLS+H
Sbjct  373   VAIKRLRHRDSESLDQVMNEIKLLSSVSHPNLVRLLGCCIEQGDPVLVYEYMPNGTLSEH  432

Query  734   LQREKGSGLPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFG  555
             LQR++GSGLPW +RL + ++T++AIAYLH++M+PPIYHRD+KS+NILLDY++ SKVADFG
Sbjct  433   LQRDRGSGLPWTLRLTVATQTAKAIAYLHSSMNPPIYHRDIKSTNILLDYDFNSKVADFG  492

Query  554   LSRFGLIESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTR  375
             LSR G+ ESSHISTAPQGTPGYLDPQYHQ FHLSDKSDVYSFGVVL EIITGLK VDFTR
Sbjct  493   LSRLGMTESSHISTAPQGTPGYLDPQYHQCFHLSDKSDVYSFGVVLAEIITGLKVVDFTR  552

Query  374   PQNEVNLAALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPS  195
             P  E+NLAALAVDKIG G + EIIDP+++ + D WTLSS++ VAE+AFRCLAFH DMRP+
Sbjct  553   PHTEINLAALAVDKIGSGCIDEIIDPILDLDLDAWTLSSIHTVAELAFRCLAFHSDMRPT  612

Query  194   MMEVAIELEQMRLSKWGIsedsiitassssssrsssdasEKPLSFST------------M  51
             M EVA ELEQ+RLS W  S      A S  SS   S+ S K  S  +            +
Sbjct  613   MTEVADELEQIRLSGWIPSMSLDSPAGSLRSSDRGSERSVKQSSIGSRRVVIPQKQPDCL  672

Query  50    KPSEKVTESSPVSVQD  3
                E++++SSP+SVQD
Sbjct  673   ASVEEISDSSPISVQD  688



>gb|AAL91622.1| At2g23450/F26B6.10 [Arabidopsis thaliana]
 gb|AAN33192.1| At2g23450/F26B6.10 [Arabidopsis thaliana]
Length=708

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/676 (50%), Positives = 446/676 (66%), Gaps = 36/676 (5%)
 Frame = -3

Query  1946  KMIPVLILLLLQSAMVFGSST------CNRSCGDGLKQLPFPFGFSSGCEILLNCTSNGT  1785
             K+  +L+ +++    +F   +      CN  CG GL  LP+PFGFS+GC I  +C++   
Sbjct  21    KLDLILVFIIVIGGSIFRRVSANFTVPCNGRCG-GLT-LPYPFGFSNGCSIRFDCSAAEK  78

Query  1784  MSIGEFPVYQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCM  1605
               IG+F V   T ++I + +   C R+IE M PLFG+NFAPTS N  L++NC+     C 
Sbjct  79    PMIGDFSVQNATENSIFVGLSHNCTRKIEDMNPLFGENFAPTSENSFLMENCNRTTDGCS  138

Query  1604  IPSTMIQTQFELQDC-GKDNISCFSEPHMT-----GGFIGYENLTGTGCKSLFSAISSPA  1443
             I    ++   +L+ C    NISCFS    +       F   + L  + C  LFS+I+  +
Sbjct  139   IKQKFLENVLKLKSCDATGNISCFSLDSNSSSKNSAKFFSMKTLRNSSCSLLFSSIAFES  198

Query  1442  AAANTTAVSLDIQVIELGWWLQGHCR---CSKNADCNTMRTPGDGKPGFRCQCSEGFTGD  1272
                N   ++L+ + + LGWWL+G C    C+ N DC  + TP  G  G RC C +GF GD
Sbjct  199   VGVNA-GIALEFERVRLGWWLKGGCESGTCAANTDCTDVETP-HGYAGHRCSCLDGFHGD  256

Query  1271  GYQGGSGCRRDDTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLA  1092
             GY   + C+R    C  +K +   C     I ++ G V     L        C  RR   
Sbjct  257   GYT--NPCQRALPECRGSKLVWRHCRSNL-ITIVGGTVGGAFLLAALAFFFFCKRRRSTP  313

Query  1091  MKNWNRRRRELRETTG-ITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEW  915
             +++    +R L E  G  ++  + YK+IEKAT+ FS+K++LG GAYGTVY GKL  NDEW
Sbjct  314   LRSHLSAKRLLSEAAGNSSVAFFPYKEIEKATDGFSEKQKLGIGAYGTVYRGKLQ-NDEW  372

Query  914   VAIKRIRHRDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQH  735
             VAIKR+RHRD++S++QV NEIKLLSSV+HPNLVRLLGC IE+G+ +LVYE+MPNGTLS+H
Sbjct  373   VAIKRLRHRDSESLDQVMNEIKLLSSVSHPNLVRLLGCCIEQGDPVLVYEYMPNGTLSEH  432

Query  734   LQREKGSGLPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFG  555
             LQR++GSGLPW +RL + ++T++AIAYLH++M+PPIYHRD+KS+NILLDY++ SKVADFG
Sbjct  433   LQRDRGSGLPWTLRLTVATQTAKAIAYLHSSMNPPIYHRDIKSTNILLDYDFNSKVADFG  492

Query  554   LSRFGLIESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTR  375
             LSR G+ ESSHISTAPQGTPGYLDPQYHQ FHLSDKSDVYSFGVVL EIITGLK VDFTR
Sbjct  493   LSRLGMTESSHISTAPQGTPGYLDPQYHQCFHLSDKSDVYSFGVVLAEIITGLKVVDFTR  552

Query  374   PQNEVNLAALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPS  195
             P  E+NLAALAVDKIG G + EIIDP+++ + D WTLSS++ VAE+AFRCLAFH DMRP+
Sbjct  553   PHTEINLAALAVDKIGSGCIDEIIDPILDLDLDAWTLSSIHTVAELAFRCLAFHSDMRPT  612

Query  194   MMEVAIELEQMRLSKWGIsedsiitassssssrsssdasEKPLSFST------------M  51
             M EVA ELEQ+RLS W  S      A S  SS   S+ S K  S  +            +
Sbjct  613   MTEVADELEQIRLSGWIPSMSLDSPAGSLRSSDRGSERSVKQSSIGSRRVVIPQKQPDCL  672

Query  50    KPSEKVTESSPVSVQD  3
                E++++SSP+SVQD
Sbjct  673   ASVEEISDSSPISVQD  688



>ref|XP_002880505.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56764.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=705

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/649 (51%), Positives = 435/649 (67%), Gaps = 30/649 (5%)
 Frame = -3

Query  1883  CNRSCGDGLKQLPFPFGFSSGCEILLNCTSNGTMSIGEFPVYQLTPDTIMINIPAKCGRR  1704
             CN  CG GL  LP+PFGFS+GC I  +C++     IG+F V  +T D I + +P  C R+
Sbjct  45    CNGRCG-GLT-LPYPFGFSNGCRIQFDCSAVEKPMIGDFSVQNVTEDGIFVGLPHNCTRK  102

Query  1703  IEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMIQTQFELQDC-GKDNISCFS--  1533
             IE M+PLFG++FAPTS N  L+++C +    C I    ++    L+ C  K NISCFS  
Sbjct  103   IEDMRPLFGEHFAPTSENSFLMEDCVNTTDGCSIKQKFLENVLNLESCDSKGNISCFSLD  162

Query  1532  ---EPHMTGGFIGYENLTGTGCKSLFSAISSPAAAANTTAVSLDIQVIELGWWLQGHCR-  1365
                    +  F   + L  + C  LFS+I+  +   N   ++L+ + + LGWWL+G C+ 
Sbjct  163   TNSSSKNSAKFFSMKELRNSSCSLLFSSIAFESGGLNA-GIALEFERVRLGWWLKGSCKN  221

Query  1364  --CSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTRCNPAKYLLGECGG  1191
               C+ N +C  + TP  G  G+RC C  G+ GDG+     C+R    C  +K +   C  
Sbjct  222   SPCAVNTNCTDVDTP-HGYAGYRCSCLAGYHGDGFI--KACQRALPDCRGSKLVWRHCRS  278

Query  1190  KTRigvliggviagaaLMVSVGLICCIIRRRLAMKNWNRRRRELRETTG-ITIPVYSYKD  1014
                I ++ G V     L     L  C  RR   +++    +R L E  G  ++  + YK+
Sbjct  279   NL-ITIVGGTVGGAFLLAGLALLFFCKRRRSTPLRSHLSAKRLLSEAAGNSSVAFFPYKE  337

Query  1013  IEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIKLLSSV  834
             IEKAT+ FS+K++LG GAYGTVY GKL  NDEWVAIKR+RHRD++S++QV NEIKLLSSV
Sbjct  338   IEKATDGFSEKQQLGVGAYGTVYRGKLQ-NDEWVAIKRLRHRDSESLDQVMNEIKLLSSV  396

Query  833   NHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVSETSQAIAY  654
             +HPNLVRLLGC IE+G+ +LVYE+MPNGTLS+HLQR++GSGLPW +RL + ++T++AIAY
Sbjct  397   SHPNLVRLLGCCIEQGDPVLVYEYMPNGTLSEHLQRDRGSGLPWTLRLTVATQTAKAIAY  456

Query  653   LHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGTPGYLDPQY  474
             LH+AM+PPIYHRD+KS+NILLDY++ SKVADFGLSR G+ ESSHISTAPQGTPGYLDPQY
Sbjct  457   LHSAMNPPIYHRDIKSTNILLDYDFNSKVADFGLSRLGMTESSHISTAPQGTPGYLDPQY  516

Query  473   HQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLEIIDPL  294
             HQ FHLSDKSDVYSFGVVL EIITGLK VDFTRP  E+NLAALAVDKIG G + EIIDP+
Sbjct  517   HQCFHLSDKSDVYSFGVVLAEIITGLKVVDFTRPHTEINLAALAVDKIGSGCIDEIIDPI  576

Query  293   IEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKWGIsedsiitas  114
             ++ + D WTLSS++ VAE+ FRCLAFH DMRP+M EVA ELEQ+RL+ W         A 
Sbjct  577   LDLDLDAWTLSSIHTVAELTFRCLAFHSDMRPTMTEVADELEQIRLNGWIPHMSLDSPAG  636

Query  113   sssssrsssdasEKPLS------------FSTMKPSEKVTESSPVSVQD  3
             S  SS   S+ S K  S               +   E++++SSP+SVQD
Sbjct  637   SLRSSDRGSERSVKQSSTGSRRVVIPQKQLDNLASVEEISDSSPISVQD  685



>gb|KGN48469.1| hypothetical protein Csa_6G488880 [Cucumis sativus]
Length=717

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/603 (54%), Positives = 420/603 (70%), Gaps = 17/603 (3%)
 Frame = -3

Query  1934  VLILLLLQSAMVFGSSTCNRSCGDGLKQLPFPFGFSSGCEILLNCTSNGTMSIGEFPVYQ  1755
             ++++ +  + +       +   G+  + +  PFGF+    I L C+ NG + IG F V  
Sbjct  9     IVVITIFSAFLTIAEGLTSCETGNSAQFVRHPFGFTDVKPIKLGCSKNGEIQIGRFQVQN  68

Query  1754  LTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMIQTQF  1575
             +   +I+I +P  C   I ++  L  KN+ PT  N + L NC+   L C +       Q 
Sbjct  69    INERSIIIKLPTGCNIPINSLSELSSKNYKPTLRNSLFL-NCTEQPLPCGVMGNFTLNQ-  126

Query  1574  ELQDCG--KDNISCFSEPHMTGGFIGYENLTGTGCKSLFSAISSPAAAANTTAVSLDIQV  1401
                DCG   +N+SCF++    G F+   N     C SL S++     + +TT   ++  V
Sbjct  127   -PTDCGLKSNNMSCFTKTEQNG-FLPPLN----KCHSLLSSVFVNFTSNSTTQFEVEFGV  180

Query  1400  IELGWWLQGH--CRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQG-GSGCRRDDTR  1230
             IEL WW+      +CSKNA+   + T      GFRCQC EGF G+ Y   G GCRR   +
Sbjct  181   IELEWWVSPSSVAQCSKNANRENI-TSSTENLGFRCQCEEGFEGNAYDNDGGGCRRVSHK  239

Query  1229  CNPAKYLLGECGGKTRigvliggviagaaLMVSVGLIC-CIIRRRLAMKNWNRRRRELRE  1053
             CNP  Y+ G CGG++++  LI GVI GA LM  + LIC CI RR + +K     +R L E
Sbjct  240   CNPPTYITGRCGGESKVAALIAGVIVGAFLMAVLTLICYCIRRRSMCLKGQMSAKRLLSE  299

Query  1052  TTG-ITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDS  876
               G  ++ +Y YK+IE+ATN FS+K+RLG GA+GTVY+G+LH+ DEWVA+KRI++RD +S
Sbjct  300   AAGNSSVTLYPYKEIERATNGFSEKQRLGTGAFGTVYAGRLHE-DEWVAVKRIKYRDHNS  358

Query  875   IEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPV  696
             I+QV NEIKLLSSV+HPNLVRLLGC IE+G+QILVYEFMPNGTLSQHLQRE+G+GLPW  
Sbjct  359   IDQVMNEIKLLSSVSHPNLVRLLGCCIEEGQQILVYEFMPNGTLSQHLQRERGNGLPWTT  418

Query  695   RLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHIS  516
             RL I +ETS+AIAYLH+++HPPIYHRD+KSSNILLD+ +KSKVADFGLSR G+ E SH+S
Sbjct  419   RLTIAAETSRAIAYLHSSVHPPIYHRDIKSSNILLDHGFKSKVADFGLSRLGMTEISHVS  478

Query  515   TAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVD  336
             TAPQGTPGY+DPQYHQ+F+LSDKSDVYSFGVVLVEIIT LK VDFTRPQ+EVNLAALA+D
Sbjct  479   TAPQGTPGYVDPQYHQNFYLSDKSDVYSFGVVLVEIITALKVVDFTRPQSEVNLAALAID  538

Query  335   KIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRL  156
             +IG+  + E+IDP +E  +D WTL S++KVAE+AFRCLAFH DMRPSM EVA ELE +R 
Sbjct  539   RIGRNSVDELIDPFLEPHRDAWTLYSIHKVAELAFRCLAFHSDMRPSMTEVAEELESIRR  598

Query  155   SKW  147
             S W
Sbjct  599   SGW  601



>ref|XP_009392373.1| PREDICTED: wall-associated receptor kinase-like 14 [Musa acuminata 
subsp. malaccensis]
Length=715

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/661 (52%), Positives = 451/661 (68%), Gaps = 26/661 (4%)
 Frame = -3

Query  1934  VLILLLLQSAMVFGSSTCNRSCGDGLKQLPFPFGFSSGCEILLNCTS--NGTMSIGEFPV  1761
             V+ + L+ SA    +  C R+CG      P+PFGFS GC I L C++    T+ IGEF V
Sbjct  44    VVAVGLVVSAQ--AAKDCERACGS--YAAPYPFGFSDGCPIHLGCSNLPKPTIRIGEFTV  99

Query  1760  YQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMIQT  1581
               +T D +++++P  C R + A + LFG N+A +  NG+ L+NC+    K +     + T
Sbjct  100   RNITDDGLLVDVPPACNRSVHAARSLFGNNYALSRRNGLFLRNCTPTAGKSLTERCSVDT  159

Query  1580  QFELQDCGK--DNISCFSEPHMTGGFIGYENLTGTGCKSLFS--AISSPAAAANTTAVSL  1413
                   CG   DN +C        GF   +++  +GC  LF+   I+ P      +  SL
Sbjct  160   ILIDGSCGPVYDNATCLYNA-TKEGFFNADSIAASGCGFLFTTIGINDPGG---VSVPSL  215

Query  1412  DIQVIELGWWLQGHCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRR---  1242
             D+   EL WWL+G CRC+ +A+C T+ +P   +PGFRC CSEGF GDG+  G+GCRR   
Sbjct  216   DLSTAELAWWLEGTCRCAADANCTTVTSPVTHRPGFRCGCSEGFQGDGFIDGTGCRRVSD  275

Query  1241  DDTRCNPAKYLLGECGGKT-RigvliggviagaaLMVSVGLICCIIRRRLAMKNWNRRRR  1065
              + +CNP KY+ G CGG T R G L+GG+IAGA+ M ++  +C  I+R  ++    +  R
Sbjct  276   PNQKCNPTKYMTGGCGGTTSRYGFLVGGIIAGASAMAALAAVCWWIKRHSSLTRKRKSMR  335

Query  1064  ELRETTGITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRD  885
              L       +P+YSYKD+EKAT+ FS    LG GA+GTVY+G +  +D  VA+K+I++ +
Sbjct  336   RLLSEASCAVPLYSYKDMEKATDGFSADHILGTGAFGTVYAG-MFSHDRLVAVKKIKNLN  394

Query  884   TDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLP  705
              DSIEQV NEI+LLSSV+HPNLVRLLGC +E+ EQILVYE+MP+GTL+QHLQR +G  LP
Sbjct  395   NDSIEQVMNEIRLLSSVSHPNLVRLLGCCVEQREQILVYEYMPHGTLAQHLQRVRGPVLP  454

Query  704   WPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESS  525
             W VRL I +ET++AIAYLH+A+HPPIYHRD+KSSNILLD+ +  KVADFGLSR G+ E S
Sbjct  455   WTVRLTIAAETAKAIAYLHSAVHPPIYHRDIKSSNILLDHRFNPKVADFGLSRMGMTEMS  514

Query  524   HISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAAL  345
             HISTAPQGTPGYLDPQYHQ+F LSDKSDVYSFGVVL EIIT LKAVDF+R Q+EV LAAL
Sbjct  515   HISTAPQGTPGYLDPQYHQNFQLSDKSDVYSFGVVLTEIITALKAVDFSRAQSEVYLAAL  574

Query  344   AVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQ  165
             AVD+IGKG + +IIDP +   +D  TL+S++KVAE+AFRCLAFHRDMRPSM EVA ELEQ
Sbjct  575   AVDRIGKGCIDDIIDPHLAPHRDPRTLASIHKVAELAFRCLAFHRDMRPSMTEVADELEQ  634

Query  164   MRLSKWGIsedsiitassssssrsssdasEKPLSFSTMK-------PSEKVTESSPVSVQ  6
             +RLS W  ++ S+  + SSSS  S S  +EKP + S  +         E+V   SPVSVQ
Sbjct  635   IRLSGWVPTDGSMFLSKSSSSCSSPSSCNEKPRTTSKSRRLASVSSRGEEVKGGSPVSVQ  694

Query  5     D  3
             +
Sbjct  695   E  695



>gb|EPS73768.1| hypothetical protein M569_00987, partial [Genlisea aurea]
Length=608

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/602 (52%), Positives = 413/602 (69%), Gaps = 42/602 (7%)
 Frame = -3

Query  1892  SSTCNRSCGDGLKQLPFPFGFSSGCEILLNCTSNGTMSIGEFPVYQLTPDTIMINIPAKC  1713
             S+ C R CG+    + +PFGFS GC I LNC+  G + +G F    +T + I I +P +C
Sbjct  3     SAACPRQCGNA--TVKYPFGFSDGCGIRLNCSGGGEIGVGGFDALNVTGERISIGLPIRC  60

Query  1712  GRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMIQTQFELQDCGKDNISCFS  1533
              R IE ++ LFG NFAPT  N  LL+NCS     C+IPS  +  +     CG  N SC++
Sbjct  61    DRSIEKLRELFGPNFAPTWKNEFLLENCSESVRDCLIPSRFLGAE----SCGGYNRSCYA  116

Query  1532  EPHMTG---GFIGYENLTGTG-CKSLFSAIS---SPAAAANTTAVSLDIQVIELGWWLQG  1374
                  G    F+ Y ++   G C  L S++    SP      ++++L++  +ELGWWL G
Sbjct  117   PGSADGIAVEFLNYTDVLRRGDCGVLLSSMMVDWSPG-----SSIALEVGTVELGWWLDG  171

Query  1373  HCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTRCNPAKYLLGECG  1194
              C C  NA C  +R    G+ G+RC C++G+ GDG+  G+GCRR     +  +       
Sbjct  172   ACDCDGNASCTVVRY--GGRVGYRCNCNQGYVGDGFSAGNGCRRASDSSSGRR-------  222

Query  1193  GKTRigvliggviagaaLMVSVGLICC--IIRRRLAMKNWNRRRRELRETTG-ITIPVYS  1023
             G+++  V I G     AL  ++  + C    +R  A KN    +R + E  G  TIP+Y 
Sbjct  223   GRSKKVVAIVGGALAGALSTAMAAVACHHAKKRTAARKNRITAKRLVAEALGKSTIPLYP  282

Query  1022  YKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDS--IEQVTNEIK  849
             Y++I +AT  FS+ + LG GAYGTVY+GKL  NDEWVAIKRI+HRD D   I QV NEIK
Sbjct  283   YREIHRATRGFSESQMLGTGAYGTVYAGKLR-NDEWVAIKRIKHRDDDGEGIAQVMNEIK  341

Query  848   LLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVSETS  669
             LLSSV+HPNLVRLLGCS E GEQILVYE+MPNGTL+QHLQRE+G  LPW VRL + ++T+
Sbjct  342   LLSSVSHPNLVRLLGCSFENGEQILVYEYMPNGTLAQHLQRERGPTLPWSVRLAVAAQTA  401

Query  668   QAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIES--------SHIST  513
             +A+AYLH+A++PPIYHRD+KSSNILLDY++ SKVADFGLSRFG+  +        SH+ST
Sbjct  402   RAVAYLHSAVNPPIYHRDIKSSNILLDYDFNSKVADFGLSRFGMAAAAGGDESSKSHVST  461

Query  512   APQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDK  333
             APQGTPGY+DPQYHQ+FHLSD+SDVYSFGVVLVEI++G+KAVDFTRP+++VNLAALAVDK
Sbjct  462   APQGTPGYVDPQYHQNFHLSDRSDVYSFGVVLVEIVSGMKAVDFTRPRSDVNLAALAVDK  521

Query  332   IGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLS  153
             IGKG + EI+DP I  + D WT+++V+KVAE+AFRCLAF   MRPSM+EVA ELE +R+ 
Sbjct  522   IGKGRVEEIVDPFISYD-DAWTVAAVHKVAELAFRCLAFDYHMRPSMVEVAEELEMVRVG  580

Query  152   KW  147
             +W
Sbjct  581   EW  582



>ref|XP_006649661.1| PREDICTED: wall-associated receptor kinase-like 14-like [Oryza 
brachyantha]
Length=702

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/592 (52%), Positives = 412/592 (70%), Gaps = 20/592 (3%)
 Frame = -3

Query  1883  CNRSCGDGLKQLPFPFGFSSGCEILLNCT-SNGTMSIGE-----FPVYQLTPDTIMINIP  1722
             C RSCG GL+ +P+PFGFSSGC + L C  ++G   +G        V  +TP  +++ +P
Sbjct  37    CTRSCG-GLR-VPYPFGFSSGCAVRLGCDDASGVAWLGARRELGLLVTNVTPRALVLTLP  94

Query  1721  AKCGRRIEA-MKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMIQTQFELQDCGKDNI  1545
               C R + A ++ LF  N+AP   N +++ +C +         T+    +  + C   +I
Sbjct  95    PNCSRSLNASLEALFTDNYAPAVQNALVVSSCDARSAALTSNCTIPPEAYLEKSC--SSI  152

Query  1544  SCFSEPHMTGGFIGYENLTGTGCKSLFS---AISSPAAAANTTAVSLDIQVIELGWWLQG  1374
              C   P  TG   G      +  + L S    + S +  +NT+  +L +  +EL WW+QG
Sbjct  153   RCVLPP--TGANSGSNLFARSEMRRLGSECAGLVSSSIYSNTSGPALQLTALELEWWVQG  210

Query  1373  HCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTRCNPAKYLLGECG  1194
              CRCS +A C+    P   +  FRC+C EGF GDGY  G+GCR+   +CNP+KYL G CG
Sbjct  211   QCRCSSHASCDEFTAPTTQQKAFRCECPEGFEGDGYAAGAGCRKVP-KCNPSKYLSGSCG  269

Query  1193  GKTRigvliggviagaaLMVSVGLICCIIRRRLAMKNWNRRRRELRETTGITIPVYSYKD  1014
                +IG+LI G++ GA +M    L+  ++RRR A+    +  + L      T+P Y+Y++
Sbjct  270   KLVQIGLLIAGIVFGAMVMGVTCLVYHLLRRRSAVIRTQQTTKRLLSEASCTVPFYTYRE  329

Query  1013  IEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIKLLSSV  834
             IE+ATN F++ +RLG GAYGTVY+G+L  N+  VA+KRI+ RD   +++V NE+KL+SSV
Sbjct  330   IERATNGFAEDQRLGTGAYGTVYAGRL-SNNRLVAVKRIKQRDNAGLDRVMNEVKLVSSV  388

Query  833   NHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVSETSQAIAY  654
             +H NLVRLLGC IE+G+QILVYEFMPNGTL+QHLQRE+G  +PW VRL I +ET++AIAY
Sbjct  389   SHRNLVRLLGCCIEQGQQILVYEFMPNGTLAQHLQRERGPAVPWTVRLRIAAETAKAIAY  448

Query  653   LHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGL--IESSHISTAPQGTPGYLDP  480
             LH+ +HPPIYHRD+KSSNILLD+ Y SKVADFGLSR G+  ++SSHISTAPQGTPGY+DP
Sbjct  449   LHSEVHPPIYHRDIKSSNILLDHEYNSKVADFGLSRMGMTSVDSSHISTAPQGTPGYVDP  508

Query  479   QYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLEIID  300
             QYHQ+FHLSDKSDVYSFGVVLVEIIT +KAVDF R  +EVNLA LAVD+IGKG L +I+D
Sbjct  509   QYHQNFHLSDKSDVYSFGVVLVEIITAMKAVDFNRAGSEVNLAQLAVDRIGKGCLDDIVD  568

Query  299   PLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKWG  144
             P ++  +D WTL+S++KVAE+AFRCLAFH +MRPSM EVA EL+Q+++S W 
Sbjct  569   PFLDPHRDAWTLTSIHKVAELAFRCLAFHSEMRPSMAEVADELDQIQVSGWA  620



>ref|XP_009412515.1| PREDICTED: wall-associated receptor kinase-like 14 [Musa acuminata 
subsp. malaccensis]
Length=693

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/606 (52%), Positives = 412/606 (68%), Gaps = 25/606 (4%)
 Frame = -3

Query  1931  LILLLLQSAMVFGSSTCNRSCGDGLKQLPFPFGFSSGCEILLNCTSNGTMSIGEFPVYQL  1752
             L   L    +  G++ CNR+CG G   +P+PFGFS+GC I LNC+ +G   +GEF V  +
Sbjct  34    LFFALSLLCVATGAAGCNRTCGSG-PAVPYPFGFSAGCPIRLNCSQDGARFLGEFRVRNI  92

Query  1751  TPDTIMINIPAKCGRRIE-AMKPLFGKNFAPTSNNGILLQNCSSPE-LKCMIPSTMIQTQ  1578
             T D + +++P  C R I  A   LFG N+A T++N + L+NC+S    +C I + +I  +
Sbjct  93    TTDAVHLDVPPVCDRFIHRATAGLFGANYAMTASNALFLRNCTSKTGSECSISTDIIAKR  152

Query  1577  FELQDCG--KDNISCFSEPHMTGGFIGYENLTG--TGCKSLFSAISSPAAAANTTAVSLD  1410
              +L  CG   D+ISC+S    T GF+   N T   T C+ L++++      A++   SL 
Sbjct  153   MKLTSCGPKDDDISCYSSGR-TDGFLSDANFTAAATNCRLLYTSVRY-GEDASSDQPSLV  210

Query  1409  IQVIELGWWLQGHCRCSKNADCNTMRTPGD----GKPGFRCQCSEGFTGDGYQGGSGCRR  1242
                 E+GWWL G CRC+ NA C  +  P D     K GFRC C EGF GDG+  G  CRR
Sbjct  211   FGSAEIGWWLNGECRCAANATCKRVDVPVDTQNSSKKGFRCSCHEGFIGDGFAEGERCRR  270

Query  1241  DDTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRR--LAMKNWNRRR  1068
             D      A  +    GGK    V      A  AL +++  +C ++RRR  ++    +  R
Sbjct  271   D------AASISSIPGGKAGAIVGGAVAGAALALGLAL--LCYLVRRRGIVSEVEESGTR  322

Query  1067  RELRETTGITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHR  888
             R L ET+  T+ VYS+K++E+AT NFSD  +LG GAY TVY G+   N   VAIKR++H 
Sbjct  323   RLLYETS-CTVAVYSHKEVERATGNFSDAYKLGAGAYATVYMGRF-SNTGLVAIKRLKHP  380

Query  887   DTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGL  708
             DTD+IE V NEIKL+SSV+HPNLV LLGC I+ GE ILVYEFMPNGTLSQHL RE+G+GL
Sbjct  381   DTDNIEHVINEIKLVSSVSHPNLVHLLGCCIDSGEHILVYEFMPNGTLSQHLHRERGNGL  440

Query  707   PWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIES  528
              W  R+ I +ET++AI+YLH A+HPPIYHRD+KSSNILLDY+ + K+ADFGLSR G++ES
Sbjct  441   SWSARVSIATETARAISYLHTAVHPPIYHRDIKSSNILLDYDLRPKLADFGLSRVGIVES  500

Query  527   SHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAA  348
             SHISTAPQGTPGY+DPQYHQ+FHLSDKSDVYS+GVVLVE+IT +K VDF R  +EVNLA+
Sbjct  501   SHISTAPQGTPGYVDPQYHQNFHLSDKSDVYSYGVVLVEMITAMKVVDFRRAASEVNLAS  560

Query  347   LAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELE  168
             LA DKIGKG + +I+DP+I+   +  T +SV KVAE+AFRCLAFHRD RPSM EVA ELE
Sbjct  561   LAADKIGKGLVEDIVDPIIKENWNGQTRASVQKVAELAFRCLAFHRDARPSMAEVAEELE  620

Query  167   QMRLSK  150
             ++ + +
Sbjct  621   KIMMEE  626



>ref|NP_001049435.1| Os03g0225700 [Oryza sativa Japonica Group]
 gb|AAN52750.1| Putative protein kinase [Oryza sativa Japonica Group]
 gb|ABF94739.1| WAK-like kinase, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF11349.1| Os03g0225700 [Oryza sativa Japonica Group]
 dbj|BAG95189.1| unnamed protein product [Oryza sativa Japonica Group]
Length=704

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/612 (51%), Positives = 412/612 (67%), Gaps = 55/612 (9%)
 Frame = -3

Query  1883  CNRSCGDGLKQLPFPFGFSSGCEILLNCT-SNGTM-----SIGEFPVYQLTPDTIMINIP  1722
             C +SCG    ++P+PFGFS GC + L C  ++GT            V  +TP  I++ +P
Sbjct  34    CTQSCGR--MRVPYPFGFSRGCTVQLGCDDASGTAWLGGTRGLGLLVSNVTPRAIVLTLP  91

Query  1721  AKCGRRI-EAMKPLFGKNFAPTSNNGIL-----------LQNCSSP----------ELKC  1608
               C R + E++  LF  N+APT+ N ++           L NCS P           ++C
Sbjct  92    PNCSRPLNESLDALFTDNYAPTAQNALVVSSCDPQAAARLSNCSIPPEAYLEKSCNSIRC  151

Query  1607  MIPSTMIQTQFELQDCGKDNISCFSEPHMTGGFIGYENLT--GTGCKSLFSAISSPAAAA  1434
             ++PST            K N+      ++T  F+    +   G+ C+ L SA    +  +
Sbjct  152   VLPST------------KANVD---GTNVTDPFLNRSEMRRLGSDCRGLVSA----SIYS  192

Query  1433  NTTAVSLDIQVIELGWWLQGHCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGS  1254
             NT   +L +  +EL WW+QG C CS +A C+    P   K  FRC+C EGF GDGY  G+
Sbjct  193   NTAGPALQLTALELDWWVQGRCGCSSHAICDGFTPPSTQKEAFRCECQEGFEGDGYTAGA  252

Query  1253  GCRRDDTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAMKNWNR  1074
             GCRR   +CNP+KYL G CG   +IG+L+ GV  GA +M    L+  ++RRR A     +
Sbjct  253   GCRRV-PKCNPSKYLSGSCGKLVQIGLLVAGVFFGAMVMGITCLVYHLLRRRSAALRSQK  311

Query  1073  RRRELRETTGITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIR  894
               + L      T+P Y+Y++I++ATN F++ +RLG GAYGTVY+G+L  N+  VA+KRI+
Sbjct  312   STKRLLSEASCTVPFYTYREIDRATNGFAEDQRLGTGAYGTVYAGRL-SNNRLVAVKRIK  370

Query  893   HRDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGS  714
              RD   +++V NE+KL+SSV+H NLVRLLGC IE G+QILVYEFMPNGTL+QHLQRE+G 
Sbjct  371   QRDNAGLDRVMNEVKLVSSVSHRNLVRLLGCCIEHGQQILVYEFMPNGTLAQHLQRERGP  430

Query  713   GLPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGL-  537
              +PW VRL I  ET++AIAYLH+ +HPPIYHRD+KSSNILLD+ Y SKVADFGLSR G+ 
Sbjct  431   AVPWTVRLRIAVETAKAIAYLHSEVHPPIYHRDIKSSNILLDHEYNSKVADFGLSRMGMT  490

Query  536   -IESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEV  360
              ++SSHISTAPQGTPGY+DPQYHQ+FHLSDKSDVYSFGVVLVEIIT +KAVDF+R  +EV
Sbjct  491   SVDSSHISTAPQGTPGYVDPQYHQNFHLSDKSDVYSFGVVLVEIITAMKAVDFSRVGSEV  550

Query  359   NLAALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVA  180
             NLA LAVD+IGKG L +I+DP ++  +D WTL+S++KVAE+AFRCLAFH +MRPSM EVA
Sbjct  551   NLAQLAVDRIGKGSLDDIVDPYLDPHRDAWTLTSIHKVAELAFRCLAFHSEMRPSMAEVA  610

Query  179   IELEQMRLSKWG  144
              ELEQ+++S W 
Sbjct  611   DELEQIQVSGWA  622



>gb|EAY89102.1| hypothetical protein OsI_10590 [Oryza sativa Indica Group]
Length=704

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/612 (51%), Positives = 411/612 (67%), Gaps = 55/612 (9%)
 Frame = -3

Query  1883  CNRSCGDGLKQLPFPFGFSSGCEILLNCT-SNGTM-----SIGEFPVYQLTPDTIMINIP  1722
             C +SCG    ++P+PFGFS GC + L C  ++GT            V  +TP  I++ +P
Sbjct  34    CTQSCGR--MRVPYPFGFSRGCTVQLGCDDASGTAWLGGTRGLGLLVSNVTPRAIVLTLP  91

Query  1721  AKCGRRI-EAMKPLFGKNFAPTSNNGIL-----------LQNCSSP----------ELKC  1608
               C R + E++  LF  N+APT+ N ++           L NCS P           ++C
Sbjct  92    PNCSRPLNESLDALFTDNYAPTAQNALVVSSCDPQAAARLSNCSIPPEAYLEKSCNSIRC  151

Query  1607  MIPSTMIQTQFELQDCGKDNISCFSEPHMTGGFIGYENLT--GTGCKSLFSAISSPAAAA  1434
             ++PST            K N+      ++T  F+    +   G+ C+ L SA    +  +
Sbjct  152   VLPST------------KANVD---GTNVTDPFLNRSEMRRLGSDCRGLVSA----SIYS  192

Query  1433  NTTAVSLDIQVIELGWWLQGHCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGS  1254
             NT   +L +  +EL WW+QG C CS +A C+    P   K  FRC+C EGF GDGY  G+
Sbjct  193   NTAGPALQLTALELDWWVQGRCGCSSHAICDGFTPPSTQKEAFRCECQEGFEGDGYTAGA  252

Query  1253  GCRRDDTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAMKNWNR  1074
             GCRR   +CNP+KYL G CG   +IG+L+ GV  GA +M    L+  ++RRR A     +
Sbjct  253   GCRRV-PKCNPSKYLSGSCGKLVQIGLLVAGVFFGAMVMGITCLVYHLLRRRSAALRSQQ  311

Query  1073  RRRELRETTGITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIR  894
               + L      T+P Y+Y++I++ATN F++ +RLG GAYGTVY+G+L  N+  VA+KRI+
Sbjct  312   STKRLLSEASCTVPFYTYREIDRATNGFAEDQRLGTGAYGTVYAGRL-SNNRLVAVKRIK  370

Query  893   HRDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGS  714
              RD   ++ V NE+KL+SSV+H NLVRLLGC IE G+QILVYEFMPNGTL+QHLQRE+G 
Sbjct  371   QRDNAGLDCVMNEVKLVSSVSHRNLVRLLGCCIEHGQQILVYEFMPNGTLAQHLQRERGP  430

Query  713   GLPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGL-  537
              +PW VRL I  ET++AIAYLH+ +HPPIYHRD+KSSNILLD+ Y SKVADFGLSR G+ 
Sbjct  431   AVPWTVRLRIAVETAKAIAYLHSEVHPPIYHRDIKSSNILLDHEYNSKVADFGLSRMGMT  490

Query  536   -IESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEV  360
              ++SSHISTAPQGTPGY+DPQYHQ+FHLSDKSDVYSFGVVLVEIIT +KAVDF+R  +EV
Sbjct  491   SVDSSHISTAPQGTPGYVDPQYHQNFHLSDKSDVYSFGVVLVEIITAMKAVDFSRVGSEV  550

Query  359   NLAALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVA  180
             NLA LAVD+IGKG L +I+DP ++  +D WTL+S++KVAE+AFRCLAFH +MRPSM EVA
Sbjct  551   NLAQLAVDRIGKGSLDDIVDPYLDPHRDAWTLTSIHKVAELAFRCLAFHSEMRPSMAEVA  610

Query  179   IELEQMRLSKWG  144
              ELEQ+++S W 
Sbjct  611   DELEQIQVSGWA  622



>ref|XP_004142024.1| PREDICTED: wall-associated receptor kinase-like 14-like [Cucumis 
sativus]
Length=579

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/480 (61%), Positives = 365/480 (76%), Gaps = 14/480 (3%)
 Frame = -3

Query  1565  DCG--KDNISCFSEPHMTGGFIGYENLTGTGCKSLFSAISSPAAAANTTAVSLDIQVIEL  1392
             DCG   +N+SCF++    G F+   N     C SL S++     + +TT   ++  VIEL
Sbjct  11    DCGLKSNNMSCFTKTEQNG-FLPPLN----KCHSLLSSVFVNFTSNSTTQFEVEFGVIEL  65

Query  1391  GWWLQGH--CRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQG-GSGCRRDDTRCNP  1221
              WW+      +CSKNA+   + T      GFRCQC EGF G+ Y   G GCRR   +CNP
Sbjct  66    EWWVSPSSVAQCSKNANRENI-TSSTENLGFRCQCEEGFEGNAYDNDGGGCRRVSHKCNP  124

Query  1220  AKYLLGECGGKTRigvliggviagaaLMVSVGLIC-CIIRRRLAMKNWNRRRRELRETTG  1044
               Y+ G CGG++++  LI GVI GA LM  + LIC CI RR + +K     +R L E  G
Sbjct  125   PTYITGRCGGESKVAALIAGVIVGAFLMAVLTLICYCIRRRSMCLKGQMSAKRLLSEAAG  184

Query  1043  -ITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQ  867
               ++ +Y YK+IE+ATN FS+K+RLG GA+GTVY+G+LH+ DEWVA+KRI++RD +SI+Q
Sbjct  185   NSSVTLYPYKEIERATNGFSEKQRLGTGAFGTVYAGRLHE-DEWVAVKRIKYRDHNSIDQ  243

Query  866   VTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLG  687
             V NEIKLLSSV+HPNLVRLLGC IE+G+QILVYEFMPNGTLSQHLQRE+G+GLPW  RL 
Sbjct  244   VMNEIKLLSSVSHPNLVRLLGCCIEEGQQILVYEFMPNGTLSQHLQRERGNGLPWTTRLT  303

Query  686   IVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAP  507
             I +ETS+AIAYLH+++HPPIYHRD+KSSNILLD+ +KSKVADFGLSR G+ E SH+STAP
Sbjct  304   IAAETSRAIAYLHSSVHPPIYHRDIKSSNILLDHGFKSKVADFGLSRLGMTEISHVSTAP  363

Query  506   QGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIG  327
             QGTPGY+DPQYHQ+F+LSDKSDVYSFGVVLVEIIT LK VDFTRPQ+EVNLAALA+D+IG
Sbjct  364   QGTPGYVDPQYHQNFYLSDKSDVYSFGVVLVEIITALKVVDFTRPQSEVNLAALAIDRIG  423

Query  326   KGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKW  147
             +  + E+IDP +E  +D WTL S++KVAE+AFRCLAFH DMRPSM EVA ELE +R S W
Sbjct  424   RNSVDELIDPFLEPHRDAWTLYSIHKVAELAFRCLAFHSDMRPSMTEVAEELESIRRSGW  483



>ref|XP_002468238.1| hypothetical protein SORBIDRAFT_01g042280 [Sorghum bicolor]
 gb|EER95236.1| hypothetical protein SORBIDRAFT_01g042280 [Sorghum bicolor]
Length=714

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/615 (51%), Positives = 414/615 (67%), Gaps = 32/615 (5%)
 Frame = -3

Query  1907  AMVFGSSTCNRSCGDGLKQLPFPFGFSSGCEILLNC--TSNGTMSIGE-----FPVYQLT  1749
             A    + +C RSCG+   Q  +PFGFS GCEI L C   +NGT  +G        V+ +T
Sbjct  18    AAAASNGSCARSCGNLTVQ--YPFGFSPGCEIPLGCDDQANGTAWVGGARELGLLVHNVT  75

Query  1748  PDTIMINIPAKCGRRIEA-MKPLFGKNFAPTSNNGILLQNCS----SPELKCMIPSTMIQ  1584
                +++ +P  C R + A ++ LF +++AP S N +++  CS    S    C      + 
Sbjct  76    ARAVVLALPQDCSRGLNASIQALFSRSYAPGSQNALVVSKCSPASPSHTTNCSDGDRYLD  135

Query  1583  TQFELQDCGKDNISCF---SEPHMTGG----FIGYENLTG--TGCKSLFSAISSPAAAAN  1431
                +  +   + I C      P ++GG    F+    +    + C  L SA S   A A 
Sbjct  136   RSSQC-NTTAEPIRCVLPPGPPAISGGSDQRFLDRTEMRELVSECARLVSAASYWDAPAP  194

Query  1430  TTAVSLDIQVIELGWWLQGH-CRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGS  1254
               A +L + V+EL WW+ G  CRCS++A+CN + TP  G+  FRC+C EG+ GDG+  G+
Sbjct  195   APAPALLLGVMELEWWVVGETCRCSRHANCNRVTTPIAGQQAFRCECPEGYDGDGFADGT  254

Query  1253  GCRRDDTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAMKNWNR  1074
             GCRR   +CNP+KYL G+CG   +I +L+ G++ GA +M    L    ++RR A     R
Sbjct  255   GCRRA-PKCNPSKYLSGDCGKTIQITLLVAGIMFGAMVMGLTCLAYQFLKRRSAYIRTKR  313

Query  1073  RRRELRETTGITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIR  894
               +         +P+YSY++IE+AT  FS+++RLG GAYGTVY+G+L D D  VA+KRIR
Sbjct  314   STKRFLSEASCAVPLYSYREIERATGGFSEEKRLGTGAYGTVYAGRLSD-DRQVAVKRIR  372

Query  893   HRDTDS-IEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKG  717
              RD    ++ V NE+KLLS V H NLVRLLGC IE+G+QILVYEFMPNGTL+QHLQRE+G
Sbjct  373   PRDNGGGVDCVVNEVKLLSCVCHGNLVRLLGCCIEQGQQILVYEFMPNGTLAQHLQRERG  432

Query  716   SG-LPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFG  540
             +  +PW VRL I +ET++AIAYLH+ +HPPIYHRDVKSSNILLDY Y SKVADFGLSR G
Sbjct  433   AAAMPWTVRLRIAAETAKAIAYLHSEVHPPIYHRDVKSSNILLDYEYNSKVADFGLSRMG  492

Query  539   ---LIESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQ  369
                + +SSHISTAPQGTPGY+DPQYHQ+FHLSD+SDVYSFGVVLVEIIT +KAVDF R  
Sbjct  493   NMGMGDSSHISTAPQGTPGYVDPQYHQNFHLSDRSDVYSFGVVLVEIITAMKAVDFARAP  552

Query  368   NEVNLAALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMM  189
             +EVNLA LAVD+IG+G + +I+DP ++  +D WTLSS++KVAE+AFRCLAFH +MRPSM 
Sbjct  553   SEVNLAQLAVDRIGRGCVDDIVDPYLDPHRDAWTLSSIHKVAELAFRCLAFHSEMRPSMT  612

Query  188   EVAIELEQMRLSKWG  144
             EVA ELEQ++LS W 
Sbjct  613   EVADELEQIQLSGWA  627



>ref|XP_008652965.1| PREDICTED: wall-associated receptor kinase-like 14 [Zea mays]
 tpg|DAA44174.1| TPA: putative WAK-related receptor-like protein kinase family 
protein [Zea mays]
Length=710

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/611 (50%), Positives = 407/611 (67%), Gaps = 35/611 (6%)
 Frame = -3

Query  1895  GSSTCNRSCGDGLKQLPFPFGFSSGCEILLNCT-SNGTMSIGE-----FPVYQLTPDTIM  1734
             G+ +C RSCG GL  + +PFGFS GCEI L C  ++GT  +G+       V  +T   + 
Sbjct  24    GNGSCARSCG-GLT-VQYPFGFSPGCEIRLGCDPADGTAWLGKTRELGLLVSNVTARALF  81

Query  1733  INIPAKCGRRIEA-MKPLFGKNFAPTSNNGILLQNCSSPE-----LKCMIP-STMIQTQF  1575
             + +   C RR+ A ++ LF K +AP S NG+++ +CSS         C +P S  +    
Sbjct  82    LTLRPNCSRRLNASVEALFTKAYAPGSQNGLVVSSCSSASQADHIRNCSVPPSAYLDNSS  141

Query  1574  ELQDCGKDNISC--FSEP-HMTGGFIGYENLTGTG--CKSLFSAISSPAAAANTTAVSLD  1410
             +      D+I C   + P  +   F+    +      C  L SA+S      +  A +L 
Sbjct  142   QCGRAAADSIRCPVLTRPTSVPDRFLNRTRMQALAAECTGLVSAVSY----LDAPAPALL  197

Query  1409  IQVIELGWWLQGHCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTR  1230
             +  +EL WW+ G CRCS +A+C  + TP  G+  FRC C +G  GDG+  G GCR +  +
Sbjct  198   LATMELEWWMLGPCRCSSHANCTQVTTPVAGQEAFRCDCPKGSEGDGFAEGVGCR-EGPK  256

Query  1229  CNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAMKNWNRRRRELRET  1050
             CNP+KYL G+CG   +I +L+ G++ GA +     L   +++RR A     R  ++    
Sbjct  257   CNPSKYLQGDCGKTIQIVLLVAGIMFGAMVTGVTCLAYQLLKRRSASIRMKRSTKQFLSE  316

Query  1049  TGITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDS-I  873
                T+P+YSY++IE+AT  FS+++RLG GAYGTVY G+L D D  VA+KRIR  D    +
Sbjct  317   ASCTVPLYSYREIERATGGFSEEKRLGTGAYGTVYEGRLSD-DRLVAVKRIRPSDNGGGV  375

Query  872   EQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKG-SGLPWPV  696
             + V NE+KLLS V H NLVRLLGC IE+G+QILVYEFMPNGTL+QHLQRE+G + +PW V
Sbjct  376   DSVVNEVKLLSCVCHRNLVRLLGCCIEQGQQILVYEFMPNGTLAQHLQRERGPAAMPWTV  435

