BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18163_g2_i1 len=780 path=[758:0-779]

Length=780
                                                                      Score     E

ref|XP_009597672.1|  PREDICTED: mannan synthase 1-like isoform X2       316   5e-101   
ref|XP_009765562.1|  PREDICTED: mannan synthase 1-like isoform X2       316   5e-101   
ref|XP_006354365.1|  PREDICTED: mannan synthase 1-like                  315   1e-100   
ref|XP_004246627.1|  PREDICTED: mannan synthase 1-like                  315   2e-100   
emb|CDP06773.1|  unnamed protein product                                306   6e-97    
sp|Q6UDF0.1|CSLA1_CYATE  RecName: Full=Mannan synthase 1; AltName...    303   7e-96    Cyamopsis tetragonoloba [cluster bean]
ref|XP_011094610.1|  PREDICTED: mannan synthase 1-like                  302   2e-95    
gb|ACE60600.1|  mannan synthase                                         302   2e-95    Coffea canephora [robusta coffee]
ref|XP_010096071.1|  hypothetical protein L484_000910                   301   2e-95    
gb|ACE60601.1|  mannan synthase                                         300   8e-95    Coffea arabica [arabica coffee]
ref|XP_009597671.1|  PREDICTED: mannan synthase 1-like isoform X1       301   8e-95    
ref|XP_009765561.1|  PREDICTED: mannan synthase 1-like isoform X1       300   1e-94    
ref|XP_002277171.1|  PREDICTED: mannan synthase 1-like                  299   1e-94    Vitis vinifera
gb|KEH24032.1|  cellulose synthase-like protein A1                      296   2e-93    
gb|KHN09524.1|  Mannan synthase 1                                       293   1e-92    
ref|XP_004493996.1|  PREDICTED: mannan synthase 1-like                  295   1e-92    
gb|EYU38560.1|  hypothetical protein MIMGU_mgv1a017694mg                294   2e-92    
ref|XP_003520655.1|  PREDICTED: mannan synthase 1-like                  293   3e-92    
gb|AFV79650.1|  mannan synthase                                         291   2e-91    
gb|KDO49989.1|  hypothetical protein CISIN_1g044519mg                   286   2e-89    
ref|XP_003553558.1|  PREDICTED: mannan synthase 1-like                  286   3e-89    
ref|XP_008800552.1|  PREDICTED: mannan synthase 1-like                  280   3e-87    
ref|XP_010935702.1|  PREDICTED: mannan synthase 1-like isoform X1       271   1e-83    
ref|XP_009385870.1|  PREDICTED: mannan synthase 1-like                  271   1e-83    
gb|ABG34548.1|  cellulose synthase-like A2                              270   3e-83    Pinus taeda
emb|CAN74410.1|  hypothetical protein VITISV_013215                     270   5e-83    Vitis vinifera
gb|ABR16486.1|  unknown                                                 263   4e-82    Picea sitchensis
gb|ABG34547.1|  cellulose synthase-like A1                              263   1e-80    Pinus taeda
ref|XP_002530892.1|  transferase, transferring glycosyl groups, p...    260   2e-80    Ricinus communis
ref|XP_011094427.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    262   4e-80    
gb|AEZ00898.1|  putative beta-14-mannan synthase                        253   4e-80    
ref|XP_009404378.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    261   1e-79    
ref|XP_009601859.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    260   3e-79    
ref|XP_008456578.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    259   6e-79    
ref|XP_004307031.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    256   2e-78    
ref|XP_008232025.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    257   2e-78    
ref|XP_009771587.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    258   3e-78    
ref|XP_007219015.1|  hypothetical protein PRUPE_ppa004315mg             257   3e-78    
gb|KDP45030.1|  hypothetical protein JCGZ_01530                         257   4e-78    
ref|XP_008673321.1|  PREDICTED: hypothetical protein isoform X1         254   4e-78    
ref|XP_010912225.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    256   4e-78    
ref|XP_007220072.1|  hypothetical protein PRUPE_ppa024741mg             256   6e-78    
ref|XP_010912224.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    256   6e-78    
ref|XP_007010197.1|  Nucleotide-diphospho-sugar transferases supe...    256   6e-78    
ref|XP_007027600.1|  Nucleotide-diphospho-sugar transferases supe...    256   1e-77    
ref|XP_004151323.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    254   1e-77    
ref|XP_002283672.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    256   1e-77    Vitis vinifera
gb|EYU41550.1|  hypothetical protein MIMGU_mgv1a004346mg                255   2e-77    
ref|XP_009774056.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    255   2e-77    
ref|XP_007162846.1|  hypothetical protein PHAVU_001G185800g             254   3e-77    
ref|NP_001183100.1|  hypothetical protein                               254   3e-77    
emb|CDO99850.1|  unnamed protein product                                252   4e-77    
ref|XP_002459874.1|  hypothetical protein SORBIDRAFT_02g012870          254   4e-77    Sorghum bicolor [broomcorn]
ref|XP_010940677.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    254   4e-77    
ref|XP_003554414.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    254   6e-77    
ref|XP_008804385.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    254   8e-77    
ref|XP_008363207.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    250   1e-76    
emb|CDP15350.1|  unnamed protein product                                253   1e-76    
ref|XP_004494136.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    253   1e-76    
ref|XP_004959258.1|  PREDICTED: mannan synthase 1-like                  253   2e-76    
ref|XP_006606290.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    250   2e-76    
ref|XP_010325940.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    251   2e-76    
ref|XP_009623019.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    252   3e-76    
ref|XP_008363208.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    250   4e-76    
gb|KDP42759.1|  hypothetical protein JCGZ_23699                         251   5e-76    
dbj|BAK03076.1|  predicted protein                                      251   5e-76    
ref|XP_010325939.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    251   5e-76    
ref|XP_009361452.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    250   6e-76    
ref|XP_009365313.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    251   6e-76    
