BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18171_g1_i1 len=160 path=[138:0-36 451:37-159]

Length=160
                                                                      Score     E

gb|EYU41997.1|  hypothetical protein MIMGU_mgv1a013247mg              44.7    8e-04   
ref|XP_009764732.1|  PREDICTED: prosaposin-like                       44.7    0.001   



>gb|EYU41997.1| hypothetical protein MIMGU_mgv1a013247mg [Erythranthe guttata]
Length=226

 Score = 44.7 bits (104),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -2

Query  153  TKCKKLVF*YAPPILMNAEQFPVTNGIC  70
            TKCK+LVF YAP IL+NAEQF  TN +C
Sbjct  178  TKCKRLVFEYAPIILVNAEQFLETNDVC  205



>ref|XP_009764732.1| PREDICTED: prosaposin-like [Nicotiana sylvestris]
Length=245

 Score = 44.7 bits (104),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -2

Query  159  FSTKCKKLVF*YAPPILMNAEQFPVTNGIC  70
            ++TKCKKL+F YAP IL+NAEQF   N IC
Sbjct  188  YATKCKKLIFEYAPVILVNAEQFLEKNDIC  217



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 519368764968