Query  695   RLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIES----  528
             RL I +ET++A+AYLH+ +HPPIYHRD+KSSNILLD+ Y SKVADFGLSR G   S    
Sbjct  436   RLRIAAETAKAVAYLHSEVHPPIYHRDIKSSNILLDFEYNSKVADFGLSRMGKASSPSSV  495

Query  527   ---SHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVN  357
                SHISTAPQGTPGY+DPQYHQ+FHLSD+SDVYSFGVVLVEIIT +KAVDFTR  +EVN
Sbjct  496   GDPSHISTAPQGTPGYVDPQYHQNFHLSDRSDVYSFGVVLVEIITAMKAVDFTRVPSEVN  555

Query  356   LAALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAI  177
             LA LAVD+IG+G + +I+DP ++  +D WTLSS++KVAE+AFRCLAFH +MRPSM EVA 
Sbjct  556   LAQLAVDRIGRGRVDDIVDPYLDPHRDAWTLSSIHKVAELAFRCLAFHSEMRPSMTEVAD  615

Query  176   ELEQMRLSKWG  144
             ELEQ++ S W 
Sbjct  616   ELEQIQRSGWA  626



>ref|XP_004985141.1| PREDICTED: wall-associated receptor kinase-like 14-like [Setaria 
italica]
Length=714

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/612 (51%), Positives = 404/612 (66%), Gaps = 30/612 (5%)
 Frame = -3

Query  1907  AMVFGSSTCNRSCGDGLKQLPFPFGFSSGCEILLNC----TSNGTMSIGE-----FPVYQ  1755
             A   G+ +C RSCG GL  + +PFGFS GCEI L C       GT  +G        V  
Sbjct  22    AAAAGNGSCARSCG-GLT-VQYPFGFSPGCEIPLGCDDQKNGTGTAWLGAERGLGLLVSN  79

Query  1754  LTPDTIMINIPAKCGRRIEA-MKPLFGKNFAPTSNNGILLQNC--SSPELKCMIPSTMI-  1587
             +T   + + +   C RR+ A +K LF +N+AP   N +L+ +C  ++    C +P     
Sbjct  80    VTARALFLALLPDCSRRLNASVKELFSENYAPGPQNTLLVSSCNLAARTNNCSVPPATYL  139

Query  1586  --QTQFELQDCGKDNISCFSEPHMTGGFIGYE-NLTGTGCKSLFSAISSPAAAANTTAVS  1416
                +         +N SC   P         E    G+ C  L SA S  A+ A T A+ 
Sbjct  140   NHSSSHCFHGAKAENFSCVHPPSGNRFLNKTEIRALGSECTGLVSAASYWASPAPTPAIL  199

Query  1415  LDIQVIELGWWLQGHCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRR--  1242
             L   V+EL WW+ G C C+ NA+C  + TP D +  FRC C EGF GDG+  G+GCRR  
Sbjct  200   LG--VMELEWWMLGPCSCAPNANCIAVSTP-DSRQAFRCDCIEGFEGDGFPDGTGCRRVS  256

Query  1241  -DDTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAMKNWNRRRR  1065
               + RCNP+KYL  +CG   +I +L+ G++ GA +     ++  +++RR A     R  +
Sbjct  257   VPNARCNPSKYLAEDCGKTAQIALLVAGIVFGAMVTCVTCVVYQLLKRRSASIRTKRSTK  316

Query  1064  ELRETTGITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRD  885
              L       +P YSY++I++AT+ FSD +RLG GAYGTVY+G+L D    VA+KRIR RD
Sbjct  317   RLLSEASCAVPFYSYREIDRATDGFSDAKRLGTGAYGTVYAGRLGDG-PLVAVKRIRQRD  375

Query  884   TDS-IEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKG-SG  711
              D+ +  V +E+KL+S V HPNLVRLLGC IE+G QILVYEFMPNGTL+QHLQRE+G + 
Sbjct  376   NDAGLGCVMHEVKLVSCVCHPNLVRLLGCCIEQGHQILVYEFMPNGTLAQHLQRERGPAA  435

Query  710   LPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFG---  540
             +PW VRL I +ET++AIAYLH+ + PPIYHRDVKSSNILLD+ Y SKVADFGLSR G   
Sbjct  436   MPWTVRLRIAAETAKAIAYLHSEVDPPIYHRDVKSSNILLDHEYNSKVADFGLSRLGKAS  495

Query  539   LIESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEV  360
             L +SSHISTAPQGTPGY+DPQYHQ+FHLSD+SDVYSFGVVLVEIIT +KAVD  RP +EV
Sbjct  496   LGDSSHISTAPQGTPGYVDPQYHQNFHLSDRSDVYSFGVVLVEIITAMKAVDLNRPPSEV  555

Query  359   NLAALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVA  180
             NLA LAVD+IG+G + +I+DP ++  +D WTLSS++KVAE+AFRCLAFH +MRPSM EVA
Sbjct  556   NLAQLAVDRIGRGRVDDIVDPYLDPHRDAWTLSSIHKVAELAFRCLAFHSEMRPSMAEVA  615

Query  179   IELEQMRLSKWG  144
              EL+Q++ S W 
Sbjct  616   DELDQVQRSGWA  627



>ref|XP_010550388.1| PREDICTED: wall-associated receptor kinase-like 21 [Tarenaya 
hassleriana]
Length=583

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/580 (52%), Positives = 399/580 (69%), Gaps = 29/580 (5%)
 Frame = -3

Query  1850  LPFPFGFSSGCE-ILLNCTSNGTMSIGEFPVYQLTPDTIMINIPAKCGRRIEAMKPLFGK  1674
             + +PFG S+    I  NC++NG   IG+F V ++T  +I + I  KC R I  ++ LFG+
Sbjct  1     MRYPFGNSTDSSPIRFNCSANGIAKIGQFHVEEVTETSITVGIRPKCNRTIGKIERLFGE  60

Query  1673  NFAPTSN-NGILLQNCSSPELKCMIPSTMIQTQFELQDC-GKDNISCFSEPH---MTGGF  1509
             N+AP+ N N ILLQ C  P   C+I    I+ +  L  C   +N+SCFS      +    
Sbjct  61    NYAPSRNQNIILLQECEKPFDSCIIRRKFIENRLNLNRCKSANNVSCFSSSEGGVIMADV  120

Query  1508  IGYENLTG-TGCKSLFSAISSPAAAANTTAVSLDIQVIELGWWLQGHC---RCSKNADCN  1341
             + ++++   + CK  FS+I+S ++    + VSL+ + ++L WWL+G C    CS+N  C 
Sbjct  121   MSFDDIVNRSQCKFWFSSITSESSDG-YSEVSLEFERVKLSWWLKGGCGNTTCSENTKCT  179

Query  1340  TMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTRCNPAKYLLGECGGKTRigvligg  1161
              ++   DG  G RC C +GF GD   GG        RC  A   LG   G  R+ VL  G
Sbjct  180   VVKL-SDGAVGHRCSCLDGFHGDDLGGG--------RCRGASNGLG---GSVRVIVLGAG  227

Query  1160  viagaaLMVSVGLIC-CIIRRRLAMKNWNRRRRELRETTG-ITIPVYSYKDIEKATNNFS  987
             ++ GA LMV +  IC C+ +R ++ ++ +  +R L E  G  ++P Y++K+IEKAT+ FS
Sbjct  228   IVFGALLMVVLIAICFCLQKRFVSSRSLSIAKRLLCEVAGNSSVPFYTFKEIEKATDGFS  287

Query  986   DKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIKLLSSVNHPNLVRLL  807
             D+ +LG GAYGTVY+GKL  N    A+KR+R RDT SI+QV NEIKLLSSVNHPNLVRLL
Sbjct  288   DQNKLGTGAYGTVYAGKLA-NGSRGAVKRLRRRDTKSIDQVVNEIKLLSSVNHPNLVRLL  346

Query  806   GCSIEKGEQILVYEFMPNGTLSQHLQREKGSG-LPWPVRLGIVSETSQAIAYLHNAMHPP  630
             GC I  GE ILVYEFMPNGTLSQHLQRE G+  LP  +RL I S+T+ AIA+LH++++PP
Sbjct  347   GCCIAHGEPILVYEFMPNGTLSQHLQREGGNAPLPLRLRLAIASQTANAIAHLHSSVNPP  406

Query  629   IYHRDVKSSNILLDYNYKSKVADFGLSRFGLIE--SSHISTAPQGTPGYLDPQYHQDFHL  456
             IYHRD+KSSNILLDY++ SK++DFGLSR G+ E  +SHISTAPQGTPGYLDPQYHQDF L
Sbjct  407   IYHRDIKSSNILLDYSFNSKISDFGLSRLGMTEFDASHISTAPQGTPGYLDPQYHQDFQL  466

Query  455   SDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLEIIDPLIEAEKD  276
             SDKSDVYSFGVVLVEII+ +K +DF+RP +EVNLAALAVD+IG+G + EI+DP ++ E D
Sbjct  467   SDKSDVYSFGVVLVEIISAMKVIDFSRPFSEVNLAALAVDRIGQGRVEEIVDPYLKTETD  526

Query  275   VWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRL  156
                   V   AE+AFRCL+FHRDMRP+M EVA EL+++R+
Sbjct  527   PRKFGYVQNAAELAFRCLSFHRDMRPTMTEVAEELQRIRV  566



>dbj|BAK05177.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=721

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/620 (48%), Positives = 402/620 (65%), Gaps = 44/620 (7%)
 Frame = -3

Query  1895  GSSTCNRSCGDGLKQLPFPFGFSSGCEILLNCTSN----------GTMSIGEFPVYQLTP  1746
             G+ +C RSCG     LP+PFGFSSGC I L+C             G   +G   V  +TP
Sbjct  22    GNGSCVRSCG--AMTLPYPFGFSSGCTIRLSCDVGIDGVGAAWLGGARELGLL-VRNVTP  78

Query  1745  DTIMINIPAKCGRRIEA-MKPLFGKNFAPTSNNGILLQNCSSPEL----KCMIPSTMIQT  1581
               +++N+   C R   A ++ LF  ++AP S N +++ +CSS E      C         
Sbjct  79    RALILNLHPDCSRSFNASIEALFSDSYAPASGNTLVVSSCSSSEADHIKNCSSEPPDPYM  138

Query  1580  QFELQDC-GKDNISCF---------SEPHMTGGFIGYENLTGT-----GCKSLFSAISSP  1446
                   C   ++I C            P  T   IG+  L  +      C  L SA+S  
Sbjct  139   DMPSSHCTANESIRCILPQRPSNASGLPLRTNNTIGHHLLNRSEILRYNCTGLVSAVSYS  198

Query  1445  AAAANTTAVSLDIQVIELGWWLQGHCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGY  1266
              A       SL +  +EL WW+ G C+C + A+C           GF+C C EG  GDG+
Sbjct  199   EAQGP----SLLLGALELDWWVPGRCQCDRRANCTQFPATKTRPEGFQCDCPEGLHGDGF  254

Query  1265  QGGSGCRR-DDTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAM  1089
               G+GCR    ++CNP+KYL  +CG    + +++ G+I GA +M    ++C I++RR A 
Sbjct  255   VDGTGCREVSKSKCNPSKYLSRDCGKIILVALIMAGIIFGAMVMGISCVVCHILKRRSAS  314

Query  1088  KNWNRRRRELRETTGITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVA  909
                 +  + L       +P+YSY++IE+AT+ FS+  RLG GAYGTVY+G+L DN   VA
Sbjct  315   IRSQQSTKRLLSEADCAVPLYSYREIERATSGFSEDHRLGTGAYGTVYAGRLSDN-RLVA  373

Query  908   IKRIRHRDT--DSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQH  735
             +KRI+HRD     ++ V NE+KL+SSV+H +LVRLLGC IE+G+QILVYEFMPNGTL+QH
Sbjct  374   VKRIKHRDNADGGLDSVMNEVKLVSSVSHRHLVRLLGCCIEQGQQILVYEFMPNGTLAQH  433

Query  734   LQREKGS-GLPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADF  558
             LQRE+G   +PW VRL + +ET++AIAYLH+ +HPPIYHRD+KSSNILLD+ Y SKVADF
Sbjct  434   LQRERGRPAVPWTVRLRMAAETAKAIAYLHSDVHPPIYHRDIKSSNILLDHGYNSKVADF  493

Query  557   GLSRFGL--IESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVD  384
             GLSR G+  ++SSHISTAPQGTPGY+DPQYHQ+FHLSDKSDVYSFGVVLVEIIT +KAVD
Sbjct  494   GLSRMGMTSVDSSHISTAPQGTPGYVDPQYHQNFHLSDKSDVYSFGVVLVEIITAMKAVD  553

Query  383   FTRPQNEVNLAALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDM  204
             F+R  +EVNLA LAV+KI +G + +I+DP ++  +D WTL+S++KVAE+AFRCLAFH ++
Sbjct  554   FSRGPSEVNLAQLAVEKIARGCVDDIVDPFLDLHRDAWTLTSIHKVAELAFRCLAFHSEI  613

Query  203   RPSMMEVAIELEQMRLSKWG  144
             RPSM EVA ELEQ+++S W 
Sbjct  614   RPSMAEVADELEQIQVSGWA  633



>gb|EEE58629.1| hypothetical protein OsJ_09989 [Oryza sativa Japonica Group]
Length=686

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/612 (49%), Positives = 393/612 (64%), Gaps = 73/612 (12%)
 Frame = -3

Query  1883  CNRSCGDGLKQLPFPFGFSSGCEILLNCT-SNGTM-----SIGEFPVYQLTPDTIMINIP  1722
             C +SCG    ++P+PFGFS GC + L C  ++GT            V  +TP  I++ +P
Sbjct  34    CTQSCGR--MRVPYPFGFSRGCTVQLGCDDASGTAWLGGTRGLGLLVSNVTPRAIVLTLP  91

Query  1721  AKCGRRI-EAMKPLFGKNFAPTSNNGIL-----------LQNCSSP----------ELKC  1608
               C R + E++  LF  N+APT+ N ++           L NCS P           ++C
Sbjct  92    PNCSRPLNESLDALFTDNYAPTAQNALVVSSCDPQAAARLSNCSIPPEAYLEKSCNSIRC  151

Query  1607  MIPSTMIQTQFELQDCGKDNISCFSEPHMTGGFIGYENLT--GTGCKSLFSAISSPAAAA  1434
             ++PST            K N+      ++T  F+    +   G+ C+ L SA    +  +
Sbjct  152   VLPST------------KANVD---GTNVTDPFLNRSEMRRLGSDCRGLVSA----SIYS  192

Query  1433  NTTAVSLDIQVIELGWWLQGHCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGS  1254
             NT   +L +  +EL WW+QG C CS +A C+    P   K  FRC+C EGF GDGY  G+
Sbjct  193   NTAGPALQLTALELDWWVQGRCGCSSHAICDGFTPPSTQKEAFRCECQEGFEGDGYTAGA  252

Query  1253  GCRRDDTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAMKNWNR  1074
             GCRR   +CNP+KYL G CG   +IG+L+ GV  GA +M    L+  ++RRR A     +
Sbjct  253   GCRRV-PKCNPSKYLSGSCGKLVQIGLLVAGVFFGAMVMGITCLVYHLLRRRSAALRSQK  311

Query  1073  RRRELRETTGITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIR  894
               + L      T+P Y+Y++I++ATN F++ +RLG GA  +  +        W A     
Sbjct  312   STKRLLSEASCTVPFYTYREIDRATNGFAEDQRLGTGAGSSSAT-----TPGWTA-----  361

Query  893   HRDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGS  714
                      V NE+KL+SSV+H NLVRLLGC IE G+QILVYEFMPNGTL+QHLQRE+G 
Sbjct  362   ---------VMNEVKLVSSVSHRNLVRLLGCCIEHGQQILVYEFMPNGTLAQHLQRERGP  412

Query  713   GLPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGL-  537
              +PW VRL I  ET++AIAYLH+ +HPPIYHRD+KSSNILLD+ Y SKVADFGLSR G+ 
Sbjct  413   AVPWTVRLRIAVETAKAIAYLHSEVHPPIYHRDIKSSNILLDHEYNSKVADFGLSRMGMT  472

Query  536   -IESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEV  360
              ++SSHISTAPQGTPGY+DPQYHQ+FHLSDKSDVYSFGVVLVEIIT +KAVDF+R  +EV
Sbjct  473   SVDSSHISTAPQGTPGYVDPQYHQNFHLSDKSDVYSFGVVLVEIITAMKAVDFSRVGSEV  532

Query  359   NLAALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVA  180
             NLA LAVD+IGKG L +I+DP ++  +D WTL+S++KVAE+AFRCLAFH +MRPSM EVA
Sbjct  533   NLAQLAVDRIGKGSLDDIVDPYLDPHRDAWTLTSIHKVAELAFRCLAFHSEMRPSMAEVA  592

Query  179   IELEQMRLSKWG  144
              ELEQ+++S W 
Sbjct  593   DELEQIQVSGWA  604



>ref|XP_006393874.1| hypothetical protein EUTSA_v10003840mg [Eutrema salsugineum]
 gb|ESQ31160.1| hypothetical protein EUTSA_v10003840mg [Eutrema salsugineum]
Length=613

 Score =   535 bits (1378),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 286/620 (46%), Positives = 392/620 (63%), Gaps = 50/620 (8%)
 Frame = -3

Query  1934  VLILLLLQSAMVFGSSTCNRSCGDGLKQLPFPFGFSSGCEILLNCTS-NGTMSIGEFPVY  1758
             +++  L  +    GS  C  S       L +PFGFS G  I  NC+   G   IGEF V 
Sbjct  14    IVVFTLTVATPTTGSVNCQTS------SLRYPFGFSDGYPIRFNCSKKTGDAEIGEFVVE  67

Query  1757  QLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPT-SNNGILLQNCSSPELKCMIPSTMIQT  1581
             ++T   I + IP  C R I  ++ LF +N AP+ S N IL+Q C      C+I +  ++ 
Sbjct  68    EVTNANIYVKIPPICKRDILKIEQLFLENLAPSNSRNIILVQGCKEQSSDCLIRTRFVED  127

Query  1580  QFELQDCGKDNISCFSEPHMTGGFIGYENLTGT-GCKSLFSAISSPAAAANTTAVSLDIQ  1404
             +  +  C K  +SC          +   ++  + GCK  FS+I+  +  + +   S+++ 
Sbjct  128   RLNISRC-KSPVSCLHGATTMADVMSIGDVVNSSGCKYWFSSITPQSTNSKSQGGSMNLG  186

Query  1403  VIELGWWLQGHC-----RCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRD  1239
              + L WWL+  C      CS NA C  ++ P +G  G RC C +GF G+ +    GCR  
Sbjct  187   RLRLDWWLKERCDNNNTTCSDNATCTNVKLP-NGGFGHRCTCLQGFRGNAFTVHGGCRLV  245

Query  1238  DTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAMKNWNRR----  1071
               R    K ++   GG                  V +G++  I    +A  N ++R    
Sbjct  246   GKRKGVHKLIVLATGG------------------VLIGVVSLIAILVVAYINHHKRSASS  287

Query  1070  ------RRELRETTG-ITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWV  912
                    R L E  G  ++P Y+YK+IEKAT+NFS+K +LG GAYGTVY+G+   N  WV
Sbjct  288   SKTSMANRLLSELDGNSSVPFYTYKEIEKATDNFSEKNKLGTGAYGTVYAGEFQ-NMSWV  346

Query  911   AIKRIRHRDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHL  732
             AIKR+R +D+ SI+QV NEIKLLS+V+HPNLVRLLGC I +GE  LVYEFMPNGTLSQHL
Sbjct  347   AIKRLRRKDSKSIDQVANEIKLLSTVSHPNLVRLLGCCISQGEPFLVYEFMPNGTLSQHL  406

Query  731   QREKG-SGLPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFG  555
             Q E+G + L WP+RL I S+T+ AIA+LH++M+PPIYHRD+KSSNILLDY + SK++DFG
Sbjct  407   QHERGHTPLSWPLRLAIASQTANAIAHLHSSMNPPIYHRDIKSSNILLDYEFNSKISDFG  466

Query  554   LSRFGL---IESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVD  384
             LSR G+    ++SHISTAPQGTPGYLDPQYHQDF LSDKSDVYSFGVVL+EII+G K +D
Sbjct  467   LSRLGMSTDFDASHISTAPQGTPGYLDPQYHQDFQLSDKSDVYSFGVVLIEIISGFKVID  526

Query  383   FTRPQNEVNLAALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDM  204
             FTR   EVNLA+LA+D+IG+G +++IIDP ++A+ D    +SV  VAE+AFRCL+FHR+M
Sbjct  527   FTRSYTEVNLASLALDRIGRGLVVDIIDPCLKADNDPEMFASVQNVAELAFRCLSFHRNM  586

Query  203   RPSMMEVAIELEQMRLSKWG  144
             RP+M+EV  +L++++L  +G
Sbjct  587   RPTMIEVTEDLQRIKLMYFG  606



>ref|XP_002866737.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42996.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=612

 Score =   534 bits (1375),  Expect = 9e-179, Method: Compositional matrix adjust.
 Identities = 291/611 (48%), Positives = 394/611 (64%), Gaps = 36/611 (6%)
 Frame = -3

Query  1937  PVLILLLLQSAMVFGSSTCNRSCGDGLKQLPFPFGFSSGCEILLNCTS-NGTMSIGEFPV  1761
             P L+ +   +  V   +T +  C  G   L +PFGFS G  I  NC+   G   IGEF V
Sbjct  7     PYLVFVFFFTLAVATQTTGSVKCKTG--SLSYPFGFSDGYPIRFNCSEITGEAVIGEFAV  64

Query  1760  YQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTS-NNGILLQNCSSPELKCMIPSTMIQ  1584
              ++T   I + IP  C R I  ++ LF +NFAP+   N IL+Q C+     C+I S  ++
Sbjct  65    QEVTNTNIYVKIPPVCERGIGKIEQLFRENFAPSKLQNIILVQGCTEHSFDCLIRSKFVE  124

Query  1583  TQFELQDCGKDNISCFSEPHMTG----GFIGYENLTGTGCKSLFSAISSPAAAANTTAVS  1416
              +  +  C K  +SCF+    T       IG + + G+GCK  FS+IS    + N   + 
Sbjct  125   DRLNISRC-KSQVSCFNGTTTTTIADVMSIG-DVVNGSGCKYWFSSISQSQVSVNLGRLK  182

Query  1415  LDIQVIELGWWLQGHCR---CSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCR  1245
             LD       WWL+G C    CS+NADC  ++   DG  G RC C EGF+G  +    GC 
Sbjct  183   LD-------WWLKGSCSNITCSENADCANVKL-ADGGLGHRCTCREGFSGKAFTVPGGCH  234

Query  1244  RDDTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAMKNWNRRRR  1065
             R          L+ +  G  ++ VL    I    L+++V ++  I R + + +     R 
Sbjct  235   R----------LVRKRKGLHKLIVLGTAGILVGVLVIAVLIVTYIFRNKRSARTSIANRL  284

Query  1064  ELRETTGITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRD  885
                     ++P Y+YK+IEKAT++FSDK  LG GAYGTVY+G+   N   VAIKR+RH+D
Sbjct  285   LCELAGNSSVPFYTYKEIEKATDSFSDKNMLGTGAYGTVYAGEF-PNSSCVAIKRLRHKD  343

Query  884   TDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKG-SGL  708
             T SI+QV NEIKLLSSV+HPNLVRLLGC    GE  LVYEFMPNGTL QHLQ E+G + L
Sbjct  344   TTSIDQVVNEIKLLSSVSHPNLVRLLGCCFADGEPFLVYEFMPNGTLYQHLQHERGQTPL  403

Query  707   PWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGL---  537
              WP+RL I  +T+ AIA+LH++++PPIYHRD+KSSNILLD+ Y SK++DFGLSR G+   
Sbjct  404   SWPLRLAIACQTANAIAHLHSSVNPPIYHRDIKSSNILLDHEYNSKISDFGLSRLGMSTD  463

Query  536   IESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVN  357
              E+SHISTAPQGTPGY+DPQYHQDF LSDKSDVYSFGVVL+EII+G K +DFTRP  EVN
Sbjct  464   FEASHISTAPQGTPGYVDPQYHQDFQLSDKSDVYSFGVVLIEIISGFKVIDFTRPYTEVN  523

Query  356   LAALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAI  177
             LA+LAVD+IGKG +++IIDP ++ + D    +S++ +AE+AFRCL+FHR+MRP+M+E+  
Sbjct  524   LASLAVDRIGKGRVVDIIDPCLKTDIDPKMFASIHNLAELAFRCLSFHRNMRPTMIEITE  583

Query  176   ELEQMRLSKWG  144
             +L++++L  +G
Sbjct  584   DLQRIKLMYFG  594



>emb|CDY53844.1| BnaA07g37390D [Brassica napus]
Length=617

 Score =   532 bits (1371),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 290/614 (47%), Positives = 395/614 (64%), Gaps = 38/614 (6%)
 Frame = -3

Query  1937  PVLILLLLQSAMVFGSSTCNRSCGDGLKQLPFPFGFSSGCEILLNCTS-NGTMSIGEFPV  1761
             P LI L   +  V   + C+ +C  G   LP+PFGF+ G  I  NC+      +IGEF V
Sbjct  5     PYLIFLFF-TLTVAAQTICSVNCQPG--SLPYPFGFTDGYPIRFNCSKKTDEAAIGEFAV  61

Query  1760  YQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPT-SNNGILLQNCSSPELKCMIPSTMIQ  1584
              ++T   I + IP  C R I  ++ LF  NFAP+ S N IL+Q C+     C I  + +Q
Sbjct  62    AEVTNANIYVKIPPLCKRDIRKIEQLFRHNFAPSLSQNTILVQGCNESSSDCSIGRSFVQ  121

Query  1583  TQFELQDCGKDNISCF-SEPHMTGGFIGYENLTG-TGCKSLFSAISSPAAAANTTAVSLD  1410
              +  L  C    + C  +   +    +   N+   +GCK  FS+I+  + +  +  +   
Sbjct  122   DRLNLSSC-ISQVRCLDAATEIKADVMSVVNVVNRSGCKYWFSSITPQSKSRGSVNL---  177

Query  1409  IQVIELGWWLQGHCR---CSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRD  1239
             +  + L WWL+  C    CS NA C T+   G G  G RC C +GF G+ +    GCR  
Sbjct  178   LGQLRLDWWLKEGCSSTTCSANASCTTVNI-GGGGFGHRCTCDDGFYGNAFNVHGGCRP-  235

Query  1238  DTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAMKNW-----NR  1074
                       +G+  G     +++G  I   A ++++ +   I R + +  +      NR
Sbjct  236   ----------VGKRKGLLHKLIVLGIAILVGASLIAILIFAFIYRHKRSTSSSRSSLANR  285

Query  1073  RRRELRETTGITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIR  894
                EL   +  ++P Y+YK++EKAT+NFSDK +LG GAYGTVY+G+   N  WVAIKR+R
Sbjct  286   LFCELAGNS--SVPFYTYKELEKATDNFSDKNKLGTGAYGTVYAGEF-PNSSWVAIKRLR  342

Query  893   HRDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGS  714
              +DT SI+QV NEIKLLSSV+HPNLVRLLGC + +GE ILVYEFMPNGTLSQHLQ E+G 
Sbjct  343   RKDTPSIDQVVNEIKLLSSVSHPNLVRLLGCCVAQGEPILVYEFMPNGTLSQHLQHERGH  402

Query  713   G-LPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGL  537
               L WP+RL I S+T+ AIA+LH++++PPIYHRD+KSSNILLDY + SKV+DFGLSR G+
Sbjct  403   APLSWPLRLSIASQTANAIAHLHSSVNPPIYHRDIKSSNILLDYEFNSKVSDFGLSRLGM  462

Query  536   ---IESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQN  366
                 + SHISTAPQGTPGYLDPQYHQDF LSDKSDVYSFGVVL+EII+G K +DFTRP  
Sbjct  463   STDFDVSHISTAPQGTPGYLDPQYHQDFQLSDKSDVYSFGVVLIEIISGFKVIDFTRPFT  522

Query  365   EVNLAALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMME  186
             EVNLAALA+D+IG+G +++IIDP ++   D    SSV  +AE+AFRCL+FHR+MRP+M+E
Sbjct  523   EVNLAALAIDRIGRGRVVDIIDPSLQTVNDPKMFSSVQNLAELAFRCLSFHRNMRPTMIE  582

Query  185   VAIELEQMRLSKWG  144
             VA ++++++L  +G
Sbjct  583   VAEDIQRIKLMYFG  596



>ref|XP_008347439.1| PREDICTED: wall-associated receptor kinase-like 14 [Malus domestica]
Length=510

 Score =   527 bits (1358),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 285/449 (63%), Positives = 341/449 (76%), Gaps = 23/449 (5%)
 Frame = -3

Query  1289  EGFTGDGYQGGSGCRRDDTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCI  1110
             E F+ DG    S      + CNPAKYL G+CGGK+R  +LIG V  GA+LM+SV L+CC 
Sbjct  45    EAFS-DGIPLVSELESVSSTCNPAKYLSGQCGGKSRFILLIGAVFVGASLMISVALLCCF  103

Query  1109  IRRRLAMKNWNRRRRELRETTG-ITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKL  933
             IRRR  +K  +  +R L   TG   IP YSYK+IEKATN+FSDK+RLG+GAYGTVY+GKL
Sbjct  104   IRRRSKLKARHSTKRLLSAATGNCNIPFYSYKEIEKATNSFSDKQRLGNGAYGTVYAGKL  163

Query  932   HDNDEWVAIKRIRHRDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPN  753
             HD  EWVAIKRI+HR  +S++QV NEIKL+SSV HPNLV+LLGCSIE GEQILVYEFM N
Sbjct  164   HD--EWVAIKRIKHRGHESMDQVMNEIKLISSVRHPNLVQLLGCSIEHGEQILVYEFMEN  221

Query  752   GTLSQHLQREKGSGLPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKS  573
             GTL QHLQRE+G GL W  RL I +ET+QAI++LH+A +PPIYHRD+KSSNILLD  ++S
Sbjct  222   GTLCQHLQRERGEGLSWLSRLNIAAETAQAISHLHSASNPPIYHRDIKSSNILLDCKFRS  281

Query  572   KVADFGLSRFGLIESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLK  393
             KVADFGLSR G++E+SHISTAPQGTPGYLDPQYHQ+FHLSDKSDVYSFGVVL EII+GLK
Sbjct  282   KVADFGLSRLGMVETSHISTAPQGTPGYLDPQYHQNFHLSDKSDVYSFGVVLAEIISGLK  341

Query  392   AVDFTRPQNEVNLAALAVDKIGKGGLLEIIDPLIE-AEKDVWTLSSVNKVAEIAFRCLAF  216
             AVDF RP +EVNLAALA D+IG+  L EIIDP +E    D WTLSSV KVAE+AFRCLAF
Sbjct  342   AVDFNRPPDEVNLAALATDRIGRACLNEIIDPFLEPCMDDAWTLSSVQKVAELAFRCLAF  401

Query  215   HRDMRPSMMEVAIELEQMRLSKW-GIsedsiitassssssrsssdasEKPLSFS------  57
             HRDMRP+M+EV  ELE ++LS+W    E++   +S  SS  S S  SEKPLS +      
Sbjct  402   HRDMRPTMIEVTAELELIKLSRWPSSEENTYTASSEGSSHCSPSSVSEKPLSITKSRSLR  461

Query  56    -----------TMKPSEKVTESSPVSVQD  3
                        +   SEK+ ++SPV+ QD
Sbjct  462   SVIALQNGDAGSFNSSEKLRDNSPVTFQD  490



>ref|XP_006280180.1| hypothetical protein CARUB_v10026084mg [Capsella rubella]
 gb|EOA13078.1| hypothetical protein CARUB_v10026084mg [Capsella rubella]
Length=623

 Score =   530 bits (1365),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 296/620 (48%), Positives = 399/620 (64%), Gaps = 44/620 (7%)
 Frame = -3

Query  1937  PVLILLLL------QSAMVFGSSTCNRSCGDGLKQLPFPFGFSSGCEILLNCT-SNGTMS  1779
             P L+ L L       +A   GS  C          L +PFG S G  I  NC+ + G   
Sbjct  7     PYLVFLFLFCFTLSVAAQTIGSVKCKTG------SLRYPFGLSDGYPIRFNCSKTTGDAL  60

Query  1778  IGEFPVYQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSN-NGILLQNCSSPELKCMI  1602
             IGEF V ++T   I + IP  C R+I  ++ LF +N AP+S+ N IL Q C      C+I
Sbjct  61    IGEFSVQEVTNANIYVTIPPVCKRKIGIIEQLFRENLAPSSSQNIILFQGCKEQSFNCLI  120

Query  1601  PSTMIQTQFELQDCGKDNISCFSEPHMTGGF----IGYENLTGTGCKSLFSAISSPAAAA  1434
                 ++ +  +  C K  + C      T       IG + L  +GC+  FS+I+ P +  
Sbjct  121   RRQFVEDRLNISRC-KSPVKCLDGATTTIAADVMSIG-DVLNRSGCEYWFSSIT-PDSKN  177

Query  1433  NTTAVSLDIQVIELGWWLQGHC---RCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQ  1263
               + VS ++  ++L WWL   C    CS NADC  +    DG  G RC C EGFTG+ + 
Sbjct  178   TKSQVSFNLGRLKLDWWLNKSCSGANCSDNADCTDVNL-ADGGFGHRCTCREGFTGEAFT  236

Query  1262  GGSGCRRDDTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAMKN  1083
                GCRR          L+G+  G  R  V++G  +    L+V+V +   I R + +  +
Sbjct  237   VPGGCRR----------LVGKHRG-LRKLVVLGTGVLVGVLVVAVFMFAYIFRHKQSASS  285

Query  1082  WNRR--RRELRETTG-ITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWV  912
                    R L E  G  ++P Y+YK+IEKAT++FSD+ +LG GAYGTVY+G+   N  WV
Sbjct  286   ERTSIANRLLCELAGNSSVPFYTYKEIEKATDSFSDRNKLGTGAYGTVYAGEF-PNSSWV  344

Query  911   AIKRIRHRDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHL  732
             AIKR+R +DT SI+QV NEIKLLSSV+HPNLVRLLGC I  GE  LVY+FMPNGTLSQHL
Sbjct  345   AIKRLRRKDTTSIDQVVNEIKLLSSVSHPNLVRLLGCCIADGEPFLVYDFMPNGTLSQHL  404

Query  731   QREKG-SGLPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFG  555
             Q E+G + L WP+RL I S+T+ AIA+LH++++PPIYHRD+KSSNILLDY + SK++DFG
Sbjct  405   QHERGQTPLSWPLRLAIASQTANAIAHLHSSVNPPIYHRDIKSSNILLDYEFNSKISDFG  464

Query  554   LSRFGL---IESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVD  384
             LSR G+    E SHISTAPQGTPGY+DPQYHQDF LSDKSDVYSFGVVLVEII+G K +D
Sbjct  465   LSRLGMSTDFEVSHISTAPQGTPGYVDPQYHQDFQLSDKSDVYSFGVVLVEIISGFKVID  524

Query  383   FTRPQNEVNLAALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDM  204
             FTRP +EVNLA+LA+D IG+G ++++IDP ++  KD  T +S++ +AE+AFRCL+FHR+M
Sbjct  525   FTRPYSEVNLASLAIDWIGRGRVVDLIDPCLKTNKDPKTFASIHNLAELAFRCLSFHRNM  584

Query  203   RPSMMEVAIELEQMRLSKWG  144
             RP+M+EV  +L++++L  +G
Sbjct  585   RPTMIEVTEDLQRIKLMYFG  604



>emb|CDY54167.1| BnaC07g48570D [Brassica napus]
Length=616

 Score =   528 bits (1360),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 287/614 (47%), Positives = 393/614 (64%), Gaps = 38/614 (6%)
 Frame = -3

Query  1937  PVLILLLLQSAMVFGSSTCNRSCGDGLKQLPFPFGFSSGCEILLNCTS-NGTMSIGEFPV  1761
             P LI L   +  V   +T + +C  G   LP+PFGF+ G  I  NC+      +IGEF V
Sbjct  5     PYLIFLFF-TLTVAAQTTGSVNCQTGY--LPYPFGFTDGYPIRFNCSEKTDEAAIGEFAV  61

Query  1760  YQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPT-SNNGILLQNCSSPELKCMIPSTMIQ  1584
              ++T   I + IP  C R I  ++ LF  NFAP+ S N IL+Q C+     C I  + +Q
Sbjct  62    AEVTNANIYVKIPPLCKRDIRKIEQLFRHNFAPSISQNTILVQGCNESSSDCSIGRSFVQ  121

Query  1583  TQFELQDCGKDNISCF-SEPHMTGGFIGYENLTG-TGCKSLFSAISSPAAAANTTAVSLD  1410
              +  L  C    + C  +   +    +   ++   +GCK   S+I+  + +     +   
Sbjct  122   DRLNLSSC-ISQVRCLDAATEIKADVMSVVDVVNRSGCKYWLSSITLQSKSQGLVNL---  177

Query  1409  IQVIELGWWLQGHCR---CSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRD  1239
             +  + L WWL+  C    CS NA C T+   G G  G RC C +GF G+ +    GCR  
Sbjct  178   LGQLRLDWWLKEGCSSTTCSANASCTTVNL-GGGGFGHRCTCDDGFYGNAFIVHGGCRP-  235

Query  1238  DTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAMKN-----WNR  1074
                       +G+  G     ++ G  I   A ++++ +   + R + +  +      NR
Sbjct  236   ----------VGKRKGLLLKVIVFGIAILLGASLIAILIFAFVYRHKRSASSSRTSLANR  285

Query  1073  RRRELRETTGITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIR  894
                EL   +  ++P Y+YK++EKAT+NFSDK +LG GAYGTVY+G+   N  WVAIKR+R
Sbjct  286   LFCELAGNS--SVPFYTYKELEKATDNFSDKNKLGTGAYGTVYAGEF-SNSSWVAIKRLR  342

Query  893   HRDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGS  714
              +DT SI+QV NEIKLLSSV+HPNLVRLLGC + +GE ILVYEFMPNGTLSQHLQ E+G 
Sbjct  343   RKDTPSIDQVVNEIKLLSSVSHPNLVRLLGCCVAQGEPILVYEFMPNGTLSQHLQHERGH  402

Query  713   G-LPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGL  537
               L WP+RL I S+T+ AIA+LH++++PPIYHRD+KSSNILLDY + SKV+DFGLSR G+
Sbjct  403   APLSWPLRLSIASQTANAIAHLHSSVNPPIYHRDIKSSNILLDYEFNSKVSDFGLSRLGM  462

Query  536   ---IESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQN  366
                 + SHISTAPQGTPGYLDPQYHQDF LSDKSDVYSFGVVL+EII+G K +DFTRP  
Sbjct  463   STDFDVSHISTAPQGTPGYLDPQYHQDFQLSDKSDVYSFGVVLIEIISGFKVIDFTRPFT  522

Query  365   EVNLAALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMME  186
             EVNLAALA+D+IG+G +++IIDP ++ E D    +SV  +AE+AFRCL+FHR+MRP+M+E
Sbjct  523   EVNLAALAIDRIGRGRVVDIIDPSLQTENDPKMFASVQNLAELAFRCLSFHRNMRPTMIE  582

Query  185   VAIELEQMRLSKWG  144
             VA ++++++L  +G
Sbjct  583   VAEDIQRIKLMYFG  596



>ref|XP_003558447.1| PREDICTED: wall-associated receptor kinase-like 14 [Brachypodium 
distachyon]
Length=722

 Score =   531 bits (1369),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 296/623 (48%), Positives = 408/623 (65%), Gaps = 59/623 (9%)
 Frame = -3

Query  1883  CNRSCGDGLKQLPFPFGFSSGCEILLNCTSN----------GTMSIGEFPVYQLTPDTIM  1734
             C RSCG G  +LP+PFGFSSGC I L C  +          G   +G   V  +T   ++
Sbjct  27    CERSCG-GTTKLPYPFGFSSGCTIPLGCDHDTGVAWLGRAAGARELGLL-VRNVTRRALI  84

Query  1733  INIPAKCGRRIEA-MKPLFGKNFAPTSNNGILLQN--------------CSSPELKCMIP  1599
             + +   C R + A ++ LF  N+AP S N +++ +              C++P      P
Sbjct  85    LELLPDCSRALNASVQELFSDNYAPPSRNALVVSSCSASAASAQNNASSCTAP------P  138

Query  1598  STMIQTQFELQDCGKD-NISCF--SEPHMTGG----FIGYENLTGTGCKSLFSAISSPAA  1440
                I        CG + +  C     P  TGG    F+   ++  + C +L S+    A+
Sbjct  139   DRYIDRNSS--HCGANTSFKCILPPAPSNTGGRGQRFLSKRDILASECTALVSS----AS  192

Query  1439  AANTTAVSLDIQVIELGWWLQG-HCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQ  1263
               +T   +L +  +EL WW++G +CRC  +A+C  +  P  GK  FRC+C +GF GDG+ 
Sbjct  193   YWDTLGPALLLGKLELDWWVKGQYCRCHSSANCTLLTAPTTGKEAFRCECRDGFEGDGFL  252

Query  1262  GGSGCRRDDTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAMKN  1083
              G+GC++  ++C+ +KYL G  G   +IG+L+ GVI GA +M    + C +++RR A   
Sbjct  253   DGAGCKKV-SKCDSSKYLSGVWGKPVQIGLLLAGVIFGAMVMGVTCVACHLLKRRSASIR  311

Query  1082  WNRRRRELRETTGITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIK  903
               +  + L      T+P +SY++IE+AT  FS+  RLG GAYGTVY+G+L DN   VA+K
Sbjct  312   SQQSTKRLLSEASCTVPFFSYREIERATGGFSEDHRLGTGAYGTVYAGRLSDN-RLVAVK  370

Query  902   RIRHRDTDS---IEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHL  732
             RI+ R  D+   ++ V NE+KL+SSV+H +LVRLLGC I++G+QILVYEFMPNGTL+QHL
Sbjct  371   RIKQRGDDNAAGLDCVMNEVKLVSSVSHRSLVRLLGCCIDQGQQILVYEFMPNGTLAQHL  430

Query  731   QREKGSG-LPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFG  555
             QRE+G G +PW VRL + +ET++AIAYLH+ +HPPIYHRD+KSSNILLD+ Y SKVADFG
Sbjct  431   QRERGPGAVPWTVRLRVAAETARAIAYLHSEVHPPIYHRDIKSSNILLDHEYNSKVADFG  490

Query  554   LSRFGLIES-----SHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKA  390
             LSR G+  +     SHISTAPQGTPGY+DPQYHQ+FHLSDKSDVYSFGVVL EIIT +KA
Sbjct  491   LSRKGMAAADADAASHISTAPQGTPGYVDPQYHQNFHLSDKSDVYSFGVVLAEIITAMKA  550

Query  389   VDFTR-PQNEVNLAALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFH  213
             VDF+R P   VNLA LAV+KIG+G + +I+DP ++  +D WTL+S++KVAE+AFRCLAF 
Sbjct  551   VDFSRAPGEAVNLAQLAVEKIGRGCVDDIVDPYLDPHRDAWTLTSIHKVAELAFRCLAFQ  610

Query  212   RDMRPSMMEVAIELEQMRLSKWG  144
              ++RPSM EVA ELEQ+++S W 
Sbjct  611   SEIRPSMAEVADELEQIQVSGWA  633



>ref|XP_009103485.1| PREDICTED: wall-associated receptor kinase-like 21 [Brassica 
rapa]
Length=616

 Score =   527 bits (1358),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 288/614 (47%), Positives = 395/614 (64%), Gaps = 38/614 (6%)
 Frame = -3

Query  1937  PVLILLLLQSAMVFGSSTCNRSCGDGLKQLPFPFGFSSGCEILLNCTS-NGTMSIGEFPV  1761
             P LI L   +  V   +T + +C  G   LP+PFGF+ G  I  NC+      +IGEF V
Sbjct  5     PYLIFLFF-TLTVAAQTTGSVNCQPG--SLPYPFGFTDGYPIRFNCSEKTDEAAIGEFSV  61

Query  1760  YQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPT-SNNGILLQNCSSPELKCMIPSTMIQ  1584
              ++T   I + IP  C R I  ++ LF  +FAP+ S N IL+Q C+     C I  + +Q
Sbjct  62    AEVTNANIYVKIPPLCKRDIRKIEQLFRHSFAPSISQNTILVQGCNESSSDCSIGRSFVQ  121

Query  1583  TQFELQDCGKDNISCF-SEPHMTGGFIGYENLTG-TGCKSLFSAISSPAAAANTTAVSLD  1410
              +  L  C    + C  +   +    +   N+   +GCK  FS+I+  + +  +  +   
Sbjct  122   DRLNLSSC-ISQVRCLDAATEIKADVMSVVNVVNRSGCKYWFSSITPQSKSQGSVNL---  177

Query  1409  IQVIELGWWLQGHCR---CSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRD  1239
             +  + L WWL+  C    CS NA C T+   G G  G RC C +GF G+ +    GCR  
Sbjct  178   LGQLRLDWWLKEGCSSTTCSANASCTTVNI-GGGGFGHRCTCDDGFYGNAFNVHGGCRP-  235

Query  1238  DTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAMKNW-----NR  1074
                       +G+  G     +++G  I   A ++++ +   I R + +  +      NR
Sbjct  236   ----------VGKRKGLLHKLIVLGIAILLGASLIAILIFAFIYRHKRSASSSRSSLANR  285

Query  1073  RRRELRETTGITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIR  894
                EL   +  ++P Y+YK++EKAT+NFSDK +LG GAYGTVY+G+   N  WVAIKR+R
Sbjct  286   LFCELAGNS--SVPFYTYKELEKATDNFSDKNKLGTGAYGTVYAGEF-PNSSWVAIKRLR  342

Query  893   HRDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGS  714
              +DT SI+QV NEIKLLSSV+HPNLVRLLGC + +GE ILVYEFMPNGTLSQHLQ E+G 
Sbjct  343   RKDTPSIDQVVNEIKLLSSVSHPNLVRLLGCCVAQGEPILVYEFMPNGTLSQHLQHERGH  402

Query  713   G-LPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGL  537
               L WP+RL I S+T+ AIA+LH++++PPIYHRD+KSSNILLDY + SKV+DFGLSR G+
Sbjct  403   APLSWPLRLSIASQTANAIAHLHSSVNPPIYHRDIKSSNILLDYEFNSKVSDFGLSRLGM  462

Query  536   ---IESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQN  366
                 + SHISTAPQGTPGYLDPQYHQDF LSDKSDVYSFGVVL+EII+G K +DFTRP  
Sbjct  463   STDFDVSHISTAPQGTPGYLDPQYHQDFQLSDKSDVYSFGVVLIEIISGFKVIDFTRPFT  522

Query  365   EVNLAALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMME  186
             EVNLAALA+D+IG+G +++IIDP ++   D    SS+  +AE+AFRCL+FHR+MRP+M+E
Sbjct  523   EVNLAALAIDRIGRGRVVDIIDPSLQTVNDPKMFSSLQNLAELAFRCLSFHRNMRPTMIE  582

Query  185   VAIELEQMRLSKWG  144
             VA ++++++L  +G
Sbjct  583   VAEDIQRIKLMYFG  596



>ref|XP_010464869.1| PREDICTED: LOW QUALITY PROTEIN: wall-associated receptor kinase-like 
21 [Camelina sativa]
Length=629

 Score =   526 bits (1356),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 288/618 (47%), Positives = 396/618 (64%), Gaps = 37/618 (6%)
 Frame = -3

Query  1934  VLILLLLQSAMVFGSSTCNRSCGDGLKQLPFPFGFSSGCEILLNCTS-NGTMSIGEFPVY  1758
             +L L  L +  +   +T + +C  G   L +PFGFS G  I  NC+   G   IGEF V 
Sbjct  9     LLFLFFLTTIAIATQTTGSVNCQTG--SLRYPFGFSDGYPIXFNCSKITGDAVIGEFSVQ  66