ref|XP_003521436.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    251   6e-76    
ref|XP_008241312.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    251   6e-76    
ref|XP_008671633.1|  PREDICTED: mannan synthase 1-like                  242   6e-76    
ref|XP_006606289.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    249   7e-76    
ref|XP_006851749.1|  hypothetical protein AMTR_s00040p00223350          251   8e-76    
ref|XP_009353016.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    250   8e-76    
ref|XP_007143832.1|  hypothetical protein PHAVU_007G105400g             251   9e-76    
ref|XP_006339112.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    251   1e-75    
ref|XP_003556282.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    251   1e-75    
gb|KHN00923.1|  Glucomannan 4-beta-mannosyltransferase 9                250   1e-75    
ref|XP_004249461.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    250   1e-75    
ref|XP_009390016.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    250   2e-75    
ref|XP_009401015.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    250   2e-75    
emb|CBI30236.3|  unnamed protein product                                250   2e-75    
ref|XP_002311972.2|  4-mannan synthase family protein                   250   2e-75    Populus trichocarpa [western balsam poplar]
ref|XP_008359466.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    250   2e-75    
ref|XP_003535494.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    249   2e-75    
ref|XP_009353014.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    249   3e-75    
ref|XP_006341174.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    249   3e-75    
gb|KHN37850.1|  Glucomannan 4-beta-mannosyltransferase 9                249   3e-75    
ref|XP_002315357.1|  4-mannan synthase family protein                   249   3e-75    Populus trichocarpa [western balsam poplar]
ref|XP_006589371.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    248   4e-75    
gb|AES60635.2|  cellulose synthase-like protein A1                      249   5e-75    
ref|XP_010554515.1|  PREDICTED: probable mannan synthase 7 isofor...    246   6e-75    
ref|XP_009335111.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    248   6e-75    
ref|XP_010554516.1|  PREDICTED: probable mannan synthase 7 isofor...    247   8e-75    
ref|XP_010694523.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    248   1e-74    
ref|XP_003578707.1|  PREDICTED: mannan synthase 1-like                  248   1e-74    
gb|KCW89263.1|  hypothetical protein EUGRSUZ_A01558                     244   1e-74    
gb|AFW66233.1|  hypothetical protein ZEAMMB73_021965                    239   2e-74    
ref|XP_010525611.1|  PREDICTED: probable mannan synthase 3 isofor...    243   2e-74    
gb|AFZ78578.1|  cellulose synthase-like protein                         247   2e-74    
gb|KGN63048.1|  hypothetical protein Csa_2G386160                       251   2e-74    
gb|KEH24115.1|  cellulose synthase-like protein A1                      247   2e-74    
ref|XP_007203625.1|  hypothetical protein PRUPE_ppa004037mg             247   2e-74    
ref|XP_009603536.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    246   3e-74    
ref|XP_011024272.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    247   3e-74    
ref|XP_009379774.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    247   4e-74    
ref|XP_010110184.1|  hypothetical protein L484_016805                   247   4e-74    
gb|ACR38199.1|  unknown                                                 239   4e-74    Zea mays [maize]
ref|XP_008232088.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    245   4e-74    
ref|XP_003571119.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    246   4e-74    
ref|XP_010554514.1|  PREDICTED: probable mannan synthase 7 isofor...    247   4e-74    
gb|KCW48370.1|  hypothetical protein EUGRSUZ_K02079                     239   5e-74    
emb|CBI40224.3|  unnamed protein product                                244   6e-74    
ref|XP_010112526.1|  hypothetical protein L484_012804                   247   6e-74    
ref|XP_009760346.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    246   6e-74    
ref|XP_002437311.1|  hypothetical protein SORBIDRAFT_10g024640          243   7e-74    Sorghum bicolor [broomcorn]
ref|XP_009603535.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    246   8e-74    
gb|KEH43412.1|  cellulose synthase-like protein A1                      245   1e-73    
ref|XP_006360487.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    245   1e-73    
ref|XP_011010407.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    245   1e-73    
gb|AFW73370.1|  hypothetical protein ZEAMMB73_956340                    238   1e-73    
ref|XP_010243535.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    245   1e-73    
ref|XP_009603325.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    245   1e-73    
ref|XP_009793132.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    244   1e-73    
ref|XP_010050059.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    245   2e-73    
gb|KHG19821.1|  Glucomannan 4-beta-mannosyltransferase 9 -like pr...    244   2e-73    
ref|XP_010521855.1|  PREDICTED: probable mannan synthase 3              245   3e-73    
ref|XP_004250002.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    244   3e-73    
ref|XP_002269110.2|  PREDICTED: glucomannan 4-beta-mannosyltransf...    244   4e-73    Vitis vinifera
ref|XP_010525610.1|  PREDICTED: probable mannan synthase 3 isofor...    244   4e-73    
ref|XP_009793131.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    244   4e-73    
ref|XP_010525608.1|  PREDICTED: probable mannan synthase 3 isofor...    244   5e-73    
ref|XP_010543471.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    244   5e-73    
ref|XP_004496174.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    243   7e-73    
ref|XP_009421122.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    243   8e-73    
ref|XP_004143299.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    243   1e-72    
ref|XP_009793130.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    243   1e-72    
ref|XP_004170553.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    243   1e-72    
ref|XP_004239715.2|  PREDICTED: glucomannan 4-beta-mannosyltransf...    243   1e-72    
ref|XP_004951606.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    242   2e-72    
gb|EPS66478.1|  hypothetical protein M569_08299                         233   3e-72    
gb|EMT23763.1|  hypothetical protein F775_17087                         247   3e-72    
ref|XP_004303037.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    241   3e-72    
ref|XP_010911245.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    234   4e-72    
ref|XP_006436686.1|  hypothetical protein CICLE_v10031284mg             240   5e-72    
gb|AGE09561.1|  CSLA9-like protein                                      241   5e-72    
gb|KDO40534.1|  hypothetical protein CISIN_1g009761mg                   241   6e-72    
ref|XP_006492171.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    241   6e-72    
gb|EMT02496.1|  hypothetical protein F775_10659                         236   7e-72    
gb|KCW89261.1|  hypothetical protein EUGRSUZ_A01558                     240   1e-71    
emb|CDP06989.1|  unnamed protein product                                240   1e-71    
gb|ACF33171.1|  mannan synthase                                         240   2e-71    Coffea canephora [robusta coffee]
gb|AFW87395.1|  hypothetical protein ZEAMMB73_638072                    238   2e-71    
ref|XP_008462529.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    239   3e-71    
ref|XP_010038980.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    239   3e-71    
ref|XP_006345855.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    238   3e-71    
ref|NP_001131007.1|  uncharacterized protein LOC100192112               238   3e-71    Zea mays [maize]
ref|XP_010067160.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    237   4e-71    
ref|XP_008659807.1|  PREDICTED: probable mannan synthase 9              238   5e-71    
ref|XP_004143300.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    238   6e-71    
ref|XP_007145259.1|  hypothetical protein PHAVU_007G223800g             238   7e-71    
ref|XP_004164074.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    238   7e-71    
ref|XP_006430317.1|  hypothetical protein CICLE_v10011455mg             238   8e-71    
gb|KDO45609.1|  hypothetical protein CISIN_1g040333mg                   237   8e-71    
ref|XP_004965827.1|  PREDICTED: probable mannan synthase 9-like         238   1e-70    
ref|XP_011089999.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    238   1e-70    
ref|XP_004137864.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    237   1e-70    
ref|XP_010558212.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    237   2e-70    
ref|XP_010477641.1|  PREDICTED: probable mannan synthase 3              238   2e-70    
ref|XP_006424348.1|  hypothetical protein CICLE_v10028164mg             237   2e-70    
ref|XP_009122674.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    237   2e-70    
emb|CDX70286.1|  BnaA10g26350D                                          237   2e-70    
ref|XP_011018871.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    237   2e-70    
ref|XP_006481909.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    237   2e-70    
ref|XP_008442792.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    236   3e-70    
ref|XP_006661580.1|  PREDICTED: mannan synthase 1-like                  236   3e-70    
ref|XP_006484970.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    236   4e-70    
ref|XP_006384673.1|  glycosyl transferase family 2 family protein       236   4e-70    
ref|XP_003560565.2|  PREDICTED: probable mannan synthase 9              235   4e-70    
ref|XP_002453460.1|  hypothetical protein SORBIDRAFT_04g006260          236   5e-70    Sorghum bicolor [broomcorn]
gb|EMS50576.1|  hypothetical protein TRIUR3_00182                       235   5e-70    
ref|XP_003539806.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    236   6e-70    
gb|EYU36101.1|  hypothetical protein MIMGU_mgv1a0044822mg               232   6e-70    
ref|XP_010498857.1|  PREDICTED: probable mannan synthase 3              236   7e-70    
ref|XP_006398833.1|  hypothetical protein EUTSA_v10013220mg             235   7e-70    
ref|XP_006307154.1|  hypothetical protein CARUB_v10008745mg             236   9e-70    
ref|XP_006381326.1|  hypothetical protein POPTR_0006s11810g             235   9e-70    
ref|XP_003538146.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    235   1e-69    
emb|CAB10434.1|  cellulose synthase like protein                        230   1e-69    Arabidopsis thaliana [mouse-ear cress]
gb|KHN38673.1|  Glucomannan 4-beta-mannosyltransferase 2                235   1e-69    
ref|XP_006416081.1|  hypothetical protein EUTSA_v10007266mg             234   3e-69    
ref|XP_009337395.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    234   4e-69    
ref|XP_002873112.1|  ATCSLA09                                           233   4e-69    
ref|NP_193392.3|  cellulose synthase-like A01                           229   5e-69    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008647195.1|  PREDICTED: uncharacterized protein LOC103628848    239   6e-69    
ref|NP_001031084.1|  putative mannan synthase 3                         232   6e-69    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010490868.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    233   8e-69    
ref|XP_009115523.1|  PREDICTED: probable mannan synthase 3              233   9e-69    
gb|KDP34366.1|  hypothetical protein JCGZ_11249                         233   9e-69    
ref|XP_008385455.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    233   9e-69    
gb|AFZ78579.1|  cellulose synthase-like protein                         233   1e-68    
emb|CDY44151.1|  BnaA09g31010D                                          233   1e-68    
ref|XP_010452272.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    232   1e-68    
ref|XP_010937165.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    233   1e-68    
ref|XP_002870144.1|  hypothetical protein ARALYDRAFT_915064             233   1e-68    
emb|CDY11268.1|  BnaA03g01040D                                          232   1e-68    
ref|XP_010031452.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    232   1e-68    
gb|EEC85104.1|  hypothetical protein OsI_32487                          232   1e-68    Oryza sativa Indica Group [Indian rice]
emb|CDY04707.1|  BnaC05g18820D                                          232   2e-68    
ref|XP_004497598.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    231   2e-68    