Query  1757  QLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTS-NNGILLQNCSSPE--LKCMIPSTMI  1587
             ++T   I + +P  C R+I  +K LF +N AP+   N IL+Q C   E    C+I    I
Sbjct  67    EVTNSNIYVTVPPVCKRKISKIKQLFRENMAPSYLQNIILVQGCKKEEQSYNCLIRRKFI  126

Query  1586  QTQFELQDCGKDNISCFSEPHMTGGFIGYEN------LTGTGCKSLFSAISSPAAAANTT  1425
             + +  +  C K  ++C             +       L  +GCK  FS+I+ P +    +
Sbjct  127   EDRLNISRC-KSPVTCLDGVTTKTTTAAVDVMSIGDVLNRSGCKYWFSSIT-PDSKNTKS  184

Query  1424  AVSLDIQVIELGWWLQGHCR---CSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGS  1254
              +S  +  ++L WWL+  C    CS+NADC  ++   DG  G RC C +GFTG+ +    
Sbjct  185   DISFSLGRLKLDWWLKNSCNSANCSENADCTDVKL-ADGGFGHRCTCRDGFTGEAFTVPG  243

Query  1253  GCRRDDTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAMK---N  1083
             GCRR          L+ +  G  ++ V     +    L+++V +   I R + +      
Sbjct  244   GCRR----------LVAKHRGLHKLVVFGTVGVLVGVLVLAVLMFTYIFRHKRSASLTTT  293

Query  1082  WNRRRRELRETTG-ITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAI  906
              +   R L E  G  ++P Y+YK+IEKAT++FSDK +LG GAYGTVY+G+   N  WVAI
Sbjct  294   SSIANRLLCELAGNSSVPFYTYKEIEKATDSFSDKNKLGTGAYGTVYAGEF-PNSSWVAI  352

Query  905   KRIRHRDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQR  726
             KR+R +DT SI+QV NEIKLLSSV+HPNLVRLLGC I  GE  LVYEFMPNGTLSQHLQ 
Sbjct  353   KRLRRKDTTSIDQVVNEIKLLSSVSHPNLVRLLGCCIADGEPFLVYEFMPNGTLSQHLQH  412

Query  725   EKG-SGLPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLS  549
             E+G + L WP+RL I S+T+ AIA+LH++++PPIYHRD+KSSNILLD+ + SK++DFGLS
Sbjct  413   ERGQTPLSWPLRLAIASQTANAIAHLHSSVNPPIYHRDIKSSNILLDFEFNSKISDFGLS  472

Query  548   RFGL---IESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFT  378
             R G+    E+SHISTAPQGTPGYLDPQYHQDF LSDKSDVYSFGVVLVEII+G K +DFT
Sbjct  473   RVGMSTDFEASHISTAPQGTPGYLDPQYHQDFQLSDKSDVYSFGVVLVEIISGFKVIDFT  532

Query  377   RPQNEVNLAALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRP  198
             RP  EVNLA+LA+D+IG+G +++IIDP ++ + D    +S++ +AE+AF CL+FHR+MRP
Sbjct  533   RPYTEVNLASLAIDRIGRGRMVDIIDPCLKTDNDPKMFASIHNLAELAFSCLSFHRNMRP  592

Query  197   SMMEVAIELEQMRLSKWG  144
             +M+EV   L++++L  +G
Sbjct  593   TMIEVTEHLQRIKLMYFG  610



>ref|XP_004160512.1| PREDICTED: wall-associated receptor kinase-like 14-like [Cucumis 
sativus]
Length=471

 Score =   513 bits (1320),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 249/364 (68%), Positives = 305/364 (84%), Gaps = 3/364 (1%)
 Frame = -3

Query  1232  RCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLIC-CIIRRRLAMKNWNRRRRELR  1056
             +CNP  Y+ G CGG++++  LI GVI GA LM  + LIC CI RR + +K     +R L 
Sbjct  13    KCNPPTYITGRCGGESKVAALIAGVIVGAFLMAVLTLICYCIRRRSMCLKGQMSAKRLLS  72

Query  1055  ETTG-ITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTD  879
             E  G  ++ +Y YK+IE+ATN FS+K+RLG GA+GTVY+G+LH+ DEWVA+KRI++RD +
Sbjct  73    EAAGNSSVTLYPYKEIERATNGFSEKQRLGTGAFGTVYAGRLHE-DEWVAVKRIKYRDHN  131

Query  878   SIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWP  699
             SI+QV NEIKLLSSV+HPNLVRLLGC IE+G+QILVYEFMPNGTLSQHLQRE+G+GLPW 
Sbjct  132   SIDQVMNEIKLLSSVSHPNLVRLLGCCIEEGQQILVYEFMPNGTLSQHLQRERGNGLPWT  191

Query  698   VRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHI  519
              RL I +ETS+AIAYLH+++HPPIYHRD+KSSNILLD+ +KSKVADFGLSR G+ E SH+
Sbjct  192   TRLTIAAETSRAIAYLHSSVHPPIYHRDIKSSNILLDHGFKSKVADFGLSRLGMTEISHV  251

Query  518   STAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAV  339
             STAPQGTPGY+DPQYHQ+F+LSDKSDVYSFGVVLVEIIT LK VDFTRPQ+EVNLAALA+
Sbjct  252   STAPQGTPGYVDPQYHQNFYLSDKSDVYSFGVVLVEIITALKVVDFTRPQSEVNLAALAI  311

Query  338   DKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMR  159
             D+IG+  + E+IDP +E  +D WTL S++KVAE+AFRCLAFH DMRPSM EVA ELE +R
Sbjct  312   DRIGRNSVDELIDPFLEPHRDAWTLYSIHKVAELAFRCLAFHSDMRPSMTEVAEELESIR  371

Query  158   LSKW  147
              S W
Sbjct  372   RSGW  375



>ref|XP_008347440.1| PREDICTED: wall-associated receptor kinase-like 14 [Malus domestica]
Length=406

 Score =   508 bits (1309),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 247/333 (74%), Positives = 284/333 (85%), Gaps = 4/333 (1%)
 Frame = -3

Query  1139  MVSVGLICCIIRRRLAMKNWNRRRRELRETTG-ITIPVYSYKDIEKATNNFSDKRRLGDG  963
             M+S+ LICC IRR+  +K  +  +R L E TG   IP YSYK+IEKATN+FSDK+RLG G
Sbjct  32    MISLALICCFIRRQSKLKARHSTKRLLSEATGNCNIPFYSYKEIEKATNSFSDKQRLGTG  91

Query  962   AYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGE  783
             AYGTVY+GKLHD  EWVAIKRI+HR  +SI+QV NEIKL+SSV HPNLVRLLGCSIE+GE
Sbjct  92    AYGTVYAGKLHD--EWVAIKRIKHRGHESIDQVMNEIKLISSVRHPNLVRLLGCSIERGE  149

Query  782   QILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSS  603
             QILVYEFM NGTL QHLQRE+G GL W  RL I +ET++AI++LH+A+ PPIYHRD+KSS
Sbjct  150   QILVYEFMGNGTLCQHLQRERGEGLSWLTRLTIAAETAKAISHLHSAVKPPIYHRDIKSS  209

Query  602   NILLDYNYKSKVADFGLSRFGLIESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGV  423
             NILLD  +KSKVADFGLSR G+ E+SHISTAPQGTPGYLDPQYHQ+FHLSDKSDVYSFGV
Sbjct  210   NILLDCKFKSKVADFGLSRLGMAETSHISTAPQGTPGYLDPQYHQNFHLSDKSDVYSFGV  269

Query  422   VLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLEIIDPLIE-AEKDVWTLSSVNKV  246
             VLVEIITGLKAVDFTRPQNEVNLAALA D+IG+G L EIIDP +E    D W LSSV+KV
Sbjct  270   VLVEIITGLKAVDFTRPQNEVNLAALATDRIGRGCLNEIIDPFLEPLLDDAWPLSSVHKV  329

Query  245   AEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKW  147
             AE+AFRCLAF RDMRP+M+EV  ELE ++LSKW
Sbjct  330   AELAFRCLAFQRDMRPTMIEVTAELELIKLSKW  362



>ref|XP_010106074.1| Wall-associated receptor kinase-like 14 [Morus notabilis]
 gb|EXC07344.1| Wall-associated receptor kinase-like 14 [Morus notabilis]
Length=373

 Score =   504 bits (1297),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 241/311 (77%), Positives = 276/311 (89%), Gaps = 3/311 (1%)
 Frame = -3

Query  1070  RRELRETTG-ITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIR  894
             +R L E TG + IP+YS+KD+EKATN FSDK RLG GAYGTVY+GKL + DEW+AIKRIR
Sbjct  6     KRHLSEATGNLNIPIYSFKDVEKATNGFSDKYRLGTGAYGTVYAGKL-NCDEWLAIKRIR  64

Query  893   HRDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGS  714
             +RD DSIEQV NEIKL+S+V+HPNLVRLLGCSI+ GEQILVYEFMPNGTL QHL RE+G 
Sbjct  65    YRDADSIEQVVNEIKLISTVSHPNLVRLLGCSIDYGEQILVYEFMPNGTLCQHLHRERGD  124

Query  713   GLPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLI  534
             GL W +RL + +ET+QAIAYLH+A+ PPIYHRD+KSSNILLD N++SKVADFGLSR G++
Sbjct  125   GLSWLIRLTVAAETAQAIAYLHSAIKPPIYHRDIKSSNILLDQNFRSKVADFGLSRLGMV  184

Query  533   ESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNL  354
             E+SHISTAPQGTPGYLDPQYHQ+FHLSDKSDVYSFGVVLVEIITGLKAVDF+RPQNEVNL
Sbjct  185   ETSHISTAPQGTPGYLDPQYHQNFHLSDKSDVYSFGVVLVEIITGLKAVDFSRPQNEVNL  244

Query  353   AALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIE  174
             AALA D+IGKG L EIIDPLIE  +D WTL SV++VAE+AFRCLAFHRDMRPSM EVA E
Sbjct  245   AALATDRIGKGCLDEIIDPLIEPHRDAWTLWSVHRVAELAFRCLAFHRDMRPSMTEVAAE  304

Query  173   LEQMRLSK-WG  144
             L+Q R S+ WG
Sbjct  305   LDQTRRSRSWG  315



>gb|KFK28363.1| hypothetical protein AALP_AA8G505700 [Arabis alpina]
Length=615

 Score =   511 bits (1317),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 286/590 (48%), Positives = 387/590 (66%), Gaps = 53/590 (9%)
 Frame = -3

Query  1835  GFSSGCEILLNCTS-NGTMSIGEFPVYQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPT  1659
             G S G  I  NC++  G   IGEF + ++T  +I + IP  C R+I  +  LFG+N AP+
Sbjct  28    GSSFGYPIRFNCSNITGDAQIGEFVIQEITNTSIYVKIPPMCNRQIHKIDSLFGENHAPS  87

Query  1658  -SNNGILLQNCS--SPELKCMIP-STMIQTQFELQDCGKDNISCFSEPH-----MTGGFI  1506
              S N IL+Q C+  S    C I  +  ++    L  C K  +SC          M+ G +
Sbjct  88    NSQNVILVQECNRSSSSSDCSIRMNRFVEENLNLSRC-KSPVSCLERATTEFDVMSIGDV  146

Query  1505  GYENLTGTGCKSLFSAISSPAAAANTTAVSLDIQVIELGWWLQ---GHCRCSKNADCNTM  1335
             G       GCK  FS++++ +       VSL++ +I+L WW+    G+  CS+NA+C  +
Sbjct  147   G-------GCKYWFSSVTTESRDGKP-GVSLNLGLIKLDWWITEGCGNTNCSENANCTEV  198

Query  1334  RTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTRCNPAKYLLGECGGKTRigvliggvi  1155
             + PG G  G RC C++GF GD +    GCR         K L+G   G            
Sbjct  199   KLPGGGL-GHRCTCNDGFRGDAFTVNGGCRSVHKHRGLYK-LIGLGTG------------  244

Query  1154  agaaLMVSVGLICCII------RRRLAM-KNWNRRRRELRETTG-ITIPVYSYKDIEKAT  999
                 ++V V LI  +I      ++R A   + +   R L E  G  ++P Y+YK+IEKAT
Sbjct  245   ----ILVGVLLIAILIYAYIYRQKRFAYTASTSIANRLLCELAGNSSVPFYTYKEIEKAT  300

Query  998   NNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIKLLSSVNHPNL  819
             ++FSDK +LG GAYGTVY+G+L  N  WVAIKR++H DT SI+QV NE+KL+SSV+HPNL
Sbjct  301   DSFSDKNKLGTGAYGTVYAGEL-PNSSWVAIKRLKHIDTSSIDQVLNEVKLVSSVSHPNL  359

Query  818   VRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKG-SGLPWPVRLGIVSETSQAIAYLHNA  642
             VRLLGC I +GE  LVYEFM NGTLSQHLQ E+G + L WP RL I S+T+ AIA+LH++
Sbjct  360   VRLLGCCISQGEPFLVYEFMSNGTLSQHLQHERGDTPLSWPFRLSIASQTANAIAHLHSS  419

Query  641   MHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGL---IESSHISTAPQGTPGYLDPQYH  471
             ++PPIYHRD+KSSNILLDY + SK++DFGLSR G+    + SHISTAPQGTPGYLDPQYH
Sbjct  420   VNPPIYHRDIKSSNILLDYEFNSKLSDFGLSRLGMTTDFDMSHISTAPQGTPGYLDPQYH  479

Query  470   QDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLEIIDPLI  291
             QDF LSDKSDVYSFGVVL+EII+G K +DFTRP +EVNLA LAVD+IG+G + +I+DP +
Sbjct  480   QDFQLSDKSDVYSFGVVLIEIISGFKVIDFTRPCDEVNLAVLAVDRIGRGRVKDIVDPCL  539

Query  290   EAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKWGI  141
             + E D    +S++ +AE+AFRCL+FHR+MRP+M+EV  +L+Q++L  +GI
Sbjct  540   KTENDPKMFASIHNLAELAFRCLSFHRNMRPTMLEVTEDLQQIKLMYFGI  589



>dbj|BAC42322.1| unknown protein [Arabidopsis thaliana]
Length=620

 Score =   506 bits (1303),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 288/617 (47%), Positives = 387/617 (63%), Gaps = 43/617 (7%)
 Frame = -3

Query  1937  PVLILLLLQSAMVFGSSTCNR-SCGDGLKQLPFPFGFSSGCEILLNCTS-NGTMSIGEFP  1764
             P LI +     +   + T     C   L  L +PFGFS G  I  NC+   G   IGEF 
Sbjct  5     PYLIFVFFVFTLTVATQTTGSVKCKTSL--LRYPFGFSDGYPIRFNCSEITGEAVIGEFA  62

Query  1763  VYQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTS-NNGILLQNC--SSPELKCMIPST  1593
             V ++T   I + IP  C R I  ++ LF +N AP+   N IL+Q C   +    C+I + 
Sbjct  63    VQEVTNSNIYVEIPPVCKRNIRKIEQLFRENLAPSKLQNIILVQGCKKQNKSSNCLIRNK  122

Query  1592  MIQTQFELQDCGKDNISCFSEPHMTGGFIGY--ENLTGTGCKSLFSAISSPAAAANTTAV  1419
              ++ +  L  C K  +SC      T   +    + + G+GCK  FS+IS    + N   +
Sbjct  123   FVENRLNLSKC-KSPVSCLDGATTTTADVMSLGDVVNGSGCKYWFSSISQSQVSVNLGRL  181

Query  1418  SLDIQVIELGWWLQGHCR---CSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGC  1248
              LD       WWL+G C    CS+NADC  ++   DG  G RC C EGF+G  +    GC
Sbjct  182   KLD-------WWLKGSCSNTTCSENADCAKVKL-DDGGLGHRCTCREGFSGKAFTVPGGC  233

Query  1247  RRDDTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAMKN-----  1083
              R          L+ +  G  ++ VL    I    L++ V +     R + +  +     
Sbjct  234   HR----------LVYKRKGLHKLVVLGTAGILVGVLVIVVLIATYFFRNKQSASSERASI  283

Query  1082  WNRRRRELRETTGITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIK  903
              NR   EL E +  ++P Y+YK+IEKAT++FSDK  LG GAYGTVY+G+   N   VAIK
Sbjct  284   ANRLLCELAENS--SVPFYTYKEIEKATDSFSDKNMLGTGAYGTVYAGEF-PNSSCVAIK  340

Query  902   RIRHRDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQRE  723
             R++H+DT SI+QV NEIKLLSSV+HPNLVRLLGC    GE  LVYEFMPNGTL QHLQ E
Sbjct  341   RLKHKDTTSIDQVVNEIKLLSSVSHPNLVRLLGCCFADGEPFLVYEFMPNGTLYQHLQHE  400

Query  722   KGSG-LPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSR  546
             +G   L W +RL I  +T+ AIA+LH++++PPIYHRD+KSSNILLD+ + SK++DFGLSR
Sbjct  401   RGQPPLSWQLRLAIACQTANAIAHLHSSVNPPIYHRDIKSSNILLDHEFNSKISDFGLSR  460

Query  545   FGL---IESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTR  375
              G+    E+SHISTAPQGTPGYLDPQYHQDF LSDKSDVYSFGVVLVEII+G K +DFTR
Sbjct  461   LGMSTDFEASHISTAPQGTPGYLDPQYHQDFQLSDKSDVYSFGVVLVEIISGFKVIDFTR  520

Query  374   PQNEVNLAALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPS  195
             P +EVNLA+LAVD+IG+G +++IIDP +  E +    +S++ +AE+AFRCL+FHR+MRP+
Sbjct  521   PYSEVNLASLAVDRIGRGRVVDIIDPCLNKEINPKMFASIHNLAELAFRCLSFHRNMRPT  580

Query  194   MMEVAIELEQMRLSKWG  144
             M+E+  +L +++L  +G
Sbjct  581   MVEITEDLHRIKLMHYG  597



>ref|NP_201480.3| wall-associated receptor kinase-like 21 [Arabidopsis thaliana]
 sp|Q8GYF5.2|WAKLR_ARATH RecName: Full=Wall-associated receptor kinase-like 21; Flags: 
Precursor [Arabidopsis thaliana]
 dbj|BAB08621.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED98263.1| wall-associated receptor kinase-like 21 [Arabidopsis thaliana]
Length=622

 Score =   503 bits (1296),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 287/615 (47%), Positives = 385/615 (63%), Gaps = 39/615 (6%)
 Frame = -3

Query  1937  PVLILLLLQSAMVFGSSTCNR-SCGDGLKQLPFPFGFSSGCEILLNCTS-NGTMSIGEFP  1764
             P LI +     +   + T     C   L  L +PFGFS G  I  NC+   G   IGEF 
Sbjct  7     PYLIFVFFVFTLTVATQTTGSVKCKTSL--LRYPFGFSDGYPIRFNCSEITGEAVIGEFA  64

Query  1763  VYQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTS-NNGILLQNC--SSPELKCMIPST  1593
             V ++T   I + IP  C R I  ++ LF +N AP+   N IL+Q C   +    C+I + 
Sbjct  65    VQEVTNSNIYVEIPPVCKRNIRKIEQLFRENLAPSKLQNIILVQGCKKQNKSSNCLIRNK  124

Query  1592  MIQTQFELQDCGKDNISCFSEPHMTGGFIGY--ENLTGTGCKSLFSAISSPAAAANTTAV  1419
              ++ +  L  C K  +SC      T   +    + + G+GCK  FS+IS    + N   +
Sbjct  125   FVENRLNLSKC-KSPVSCLDGATTTTADVMSLGDVVNGSGCKYWFSSISQSQVSVNLGRL  183

Query  1418  SLDIQVIELGWWLQGHCR---CSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGC  1248
              LD       WWL+G C    CS+NADC  ++   DG  G RC C EGF+G  +    GC
Sbjct  184   KLD-------WWLKGSCSNTTCSENADCAKVKL-DDGGLGHRCTCREGFSGKAFTVPGGC  235

Query  1247  RRDDTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAMKNWNRR-  1071
              R          L+ +  G  ++ VL    I    L++ V +     R + +  +     
Sbjct  236   HR----------LVYKRKGLHKLVVLGTAGILVGVLVIVVLIATYFFRNKQSASSERASI  285

Query  1070  -RRELRETTG-ITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRI  897
               R L E  G  ++P Y+YK+IEKAT++FSDK  LG GAYGTVY+G+   N   VAIKR+
Sbjct  286   ANRLLCELAGNSSVPFYTYKEIEKATDSFSDKNMLGTGAYGTVYAGEF-PNSSCVAIKRL  344

Query  896   RHRDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKG  717
             +H+DT SI+QV NEIKLLSSV+HPNLVRLLGC    GE  LVYEFMPNGTL QHLQ E+G
Sbjct  345   KHKDTTSIDQVVNEIKLLSSVSHPNLVRLLGCCFADGEPFLVYEFMPNGTLYQHLQHERG  404

Query  716   SG-LPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFG  540
                L W +RL I  +T+ AIA+LH++++PPIYHRD+KSSNILLD+ + SK++DFGLSR G
Sbjct  405   QPPLSWQLRLAIACQTANAIAHLHSSVNPPIYHRDIKSSNILLDHEFNSKISDFGLSRLG  464

Query  539   L---IESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQ  369
             +    E+SHISTAPQGTPGYLDPQYHQDF LSDKSDVYSFGVVLVEII+G K +DFTRP 
Sbjct  465   MSTDFEASHISTAPQGTPGYLDPQYHQDFQLSDKSDVYSFGVVLVEIISGFKVIDFTRPY  524

Query  368   NEVNLAALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMM  189
             +EVNLA+LAVD+IG+G +++IIDP +  E +    +S++ +AE+AFRCL+FHR+MRP+M+
Sbjct  525   SEVNLASLAVDRIGRGRVVDIIDPCLNKEINPKMFASIHNLAELAFRCLSFHRNMRPTMV  584

Query  188   EVAIELEQMRLSKWG  144
             E+  +L +++L  +G
Sbjct  585   EITEDLHRIKLMHYG  599



>ref|XP_008674033.1| PREDICTED: WAK-like kinase isoform X1 [Zea mays]
Length=720

 Score =   454 bits (1168),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 274/644 (43%), Positives = 370/644 (57%), Gaps = 83/644 (13%)
 Frame = -3

Query  1895  GSSTCNRSCGDGLKQLPFPFGFSSGCEILLNCTSN------GTMSIGEFPV--YQLTPDT  1740
             G   C+R CG+    +P+PFGFS  C I L+C          + +   +P+  +  T  T
Sbjct  26    GGVGCDRQCGN--TTVPYPFGFSGACPIRLDCNVTTPQLVTNSSAASPYPILSFDATAST  83

Query  1739  IMINIPAKCGRRI-EAMKPLFGKNFAPTSNNGILL-QNC---SSPELKCMIPSTMIQTQF  1575
              ++++P  C R + EA   L G  +  TS+ G+ L + C   ++    C + +T+++T  
Sbjct  84    FLVSLPPSCNRTVGEARAALDGSRYGVTSHTGLFLARGCLGKAAATGNCSVSATIMKTAL  143

Query  1574  ELQDCGKDNI--SCFSEP-----------------HMTGGFIGYENLTGTGCK-SLFSAI  1455
                 CG      +C + P                    G F+ ++ +   GC+ +L SA+
Sbjct  144   RTAGCGDKGAIWTCVAAPLPPPQGLNATAAAAAWDGEAGQFLPWKKVEDAGCEDALTSAV  203

Query  1454  SSPAAAANTTAVSLDIQVIELGWWLQGHC-------RCSKNADCNTMRTPGDGKPGFRCQ  1296
             S   A +     S+D    ELGWWL G C       +C++NA C  + T   G  G RC 
Sbjct  204   S---ALSPEGLPSVDFGAAELGWWLDGTCANATAGGQCARNATCQDIET-SRGTRGHRCA  259

Query  1295  CS-EGFTGDGYQGGSGCRRDDTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLI  1119
             C   G +GDGY  G GC           Y + E   K  + V+  GV A  A      L+
Sbjct  260   CVVAGMSGDGYAAGDGC-----------YYVAERSAKKIVLVVAAGVAASVAAATGALLL  308

Query  1118  CCI-IRRRLAMKNWNRRRRELR----ETTGITIPVYSYKDIEKATNNFSDKRRLGDGAYG  954
             C +  RRR A ++ + R   +R      T   +PVYSY +I +ATN+FS   RLG GAYG
Sbjct  309   CWLQCRRRKAGRSASERLAAMRLLSEAATSSGVPVYSYGEIARATNSFSHTHRLGTGAYG  368

Query  953   TVYSGKLHDNDE---WVAIKRIRHRDTDSIEQVT--------NEIKLLSSVNHPNLVRLL  807
             TVY GKL         VAIKR+R R     ++          NEIKL+SSV+HPNLVRLL
Sbjct  369   TVYVGKLPGTGSAPALVAIKRLRRRHHHDEDEDAAAEAALLLNEIKLISSVSHPNLVRLL  428

Query  806   GCSIEKGEQILVYEFMPNGTLSQHLQREKGS-----GLPWPVRLGIVSETSQAIAYLHNA  642
             GC ++ GEQ+LVYE++PNGTLSQHL     S      L W  RLG+  ET+ AIA+LH  
Sbjct  429   GCCLDGGEQVLVYEYVPNGTLSQHLHSAGASTGGRGALTWRARLGVAVETAGAIAHLHG-  487

Query  641   MHPPIYHRDVKSSNILLDYNYKSKVADFGLSR-FGLIES--SHISTAPQGTPGYLDPQYH  471
             M PPI+HRDVKSSNILLD   + K+ADFGLSR    +E+  SH+STAPQGTPGY+DP+YH
Sbjct  488   MRPPIFHRDVKSSNILLDAALRPKLADFGLSRAVDRLEAARSHVSTAPQGTPGYVDPEYH  547

Query  470   QDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLEIIDPLI  291
             Q+FHLSDKSDVYSFGVVL+E++T +K VDF RP  EVNLA+LA+D+IGKG + EI+DP +
Sbjct  548   QNFHLSDKSDVYSFGVVLLELVTAMKVVDFDRPPAEVNLASLALDRIGKGQVAEIVDPAL  607

Query  290   EAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMR  159
                 + W + SV  V+E+AFRCLAF +D+RPSM EVA EL+++R
Sbjct  608   LGAGEDWVMGSVRHVSELAFRCLAFQKDVRPSMREVAAELQRIR  651



>tpg|DAA47345.1| TPA: putative WAK-related receptor-like protein kinase family 
protein [Zea mays]
Length=720

 Score =   443 bits (1140),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 270/644 (42%), Positives = 369/644 (57%), Gaps = 87/644 (14%)
 Frame = -3

Query  1883  CNRSCGDGLKQLPFPFGFSSG--CEILLNCTSNGTMSI---------GEFPV--YQLTPD  1743
             CNR CG     +P+PFGFS G  C ILL C +  + ++           +PV  +     
Sbjct  26    CNRRCGS--TTVPYPFGFSGGGACPILLACNATASTALLPRSTAAAAASYPVQSFDSAAS  83

Query  1742  TIMINIPAKCGRRI-EAMKPLFGKNFAPTSNNGILLQN-------CSSPELKCMIPSTMI  1587
             T ++++   CGR + EA   L G  +  +S  G+ L+          SP   C +PS ++
Sbjct  84    TFLVSLVPSCGRGVAEARAALGGAGYGVSSRTGLFLRGGCGRAAGSRSPS-DCNVPSGVM  142

Query  1586  QTQFELQDCGKDNISCFS-------------EPHMTGGFIGYENLTGTGCKSLFSAISSP  1446
                     CG  N S ++                  G F+ ++ +   GC+    A++S 
Sbjct  143   AAILRTVQCGGGNDSSWTCVLSAPPAPGSPAAARGQGQFMRWDEVAAAGCED---ALTSA  199

Query  1445  AAAANTTAV-SLDIQVIELGWWLQGHCRC--------SKNADCNTMRTPGDGKPGFRCQC  1293
               A +   V S+   + E+GWW+ G C          ++NA C+ ++TPG G  G RC C
Sbjct  200   VYAYSPQGVPSIQFGIAEMGWWVDGRCGDGGGGGGRCARNATCHDVQTPG-GAWGHRCAC  258

Query  1292  SEGFTGDGYQGGSGCRRDDT-RCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLIC  1116
              +G  GDG+  G GC  D   R   AK          +I +++   +A +    +  L+ 
Sbjct  259   VDGMAGDGFAAGQGCYYDGAPRERSAK----------KIVLVVAAGVAASVAAATGALLL  308

Query  1115  CII--RRRLAMKNWNRRRRELR----ETTGITIPVYSYKDIEKATNNFSDKRRLGDGAYG  954
             C +  RRR A ++ + R   +R      T   +PVYSY +I +ATN+FS   RLG GAYG
Sbjct  309   CWLQCRRRKAGRSASERLAAMRLLSEAATSSGVPVYSYGEIARATNSFSHTHRLGTGAYG  368

Query  953   TVYSGKLHDNDE---WVAIKRIRHRDTDSIEQVT--------NEIKLLSSVNHPNLVRLL  807
             TVY GKL         VAIKR+R R     ++          NEIKL+SSV+HPNLVRLL
Sbjct  369   TVYVGKLPGTGSAPALVAIKRLRRRHHHDEDEDAAAEAALLLNEIKLISSVSHPNLVRLL  428

Query  806   GCSIEKGEQILVYEFMPNGTLSQHLQREKGS-----GLPWPVRLGIVSETSQAIAYLHNA  642
             GC ++ GEQ+LVYE++PNGTLSQHL     S      L W  RLG+  ET+ AIA+LH  
Sbjct  429   GCCLDGGEQVLVYEYVPNGTLSQHLHSAGASTGGRGALTWRARLGVAVETAGAIAHLHG-  487

Query  641   MHPPIYHRDVKSSNILLDYNYKSKVADFGLSR-FGLIES--SHISTAPQGTPGYLDPQYH  471
             M PPI+HRDVKSSNILLD   + K+ADFGLSR    +E+  SH+STAPQGTPGY+DP+YH
Sbjct  488   MRPPIFHRDVKSSNILLDAALRPKLADFGLSRAVDRLEAARSHVSTAPQGTPGYVDPEYH  547

Query  470   QDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLEIIDPLI  291
             Q+FHLSDKSDVYSFGVVL+E++T +K VDF RP  EVNLA+LA+D+IGKG + EI+DP +
Sbjct  548   QNFHLSDKSDVYSFGVVLLELVTAMKVVDFDRPPAEVNLASLALDRIGKGQVAEIVDPAL  607

Query  290   EAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMR  159
                 + W + SV  V+E+AFRCLAF +D+RPSM EVA EL+++R
Sbjct  608   LGAGEDWVMGSVRHVSELAFRCLAFQKDVRPSMREVAAELQRIR  651



>ref|NP_001147438.1| WAK-like kinase precursor [Zea mays]
 gb|ACG27516.1| WAK-like kinase [Zea mays]
Length=727

 Score =   443 bits (1140),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 270/644 (42%), Positives = 369/644 (57%), Gaps = 87/644 (14%)
 Frame = -3

Query  1883  CNRSCGDGLKQLPFPFGFSSG--CEILLNCTSNGTMSI---------GEFPV--YQLTPD  1743
             CNR CG     +P+PFGFS G  C ILL C +  + ++           +PV  +     
Sbjct  26    CNRRCGS--TTVPYPFGFSGGGACPILLACNATASTALLPRSTAAAAASYPVQSFDSAAS  83

Query  1742  TIMINIPAKCGRRI-EAMKPLFGKNFAPTSNNGILLQN-------CSSPELKCMIPSTMI  1587
             T ++++   CGR + EA   L G  +  +S  G+ L+          SP   C +PS ++
Sbjct  84    TFLVSLVPSCGRGVAEARAALGGAGYGVSSRTGLFLRGGCGRAAGSRSPS-DCNVPSGVM  142

Query  1586  QTQFELQDCGKDNISCFS-------------EPHMTGGFIGYENLTGTGCKSLFSAISSP  1446
                     CG  N S ++                  G F+ ++ +   GC+    A++S 
Sbjct  143   AAILRTVQCGGGNDSSWTCVLSAPPAPGSPAAARGQGQFMRWDEVAAAGCED---ALTSA  199

Query  1445  AAAANTTAV-SLDIQVIELGWWLQGHCRC--------SKNADCNTMRTPGDGKPGFRCQC  1293
               A +   V S+   + E+GWW+ G C          ++NA C+ ++TPG G  G RC C
Sbjct  200   VYAYSPQGVPSIQFGIAEMGWWVDGRCGDGGGGGGRCARNATCHDVQTPG-GAWGHRCAC  258

Query  1292  SEGFTGDGYQGGSGCRRDDT-RCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLIC  1116
              +G  GDG+  G GC  D   R   AK          +I +++   +A +    +  L+ 
Sbjct  259   VDGMAGDGFAAGQGCYYDGAPRERSAK----------KIVLVVAAGVAASVAAATGALLL  308

Query  1115  CII--RRRLAMKNWNRRRRELR----ETTGITIPVYSYKDIEKATNNFSDKRRLGDGAYG  954
             C +  RRR A ++ + R   +R      T   +PVYSY +I +ATN+FS   RLG GAYG
Sbjct  309   CWLQCRRRKAGRSASERLAAMRLLSEAATSSGVPVYSYGEIARATNSFSHTHRLGTGAYG  368

Query  953   TVYSGKLHDNDE---WVAIKRIRHRDTDSIEQVT--------NEIKLLSSVNHPNLVRLL  807
             TVY GKL         VAIKR+R R     ++          NEIKL+SSV+HPNLVRLL
Sbjct  369   TVYVGKLPGTGSAPALVAIKRLRRRHHHDEDEDAAAEAALLLNEIKLISSVSHPNLVRLL  428

Query  806   GCSIEKGEQILVYEFMPNGTLSQHLQREKGS-----GLPWPVRLGIVSETSQAIAYLHNA  642
             GC ++ GEQ+LVYE++PNGTLSQHL     S      L W  RLG+  ET+ AIA+LH  
Sbjct  429   GCCLDGGEQVLVYEYVPNGTLSQHLHSAGASTGGRGALTWRARLGVAVETAGAIAHLHG-  487

Query  641   MHPPIYHRDVKSSNILLDYNYKSKVADFGLSR-FGLIES--SHISTAPQGTPGYLDPQYH  471
             M PPI+HRDVKSSNILLD   + K+ADFGLSR    +E+  SH+STAPQGTPGY+DP+YH
Sbjct  488   MRPPIFHRDVKSSNILLDATLRPKLADFGLSRAVDRLEAARSHVSTAPQGTPGYVDPEYH  547

Query  470   QDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLEIIDPLI  291
             Q+FHLSDKSDVYSFGVVL+E++T +K VDF RP  EVNLA+LA+D+IGKG + EI+DP +
Sbjct  548   QNFHLSDKSDVYSFGVVLLELVTAMKVVDFDRPPAEVNLASLALDRIGKGQVAEIVDPAL  607

Query  290   EAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMR  159
                 + W + SV  V+E+AFRCLAF +D+RPSM EVA EL+++R
Sbjct  608   LGAGEDWVMGSVRHVSELAFRCLAFQKDVRPSMREVAAELQRIR  651



>dbj|BAJ96733.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=696

 Score =   436 bits (1120),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 270/636 (42%), Positives = 365/636 (57%), Gaps = 78/636 (12%)
 Frame = -3

Query  1883  CNRSCGDGLKQLPFPFGFSSGCEILLNCTSNGTMSI----GEFPV------YQLTPDTIM  1734
             C+R CG     +P+PFGFS GC ILL+C ++ +  I    GE         +  T  TI+
Sbjct  28    CSRQCGS--TTVPYPFGFSPGCPILLSCDASVSTPILPYIGESGTAYRVISFNSTTSTIV  85

Query  1733  INIPAKCGRRI-EAMKPLFGKNFAPTSNNGILLQ------NCSSPELKCMIPSTMIQTQF  1575
             + +P  C R + EA + L G+N+A +S  G+ L+      N S+    C +P+ ++    
Sbjct  86    VGLPPSCSRSVPEARRALSGRNYAVSSRTGLFLRGGCAGINASAGVGSCSVPADVMSRLL  145

Query  1574  ELQDC-----GKDN-ISC--FSEPHMTGG-----FIGYENLTGTGCKSLFSAISSPAAAA  1434
                 C     G D  ++C  FS  + T       F+ +E +    C  + ++      A 
Sbjct  146   RTARCVGVGNGNDTAVACVAFSVANSTAHERDDQFLRWEKVEKQRCDDVLTSTVFVVTAE  205

Query  1433  NTTAVSLDIQVIELGWWLQGHC-------RCSKNADCNTMRTPGDGKPGFRCQCSEGFTG  1275
              T   +L+  V ELGWWL G C       RC+ NA C  + TPG G+ G RC C+ G  G
Sbjct  206   GT--ATLEFAVAELGWWLNGTCGADGTGERCAANATCTDVDTPG-GETGHRCACAAGMEG  262

Query  1274  DGYQGGSGCRRDDTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRL  1095
             DG+ GG GC R   +  P K +           +++G V+  AA    + L+C   RRR 
Sbjct  263   DGFSGGDGCYR--AKRVPKKKV---------AFIVVGVVVGVAAATGVLLLLCWAQRRRS  311

Query  1094  AMK--NWNRRRRELR----ETTGITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKL  933
               K  + + R   +R      T   +PVYSY ++ +ATN+FS   RLG GAYGTVY G+L
Sbjct  312   GGKGRHGSSRLAAMRLLSEAATSSGVPVYSYNEVARATNSFSHTHRLGTGAYGTVYVGRL  371

Query  932   HDND-EWVAIKRIRHRDTD-------SIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQI  777
               N    VAIKR+R R  D       ++  + NEI+L+SS++HPNLVRLLGC +++GE I
Sbjct  372   PANSTALVAIKRLRCRHDDDGDDGGRAVALLLNEIRLISSLSHPNLVRLLGCCLDRGEHI  431

Query  776   LVYEFMPNGTLSQHLQREKGSG------LPWPVRLGIVSETSQAIAYLHNAMHPPIYHRD  615
             LVYE +PNGTLS HL             LPW  RLG V+  + A     +A  PPI+HRD
Sbjct  432   LVYELVPNGTLSHHLHGGGDGDGDGNPTLPWRARLG-VAAGTAAAIAYLHAARPPIFHRD  490

Query  614   VKSSNILLDYNYKSKVADFGLSRFGL----IESSHISTAPQGTPGYLDPQYHQDFHLSDK  447
             VKS NILL  + ++K+ADFGLSR          SH+STAPQGTPGY+DP+YH  FHLSDK
Sbjct  491   VKSGNILLGADLRAKLADFGLSRAARGAEDASRSHVSTAPQGTPGYVDPEYHHSFHLSDK  550

Query  446   SDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLEIIDPLIEAEKDVWT  267
             SDVYSFGVVL+E+IT +K VDF RP NEVNLA LA+D+IGKG + EI+DP +    + W 
Sbjct  551   SDVYSFGVVLLELITAMKVVDFGRPANEVNLACLALDRIGKGRVHEIVDPALLRHGEDWV  610

Query  266   LSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMR  159
             + SV  V+E+AFRCLAF +D+RPSM EVA EL ++R
Sbjct  611   MESVRHVSELAFRCLAFDKDVRPSMSEVAAELCRIR  646



>dbj|BAJ96357.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=696

 Score =   432 bits (1111),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 270/636 (42%), Positives = 365/636 (57%), Gaps = 78/636 (12%)
 Frame = -3

Query  1883  CNRSCGDGLKQLPFPFGFSSGCEILLNCTSNGTMSI----GEFPV------YQLTPDTIM  1734
             C+R CG     +P+PFGFS GC ILL+C ++ +  I    GE         +  T  TI+
Sbjct  28    CSRQCGS--TTVPYPFGFSPGCPILLSCDASVSTPILPYIGESGTAYRVISFNSTTSTIV  85

Query  1733  INIPAKCGRRI-EAMKPLFGKNFAPTSNNGILLQ------NCSSPELKCMIPSTMIQTQF  1575
             + +P  C R + EA + L G+N+A +S  G+ L+      N S+    C +P+ ++    
Sbjct  86    VGLPPSCSRSVPEARRALSGRNYAVSSRTGLFLRGGCAGINASAGVGSCSVPADVMSRLL  145

Query  1574  ELQDC-----GKDN-ISC--FSEPHMTGG-----FIGYENLTGTGCKSLFSAISSPAAAA  1434
                 C     G D  ++C  FS  + T       F+ +E +    C  + ++      A 
Sbjct  146   RTARCVGVGNGNDTAVACVAFSVANSTAHERDDQFLRWEKVEKQRCDDVLTSTVFVVTAE  205

Query  1433  NTTAVSLDIQVIELGWWLQGHC-------RCSKNADCNTMRTPGDGKPGFRCQCSEGFTG  1275
              T   +L+  V ELGWWL G C       RC+ NA C  + TPG G+ G RC C+ G  G
Sbjct  206   GT--ATLEFAVAELGWWLNGTCGADGTGERCAANATCTDVDTPG-GETGHRCACAAGMEG  262

Query  1274  DGYQGGSGCRRDDTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRL  1095
             DG+ GG GC R   +  P K +           +++G V+  AA    + L+C   RRR 
Sbjct  263   DGFSGGDGCYR--AKRVPKKKV---------AFIVVGVVVGVAAAAGVLLLLCWAQRRRS  311

Query  1094  AMK--NWNRRRRELR----ETTGITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKL  933
               K  + + R   +R      T   +PVYSY ++ +ATN+FS   RLG GAYGTVY G+L
Sbjct  312   GGKGRHGSSRLAAMRLLSEAATSSGVPVYSYNEVARATNSFSHTHRLGTGAYGTVYVGRL  371

Query  932   HDND-EWVAIKRIRHRDTD-------SIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQI  777
               N    VAIKR+R R  D       ++  + NEI+L+SS++HPNLVRLLGC +++GE I
Sbjct  372   PANSTALVAIKRLRCRHDDDGDDGGRAVALLLNEIRLISSLSHPNLVRLLGCCLDRGEHI  431

Query  776   LVYEFMPNGTLSQHLQREKGSG------LPWPVRLGIVSETSQAIAYLHNAMHPPIYHRD  615
             LVYE +PNGTLS HL             LPW  RLG V+  + A     +A  PPI+HRD
Sbjct  432   LVYELVPNGTLSHHLHGGGDGDGDGNPTLPWRARLG-VAAGTAAAIAYLHAARPPIFHRD  490

Query  614   VKSSNILLDYNYKSKVADFGLSRFGL----IESSHISTAPQGTPGYLDPQYHQDFHLSDK  447
             VKS NILL  + ++K+ADFGLSR          SH+STAPQGTPGY+DP+YH  FHLSDK
Sbjct  491   VKSGNILLGADLRAKLADFGLSRAARGAEDASRSHVSTAPQGTPGYVDPEYHHSFHLSDK  550

Query  446   SDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLEIIDPLIEAEKDVWT  267
             SDVYSFGVVL+E+IT +K VDF RP NEVNLA LA+D+IGKG + EI+DP +    + W 
Sbjct  551   SDVYSFGVVLLELITAMKVVDFGRPANEVNLACLALDRIGKGRVHEIVDPALLRHGEDWV  610

Query  266   LSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMR  159
             + SV  V+E+AFRCLAF +D+RPSM EVA EL ++R
Sbjct  611   MESVRHVSELAFRCLAFDKDVRPSMSEVAAELCRIR  646



>gb|EAY83755.1| hypothetical protein OsI_38972 [Oryza sativa Indica Group]
Length=725

 Score =   432 bits (1112),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 270/649 (42%), Positives = 371/649 (57%), Gaps = 96/649 (15%)
 Frame = -3

Query  1895  GSSTCNRSCGDGLKQLPFPFGFSSGCEILLNCT-----------SNGTMSIGEFPVYQL-  1752
             G   C R CG GL  +P+PFGFS  C ILL C            +NGT +  E   Y + 
Sbjct  38    GDERCRRKCG-GL-DVPYPFGFSGDCPILLACDEGNSTAALLRPTNGTSTTMEPLSYAVV  95

Query  1751  ------TPDTIMINIPAKCGRRI-EAMKPLFGKNFAPTSNNGILLQNCSSPELK-CMIPS  1596
                   T  T ++++   C R + +A   L G N+  +S+ G+ ++ C + +   C +P+
Sbjct  96    GKSFNSTASTFVVSLLPSCNRTVSDARLWLTGANYGVSSSTGLFVRGCQNAKNNSCSVPA  155

Query  1595  TMIQTQFELQDC---------GKDNISCF----SEPHMTGG---FIGYENLTGTGCKSLF  1464
               + +      C             ++C     +E  M  G   F  ++ +    C +L 
Sbjct  156   EAMSSMLTTAKCGGGGGGNGTASSPVTCIPTMSTEADMAKGVGLFAQWDKVEEPRCDNLL  215

Query  1463  SAISSPAAAANTTAVSLDIQVIELGWWLQGHCR------------CSKNADCNTMRTPGD  1320
             +++       N    +L+I V E+GWW+ G+C             C+ NA C+ +RTP  
Sbjct  216   TSVY--GETTNDGVFTLEIAVAEMGWWVNGNCSNHSAAAADLVGLCAANATCHDVRTP-S  272

Query  1319  GKPGFRCQCSEGFTGDGYQGGSGCRRDDTRCNPAKYLLGECGGKTRigvliggviagaaL  1140
             G  G +C+C EG  GDG+  G GC     + +  K L+   G            +    +
Sbjct  273   GAWGHQCRCLEGMDGDGFAAGEGCHFPAKKSSTKKILIIVGG------------VLAGTV  320

Query  1139  MVSVGLICCIIRR------------RLAMKNWNRRRRELRETTGITIPVYSYKDIEKATN  996
                V  +CC   R            RLA K   R   E   ++G+  PVYSY ++ +ATN
Sbjct  321   AAGVLFLCCARCRQSGGGGGRSGFDRLAAK---RLLSEAASSSGV--PVYSYHEVARATN  375

Query  995   NFSDKRRLGDGAYGTVYSGKL-HDNDEWVAIKRIRHRDTD-----SIEQVTNEIKLLSSV  834
             +FS   RLG GAYGTVY GKL   +   VAIKR+R R  D     ++  + NE+KL+SS+
Sbjct  376   SFSHTHRLGTGAYGTVYVGKLPASSPSLVAIKRMRRRHDDGDDDAAVAVLLNEVKLISSL  435

Query  833   NHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVSETSQAIAY  654
             +HP LVRLLGC +++GEQILVYEF+PNGTL+ HL    G GLPW  RLG+ +ET+ AIAY
Sbjct  436   SHPGLVRLLGCCLDRGEQILVYEFVPNGTLAHHL---AGGGLPWRARLGVAAETAAAIAY  492

Query  653   LHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSR-FGLIES---SHISTAPQGTPGYL  486
             LH A  PPI HRDVKSSNILLD + + ++ADFGLSR  G ++    SH+STAPQGTPGYL
Sbjct  493   LH-AKRPPILHRDVKSSNILLDGDLRPRLADFGLSRAVGRLDQASLSHVSTAPQGTPGYL  551

Query  485   DPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLEI  306
             DP+YHQ+FHLSDKSDVYSFGVVL+E+IT +K VDF RP  EVNLA+LA+D+IGKG + +I
Sbjct  552   DPEYHQNFHLSDKSDVYSFGVVLLELITAMKVVDFARPAAEVNLASLALDRIGKGRVDDI  611

Query  305   IDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMR  159
             +DP +    D W + SV  V+E+AFRCLAF +D+RP+M EVA EL ++R
Sbjct  612   VDPALVDRADEWVMRSVRHVSELAFRCLAFQKDVRPAMSEVAAELARIR  660



>gb|KFK28362.1| hypothetical protein AALP_AA8G505700 [Arabis alpina]
Length=581

 Score =   427 bits (1097),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 255/590 (43%), Positives = 354/590 (60%), Gaps = 87/590 (15%)
 Frame = -3