ref|XP_009403735.1|  PREDICTED: probable mannan synthase 9 isofor...    231   2e-68    
ref|NP_850952.1|  putative mannan synthase 3                            232   2e-68    Arabidopsis thaliana [mouse-ear cress]
gb|ABD79100.1|  cellulose synthase-like A2                              232   2e-68    Physcomitrella patens
ref|XP_010278246.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    231   2e-68    
ref|XP_011005673.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    231   3e-68    
gb|AAQ62571.1|  glycosyltransferase 5                                   231   3e-68    Ipomoea trifida
ref|XP_001759209.1|  cellulose synthase-like A3, glycosyltransfer...    231   3e-68    
ref|XP_009130779.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    231   4e-68    
ref|XP_010516765.1|  PREDICTED: probable mannan synthase 7 isofor...    229   4e-68    
emb|CDX80885.1|  BnaC03g01390D                                          231   4e-68    
gb|KFK24842.1|  hypothetical protein AALP_AA8G031700                    231   5e-68    
ref|XP_006414326.1|  hypothetical protein EUTSA_v10024828mg             231   5e-68    
ref|XP_009629011.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    231   5e-68    
ref|XP_010937163.1|  PREDICTED: probable mannan synthase 11 isofo...    224   7e-68    
ref|XP_010423663.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    230   8e-68    
ref|NP_195996.1|  glucomannan 4-beta-mannosyltransferase 9              230   9e-68    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010505088.1|  PREDICTED: probable mannan synthase 7              230   1e-67    
sp|Q84W54.1|CSLA1_ARATH  RecName: Full=Probable mannan synthase 1...    230   1e-67    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004160102.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    225   1e-67    
ref|XP_003551076.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    229   1e-67    
ref|XP_006282581.1|  hypothetical protein CARUB_v10004510mg             230   1e-67    
ref|XP_002963530.1|  glycosyltransferase family 2 protein               229   1e-67    
ref|XP_001764061.1|  cellulose synthase-like A1, glycosyltransfer...    229   1e-67    
ref|XP_010516764.1|  PREDICTED: probable mannan synthase 7 isofor...    230   2e-67    
ref|XP_002874083.1|  hypothetical protein ARALYDRAFT_489123             229   2e-67    
gb|KEH42109.1|  cellulose synthase-like protein A1                      229   2e-67    
ref|XP_007132379.1|  hypothetical protein PHAVU_011G089900g             229   2e-67    
gb|EEE56486.1|  hypothetical protein OsJ_05716                          228   2e-67    Oryza sativa Japonica Group [Japonica rice]
ref|NP_197666.1|  glucomannan 4-beta-mannosyltransferase 2              229   2e-67    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001046164.1|  Os02g0192500                                       228   2e-67    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011044347.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    229   2e-67    
ref|XP_007208459.1|  hypothetical protein PRUPE_ppa003918mg             228   2e-67    
ref|XP_007208460.1|  hypothetical protein PRUPE_ppa003918mg             229   3e-67    
ref|XP_008227108.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    229   3e-67    
dbj|BAE98718.1|  hypothetical protein                                   228   4e-67    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010453775.1|  PREDICTED: probable mannan synthase 11             228   4e-67    
tpg|DAA57949.1|  TPA: hypothetical protein ZEAMMB73_988025              225   4e-67    
emb|CBI17089.3|  unnamed protein product                                225   5e-67    
gb|AAQ62570.1|  glycosyltransferase 1                                   228   5e-67    Ipomoea trifida
ref|XP_010492500.1|  PREDICTED: probable mannan synthase 11             227   5e-67    
ref|XP_011088835.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    228   6e-67    
ref|XP_010493365.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    228   7e-67    
ref|XP_010421063.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    228   8e-67    
ref|XP_010509580.1|  PREDICTED: probable mannan synthase 7              228   8e-67    
ref|XP_010454539.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    227   9e-67    
ref|XP_002312893.1|  glycosyl transferase family 2 family protein       228   9e-67    Populus trichocarpa [western balsam poplar]
ref|XP_006287469.1|  hypothetical protein CARUB_v10000681mg             227   9e-67    
ref|XP_006646997.1|  PREDICTED: LOW QUALITY PROTEIN: glucomannan ...    227   1e-66    
ref|XP_010520406.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    227   1e-66    
ref|XP_006287471.1|  hypothetical protein CARUB_v10000683mg             227   1e-66    
ref|XP_004294040.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    227   1e-66    
ref|XP_002890585.1|  hypothetical protein ARALYDRAFT_889889             227   1e-66    
ref|XP_010937162.1|  PREDICTED: probable mannan synthase 11 isofo...    224   1e-66    
ref|XP_004241301.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    227   2e-66    
ref|XP_006347222.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    226   2e-66    
ref|XP_003606275.1|  Glucomannan 4-beta-mannosyltransferase             225   2e-66    
emb|CDY10358.1|  BnaCnng02590D                                          226   2e-66    
ref|XP_006656269.1|  PREDICTED: probable mannan synthase 9-like         226   2e-66    
ref|XP_010420302.1|  PREDICTED: probable mannan synthase 11             226   2e-66    
gb|AAQ62572.1|  glycosyltransferase 10                                  226   2e-66    Ipomoea trifida
ref|XP_002981551.1|  family 2 glycosyltransferase                       226   2e-66    
emb|CDP15609.1|  unnamed protein product                                225   2e-66    
ref|XP_010440127.1|  PREDICTED: probable mannan synthase 1              226   2e-66    
ref|XP_001759264.1|  cellulose synthase-like A2, glycosyltransfer...    226   3e-66    
ref|XP_010434800.1|  PREDICTED: probable mannan synthase 1 isofor...    226   3e-66    
ref|XP_010434799.1|  PREDICTED: probable mannan synthase 1 isofor...    226   3e-66    
ref|XP_010449754.1|  PREDICTED: probable mannan synthase 1              226   3e-66    
dbj|BAK08066.1|  predicted protein                                      226   3e-66    