Query  1835  GFSSGCEILLNCTS-NGTMSIGEFPVYQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPT  1659
             G S G  I  NC++  G   IGEF + ++T  +I + IP  C R+I  +  LFG+N AP+
Sbjct  28    GSSFGYPIRFNCSNITGDAQIGEFVIQEITNTSIYVKIPPMCNRQIHKIDSLFGENHAPS  87

Query  1658  -SNNGILLQNCS--SPELKCMIP-STMIQTQFELQDCGKDNISCFSEPH-----MTGGFI  1506
              S N IL+Q C+  S    C I  +  ++    L  C K  +SC          M+ G +
Sbjct  88    NSQNVILVQECNRSSSSSDCSIRMNRFVEENLNLSRC-KSPVSCLERATTEFDVMSIGDV  146

Query  1505  GYENLTGTGCKSLFSAISSPAAAANTTAVSLDIQVIELGWWLQ---GHCRCSKNADCNTM  1335
             G       GCK  FS++++ +       VSL++ +I+L WW+    G+  CS+NA+C  +
Sbjct  147   G-------GCKYWFSSVTTESRDGKP-GVSLNLGLIKLDWWITEGCGNTNCSENANCTEV  198

Query  1334  RTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTRCNPAKYLLGECGGKTRigvliggvi  1155
             + PG G  G RC C++GF GD +    GCR         K L+G   G            
Sbjct  199   KLPGGGL-GHRCTCNDGFRGDAFTVNGGCRSVHKHRGLYK-LIGLGTG------------  244

Query  1154  agaaLMVSVGLICCII------RRRLAM-KNWNRRRRELRETTG-ITIPVYSYKDIEKAT  999
                 ++V V LI  +I      ++R A   + +   R L E  G  ++P Y+YK+IEKAT
Sbjct  245   ----ILVGVLLIAILIYAYIYRQKRFAYTASTSIANRLLCELAGNSSVPFYTYKEIEKAT  300

Query  998   NNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIKLLSSVNHPNL  819
             ++FSDK +LG GAYGTVY+G+L  N  WVAIKR++H DT SI+QV NE+KL+SSV+HPNL
Sbjct  301   DSFSDKNKLGTGAYGTVYAGEL-PNSSWVAIKRLKHIDTSSIDQVLNEVKLVSSVSHPNL  359

Query  818   VRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKG-SGLPWPVRLGIVSETSQAIAYLHNA  642
             VRLLGC I +GE  LVYEFM NGTLSQHLQ E+G + L WP RL I S+T+ AIA+LH++
Sbjct  360   VRLLGCCISQGEPFLVYEFMSNGTLSQHLQHERGDTPLSWPFRLSIASQTANAIAHLHSS  419

Query  641   MHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGL---IESSHISTAPQGTPGYLDPQYH  471
             ++PPIYHRD+KSSNILLDY + SK++DFGLSR G+    + SHISTAPQ           
Sbjct  420   VNPPIYHRDIKSSNILLDYEFNSKLSDFGLSRLGMTTDFDMSHISTAPQ-----------  468

Query  470   QDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLEIIDPLI  291
                                    G K +DFTRP +EVNLA LAVD+IG+G + +I+DP +
Sbjct  469   -----------------------GFKVIDFTRPCDEVNLAVLAVDRIGRGRVKDIVDPCL  505

Query  290   EAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKWGI  141
             + E D    +S++ +AE+AFRCL+FHR+MRP+M+EV  +L+Q++L  +GI
Sbjct  506   KTENDPKMFASIHNLAELAFRCLSFHRNMRPTMLEVTEDLQQIKLMYFGI  555



>ref|NP_001067182.1| Os12g0595800 [Oryza sativa Japonica Group]
 gb|ABA99191.1| Protein kinase domain containing protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF30201.1| Os12g0595800 [Oryza sativa Japonica Group]
 gb|EAZ21095.1| hypothetical protein OsJ_36737 [Oryza sativa Japonica Group]
Length=725

 Score =   431 bits (1109),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 269/649 (41%), Positives = 370/649 (57%), Gaps = 96/649 (15%)
 Frame = -3

Query  1895  GSSTCNRSCGDGLKQLPFPFGFSSGCEILLNCT-----------SNGTMSIGEFPVYQL-  1752
             G   C R CG GL  +P+PFGFS  C ILL C            +NGT +  E   Y + 
Sbjct  38    GDERCRRKCG-GL-DVPYPFGFSGDCPILLACDEGNSTAALLRPTNGTSTTMEPLSYAVV  95

Query  1751  ------TPDTIMINIPAKCGRRI-EAMKPLFGKNFAPTSNNGILLQNCSSPELK-CMIPS  1596
                   T  T ++++   C R + +A   L G N+  +S+ G+ ++ C + +   C +P+
Sbjct  96    GKSFNSTASTFVVSLLPSCNRTVSDARLWLTGANYGVSSSTGLFVRGCQNAKNNSCSVPA  155

Query  1595  TMIQTQFELQDC---------GKDNISCF----SEPHMTGG---FIGYENLTGTGCKSLF  1464
               + +      C             ++C     +E  M  G   F  ++ +    C +L 
Sbjct  156   EAMSSMLTTAKCGGGGGGNGTASSPVTCIPTMSTEADMAKGVGLFAQWDKVEEPRCDNLL  215

Query  1463  SAISSPAAAANTTAVSLDIQVIELGWWLQGHCR------------CSKNADCNTMRTPGD  1320
             +++       N    +L+I V E+GWW+ G+C             C+ NA C+ +RTP  
Sbjct  216   TSVY--GETTNDGVFTLEIAVAEMGWWVNGNCSNHSAAAADLVGLCAANATCHDVRTP-S  272

Query  1319  GKPGFRCQCSEGFTGDGYQGGSGCRRDDTRCNPAKYLLGECGGKTRigvliggviagaaL  1140
             G  G +C+C EG  GDG+  G GC     + +  K L+   G            +    +
Sbjct  273   GAWGHQCRCLEGMDGDGFAAGEGCHFPAKKSSTKKILIIVGG------------VLAGTV  320

Query  1139  MVSVGLICCI------------IRRRLAMKNWNRRRRELRETTGITIPVYSYKDIEKATN  996
                V  +CC                RLA K   R   E   ++G+  PVYSY ++ +ATN
Sbjct  321   AAGVLFLCCARCRRSGGGGGRSGFDRLAAK---RLLSEAASSSGV--PVYSYHEVARATN  375

Query  995   NFSDKRRLGDGAYGTVYSGKL-HDNDEWVAIKRIRHRDTD-----SIEQVTNEIKLLSSV  834
             +FS   RLG GAYGTVY GKL   +   VAIKR+R R  D     ++  + NE+KL+SS+
Sbjct  376   SFSHTHRLGTGAYGTVYVGKLPASSPSLVAIKRMRRRHDDGDDDAAVAVLLNEVKLISSL  435

Query  833   NHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVSETSQAIAY  654
             +HP LVRLLGC +++GEQILVYEF+PNGTL+ HL    G GLPW  RLG+ +ET+ AIAY
Sbjct  436   SHPGLVRLLGCCLDRGEQILVYEFVPNGTLAHHL---AGGGLPWRARLGVAAETAAAIAY  492

Query  653   LHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSR-FGLIES---SHISTAPQGTPGYL  486
             LH A  PPI HRDVKSSNILLD + + ++ADFGLSR  G ++    SH+STAPQGTPGYL
Sbjct  493   LH-AKRPPILHRDVKSSNILLDGDLRPRLADFGLSRAVGRLDQASLSHVSTAPQGTPGYL  551

Query  485   DPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLEI  306
             DP+YHQ+FHLSDKSDVYSFGVVL+E+IT +K VDF RP  EVNLA+LA+D+IGKG + +I
Sbjct  552   DPEYHQNFHLSDKSDVYSFGVVLLELITAMKVVDFARPAAEVNLASLALDRIGKGRVDDI  611

Query  305   IDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMR  159
             +DP +    D W + SV  V+E+AFRCLAF +D+RP+M EVA EL ++R
Sbjct  612   VDPALVDRADEWVMRSVRHVSELAFRCLAFQKDVRPAMSEVAAELARIR  660



>ref|XP_004963056.1| PREDICTED: wall-associated receptor kinase-like 14-like isoform 
X2 [Setaria italica]
Length=713

 Score =   431 bits (1107),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 273/649 (42%), Positives = 366/649 (56%), Gaps = 82/649 (13%)
 Frame = -3

Query  1910  SAMVFGSSTCNRSCGDGLKQLPFPFGFSSGCEILLNCTSN--------GTMSIGEFPV--  1761
             SA       CNR C      +P+PFGFS  C ILL+C +         G+ +   +P+  
Sbjct  17    SATAAAGGGCNRRCNG--SPVPYPFGFSGDCPILLSCNATASTPQLRTGSTAAAPYPILS  74

Query  1760  YQLTPDTIMINIPAKCGRRI---EAMKPLFGKN----FAPTSNNGILLQ-NCSSPELK--  1611
             +  T  T ++++   C R +    A   +  +N    +  +S  G+ L+  CS    K  
Sbjct  75    FNSTRSTFVVSLVPLCNRTVGDANASLNVASQNGAAGYGVSSQTGLFLRGTCSGATPKAS  134

Query  1610  -CMIPSTMIQTQFELQDCGKDNI-SCFSEPHMT----------GGFIGYENLTGTGCKSL  1467
              C  P+ ++    +   C  D   +C   P  +          G F+ +  +   GC+  
Sbjct  135   NCSAPADIMAKLLKTARCVNDTAWTCVGSPPPSITAAENSKERGAFLDWGAVEAAGCEDA  194

Query  1466  FSAISSPAAAANTTAVSLDIQVIELGWWLQGHC-------RCSKNADCNTMRTPGDGKPG  1308
              +  ++    A     SL+  V ELGWWL G C        C+ NA C+ ++TP  G  G
Sbjct  195   LT-TATVYGIAPAGVPSLEFGVAELGWWLNGTCANATGGGECAHNATCHNVQTP-SGAWG  252

Query  1307  FRCQCSEGFTGDGYQGGSGCRRDDTRCNPAKYLLGECGGKTRigvliggviagaaLMVSV  1128
              RC C +G TGDG+  G GC     R             K +  +++ GV+AG A     
Sbjct  253   HRCACRDGMTGDGFAAGEGCHYGAER------------SKKKFLLVVAGVVAGVAAAAGA  300

Query  1127  GLICCI-IRRRLAMKNWNRRRRELR----ETTGITIPVYSYKDIEKATNNFSDKRRLGDG  963
              L+C +  RR  A ++ + R   +R      T   +PVYSY ++ +ATN+FS   RLG G
Sbjct  301   LLLCWVQCRRCKAGRSSSERLAAMRLLSEAATSSGVPVYSYAEVARATNSFSHTHRLGTG  360

Query  962   AYGTVYSGKL-HDNDEWVAIKRIRHRD---------TDSIEQVTNEIKLLSSVNHPNLVR  813
             AYGTVY GKL       VAIKR+R R            +   + NEIKL+SSV+HPNLVR
Sbjct  361   AYGTVYVGKLPASAPALVAIKRLRSRHHHEDDDDDAAAAAALLLNEIKLISSVSHPNLVR  420

Query  812   LLGCSIEKGEQILVYEFMPNGTLSQHL-------QREKGSGLPWPVRLGIVSETSQAIAY  654
             LLGC +++GEQILVYE++PNGTLSQHL            S L W  RLG+ +ET+ AIAY
Sbjct  421   LLGCCLDRGEQILVYEYVPNGTLSQHLLAGDSGGGGRGRSRLTWRARLGVAAETAAAIAY  480

Query  653   LHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSR----FGLIESSHISTAPQGTPGYL  486
             LH  M PPI+HRDVKSSNILLD + + K+ADFGLSR     G    SH+STAPQGTPGY+
Sbjct  481   LHG-MRPPIFHRDVKSSNILLDGSLRPKLADFGLSRAAGRLGEATRSHVSTAPQGTPGYV  539

Query  485   DPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLEI  306
             DP+YHQ FHLSDKSDVYSFGVVL+E+IT +K VDF RP  EVNLA+LA+D+IGKG + EI
Sbjct  540   DPEYHQCFHLSDKSDVYSFGVVLLELITAMKVVDFDRPAAEVNLASLALDRIGKGRVGEI  599

Query  305   IDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMR  159
             +DP I    + W + SV  V+E+AFRCLAFH+D+RP+M EVA EL ++R
Sbjct  600   VDPAILGGGEEWVMESVRHVSELAFRCLAFHKDVRPAMCEVAAELHRIR  648



>gb|EMT09586.1| Wall-associated receptor kinase-like 14 [Aegilops tauschii]
Length=712

 Score =   424 bits (1091),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 251/597 (42%), Positives = 348/597 (58%), Gaps = 87/597 (15%)
 Frame = -3

Query  1853  QLPFPFGFSSGCEILLNCTSN----------GTMSIGEFPVYQLTPDTIMINIPAKCGRR  1704
             +LP+PFGFSSGC I L C             G   +G   V  +T   +++++PA C RR
Sbjct  2     ELPYPFGFSSGCTIRLGCHVGADGVGAAWLGGARELGLL-VRNVTSRALILDLPADCSRR  60

Query  1703  I-EAMKPLFGKNFAPTSNNGILLQNCSS----PEL-KCMIPSTMIQTQFELQDCGKDNIS  1542
               E+++ LF  ++AP S N ++  +CS+    P+   C  P               ++I 
Sbjct  61    FNESVEALFSDSYAPASRNALVATSCSAAAGAPQTSNCSGPPYRYMDMPSSHCTANESIR  120

Query  1541  CFSEP-----HMTGG--FIGYENLTGTGCKSLFSAISSPAAAANTTAVSLDIQVIELGWW  1383
             C   P     ++T G  F+    +  + C  L SA+S   A       SL +  +EL WW
Sbjct  121   CILPPPRPHSNLTSGHHFLNKSEVLRSNCTVLVSAVSYSDAGGP----SLLLGALELDWW  176

Query  1382  LQGHCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGC-RRDDTRCNPAKYLL  1206
             + G CRC   A+C  +         F+C+C EG  GDG+  G+GC     ++C+ + YL 
Sbjct  177   VPGPCRCDARANCTQLPATRTRPEAFQCECPEGLQGDGFVDGTGCWEVSKSKCDRSNYLR  236

Query  1205  GECGGKTRigvliggviagaaLMVSVG-LICCIIRRRLAMKNWNRRRRELRETTGITIPV  1029
              +CG K  +  LI   I   A+++ +G ++C +++RR A     +  + L      T+P+
Sbjct  237   -DCG-KIVLVGLIMAGIVFGAMVMGIGCVVCHLVKRRSASIRSQQSTKRLLSEVDCTVPL  294

Query  1028  YSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIK  849
             YSY++IE+AT+ FS+ +RLG GAYGTVY+G+L DN   VA+KR        I+   N   
Sbjct  295   YSYREIERATSGFSEDQRLGTGAYGTVYAGRLSDN-RLVAVKR--------IKHRDNADG  345

Query  848   LLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVSETS  669
              L SV   N V+L                                          VS T+
Sbjct  346   GLDSVM--NEVKL------------------------------------------VSSTA  361

Query  668   QAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGL--IESSHISTAPQGTP  495
             +AIAYLH+ +HPPIYHRD+KSSNILLD+ Y SKVADFGLSR G+  ++SSHISTAPQGTP
Sbjct  362   KAIAYLHSEVHPPIYHRDIKSSNILLDHEYNSKVADFGLSRMGMPSVDSSHISTAPQGTP  421

Query  494   GYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGL  315
             GY+DPQYHQ+FHLSDKSDVYSFGVVLVEIIT +KAVDF+R  +EVNLA LAV+KIG+G +
Sbjct  422   GYVDPQYHQNFHLSDKSDVYSFGVVLVEIITAMKAVDFSRGPSEVNLAQLAVEKIGRGCV  481

Query  314   LEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKWG  144
              +I+DP ++  +D WTL+S++KVAE+AFRCLAFH ++RPSM EVA ELEQ+++S W 
Sbjct  482   DDIVDPFLDPHRDAWTLTSIHKVAELAFRCLAFHSEIRPSMAEVADELEQIQVSGWA  538



>ref|XP_004963055.1| PREDICTED: wall-associated receptor kinase-like 14-like isoform 
X1 [Setaria italica]
Length=759

 Score =   424 bits (1091),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 275/650 (42%), Positives = 363/650 (56%), Gaps = 93/650 (14%)
 Frame = -3

Query  1883  CNRSCGDGLKQLPFPFGFSSGCEILL--NCTSN-----GTMSIGEFPV--YQLTPDTIMI  1731
             CNR  G     +P+PFGFS  C I+L  N T++     G+ +   +PV  +  T  T ++
Sbjct  63    CNRQRGG--VTVPYPFGFSGDCPIILAFNQTTSTSLLQGSTAAAPYPVLSFNSTSSTFLV  120

Query  1730  NIPAKCGRRI-EAMKPLFGKNFAPTSNNGILLQNCSSPELKCM------------IPSTM  1590
              +   C R + EA   L G  +  +S  GI ++   S                  +PS +
Sbjct  121   ALSPLCNRTVPEAKASLSGAGYGVSSRTGIFVRGGCSSGGGGGAPAAKAAASSCAVPSDV  180

Query  1589  IQTQFELQDCGKDNISC--------------FSEPHMTGGFIGYENLTGTGCKSLFSAIS  1452
             +        CG ++ S                +     G F+ +E +   GC+   +A  
Sbjct  181   MTKLLRTAQCGGNDTSASWTCVASAPPDAGSAAAARGEGQFMRWEKVEAAGCQDALTA--  238

Query  1451  SPAAAANTT--AVSLDIQVIELGWWLQGHC-----------RCSKNADCNTMRTPGDGKP  1311
               A  A T     S++  V ELGWWL G C           RC+ NA C  + TP  G  
Sbjct  239   --AVYARTPLGVPSVEFGVAELGWWLAGTCANATSGGGGGGRCAANATCRDVVTP-SGAV  295

Query  1310  GFRCQCSEGFTGDGYQGGSGCRRDDTRCNPAKYLLGECGGKTRigvliggviagaaLMVS  1131
             G RC C +G  GDG+  G GC  D     P +        K +  +++ GV+AG A    
Sbjct  296   GHRCACRDGMVGDGFAAGEGCHFD----VPVER------SKKKFLLVVAGVVAGVAAAAG  345

Query  1130  VGLICCI-IRRRLAMKNWNRRRRELR----ETTGITIPVYSYKDIEKATNNFSDKRRLGD  966
               L+C +  RR  A ++ + R   +R      T   +PVYSY ++ +ATN+FS   RLG 
Sbjct  346   ALLLCWVQCRRCKAGRSSSERLAAMRLLSEAATSSGVPVYSYAEVARATNSFSHTHRLGT  405

Query  965   GAYGTVYSGKL-HDNDEWVAIKRIRHRD---------TDSIEQVTNEIKLLSSVNHPNLV  816
             GAYGTVY GKL       VAIKR+R R            +   + NEIKL+SSV+HPNLV
Sbjct  406   GAYGTVYVGKLPASAPALVAIKRLRSRHHHEDDDDDAAAAAALLLNEIKLISSVSHPNLV  465

Query  815   RLLGCSIEKGEQILVYEFMPNGTLSQHL-------QREKGSGLPWPVRLGIVSETSQAIA  657
             RLLGC +++GEQILVYE++PNGTLSQHL            S L W  RLG+ +ET+ AIA
Sbjct  466   RLLGCCLDRGEQILVYEYVPNGTLSQHLLAGDSGGGGRGRSRLTWRARLGVAAETAAAIA  525

Query  656   YLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSR----FGLIESSHISTAPQGTPGY  489
             YLH  M PPI+HRDVKSSNILLD + + K+ADFGLSR     G    SH+STAPQGTPGY
Sbjct  526   YLHG-MRPPIFHRDVKSSNILLDGSLRPKLADFGLSRAAGRLGEATRSHVSTAPQGTPGY  584

Query  488   LDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLE  309
             +DP+YHQ FHLSDKSDVYSFGVVL+E+IT +K VDF RP  EVNLA+LA+D+IGKG + E
Sbjct  585   VDPEYHQCFHLSDKSDVYSFGVVLLELITAMKVVDFDRPAAEVNLASLALDRIGKGRVGE  644

Query  308   IIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMR  159
             I+DP I    + W + SV  V+E+AFRCLAFH+D+RP+M EVA EL ++R
Sbjct  645   IVDPAILGGGEEWVMESVRHVSELAFRCLAFHKDVRPAMCEVAAELHRIR  694



>gb|ABG22068.1| Protein kinase domain containing protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAG92968.1| unnamed protein product [Oryza sativa Japonica Group]
Length=728

 Score =   421 bits (1083),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 269/658 (41%), Positives = 365/658 (55%), Gaps = 103/658 (16%)
 Frame = -3

Query  1895  GSSTCNRSCGDGLKQLPFPFGFSSGCEILLNCTSNGTMSIGE-FPV--------------  1761
             G   C R CG GL  +P+P GFS  C ILL C   G  +     P               
Sbjct  30    GGERCRRQCG-GL-VVPYPLGFSGSCPILLACVDAGNSTAALILPGGGGGGNATTTTSSY  87

Query  1760  ------YQLTPDTIMINIPAKCGRRI-EAMKPLFGKNFAPTSNNGILLQ------NCSSP  1620
                   +  +  T ++ +P  C R + EA + L G N+  +S  G+ L+      + +S 
Sbjct  88    SYTASNFNASRSTFVVALPPSCSRTVSEARRWLSGANYGVSSRTGLFLRGDCHRNSSASN  147

Query  1619  ELKCMIPSTMIQTQFELQDCGKDN------ISCFSEPHMTGGFIGYENLTGTGCKSLFS-  1461
                C IP+  +        CG +       ++C +           E+ +G+G   LF+ 
Sbjct  148   ATNCSIPAETMSRMVPTASCGAEGNTTASALTCVTSTSPAPDPAKPESSSGSGIVGLFAE  207

Query  1460  --AISSPAAAANTTAV---------SLDIQVIELGWWLQGHC-----------RCSKNAD  1347
                +  P+     T+V         SL+  V E+GWW+ G+C           RC+ NA 
Sbjct  208   WKKLEEPSCDNLLTSVYGDTREGVFSLEFSVAEMGWWVNGNCTHGGGGGDLAWRCAPNAT  267

Query  1346  CNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTRCNPAKYLLGECGGKTRigvli  1167
             C  ++TP  G  G +C+C  G  GDG+  G GC     + +  K L+   G         
Sbjct  268   CLNVQTPTGGW-GHQCKCLHGMVGDGFAAGEGCYFAAKKSSTKKILIIVGG---------  317

Query  1166  ggviagaaLMVSVGLICCI------------IRRRLAMKNWNRRRRELRETTGITIPVYS  1023
                +    +   V  +CC                RLA K   R   E   ++G+  PVYS
Sbjct  318   ---VLAGTVAAGVLFLCCARCRRSGGGGGRSGFDRLAAK---RLLSEAASSSGV--PVYS  369

Query  1022  YKDIEKATNNFSDKRRLGDGAYGTVYSGKL-HDNDEWVAIKRIRHRDTD-----SIEQVT  861
             Y ++ +ATN+FS   RLG GAYGTVY GKL   +   VAIKR+R R  D     ++  + 
Sbjct  370   YHEVARATNSFSHTHRLGTGAYGTVYVGKLPASSPSLVAIKRMRRRHDDGDDDAAVAVLL  429

Query  860   NEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIV  681
             NE+KL+SS++HP LVRLLGC +++GEQILVYEF+PNGTL+ HL    G GLPW  RLG+ 
Sbjct  430   NEVKLISSLSHPGLVRLLGCCLDRGEQILVYEFVPNGTLAHHLA---GGGLPWRARLGVA  486

Query  680   SETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSR-FGLIES---SHIST  513
             +ET+ AIAYLH A  PPI HRDVKSSNILLD + + ++ADFGLSR  G ++    SH+ST
Sbjct  487   AETAAAIAYLH-AKRPPILHRDVKSSNILLDGDLRPRLADFGLSRAVGRLDQASLSHVST  545

Query  512   APQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDK  333
             APQGTPGYLDP+YHQ+FHLSDKSDVYSFGVVL+E+IT +K VDF RP  EVNLA+LA+D+
Sbjct  546   APQGTPGYLDPEYHQNFHLSDKSDVYSFGVVLLELITAMKVVDFARPAAEVNLASLALDR  605

Query  332   IGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMR  159
             IGKG + +I+DP +    D W + SV  V+E+AFRCLAF +D+RP+M EVA EL ++R
Sbjct  606   IGKGRVDDIVDPALVDRADEWVMRSVRHVSELAFRCLAFQKDVRPAMSEVAAELARIR  663



>ref|XP_003577672.1| PREDICTED: wall-associated receptor kinase-like 14 [Brachypodium 
distachyon]
 ref|XP_010237077.1| PREDICTED: wall-associated receptor kinase-like 14 [Brachypodium 
distachyon]
Length=705

 Score =   416 bits (1069),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 263/628 (42%), Positives = 359/628 (57%), Gaps = 68/628 (11%)
 Frame = -3

Query  1883  CNRSCGDGLKQLPFPFGFSSGCEILLNCTS-------NGTMSIGEFPV--YQLTPDTIMI  1731
             CNR CG G   +P+PFGFS+GC I L+C         N T +     V  +  +  T+++
Sbjct  35    CNRRCGGG--GVPYPFGFSAGCPIPLSCDDANSSALLNATHTTAPCRVVSFNSSASTVVV  92

Query  1730  NIPAKCGRRIEAMKP-LFGKNFAPTSNNGILLQN--CSS-PELK-CMIPSTMIQTQFELQ  1566
             ++P  C R +E  K  L G N+  ++  G+ L+   C + P    C +P+ ++       
Sbjct  93    SLPPSCDRTVEQAKAALSGANYGVSARTGLFLRGGGCRAWPNASACSVPAGVMSRLLRNA  152

Query  1565  DC-GKDNISCFS-----------EPHMTGGFIGYENLTGTGCKSLFSAISSPAAAANTTA  1422
              C G D  +  +           +      F+ ++    T C  L ++     A      
Sbjct  153   QCIGNDTSAGAAAGAVACVASAAQNATAETFLSWDKAEKTKCDDLLTSAVYMDAEDQGAG  212

Query  1421  VSLDIQVIELGWWLQGHCRCSKNA----DCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGS  1254
              SL+  V ELGWWL G C  +        C  +RTPG+   G RC C  G  GDG+  G 
Sbjct  213   GSLEFGVAELGWWLNGTCAAAGRCAANATCTDVRTPGN-TAGHRCACEAGLEGDGFSAGD  271

Query  1253  GCRRDDTRCNPAKYLLGECG-GKTRigvliggviagaaLMVSVGLICCIIRRRLAM----  1089
             GC           YL  + G  K  + ++ G + +      SV L+C   RRR       
Sbjct  272   GC-----------YLRAKRGRSKKTVAIIGGVLASVTVAAASVLLLCWAQRRRSGCYGRS  320

Query  1088  -KNWNRRRRELRETTGIT-IPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDE-  918
               N +  +R L E    + +PVYSY ++ +AT++FS   RLG GAYGTVY G+L  +   
Sbjct  321   DSNRSAAKRLLSEAAASSGVPVYSYNEMARATSSFSHTHRLGTGAYGTVYVGRLPTSSPV  380

Query  917   WVAIKRIRHRDT------DSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMP  756
              VAIKR+R R         ++ ++ NEIKL+SS++HPNLVRLLGC +++GEQILVYEF+P
Sbjct  381   LVAIKRLRCRHDDDDDDGKAVSRLLNEIKLISSLSHPNLVRLLGCCLDRGEQILVYEFVP  440

Query  755   NGTLSQHLQREKGSG--LPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYN  582
             NGTLS HL      G  L W  RL + +  + A+AYL +A  PPI HRD+KSSNILL  +
Sbjct  441   NGTLSHHLIGGGNGGVRLLWRARLRVAAGIAAAVAYL-HAARPPILHRDIKSSNILLGTD  499

Query  581   YKSKVADFGLSRFGL-----IESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVL  417
              ++K+ADFGLSR G         SH+STAPQGTPGY+DP+YHQ FHLSDKSDVYSFGVVL
Sbjct  500   LRAKLADFGLSRVGAGLDLSSTRSHVSTAPQGTPGYVDPEYHQSFHLSDKSDVYSFGVVL  559

Query  416   VEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLEIIDP--LIEAEKDVWTLSSVNKVA  243
             +E+IT +K VD  RP NEVNLA+LA+D+IGKG + EI+DP  L+E   + W + SV  V+
Sbjct  560   LELITAMKVVDLDRPPNEVNLASLALDRIGKGRVHEIVDPVLLVENGGEEWVMESVRHVS  619

Query  242   EIAFRCLAFHRDMRPSMMEVAIELEQMR  159
             E+AFRCLAF +D+RPSM EVA EL ++R
Sbjct  620   ELAFRCLAFDKDVRPSMSEVAAELCRIR  647



>ref|XP_002442442.1| hypothetical protein SORBIDRAFT_08g020100 [Sorghum bicolor]
 gb|EES16280.1| hypothetical protein SORBIDRAFT_08g020100 [Sorghum bicolor]
Length=743

 Score =   417 bits (1072),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 257/662 (39%), Positives = 357/662 (54%), Gaps = 87/662 (13%)
 Frame = -3

Query  1910  SAMVFGSSTCNRSCGDGLKQLPFPFGFSSGCEILLNCTSNGTMSIGEFP-----------  1764
             ++ V G   C+R CG     +P+P GFS  C I L C    + +    P           
Sbjct  23    TSAVNGGVRCDRQCGS--TTVPYPLGFSGDCPITLTCNQTSSAASLLLPHSAGTAASPYT  80

Query  1763  --VYQLTPDTIMINIPAKCGRRI-EAMKPLFGKNFAPTSNNGILLQNC---SSPELKCMI  1602
                +  +  T ++++P  C R + EA   L G  +  T++ G+ L+      S    C +
Sbjct  81    ILSFNASASTFLVSLPTSCNRTVGEARAALNGSGYGVTNHTGLFLRGSCRSHSAAANCSV  140

Query  1601  PSTMIQTQFELQDCGKDNISCFS---------------------------------EPHM  1521
              ++++ T      CG +  + ++                                 +   
Sbjct  141   SASVMATVLRTAGCGDNGTTAWTCVAQLPLSSGSSPNSSSSTTAAAAPAARGGEDGQSSS  200

Query  1520  TGGFIGYENLTGTGCKSLFSAISSPAAAANTTAVSLDIQVIELGWWLQGHCR----CSKN  1353
             +  F+ ++ +   GC+   +++           +S+++   ELGWWL G C     C++N
Sbjct  201   SSSFLPWKKVDDAGCEDALTSVVYTFTPEGL--LSVELAAAELGWWLNGACAGNATCAQN  258

Query  1352  ADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTRCNPAKYLLGECGGKTRigv  1173
             A C  + TP  G  G RC C +G +GDGY  G GC       +  K +     G      
Sbjct  259   ATCYDVETPTGGS-GHRCACVDGMSGDGYAAGDGCHFGGAAGSSKKKVFLIAAGVLAGVA  317

Query  1172  liggviagaaLMVSVGLICCIIRRRLAMKNWNRRRRELRETTGITIPVYSYKDIEKATNN  993
                G++                  RLA     R   E   ++G+  PVYS+ +I +ATN+
Sbjct  318   AAAGLLLLWRRRCRRYKAGRSASERLAAM---RLLSEAAASSGV--PVYSFAEIARATNS  372

Query  992   FSDKRRLGDGAYGTVYSGKLHDNDE-----WVAIKRIRHRDTDSIEQVT-------NEIK  849
             FS   RLG GAYGTVY GKL  +        VAIKR+R R     +          NEIK
Sbjct  373   FSHTHRLGTGAYGTVYVGKLPGSSSAPAAALVAIKRLRCRLHHDDDDAAAEAALLLNEIK  432

Query  848   LLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSG-------LPWPVRL  690
             L+S+V+HPNLVRLLGC +++GEQ+LVYE++PNGTLSQHL      G       L W  RL
Sbjct  433   LISAVSHPNLVRLLGCCLDRGEQVLVYEYVPNGTLSQHLVSSSSGGGGGVRSRLTWRARL  492

Query  689   GIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSR-FGLIES--SHI  519
             G+ +ET+ AIAYLH  M PPI+HRDVKSSNILLD   + K+ADFGLSR    +E+  SH+
Sbjct  493   GVAAETAAAIAYLHG-MRPPIFHRDVKSSNILLDGALRPKLADFGLSRAVDRLEAARSHV  551

Query  518   STAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAV  339
             STAPQGTPGY+DP+YHQ+FHLSDKSDVYSFGVVL+E+IT +K VDF RP  EVNLA+LA+
Sbjct  552   STAPQGTPGYVDPEYHQNFHLSDKSDVYSFGVVLLELITAMKVVDFDRPPAEVNLASLAL  611

Query  338   DKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMR  159
             D+IGKG + EI+DP + A  + W + SV  V+E+AFRCLAF +D+RPSM EVA EL ++R
Sbjct  612   DRIGKGRVSEIVDPALLAGDEDWVMGSVRLVSELAFRCLAFQKDVRPSMSEVAAELHRIR  671

Query  158   LS  153
             L+
Sbjct  672   LA  673



>ref|XP_010535318.1| PREDICTED: wall-associated receptor kinase-like 21, partial [Tarenaya 
hassleriana]
Length=284

 Score =   387 bits (995),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 186/268 (69%), Positives = 224/268 (84%), Gaps = 4/268 (1%)
 Frame = -3

Query  950  VYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILV  771
            VY+GKL  N  WVA+KR+R RDT SI+QV NEIKLLSSVNHPNLVRLLGC I  GE ILV
Sbjct  1    VYAGKL-ANGSWVAVKRLRRRDTKSIDQVVNEIKLLSSVNHPNLVRLLGCCIAHGEPILV  59

Query  770  YEFMPNGTLSQHLQREKGSG-LPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNIL  594
            YEFMPNGTLSQHLQRE G+  LP  +RL I S+T+ AIA+LH++++PPIYHRD+KSSNIL
Sbjct  60   YEFMPNGTLSQHLQREGGNAPLPLRLRLAIASQTANAIAHLHSSVNPPIYHRDIKSSNIL  119

Query  593  LDYNYKSKVADFGLSRFGLIE--SSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVV  420
            LDY++ SK++DFGLSR G+ E  +SHISTAPQGTPGYLDPQYHQDF LSDKSDVYSFGVV
Sbjct  120  LDYSFNSKISDFGLSRLGMTEFDASHISTAPQGTPGYLDPQYHQDFQLSDKSDVYSFGVV  179

Query  419  LVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAE  240
            LVEII+ +K +DF+RP +EVNLAALAVD+IG+G + EI+DP ++ E D      V   AE
Sbjct  180  LVEIISAMKVIDFSRPFSEVNLAALAVDRIGQGRVEEIVDPYLKTETDPRKFGYVQNAAE  239

Query  239  IAFRCLAFHRDMRPSMMEVAIELEQMRL  156
            +AFRCL+FHRDMRP+M EVA EL+++R+
Sbjct  240  LAFRCLSFHRDMRPTMTEVAEELQRIRV  267



>ref|XP_009419441.1| PREDICTED: wall-associated receptor kinase-like 14 [Musa acuminata 
subsp. malaccensis]
Length=365

 Score =   386 bits (992),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 200/350 (57%), Positives = 256/350 (73%), Gaps = 4/350 (1%)
 Frame = -3

Query  1205  GECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAMKNWNRRRRELRETTGITIPVY  1026
             G+C   +++G  +GGV+A  +LM+ V      IRR        +  R L   T  T+  +
Sbjct  9     GDCWSGSKVGAFLGGVLAAVSLMLGVAFFREYIRRLSTASRGKQITRRLLSQTSCTVATF  68

Query  1025  SYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIKL  846
             S K++E+AT+NF+    LG GAY TVY GKL  N   VAIKR++H D D I    NEIKL
Sbjct  69    SLKNVERATSNFAGTSVLGAGAYSTVYVGKL-SNAGLVAIKRLKHDDVDLI---INEIKL  124

Query  845   LSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVSETSQ  666
             +SSV+HPN+VRLLGC IE GE ILVYEFMPNGTLSQHL+R++G GL W  R+ I ++ + 
Sbjct  125   VSSVSHPNVVRLLGCCIESGEHILVYEFMPNGTLSQHLRRKRGDGLSWHARVSIAADVAT  184

Query  665   AIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGTPGYL  486
             A+AYLH A+ PPIYHRDVKSSNILLDY+ + K+ADFGL+   ++ESS+ ST PQGT GY+
Sbjct  185   AVAYLHTAVQPPIYHRDVKSSNILLDYDLRPKLADFGLATPAMVESSNASTVPQGTMGYV  244

Query  485   DPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLEI  306
             DPQ H +FHLSDK DVYSFGVVLVE+IT +K VDF R  +EVNLAALA D+IGKG + +I
Sbjct  245   DPQCHCNFHLSDKCDVYSFGVVLVEMITAMKVVDFGRATSEVNLAALATDRIGKGMVEDI  304

Query  305   IDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRL  156
             +DP I+ + D  T +SV +VAE+AFRCLAF+R+ RPSM EVA ELE++R+
Sbjct  305   VDPFIKGDWDDRTRASVQEVAEVAFRCLAFYREARPSMAEVAEELERIRI  354



>gb|ABA99190.2| Protein kinase domain containing protein, expressed [Oryza sativa 
Japonica Group]
Length=613

 Score =   394 bits (1011),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 226/454 (50%), Positives = 295/454 (65%), Gaps = 56/454 (12%)
 Frame = -3

Query  1418  SLDIQVIELGWWLQGHC------------RCSKNADCNTMRTPGDGKPGFRCQCSEGFTG  1275
             +L++ V ELGWW+ G C            RC+ NA C+ ++TPG G+ G +C+C  GFTG
Sbjct  117   ALELAVAELGWWVNGSCKHSAAAAGNLSGRCAANATCHDVQTPG-GEWGHQCKCLPGFTG  175

Query  1274  DGYQGGSGCRRDDTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCI-----  1110
             DG+  G GC     + +  K L+   G            +    +   V  +CC      
Sbjct  176   DGFAAGDGCNLSAKKSSTKKILIIVGG------------VLAGTVAAGVLFLCCARCRRS  223

Query  1109  -------IRRRLAMKNWNRRRRELRETTGITIPVYSYKDIEKATNNFSDKRRLGDGAYGT  951
                       RLA K   R   E   ++G+  PVYSY ++ +ATN+FS   RLG GAYGT
Sbjct  224   GGGGGRSGFDRLAAK---RLLSEAASSSGV--PVYSYHEVARATNSFSHTHRLGTGAYGT  278

Query  950   VYSGKL-HDNDEWVAIKRIRHRDTD-----SIEQVTNEIKLLSSVNHPNLVRLLGCSIEK  789
             VY GKL   +   VAIKR+R R  D     ++  + NE+KL+SS++HP LVRLLGC +++
Sbjct  279   VYVGKLPASSPSLVAIKRMRRRHDDGDDDAAVAVLLNEVKLISSLSHPGLVRLLGCCLDR  338

Query  788   GEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVK  609
             GEQILVYEF+PNGTL+ HL    G GLPW  RLG+ +ET+ AIAYLH A  PPI HRDVK
Sbjct  339   GEQILVYEFVPNGTLAHHL---AGGGLPWRARLGVAAETAAAIAYLH-AKRPPILHRDVK  394

Query  608   SSNILLDYNYKSKVADFGLSR-FGLIES---SHISTAPQGTPGYLDPQYHQDFHLSDKSD  441
             SSNILLD + + ++ADFGLSR  G ++    SH+STAPQGTPGYLDP+YHQ+FHLSDKSD
Sbjct  395   SSNILLDGDLRPRLADFGLSRAVGRLDQASLSHVSTAPQGTPGYLDPEYHQNFHLSDKSD  454

Query  440   VYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLEIIDPLIEAEKDVWTLS  261
             VYSFGVVL+E+IT +K VDF RP  EVNLA+LA+D+IGKG + +I+DP +    D W + 
Sbjct  455   VYSFGVVLLELITAMKVVDFARPAAEVNLASLALDRIGKGRVDDIVDPALVDRADEWVMR  514

Query  260   SVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMR  159
             SV  V+E+AFRCLAF +D+RP+M EVA EL ++R
Sbjct  515   SVRHVSELAFRCLAFQKDVRPAMSEVAAELARIR  548



>ref|XP_002993997.1| hypothetical protein SELMODRAFT_25054, partial [Selaginella moellendorffii]
 gb|EFJ04937.1| hypothetical protein SELMODRAFT_25054, partial [Selaginella moellendorffii]
Length=287

 Score =   353 bits (907),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 177/289 (61%), Positives = 220/289 (76%), Gaps = 4/289 (1%)
 Frame = -3

Query  1028  YSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIK  849
             +SYKD+E+AT +FS  + LG G +GTVY GKL D  + VA+KRI H  +  IEQV NE+K
Sbjct  1     FSYKDLERATKDFSPAQMLGHGGHGTVYKGKLPDGRD-VAVKRINHISSHGIEQVLNEVK  59

Query  848   LLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVSETS  669
             +L SV+HPNLV+LLGC +E  + +LVYEF+PNGTL++HLQRE+G GL W  R+ I +E +
Sbjct  60    VLLSVSHPNLVQLLGCCLEVYDPLLVYEFVPNGTLAEHLQRERGDGLDWFTRVAIAAEAA  119

Query  668   QAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGTPGY  489
             Q IAYLH +  PPIYHRDVKS+NILLD  + +KV DFGLSR  L E+SH+STAPQGTPGY
Sbjct  120   QGIAYLH-SRSPPIYHRDVKSTNILLDGEFNTKVGDFGLSRTALTEASHVSTAPQGTPGY  178

Query  488   LDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLE  309
             +DP YHQ F LSDKSDVYSFGVVLVE+IT +K VDFTR + EVNLAALAV KI    L E
Sbjct  179   VDPDYHQSFQLSDKSDVYSFGVVLVEMITSMKVVDFTRDKREVNLAALAVGKIATDCLDE  238

Query  308   IIDP--LIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELE  168
             IIDP  +I+A ++      + ++AE+AFRCLA  +D RPSM EV  E+E
Sbjct  239   IIDPALMIQACRNPVVRCMIQRMAELAFRCLAHEKDARPSMAEVFDEVE  287



>emb|CBI38365.3| unnamed protein product [Vitis vinifera]
Length=628

 Score =   359 bits (922),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 218/412 (53%), Positives = 283/412 (69%), Gaps = 19/412 (5%)
 Frame = -3

Query  1925  LLLLQSAMVFGSSTCNRSCGDG--LKQLPFPFGFSSGCEILLNCTSNGTMSIGEFPVYQL  1752
             +L L   +   S+  N SCG G   K++ +PFGFSS   I LNC+  G + I  F V  +
Sbjct  19    ILALICTVTLVSAIKNDSCGTGKSAKRVHYPFGFSSDSPIKLNCSKEGEIEIQNFKVQNV  78

Query  1751  TPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMIQTQFE  1572
             T D+I+IN+PA+C R I+ ++PLFGKN+A +S N +L QNCSS    C+IP+++   Q +
Sbjct  79    TTDSIIINLPAQCQREIQKIEPLFGKNYALSSKNSLLFQNCSSSSSGCVIPTSVFNGQNK  138

Query  1571  LQDC-GK--DNISCF---SEPHMTGGFIGYENLTGTGCKSLFSAISSPAAAANTTAVSLD  1410
             L +C GK  +NISCF   SE      F+ + N+TGTGCK  F  +S      N +AVSL+
Sbjct  139   LNNCNGKSDNNISCFPLDSESE----FMSFANVTGTGCK--FLLLSMAVEWRNNSAVSLE  192

Query  1409  IQVIELGWWLQGHCRCSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTR  1230
             +   +LGWWL   C C+ NA    +  PG    G RC C EGF GDG++ G GC+ + T 
Sbjct  193   LGTAQLGWWLDHPCHCAPNAKHTNLTVPGGF--GCRCSCKEGFDGDGFKDGDGCQ-EVTD  249

Query  1229  CNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAMKNWNRRRRELRET  1050
             CN +KY+ G CGG TR+ VL+GGVI GA+LM +V LIC  IRRR  ++     +R + E 
Sbjct  250   CNASKYMSGTCGGTTRVAVLVGGVIVGASLMSTVALICYCIRRRSYLRRRMSAKRLICEA  309

Query  1049  TG-ITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSI  873
              G  ++P+Y YK++E+ATN FS+K+RLG GAYGTV++GKLH NDEWVAIK+IR+RD DSI
Sbjct  310   AGNSSVPLYPYKEVERATNGFSEKQRLGTGAYGTVFAGKLH-NDEWVAIKKIRNRDNDSI  368

Query  872   EQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKG  717
             EQV NEIKL+SSVNHPNLVRLLGC IE GEQILVYEFM NGTLSQHLQ+E+G
Sbjct  369   EQVMNEIKLISSVNHPNLVRLLGCCIENGEQILVYEFMANGTLSQHLQKERG  420


 Score =   134 bits (337),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 95/132 (72%), Gaps = 3/132 (2%)
 Frame = -3

Query  395  KAVDFTRPQNEVNLAALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAF  216
            K VDF+RP +EVNLAALA+D+IG+G + EIIDP +E ++D WTL S++KVAE+AFRCLAF
Sbjct  421  KVVDFSRPHSEVNLAALAIDRIGRGCVDEIIDPFLEPQRDAWTLCSIHKVAELAFRCLAF  480

Query  215  HRDMRPSMMEVAIELEQMRLSKWG-IsedsiitassssssrsssdasEKPLSFSTMKPSE  39
            HRDMRPSMMEVA ELE +RLS W  + E+  + +S +SS         +P     +   E
Sbjct  481  HRDMRPSMMEVADELEHVRLSGWAPMEENICVASSVASSWSRRLFVPHRPT--DCLASME  538

Query  38   KVTESSPVSVQD  3
            ++ +SSPVSV D
Sbjct  539  EIKDSSPVSVHD  550



>ref|XP_002979084.1| hypothetical protein SELMODRAFT_25174, partial [Selaginella moellendorffii]
 gb|EFJ20041.1| hypothetical protein SELMODRAFT_25174, partial [Selaginella moellendorffii]
Length=283

 Score =   347 bits (889),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 174/285 (61%), Positives = 216/285 (76%), Gaps = 4/285 (1%)
 Frame = -3

Query  1016  DIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIKLLSS  837
             D+E+AT +FS  + LG G +GTVY GKL D  + VA+KRI H  +  IEQV NE+K+L S
Sbjct  1     DLERATKDFSPAQMLGHGGHGTVYKGKLPDGRD-VAVKRINHISSHGIEQVLNEVKVLLS  59

Query  836   VNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVSETSQAIA  657
             V+HPNLV+LLGC +E  + +LVYEF+PNGTL++HLQRE+G GL W  R+ I +E +Q IA
Sbjct  60    VSHPNLVQLLGCCLEVYDPLLVYEFVPNGTLAEHLQRERGDGLDWFTRVAIAAEAAQGIA  119

Query  656   YLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGTPGYLDPQ  477
             YLH +  PPIYHRDVKS+NILLD  + +KV DFGLSR  L E+SH+STAPQGTPGY+DP 
Sbjct  120   YLH-SRSPPIYHRDVKSTNILLDGEFNTKVGDFGLSRTALTEASHVSTAPQGTPGYVDPD  178

Query  476   YHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLEIIDP  297
             YHQ F LSDKSDVYSFGVVLVE+IT +K VDFTR + EVNLAALAV KI    L EIIDP
Sbjct  179   YHQSFQLSDKSDVYSFGVVLVEMITSMKVVDFTRDKREVNLAALAVGKIATDCLDEIIDP  238

Query  296   --LIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELE  168
               +I+A ++      + ++AE+AFRCLA  +D RPSM EV  E+E
Sbjct  239   ALMIQACRNPVVRCMIQRMAELAFRCLAHEKDARPSMAEVFDEVE  283



>gb|ACN87687.1| kinase-like protein [Corylus avellana]
Length=184

 Score =   325 bits (832),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 152/184 (83%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = -3

Query  998  NNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIKLLSSVNHPNL  819
            N+FSDK+RLG GAYGTVY+GKLH +++WVAIKRI+HRDT+SIEQV NEIKLLSSV+HPNL
Sbjct  1    NSFSDKQRLGTGAYGTVYAGKLHGSEDWVAIKRIKHRDTESIEQVMNEIKLLSSVSHPNL  60

Query  818  VRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVSETSQAIAYLHNAM  639
            VRLLGCSIE GEQILVYEFMPNGTL QHLQRE+G GLPW VRL I SET+QAIA+LH+A+
Sbjct  61   VRLLGCSIEYGEQILVYEFMPNGTLCQHLQRERGDGLPWQVRLTIASETAQAIAHLHSAI  120

Query  638  HPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGTPGYLDPQYHQDFH  459
            +PPIYHRD+KSSNILLDY++KSKVADFGLSR G+ E SHISTAPQGTPGYLDPQYHQ FH
Sbjct  121  NPPIYHRDIKSSNILLDYDFKSKVADFGLSRLGMTEISHISTAPQGTPGYLDPQYHQCFH  180

Query  458  LSDK  447
            LSDK
Sbjct  181  LSDK  184



>gb|ACN87686.1| kinase-like protein [Corylus avellana]
Length=184

 Score =   325 bits (832),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 152/183 (83%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = -3

Query  995  NFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIKLLSSVNHPNLV  816
            NFSDK+RLG GAYGTVY+GKLH +++WVAIKRI+HRDT+SIEQV NEIKLLSSV+HPNLV
Sbjct  2    NFSDKQRLGTGAYGTVYAGKLHGSEDWVAIKRIKHRDTESIEQVMNEIKLLSSVSHPNLV  61

Query  815  RLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVSETSQAIAYLHNAMH  636
            RLLGCSIE GEQILVYEFMPNGTL QHLQRE+G GLPW VRL I SET+QAIA+LH+A++
Sbjct  62   RLLGCSIEYGEQILVYEFMPNGTLCQHLQRERGDGLPWQVRLTIASETAQAIAHLHSAIN  121

Query  635  PPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGTPGYLDPQYHQDFHL  456
            PPIYHRD+KSSNILLDY++KSKVADFGLSR G+ E SHISTAPQGTPGYLDPQYHQ FHL
Sbjct  122  PPIYHRDIKSSNILLDYDFKSKVADFGLSRLGMTEISHISTAPQGTPGYLDPQYHQCFHL  181

Query  455  SDK  447
            SDK
Sbjct  182  SDK  184



>gb|ACN87688.1| kinase-like protein [Corylus avellana]
Length=184

 Score =   322 bits (825),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 151/184 (82%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = -3

Query  998  NNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIKLLSSVNHPNL  819
            N+FSDK+RLG GAYGTVY+GKLH +++WVAIKRI+HRDT+SIEQV NEIKLLSSV+HPNL
Sbjct  1    NSFSDKQRLGTGAYGTVYAGKLHGSEDWVAIKRIKHRDTESIEQVMNEIKLLSSVSHPNL  60

Query  818  VRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVSETSQAIAYLHNAM  639
            VRLLGCSIE GEQILVYEFMPNGTL QHLQRE+  GLPW VRL I SET+QAIA+LH+A+
Sbjct  61   VRLLGCSIEYGEQILVYEFMPNGTLCQHLQRERRDGLPWQVRLTIASETAQAIAHLHSAI  120

Query  638  HPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGTPGYLDPQYHQDFH  459
            +PPIYHRD+KSSNILLDY++KSKVADFGLSR G+ E SHISTAPQGTPGYLDPQYHQ FH
Sbjct  121  NPPIYHRDIKSSNILLDYDFKSKVADFGLSRLGMTEISHISTAPQGTPGYLDPQYHQCFH  180

Query  458  LSDK  447
            LSDK
Sbjct  181  LSDK  184



>gb|ACN87685.1| kinase-like protein [Corylus avellana]
Length=184

 Score =   322 bits (824),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 151/184 (82%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = -3

Query  998  NNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIKLLSSVNHPNL  819
            N+FSDK+RLG GAYGTVY+GKLH +++WVAIKRI+HRDT+SIEQV NEIKLLSSV+HPNL
Sbjct  1    NSFSDKQRLGTGAYGTVYAGKLHGSEDWVAIKRIKHRDTESIEQVMNEIKLLSSVSHPNL  60

Query  818  VRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVSETSQAIAYLHNAM  639
            VRLLGCSIE GEQILVYE MPNGTL QHLQRE+G GLPW VRL I SET+QAIA+LH+A+
Sbjct  61   VRLLGCSIEYGEQILVYESMPNGTLCQHLQRERGDGLPWQVRLTIASETAQAIAHLHSAI  120

Query  638  HPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGTPGYLDPQYHQDFH  459
            +PPIYHRD+KSSNILLDY++KSKVADFGLSR G+ E SHISTAPQGTPGYLDPQYHQ FH
Sbjct  121  NPPIYHRDIKSSNILLDYDFKSKVADFGLSRLGMTEISHISTAPQGTPGYLDPQYHQCFH  180

Query  458  LSDK  447
            LSDK
Sbjct  181  LSDK  184



>gb|ACI05974.1| kinase-like protein pac.W.ArB.305 [Platanus x acerifolia]
 gb|ACI05975.1| kinase-like protein pac.W.ArB.312 [Platanus x acerifolia]
Length=183

 Score =   317 bits (812),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 149/184 (81%), Positives = 166/184 (90%), Gaps = 1/184 (1%)
 Frame = -3

Query  998  NNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIKLLSSVNHPNL  819
            N FS+K+RLG GAYGTVY+GKLH+ D WVAIK+IRHRD D IEQV NEIKLLSSV+HPNL
Sbjct  1    NGFSEKQRLGTGAYGTVYAGKLHNVD-WVAIKKIRHRDNDGIEQVMNEIKLLSSVSHPNL  59

Query  818  VRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVSETSQAIAYLHNAM  639
            VRLLGC IEKGEQILVYEFMPNGTLSQHLQRE  +GLPW  RL I +ET+ AIA+LH+A+
Sbjct  60   VRLLGCCIEKGEQILVYEFMPNGTLSQHLQREISTGLPWMTRLTIATETAHAIAHLHSAI  119

Query  638  HPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGTPGYLDPQYHQDFH  459
            +PPI+HRD+KSSNILLDYNY SKVADFGLSR G+ ESSHISTAPQGTPGYLDPQYHQ+FH
Sbjct  120  NPPIFHRDIKSSNILLDYNYNSKVADFGLSRLGMTESSHISTAPQGTPGYLDPQYHQNFH  179

Query  458  LSDK  447
            LSDK
Sbjct  180  LSDK  183



>ref|XP_002960238.1| hypothetical protein SELMODRAFT_139490 [Selaginella moellendorffii]
 gb|EFJ37777.1| hypothetical protein SELMODRAFT_139490 [Selaginella moellendorffii]
Length=351

 Score =   319 bits (817),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 154/290 (53%), Positives = 213/290 (73%), Gaps = 5/290 (2%)
 Frame = -3

Query  1031  VYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEI  852
             V+++++++ AT +F++ R LG G + TVY GKL D    VA+K++   +   I+Q  NE+
Sbjct  2     VFTFRELKTATKSFAESRLLGGGGFSTVYQGKLPDG-RIVAVKKLNQGNKQGIQQFQNEV  60

Query  851   KLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVSET  672
              +LS V HPNLV+LLG  +E  + +LVYEF+ NGTL+ HL  EKG+GL    R+ I  ET
Sbjct  61    NILSQVRHPNLVQLLGYCLEGRDLLLVYEFVLNGTLADHLHGEKGNGLSLETRITIALET  120

Query  671   SQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGTPG  492
             +QA+AYLH  + PPIYHRDVK+SNILLD ++K+KVADFGLSR   ++++HISTAPQGTPG
Sbjct  121   AQALAYLHFYVKPPIYHRDVKTSNILLDKDFKAKVADFGLSRLTHLDATHISTAPQGTPG  180

Query  491   YLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLL  312
             YLDP YH+ + L+DKSDVYSFGVVL+E+I+  KAVD TR + E+NLA++A+ +I  G L 
Sbjct  181   YLDPDYHESYQLTDKSDVYSFGVVLLELISRKKAVDMTRDKKEINLASMALARIHSGALH  240

Query  311   EIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQM  162
             E+ DP +  +   W L  + ++ E+AFRCLA  +D RPSM+EV  ELEQ+
Sbjct  241   ELFDPDLSVK--YWKL--LTRLVEVAFRCLAAEKDDRPSMVEVVRELEQL  286



>ref|XP_002967476.1| hypothetical protein SELMODRAFT_87751 [Selaginella moellendorffii]
 gb|EFJ32075.1| hypothetical protein SELMODRAFT_87751 [Selaginella moellendorffii]
Length=351

 Score =   319 bits (817),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 154/290 (53%), Positives = 213/290 (73%), Gaps = 5/290 (2%)
 Frame = -3

Query  1031  VYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEI  852
             V+++++++ AT +F++ R LG G + TVY GKL D    VA+K++   +   I+Q  NE+
Sbjct  2     VFTFRELKTATKSFAESRLLGGGGFSTVYQGKLPDG-RIVAVKKLNQGNKQGIQQFQNEV  60

Query  851   KLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVSET  672
              +LS V HPNLV+LLG  +E  + +LVYEF+ NGTL+ HL  EKG+GL    R+ I  ET
Sbjct  61    NILSQVRHPNLVQLLGYCLEGRDLLLVYEFVLNGTLADHLHGEKGNGLSLETRITIALET  120

Query  671   SQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGTPG  492
             +QA+AYLH  + PPIYHRDVK+SNILLD ++K+KVADFGLSR   ++++HISTAPQGTPG
Sbjct  121   AQALAYLHFYVKPPIYHRDVKTSNILLDKDFKAKVADFGLSRLTHLDATHISTAPQGTPG  180

Query  491   YLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLL  312
             YLDP YH+ + L+DKSDVYSFGVVL+E+I+  KAVD TR + E+NLA++A+ +I  G L 
Sbjct  181   YLDPDYHESYQLTDKSDVYSFGVVLLELISRKKAVDMTRDKKEINLASMALARIHSGALH  240

Query  311   EIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQM  162
             E+ DP +  +   W L  + ++ E+AFRCLA  +D RPSM+EV  ELEQ+
Sbjct  241   ELFDPDLSVK--YWKL--LTRLVEVAFRCLAAEKDDRPSMVEVVRELEQL  286



>gb|ACN87689.1| kinase-like protein [Corylus avellana]
Length=178

 Score =   309 bits (792),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 146/178 (82%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = -3

Query  983  KRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIKLLSSVNHPNLVRLLG  804
            K+RLG GAYGTVY+GKLH +++WVAIKRI+HRDT+SIEQV NEIKLLSSV+HPNLVRLLG
Sbjct  1    KQRLGTGAYGTVYAGKLHGSEDWVAIKRIKHRDTESIEQVMNEIKLLSSVSHPNLVRLLG  60

Query  803  CSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVSETSQAIAYLHNAMHPPIY  624
            CSIE GEQILVYEFMPNGTL QHLQRE+G GLP  VRL I SET+QAIA+LH+A++PPIY
Sbjct  61   CSIEYGEQILVYEFMPNGTLCQHLQRERGDGLPRQVRLTIASETAQAIAHLHSAINPPIY  120

Query  623  HRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGTPGYLDPQYHQDFHLSD  450
            HRD+KSSNILLDY++KSKVADFGLSR G+ E SHISTAPQGTPGYLDPQYHQ FHLSD
Sbjct  121  HRDIKSSNILLDYDFKSKVADFGLSRLGMTEISHISTAPQGTPGYLDPQYHQCFHLSD  178



>ref|XP_001774205.1| predicted protein [Physcomitrella patens]
 gb|EDQ60981.1| predicted protein, partial [Physcomitrella patens]
Length=287

 Score =   309 bits (792),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 155/290 (53%), Positives = 209/290 (72%), Gaps = 6/290 (2%)
 Frame = -3

Query  1031  VYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEI  852
             +++YK+++ AT NFS   +LG+G +GTVY GKL D    VA+K++    +  I+Q  NE+
Sbjct  1     LFTYKELDHATQNFSANHQLGEGGFGTVYKGKLSDG-RLVAVKKLNQGGSQGIQQFHNEV  59

Query  851   KLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVSET  672
             ++LS V HP+LV+LLG   E+   +LVYE++PNG++S HL       LPW  RLGI  +T
Sbjct  60    EVLSKVRHPHLVQLLGWCRER--PLLVYEYLPNGSISYHLHGGNNGHLPWETRLGIAIQT  117

Query  671   SQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGL-IESSHISTAPQGTP  495
             ++A++YLH  + PPI+HRDVK++NILLD  +K KVADFGLSR  + +E++HISTAPQGTP
Sbjct  118   AEALSYLHFVVSPPIFHRDVKTTNILLDEGFKVKVADFGLSRLVVNLENTHISTAPQGTP  177

Query  494   GYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGL  315
             GYLDP YH+ +HLSDKSDVYSFGVVL+E++T  KAVD  R + E+NLA+LAV KI  G L
Sbjct  178   GYLDPDYHESYHLSDKSDVYSFGVVLMELVTAKKAVDMARERKEINLASLAVAKIHSGCL  237

Query  314   LEIIDP--LIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIEL  171
              EI+DP   ++   +      V +VAE+AFRCLA  +D RPSM EV  EL
Sbjct  238   HEILDPNLTVQFHDNPMMQVMVEQVAELAFRCLASEKDDRPSMKEVLAEL  287



>gb|KCW58874.1| hypothetical protein EUGRSUZ_H01501 [Eucalyptus grandis]
Length=642

 Score =   319 bits (818),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 204/621 (33%), Positives = 323/621 (52%), Gaps = 52/621 (8%)
 Frame = -3

Query  1943  MIP--VLILLLLQSAMVFGSST----------CNRSCGDGL---KQLPFPFGFSSGCEIL  1809
             M+P   L +LLL + MV    T          C++ C +G    + L +PFGFS GC I 
Sbjct  1     MMPKTALSMLLLLAGMVLPILTVGARKAIPPPCSQICHNGKPEKQNLTYPFGFSPGCPIQ  60

Query  1808  LNCTSNGTMSIGEFPVYQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNC  1629
             LNCT +G   IG+F V   + +T+ + I A+C R  EA+  L+G+N+AP   N ILL NC
Sbjct  61    LNCTDDGDALIGKFRVQSASSETVTVTIEAQCNRSFEAIANLYGRNYAPIGKNSILLNNC  120

Query  1628  S--SPELKCMIPST-MIQTQF----ELQDCGKDNISCFSEP--HMTGGFIGYENLTGTGC  1476
             +  SP   C +P+T +IQ Q+    E ++     +SC+SE   + +  F+    L+  GC
Sbjct  121   TQISP---CNLPNTQVIQAQYQSLCETKNMANTGMSCYSEEANNYSIKFLNRSRLSALGC  177

Query  1475  KSLFSAISSPAAAANTTAVSLDIQVIELGWWLQG-HCRCSKNADCNTMR-TPGDGKPGFR  1302
             K   S++S  A A N  +VSL +Q+++L WW+ G  C CS++ADC  +   P  G  GFR
Sbjct  178   KFFLSSMS--AEALNNVSVSLGVQMLQLAWWVNGDECECSRDADCVRLSGLPNGGGNGFR  235

Query  1301  CQCSEGFTGDGYQGGSGCRRDDTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGL  1122
             C+C +GF GDG+  G+GC+R ++     K    +      + +++  ++     M+ +G 
Sbjct  236   CKCRDGFLGDGFLAGTGCQRAESSPGRKKEETLKV-----LTIVLPLMVLLVVSMLILGA  290

Query  1121  ICCIIRRRL---AMKNWNRRRRELRETTGITIPVYSYKDIEKATNNFSDKRRLGDGAYGT  951
             +  I R+R     +++W R     R         + YKD+  AT  F D+  LG G +G 
Sbjct  291   VYVIRRKRKFAEVLEDWERDYGPHR---------FKYKDLYTATKGFRDQELLGAGGFGQ  341

Query  950   VYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILV  771
             VY G L  ++  +A+KR+ H     + +   EI  +  + H NLV LLG    K E +LV
Sbjct  342   VYRGILPTSNIEIAVKRVSHESRQGMREFVAEIISIGRLRHRNLVALLGYCRRKRELLLV  401

Query  770   YEFMPNGTLSQHLQREKGSGLPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILL  591
             Y+ MPNG+L ++L  +    L W  RL ++   +  + YLH      + HRD+K+SNILL
Sbjct  402   YDHMPNGSLDKYLYNQPKVTLNWMQRLRVIKGVASGLLYLHKGWEQVVIHRDIKASNILL  461

Query  590   DYNYKSKVADFGLSRFGLIESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVE  411
             D  +  ++ DFGL+R     +   +T   GT GYL P++ +    +  +DV++FGV L+E
Sbjct  462   DAEFNGRLGDFGLARLYDHGTDPQTTHVVGTFGYLAPEHMRTGKATTSTDVFAFGVFLLE  521

Query  410   IITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAF  231
             +  G + +     + +V L      +  +G +LE  DP +  E   +    +  V ++  
Sbjct  522   VACGRRPIKHGHTE-DVILVDWVFSRWDRGEILEARDPKLGLE---FVEEEMELVLKLGL  577

Query  230   RCLAFHRDMRPSMMEVAIELE  168
              C   +  MRPSM +V   LE
Sbjct  578   MCSHANPLMRPSMRQVLQYLE  598



>ref|XP_010026226.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Eucalyptus grandis]
Length=724

 Score =   318 bits (814),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 202/616 (33%), Positives = 320/616 (52%), Gaps = 50/616 (8%)
 Frame = -3

Query  1934  VLILLLLQSAMVFGSST----------CNRSCGDGL---KQLPFPFGFSSGCEILLNCTS  1794
              L +LLL + MV    T          C++ C +G    + L +PFGFS GC I LNCT 
Sbjct  5     ALSMLLLLAGMVLPILTVGARKAIPPPCSQICHNGKPEKQNLTYPFGFSPGCPIQLNCTD  64

Query  1793  NGTMSIGEFPVYQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCS--SP  1620
             +G   IG+F V   + +T+ + I A+C R  EA+  L+G+N+AP   N ILL NC+  SP
Sbjct  65    DGDALIGKFRVQSASSETVTVTIEAQCNRSFEAIANLYGRNYAPIGKNSILLNNCTQISP  124

Query  1619  ELKCMIPST-MIQTQF----ELQDCGKDNISCFSEP--HMTGGFIGYENLTGTGCKSLFS  1461
                C +P+T +IQ Q+    E ++     +SC+SE   + +  F+    L+  GCK   S
Sbjct  125   ---CNLPNTQVIQAQYQSLCETKNMANTGMSCYSEEANNYSIKFLNRSRLSALGCKFFLS  181

Query  1460  AISSPAAAANTTAVSLDIQVIELGWWLQG-HCRCSKNADCNTMR-TPGDGKPGFRCQCSE  1287
             ++S  A A N  +VSL +Q+++L WW+ G  C CS++ADC  +   P  G  GFRC+C +
Sbjct  182   SMS--AEALNNVSVSLGVQMLQLAWWVNGDECECSRDADCVRLSGLPNGGGNGFRCKCRD  239

Query  1286  GFTGDGYQGGSGCRRDDTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCII  1107
             GF GDG+  G+GC+R ++     K    +      + +++  ++     M+ +G +  I 
Sbjct  240   GFLGDGFLAGTGCQRAESSPGRKKEETLKV-----LTIVLPLMVLLVVSMLILGAVYVIR  294

Query  1106  RRRL---AMKNWNRRRRELRETTGITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGK  936
             R+R     +++W R     R         + YKD+  AT  F D+  LG G +G VY G 
Sbjct  295   RKRKFAEVLEDWERDYGPHR---------FKYKDLYTATKGFRDQELLGAGGFGQVYRGI  345

Query  935   LHDNDEWVAIKRIRHRDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMP  756
             L  ++  +A+KR+ H     + +   EI  +  + H NLV LLG    K E +LVY+ MP
Sbjct  346   LPTSNIEIAVKRVSHESRQGMREFVAEIISIGRLRHRNLVALLGYCRRKRELLLVYDHMP  405

Query  755   NGTLSQHLQREKGSGLPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYK  576
             NG+L ++L  +    L W  RL ++   +  + YLH      + HRD+K+SNILLD  + 
Sbjct  406   NGSLDKYLYNQPKVTLNWMQRLRVIKGVASGLLYLHKGWEQVVIHRDIKASNILLDAEFN  465

Query  575   SKVADFGLSRFGLIESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGL  396
              ++ DFGL+R     +   +T   GT GYL P++ +    +  +DV++FGV L+E+  G 
Sbjct  466   GRLGDFGLARLYDHGTDPQTTHVVGTFGYLAPEHMRTGKATTSTDVFAFGVFLLEVACGR  525

Query  395   KAVDFTRPQNEVNLAALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAF  216
             + +     + +V L      +  +G +LE  DP +  E   +    +  V ++   C   
Sbjct  526   RPIKHGHTE-DVILVDWVFSRWDRGEILEARDPKLGLE---FVEEEMELVLKLGLMCSHA  581

Query  215   HRDMRPSMMEVAIELE  168
             +  MRPSM +V   LE
Sbjct  582   NPLMRPSMRQVLQYLE  597



>ref|XP_002966230.1| hypothetical protein SELMODRAFT_25022, partial [Selaginella moellendorffii]
 gb|EFJ32257.1| hypothetical protein SELMODRAFT_25022, partial [Selaginella moellendorffii]
Length=289

 Score =   300 bits (768),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 150/291 (52%), Positives = 198/291 (68%), Gaps = 7/291 (2%)
 Frame = -3

Query  1028  YSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIK  849
             Y+  +I+KATN F  + ++G G +GTVY G L D+   +AIKR  H    S     NE+ 
Sbjct  1     YTLSEIDKATNGFDKEHKIGSGGFGTVYKG-LFDDGSVLAIKRANHTSKQSSRHFYNEVA  59

Query  848   LLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVSETS  669
             +LS VNH NL+RL+GC ++    ILVYE++PNG L +HL +  G  L W  RL I  ET+
Sbjct  60    ILSQVNHRNLLRLMGCCVDSDVPILVYEYIPNGNLFEHLHKRPGV-LSWSNRLTIAIETA  118

Query  668   QAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGTPGY  489
             +A+AYLH+A +PPIYHRDVKS+NILLD  + +KVADFGLSR   ++ +H+ST  QGTPGY
Sbjct  119   EALAYLHSAAYPPIYHRDVKSANILLDNAFTTKVADFGLSRLVPVDVTHVSTMVQGTPGY  178

Query  488   LDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLE  309
             +DP+YHQ + L+DKSDVYSFGVVL+E++TG K VDF R   +VNL+A +V  I KG + E
Sbjct  179   VDPEYHQTYQLTDKSDVYSFGVVLLEMVTGRKPVDFARASKDVNLSAYSVPLIRKGLIEE  238

Query  308   IIDPLIEAE-----KDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIEL  171
             I+DP +E        D+  L S+  VA +A  CLAF RD RP+M  V  EL
Sbjct  239   IVDPKLEVRVSGNAADLELLESIRAVANVAMACLAFTRDERPTMKRVLEEL  289



>gb|ACN87690.1| kinase-like protein [Corylus avellana]
Length=177

 Score =   295 bits (754),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 137/177 (77%), Positives = 160/177 (90%), Gaps = 1/177 (1%)
 Frame = -3

Query  980  RRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIKLLSSVNHPNLVRLLGC  801
            + LG GA+GTVY+GK  D DE VAIK+I++RDT+SI+QV NEIKLLSSV+HPNLVRLLGC
Sbjct  2    QMLGTGAFGTVYAGKFQD-DELVAIKKIKYRDTNSIDQVLNEIKLLSSVSHPNLVRLLGC  60

Query  800  SIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVSETSQAIAYLHNAMHPPIYH  621
             IE+GEQILVYE+MPNGTL+QHLQRE+ +GLPW  RL I SET+ AIAYLH+AM+PPIYH
Sbjct  61   CIEEGEQILVYEYMPNGTLAQHLQRERSNGLPWTTRLTIASETANAIAYLHSAMNPPIYH  120

Query  620  RDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGTPGYLDPQYHQDFHLSD  450
            RD+KSSNILLD++YKSKVADFGLSR G+ E SHISTAPQGTPGY+DPQYHQ+FHLSD
Sbjct  121  RDIKSSNILLDHSYKSKVADFGLSRLGMTEISHISTAPQGTPGYVDPQYHQNFHLSD  177



>ref|XP_006842370.1| hypothetical protein AMTR_s00079p00188790 [Amborella trichopoda]
 gb|ERN04045.1| hypothetical protein AMTR_s00079p00188790 [Amborella trichopoda]
Length=554

 Score =   308 bits (788),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 156/294 (53%), Positives = 207/294 (70%), Gaps = 6/294 (2%)
 Frame = -3

Query  1040  TIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVT  861
             +I V++Y+++E+AT NFS  + LGDG +GTVY GKL D    VAIKR+   +   +EQ  
Sbjct  211   SITVFTYEELEEATINFSPSKELGDGGFGTVYLGKLRDG-RLVAIKRLYENNCKQVEQFM  269

Query  860   NEIKLLSSVNHPNLVRLLGC-SIEKGEQILVYEFMPNGTLSQHLQRE--KGSG-LPWPVR  693
             NEIK+LSS  HPNLV L GC S    E +LVYE+MPNGT++ HL  +  K  G L W +R
Sbjct  270   NEIKILSSARHPNLVCLYGCTSRHSRELLLVYEYMPNGTVADHLHGDGSKSKGVLSWKIR  329

Query  692   LGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHIST  513
             + I  ET+ A+AYLH ++ PPI HRDVK++NILLD N++ KVADFG+SR   ++ +H+ST
Sbjct  330   MSIAIETADALAYLH-SIEPPIIHRDVKTNNILLDNNFRVKVADFGMSRLFPLDVTHVST  388

Query  512   APQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDK  333
             AP GTPGY+DP YHQ + L+DKSDVYSFGVVL E+I+G  AVD  R ++E+NLA +A++K
Sbjct  389   APLGTPGYVDPDYHQCYQLTDKSDVYSFGVVLAELISGKPAVDIARHRHEINLATMAINK  448

Query  332   IGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIEL  171
             I    L E++DP I  E D      V  VAE+ FRCL+  +D+RP+M EVA  L
Sbjct  449   IQNRALHELVDPEIGFESDPLVKKMVTLVAELTFRCLSLEKDLRPTMEEVAAAL  502



>ref|XP_011076378.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Sesamum indicum]
Length=644

 Score =   310 bits (794),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 158/301 (52%), Positives = 211/301 (70%), Gaps = 7/301 (2%)
 Frame = -3

Query  1037  IPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTN  858
             IP++S  ++E+ATNNF   + LGDG +GTVY GKL D  E VAIKR+   +   ++Q  N
Sbjct  290   IPIFSCAELEEATNNFDSSKELGDGGFGTVYYGKLRDGRE-VAIKRLYEHNYRRVQQFMN  348

Query  857   EIKLLSSVNHPNLVRLLGCSIEKG-EQILVYEFMPNGTLSQHLQ--REKGSGLPWPVRLG  687
             EIK+L+S+ HPNLV L GC+  +  E +LVYE++PNGT+  HL   R K + L WPVR+ 
Sbjct  349   EIKILTSLRHPNLVSLYGCTSRRSRELLLVYEYIPNGTVGDHLHGDRAKEAPLTWPVRMS  408

Query  686   IVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAP  507
             I  ET+ A+AYLH +    I HRDVKS+NILLD N+  KVADFGLSR    + +HISTAP
Sbjct  409   IAIETASALAYLHKS---DIIHRDVKSNNILLDSNFCVKVADFGLSRLFPNDVTHISTAP  465

Query  506   QGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIG  327
             QGTPGY+DP+YHQ + L+DKSDVYSFGVVL+E+I+ + AVD +R ++E+NLA LAV++I 
Sbjct  466   QGTPGYVDPEYHQCYQLTDKSDVYSFGVVLIELISSMPAVDISRHRHEINLANLAVNRIQ  525

Query  326   KGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKW  147
             +    E+IDP +  E D   +     VAE+AFRCL   +DMRPSM EV   L+ ++  + 
Sbjct  526   RCAFDELIDPSLGYETDAEVMRMTTSVAELAFRCLQLEKDMRPSMDEVLSFLQDIQAGED  585

Query  146   G  144
             G
Sbjct  586   G  586



>emb|CDP00659.1| unnamed protein product [Coffea canephora]
Length=414

 Score =   301 bits (770),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 152/298 (51%), Positives = 212/298 (71%), Gaps = 11/298 (4%)
 Frame = -3

Query  1037  IPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTN  858
             +PV+SY ++E+ATN+F   + LGDG +GTVY GKL D  E VA+KR+   +   +EQ  N
Sbjct  60    VPVFSYSELEEATNSFDASKELGDGGFGTVYFGKLRDGRE-VAVKRLYEHNFKRMEQFMN  118

Query  857   EIKLLSSVNHPNLVRLLGCSIEK-GEQILVYEFMPNGTLSQHLQ--REKGSGLPWPVRLG  687
             EI++L+ + H NLV L GC+  +  E +LVYE++PNGT++ HL   R K   L W  R+ 
Sbjct  119   EIQILTRLRHRNLVTLYGCTSRRCRELLLVYEYIPNGTVADHLHGDRAKDKYLTWQHRMN  178

Query  686   IVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAP  507
             I  ET+ A+AYLH +    I HRDVK++NILLD+N+  KVADFGLSR    + SHISTAP
Sbjct  179   IAIETADALAYLHKS---DIIHRDVKTNNILLDHNFCVKVADFGLSRLFPNDVSHISTAP  235

Query  506   QGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIG  327
             QGTPGY+DP+YHQ + L+DKSDVYSFGVVL+E+I+ + AVD +R ++E+NLA LA+++I 
Sbjct  236   QGTPGYVDPEYHQCYQLTDKSDVYSFGVVLIELISSMPAVDISRHRHEINLANLAINRIQ  295

Query  326   KGGLLEIIDPLIEAEKD--VWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMR  159
             +    E+IDP +E + D  VW +++   VAE+AFRCL   +DMRP M EV   L++++
Sbjct  296   RCAFDELIDPSLEYKSDTEVWRMTT--SVAELAFRCLQLEKDMRPKMEEVVETLKEIK  351



>gb|KDO63212.1| hypothetical protein CISIN_1g013686mg [Citrus sinensis]
Length=438

 Score =   300 bits (768),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 151/299 (51%), Positives = 211/299 (71%), Gaps = 7/299 (2%)
 Frame = -3

Query  1031  VYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEI  852
             V+S  ++E+AT+NF+  ++LGDG +G VY G L D    VA+KR+   +   IEQ  NE+
Sbjct  99    VFSCSELEEATDNFNSSKQLGDGGFGAVYLGILRDG-RIVAVKRLYENNFKRIEQFMNEV  157

Query  851   KLLSSVNHPNLVRLLGC-SIEKGEQILVYEFMPNGTLSQHLQREKGSG--LPWPVRLGIV  681
             ++L+ + HPNLV+L GC S +  E +LVYE++PNGT++ HL   + +   LPWPVRL I 
Sbjct  158   EILTKLQHPNLVKLYGCTSRQSRELLLVYEYIPNGTVADHLHNRQPNSCLLPWPVRLSIA  217

Query  680   SETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQG  501
              ET+ A+AYLH +    + HRDVKS+NILLD N++ KVADFGLSR    + +H+STAPQG
Sbjct  218   IETAGALAYLHAS---DVIHRDVKSNNILLDNNFRVKVADFGLSRLFPTDVTHVSTAPQG  274

Query  500   TPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKG  321
             TPGY+DP Y Q + L+DKSDVYSFGVVL+E+I+GL+AVD +R ++++NL+ +A +KI  G
Sbjct  275   TPGYVDPDYFQCYKLTDKSDVYSFGVVLIELISGLEAVDTSRHRHDINLSNMATNKIQNG  334

Query  320   GLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKWG  144
              L E++DP +  EKD    + V  VAE+AFRC+   RDMRP+M EV   L + + S  G
Sbjct  335   ALNELVDPSLGFEKDYAVRNMVTSVAELAFRCVQQDRDMRPTMKEVLEILRETKDSNLG  393



>ref|XP_010070227.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Eucalyptus grandis]
Length=645

 Score =   305 bits (781),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 189/592 (32%), Positives = 304/592 (51%), Gaps = 46/592 (8%)
 Frame = -3

Query  1883  CNRSCGDGL---KQLPFPFGFSSGCEILLNCTSNGTMSIGEFPVYQLTPDTIMINIPAKC  1713
             C+++CG G+   + L +PFGFS GC I LNCT  G   IGEF V   +PDT+ I I A C
Sbjct  36    CSQTCGTGMPAKQNLTYPFGFSPGCPIRLNCTEGGDALIGEFLVQSASPDTVTITIEAMC  95

Query  1712  GRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPST-MIQTQFE----LQDCGKDN  1548
              R   ++  L+G+N+APT  N ++L NC+     C +P+T +I  QF+      +   ++
Sbjct  96    NRSFGSIDQLYGRNYAPTVKNSVVLDNCTQIN-PCNVPNTQVIGAQFQSLCKASNKTNNS  154

Query  1547  ISCFSEP--HMTGGFIGYENLTGTGCKSLFSAISSPAAAANTTAVSLDIQVIELGWWLQG  1374
             +SC+S+     +  F+    L   GC    S++S      N  AVSL +Q+++L WW+ G
Sbjct  155   MSCYSDQANDYSTKFLNRTRLFALGCTYFVSSLSE--EEVNNVAVSLGVQILQLEWWVNG  212

Query  1373  -HCRCSKNADCNTMR-TPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTRCNPAKYLLGE  1200
               C CS+++DC  +   P  G  GFRC+C +GF GDG+  G+GC+R  +  +  K    E
Sbjct  213   DECECSQDSDCVPLSGLPNGGGNGFRCKCKDGFRGDGFLAGTGCQRAKSSPDKKK----E  268

Query  1199  CGGKTRigvliggviagaaLMVSVGLICCIIRRRL---AMKNWNRRRRELRETTGITIPV  1029
                K  + +++  ++     M+ +G++  I R+R     +++W R     R         
Sbjct  269   EALKV-LTIVLPLMVLLVVSMLILGVVYVIRRKRKFAEVLEDWERDYGPHR---------  318

Query  1028  YSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIK  849
             + YKD+  AT  F D+  LG G +G VY G L  ++  +A+KR+ H     + +   EI 
Sbjct  319   FRYKDLYIATKGFRDQELLGAGGFGRVYRGILPTSNVDIAVKRVSHESGQGMREFAAEII  378

Query  848   LLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVSETS  669
              +  + H NLV L G    K E +LVY++MPNG+L ++L  +    L W  R G++   +
Sbjct  379   SIGRLRHRNLVALHGYCRRKRELLLVYDYMPNGSLDKYLYNQPKVTLNWMQRFGVIKGVA  438

Query  668   QAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGTPGY  489
               + YLH      + HRD+K+SN+LLD  +  ++ DFGL+R         +T   GT GY
Sbjct  439   SGLLYLHEGWEQVVIHRDIKASNVLLDAEFNGRLGDFGLARLHDHGDDPQTTRIAGTVGY  498

Query  488   LDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLE  309
             L P++ +    +  +DV++FG  L+E+  G + +       +V L         +G +LE
Sbjct  499   LAPEHVRTGRATRSTDVFAFGAFLLEVACGRRPIK-QEDTEDVILVDWVFSCWDRGDILE  557

Query  308   IIDP-----LIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELE  168
               DP      +E E ++        V ++   C   +  MRPSM +V   L+
Sbjct  558   ARDPKLGVGFVEEEMEL--------VLKLGLMCSHANPLMRPSMRQVLQYLD  601



>ref|XP_002980244.1| hypothetical protein SELMODRAFT_112637, partial [Selaginella 
moellendorffii]
 gb|EFJ18504.1| hypothetical protein SELMODRAFT_112637, partial [Selaginella 
moellendorffii]
Length=293

 Score =   293 bits (751),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 145/292 (50%), Positives = 204/292 (70%), Gaps = 3/292 (1%)
 Frame = -3

Query  1028  YSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIK  849
             +S+ ++ +AT NF  +  LG G++GTV+ G L D+D  VAIK+        I+Q  NE+ 
Sbjct  2     FSFDELSRATQNFKAELMLGTGSFGTVFQGVL-DDDTPVAIKKANSTTGPRIQQFLNEVT  60

Query  848   LLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVSETS  669
             +LS VNH NLV+LLGC +E    +LV+EF+PNGTL +HLQ  + S L W  RL I  ET+
Sbjct  61    ILSQVNHRNLVKLLGCCLETEVPLLVFEFVPNGTLFEHLQHRRSSILSWERRLQIAIETA  120

Query  668   QAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGTPGY  489
             +AI+YLH++   PIYHRDVKS+NILLD  + +KVADFG+S+   +E++H+ST   GTPGY
Sbjct  121   EAISYLHSSAAQPIYHRDVKSTNILLDEKFTAKVADFGISKLVSLEATHVSTTVHGTPGY  180

Query  488   LDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLE  309
             +DPQY Q++ L+DKSDVYSFGVVL+E+ITG K VDF+R  ++ NL A ++  I    + +
Sbjct  181   IDPQYQQNYQLTDKSDVYSFGVVLLELITGQKPVDFSRNSSDKNLTAFSLAYIQSSRIED  240

Query  308   IIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLS  153
             IID  +E   +   +SS+ +VA +A RCL F+R+ RP+M  VA EL  M++S
Sbjct  241   IIDKGLELGDERAKISSIQEVANLAIRCLEFNRENRPAMRSVAEEL--MKIS  290



>ref|XP_006482215.1| PREDICTED: probable serine/threonine-protein kinase At1g18390-like 
isoform X2 [Citrus sinensis]
Length=484

 Score =   300 bits (768),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 152/299 (51%), Positives = 211/299 (71%), Gaps = 7/299 (2%)
 Frame = -3

Query  1031  VYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEI  852
             V+S  ++E+AT+NF+  ++LGDG +G VY G L D    VA+KR+   +   IEQ  NE+
Sbjct  145   VFSCSELEEATDNFNSSKQLGDGGFGAVYLGILRDG-RIVAVKRLYENNFKRIEQFMNEV  203

Query  851   KLLSSVNHPNLVRLLGC-SIEKGEQILVYEFMPNGTLSQHLQREKGSG--LPWPVRLGIV  681
             ++L+ + HPNLV+L GC S +  E +LVYE++PNGT++ HL   + +   LPWPVRL I 
Sbjct  204   EILTKLQHPNLVKLYGCTSRQSRELLLVYEYIPNGTVADHLHNRQPNSCLLPWPVRLSIA  263

Query  680   SETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQG  501
              ET+ A+AYLH +    + HRDVKS+NILLD N++ KVADFGLSR    + +H+STAPQG
Sbjct  264   IETAGALAYLHAS---DVIHRDVKSNNILLDNNFRVKVADFGLSRLFPTDVTHVSTAPQG  320

Query  500   TPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKG  321
             TPGY+DP Y Q + L+DKSDVYSFGVVL+E+I+GL+AVD +R ++++NL+ +A +KI  G
Sbjct  321   TPGYVDPDYFQCYKLTDKSDVYSFGVVLIELISGLEAVDTSRHRHDINLSNMATNKIQNG  380

Query  320   GLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKWG  144
              L E++DP +  EKD    + V  VAE+AFRC+   RDMRPSM EV   L + + S  G
Sbjct  381   ALNELVDPSLGFEKDYAVRNMVTSVAELAFRCVQQDRDMRPSMKEVLEILRETKDSNLG  439



>ref|XP_010264788.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Nelumbo nucifera]
Length=675

 Score =   305 bits (782),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 150/295 (51%), Positives = 206/295 (70%), Gaps = 7/295 (2%)
 Frame = -3

Query  1058  RETTGITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTD  879
             + +T   +P++SY ++E+ATNNF   + LGDG +GTVY GKL D    VA+KR+   +  
Sbjct  326   KASTYFGVPIFSYDELEEATNNFDSTKELGDGGFGTVYHGKLRDG-RVVAVKRLYENNYK  384

Query  878   SIEQVTNEIKLLSSVNHPNLVRLLGCSIEKG-EQILVYEFMPNGTLSQHLQ--REKGSGL  708
              +EQ  NE+++L+ + H NLV L GC+  +  E ILVYE++PNGT++ HL   R K  GL
Sbjct  385   RVEQFMNEVEILTRLRHQNLVTLYGCTSRRSRELILVYEYIPNGTVADHLHGDRAKAGGL  444

Query  707   PWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIES  528
             PW +R+ I  ET+ A++YLH +    I HRDVK++NILLD N+  KVADFGLSR    + 
Sbjct  445   PWSIRMSISIETASALSYLHAS---DIIHRDVKTNNILLDNNFGVKVADFGLSRLFPTDV  501

Query  527   SHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAA  348
             +H+STAPQGTPGY+DP+YHQ + L+DKSDVYSFGVVL+E+I+   AVD TR ++E+NLA 
Sbjct  502   THVSTAPQGTPGYVDPEYHQCYQLTDKSDVYSFGVVLIELISSKPAVDITRHRHEINLAN  561

Query  347   LAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEV  183
             +A+++I    L E+IDP +  E D         VAE+AFRCL F R+MRP+M EV
Sbjct  562   MAINRIQNRTLHELIDPCLNFESDHRVRRMATAVAELAFRCLQFEREMRPTMDEV  616



>gb|EPS62302.1| hypothetical protein M569_12488, partial [Genlisea aurea]
Length=314

 Score =   294 bits (753),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 151/288 (52%), Positives = 199/288 (69%), Gaps = 7/288 (2%)
 Frame = -3

Query  1037  IPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTN  858
             IP+++YK++E+AT NF   + LGDG +GTVY GKL D  E VA+KR+   +   +EQ   
Sbjct  26    IPIFTYKELEEATCNFDASKELGDGGFGTVYHGKLQDGRE-VAVKRLYEHNYRIVEQFMT  84

Query  857   EIKLLSSVNHPNLVRLLGCSIEKG-EQILVYEFMPNGTLSQHLQRE--KGSGLPWPVRLG  687
             EIK+L+ + HPNLV L GC+  +  E +LVYE++PNGT++ HL  E  K + LPW VR+ 
Sbjct  85    EIKILTHLQHPNLVSLHGCTSRRSRELLLVYEYVPNGTVADHLHGENSKEAPLPWSVRMN  144

Query  686   IVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAP  507
             I  ET+ A+AYLH      + HRDVK++NILLD N+  KVADFGLSR    + +HISTAP
Sbjct  145   IAVETAAALAYLHKN---DVIHRDVKTNNILLDNNFSVKVADFGLSRLFPSDVTHISTAP  201

Query  506   QGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIG  327
             QGTPGY+DP YHQ + L+DKSDVYSFGVVL+E+I+ L AVD TR ++E+NLA LA D+I 
Sbjct  202   QGTPGYVDPVYHQCYQLTDKSDVYSFGVVLMELISSLPAVDITRHRHEINLANLAFDRIQ  261

Query  326   KGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEV  183
             K  L E+IDP +    D    +    VAE+ F+CL    + RPSM EV
Sbjct  262   KSALDELIDPNLGYGSDPQVRNMTTAVAELGFQCLQLETETRPSMDEV  309



>ref|XP_002963090.1| hypothetical protein SELMODRAFT_78793, partial [Selaginella moellendorffii]
 gb|EFJ36553.1| hypothetical protein SELMODRAFT_78793, partial [Selaginella moellendorffii]
Length=301

 Score =   294 bits (752),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 143/290 (49%), Positives = 202/290 (70%), Gaps = 1/290 (0%)
 Frame = -3

Query  1028  YSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIK  849
             +S+ ++ +AT NF  +  LG G++GTV+ G L D+D  VAIK+        I+Q  NE+ 
Sbjct  6     FSFDELSRATQNFKAELMLGTGSFGTVFQGVL-DDDTPVAIKKANSTTGPRIQQFLNEVT  64

Query  848   LLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVSETS  669
             +LS VNH NLV+LLGC +E    +LV+EF+PNGTL +HLQ  + S L W  RL I  ET+
Sbjct  65    ILSQVNHRNLVKLLGCCLETDVPLLVFEFVPNGTLFEHLQHRRSSILSWERRLQIAIETA  124

Query  668   QAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGTPGY  489
             +AI+YLH++   PIYHRDVKS+NILLD  + +KVADFG+S+   +E++H+ST   GTPGY
Sbjct  125   EAISYLHSSAAQPIYHRDVKSTNILLDEKFTAKVADFGISKLVSLEATHVSTTVHGTPGY  184

Query  488   LDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLE  309
             +DPQY Q++ L+DKSDVYSFGVVL+E+ITG K VDF+R  ++ NL A ++  I    + +
Sbjct  185   IDPQYQQNYQLTDKSDVYSFGVVLLELITGQKPVDFSRNSSDKNLTAFSLAYIQSSRIED  244

Query  308   IIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMR  159
             IID  +E   +   +SS+ +VA +A RCL F R+ RP+M  VA EL +++
Sbjct  245   IIDKGLELGDERAKISSIQEVANLAIRCLEFDRENRPAMRSVAEELMKIK  294



>ref|NP_001170444.1| uncharacterized protein LOC100384436 [Zea mays]
 gb|ACN37017.1| unknown [Zea mays]
Length=444

 Score =   298 bits (762),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 151/294 (51%), Positives = 206/294 (70%), Gaps = 8/294 (3%)
 Frame = -3

Query  1031  VYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEI  852
             +++Y+++E+AT+ F + R LGDG +GTVY G L D    VA+KR+ +     +EQ  NE 
Sbjct  115   LFTYEELEEATSCFDENRELGDGGFGTVYKGYLKDG-RVVAVKRLYNNSYRRVEQFQNEA  173

Query  851   KLLSSVNHPNLVRLLGC-SIEKGEQILVYEFMPNGTLSQHL--QREKGSGLPWPVRLGIV  681
              +LS + HPNLV   GC S +  E +LVYEF+ NGT++ HL  QR     LPWP+RLG+ 
Sbjct  174   AILSGLRHPNLVMFYGCTSSQSRELLLVYEFVANGTVADHLHGQRAAERALPWPLRLGVA  233

Query  680   SETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQG  501
              E++ A+ YLH A+ PP+ HRDVK++NILLD +Y  KVADFGLSR   ++ +H+STAPQG
Sbjct  234   VESAAALTYLH-AIEPPVVHRDVKTTNILLDADYHVKVADFGLSRLFPLDVTHVSTAPQG  292

Query  500   TPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKG  321
             TPGY+DP+YHQ + L+DKSDVYSFGVVLVE+I+   AVD TR +NE+NLA +A+ KI K 
Sbjct  293   TPGYVDPEYHQCYQLTDKSDVYSFGVVLVELISSKPAVDVTRHRNEINLAGMAISKIQKC  352

Query  320   GLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMR  159
              L E++D  +  E D  T  ++  VAE+AFRCL  + +MRP + EV   LE +R
Sbjct  353   QLEELVDIDLGYETDPATKKAMTAVAELAFRCLQQNGEMRPPIKEV---LEVLR  403



>gb|KDO76913.1| hypothetical protein CISIN_1g0479691mg, partial [Citrus sinensis]
Length=366

 Score =   295 bits (754),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 149/304 (49%), Positives = 209/304 (69%), Gaps = 7/304 (2%)
 Frame = -3

Query  1052  TTGITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSI  873
             T    +P++SY D+ +ATN+FS ++ LGDG +GTVY GKL D  E VA+KR+   +   +
Sbjct  5     TVYFGVPIFSYSDLAEATNDFSREKELGDGGFGTVYYGKLKDGRE-VAVKRLYDNNYRRV  63