gb|KFK39910.1|  hypothetical protein AALP_AA3G305000                    226   3e-66    
gb|KGN46914.1|  hypothetical protein Csa_6G150530                       226   3e-66    
ref|XP_008458630.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    226   3e-66    
ref|XP_004145779.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    226   3e-66    
ref|XP_009794211.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    226   3e-66    
ref|XP_002269677.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    226   4e-66    
emb|CAN82595.1|  hypothetical protein VITISV_013708                     226   4e-66    
ref|XP_009120642.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    226   4e-66    
gb|ACV71015.1|  UPA15                                                   225   4e-66    
sp|Q67VS7.1|CSLA9_ORYSJ  RecName: Full=Probable mannan synthase 9...    225   5e-66    
emb|CDX69464.1|  BnaA10g18130D                                          223   5e-66    
ref|XP_009126562.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    225   6e-66    
ref|XP_009590983.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    225   6e-66    
gb|AAC98005.1|  Similar to gi|2245014 glucosyltransferase homolog...    223   7e-66    
ref|XP_009121507.1|  PREDICTED: probable mannan synthase 11             224   9e-66    
ref|XP_009410399.1|  PREDICTED: probable mannan synthase 11 isofo...    224   9e-66    
ref|XP_006400777.1|  hypothetical protein EUTSA_v10013221mg             224   9e-66    
ref|XP_003606273.1|  Glucomannan 4-beta-mannosyltransferase             225   1e-65    
gb|KEH42113.1|  cellulose synthase-like protein A1                      224   1e-65    
ref|XP_009410398.1|  PREDICTED: probable mannan synthase 11 isofo...    225   1e-65    
gb|KEH42110.1|  cellulose synthase-like protein A1                      224   1e-65    
ref|XP_010683891.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    224   1e-65    
ref|XP_010535659.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    224   1e-65    
ref|XP_010690012.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    224   1e-65    
gb|KFK26523.1|  hypothetical protein AALP_AA8G260200                    224   2e-65    
ref|XP_010540229.1|  PREDICTED: probable mannan synthase 3 isofor...    223   2e-65    
ref|XP_008783951.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    223   2e-65    
ref|XP_009136796.1|  PREDICTED: probable mannan synthase 1              224   3e-65    
emb|CDX79614.1|  BnaC03g19500D                                          224   3e-65    
ref|XP_004251009.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    223   3e-65    
ref|XP_008783968.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    223   3e-65    
ref|XP_009133031.1|  PREDICTED: probable mannan synthase 7              223   3e-65    
ref|XP_010540228.1|  PREDICTED: probable mannan synthase 11 isofo...    223   5e-65    
ref|XP_010540227.1|  PREDICTED: probable mannan synthase 11 isofo...    223   5e-65    
ref|XP_006403035.1|  hypothetical protein EUTSA_v10005891mg             223   5e-65    
ref|XP_007015961.1|  Cellulose synthase-like A02 isoform 1              223   5e-65    
ref|XP_008783962.1|  PREDICTED: probable mannan synthase 9 isofor...    223   6e-65    
emb|CDX90506.1|  BnaA03g42750D                                          223   6e-65    
ref|XP_002878056.1|  hypothetical protein ARALYDRAFT_907034             222   1e-64    
ref|XP_010089159.1|  hypothetical protein L484_003290                   222   1e-64    
gb|EMS67675.1|  hypothetical protein TRIUR3_27071                       221   1e-64    
ref|XP_002527445.1|  transferase, transferring glycosyl groups, p...    222   1e-64    
gb|KHG21024.1|  Glucomannan 4-beta-mannosyltransferase 2 -like pr...    222   1e-64    
gb|EAY84833.1|  hypothetical protein OsI_06199                          221   2e-64    
ref|XP_006349077.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    221   2e-64    
emb|CDY26505.1|  BnaC09g41630D                                          221   2e-64    
ref|XP_008787126.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    220   2e-64    
ref|XP_008363527.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    219   4e-64    
ref|XP_010937167.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    221   4e-64    
ref|XP_004506130.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    220   5e-64    
ref|XP_010937166.1|  PREDICTED: probable mannan synthase 11             220   5e-64    
gb|ADW77641.1|  putative mannan synthase                                220   5e-64    
ref|XP_002863134.1|  predicted protein                                  220   5e-64    
ref|XP_010440588.1|  PREDICTED: probable mannan synthase 15 isofo...    218   6e-64    
ref|XP_009116294.1|  PREDICTED: probable mannan synthase 14             219   6e-64    
emb|CAB87854.1|  putative protein                                       219   7e-64    
ref|XP_010440586.1|  PREDICTED: probable mannan synthase 15 isofo...    218   7e-64    
ref|XP_008360269.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    220   7e-64    
ref|XP_009769755.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    219   8e-64    
gb|KHN02317.1|  Mannan synthase 1                                       219   8e-64    
ref|XP_008676306.1|  PREDICTED: mannan synthase 1-like                  209   8e-64    
ref|NP_191159.2|  cellulose synthase like A14                           219   1e-63    
gb|AAO42815.1|  At3g56000                                               219   1e-63    
ref|XP_006410731.1|  hypothetical protein EUTSA_v10016754mg             216   1e-63    
ref|XP_010926632.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    217   1e-63    
emb|CDY68733.1|  BnaUnng03000D                                          212   1e-63    
emb|CDX72181.1|  BnaC08g26930D                                          219   1e-63    
ref|XP_008783930.1|  PREDICTED: probable mannan synthase 3 isofor...    220   1e-63    
ref|XP_008783921.1|  PREDICTED: probable mannan synthase 3 isofor...    220   1e-63    
ref|XP_008787118.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    218   2e-63    
ref|XP_010427404.1|  PREDICTED: probable mannan synthase 14             219   2e-63    
dbj|BAJ89328.1|  predicted protein                                      210   2e-63    
emb|CDY54604.1|  BnaA05g28600D                                          218   2e-63    
ref|XP_006287553.1|  hypothetical protein CARUB_v10000762mg             218   2e-63    