Query  872   EQVTNEIKLLSSVNHPNLVRLLGCSIEKGE-QILVYEFMPNGTLSQHLQ--REKGSGLPW  702
             EQ  NE+++L+ + H NLV L GC+    +  +LVYEF+ NGT++  L   R K   L W
Sbjct  64    EQFMNEVEILTRLRHKNLVSLFGCTSRYSQGLLLVYEFVANGTVADQLHGDRAKHGLLTW  123

Query  701   PVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSH  522
             P+R+ I  ET+ A+AYLH +    I HRDVK++NILLD N+  KVADFGLSR   ++ +H
Sbjct  124   PIRMNIAIETASALAYLHAS---DIIHRDVKTNNILLDSNFCVKVADFGLSRLFPLDVTH  180

Query  521   ISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALA  342
             +STAPQGTPGY+DP+YHQ + L+DKSDVYSFGVVL+E+I+ + AVD  R ++E+NLA LA
Sbjct  181   VSTAPQGTPGYVDPEYHQCYQLTDKSDVYSFGVVLIELISSMPAVDMNRHRHEINLANLA  240

Query  341   VDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQM  162
             ++KI K    E+IDP +  E D         VAE+AF CL  ++++RPSM EV  EL+++
Sbjct  241   INKIQKCAFDELIDPCLGFESDEEVKRMTTSVAELAFLCLQQNKELRPSMEEVLAELQRI  300

Query  161   RLSK  150
             +  K
Sbjct  301   KSGK  304



>dbj|BAK03500.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=423

 Score =   296 bits (757),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 147/285 (52%), Positives = 202/285 (71%), Gaps = 5/285 (2%)
 Frame = -3

Query  1028  YSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIK  849
             +SY+++E+AT++F++KR LGDG +GTVY G L D    VA+KR+ +     +EQ  NE  
Sbjct  93    FSYEELEEATDSFNEKRELGDGGFGTVYKGYLGDG-RVVAVKRLYNNSYRRVEQFVNEAA  151

Query  848   LLSSVNHPNLVRLLGC-SIEKGEQILVYEFMPNGTLSQHLQ--REKGSGLPWPVRLGIVS  678
             +L+ + HPNLV   GC S E  E +LVYEF+ NGT++ HL   R     LPWP+RL +  
Sbjct  152   ILARLRHPNLVMFYGCTSKESRELLLVYEFVQNGTVADHLHGPRAAERALPWPLRLNVAV  211

Query  677   ETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGT  498
             E++ A+ YLH A+ PPI HRDVK++NILLD ++  KVADFGLSR   ++++H+STAPQGT
Sbjct  212   ESAAALTYLH-AIEPPIVHRDVKTNNILLDTDFHVKVADFGLSRLFPLDATHVSTAPQGT  270

Query  497   PGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGG  318
             PGY+DP+YHQ + L+DKSDVYSFGVVLVE+I+   AVD TR +NE+NLA +A+ KI K  
Sbjct  271   PGYVDPEYHQCYQLTDKSDVYSFGVVLVELISSKPAVDITRQRNEINLAGMAISKIQKCQ  330

Query  317   LLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEV  183
             + E++D  +  E D  T   +  VAE+AFRCL  + +MRP + EV
Sbjct  331   IEELVDLELGFESDPATRKMMTMVAELAFRCLQQNGEMRPPIREV  375



>ref|XP_009394439.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Musa acuminata subsp. malaccensis]
Length=354

 Score =   293 bits (751),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 152/286 (53%), Positives = 198/286 (69%), Gaps = 5/286 (2%)
 Frame = -3

Query  1031  VYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEI  852
             V+SY ++E+ATN F    +LGDG + TVY GKL D    VA+KR+   +   +EQ  NEI
Sbjct  14    VFSYAELEEATNKFDASDKLGDGGFCTVYKGKLQDG-RTVAVKRLYENNYRRVEQFMNEI  72

Query  851   KLLSSVNHPNLVRLLGC-SIEKGEQILVYEFMPNGTLSQHLQ--REKGSGLPWPVRLGIV  681
             ++LS + H  LV L GC S +  E +LVYEF+ NGTL+ HL   RE    L WP+RL I 
Sbjct  73    QILSRLRHQRLVILYGCTSHQSRELLLVYEFVSNGTLAHHLHGSRESQCILTWPMRLRIA  132

Query  680   SETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQG  501
              ET+ A+AYLH A++PP+ HRDVK++NILLD N+  KVADFGLSR    + +HISTAPQG
Sbjct  133   IETADALAYLH-AVNPPVIHRDVKTNNILLDSNFHVKVADFGLSRLIPKDVTHISTAPQG  191

Query  500   TPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKG  321
             TPGYLDP+YHQ F L+DKSDVYSFGVVL E+IT   AVD TR ++E+NLA +A+ +I +G
Sbjct  192   TPGYLDPEYHQCFQLTDKSDVYSFGVVLFELITSKPAVDMTRNRSEINLANMAITRIQRG  251

Query  320   GLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEV  183
              L +++D  +  + D  T   +  VAE+AFRCL    DMRP + EV
Sbjct  252   ELEQLVDAALGYQSDEVTRKMITMVAEVAFRCLQSDGDMRPPIKEV  297



>ref|XP_010279341.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X5 [Nelumbo nucifera]
Length=657

 Score =   302 bits (773),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 149/295 (51%), Positives = 210/295 (71%), Gaps = 8/295 (3%)
 Frame = -3

Query  1046  GITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQ  867
             G++IP+++Y+ +E+ATNNF   + LGDG +GTVY GKL D  + VA+KR+   +   +EQ
Sbjct  313   GVSIPIFTYEVLEEATNNFDASKELGDGGFGTVYHGKLRDGRD-VAVKRLYENNYRRVEQ  371

Query  866   VTNEIKLLSSVNHPNLVRLLGCSIEKG-EQILVYEFMPNGTLSQHLQ--REKGSGLPWPV  696
               NEI++L+ + H NLV L GC+  +  E ILVYE++PNGT++ HL   R K  GLPW +
Sbjct  372   FMNEIEILTRLRHKNLVTLYGCTSRRSRELILVYEYIPNGTVADHLHGDRAKAGGLPWSI  431

Query  695   RLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHIS  516
             R+ I  ET+ A+ YLH +    I HRDVK++NILLD N+  KVADFGLSR    +++H+S
Sbjct  432   RMSIALETAGALTYLHAS---DIIHRDVKTNNILLDNNFSVKVADFGLSRLFPTDATHVS  488

Query  515   TAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVD  336
             TAPQGTPGY+DP+YHQ + L+ KSDVYSFGVVL+E+I+   AVD +R ++E+NLA +A++
Sbjct  489   TAPQGTPGYVDPEYHQCYQLTGKSDVYSFGVVLIELISSKPAVDISRHRHEINLATMAMN  548

Query  335   KIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIEL  171
             KI    L E++DP +  E D      V  +AE+AFRCL + R+MRP+M E A+E+
Sbjct  549   KIQNRALHELVDPDLNFESDSAVRRMVTGMAELAFRCLQYDREMRPTMDE-ALEI  602



>dbj|BAG89943.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94678.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95420.1| unnamed protein product [Oryza sativa Japonica Group]
Length=348

 Score =   292 bits (748),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 146/286 (51%), Positives = 202/286 (71%), Gaps = 5/286 (2%)
 Frame = -3

Query  1031  VYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEI  852
             ++SY+++E+AT++F++ R LGDG +GTVY G L D    VA+KR+ +     +EQ  NE 
Sbjct  17    LFSYEELEEATDSFNENRELGDGGFGTVYKGILRDG-RVVAVKRLYNNSYRRVEQFVNEA  75

Query  851   KLLSSVNHPNLVRLLGC-SIEKGEQILVYEFMPNGTLSQHLQ--REKGSGLPWPVRLGIV  681
              +LS + HPNLV   GC S +  E +LVYEF+ NGT++ HL   R +   L WP+RL I 
Sbjct  76    AILSRLRHPNLVMFYGCTSSQSRELLLVYEFVANGTVADHLHGHRAQERALSWPLRLNIA  135

Query  680   SETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQG  501
              E++ A+ YLH A+ PPI HRDVK++NILLD ++  KVADFGLSR   ++ +H+STAPQG
Sbjct  136   VESAAALTYLH-AIEPPIVHRDVKTTNILLDADFHVKVADFGLSRLFPLDVTHVSTAPQG  194

Query  500   TPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKG  321
             TPGY+DP+YHQ + L+DKSDVYSFGVVLVE+I+   AVD TR +NE+NLA +A+++I K 
Sbjct  195   TPGYVDPEYHQCYQLTDKSDVYSFGVVLVELISSKPAVDITRQRNEINLAGMAINRIQKS  254

Query  320   GLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEV  183
              L E++D  +  E D  T   +  VAE+AFRCL  + +MRP + EV
Sbjct  255   QLEELVDLELGYESDPATKKMMTMVAELAFRCLQQNGEMRPPIKEV  300



>ref|XP_010279338.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X2 [Nelumbo nucifera]
Length=686

 Score =   302 bits (774),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 152/311 (49%), Positives = 218/311 (70%), Gaps = 11/311 (4%)
 Frame = -3

Query  1085  NWNRRRRELRETT---GITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEW  915
             N + R ++L + +   G++IP+++Y+ +E+ATNNF   + LGDG +GTVY GKL D  + 
Sbjct  326   NPSSRTKDLEKGSIFMGVSIPIFTYEVLEEATNNFDASKELGDGGFGTVYHGKLRDGRD-  384

Query  914   VAIKRIRHRDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKG-EQILVYEFMPNGTLSQ  738
             VA+KR+   +   +EQ  NEI++L+ + H NLV L GC+  +  E ILVYE++PNGT++ 
Sbjct  385   VAVKRLYENNYRRVEQFMNEIEILTRLRHKNLVTLYGCTSRRSRELILVYEYIPNGTVAD  444

Query  737   HLQ--REKGSGLPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVA  564
             HL   R K  GLPW +R+ I  ET+ A+ YLH +    I HRDVK++NILLD N+  KVA
Sbjct  445   HLHGDRAKAGGLPWSIRMSIALETAGALTYLHAS---DIIHRDVKTNNILLDNNFSVKVA  501

Query  563   DFGLSRFGLIESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVD  384
             DFGLSR    +++H+STAPQGTPGY+DP+YHQ + L+ KSDVYSFGVVL+E+I+   AVD
Sbjct  502   DFGLSRLFPTDATHVSTAPQGTPGYVDPEYHQCYQLTGKSDVYSFGVVLIELISSKPAVD  561

Query  383   FTRPQNEVNLAALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDM  204
              +R ++E+NLA +A++KI    L E++DP +  E D      V  +AE+AFRCL + R+M
Sbjct  562   ISRHRHEINLATMAMNKIQNRALHELVDPDLNFESDSAVRRMVTGMAELAFRCLQYDREM  621

Query  203   RPSMMEVAIEL  171
             RP+M E A+E+
Sbjct  622   RPTMDE-ALEI  631



>ref|XP_009600764.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Nicotiana tomentosiformis]
Length=657

 Score =   301 bits (771),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 156/337 (46%), Positives = 223/337 (66%), Gaps = 10/337 (3%)
 Frame = -3

Query  1139  MVSVGLICCIIRRRLAMKNWNRRRRELRETT---GITIPVYSYKDIEKATNNFSDKRRLG  969
             +VS  +I  I RR+       + RRE+   +   G  +PV+SY ++++ATNNF     LG
Sbjct  263   LVSSIVILSIWRRKRGKSGSTQFRREIEVESKYFGFQVPVFSYAELKEATNNFDPSNELG  322

Query  968   DGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEK  789
             DG +GTVY GKL+D  E VA+K +   +   ++Q  NEI++L+ + H NLV L GC+  +
Sbjct  323   DGGFGTVYYGKLYDGRE-VAVKCLYEHNCKRMQQFINEIEILTRLRHQNLVSLYGCTSRR  381

Query  788   G-EQILVYEFMPNGTLSQHLQREKGS--GLPWPVRLGIVSETSQAIAYLHNAMHPPIYHR  618
               E +LVYEF+ NGT++ HL  E+     L WP+R+ I  ET+ A+AYLH +    + HR
Sbjct  382   SRELLLVYEFISNGTVADHLNSERAEEGSLTWPIRMSIAVETASALAYLHAS---DVIHR  438

Query  617   DVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGTPGYLDPQYHQDFHLSDKSDV  438
             DVK++NILLD N++ KVADFGLSR    E SHISTAPQGTPGY+DP+YH+ + L+DKSDV
Sbjct  439   DVKTNNILLDDNFRVKVADFGLSRLFPNEVSHISTAPQGTPGYVDPEYHECYQLTDKSDV  498

Query  437   YSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLEIIDPLIEAEKDVWTLSS  258
             YSFGVVL+E+I+ + AVD TR ++E+NLA LA+++I +    E+IDP +    D      
Sbjct  499   YSFGVVLIELISSMPAVDITRHKHEINLANLAINRIQRCAFDELIDPSLGFTSDTLVKRM  558

Query  257   VNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKW  147
                VA++AFRCL   +D+RP+M EV   L +++  K+
Sbjct  559   TISVAKLAFRCLQLEKDIRPTMDEVLDILRKIQSGKF  595



>ref|XP_010279339.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X3 [Nelumbo nucifera]
Length=671

 Score =   301 bits (772),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 149/295 (51%), Positives = 210/295 (71%), Gaps = 8/295 (3%)
 Frame = -3

Query  1046  GITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQ  867
             G++IP+++Y+ +E+ATNNF   + LGDG +GTVY GKL D  + VA+KR+   +   +EQ
Sbjct  327   GVSIPIFTYEVLEEATNNFDASKELGDGGFGTVYHGKLRDGRD-VAVKRLYENNYRRVEQ  385

Query  866   VTNEIKLLSSVNHPNLVRLLGCSIEKG-EQILVYEFMPNGTLSQHLQ--REKGSGLPWPV  696
               NEI++L+ + H NLV L GC+  +  E ILVYE++PNGT++ HL   R K  GLPW +
Sbjct  386   FMNEIEILTRLRHKNLVTLYGCTSRRSRELILVYEYIPNGTVADHLHGDRAKAGGLPWSI  445

Query  695   RLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHIS  516
             R+ I  ET+ A+ YLH +    I HRDVK++NILLD N+  KVADFGLSR    +++H+S
Sbjct  446   RMSIALETAGALTYLHAS---DIIHRDVKTNNILLDNNFSVKVADFGLSRLFPTDATHVS  502

Query  515   TAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVD  336
             TAPQGTPGY+DP+YHQ + L+ KSDVYSFGVVL+E+I+   AVD +R ++E+NLA +A++
Sbjct  503   TAPQGTPGYVDPEYHQCYQLTGKSDVYSFGVVLIELISSKPAVDISRHRHEINLATMAMN  562

Query  335   KIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIEL  171
             KI    L E++DP +  E D      V  +AE+AFRCL + R+MRP+M E A+E+
Sbjct  563   KIQNRALHELVDPDLNFESDSAVRRMVTGMAELAFRCLQYDREMRPTMDE-ALEI  616



>ref|XP_006344161.1| PREDICTED: probable serine/threonine-protein kinase At1g18390-like 
[Solanum tuberosum]
Length=524

 Score =   297 bits (761),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 151/300 (50%), Positives = 209/300 (70%), Gaps = 7/300 (2%)
 Frame = -3

Query  1037  IPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTN  858
             IPV+SY ++E+ATN+F+  R LGDG +GTVY GKL D  E VA+KR+   +   ++Q  N
Sbjct  171   IPVFSYSELEEATNDFNSSRILGDGGFGTVYYGKLKDGRE-VAVKRLYEHNCKRMQQFVN  229

Query  857   EIKLLSSVNHPNLVRLLGCSIEKG-EQILVYEFMPNGTLSQHLQ--REKGSGLPWPVRLG  687
             EI++L+ + H NLV L GC+  +  E ILVYE++PNGTL+ HL   R K   L W VR+ 
Sbjct  230   EIEILTRLRHTNLVTLYGCTSRRSRELILVYEYIPNGTLADHLHGDRVKDGSLTWLVRMN  289

Query  686   IVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAP  507
             I  ET+ A+AYLH +    + H DVK++NILLD+N+  KVADFG+SR    + +HISTAP
Sbjct  290   IAIETAGALAYLHAS---DVIHCDVKTNNILLDHNFNVKVADFGISRLFPNDVTHISTAP  346

Query  506   QGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIG  327
             +GTPGY+DP+YH+ + L+ KSDVYSFGVVLVE+I+ + AVD TR   E+NLA  A++KI 
Sbjct  347   RGTPGYIDPKYHECYQLTSKSDVYSFGVVLVELISSMPAVDMTRHSQEINLANFAINKIV  406

Query  326   KGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKW  147
             K    E+IDP +  + D   L     VAE+AF CL   RDMRP+M+EV   L+++++S++
Sbjct  407   KCAFNELIDPSLGFDSDTKILEMTTSVAELAFLCLQTDRDMRPTMVEVLDTLKEIQISEF  466



>gb|EYU40786.1| hypothetical protein MIMGU_mgv11b002117mg [Erythranthe guttata]
Length=653

 Score =   301 bits (770),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 155/296 (52%), Positives = 206/296 (70%), Gaps = 7/296 (2%)
 Frame = -3

Query  1037  IPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTN  858
             IP++SYK++E+ATN+F   + LGDG +GTVY GKL D  E VAIKR+   +   +EQ  N
Sbjct  295   IPIFSYKELEEATNHFDPSQELGDGGFGTVYYGKLRDGRE-VAIKRLYEHNYRRVEQFMN  353

Query  857   EIKLLSSVNHPNLVRLLGCSIEKG-EQILVYEFMPNGTLSQHLQREKG--SGLPWPVRLG  687
             EIK+L+ + HPNLV L GC+  K  E +LVYE++ NGT++ HL  E+   S L WPVRL 
Sbjct  354   EIKILTCLRHPNLVSLYGCTSRKSRELLLVYEYISNGTIADHLHGERAHESPLTWPVRLS  413

Query  686   IVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAP  507
             +  ET+ A+AYLH +    I HRDVK++NILLD NY  KVADFGLSR    + +HISTAP
Sbjct  414   VAIETATALAYLHKS---DIIHRDVKTNNILLDENYCVKVADFGLSRLFPNDVTHISTAP  470

Query  506   QGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIG  327
             QGTPGY+DP+YHQ + L+D+SDVYSFGVVL+E+I+ + AVD +R ++E+NLA LAV++I 
Sbjct  471   QGTPGYVDPEYHQCYQLTDRSDVYSFGVVLIELISSMPAVDISRHRHEINLANLAVNRIQ  530

Query  326   KGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMR  159
             +    E+ID  +    D         VAE+AFRCL   +DMRP M EV   L+ +R
Sbjct  531   RCEFDELIDSSLGYGTDAEVARMTTSVAELAFRCLQLDKDMRPCMDEVLAFLKDIR  586



>ref|XP_011070774.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Sesamum indicum]
Length=670

 Score =   301 bits (771),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 153/296 (52%), Positives = 203/296 (69%), Gaps = 7/296 (2%)
 Frame = -3

Query  1037  IPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTN  858
             IP++SY ++E AT NF   + LGDG +G VY GKL D  E VAIKR+   +   +EQ  N
Sbjct  319   IPIFSYTELEVATGNFDASKELGDGGFGAVYHGKLQDGRE-VAIKRLYEHNYRRVEQFMN  377

Query  857   EIKLLSSVNHPNLVRLLGCSIEKG-EQILVYEFMPNGTLSQHLQREKGSGLP--WPVRLG  687
             EIK+L+ + H NLV L GC+  +  E +LVYE++PNGT++ HL  EK    P  WPVR+ 
Sbjct  378   EIKILTCLRHKNLVSLYGCTSRRSKELLLVYEYIPNGTVADHLHGEKAQKAPLSWPVRMN  437

Query  686   IVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAP  507
             I  ET+ A+AYLH +    I HRDVK+ NILLD N+  KVADFGLSR      +H+STAP
Sbjct  438   IAIETASALAYLHKS---DIIHRDVKTDNILLDNNFCVKVADFGLSRLCPNNVTHVSTAP  494

Query  506   QGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIG  327
             QGTPGY+DP+YHQ + L+DKSDVYSFGVVLVE+++ + AVD +R ++E+NLA LAV++I 
Sbjct  495   QGTPGYVDPEYHQCYQLTDKSDVYSFGVVLVELLSSMPAVDISRSRDEINLANLAVNRIL  554

Query  326   KGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMR  159
             K    E++DP +  + D         VAE+AFRCL   ++MRPSM EV   LE++R
Sbjct  555   KHAFDELLDPSLGYDYDAEVKRMSTSVAELAFRCLQLEKEMRPSMDEVLSVLEEIR  610



>ref|XP_009405140.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Musa acuminata subsp. malaccensis]
Length=421

 Score =   294 bits (752),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 149/294 (51%), Positives = 205/294 (70%), Gaps = 8/294 (3%)
 Frame = -3

Query  1031  VYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEI  852
             V+ Y+++ +AT+ F+    +GDG +GTVY GKL D    VAIKR+   +   +EQ   E+
Sbjct  79    VFEYEELHEATDGFNASNEVGDGGFGTVYKGKLRDG-RTVAIKRLYENNFRRVEQFMTEV  137

Query  851   KLLSSVNHPNLVRLLGC-SIEKGEQILVYEFMPNGTLSQHLQREKG--SGLPWPVRLGIV  681
              +LSS+ H NLV L GC S    E +LV+EF+PNGT++ HL   +    GLPWPVR+ I 
Sbjct  138   HILSSLRHHNLVSLYGCTSRHSRELLLVFEFVPNGTVADHLHGPRACEEGLPWPVRMSIA  197

Query  680   SETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQG  501
              ET+QA++YLH A+ PPI HRDVK++NILLD +++ KVADFGLSR   +  +H+ST PQG
Sbjct  198   IETAQALSYLH-AVTPPIVHRDVKTNNILLDRSFRVKVADFGLSRLFPLNVTHVSTVPQG  256

Query  500   TPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKG  321
             TPGY+DP+YHQ + L+DKSDVYSFGVVLVE+I    AVD TR ++E+NLA +AV+KI   
Sbjct  257   TPGYVDPEYHQCYQLTDKSDVYSFGVVLVELIASKPAVDITRHRHEINLAKMAVNKIQNE  316

Query  320   GLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMR  159
              L +++DP +  + +   +  + +VAE+AF CL   RDMRP+M EV   LE +R
Sbjct  317   ELDQLVDPRLWRQSNSEVIWMIRQVAEVAFGCLQEERDMRPTMKEV---LEALR  367



>ref|XP_010279340.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X4 [Nelumbo nucifera]
Length=671

 Score =   301 bits (770),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 152/311 (49%), Positives = 218/311 (70%), Gaps = 11/311 (4%)
 Frame = -3

Query  1085  NWNRRRRELRETT---GITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEW  915
             N + R ++L + +   G++IP+++Y+ +E+ATNNF   + LGDG +GTVY GKL D  + 
Sbjct  330   NPSSRTKDLEKGSIFMGVSIPIFTYEVLEEATNNFDASKELGDGGFGTVYHGKLRDGRD-  388

Query  914   VAIKRIRHRDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKG-EQILVYEFMPNGTLSQ  738
             VA+KR+   +   +EQ  NEI++L+ + H NLV L GC+  +  E ILVYE++PNGT++ 
Sbjct  389   VAVKRLYENNYRRVEQFMNEIEILTRLRHKNLVTLYGCTSRRSRELILVYEYIPNGTVAD  448

Query  737   HLQ--REKGSGLPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVA  564
             HL   R K  GLPW +R+ I  ET+ A+ YLH +    I HRDVK++NILLD N+  KVA
Sbjct  449   HLHGDRAKAGGLPWSIRMSIALETAGALTYLHAS---DIIHRDVKTNNILLDNNFSVKVA  505

Query  563   DFGLSRFGLIESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVD  384
             DFGLSR    +++H+STAPQGTPGY+DP+YHQ + L+ KSDVYSFGVVL+E+I+   AVD
Sbjct  506   DFGLSRLFPTDATHVSTAPQGTPGYVDPEYHQCYQLTGKSDVYSFGVVLIELISSKPAVD  565

Query  383   FTRPQNEVNLAALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDM  204
              +R ++E+NLA +A++KI    L E++DP +  E D      V  +AE+AFRCL + R+M
Sbjct  566   ISRHRHEINLATMAMNKIQNRALHELVDPDLNFESDSAVRRMVTGMAELAFRCLQYDREM  625

Query  203   RPSMMEVAIEL  171
             RP+M E A+E+
Sbjct  626   RPTMDE-ALEI  635



>ref|XP_010279337.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X1 [Nelumbo nucifera]
Length=690

 Score =   301 bits (770),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 149/295 (51%), Positives = 210/295 (71%), Gaps = 8/295 (3%)
 Frame = -3

Query  1046  GITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQ  867
             G++IP+++Y+ +E+ATNNF   + LGDG +GTVY GKL D  + VA+KR+   +   +EQ
Sbjct  346   GVSIPIFTYEVLEEATNNFDASKELGDGGFGTVYHGKLRDGRD-VAVKRLYENNYRRVEQ  404

Query  866   VTNEIKLLSSVNHPNLVRLLGCSIEKG-EQILVYEFMPNGTLSQHLQ--REKGSGLPWPV  696
               NEI++L+ + H NLV L GC+  +  E ILVYE++PNGT++ HL   R K  GLPW +
Sbjct  405   FMNEIEILTRLRHKNLVTLYGCTSRRSRELILVYEYIPNGTVADHLHGDRAKAGGLPWSI  464

Query  695   RLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHIS  516
             R+ I  ET+ A+ YLH +    I HRDVK++NILLD N+  KVADFGLSR    +++H+S
Sbjct  465   RMSIALETAGALTYLHAS---DIIHRDVKTNNILLDNNFSVKVADFGLSRLFPTDATHVS  521

Query  515   TAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVD  336
             TAPQGTPGY+DP+YHQ + L+ KSDVYSFGVVL+E+I+   AVD +R ++E+NLA +A++
Sbjct  522   TAPQGTPGYVDPEYHQCYQLTGKSDVYSFGVVLIELISSKPAVDISRHRHEINLATMAMN  581

Query  335   KIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIEL  171
             KI    L E++DP +  E D      V  +AE+AFRCL + R+MRP+M E A+E+
Sbjct  582   KIQNRALHELVDPDLNFESDSAVRRMVTGMAELAFRCLQYDREMRPTMDE-ALEI  635



>ref|XP_007044246.1| Kinase superfamily protein, putative isoform 2 [Theobroma cacao]
 gb|EOY00078.1| Kinase superfamily protein, putative isoform 2 [Theobroma cacao]
Length=644

 Score =   300 bits (767),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 152/305 (50%), Positives = 210/305 (69%), Gaps = 7/305 (2%)
 Frame = -3

Query  1064  ELRETTGITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRD  885
             E   T G  + +++Y ++ +ATNNF D++ LGDG +GTVY GKL D  E VAIKR+   +
Sbjct  279   ERSNTIGFGLLIFTYSELVEATNNFDDEKELGDGGFGTVYYGKLRDGRE-VAIKRLYQHN  337

Query  884   TDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKG-EQILVYEFMPNGTLSQHLQ--REKGS  714
                +EQ  NE+++L+ + H NLV L GC+  +  + +LVYEF+PNGT++ HL   R +  
Sbjct  338   CRRLEQFINEVEILTRLRHKNLVSLYGCTSRRSRDLLLVYEFIPNGTVADHLHGDRAQSG  397

Query  713   GLPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLI  534
              L WP+R+ I  ET+ A+AYLH +    I HRDVK++NILLD N+  KVADFGLSR    
Sbjct  398   LLTWPIRMSIAIETASALAYLHTS---DIVHRDVKTNNILLDDNFSVKVADFGLSRLFPH  454

Query  533   ESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNL  354
             + +HISTAPQGTPGY+DP+YHQ + L+ KSDVYSFGVVL+E+I+ + AVD TR + E+NL
Sbjct  455   DVTHISTAPQGTPGYVDPEYHQCYQLTGKSDVYSFGVVLIELISSMPAVDITRHRQEINL  514

Query  353   AALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIE  174
             A LA++KI K    E+IDP +  + D         VAE+AFRCL   ++MRPSM EV  E
Sbjct  515   ANLAINKIQKCAFDELIDPNLGYKSDEEVTRMTTSVAELAFRCLQQEKEMRPSMEEVLEE  574

Query  173   LEQMR  159
             L++++
Sbjct  575   LQRIQ  579



>ref|XP_008782360.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Phoenix dactylifera]
Length=420

 Score =   293 bits (749),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 159/353 (45%), Positives = 221/353 (63%), Gaps = 38/353 (11%)
 Frame = -3

Query  1139  MVSVGLICCIIRRRLAMKNWNRRRRELRETTGITI-----------------------PV  1029
              ++VGL+C +I        +  R+R+   T+ I +                       P+
Sbjct  40    FIAVGLLCLLIL-------YKHRKRKQHSTSSILLGPTPSSEPSSYRDPELGSLQYQTPI  92

Query  1028  YSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIK  849
             +SY+++E+ATN FS  R LG G +GTVY GKL D    VA+KR+   + + +EQ  NE++
Sbjct  93    FSYEELEEATNGFSASRELGAGGFGTVYQGKLRDG-RVVAVKRLYKHNWNRVEQFMNEVE  151

Query  848   LLSSVNHPNLVRLLGC-SIEKGEQILVYEFMPNGTLSQHLQ--REKGSGLPWPVRLGIVS  678
             +LS + H NLV L GC S    E +LVYE++PNGT++ HL   R     L WPVR+ I  
Sbjct  152   ILSHLRHQNLVSLYGCTSRHSRELLLVYEYVPNGTVADHLHGPRAHDRALTWPVRMSIAI  211

Query  677   ETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGT  498
             ET+ A+AYLH A+ P I HRDVK+SNILLD  +  KVADFGLSR   +++SH+STAPQG+
Sbjct  212   ETADALAYLH-AVEPQIIHRDVKTSNILLDRGFHVKVADFGLSRLFPLDASHVSTAPQGS  270

Query  497   PGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGG  318
             PGY+DP Y+Q + L+DKSDVYSFGVVL E+I+   AVD  R + E+NLA +A+ KI    
Sbjct  271   PGYVDPFYYQCYQLTDKSDVYSFGVVLAELISSKPAVDTDRTRREINLANMAISKIQNCH  330

Query  317   LLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMR  159
             L +++DP +  + D    + +  VAE+AFRCL   R+MRPS+ EV   LE +R
Sbjct  331   LEQLVDPSLGYQSDWEMKTMITLVAELAFRCLQLDREMRPSIKEV---LEVLR  380



>ref|XP_009801718.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Nicotiana sylvestris]
Length=657

 Score =   300 bits (767),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 156/337 (46%), Positives = 222/337 (66%), Gaps = 10/337 (3%)
 Frame = -3

Query  1139  MVSVGLICCIIRRRLAMKNWNRRRRELRETT---GITIPVYSYKDIEKATNNFSDKRRLG  969
             +VS  +I  I RR+       + RREL   +   G  +PV+SY ++++ATNNF     LG
Sbjct  263   LVSSIIILSIWRRKRGRNGSTQFRRELEVESRYFGFQVPVFSYAELKEATNNFDPSNELG  322

Query  968   DGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEK  789
             DG +GTVY GKL+D  E VA+K +   +   ++Q  NEI++L+ + H NLV L GC+  +
Sbjct  323   DGGFGTVYYGKLYDGRE-VAVKCLYEHNCKRMQQFINEIEILTRLRHQNLVSLYGCTSRR  381

Query  788   G-EQILVYEFMPNGTLSQHLQREKGSG--LPWPVRLGIVSETSQAIAYLHNAMHPPIYHR  618
               E +LVYE++PNGT++ HL  E      L WP+R+ I  ET+ A+AYLH +    + HR
Sbjct  382   SRELLLVYEYIPNGTVADHLNGEGAEEGLLTWPIRMSIAVETASALAYLHAS---DVIHR  438

Query  617   DVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGTPGYLDPQYHQDFHLSDKSDV  438
             DVK++NILLD N++ KVADFGLSR    + SHISTAPQGTPGY+DP+YH+ + L+DKSDV
Sbjct  439   DVKTNNILLDDNFRVKVADFGLSRLFPNDVSHISTAPQGTPGYVDPEYHECYQLTDKSDV  498

Query  437   YSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLEIIDPLIEAEKDVWTLSS  258
             YSFGVVL+E+I+ + AVD TR ++E+NLA LA+++I +    E+IDP +    D      
Sbjct  499   YSFGVVLIELISSMPAVDITRHKHEINLANLAINRIQRCAFDELIDPSLGFTSDTLVKRM  558

Query  257   VNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKW  147
                VA++AFRCL   +D+RP+M EV   L  ++  K+
Sbjct  559   TISVAKLAFRCLQLEKDIRPTMDEVLDILRNIQSGKF  595



>ref|XP_010922266.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X5 [Elaeis guineensis]
Length=408

 Score =   292 bits (748),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 146/295 (49%), Positives = 205/295 (69%), Gaps = 5/295 (2%)
 Frame = -3

Query  1031  VYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEI  852
             V++Y+++ +ATN+F   + LGDG +GTVY GKL D    VA+KR+   +   +EQ  NE+
Sbjct  66    VFTYEELLEATNHFDSSKELGDGGFGTVYKGKLRDG-RVVAVKRLYENNYKRVEQFMNEV  124

Query  851   KLLSSVNHPNLVRLLGCSIEKG-EQILVYEFMPNGTLSQHLQREKGS--GLPWPVRLGIV  681
              +LS + H NLV L GC+  +  E +LVYEF+PNGT++ HL   + S   L WP+RL I 
Sbjct  125   AILSCLRHQNLVSLYGCTSHRSRELLLVYEFVPNGTVADHLHGPRASERALSWPIRLSIA  184

Query  680   SETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQG  501
              ET+ A+ YLH A+ P I HRDVK++NILLD ++  KVADFGLSR    +++H+STAPQG
Sbjct  185   IETADALGYLH-AVEPQIIHRDVKTNNILLDASFHVKVADFGLSRLFPTDATHVSTAPQG  243

Query  500   TPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKG  321
             TPGYLDP+YHQ + L+DKSDVYSFGVVLVE+I+   AVD TR ++E+NLA++A++KI   
Sbjct  244   TPGYLDPEYHQCYQLTDKSDVYSFGVVLVELISSKPAVDITRHRHEINLASMAINKIQNC  303

Query  320   GLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRL  156
              L +++DP +  + D     ++  VAE+AFRCL    DMRP + EV   L ++ +
Sbjct  304   QLEQLVDPDLVYQSDWAIKKTITMVAELAFRCLQSDGDMRPPIKEVLEVLREIEI  358



>gb|KCW58869.1| hypothetical protein EUGRSUZ_H01495 [Eucalyptus grandis]
Length=602

 Score =   298 bits (763),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 185/580 (32%), Positives = 296/580 (51%), Gaps = 43/580 (7%)
 Frame = -3

Query  1856  KQLPFPFGFSSGCEILLNCTSNGTMSIGEFPVYQLTPDTIMINIPAKCGRRIEAMKPLFG  1677
             + L +PFGFS GC I LNCT  G   IGEF V   +PDT+ I I A C R   ++  L+G
Sbjct  5     QNLTYPFGFSPGCPIRLNCTEGGDALIGEFLVQSASPDTVTITIEAMCNRSFGSIDQLYG  64

Query  1676  KNFAPTSNNGILLQNCSSPELKCMIPST-MIQTQFE----LQDCGKDNISCFSEP--HMT  1518
             +N+APT  N ++L NC+     C +P+T +I  QF+      +   +++SC+S+     +
Sbjct  65    RNYAPTVKNSVVLDNCTQIN-PCNVPNTQVIGAQFQSLCKASNKTNNSMSCYSDQANDYS  123

Query  1517  GGFIGYENLTGTGCKSLFSAISSPAAAANTTAVSLDIQVIELGWWLQG-HCRCSKNADCN  1341
               F+    L   GC    S++S      N  AVSL +Q+++L WW+ G  C CS+++DC 
Sbjct  124   TKFLNRTRLFALGCTYFVSSLSE--EEVNNVAVSLGVQILQLEWWVNGDECECSQDSDCV  181

Query  1340  TMR-TPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTRCNPAKYLLGECGGKTRigvlig  1164
              +   P  G  GFRC+C +GF GDG+  G+GC+R  +  +  K    E   K  + +++ 
Sbjct  182   PLSGLPNGGGNGFRCKCKDGFRGDGFLAGTGCQRAKSSPDKKK----EEALKV-LTIVLP  236

Query  1163  gviagaaLMVSVGLICCIIRRRL---AMKNWNRRRRELRETTGITIPVYSYKDIEKATNN  993
              ++     M+ +G++  I R+R     +++W R     R         + YKD+  AT  
Sbjct  237   LMVLLVVSMLILGVVYVIRRKRKFAEVLEDWERDYGPHR---------FRYKDLYIATKG  287

Query  992   FSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIKLLSSVNHPNLVR  813
             F D+  LG G +G VY G L  ++  +A+KR+ H     + +   EI  +  + H NLV 
Sbjct  288   FRDQELLGAGGFGRVYRGILPTSNVDIAVKRVSHESGQGMREFAAEIISIGRLRHRNLVA  347

Query  812   LLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVSETSQAIAYLHNAMHP  633
             L G    K E +LVY++MPNG+L ++L  +    L W  R G++   +  + YLH     
Sbjct  348   LHGYCRRKRELLLVYDYMPNGSLDKYLYNQPKVTLNWMQRFGVIKGVASGLLYLHEGWEQ  407

Query  632   PIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGTPGYLDPQYHQDFHLS  453
              + HRD+K+SN+LLD  +  ++ DFGL+R         +T   GT GYL P++ +    +
Sbjct  408   VVIHRDIKASNVLLDAEFNGRLGDFGLARLHDHGDDPQTTRIAGTVGYLAPEHVRTGRAT  467

Query  452   DKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLEIIDP-----LIE  288
               +DV++FG  L+E+  G + +       +V L         +G +LE  DP      +E
Sbjct  468   RSTDVFAFGAFLLEVACGRRPIK-QEDTEDVILVDWVFSCWDRGDILEARDPKLGVGFVE  526

Query  287   AEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELE  168
              E ++        V ++   C   +  MRPSM +V   L+
Sbjct  527   EEMEL--------VLKLGLMCSHANPLMRPSMRQVLQYLD  558



>ref|XP_004252723.1| PREDICTED: wall-associated receptor kinase-like 20 [Solanum lycopersicum]
Length=621

 Score =   298 bits (764),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 176/427 (41%), Positives = 248/427 (58%), Gaps = 29/427 (7%)
 Frame = -3

Query  1400  IELGWWLQGHCRCSKNADCNTMRT----PGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDT  1233
             +EL W       C+  +DC++  T    P       RC C  GF  D     + C RD T
Sbjct  202   MELQWVSPPEPVCTIQSDCDSDSTCGPDPNSNGGVNRCFCHSGFHWDPI--AALCARDVT  259

Query  1232  RCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCII---------RRRLAMKNW  1080
                        C  +   G     +IAG    +SV ++  +I         R + A    
Sbjct  260   -----------CQDRDGCGRDHTALIAGLTSGLSVAVVAAVIGFFVYRRQKRIKEARDRL  308

Query  1079  NRRRRELRETTGI-TIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIK  903
              R R ++  + G+ +  +++ K+I+KATNNFS  R LG G YG VY GKL D+D  VA+K
Sbjct  309   TREREDILSSGGVKSAKLFTGKEIKKATNNFSTDRLLGAGGYGEVYYGKL-DDDTVVAVK  367

Query  902   RIRHRDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQRE  723
               +  +   IEQV NE+++L  VNH NLVR+LGC +E  + +LVYE++PNGTLS HL  +
Sbjct  368   CAKLGNAKGIEQVLNEVRILCQVNHKNLVRILGCCVELEQPLLVYEYVPNGTLSDHLYLQ  427

Query  722   KGSGLPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRF  543
             +   L W  RL I   T++ +AYLH +  PPIYHRDVKSSNILLD    +KVADFGLSR 
Sbjct  428   R-KLLTWDSRLSIAHATAEGLAYLHFSAVPPIYHRDVKSSNILLDDKLNAKVADFGLSRL  486

Query  542   GLIESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNE  363
                + SH+ST  QGT GYLDP+Y++++ L+DKSDVYSFGVVL+E++T  KA+DF+RPQ++
Sbjct  487   AHTDLSHVSTCAQGTLGYLDPEYYRNYQLTDKSDVYSFGVVLLELLTSQKAIDFSRPQDD  546

Query  362   VNLAALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEV  183
             VNLA      + +  +++ +DP ++       L ++  +  +A  CL   R  RPSM EV
Sbjct  547   VNLAIYVQRLVEEERIMDAVDPALKVGASSVELETMKALGFLAVSCLEEKRQSRPSMKEV  606

Query  182   AIELEQM  162
             A E+E +
Sbjct  607   AEEIEYI  613



>ref|XP_010922259.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X4 [Elaeis guineensis]
Length=418

 Score =   292 bits (747),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 146/295 (49%), Positives = 205/295 (69%), Gaps = 5/295 (2%)
 Frame = -3

Query  1031  VYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEI  852
             V++Y+++ +ATN+F   + LGDG +GTVY GKL D    VA+KR+   +   +EQ  NE+
Sbjct  76    VFTYEELLEATNHFDSSKELGDGGFGTVYKGKLRDG-RVVAVKRLYENNYKRVEQFMNEV  134

Query  851   KLLSSVNHPNLVRLLGCSIEKG-EQILVYEFMPNGTLSQHLQREKGS--GLPWPVRLGIV  681
              +LS + H NLV L GC+  +  E +LVYEF+PNGT++ HL   + S   L WP+RL I 
Sbjct  135   AILSCLRHQNLVSLYGCTSHRSRELLLVYEFVPNGTVADHLHGPRASERALSWPIRLSIA  194

Query  680   SETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQG  501
              ET+ A+ YLH A+ P I HRDVK++NILLD ++  KVADFGLSR    +++H+STAPQG
Sbjct  195   IETADALGYLH-AVEPQIIHRDVKTNNILLDASFHVKVADFGLSRLFPTDATHVSTAPQG  253

Query  500   TPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKG  321
             TPGYLDP+YHQ + L+DKSDVYSFGVVLVE+I+   AVD TR ++E+NLA++A++KI   
Sbjct  254   TPGYLDPEYHQCYQLTDKSDVYSFGVVLVELISSKPAVDITRHRHEINLASMAINKIQNC  313

Query  320   GLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRL  156
              L +++DP +  + D     ++  VAE+AFRCL    DMRP + EV   L ++ +
Sbjct  314   QLEQLVDPDLVYQSDWAIKKTITMVAELAFRCLQSDGDMRPPIKEVLEVLREIEI  368



>ref|XP_002527017.1| wall-associated kinase, putative [Ricinus communis]
 gb|EEF35389.1| wall-associated kinase, putative [Ricinus communis]
Length=673

 Score =   300 bits (767),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 217/651 (33%), Positives = 315/651 (48%), Gaps = 117/651 (18%)
 Frame = -3

Query  1934  VLILLLLQSAMVFGSS--TCN-RSCGDGLKQLPFPFGFSSGCEIL-------LNCTSNGT  1785
             VL  LL + A+        CN R+CGDG + + FPF      E         L+C  NG 
Sbjct  19    VLSFLLARKAICIHPQFLACNPRTCGDG-QNITFPFYIQGQQEPFCGYPGFDLSCNHNG-  76

Query  1784  MSIGEFPVYQLTPDTIMINIPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCM  1605
                   P+ +L  +  +I        + + ++      F   +      +N S PE +  
Sbjct  77    -----HPILKLRDNEYVIR---HISYKTQTVRVSNAAVFDTATTCIPPFRNTSLPEDRFK  128

Query  1604  IPSTMIQTQFELQDCG------------KDNISCFSEPHMTGGFIGYENLTGTGCKSLFS  1461
             + S      F L +C             K  + C  E         +E+    G  S+  
Sbjct  129   LSSNQTGLFF-LYECNSTLLGNRNSELNKYKVDCLIETGTGPTLSMFEDDPLLGYASV--  185

Query  1460  AISSPAAAANTTAVSLDI----------QVIELGW---WLQGHCRCSKNADCNTMRTPGD  1320
                      N   V++D+          +++E G+   W+  +C   +N+          
Sbjct  186   ------VCENKVKVAVDVHGGNSTDGLERMLERGFVLNWIASNCSICENS----------  229

Query  1319  GKPGFRCQCSEGFTGDGYQGGSGC--RRDDTRCNPAKYLLGECGGKTRigvliggviaga  1146
                G +C    GF    Y     C  R   + CNP K+ L   G                
Sbjct  230   ---GGKC----GFDDATYHFKCFCPDRPHASDCNPVKFTLIYAGA---------------  267

Query  1145  aLMVSVGLICCIIRRRLAMKNWNRRRR---ELRETTGIT---------------IPVYSY  1020
                  +GLI  ++   +   ++ RRR     +  T   +               + V+SY
Sbjct  268   ----GIGLIALLLSFYIFRSHYKRRRNASSNILSTNSFSPSSRSDLEGGSVYFGVSVFSY  323

Query  1019  KDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIKLLS  840
              ++EKAT+NF  K+ LGDG +GTVY GKL D  E VA+KR+   +   +EQ  NEI++L+
Sbjct  324   AELEKATSNFDSKKELGDGGFGTVYYGKLKDGRE-VAVKRLYEHNYRRVEQFINEIEILT  382

Query  839   SVNHPNLVRLLGCSIEKG-EQILVYEFMPNGTLSQHLQ--REKGSGLPWPVRLGIVSETS  669
              + H NLV L GC+  +  E +LVYE++PNGT++ HL   R K S L WP+R+ I  ET+
Sbjct  383   RLRHKNLVTLYGCTSRRSRELLLVYEYIPNGTVADHLHGDRSKSSPLTWPIRMSIAIETA  442

Query  668   QAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGTPGY  489
              A+AYLH +      HRDVK++NILLD N+  KVADFGLSR    + +H+STAPQGTPGY
Sbjct  443   TALAYLHAS---DTIHRDVKTNNILLDNNFCVKVADFGLSRLFPNDVTHVSTAPQGTPGY  499

Query  488   LDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLE  309
             +DP+YHQ + L+DKSDVYSFGVVL+E+I+ + AVD  R ++E+NLA LAV+KI      E
Sbjct  500   VDPEYHQCYQLTDKSDVYSFGVVLIELISSMPAVDINRHRHEINLANLAVNKIQNCAFDE  559

Query  308   IIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRL  156
             +IDP      D         VAE+AFRCL   +++RPSM EV  EL+ + +
Sbjct  560   LIDPSFGYNSDEEVKRKTISVAELAFRCLQQDKELRPSMDEVLEELKSIEI  610



>ref|XP_004300506.1| PREDICTED: probable serine/threonine-protein kinase At1g18390-like 
isoform 2 [Fragaria vesca subsp. vesca]
Length=670

 Score =   298 bits (764),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 155/318 (49%), Positives = 216/318 (68%), Gaps = 8/318 (3%)
 Frame = -3

Query  1103  RRLAMKNWNRRRRELRETTGITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDN  924
             R +  K+++R   E + +  + + V++YK++E+ATN F   + LGDG +GTVY GK+ D 
Sbjct  310   RSIFSKSYSRSDTE-KGSAYLGVHVFTYKELEQATNYFDSSKELGDGGFGTVYYGKVRDG  368

Query  923   DEWVAIKRIRHRDTDSIEQVTNEIKLLSSVNHPNLVRLLGC-SIEKGEQILVYEFMPNGT  747
                VA+KR+   +   +EQ  NEI++L+ + H NLV L GC S    E +LVYE++PNGT
Sbjct  369   RS-VAVKRLYETNYKRVEQFMNEIEILARLRHQNLVLLYGCTSRHSRELLLVYEYVPNGT  427

Query  746   LSQHLQ--REKGSGLPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKS  573
             L+ HL   + K   LPW  R+ I  ET+ A++YLH +    I HRDVK++NILLD N+  
Sbjct  428   LADHLHGGKAKPGALPWHTRINIAVETASALSYLHAS---EIIHRDVKTTNILLDNNFCV  484

Query  572   KVADFGLSRFGLIESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLK  393
             KVADFGLSR    + +HISTAPQGTPGY+DP Y+Q + L+ KSDVYSFGVVLVE+I+ L 
Sbjct  485   KVADFGLSRLFPTDVTHISTAPQGTPGYVDPDYNQCYQLTTKSDVYSFGVVLVELISSLP  544

Query  392   AVDFTRPQNEVNLAALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFH  213
             AVD TR + E+NL+ +A++KI K  L E++DP +  E D      +N VAE+AFRCL   
Sbjct  545   AVDITRHRQEINLSNMAINKIQKHALDELVDPSLGYESDFRVRKMINAVAELAFRCLQNE  604

Query  212   RDMRPSMMEVAIELEQMR  159
              DMRPSMM+V  EL++++
Sbjct  605   TDMRPSMMDVENELKRIQ  622



>ref|XP_006344163.1| PREDICTED: probable serine/threonine-protein kinase At1g18390-like 
isoform X2 [Solanum tuberosum]
Length=536

 Score =   295 bits (754),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 153/302 (51%), Positives = 210/302 (70%), Gaps = 11/302 (4%)
 Frame = -3

Query  1037  IPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTN  858
             IPV+SY ++E+ATN+F   R LGDG +GTVY G+L D  E VA+KR+   ++  ++Q  N
Sbjct  204   IPVFSYSELEEATNDFKSSRVLGDGGFGTVYYGQLKDGRE-VAVKRLYEHNSKQMQQFVN  262

Query  857   EIKLLSSVNHPNLVRLLGCSIEKG-EQILVYEFMPNGTLSQHLQ--REKGSGLPWPVRLG  687
             EI++L+ + H NLV L GC+  +  E ILVYE++PNGTL+ HL   R K   L WPVRL 
Sbjct  263   EIEILTRLRHTNLVTLYGCTSRRSRELILVYEYIPNGTLADHLHGDRAKNRSLTWPVRLN  322

Query  686   IVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAP  507
             I  ET+ A+AYLH +    I H DVK++NILLD ++  KVADFG+SR    + SHISTAP
Sbjct  323   IAIETAGALAYLHAS---DIIHCDVKTNNILLDQSFSVKVADFGISRLFPNDVSHISTAP  379

Query  506   QGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIG  327
             +GTPGY+DP+YH+ + L+ KSDVYSFGVVLVE+I+ + AVD  R   E+NLA  A++KI 
Sbjct  380   RGTPGYIDPKYHECYQLTIKSDVYSFGVVLVELISSMPAVDMKRHSQEINLANFAINKIV  439

Query  326   KGGLLEIIDPLIEAEKD--VWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLS  153
             K    E+IDP +  + D  +W ++S   VAE+AF CL   RDMRP+M EV   L++++ S
Sbjct  440   KCAFNELIDPSLGFDSDSKIWEMTS--SVAELAFLCLQTDRDMRPTMAEVLDTLKEIQTS  497

Query  152   KW  147
             ++
Sbjct  498   EF  499



>ref|XP_007158796.1| hypothetical protein PHAVU_002G182500g [Phaseolus vulgaris]
 gb|ESW30790.1| hypothetical protein PHAVU_002G182500g [Phaseolus vulgaris]
Length=664

 Score =   298 bits (763),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 148/296 (50%), Positives = 208/296 (70%), Gaps = 8/296 (3%)
 Frame = -3

Query  1037  IPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTN  858
             +  ++Y ++E+ATN F  KR LGDG +G VY GKLHD    VA+KR+ + ++  IEQ  N
Sbjct  329   VHFFTYGELEEATNFFDPKRELGDGGFGKVYFGKLHDG-RLVAVKRM-YENSLKIEQFVN  386

Query  857   EIKLLSSVNHPNLVRLLGCSIEKG-EQILVYEFMPNGTLSQHL--QREKGSGLPWPVRLG  687
             E+++L+ ++H NLV L GC+     E +LVYE++PNGT++ HL  QR K   LPW +R+ 
Sbjct  387   EVEILTGLHHQNLVSLYGCTPRHSRELMLVYEYVPNGTVADHLHGQRAKPGTLPWHIRMN  446

Query  686   IVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAP  507
             I  ET+ A+ YLH +    I HRDVK++NILLD ++  KVADFGLSR     ++HISTAP
Sbjct  447   IAIETASALVYLHAS---DIIHRDVKTNNILLDNHFSVKVADFGLSRLFPTHATHISTAP  503

Query  506   QGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIG  327
             QGTPGY+DP+YH+ +HL+DKSDVYSFGVVL+E+++ + AVD +R ++E+NL+ +A+ KI 
Sbjct  504   QGTPGYVDPEYHEYYHLTDKSDVYSFGVVLIELVSSMHAVDISRRRHEINLSNMAIKKIQ  563

Query  326   KGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMR  159
              G L EI+DP +  + D      +N VAE+AF+CL   +D RPSM EV   LE +R
Sbjct  564   SGALHEIVDPTLGFDSDFKVRKMINAVAELAFQCLQSSKDARPSMAEVLDRLEDIR  619



>gb|KFK34631.1| hypothetical protein AALP_AA5G171200 [Arabis alpina]
Length=435

 Score =   291 bits (746),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 153/330 (46%), Positives = 210/330 (64%), Gaps = 6/330 (2%)
 Frame = -3

Query  1136  VSVGLICCIIRRRLAMKNWNRRR---RELRETTGITI-PVYSYKDIEKATNNFSDKRRLG  969
             ++  +I     RR+A   W   R   R L  T    I  ++S K+I KATNNFS    LG
Sbjct  99    ITTKMIISAHNRRVAGSQWANLRKLHRNLLSTNNAGIDKIFSGKEIIKATNNFSKPNLLG  158

Query  968   DGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEK  789
              G +G V+ G L D    +A+KR +  +  SI Q+ NE+++L  V+H NLV+LLGC I+ 
Sbjct  159   SGGFGEVFKGNLSDGKT-IAVKRAKLGNEKSIYQIVNEVQILCQVSHTNLVKLLGCCIDL  217

Query  788   GEQILVYEFMPNGTLSQHLQRE-KGSGLPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDV  612
                ILVYEF+PNGTL + +    +G  LPW  RL I  +T+Q +AYLH+++ PPIYHRDV
Sbjct  218   DLPILVYEFVPNGTLYEQIHHAGEGRSLPWIRRLMIAHQTAQGLAYLHSSVTPPIYHRDV  277

Query  611   KSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYS  432
             KSSNILLD N   KVADFGLSR G+ + SH++T  QGT GYLDP+Y+ +FHL+DKSDVYS
Sbjct  278   KSSNILLDENLDVKVADFGLSRLGVSDVSHVTTCAQGTLGYLDPEYYLNFHLTDKSDVYS  337

Query  431   FGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVN  252
             FGVVL E++T  KA+DF R + +VNL       + +G  +E+IDP+I  E  V  + S+ 
Sbjct  338   FGVVLFELLTSKKAIDFNREEEDVNLVVYVRKVMKEGRFVEMIDPVIGKEATVMEIESMK  397

Query  251   KVAEIAFRCLAFHRDMRPSMMEVAIELEQM  162
             ++  +A  C+   R  RP+M   A E+E +
Sbjct  398   ELGALAELCVKETRQSRPTMKAAAKEIESI  427



>ref|XP_007044245.1| Kinase superfamily protein, putative isoform 1 [Theobroma cacao]
 gb|EOY00077.1| Kinase superfamily protein, putative isoform 1 [Theobroma cacao]
Length=724

 Score =   300 bits (767),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 152/305 (50%), Positives = 210/305 (69%), Gaps = 7/305 (2%)
 Frame = -3

Query  1064  ELRETTGITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRD  885
             E   T G  + +++Y ++ +ATNNF D++ LGDG +GTVY GKL D  E VAIKR+   +
Sbjct  359   ERSNTIGFGLLIFTYSELVEATNNFDDEKELGDGGFGTVYYGKLRDGRE-VAIKRLYQHN  417

Query  884   TDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKG-EQILVYEFMPNGTLSQHLQ--REKGS  714
                +EQ  NE+++L+ + H NLV L GC+  +  + +LVYEF+PNGT++ HL   R +  
Sbjct  418   CRRLEQFINEVEILTRLRHKNLVSLYGCTSRRSRDLLLVYEFIPNGTVADHLHGDRAQSG  477

Query  713   GLPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLI  534
              L WP+R+ I  ET+ A+AYLH +    I HRDVK++NILLD N+  KVADFGLSR    
Sbjct  478   LLTWPIRMSIAIETASALAYLHTS---DIVHRDVKTNNILLDDNFSVKVADFGLSRLFPH  534

Query  533   ESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNL  354
             + +HISTAPQGTPGY+DP+YHQ + L+ KSDVYSFGVVL+E+I+ + AVD TR + E+NL
Sbjct  535   DVTHISTAPQGTPGYVDPEYHQCYQLTGKSDVYSFGVVLIELISSMPAVDITRHRQEINL  594

Query  353   AALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIE  174
             A LA++KI K    E+IDP +  + D         VAE+AFRCL   ++MRPSM EV  E
Sbjct  595   ANLAINKIQKCAFDELIDPNLGYKSDEEVTRMTTSVAELAFRCLQQEKEMRPSMEEVLEE  654

Query  173   LEQMR  159
             L++++
Sbjct  655   LQRIQ  659



>ref|XP_010551255.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Tarenaya hassleriana]
Length=651

 Score =   297 bits (761),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 153/296 (52%), Positives = 207/296 (70%), Gaps = 7/296 (2%)
 Frame = -3

Query  1037  IPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTN  858
             IPV+SYK++E+ATNNFS  R LGDG +GTVY GKL D  E VA+KR+   +   ++Q  N
Sbjct  293   IPVFSYKELEEATNNFSGDRLLGDGGFGTVYYGKLQDGRE-VAVKRLYEHNFRRVQQFIN  351

Query  857   EIKLLSSVNHPNLVRLLGCSIEKG-EQILVYEFMPNGTLSQHLQRE--KGSGLPWPVRLG  687
             EI++L+ + H NLV L GC+  K  E +LVYEF+ NGT++ HL  +  K   LPWP+R+ 
Sbjct  352   EIEILTRLQHQNLVSLYGCTSRKSRELLLVYEFVRNGTVADHLHGDLSKPGSLPWPMRMN  411

Query  686   IVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAP  507
             I  +T+ A+AYLH +    I HRDVK++NILLD N+  KVADFGLSR    + +H+STAP
Sbjct  412   IAIQTASALAYLHAS---DIIHRDVKTTNILLDTNFSVKVADFGLSRLFPNDVTHVSTAP  468

Query  506   QGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIG  327
             QGTPGY+DP+YHQ + L+DKSDVYSFGVVLVE+I+   AVD  R + E+NL+ LAV++I 
Sbjct  469   QGTPGYVDPEYHQCYQLTDKSDVYSFGVVLVELISSKPAVDINRSKTEINLSNLAVNRIQ  528

Query  326   KGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMR  159
             K    E+IDP +  + D         VAE+AF+CL   + MRP+M EV  EL++++
Sbjct  529   KQAYDELIDPGLGYKTDEKVRKMTTMVAELAFQCLQQDKAMRPTMDEVLQELQRIQ  584



>ref|XP_004308840.1| PREDICTED: wall-associated receptor kinase-like 20-like [Fragaria 
vesca subsp. vesca]
Length=627

 Score =   296 bits (759),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 209/617 (34%), Positives = 302/617 (49%), Gaps = 85/617 (14%)
 Frame = -3

Query  1862  GLKQLPFPFGFSSGC---EILLNCTSNGTMSI----GEFPVYQLTPDTIMINI-------  1725
             G   +P+P   S  C      + C SN ++        +P+  ++P +  + +       
Sbjct  35    GTTSVPYPLSTSPTCGDQSYKIRCLSNSSLLFDTLNNSYPIASISPSSQRLVVRPSTFLS  94

Query  1724  PAKC--------GRRIEAMKPLFGKNFAPTSNNGILLQNCS-----SPELKCMIPS---T  1593
             P+ C        G ++    P     F  TS+N IL  NC+     SP L C   S   T
Sbjct  95    PSSCVTSDVIHQGIQLNESLP-----FNVTSSNTILYFNCTDSILRSP-LNCSASSLCHT  148

Query  1592  MIQTQFELQDCGKDNISCFSEPHMTGGFIGYENLTGTGCKSLFSAISSPAAAANTTAVSL  1413
              +     +  C    I C                 G    S    +     +A T+ V+L
Sbjct  149   YVNNTNSVGACRAAPICCTFR-------------AGGSSTSYMVRVRDSGCSAYTSFVNL  195

Query  1412  DIQV---------IELGWWLQGHCRCSKNADCNTMRTPGDG--KPGFR-CQCSEGFTGDG  1269
             D  +         +E+ W       C   +DC+     G    + G R C C+ GFT D 
Sbjct  196   DPVLPVARWPEPGVEIQWVAPREPVCGNQSDCDGKSVCGSDPVQNGVRRCFCNSGFTWDP  255

Query  1268  YQGGSGCRRDDTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAM  1089
               G               + + + G K R G++ G      A +V+  +   + +R   +
Sbjct  256   VSG---------------FCVDDTGSKDRTGLIAGLTSGIGASLVAATIAIVLYKRHRRI  300

Query  1088  KNWNRRRRELRETT-----GITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDN  924
             K    R  + RE       G    V++ K+I+KATNNFS    LG G YG VY G L D 
Sbjct  301   KEAQDRLTKEREAILNANGGRAAKVFTGKEIKKATNNFSRDLLLGAGGYGEVYKGTLEDG  360

Query  923   DEWVAIKRIRHRDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTL  744
                VA+K  +  +T   +QV NE+++L  VNH +LV LLGC +E  + I+VYE++ NGTL
Sbjct  361   -TVVAVKIAKLGNTKGTDQVLNEVRILCQVNHRSLVHLLGCCVELEQPIMVYEYIENGTL  419

Query  743   SQHLQREKGSG---LPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKS  573
              +HLQ  KG G   L W  RL I  +T++ +AYLH +  PPIYHRDVKSSNILLDY   +
Sbjct  420   LEHLQARKGVGRSVLSWMQRLQIAHDTAEGLAYLHFSAVPPIYHRDVKSSNILLDYKLNA  479

Query  572   KVADFGLSRFGLIESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLK  393
             KVADFGLSR    + SHIST  QGT GYLDP+Y++++ L+DKSDVYSFGVVL+E+++  K
Sbjct  480   KVADFGLSRLAHTDMSHISTCAQGTLGYLDPEYYRNYQLTDKSDVYSFGVVLLELMSSQK  539

Query  392   AVDFTRPQNEVNLAALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFH  213
             A+DF R  ++VNLA      + +  L++ IDP+++       L ++  +  +A  CL   
Sbjct  540   AIDFNRDADDVNLAVYVQRLMAEEKLIDAIDPMMKEGATALELDTMKALGFLALGCLEER  599

Query  212   RDMRPSMMEVAIELEQM  162
             R  RPSM EV  E+E +
Sbjct  600   RQNRPSMKEVVEEIEYI  616



>ref|XP_006482214.1| PREDICTED: probable serine/threonine-protein kinase At1g18390-like 
isoform X1 [Citrus sinensis]
Length=714

 Score =   299 bits (765),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 152/299 (51%), Positives = 211/299 (71%), Gaps = 7/299 (2%)
 Frame = -3

Query  1031  VYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEI  852
             V+S  ++E+AT+NF+  ++LGDG +G VY G L D    VA+KR+   +   IEQ  NE+
Sbjct  375   VFSCSELEEATDNFNSSKQLGDGGFGAVYLGILRDG-RIVAVKRLYENNFKRIEQFMNEV  433

Query  851   KLLSSVNHPNLVRLLGC-SIEKGEQILVYEFMPNGTLSQHLQREKGSG--LPWPVRLGIV  681
             ++L+ + HPNLV+L GC S +  E +LVYE++PNGT++ HL   + +   LPWPVRL I 
Sbjct  434   EILTKLQHPNLVKLYGCTSRQSRELLLVYEYIPNGTVADHLHNRQPNSCLLPWPVRLSIA  493

Query  680   SETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQG  501
              ET+ A+AYLH +    + HRDVKS+NILLD N++ KVADFGLSR    + +H+STAPQG
Sbjct  494   IETAGALAYLHAS---DVIHRDVKSNNILLDNNFRVKVADFGLSRLFPTDVTHVSTAPQG  550

Query  500   TPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKG  321
             TPGY+DP Y Q + L+DKSDVYSFGVVL+E+I+GL+AVD +R ++++NL+ +A +KI  G
Sbjct  551   TPGYVDPDYFQCYKLTDKSDVYSFGVVLIELISGLEAVDTSRHRHDINLSNMATNKIQNG  610

Query  320   GLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKWG  144
              L E++DP +  EKD    + V  VAE+AFRC+   RDMRPSM EV   L + + S  G
Sbjct  611   ALNELVDPSLGFEKDYAVRNMVTSVAELAFRCVQQDRDMRPSMKEVLEILRETKDSNLG  669



>ref|XP_009396367.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Musa acuminata subsp. malaccensis]
Length=685

 Score =   298 bits (763),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 157/304 (52%), Positives = 209/304 (69%), Gaps = 10/304 (3%)
 Frame = -3

Query  1031  VYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEI  852
             ++SY+++E+ATN+F +   LGDG +GTVY GKL D    VA+KR+   +   +EQ  NEI
Sbjct  345   LFSYEELEQATNHFDESEELGDGGFGTVYKGKLRDG-RIVAVKRLYENNYRRVEQFRNEI  403

Query  851   KLLSSVNHPNLVRLLGC-SIEKGEQILVYEFMPNGTLSQHLQREKGSG--LPWPVRLGIV  681
              +LS + HPNLV L GC S  + E +LVYEF+ NGT++ HL   + S   L WPVRL I 
Sbjct  404   DILSRLRHPNLVNLYGCTSRSERELLLVYEFVQNGTVADHLHGSRASEGILTWPVRLNIA  463

Query  680   SETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQG  501
              ET+ A+AYLH A++PPI HRDVK+SNILLD  +  KVADFGLSR    + +HISTAPQG
Sbjct  464   VETADALAYLH-AVNPPIIHRDVKTSNILLDSCFNVKVADFGLSRLFPTDVTHISTAPQG  522

Query  500   TPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKG  321
             TPGYLDP+YHQ + L+DKSDVYSFGVVLVE+I+   AVD TR + ++NLA +AVD+I  G
Sbjct  523   TPGYLDPEYHQCYQLTDKSDVYSFGVVLVELISSKPAVDITRHRKDINLANMAVDRIQNG  582

Query  320   GLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEV-----AIELEQMRL  156
              L +++D  +  + D      +  VAE+AFRCL    +MRP + EV     AI+ E  ++
Sbjct  583   ELDQLVDEGLGYQSDEAIRKMITMVAEVAFRCLQKDGEMRPPVKEVLDTLKAIQSEGYKV  642

Query  155   SKWG  144
             +K G
Sbjct  643   AKEG  646



>ref|XP_004300505.1| PREDICTED: probable serine/threonine-protein kinase At1g18390-like 
isoform 1 [Fragaria vesca subsp. vesca]
Length=690

 Score =   298 bits (762),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 155/318 (49%), Positives = 216/318 (68%), Gaps = 8/318 (3%)
 Frame = -3

Query  1103  RRLAMKNWNRRRRELRETTGITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDN  924
             R +  K+++R   E + +  + + V++YK++E+ATN F   + LGDG +GTVY GK+ D 
Sbjct  330   RSIFSKSYSRSDTE-KGSAYLGVHVFTYKELEQATNYFDSSKELGDGGFGTVYYGKVRDG  388

Query  923   DEWVAIKRIRHRDTDSIEQVTNEIKLLSSVNHPNLVRLLGC-SIEKGEQILVYEFMPNGT  747
                VA+KR+   +   +EQ  NEI++L+ + H NLV L GC S    E +LVYE++PNGT
Sbjct  389   RS-VAVKRLYETNYKRVEQFMNEIEILARLRHQNLVLLYGCTSRHSRELLLVYEYVPNGT  447

Query  746   LSQHLQ--REKGSGLPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKS  573
             L+ HL   + K   LPW  R+ I  ET+ A++YLH +    I HRDVK++NILLD N+  
Sbjct  448   LADHLHGGKAKPGALPWHTRINIAVETASALSYLHAS---EIIHRDVKTTNILLDNNFCV  504

Query  572   KVADFGLSRFGLIESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLK  393
             KVADFGLSR    + +HISTAPQGTPGY+DP Y+Q + L+ KSDVYSFGVVLVE+I+ L 
Sbjct  505   KVADFGLSRLFPTDVTHISTAPQGTPGYVDPDYNQCYQLTTKSDVYSFGVVLVELISSLP  564

Query  392   AVDFTRPQNEVNLAALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFH  213
             AVD TR + E+NL+ +A++KI K  L E++DP +  E D      +N VAE+AFRCL   
Sbjct  565   AVDITRHRQEINLSNMAINKIQKHALDELVDPSLGYESDFRVRKMINAVAELAFRCLQNE  624

Query  212   RDMRPSMMEVAIELEQMR  159
              DMRPSMM+V  EL++++
Sbjct  625   TDMRPSMMDVENELKRIQ  642



>ref|XP_010660405.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X4 [Vitis vinifera]
Length=675

 Score =   297 bits (761),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 150/303 (50%), Positives = 210/303 (69%), Gaps = 7/303 (2%)
 Frame = -3

Query  1058  RETTGITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTD  879
             + +T   + V+SY ++E+ATNNF   R LGDG +GTVY GKL D    VA+KR+   +  
Sbjct  329   KGSTYFGVQVFSYMELEEATNNFDPSRELGDGGFGTVYYGKLQDG-RVVAVKRLYENNFK  387

Query  878   SIEQVTNEIKLLSSVNHPNLVRLLGCSIEKG-EQILVYEFMPNGTLSQHLQ-REKGSG-L  708
              +EQ  NE+++L+ + H NLV+L GC+  +  E +LVYE++PNGT++ HL  ++  SG +
Sbjct  388   RVEQFMNEVQILTRLQHQNLVKLYGCTSRRSRELLLVYEYIPNGTVADHLHGKQANSGSI  447

Query  707   PWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIES  528
              WPVRL I  ET+ A+AYLH +    I HRDVK++NILLD N++ KVADFGLSR    + 
Sbjct  448   TWPVRLSIAIETANALAYLHES---EIIHRDVKTNNILLDNNFQVKVADFGLSRLFPTDV  504

Query  527   SHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAA  348
             +H+STAPQGTPGY+DP+YHQ + L+ KSDVYSFGVVL+E+I+  +AVD  R ++++NLA 
Sbjct  505   THVSTAPQGTPGYVDPEYHQCYQLTSKSDVYSFGVVLMELISSKQAVDTNRHRHDINLAN  564

Query  347   LAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELE  168
             +AV+KI    L E++DP +  E D      +  VAE+AFRCL   RDMRP+M EV   L 
Sbjct  565   MAVNKILNHTLHELVDPSLGFESDSLVRRKITLVAELAFRCLQHERDMRPTMGEVLKALR  624

Query  167   QMR  159
             ++ 
Sbjct  625   RIE  627



>ref|XP_004238904.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Solanum lycopersicum]
Length=661

 Score =   297 bits (760),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 158/334 (47%), Positives = 216/334 (65%), Gaps = 26/334 (8%)
 Frame = -3

Query  1082  WNRRRREL-----RETTGIT--------------IPVYSYKDIEKATNNFSDKRRLGDGA  960
             + RRR +      R T+G++              IPV+SY+++E+ATN FS  R LGDG 
Sbjct  273   YMRRRNDFSLFISRNTSGVSMIHHELEERCEYLGIPVFSYEELEEATNKFSSSRELGDGG  332

Query  959   YGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKG-E  783
             YGTVY GKL D  E VA+K +   +   ++Q  NEI++L+ + HPNLV L GC+  +  E
Sbjct  333   YGTVYYGKLKDGKE-VAVKSLYENNHRQMQQFINEIEILTRLRHPNLVTLYGCTSRRSRE  391

Query  782   QILVYEFMPNGTLSQHL--QREKGSGLPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVK  609
               LVYE++PNGT++ HL   R K   L W +RL I  ET+ A+AYLH +    I HRDVK
Sbjct  392   LFLVYEYIPNGTIADHLYGHRAKDKLLTWSIRLKIAIETASALAYLHAS---DIIHRDVK  448

Query  608   SSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSF  429
             ++NILLD  +  KVADFGLS+    + +HISTAPQGTPGY+DPQYH+ + L+DKSDVYSF
Sbjct  449   TNNILLDNKFCVKVADFGLSKSFPNDVTHISTAPQGTPGYVDPQYHECYQLTDKSDVYSF  508

Query  428   GVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNK  249
             GVVLVE+++  +AVD  R  +E+NLA  A+++I K    E+IDP +  E D         
Sbjct  509   GVVLVELLSSKRAVDMNRHMHEINLANYAMNRILKSAFDEVIDPSLGFETDAEVRRMTIS  568

Query  248   VAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKW  147
             VAE+AF+CL   +DMRP+M EV   L+ ++ S+W
Sbjct  569   VAELAFQCLQVVKDMRPTMEEVHETLKLIKYSEW  602



>ref|XP_009360135.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X2 [Pyrus x bretschneideri]
Length=522

 Score =   293 bits (750),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 149/301 (50%), Positives = 209/301 (69%), Gaps = 7/301 (2%)
 Frame = -3

Query  1052  TTGITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSI  873
             +T + + ++SYK++E+ATN F   + LGDG +GTVY G +HD    VA+KR    +   +
Sbjct  170   STYLGVHIFSYKELEEATNYFDSAKELGDGGFGTVYHGNVHDG-RAVAVKRPYENNWKRV  228

Query  872   EQVTNEIKLLSSVNHPNLVRLLGC-SIEKGEQILVYEFMPNGTLSQHLQ--REKGSGLPW  702
             EQ  NEI++L+ + H NLV L GC S    E +LVYE++PNG L++HL   R K   LPW
Sbjct  229   EQFMNEIEILARLRHQNLVLLYGCTSRHSRELLLVYEYIPNGNLAEHLHGGRAKPGALPW  288

Query  701   PVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSH  522
               R+ I  ET+ A++YLH +    I HRDVK++NILLD N+  KVADFGLSR   +  +H
Sbjct  289   LTRINIAIETASALSYLHAS---DIIHRDVKTTNILLDNNFGVKVADFGLSRPFPMNVTH  345

Query  521   ISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALA  342
             ISTAPQGTPGY+DP+Y+Q + L+ KSDVYSFGVVL+E+I+ + AVD TR ++E+NL+ +A
Sbjct  346   ISTAPQGTPGYVDPEYNQCYQLTSKSDVYSFGVVLIELISSMPAVDITRHRHEINLSTMA  405

Query  341   VDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQM  162
             ++KI    L E++DP +  E D  T   +  VAE+AFRCL   +D+RPSM+EV  EL+Q+
Sbjct  406   INKIKNHTLHELVDPYLGFESDSTTQKMIIAVAELAFRCLQTDKDVRPSMVEVLNELKQI  465

Query  161   R  159
             +
Sbjct  466   Q  466



>ref|XP_006430730.1| hypothetical protein CICLE_v10011179mg [Citrus clementina]
 gb|ESR43970.1| hypothetical protein CICLE_v10011179mg [Citrus clementina]
Length=716

 Score =   298 bits (763),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 150/299 (50%), Positives = 211/299 (71%), Gaps = 7/299 (2%)
 Frame = -3

Query  1031  VYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEI  852
             V+S  ++E+AT+NF+  ++LGDG +G VY G L D    VA+KR+   +   IEQ   E+
Sbjct  377   VFSCSELEEATDNFNSSKQLGDGGFGAVYLGILRDG-RIVAVKRLYENNFKRIEQFMTEV  435

Query  851   KLLSSVNHPNLVRLLGC-SIEKGEQILVYEFMPNGTLSQHLQREKGSG--LPWPVRLGIV  681
             ++L+ + HPNLV+L GC S +  E +LVYE++PNGT++ HL   + +   LPWPVRL I 
Sbjct  436   EILTKLQHPNLVKLYGCTSRQSRELLLVYEYIPNGTVADHLHNRQPNSCLLPWPVRLSIA  495

Query  680   SETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQG  501
              ET+ A+AYLH +    + HRDVKS+NILLD N++ KVADFGLSR    + +H+STAPQG
Sbjct  496   IETADALAYLHAS---DVIHRDVKSNNILLDNNFRVKVADFGLSRLFPTDVTHVSTAPQG  552

Query  500   TPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKG  321
             TPGY+DP Y Q + L+DKSDVYSFGVVL+E+I+GL+AVD +R ++++NL+ +A++KI  G
Sbjct  553   TPGYVDPDYFQCYKLTDKSDVYSFGVVLIELISGLQAVDTSRHRHDINLSNMAINKIQNG  612

Query  320   GLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKWG  144
              L E++DP +  EKD    + V  VAE+AFRC+   RDMRP+M EV   L + + S  G
Sbjct  613   ALNELVDPSLGFEKDYAVRNMVTSVAELAFRCVQQDRDMRPTMKEVLEILRETKDSNLG  671



>ref|XP_004167016.1| PREDICTED: LOW QUALITY PROTEIN: probable serine/threonine-protein 
kinase At1g18390-like [Cucumis sativus]
Length=607

 Score =   295 bits (756),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 147/293 (50%), Positives = 207/293 (71%), Gaps = 7/293 (2%)
 Frame = -3

Query  1031  VYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEI  852
             V++Y ++E+AT+NF   R LGDG YGTVY G L D    VA+KR+   +   ++Q TNE+
Sbjct  269   VFTYAELEEATHNFDRSRELGDGGYGTVYFGTLKDG-RTVAVKRLYENNYKRVQQFTNEV  327

Query  851   KLLSSVNHPNLVRLLGCSIEKGE-QILVYEFMPNGTLSQHLQ-REKGSGL-PWPVRLGIV  681
             ++LS + HPNLV+L GC+  + +  +LVYE++ NGT++ HL  ++  SGL  W VRL I 
Sbjct  328   EILSKLQHPNLVKLYGCTSRQSQGLLLVYEYISNGTVADHLHGKQANSGLLTWSVRLKIA  387

Query  680   SETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQG  501
              ET+ A+AYLH      I HRDVK++NILLD N+K KVADFGLSR   I  +H+STAPQG
Sbjct  388   IETANALAYLH---RKDIIHRDVKTNNILLDNNFKVKVADFGLSRLFPINVTHVSTAPQG  444

Query  500   TPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKG  321
             TPGY+DP+Y+Q + L+DKSDVYSFGVVLVE+I+ L+AVD  R ++++NL+ +A+++I   
Sbjct  445   TPGYVDPEYYQCYQLTDKSDVYSFGVVLVELISSLQAVDVNRNRDDINLSNMAINRIHNQ  504

Query  320   GLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQM  162
              L +++DP +  E+D    S +  VAE+A+RCL   RD RPSM EV   L ++
Sbjct  505   ALADLVDPDLGFERDYAVRSMIKSVAELAYRCLQQTRDARPSMDEVVEALREL  557



>ref|XP_002314842.2| hypothetical protein POPTR_0010s13080g [Populus trichocarpa]
 gb|EEF01013.2| hypothetical protein POPTR_0010s13080g [Populus trichocarpa]
Length=360

 Score =   288 bits (736),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 145/303 (48%), Positives = 209/303 (69%), Gaps = 10/303 (3%)
 Frame = -3

Query  1043  ITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQV  864
             ++IP++SY ++ +ATNNF  ++ +GDG +GTVY GKL D  E VA+KR+   +   ++Q 
Sbjct  45    LSIPIFSYTELGQATNNFDSEKEVGDGGFGTVYYGKLQDGRE-VAVKRLYEHNYKRVKQF  103

Query  863   TNEIKLLSSVNHPNLVRLLGCSIEKG-EQILVYEFMPNGTLSQHLQ--REKGSGLPWPVR  693
              NEI++L+ ++H NLV L GC+  +  E +LVYE++PNGT++ HL   + K S L WP+R
Sbjct  104   MNEIEILTRLHHKNLVCLYGCTSRRSRELLLVYEYIPNGTVADHLHGDQAKSSPLTWPIR  163

Query  692   LGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHIST  513
             + I  ET+ A+AYLH +    I HRDVK++NILLD N+  KVADFGLSR    + +H+ST
Sbjct  164   MSIAIETASALAYLHAS---DIIHRDVKTNNILLDNNFSVKVADFGLSRLFPKDVTHVST  220

Query  512   APQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDK  333
              PQGTPGY+DP+YHQ + L+DKSDVYSFGVVL+E+I+ + AVD TR ++E+NL+ LA+ K
Sbjct  221   VPQGTPGYVDPEYHQSYQLTDKSDVYSFGVVLIELISSMPAVDITRHRHEINLSNLAISK  280

Query  332   IGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLS  153
             I K    E+ID  +    D         VAE+AF+CL   ++ RPSM  V   L+Q+++ 
Sbjct  281   IQKCAFDELIDSRLGYNSDEEVKRMTTSVAELAFQCLQQDKETRPSMENV---LQQLKII  337

Query  152   KWG  144
             + G
Sbjct  338   QGG  340



>ref|XP_006344312.1| PREDICTED: probable serine/threonine-protein kinase At1g18390-like 
[Solanum tuberosum]
Length=1080

 Score =   305 bits (781),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 155/300 (52%), Positives = 208/300 (69%), Gaps = 7/300 (2%)
 Frame = -3

Query  1037  IPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTN  858
             IPV+SY+++E+ATN FS  R LGDG YGTVY GKL D  E VA+KR+   +   +EQ  N
Sbjct  726   IPVFSYEELEEATNKFSSSRELGDGGYGTVYYGKLKDGKE-VAVKRLYENNHRQMEQFIN  784

Query  857   EIKLLSSVNHPNLVRLLGCSIEKGEQI-LVYEFMPNGTLSQHL--QREKGSGLPWPVRLG  687
             EI++L+ + HPNLV L GC+  +  ++ LVYE++PNGT++ HL   R K   L W +RL 
Sbjct  785   EIEILTRLRHPNLVTLYGCASRRSRELFLVYEYIPNGTIADHLNGHRAKDKLLTWSIRLK  844

Query  686   IVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAP  507
             I  ET+ A+AYLH +    I HRDVK++NILLD  +  KVADFGLS+    + +HISTAP
Sbjct  845   IAIETASALAYLHAS---DIIHRDVKTNNILLDNKFCVKVADFGLSKSFPNDVTHISTAP  901

Query  506   QGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIG  327
             QGTPGY+DPQYH+ +HL+DKSDVYSFGVVLVE+I+  +AVD  R  +E+NLA  A+++I 
Sbjct  902   QGTPGYVDPQYHECYHLTDKSDVYSFGVVLVELISSKQAVDMNRHMHEINLANYAMNRIL  961

Query  326   KGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKW  147
             K    E+IDP +  E D         VAE+AF+CL   +DMRP+M EV   L+ ++ S+W
Sbjct  962   KSAFDEVIDPSLGFETDAEVRRMTTSVAELAFQCLQVVKDMRPTMEEVHEALKLIKYSEW  1021


 Score =   294 bits (752),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 146/296 (49%), Positives = 203/296 (69%), Gaps = 7/296 (2%)
 Frame = -3

Query  1037  IPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTN  858
             +PV+SY ++++AT NF   R LGDG YGTVY GKL D  E VA+KR+   +    EQ   
Sbjct  49    VPVFSYAELQQATMNFDSSRELGDGGYGTVYYGKLQDGRE-VAVKRLYDHNARRKEQFVT  107

Query  857   EIKLLSSVNHPNLVRLLGCSIEKGEQIL-VYEFMPNGTLSQHLQ--REKGSGLPWPVRLG  687
             EI++L+ + H NLV L GC+ +  +Q+L VYE++PNGT++ HL   + K   L WP+R+ 
Sbjct  108   EIEILTRLRHKNLVTLYGCTSKLSDQLLLVYEYVPNGTIADHLHGHKAKDGSLTWPIRMK  167

Query  686   IVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAP  507
             I  E + A+AYLH +    I HRDVKS+NILLD N+  KV DFGLSR    + SHISTAP
Sbjct  168   IAIEAATALAYLHAS---DIIHRDVKSNNILLDQNFCVKVGDFGLSRLHPTDISHISTAP  224

Query  506   QGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIG  327
             QGTPGY+DP+YH+ + L+DKSDVYSFGVVLVE+++ + AVDF+R   E+NL+  A+++I 
Sbjct  225   QGTPGYVDPKYHECYQLTDKSDVYSFGVVLVELLSSMPAVDFSRRNEEINLSNYAINRIL  284

Query  326   KGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMR  159
             +    E+IDP +  + D         VAEI+FRCL   +DMRP+M+EV   L++++
Sbjct  285   RCAFNELIDPSLGFQSDAEVRRMTTSVAEISFRCLQHDKDMRPTMVEVLETLQEIQ  340



>ref|XP_011034941.1| PREDICTED: wall-associated receptor kinase-like 20 [Populus euphratica]
Length=630

 Score =   296 bits (757),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 208/608 (34%), Positives = 302/608 (50%), Gaps = 61/608 (10%)
 Frame = -3

Query  1862  GLKQLPFPFGFSSGC---EILLNCTSNGTMSI---GEFPVYQLTPD---------TIMIN  1728
             G   +P+PF  +S C   +  + C S   +       +P+  + P          +++ N
Sbjct  32    GTTPVPYPFSTASTCGDPQYKIRCNSGSLLFDTLNSSYPIMSINPSIQRLVIQPASLLPN  91

Query  1727  IPAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMIQTQFELQDCGKDN  1548
                      E +       F  T +N I+  NC+   L+  +  T         +  K  
Sbjct  92    TCVTSDYIYEGISLNDSLPFNITGDNTIMFLNCTESLLRSPLNCTSTSLCHVYVNSTKGG  151

Query  1547  ISCFSEP-HMTGGFIGYEN-----LTGTGCKSLFSAISSPAAAANTTAVSLDIQV-----  1401
               C + P   T G  G        +  TGC+            A T+ V LD  +     
Sbjct  152   APCQAAPICCTFGAGGSSTAHRIRVRDTGCR------------AYTSFVDLDSVLPVDKW  199

Query  1400  ----IELGWWLQGHCRCSKNADC--NTMRTPGDGKPGFR-CQCSEGFTGDGYQGGSGCRR  1242
                 + + W L     C   ADC  N+   P     G R C C+ G   D  QG   C  
Sbjct  200   SNPGLAIKWVLPQEPVCGSQADCDGNSTCAPAANLSGVRRCYCTGGLHWDPIQGI--CVH  257

Query  1241  DDTRCNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAMKNWNRR---  1071
             D T  N      G CGG T+  ++ G        ++ + +   + +RR  +K    R   
Sbjct  258   DATCQND-----GSCGGSTKTALIAGLTSGIGLTLLVIVISVLLYKRRRRIKEAQERLAR  312

Query  1070  -RRELRETTGI-TIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRI  897
              R E+    G     +++ K I+KATNNFS  R LG G YG V+ G L D+   VA+K  
Sbjct  313   EREEILNAGGSRAAKIFTGKQIKKATNNFSKDRLLGAGGYGEVFKGIL-DDGTVVAVKCA  371

Query  896   RHRDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKG  717
             +  +T   +QV NE+++L  VNH +LV LLGC +E  + ILVYE++ NG L   LQ  K 
Sbjct  372   KLGNTKGTDQVLNEVRILCQVNHRSLVCLLGCCVELQQPILVYEYIENGNLLDRLQGLKP  431

Query  716   SG---LPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSR  546
              G   L W  RL I  +T+  +AYLH++  PPIYHRDVKSSNILLD    +KV+DFGLSR
Sbjct  432   DGKSQLSWLHRLQIAHDTADGLAYLHSSAVPPIYHRDVKSSNILLDEKLNAKVSDFGLSR  491

Query  545   FGLIESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQN  366
                 + +HIST  QGT GYLDP+Y++ + L+DKSDVYSFGVVL+E++T  KA+DFTRP++
Sbjct  492   LAHSDLTHISTCAQGTLGYLDPEYYRKYQLTDKSDVYSFGVVLLELLTSQKALDFTRPED  551

Query  365   EVNLAALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMME  186
             ++NLA      + +  L+++IDP+++ +     L +V  +A +A  C+   R  RPSM E
Sbjct  552   DINLAVYVQRMMEEEKLMDVIDPMLKVKASSLHLETVKALAFLALSCIEEKRQNRPSMKE  611

Query  185   VAIELEQM  162
             VA E+E +
Sbjct  612   VAEEIEYI  619



>ref|XP_010456187.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform 
X1 [Camelina sativa]
Length=635

 Score =   296 bits (757),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 198/598 (33%), Positives = 301/598 (50%), Gaps = 55/598 (9%)
 Frame = -3

Query  1901  VFGSSTCNRSCGDGLKQLPFPFGFSSGCEILLNCTS-NGTMSIGEFPVYQLTPDTIMINI  1725
             V  S  CN +CG     LP+PFGFS GC I  +C+  +    IG + V  +T ++I + +
Sbjct  25    VSSSEICNGNCGR--LTLPYPFGFSPGCPIRFHCSEVDQETKIGGYSVQNVTDNSIFVGL  82

Query  1724  PAKCGRRIEAMKPLFGKNFAPTSNNGILLQNCSSPELKCMIPSTMIQTQFELQDCGKD-N  1548
             P  C R+IE M  LF   FAPTS N  L+  C      C I    ++   +LQ CG   N
Sbjct  83    PHNCSRKIEDMTTLFAAQFAPTSENSFLMDECMYKTNGCSINQGFLENTLKLQSCGSTGN  142

Query  1547  ISCFSEPHMTGGFIGYENLTGTGCKSLFSAISSPAAAANTTAVSLDIQVIELGWWLQGHC  1368
             ISCFS       F   ++L  + C  LFS+I+  +  AN T ++L+ + ++LGWWL+  C
Sbjct  143   ISCFS-LDTNSKFFSMKDLRNSSCSLLFSSIAFGSVGAN-TGIALEFERVQLGWWLKEGC  200

Query  1367  R---CSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTRCNPA-KYLLGE  1200
                 C++NA+C  +  P DG  G RC C E + GDGY   + C R   + N   K+++G 
Sbjct  201   ENKPCAENANCTQVDIP-DGNAGHRCSCLEDYQGDGYI--NPCLRVRVKGNVGVKFIIG-  256

Query  1199  CGGKTRigvliggviagaaLMVSVGLICCIIRRRLAMKNWNRRRRELRETTGITIPVYSY  1020
                                  + V  I  ++   L     NRR+++ R   G  +  +  
Sbjct  257   ---------------------MGVSFIALVV-ISLYFFTRNRRKQKQRH-KGKYVQDHRL  293

Query  1019  KD----------IEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIE  870
             KD          +  ATN+FS    LG+G +G VY G L D+ E +A+KR+  R      
Sbjct  294   KDAQLLQLDFDTVRLATNDFSPNNHLGEGGFGAVYKGVL-DSGEEIAVKRLSVRSGQGDN  352

Query  869   QVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHL-QREKGSGLPWPVR  693
             +  NE+ L++ + H NLVRLLG  +E  E++L+YEF  N +L + +    + + L W  R
Sbjct  353   EFVNEVSLVAKLQHRNLVRLLGFCLEGEERLLIYEFFKNTSLEKFIFDSNRRTTLDWETR  412

Query  692   LGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSR-FGLIESSH--  522
               I++  ++ + YLH      I HRD+K+SN+LLD     K+ADFG+++ F   ++S   
Sbjct  413   HRIITGVARGLLYLHEGSRFKIIHRDMKASNVLLDDAMNPKIADFGMAKLFNTDQTSQTM  472

Query  521   ISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALA  342
              ++   GT GY+ P+Y      S K+DVYSFGV+++EII G K       Q+ + L +  
Sbjct  473   FTSRVAGTYGYMAPEYAMSGQFSVKTDVYSFGVLVLEIIKGKKNNWSPVEQSSLFLLSYV  532

Query  341   VDKIGKGGLLEIIDPLIEAEKDVWTLS-SVNKVAEIAFRCLAFHRDMRPSMMEVAIEL  171
                  +G +L I+DP +    D   LS  + K   I   C+  + + RP+M  V   L
Sbjct  533   WKCWREGKVLNIVDPSL--INDTIGLSDEIMKCIHIGLLCVQENPESRPTMPSVVAML  588



>ref|XP_009600768.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Nicotiana tomentosiformis]
Length=608

 Score =   295 bits (755),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 148/300 (49%), Positives = 206/300 (69%), Gaps = 7/300 (2%)
 Frame = -3

Query  1037  IPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTN  858
             IPV++Y+++E+ATN F+  ++LGDG YGTVY GKL D  E VA+KR+   +   ++Q  N
Sbjct  255   IPVFTYRELEEATNKFNSAKQLGDGGYGTVYYGKLRDGKE-VAVKRLYEHNHKQMQQFIN  313

Query  857   EIKLLSSVNHPNLVRLLGCSIEKG-EQILVYEFMPNGTLSQHLQ--REKGSGLPWPVRLG  687
             EI++L+ + H NLV L GC+  +  E  LVYE++PNGT++ HL   R K   L WP+RL 
Sbjct  314   EIEILTRLRHRNLVILYGCTSRRSRELFLVYEYIPNGTIADHLHGHRAKDKLLTWPIRLK  373

Query  686   IVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAP  507
             I  E + A+AYLH +    I HRDVK++NILLD ++  KVADFGLS+    + +HISTAP
Sbjct  374   IAIEIASALAYLHAS---DIIHRDVKTNNILLDNDFCVKVADFGLSKLFPNDVTHISTAP  430

Query  506   QGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIG  327
             QGTPGY+DPQYH+ + L+DKSDVYSFGVVLVE+I+ + AVD  R  +E+NLA+ A+++I 
Sbjct  431   QGTPGYVDPQYHECYQLTDKSDVYSFGVVLVELISSMPAVDMNRHMHEINLASFAMNRIL  490

Query  326   KGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKW  147
             K    E+IDP +  E +         VAE+AF+CL   +DMRP M EV   L+ ++  +W
Sbjct  491   KCAFNEVIDPALGFETNAEVRRMTTSVAELAFQCLQAVKDMRPKMEEVLETLKTIKEGEW  550



>ref|XP_004238901.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Solanum lycopersicum]
 ref|XP_010320746.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Solanum lycopersicum]
 ref|XP_010320747.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Solanum lycopersicum]
 ref|XP_010320748.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Solanum lycopersicum]
Length=660

 Score =   296 bits (758),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 152/300 (51%), Positives = 209/300 (70%), Gaps = 7/300 (2%)
 Frame = -3

Query  1037  IPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTN  858
             IPV+SY ++E ATN+F+  R LGDG +GTVY GKL D  E VA+KR+   +   ++Q  N
Sbjct  307   IPVFSYSELEDATNDFNSSRVLGDGGFGTVYYGKLKDGRE-VAVKRLYEHNCKRMQQFVN  365

Query  857   EIKLLSSVNHPNLVRLLGCSIEKG-EQILVYEFMPNGTLSQHLQ--REKGSGLPWPVRLG  687
             +I++L+ + H NLV L GC+  +  E +LVYE++PNGTL+ HL   R K   L WPVRL 
Sbjct  366   KIEILTRLRHNNLVTLYGCTSRRSRELLLVYEYIPNGTLADHLHGDRAKNRSLTWPVRLE  425

Query  686   IVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAP  507
             I  ET+ A+AYLH +    I H DVK++NILLD N+  KVADFG+SR    + S+ISTAP
Sbjct  426   IAIETAGALAYLHAS---DIIHCDVKTNNILLDQNFSVKVADFGISRLFPNDVSYISTAP  482

Query  506   QGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIG  327
             +GTPGY+DP+YH+ + L+ KSDVYSFGVVLVE+I+ + AVD TR   E+NLA  A++KI 
Sbjct  483   RGTPGYIDPKYHECYQLTIKSDVYSFGVVLVELISSMPAVDLTRHSQEINLANFAINKIV  542