ref|XP_010440585.1|  PREDICTED: probable mannan synthase 15 isofo...    218   2e-63    
ref|XP_010440584.1|  PREDICTED: probable mannan synthase 15 isofo...    218   2e-63    
gb|EYU36982.1|  hypothetical protein MIMGU_mgv1a004240mg                218   3e-63    
ref|XP_006290419.1|  hypothetical protein CARUB_v10019203mg             218   4e-63    
ref|XP_009139629.1|  PREDICTED: probable mannan synthase 15 isofo...    215   4e-63    
ref|XP_010450209.1|  PREDICTED: probable mannan synthase 15 isofo...    215   5e-63    
ref|XP_010435268.1|  PREDICTED: probable mannan synthase 15 isofo...    215   6e-63    
ref|NP_193077.2|  putative mannan synthase 15                           217   7e-63    
gb|KHF98868.1|  Glucomannan 4-beta-mannosyltransferase 2 -like pr...    217   7e-63    
ref|XP_009403734.1|  PREDICTED: probable mannan synthase 9 isofor...    218   7e-63    
ref|XP_010435267.1|  PREDICTED: probable mannan synthase 15 isofo...    215   8e-63    
ref|XP_010516195.1|  PREDICTED: probable mannan synthase 14 isofo...    214   9e-63    
ref|XP_009382953.1|  PREDICTED: probable mannan synthase 11             217   1e-62    
ref|XP_010504474.1|  PREDICTED: probable mannan synthase 14             216   1e-62    
ref|XP_006651080.1|  PREDICTED: probable mannan synthase 4-like         216   1e-62    
ref|XP_009103139.1|  PREDICTED: probable mannan synthase 10             216   2e-62    
ref|XP_009419094.1|  PREDICTED: probable mannan synthase 4              216   2e-62    
gb|AFW73371.1|  hypothetical protein ZEAMMB73_956340                    220   3e-62    
ref|XP_010435266.1|  PREDICTED: probable mannan synthase 15 isofo...    216   3e-62    
ref|XP_009139628.1|  PREDICTED: probable mannan synthase 15 isofo...    216   3e-62    
ref|XP_003542549.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    215   3e-62    
ref|XP_009139627.1|  PREDICTED: probable mannan synthase 15 isofo...    215   3e-62    
gb|EMT24748.1|  hypothetical protein F775_52670                         215   3e-62    
ref|XP_010460178.1|  PREDICTED: probable mannan synthase 10             216   3e-62    
ref|XP_010450208.1|  PREDICTED: probable mannan synthase 15 isofo...    215   4e-62    
ref|XP_010450207.1|  PREDICTED: probable mannan synthase 15 isofo...    215   4e-62    
gb|KHN45690.1|  Glucomannan 4-beta-mannosyltransferase 9                214   4e-62    
ref|XP_003535285.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    214   4e-62    
gb|KHN48194.1|  Glucomannan 4-beta-mannosyltransferase 9                214   5e-62    
ref|XP_009410012.1|  PREDICTED: probable mannan synthase 9 isofor...    215   6e-62    
dbj|BAC43295.1|  putative glucosyltransferase                           209   7e-62    
ref|XP_002893324.1|  hypothetical protein ARALYDRAFT_313253             215   8e-62    
ref|XP_009410011.1|  PREDICTED: probable mannan synthase 9 isofor...    215   8e-62    
ref|XP_009364844.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    214   1e-61    
ref|XP_010516194.1|  PREDICTED: probable mannan synthase 14 isofo...    214   1e-61    
ref|XP_010917052.1|  PREDICTED: probable mannan synthase 4 isofor...    215   1e-61    
ref|XP_010917051.1|  PREDICTED: probable mannan synthase 4 isofor...    215   1e-61    
ref|XP_010234713.1|  PREDICTED: probable mannan synthase 4              213   2e-61    
emb|CDY01129.1|  BnaA04g06900D                                          213   2e-61    
ref|XP_008806011.1|  PREDICTED: probable mannan synthase 4              214   2e-61    
ref|XP_008787138.1|  PREDICTED: probable mannan synthase 11             213   2e-61    
gb|EMT23300.1|  hypothetical protein F775_52157                         212   3e-61    
ref|XP_008802588.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    213   4e-61    
ref|XP_010477728.1|  PREDICTED: probable mannan synthase 10             213   5e-61    
ref|XP_006416032.1|  hypothetical protein EUTSA_v10007269mg             213   5e-61    
ref|XP_010937164.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    213   6e-61    
gb|KFK34844.1|  hypothetical protein AALP_AA5G200500                    211   8e-61    
ref|XP_009131529.1|  PREDICTED: probable mannan synthase 11             211   9e-61    
ref|XP_006283494.1|  hypothetical protein CARUB_v10004546mg             211   1e-60    
ref|NP_173818.1|  cellulose synthase-like A10                           212   1e-60    
gb|AFW73394.1|  hypothetical protein ZEAMMB73_786146                    206   1e-60    
ref|XP_010498927.1|  PREDICTED: probable mannan synthase 10             211   1e-60    
ref|XP_010937357.1|  PREDICTED: probable mannan synthase 9              209   2e-60    
ref|XP_006656810.1|  PREDICTED: probable mannan synthase 3-like         209   2e-60    
emb|CDY40295.1|  BnaA07g09050D                                          211   2e-60    
ref|NP_001136470.1|  uncharacterized protein LOC100216582               206   3e-60    
gb|AFW76791.1|  hypothetical protein ZEAMMB73_274552                    204   3e-60    
sp|Q8S7W0.1|CSLA4_ORYSJ  RecName: Full=Probable mannan synthase 4...    210   4e-60    
ref|XP_002873761.1|  hypothetical protein ARALYDRAFT_488470             207   5e-60    
gb|KFK36462.1|  hypothetical protein AALP_AA4G127800                    208   5e-60    
ref|XP_006307167.1|  hypothetical protein CARUB_v10008757mg             210   6e-60    
ref|NP_197123.3|  cellulose synthase like A11                           207   7e-60    
emb|CDX70677.1|  BnaC03g07610D                                          207   8e-60    
ref|XP_010554517.1|  PREDICTED: probable mannan synthase 11             209   9e-60    
ref|XP_008780571.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    206   1e-59    
ref|NP_001064564.1|  Os10g0406400                                       201   2e-59    
gb|KFK44470.1|  hypothetical protein AALP_AA1G260600                    208   2e-59    
gb|EYU29872.1|  hypothetical protein MIMGU_mgv1a023425mg                207   3e-59    
dbj|BAK04119.1|  predicted protein                                      204   3e-59    
gb|EMS62877.1|  hypothetical protein TRIUR3_33379                       206   3e-59    
gb|AFW73395.1|  hypothetical protein ZEAMMB73_786146                    206   4e-59    
ref|NP_001130786.1|  hypothetical protein                               201   6e-59    
sp|Q67X45.1|CSLA3_ORYSJ  RecName: Full=Probable mannan synthase 3...    207   6e-59    
ref|XP_010935704.1|  PREDICTED: mannan synthase 1-like isoform X3       206   7e-59    
ref|XP_010935703.1|  PREDICTED: mannan synthase 1-like isoform X2       206   8e-59    
ref|XP_006400151.1|  hypothetical protein EUTSA_v100135781mg            196   8e-59    
ref|XP_008780554.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    206   8e-59    
gb|EEE65380.1|  hypothetical protein OsJ_20691                          206   9e-59    
gb|EEC80274.1|  hypothetical protein OsI_22257                          206   9e-59    
gb|EMT17077.1|  hypothetical protein F775_09797                         207   1e-58    
ref|NP_001132315.1|  hypothetical protein                               206   1e-58    
ref|XP_008681194.1|  PREDICTED: hypothetical protein isoform X1         206   1e-58    
ref|XP_004966838.1|  PREDICTED: probable mannan synthase 3-like         206   2e-58    
ref|XP_002879565.1|  hypothetical protein ARALYDRAFT_482526             206   2e-58    
ref|XP_007027601.1|  Nucleotide-diphospho-sugar transferases supe...    204   2e-58    
ref|XP_008664730.1|  PREDICTED: uncharacterized protein LOC100216...    206   3e-58    
ref|XP_002528577.1|  conserved hypothetical protein                     204   3e-58    
ref|XP_006660158.1|  PREDICTED: LOW QUALITY PROTEIN: probable man...    204   5e-58    
ref|XP_002468429.1|  hypothetical protein SORBIDRAFT_01g045850          204   5e-58    
ref|XP_010939804.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    198   6e-58    
ref|XP_004983152.1|  PREDICTED: probable mannan synthase 2-like         205   6e-58    
ref|XP_008649262.1|  PREDICTED: probable mannan synthase 3 isofor...    204   1e-57    
ref|NP_565813.1|  putative mannan synthase 7                            203   2e-57    
emb|CDM86569.1|  unnamed protein product                                203   2e-57    
gb|EMT15170.1|  hypothetical protein F775_14200                         202   2e-57    
ref|XP_003572230.2|  PREDICTED: probable mannan synthase 11 isofo...    203   2e-57    
ref|XP_004973516.1|  PREDICTED: probable mannan synthase 11-like        203   3e-57    
gb|EEE50933.1|  hypothetical protein OsJ_31468                          200   3e-57    
gb|EEE68748.1|  hypothetical protein OsJ_27439                          202   3e-57    
gb|AAM61171.1|  putative glucosyltransferase                            202   4e-57    
gb|AAK98678.1|AC021893_12  Putative glucosyltransferase                 201   5e-57    
ref|XP_006662343.1|  PREDICTED: probable mannan synthase 2-like         201   5e-57    
tpg|DAA50026.1|  TPA: hypothetical protein ZEAMMB73_959739              196   6e-57    
sp|Q6YWK8.1|CSLAB_ORYSJ  RecName: Full=Probable mannan synthase 1...    202   7e-57    
tpg|DAA01755.1|  TPA: cellulose synthase-like A2                        201   8e-57    
ref|XP_008658026.1|  PREDICTED: hypothetical protein isoform X1         201   8e-57    
gb|EEC66918.1|  hypothetical protein OsI_33517                          199   9e-57    
ref|XP_009141504.1|  PREDICTED: probable mannan synthase 7              201   9e-57    
gb|AFW62286.1|  hypothetical protein ZEAMMB73_786937                    198   1e-56    
emb|CDY40448.1|  BnaA04g20690D                                          201   2e-56    
gb|EEC83623.1|  hypothetical protein OsI_29346                          202   2e-56    
sp|Q7PC67.2|CSLA2_ORYSJ  RecName: Full=Probable mannan synthase 2...    201   2e-56    
ref|XP_009403159.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    200   3e-56    
ref|XP_002464637.1|  hypothetical protein SORBIDRAFT_01g022320          197   3e-56    
gb|EMT01783.1|  hypothetical protein F775_21241                         200   3e-56    
ref|XP_011088832.1|  PREDICTED: probable mannan synthase 11             198   1e-55    
ref|XP_008677729.1|  PREDICTED: uncharacterized protein LOC100501...    198   2e-55    
gb|EMS51475.1|  hypothetical protein TRIUR3_09357                       196   2e-55    
ref|XP_009769757.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    196   3e-55    
emb|CAN74357.1|  hypothetical protein VITISV_042153                     197   3e-55    
gb|KFK25839.1|  hypothetical protein AALP_AA8G168900                    196   3e-55    
ref|XP_009390887.1|  PREDICTED: probable mannan synthase 11             197   3e-55    
gb|EMS51579.1|  hypothetical protein TRIUR3_28386                       197   4e-55    
gb|EMT22485.1|  hypothetical protein F775_13089                         195   4e-55    
tpg|DAA50027.1|  TPA: hypothetical protein ZEAMMB73_959739              196   5e-55    
dbj|BAK05964.1|  predicted protein                                      196   8e-55    
dbj|BAK06422.1|  predicted protein                                      196   8e-55    
ref|XP_008649263.1|  PREDICTED: probable mannan synthase 3 isofor...    196   8e-55    
ref|XP_011010406.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    195   2e-54    
ref|XP_008664978.1|  PREDICTED: probable mannan synthase 2 isofor...    195   3e-54    
gb|EYU36983.1|  hypothetical protein MIMGU_mgv1a004073mg                194   3e-54    
ref|XP_008664977.1|  PREDICTED: probable mannan synthase 4 isofor...    196   3e-54    
ref|XP_004497599.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    193   6e-54    
ref|XP_004953872.1|  PREDICTED: probable mannan synthase 6-like         193   7e-54    
ref|XP_010227824.1|  PREDICTED: probable mannan synthase 3 isofor...    191   1e-53    
ref|XP_006428366.1|  hypothetical protein CICLE_v10013685mg             190   1e-53    
ref|XP_009380154.1|  PREDICTED: probable mannan synthase 4              192   2e-53    
ref|XP_010227823.1|  PREDICTED: probable mannan synthase 3 isofor...    192   2e-53    
ref|XP_003560885.1|  PREDICTED: probable mannan synthase 3 isofor...    192   2e-53    
tpg|DAA01745.1|  TPA: cellulose synthase-like A4                        192   3e-53    
ref|XP_002452557.1|  hypothetical protein SORBIDRAFT_04g028070          191   4e-53    
gb|EMS57245.1|  hypothetical protein TRIUR3_28392                       189   6e-53    
ref|XP_003590384.1|  Glucomannan 4-beta-mannosyltransferase             189   8e-53    
emb|CBI32777.3|  unnamed protein product                                188   1e-52    
ref|XP_006381411.1|  hypothetical protein POPTR_0006s12630g             181   2e-52    
dbj|BAF36300.1|  hypothetical protein                                   189   3e-52    
ref|XP_002436757.1|  hypothetical protein SORBIDRAFT_10g008206          180   3e-52    