Query  326   KGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKW  147
             K    E+IDP +  + D   L +   VAE+AF CL   RDMRP+M+EV   L+++++S++
Sbjct  543   KRAFNELIDPSLGFDSDTEILETTTSVAELAFLCLQTDRDMRPTMVEVLDTLKEIQISEF  602



>ref|XP_010660404.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X3 [Vitis vinifera]
Length=685

 Score =   297 bits (760),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 150/300 (50%), Positives = 209/300 (70%), Gaps = 7/300 (2%)
 Frame = -3

Query  1052  TTGITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSI  873
             +T   + V+SY ++E+ATNNF   R LGDG +GTVY GKL D    VA+KR+   +   +
Sbjct  341   STYFGVQVFSYMELEEATNNFDPSRELGDGGFGTVYYGKLQDG-RVVAVKRLYENNFKRV  399

Query  872   EQVTNEIKLLSSVNHPNLVRLLGCSIEKG-EQILVYEFMPNGTLSQHLQ-REKGSG-LPW  702
             EQ  NE+++L+ + H NLV+L GC+  +  E +LVYE++PNGT++ HL  ++  SG + W
Sbjct  400   EQFMNEVQILTRLQHQNLVKLYGCTSRRSRELLLVYEYIPNGTVADHLHGKQANSGSITW  459

Query  701   PVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSH  522
             PVRL I  ET+ A+AYLH +    I HRDVK++NILLD N++ KVADFGLSR    + +H
Sbjct  460   PVRLSIAIETANALAYLHES---EIIHRDVKTNNILLDNNFQVKVADFGLSRLFPTDVTH  516

Query  521   ISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALA  342
             +STAPQGTPGY+DP+YHQ + L+ KSDVYSFGVVL+E+I+  +AVD  R ++++NLA +A
Sbjct  517   VSTAPQGTPGYVDPEYHQCYQLTSKSDVYSFGVVLMELISSKQAVDTNRHRHDINLANMA  576

Query  341   VDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQM  162
             V+KI    L E++DP +  E D      +  VAE+AFRCL   RDMRP+M EV   L ++
Sbjct  577   VNKILNHTLHELVDPSLGFESDSLVRRKITLVAELAFRCLQHERDMRPTMGEVLKALRRI  636



>gb|KDO39222.1| hypothetical protein CISIN_1g017232mg [Citrus sinensis]
 gb|KDO39223.1| hypothetical protein CISIN_1g017232mg [Citrus sinensis]
Length=375

 Score =   287 bits (735),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 144/288 (50%), Positives = 198/288 (69%), Gaps = 7/288 (2%)
 Frame = -3

Query  1037  IPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTN  858
             + V+SY ++E+ATN F   R LGDG +GTVY G+L D    VA+KR+   +   +EQ  N
Sbjct  48    VQVFSYGELEEATNYFDSARELGDGGFGTVYYGELQDG-RAVAVKRLYENNYKRVEQFMN  106

Query  857   EIKLLSSVNHPNLVRLLGC-SIEKGEQILVYEFMPNGTLSQHL--QREKGSGLPWPVRLG  687
             E+ +L+ + H NLV L GC S    E +LVYEF+ NGT++ HL  +R K   LPWP RL 
Sbjct  107   EVDILARLRHKNLVSLYGCTSRHSRELLLVYEFISNGTVADHLHGERAKPGALPWPTRLK  166

Query  686   IVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAP  507
             I  ET+ A+ YLH +    I HRDVK++NILLD N+  KVADFGLSR      +H+STAP
Sbjct  167   IAIETASALTYLHAS---DIIHRDVKTNNILLDNNFCVKVADFGLSRLFPNHVTHVSTAP  223

Query  506   QGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIG  327
             QGTPGY+DP+YHQ + L+DKSDV+SFGVVL+E+I+ + AVD TR ++E+NL+ LA++KI 
Sbjct  224   QGTPGYVDPEYHQCYQLTDKSDVFSFGVVLIELISSMPAVDITRHRHEINLSNLAINKIQ  283

Query  326   KGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEV  183
                L E++D  +  E D     ++N VAE+AF+CL   +D+RP M++V
Sbjct  284   NKALHELVDQTLGYESDNKVRRTINAVAELAFQCLQSEKDLRPYMVDV  331



>tpg|DAA58038.1| TPA: putative WAK receptor-like protein kinase family protein 
[Zea mays]
Length=693

 Score =   296 bits (759),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 151/294 (51%), Positives = 206/294 (70%), Gaps = 8/294 (3%)
 Frame = -3

Query  1031  VYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEI  852
             +++Y+++E+AT+ F + R LGDG +GTVY G L D    VA+KR+ +     +EQ  NE 
Sbjct  364   LFTYEELEEATSCFDENRELGDGGFGTVYKGYLKDG-RVVAVKRLYNNSYRRVEQFQNEA  422

Query  851   KLLSSVNHPNLVRLLGC-SIEKGEQILVYEFMPNGTLSQHL--QREKGSGLPWPVRLGIV  681
              +LS + HPNLV   GC S +  E +LVYEF+ NGT++ HL  QR     LPWP+RLG+ 
Sbjct  423   AILSGLRHPNLVMFYGCTSSQSRELLLVYEFVANGTVADHLHGQRAAERALPWPLRLGVA  482

Query  680   SETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQG  501
              E++ A+ YLH A+ PP+ HRDVK++NILLD +Y  KVADFGLSR   ++ +H+STAPQG
Sbjct  483   VESAAALTYLH-AIEPPVVHRDVKTTNILLDADYHVKVADFGLSRLFPLDVTHVSTAPQG  541

Query  500   TPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKG  321
             TPGY+DP+YHQ + L+DKSDVYSFGVVLVE+I+   AVD TR +NE+NLA +A+ KI K 
Sbjct  542   TPGYVDPEYHQCYQLTDKSDVYSFGVVLVELISSKPAVDVTRHRNEINLAGMAISKIQKC  601

Query  320   GLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMR  159
              L E++D  +  E D  T  ++  VAE+AFRCL  + +MRP + EV   LE +R
Sbjct  602   QLEELVDIDLGYETDPATKKAMTAVAELAFRCLQQNGEMRPPIKEV---LEVLR  652



>ref|XP_010660403.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X2 [Vitis vinifera]
Length=689

 Score =   296 bits (758),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 150/303 (50%), Positives = 210/303 (69%), Gaps = 7/303 (2%)
 Frame = -3

Query  1058  RETTGITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTD  879
             + +T   + V+SY ++E+ATNNF   R LGDG +GTVY GKL D    VA+KR+   +  
Sbjct  343   KGSTYFGVQVFSYMELEEATNNFDPSRELGDGGFGTVYYGKLQDG-RVVAVKRLYENNFK  401

Query  878   SIEQVTNEIKLLSSVNHPNLVRLLGCSIEKG-EQILVYEFMPNGTLSQHLQ-REKGSG-L  708
              +EQ  NE+++L+ + H NLV+L GC+  +  E +LVYE++PNGT++ HL  ++  SG +
Sbjct  402   RVEQFMNEVQILTRLQHQNLVKLYGCTSRRSRELLLVYEYIPNGTVADHLHGKQANSGSI  461

Query  707   PWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIES  528
              WPVRL I  ET+ A+AYLH +    I HRDVK++NILLD N++ KVADFGLSR    + 
Sbjct  462   TWPVRLSIAIETANALAYLHES---EIIHRDVKTNNILLDNNFQVKVADFGLSRLFPTDV  518

Query  527   SHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAA  348
             +H+STAPQGTPGY+DP+YHQ + L+ KSDVYSFGVVL+E+I+  +AVD  R ++++NLA 
Sbjct  519   THVSTAPQGTPGYVDPEYHQCYQLTSKSDVYSFGVVLMELISSKQAVDTNRHRHDINLAN  578

Query  347   LAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELE  168
             +AV+KI    L E++DP +  E D      +  VAE+AFRCL   RDMRP+M EV   L 
Sbjct  579   MAVNKILNHTLHELVDPSLGFESDSLVRRKITLVAELAFRCLQHERDMRPTMGEVLKALR  638

Query  167   QMR  159
             ++ 
Sbjct  639   RIE  641



>ref|XP_001776649.1| predicted protein [Physcomitrella patens]
 gb|EDQ58485.1| predicted protein [Physcomitrella patens]
Length=305

 Score =   284 bits (727),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 149/299 (50%), Positives = 205/299 (69%), Gaps = 22/299 (7%)
 Frame = -3

Query  1031  VYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEI  852
             +++YK+++ AT +FS K  LG G +GTVY GKL D    VA+K++       I+Q  NE+
Sbjct  10    LFTYKELDHATQSFSTKHELGGGGFGTVYKGKLSDG-RLVAVKKLNQGGNQGIQQFHNEV  68

Query  851   KLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQREKGSGLPWPVRLGIVSET  672
              +LS V HP+LV+LLGC +E+   +LVYE++PNG++S HL     + LPW  RL I  +T
Sbjct  69    DVLSKVRHPHLVQLLGCCMER--PLLVYEYVPNGSISNHLHAGCKAPLPWKTRLEIAVQT  126

Query  671   SQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGL-IESSHISTAPQGTP  495
             ++A+AYLH  + PPI+HRDVK++NILLD ++K+K+ADFGLSR  +  E++HISTAPQGTP
Sbjct  127   AEALAYLHFLVDPPIFHRDVKTTNILLDQDFKAKIADFGLSRLVVNTENTHISTAPQGTP  186

Query  494   GYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGL  315
             GYLDP YH+ + LSDKSDVYSFGVVL+E+              E+NLA+LAV KI  G L
Sbjct  187   GYLDPDYHESYVLSDKSDVYSFGVVLMEL--------------EINLASLAVAKIQSGCL  232

Query  314   LEIIDPLIEAEKDVWTLSS--VNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKWG  144
              EI+DP +      + ++   V +VAE+AFRCLA  +D RPSM EV  +L  +R+   G
Sbjct  233   HEILDPDLTVLFYDYPMAQVMVEQVAELAFRCLASEKDDRPSMKEVLTDL--LRIQAIG  289



>ref|XP_010660402.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X1 [Vitis vinifera]
Length=700

 Score =   296 bits (758),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 150/303 (50%), Positives = 210/303 (69%), Gaps = 7/303 (2%)
 Frame = -3

Query  1058  RETTGITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTD  879
             + +T   + V+SY ++E+ATNNF   R LGDG +GTVY GKL D    VA+KR+   +  
Sbjct  354   KGSTYFGVQVFSYMELEEATNNFDPSRELGDGGFGTVYYGKLQDG-RVVAVKRLYENNFK  412

Query  878   SIEQVTNEIKLLSSVNHPNLVRLLGCSIEKG-EQILVYEFMPNGTLSQHLQ-REKGSG-L  708
              +EQ  NE+++L+ + H NLV+L GC+  +  E +LVYE++PNGT++ HL  ++  SG +
Sbjct  413   RVEQFMNEVQILTRLQHQNLVKLYGCTSRRSRELLLVYEYIPNGTVADHLHGKQANSGSI  472

Query  707   PWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIES  528
              WPVRL I  ET+ A+AYLH +    I HRDVK++NILLD N++ KVADFGLSR    + 
Sbjct  473   TWPVRLSIAIETANALAYLHESE---IIHRDVKTNNILLDNNFQVKVADFGLSRLFPTDV  529

Query  527   SHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAA  348
             +H+STAPQGTPGY+DP+YHQ + L+ KSDVYSFGVVL+E+I+  +AVD  R ++++NLA 
Sbjct  530   THVSTAPQGTPGYVDPEYHQCYQLTSKSDVYSFGVVLMELISSKQAVDTNRHRHDINLAN  589

Query  347   LAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELE  168
             +AV+KI    L E++DP +  E D      +  VAE+AFRCL   RDMRP+M EV   L 
Sbjct  590   MAVNKILNHTLHELVDPSLGFESDSLVRRKITLVAELAFRCLQHERDMRPTMGEVLKALR  649

Query  167   QMR  159
             ++ 
Sbjct  650   RIE  652



>ref|XP_010910519.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Elaeis guineensis]
Length=404

 Score =   287 bits (735),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 145/295 (49%), Positives = 203/295 (69%), Gaps = 8/295 (3%)
 Frame = -3

Query  1034  PVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNE  855
             P++SY+++++ATN FS  R LG G +G VY GKL D    VAIKR+ + +   +EQ  NE
Sbjct  63    PIFSYEELDEATNGFSTSRELGGGGFGIVYQGKLRDG-RVVAIKRLYNHNLKHVEQFMNE  121

Query  854   IKLLSSVNHPNLVRLLG-CSIEKGEQILVYEFMPNGTLSQHLQ--REKGSGLPWPVRLGI  684
             +++LS + H NLV L G  S    E +LVYEF+PNGT++ HL   R     L WP+R+ I
Sbjct  122   VEILSRLRHQNLVSLYGSTSCRSRELLLVYEFVPNGTVADHLHGSRAHDLALSWPIRMSI  181

Query  683   VSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQ  504
               ET++A+AYLH A+ P + HRDVK+SNILLD ++  KVADFGLSR   ++++H+STAPQ
Sbjct  182   AIETAEALAYLH-AVEPQVIHRDVKTSNILLDSSFHVKVADFGLSRLFPLDATHVSTAPQ  240

Query  503   GTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGK  324
             GTPGY+DP YHQ + L+DKSDVYSFGVVL E+I+   AVD  R  +E+NL+ + + KI  
Sbjct  241   GTPGYVDPFYHQCYQLTDKSDVYSFGVVLAELISAKPAVDTNRTLHEINLSNMTISKIQN  300

Query  323   GGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMR  159
               L +++DP++  + D    + +  VAE+AFRCL   R+MRP++ EV   LE +R
Sbjct  301   CQLEQLVDPILGYQSDWEMKTMITVVAELAFRCLQLEREMRPTIKEV---LEVLR  352



>ref|XP_008673287.1| PREDICTED: uncharacterized protein LOC100384436 isoform X1 [Zea 
mays]
 tpg|DAA58039.1| TPA: putative WAK receptor-like protein kinase family protein 
[Zea mays]
Length=695

 Score =   296 bits (757),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 151/294 (51%), Positives = 206/294 (70%), Gaps = 8/294 (3%)
 Frame = -3

Query  1031  VYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEI  852
             +++Y+++E+AT+ F + R LGDG +GTVY G L D    VA+KR+ +     +EQ  NE 
Sbjct  366   LFTYEELEEATSCFDENRELGDGGFGTVYKGYLKDG-RVVAVKRLYNNSYRRVEQFQNEA  424

Query  851   KLLSSVNHPNLVRLLGC-SIEKGEQILVYEFMPNGTLSQHL--QREKGSGLPWPVRLGIV  681
              +LS + HPNLV   GC S +  E +LVYEF+ NGT++ HL  QR     LPWP+RLG+ 
Sbjct  425   AILSGLRHPNLVMFYGCTSSQSRELLLVYEFVANGTVADHLHGQRAAERALPWPLRLGVA  484

Query  680   SETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQG  501
              E++ A+ YLH A+ PP+ HRDVK++NILLD +Y  KVADFGLSR   ++ +H+STAPQG
Sbjct  485   VESAAALTYLH-AIEPPVVHRDVKTTNILLDADYHVKVADFGLSRLFPLDVTHVSTAPQG  543

Query  500   TPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKG  321
             TPGY+DP+YHQ + L+DKSDVYSFGVVLVE+I+   AVD TR +NE+NLA +A+ KI K 
Sbjct  544   TPGYVDPEYHQCYQLTDKSDVYSFGVVLVELISSKPAVDVTRHRNEINLAGMAISKIQKC  603

Query  320   GLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMR  159
              L E++D  +  E D  T  ++  VAE+AFRCL  + +MRP + EV   LE +R
Sbjct  604   QLEELVDIDLGYETDPATKKAMTAVAELAFRCLQQNGEMRPPIKEV---LEVLR  654



>ref|XP_006344162.1| PREDICTED: probable serine/threonine-protein kinase At1g18390-like 
isoform X1 [Solanum tuberosum]
Length=642

 Score =   295 bits (754),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 153/302 (51%), Positives = 210/302 (70%), Gaps = 11/302 (4%)
 Frame = -3

Query  1037  IPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTN  858
             IPV+SY ++E+ATN+F   R LGDG +GTVY G+L D  E VA+KR+   ++  ++Q  N
Sbjct  310   IPVFSYSELEEATNDFKSSRVLGDGGFGTVYYGQLKDGRE-VAVKRLYEHNSKQMQQFVN  368

Query  857   EIKLLSSVNHPNLVRLLGCSIEKG-EQILVYEFMPNGTLSQHLQ--REKGSGLPWPVRLG  687
             EI++L+ + H NLV L GC+  +  E ILVYE++PNGTL+ HL   R K   L WPVRL 
Sbjct  369   EIEILTRLRHTNLVTLYGCTSRRSRELILVYEYIPNGTLADHLHGDRAKNRSLTWPVRLN  428

Query  686   IVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAP  507
             I  ET+ A+AYLH +    I H DVK++NILLD ++  KVADFG+SR    + SHISTAP
Sbjct  429   IAIETAGALAYLHAS---DIIHCDVKTNNILLDQSFSVKVADFGISRLFPNDVSHISTAP  485

Query  506   QGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIG  327
             +GTPGY+DP+YH+ + L+ KSDVYSFGVVLVE+I+ + AVD  R   E+NLA  A++KI 
Sbjct  486   RGTPGYIDPKYHECYQLTIKSDVYSFGVVLVELISSMPAVDMKRHSQEINLANFAINKIV  545

Query  326   KGGLLEIIDPLIEAEKD--VWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLS  153
             K    E+IDP +  + D  +W ++S   VAE+AF CL   RDMRP+M EV   L++++ S
Sbjct  546   KCAFNELIDPSLGFDSDSKIWEMTS--SVAELAFLCLQTDRDMRPTMAEVLDTLKEIQTS  603

Query  152   KW  147
             ++
Sbjct  604   EF  605



>ref|XP_009759507.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X2 [Nicotiana sylvestris]
Length=663

 Score =   295 bits (755),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 150/300 (50%), Positives = 207/300 (69%), Gaps = 7/300 (2%)
 Frame = -3

Query  1037  IPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTN  858
             +PV+ Y ++E+ATN+F+  R LGDG YGTVY GKL D  E VA+KR+   +   +EQ  N
Sbjct  318   VPVFPYSELEEATNDFNSSRVLGDGGYGTVYYGKLKDGRE-VAVKRLYEHNCKRMEQFVN  376

Query  857   EIKLLSSVNHPNLVRLLGCSIEKG-EQILVYEFMPNGTLSQHLQ--REKGSGLPWPVRLG  687
             EI++L+ + H NLV L GC+  +  E +LVYE++PNGTL+ HL   R K   L WP+R+ 
Sbjct  377   EIEILTRLRHNNLVTLYGCTSRRSRELLLVYEYIPNGTLADHLHGDRAKDGSLTWPIRMN  436

Query  686   IVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAP  507
             I  ET+ A+AYLH +    I H DVK++NILLD+N+  KVADFG+SR    + SHISTAP
Sbjct  437   IAIETAGALAYLHAS---DIIHCDVKTNNILLDHNFSVKVADFGISRLFPNDVSHISTAP  493

Query  506   QGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIG  327
             +GTPGY+DP+YH+ + L+ KSDVYSFGVVLVE+I+ + AVD +R   E+NLA  A++KI 
Sbjct  494   RGTPGYIDPKYHECYQLTTKSDVYSFGVVLVELISSMPAVDMSRHSQEINLANFAINKII  553

Query  326   KGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKW  147
             K    E+IDP +  + D         VAE+AF CL   RD+RPSM+EV   L++++ S++
Sbjct  554   KSAFNELIDPSLGFDSDTKIWEMATSVAELAFLCLQTDRDVRPSMVEVLDILKEIQTSEF  613



>ref|XP_007009294.1| Kinase, putative [Theobroma cacao]
 gb|EOY18104.1| Kinase, putative [Theobroma cacao]
Length=631

 Score =   294 bits (753),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 193/525 (37%), Positives = 274/525 (52%), Gaps = 37/525 (7%)
 Frame = -3

Query  1670  FAPTSNNGILLQNCSSPELKCMIPSTMIQTQFELQDCGKDNISCFSEPHMTGGFIGYENL  1491
             F  TS+N I+  NC+   L+  +  +         +   +  +C   P      I     
Sbjct  111   FNVTSSNTIMFLNCTDSVLRSPLDCSSTGLCHVYVNDSSNATACEVAP------ICCTFR  164

Query  1490  TGTGCKSLFSAISSPAAAANTTAVSLDIQV---------IELGWWLQGHCRCSKNADCNT  1338
              G G  +    +      A T+ VSLD  +         +EL W       CS  ADC+ 
Sbjct  165   AGGGATAHAIRVRESGCRAYTSFVSLDAGLPVNQWPQPGMELQWISPPEPVCSAQADCDG  224

Query  1337  MRT--PGDGKPGF-RCQCSEGFTGDGYQGGSGCRRDDTRCNPAKYLLGECGGKTRigvli  1167
               T  P     G  RC C+ G   D  +G   C  + T  NP     G CGG  R  ++ 
Sbjct  225   NSTCGPDPNSNGIQRCFCNSGLWWDPIEGI--CAENSTCQNP-----GGCGGSDRTALIA  277

Query  1166  ggviagaaLMVSVGLICCIIRRRLAMKNWNRRRRELRE------TTGITIPVYSYKDIEK  1005
             G        + +  +   + +R   + +   R R+ RE        G    V++ K+I+K
Sbjct  278   GLTAGLGTALFAAIIGMLVYKRHRRIIDAQERLRKEREEILNANNAGRAAKVFTGKEIKK  337

Query  1004  ATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIKLLSSVNHP  825
             ATNNFS  R LG G YG VY G L D+   VA+K  +  +    +QV NE+++L  VNH 
Sbjct  338   ATNNFSRDRILGAGGYGDVYKGIL-DDGTVVAVKCAKLGNAKGTDQVLNEVRILCQVNHR  396

Query  824   NLVRLLGCSIEKGEQILVYEFMPNGTLSQHLQR----EKGSGLPWPVRLGIVSETSQAIA  657
             +LVRLLGC +E  + ILVYE++ NG L  HLQ     E+G  L W  RL I  +T+  +A
Sbjct  397   SLVRLLGCCVELEQPILVYEYIENGNLLDHLQSLSHGERGL-LTWTRRLQIACDTADGLA  455

Query  656   YLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGTPGYLDPQ  477
             YLH++  PPIYHRDVKSSNILLD N  +KV+DFGLSR    + SH+ST  QGT GYLDP+
Sbjct  456   YLHSSAVPPIYHRDVKSSNILLDVNLNAKVSDFGLSRLAHTDMSHVSTCAQGTLGYLDPE  515

Query  476   YHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLEIIDP  297
             Y++++ L+DKSDVYSFGVVL+E++T  KA+DF R  ++VNLA        +  L+++IDP
Sbjct  516   YYRNYQLTDKSDVYSFGVVLLELLTSQKAIDFNRDPDDVNLAVYVKRMADEEKLVDVIDP  575

Query  296   LIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQM  162
             ++  +     + ++  +  +A  CL   R  RPSM EV  E+E +
Sbjct  576   MLREKSSPIEVDTMKALGFLALNCLEERRQNRPSMKEVTEEIEYI  620



>ref|XP_009759506.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X1 [Nicotiana sylvestris]
Length=668

 Score =   295 bits (755),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 150/300 (50%), Positives = 207/300 (69%), Gaps = 7/300 (2%)
 Frame = -3

Query  1037  IPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTN  858
             +PV+ Y ++E+ATN+F+  R LGDG YGTVY GKL D  E VA+KR+   +   +EQ  N
Sbjct  323   VPVFPYSELEEATNDFNSSRVLGDGGYGTVYYGKLKDGRE-VAVKRLYEHNCKRMEQFVN  381

Query  857   EIKLLSSVNHPNLVRLLGCSIEKG-EQILVYEFMPNGTLSQHLQ--REKGSGLPWPVRLG  687
             EI++L+ + H NLV L GC+  +  E +LVYE++PNGTL+ HL   R K   L WP+R+ 
Sbjct  382   EIEILTRLRHNNLVTLYGCTSRRSRELLLVYEYIPNGTLADHLHGDRAKDGSLTWPIRMN  441

Query  686   IVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAP  507
             I  ET+ A+AYLH +    I H DVK++NILLD+N+  KVADFG+SR    + SHISTAP
Sbjct  442   IAIETAGALAYLHAS---DIIHCDVKTNNILLDHNFSVKVADFGISRLFPNDVSHISTAP  498

Query  506   QGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIG  327
             +GTPGY+DP+YH+ + L+ KSDVYSFGVVLVE+I+ + AVD +R   E+NLA  A++KI 
Sbjct  499   RGTPGYIDPKYHECYQLTTKSDVYSFGVVLVELISSMPAVDMSRHSQEINLANFAINKII  558

Query  326   KGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKW  147
             K    E+IDP +  + D         VAE+AF CL   RD+RPSM+EV   L++++ S++
Sbjct  559   KSAFNELIDPSLGFDSDTKIWEMATSVAELAFLCLQTDRDVRPSMVEVLDILKEIQTSEF  618



>ref|XP_010916447.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X1 [Elaeis guineensis]
Length=690

 Score =   295 bits (756),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 171/448 (38%), Positives = 251/448 (56%), Gaps = 54/448 (12%)
 Frame = -3

Query  1400  IELGWWLQG--HCR-CSKNADCNTMRTPGDGKPGFRCQCSEGFTGDGYQGGSGCRRDDTR  1230
              ELGW  +G   CR C +          G G   F C   +G   + Y+ G   R+ D  
Sbjct  222   FELGWETEGGDECRSCERIGGSCGYSETGAGDRAFVCHHMDGSQEEEYRAGGEVRKSD--  279

Query  1229  CNPAKYLLGECGGKTRigvliggviagaaLMVSVGLICCIIRRRLAMKNWNR-RRRELRE  1053
                         GK++    I   +     ++ V  + C+        +W++ R+R+ R 
Sbjct  280   ------------GKSKTRRNIAIGVGMGVGVMLVASLVCL--------SWHKLRQRKQRS  319

Query  1052  T-----------------------TGITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYS  942
                                     TG    +++Y+++E+ATN FS  + LGDG +GTVY 
Sbjct  320   ASSILLGRTASSEPCFKNDPELGKTGYQTTIFTYEELEEATNGFSASKELGDGGFGTVYK  379

Query  941   GKLHDNDEWVAIKRIRHRDTDSIEQVTNEIKLLSSVNHPNLVRLLGC-SIEKGEQILVYE  765
             GKL D    VA+KR+   +   +EQ  NE+++LS ++H NLV L GC S    E +LVYE
Sbjct  380   GKLRDG-RVVAVKRLYEHNYKRVEQFMNEVEILSRLHHQNLVSLYGCTSRHSRELLLVYE  438

Query  764   FMPNGTLSQHLQ--REKGSGLPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILL  591
             ++PNGT++ HL   R +   L WP+RL I  ET+ A+ YLH A+ P I HRDVK++NILL
Sbjct  439   YVPNGTVADHLHGPRAQEGALTWPIRLNIAIETADALGYLH-AVEPQIIHRDVKTNNILL  497

Query  590   DYNYKSKVADFGLSRFGLIESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVE  411
             D ++  KVADFGLSR   ++++H+STAPQGTPGY+DP+YHQ + L+DKSDVYSFGVVL E
Sbjct  498   DNSFHVKVADFGLSRLFPLDATHVSTAPQGTPGYVDPEYHQCYQLTDKSDVYSFGVVLAE  557

Query  410   IITGLKAVDFTRPQNEVNLAALAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAF  231
             +I+   AVD  R ++E+NLA +   K+    L +++DP +  + D    + +  VAE+AF
Sbjct  558   LISSKPAVDTNRTRHEINLANMTTSKVQNCQLDQLVDPSLGYQTDWEMKTMITLVAELAF  617

Query  230   RCLAFHRDMRPSMMEVAIELEQMRLSKW  147
             RCL   R+MRPS+ EV   L ++   ++
Sbjct  618   RCLQLEREMRPSIKEVLEVLREIESGQY  645



>ref|XP_009759505.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X3 [Nicotiana sylvestris]
Length=502

 Score =   290 bits (742),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 147/300 (49%), Positives = 206/300 (69%), Gaps = 7/300 (2%)
 Frame = -3

Query  1037  IPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTN  858
             +PV+SY ++E+ATN+F+  R LGDG +GTVY GKL D  E VA+KR+   +   +EQ  N
Sbjct  158   VPVFSYSELEEATNDFNSSRVLGDGGFGTVYYGKLKDGRE-VAVKRLYEHNCKRMEQFVN  216

Query  857   EIKLLSSVNHPNLVRLLGCSIEKG-EQILVYEFMPNGTLSQHL--QREKGSGLPWPVRLG  687
             EI++L+ + H NLV L GC+  +  E +LVYE++ NGTL+ HL  +R K   L WP+R+ 
Sbjct  217   EIEILTRLRHNNLVTLYGCTSSRSRELLLVYEYILNGTLADHLHGRRAKQRSLAWPIRMN  276

Query  686   IVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAP  507
             I  ET+ A+AYLH +    + H DVK++NILLD+N+  KVADFG+SR    + SHISTAP
Sbjct  277   IAVETAGALAYLHAS---DVIHCDVKTNNILLDHNFSVKVADFGISRLFPDDVSHISTAP  333

Query  506   QGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIG  327
             +GTPGY+DP+YH+ + L+ KSDVYS GVVLVE+I+ + AVD  R   E+NLA  A++KI 
Sbjct  334   RGTPGYIDPKYHECYQLTSKSDVYSLGVVLVELISSMPAVDMNRHNQEINLANFAINKIV  393

Query  326   KGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKW  147
             K    E+IDP +  + D         VAE+AF CL   RDMRP+M+EV   L++++ S++
Sbjct  394   KCAFNELIDPSLGFDSDTKIWEMTTSVAELAFLCLQTDRDMRPTMVEVLDTLKEIQTSEF  453



>ref|XP_009775398.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Nicotiana sylvestris]
Length=657

 Score =   294 bits (753),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 149/300 (50%), Positives = 207/300 (69%), Gaps = 7/300 (2%)
 Frame = -3

Query  1037  IPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTN  858
             IPV+SY+++E+AT+ F+  ++LGDG YGTVY GKL D  E VA+KR+   + + ++Q  N
Sbjct  304   IPVFSYRELEEATDKFNSSKQLGDGGYGTVYYGKLRDGKE-VAVKRLYEHNHNQMKQFIN  362

Query  857   EIKLLSSVNHPNLVRLLGCSIEKG-EQILVYEFMPNGTLSQHLQ--REKGSGLPWPVRLG  687
             EI++L+ + HPNLV L GC+  +  E  LVYE++PNGT++ HL   R K   L WP+RL 
Sbjct  363   EIEILTRLRHPNLVILYGCTSRRSRELFLVYEYIPNGTIADHLHGHRAKDKLLTWPIRLK  422

Query  686   IVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAP  507
             I  E + A+AYLH +    I HRDVK++NILLD ++  KVADFGLS+    + +HISTAP
Sbjct  423   IAIEIASALAYLHAS---DIIHRDVKTNNILLDNDFCVKVADFGLSKLFPNDVTHISTAP  479

Query  506   QGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIG  327
             QGTPGY+DPQYH+ + L+DKSDVYSFGVVLVE+I+ + AVD  R  +E+NLA  A+++I 
Sbjct  480   QGTPGYVDPQYHECYQLTDKSDVYSFGVVLVELISSMPAVDMNRHMHEINLANFAMNRIL  539

Query  326   KGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMRLSKW  147
             K    E+IDP +  E +         VAE+AF+CL   +DMRP M EV   L+ ++  +W
Sbjct  540   KCAFEEVIDPSLGFETNAEIRRMTISVAELAFQCLQGVKDMRPKMEEVLETLKTIKEGEW  599



>ref|XP_006387971.1| hypothetical protein POPTR_0442s00200g [Populus trichocarpa]
 gb|ERP46885.1| hypothetical protein POPTR_0442s00200g [Populus trichocarpa]
Length=638

 Score =   294 bits (752),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 150/308 (49%), Positives = 211/308 (69%), Gaps = 7/308 (2%)
 Frame = -3

Query  1058  RETTGITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTD  879
             R +T + + V+SY ++E+ATN F   + LGDG +GTVY G L D    VA+KR+   +  
Sbjct  327   RGSTYLGVRVFSYNELEEATNCFDSSKELGDGGFGTVYYGVLRDG-RVVAVKRLYESNMR  385

Query  878   SIEQVTNEIKLLSSVNHPNLVRLLGC-SIEKGEQILVYEFMPNGTLSQHLQ-REKGSGL-  708
               EQ  NEI++L+ + H NLV L GC S    E +LVYE++PNGT++ HL  R+  SGL 
Sbjct  386   RAEQFMNEIEILAHLRHKNLVELYGCTSRHSRELLLVYEYLPNGTVADHLHGRQSNSGLL  445

Query  707   PWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIES  528
              WPVRL I  ET+ A+AYLH +    + HRDVK++NILLD ++  KVADFGLSR    + 
Sbjct  446   TWPVRLSIAIETASALAYLHAS---DVIHRDVKTNNILLDNDFHVKVADFGLSRLFPTDV  502

Query  527   SHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAA  348
             +H+STAPQGTPGY+DP+Y+Q +HL++KSDVYS+GVVL+E+I+ L+AVD TR ++++NL+ 
Sbjct  503   THVSTAPQGTPGYVDPEYYQCYHLTNKSDVYSYGVVLIELISALEAVDITRHRHDINLSN  562

Query  347   LAVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELE  168
             +AV+KI    L E++DP +  +KD      V+ VAE+AF CL   R+MRP+M EV   L 
Sbjct  563   MAVNKIQNHALNELVDPFLGFDKDFVVREMVSSVAELAFMCLQHEREMRPTMEEVLEVLR  622

Query  167   QMRLSKWG  144
              +    +G
Sbjct  623   GIERENYG  630



>ref|XP_006388422.1| hypothetical protein POPTR_0188s00200g [Populus trichocarpa]
 gb|ERP47336.1| hypothetical protein POPTR_0188s00200g [Populus trichocarpa]
Length=661

 Score =   294 bits (753),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 154/302 (51%), Positives = 203/302 (67%), Gaps = 7/302 (2%)
 Frame = -3

Query  1055  ETTGITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDS  876
             +T    +P++SY ++E+ATNNF  K  LGDG +GTVY GKL D  E VA+KR+   +   
Sbjct  280   DTNYFGVPIFSYSELEEATNNFDSKHELGDGGFGTVYYGKLRDGRE-VAVKRLYEHNRKR  338

Query  875   IEQVTNEIKLLSSVNHPNLVRLLGC-SIEKGEQILVYEFMPNGTLSQHLQ--REKGSGLP  705
             I+Q  NEI++L+ + H NLV L GC S    E +LVYE++PNGT++ HL   R K   L 
Sbjct  339   IKQFMNEIQILTRLRHKNLVSLYGCTSCYSRELLLVYEYIPNGTVADHLHHDRAKSGSLT  398

Query  704   WPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESS  525
             W +R+ I  ET+ A+AYLH      I HRDVK++NILLD N+  KVADFGLSR    + +
Sbjct  399   WTIRMRIAIETAGALAYLHAT---DIIHRDVKTNNILLDNNFCVKVADFGLSRLFPNDVT  455

Query  524   HISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAAL  345
             HISTAPQGTPGYLDP+YHQ + L+ KSDVYSFGVVL+E+I+ + AVD TR Q+E+NLA L
Sbjct  456   HISTAPQGTPGYLDPEYHQCYQLTAKSDVYSFGVVLIELISSMPAVDMTRDQHEINLATL  515

Query  344   AVDKIGKGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQ  165
             A++KI K    E+IDP +  + D         VAE+AF CL   +++RP M EV  EL+ 
Sbjct  516   AMNKIQKCAFDELIDPYLGYKSDEEIKRMTTSVAELAFLCLQQGKEIRPCMNEVLKELKA  575

Query  164   MR  159
             M 
Sbjct  576   ME  577



>tpg|DAA38848.1| TPA: putative WAK receptor-like protein kinase family protein 
[Zea mays]
Length=365

 Score =   285 bits (730),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 144/294 (49%), Positives = 201/294 (68%), Gaps = 7/294 (2%)
 Frame = -3

Query  1031  VYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEI  852
             +++Y+++E+AT+ F+D R LGDG +GTVY GKL D    VA+KR+   +   +EQ  NE+
Sbjct  22    IFTYEELEEATDGFNDSRELGDGGFGTVYKGKLRDG-RVVAVKRLYKNNYKRVEQFINEV  80

Query  851   KLLSSVNHPNLVRLLGCSIEKGEQI-LVYEFMPNGTLSQHLQREKGS--GLPWPVRLGIV  681
              +LS + H NLV L GC+      + LVYEF+PNGT++ H+   + S  GL WP R+ I 
Sbjct  81    DILSRLLHQNLVILYGCTSRSSRDLMLVYEFIPNGTVADHVHGSRASERGLTWPRRMSIA  140

Query  680   SETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQG  501
              ET++A+AYLH      I HRDVK++NILLD ++  KVADFGLSR    E +H+ST PQG
Sbjct  141   IETAEALAYLHAV---EIIHRDVKTNNILLDNSFHVKVADFGLSRLYPPEVTHVSTVPQG  197

Query  500   TPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKG  321
             TPGY+DP YHQ + L++KSDVYSFGVVLVE+++   AVD  R  +E+NLA +A+++I   
Sbjct  198   TPGYVDPVYHQCYKLTEKSDVYSFGVVLVELVSSKPAVDMGRSHSEINLANMALNRIQNH  257

Query  320   GLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMR  159
              + +++DP +  E D  T  S++ VAE+AFRCL   RD RPSM EV   L ++R
Sbjct  258   EVGQLVDPELGYETDGETKRSIDLVAELAFRCLQLERDSRPSMKEVVEALNRIR  311



>ref|XP_010098860.1| Wall-associated receptor kinase-like 20 [Morus notabilis]
 gb|EXB75948.1| Wall-associated receptor kinase-like 20 [Morus notabilis]
Length=631

 Score =   293 bits (751),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 205/559 (37%), Positives = 296/559 (53%), Gaps = 68/559 (12%)
 Frame = -3

Query  1727  IPAKC-GRRIEAMKPLFGKNFAP---TSNNGILLQNCS-----SPELKCMIPSTMIQTQF  1575
             +P KC  R +E  + L+     P   TS+N I L NCS     SP L C  PS++     
Sbjct  95    LPGKCVTRDMEVGEGLWLNQSLPFNITSSNTIFLLNCSPRLLVSP-LNC-TPSSLCHRYL  152

Query  1574  ELQ---------DCGKDNISCFSEPHMTGGF-IGYE-NLTGTGCKSLFSAIS-SPAAAAN  1431
             E            C  D   C +   + GG    Y+  L  +GC++  S +       AN
Sbjct  153   ESSGHVDSKRAFQCASDLDPCCT--FIAGGMPSAYKIRLHSSGCRAFRSILHLDMEKPAN  210

Query  1430  TTAVSLDIQVIELGWWLQGHCRCSKNADCN--TMRTPGDGKPGFRCQCSEGFTGDGYQGG  1257
                  L+IQ     W       C    DC+  +  +P      FRC C+ G+  D     
Sbjct  211   LWEEGLEIQ-----WAPPQEPVCKTQQDCSGASKCSPAGNSGVFRCICNRGYQWD-----  260

Query  1256  SGCRRDDTRCNPAKYLLGECGGKTRigvliggviag--aaLMVSVGLICCIIRRRLAMKN  1083
                           + LG C  K R   +   +          S+ L+  ++R R + + 
Sbjct  261   --------------HSLGTCLRKKRSAKVGLSLKVSIGVISFFSLALVMTLVRVRKSCRL  306

Query  1082  WNRR------RRELRETTG-ITIPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDN  924
              ++R      R E+ E  G  +  V++ K+++KATN FS  R LG G +G VY G+L D 
Sbjct  307   SSKRTKLAKAREEMLECHGGKSAKVFNLKEVKKATNGFSKDRILGSGGFGEVYKGELQDG  366

Query  923   DEWVAIKRIRHRDTDSIEQVTNEIKLLSSVNHPNLVRLLGCSIEKGEQILVYEFMPNGTL  744
                VA+K  +  +  S EQV NE+ +LS VNH NLV+LLGC I   + +++YE++ NGTL
Sbjct  367   -TIVAVKSAKVGNIKSTEQVLNEVGILSQVNHKNLVKLLGCCIYSEQPLMIYEYVSNGTL  425

Query  743   SQHLQREKGSGLPWPVRLGIVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVA  564
               HLQ +  + L W  RL I  +T++A+ YLH++ H PIYHRDVKS+NILLD    +KVA
Sbjct  426   HAHLQGKYPTFLDWKTRLRIALQTAEALTYLHSSAHTPIYHRDVKSTNILLDDCMNAKVA  485

Query  563   DFGLSRFGLIESSHISTAPQGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVD  384
             DFGLSR      SH+ST  QGT GYLDP+Y++++ L+DKSDVYS+GVVL+E++T  KA+D
Sbjct  486   DFGLSRLASPGLSHVSTCAQGTLGYLDPEYYRNYQLTDKSDVYSYGVVLLELLTSQKAID  545

Query  383   FTRPQNEVNLAALAVDKIGKGGLLEIIDP-LIEAEK----DVWTLSSVNKVAEIAFRCLA  219
             F+R Q++VNLA     +     +LEI+D  L++ EK    DV  L+S+  V E+A  CL 
Sbjct  546   FSRDQDDVNLATYVRGRAKSDAILEIVDQRLMQEEKPSSSDV--LTSLKLVLELALSCLR  603

Query  218   FHRDMRPSMMEVAIELEQM  162
               ++ RP+M EV  EL+++
Sbjct  604   EKKEDRPTMKEVVQELQRI  622



>ref|XP_010232164.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Brachypodium distachyon]
Length=701

 Score =   295 bits (755),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 146/285 (51%), Positives = 204/285 (72%), Gaps = 5/285 (2%)
 Frame = -3

Query  1028  YSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEIK  849
             +SY+++E+AT++F++KR +GDG +GTVY G L D    VA+KR+ +     +EQ  NE  
Sbjct  372   FSYEELEEATDSFNEKREIGDGGFGTVYKGYLADG-RVVAVKRLYNNSYRRVEQFVNEAA  430

Query  848   LLSSVNHPNLVRLLGC-SIEKGEQILVYEFMPNGTLSQHLQREKGS--GLPWPVRLGIVS  678
             +L+ + HPNLV   GC S E  E +LVYEF+ NGT++ HL   + +   LPWP+RL I  
Sbjct  431   ILARLRHPNLVMFYGCTSKESRELLLVYEFVQNGTVADHLHGHRAAERALPWPLRLNIAV  490

Query  677   ETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQGT  498
             E++ A+ YLH A+ PPI HRDVK++NILLD ++  KVADFGLSR   ++++H+STAPQGT
Sbjct  491   ESAAALTYLH-AIEPPIVHRDVKTNNILLDADFHVKVADFGLSRLFPLDATHVSTAPQGT  549

Query  497   PGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKGG  318
             PGY+DP+YHQ + L+DKSDVYSFGVVLVE+I+   AVD TR +NE+NLA +A+++I K  
Sbjct  550   PGYVDPEYHQCYQLTDKSDVYSFGVVLVELISSKPAVDITRQRNEINLAGMAINRIQKCQ  609

Query  317   LLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEV  183
             L E++D  +  E D  T   +  VAE+AFRCL  + +MRP + EV
Sbjct  610   LEELVDLELGYESDPATRKMMTMVAELAFRCLQQNGEMRPPIKEV  654



>ref|XP_004150517.1| PREDICTED: probable serine/threonine-protein kinase At1g18390-like 
[Cucumis sativus]
Length=680

 Score =   295 bits (754),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 147/293 (50%), Positives = 207/293 (71%), Gaps = 7/293 (2%)
 Frame = -3

Query  1031  VYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTNEI  852
             V++Y ++E+AT+NF   R LGDG YGTVY G L D    VA+KR+   +   ++Q TNE+
Sbjct  342   VFTYAELEEATHNFDRSRELGDGGYGTVYFGTLKDG-RTVAVKRLYENNYKRVQQFTNEV  400

Query  851   KLLSSVNHPNLVRLLGCSIEKGE-QILVYEFMPNGTLSQHLQ-REKGSGL-PWPVRLGIV  681
             ++LS + HPNLV+L GC+  + +  +LVYE++ NGT++ HL  ++  SGL  W VRL I 
Sbjct  401   EILSKLQHPNLVKLYGCTSRQSQGLLLVYEYISNGTVADHLHGKQANSGLLTWSVRLKIA  460

Query  680   SETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAPQG  501
              ET+ A+AYLH      I HRDVK++NILLD N+K KVADFGLSR   I  +H+STAPQG
Sbjct  461   IETANALAYLH---RKDIIHRDVKTNNILLDNNFKVKVADFGLSRLFPINVTHVSTAPQG  517

Query  500   TPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIGKG  321
             TPGY+DP+Y+Q + L+DKSDVYSFGVVLVE+I+ L+AVD  R ++++NL+ +A+++I   
Sbjct  518   TPGYVDPEYYQCYQLTDKSDVYSFGVVLVELISSLQAVDVNRNRDDINLSNMAINRIHNQ  577

Query  320   GLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQM  162
              L +++DP +  E+D    S +  VAE+A+RCL   RD RPSM EV   L ++
Sbjct  578   ALADLVDPDLGFERDYAVRSMIKSVAELAYRCLQQTRDARPSMDEVVEALREL  630



>ref|XP_010540003.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X2 [Tarenaya hassleriana]
Length=664

 Score =   294 bits (753),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 145/296 (49%), Positives = 205/296 (69%), Gaps = 7/296 (2%)
 Frame = -3

Query  1037  IPVYSYKDIEKATNNFSDKRRLGDGAYGTVYSGKLHDNDEWVAIKRIRHRDTDSIEQVTN  858
             + V++Y+++E+ATNNF   + LGDG +GTVY G+L D    VA+KR+   +   +EQ  N
Sbjct  321   VRVFTYEELEEATNNFDPSKELGDGGFGTVYYGQLKDG-RSVAVKRLYENNYKRVEQFRN  379

Query  857   EIKLLSSVNHPNLVRLLGCSIEKG-EQILVYEFMPNGTLSQHLQ--REKGSGLPWPVRLG  687
             E+++L+ + HPNLV L GCS +   + +LVYEF+PNGTL+ HL   R   S LPW  RL 
Sbjct  380   EVEILARLRHPNLVTLFGCSSKHSRDLLLVYEFIPNGTLADHLHGPRANPSALPWSTRLK  439

Query  686   IVSETSQAIAYLHNAMHPPIYHRDVKSSNILLDYNYKSKVADFGLSRFGLIESSHISTAP  507
             I +ET+ A+ YLH +    I HRDVKS+NILLD N+  KVADFGLSR   ++ +H+ST+P
Sbjct  440   IAAETANALKYLHAS---EIIHRDVKSNNILLDRNFNVKVADFGLSRLFPMDRTHVSTSP  496

Query  506   QGTPGYLDPQYHQDFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAALAVDKIG  327
             QGTPGYLDP YHQ + L+ KSDV+SFGVVL+E+I+ + AVD TR ++E+NL+ +A+ KI 
Sbjct  497   QGTPGYLDPDYHQCYQLTSKSDVFSFGVVLMELISSMPAVDITRHRHEINLSKMAIVKIQ  556

Query  326   KGGLLEIIDPLIEAEKDVWTLSSVNKVAEIAFRCLAFHRDMRPSMMEVAIELEQMR  159
                L E++D  +  E D     SV+ VAE+AF+CL   +D+RP + +V   L ++R
Sbjct  557   SHSLHEMVDSTLGFETDAKVRDSVSSVAELAFQCLQSDKDLRPDISQVLETLTRIR  612



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5775615136212