>ref|XP_009597672.1| PREDICTED: mannan synthase 1-like isoform X2 [Nicotiana tomentosiformis]
Length=527

 Score =   316 bits (810),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 150/203 (74%), Positives = 173/203 (85%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM KEI+  ERVS++KKFHLIY FFFVRKIIAHWVTFFFYCVVIP  I++P
Sbjct  325  SCGPANLFRKMMKEIMLCERVSIWKKFHLIYGFFFVRKIIAHWVTFFFYCVVIPATILVP  384

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+HLTKP+AIYLPATITILNAACT RSFHLLV WILFENVMSLHR+KA IIGLLEANR N
Sbjct  385  EVHLTKPLAIYLPATITILNAACTPRSFHLLVFWILFENVMSLHRSKATIIGLLEANRVN  444

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLGN  KQ+ + +A +R   R+ ERIH+LE++MG +ML CA Y+++FG+D F+I
Sbjct  445  EWVVTEKLGNMMKQKYSAKASKRPRSRIGERIHVLELLMGMYMLYCAIYNMLFGNDHFFI  504

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL LQA AFF VG  +VGT VP 
Sbjct  505  YLFLQAGAFFIVGVGYVGTFVPN  527



>ref|XP_009765562.1| PREDICTED: mannan synthase 1-like isoform X2 [Nicotiana sylvestris]
Length=527

 Score =   316 bits (810),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 150/203 (74%), Positives = 173/203 (85%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM KEI+  ERVS++KKFHLIY FFFVRKIIAHWVTFFFYCVVIP  I++P
Sbjct  325  SCGPANLFRKMMKEIMLCERVSIWKKFHLIYGFFFVRKIIAHWVTFFFYCVVIPATILVP  384

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+HLTKP+AIYLPATITILNAACT RSFHLLV WILFENVMSLHR+KA IIGLLEANR N
Sbjct  385  EVHLTKPLAIYLPATITILNAACTPRSFHLLVFWILFENVMSLHRSKATIIGLLEANRVN  444

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLGN  KQ+ + +A +R   R+ ERIH+LE++MG +ML CA Y+++FG+D F+I
Sbjct  445  EWVVTEKLGNMMKQKYSAKASKRPRSRIGERIHVLELLMGMYMLYCAIYNMLFGNDHFFI  504

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL LQA AFF VG  +VGT VP 
Sbjct  505  YLFLQAGAFFIVGVGYVGTFVPN  527



>ref|XP_006354365.1| PREDICTED: mannan synthase 1-like [Solanum tuberosum]
Length=527

 Score =   315 bits (807),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 149/203 (73%), Positives = 174/203 (86%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM KEI+  ERVS++KKFHLIY FFFVRKIIAHWVTFFFYCVVIP  I++P
Sbjct  325  SCGPANLFRKMIKEIILCERVSVWKKFHLIYGFFFVRKIIAHWVTFFFYCVVIPATILVP  384

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+HLTKP+AIYLPATITILNAACT RSFHLLV WILFENVMSLHR+KAAIIGLLEA+R N
Sbjct  385  EVHLTKPLAIYLPATITILNAACTPRSFHLLVFWILFENVMSLHRSKAAIIGLLEASRVN  444

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLGN  KQ+ + +A ++   R+ ERIH+LE++MG +ML CA Y+++FG+D F+I
Sbjct  445  EWVVTEKLGNTMKQKYSAKASKKPRSRIGERIHVLELLMGMYMLHCAIYNMLFGNDHFFI  504

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL LQA AFF VG  +VGT VP 
Sbjct  505  YLFLQAGAFFIVGIGYVGTFVPN  527



>ref|XP_004246627.1| PREDICTED: mannan synthase 1-like [Solanum lycopersicum]
Length=527

 Score =   315 bits (806),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 174/203 (86%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM KEI+  ERVS++KKFHLIY FFFVRKIIAHWVTFFFYC+VIP  I++P
Sbjct  325  SCGPANLFRKMIKEIILCERVSVWKKFHLIYGFFFVRKIIAHWVTFFFYCIVIPATILVP  384

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+HLTKP+AIYLPATITILNAACT RSFHLLV WILFENVMSLHR+KAAIIGLLEA+R N
Sbjct  385  EVHLTKPLAIYLPATITILNAACTPRSFHLLVFWILFENVMSLHRSKAAIIGLLEASRVN  444

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLGN  KQ+ + +A ++   R+ ERIH+LE++MG +ML CA Y+++FG+D F+I
Sbjct  445  EWVVTEKLGNTMKQKYSAKASKKPRSRIGERIHVLELLMGMYMLHCAIYNMLFGNDHFFI  504

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL LQA AFF VG  +VGT VP 
Sbjct  505  YLFLQAGAFFIVGIGYVGTFVPN  527



>emb|CDP06773.1| unnamed protein product [Coffea canephora]
Length=530

 Score =   306 bits (783),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 144/204 (71%), Positives = 174/204 (85%), Gaps = 1/204 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKMFKEIL  ERVS++KKFH+IYAFFFVRKI+AHWVTFFFYC+VIP  I++P
Sbjct  327  SCGPANLFRKMFKEILLCERVSIWKKFHVIYAFFFVRKIVAHWVTFFFYCIVIPATILVP  386

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+HL KPIA+YLPATIT+LNAA T RS HLLV WILFENVMSLHR+KAAIIGLLEA+R N
Sbjct  387  EVHLPKPIAVYLPATITLLNAASTPRSLHLLVFWILFENVMSLHRSKAAIIGLLEASRVN  446

Query  420  EWVVTEKLGNAAKQRQAV-RAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFY  244
            EW+VTEKLGNA KQ+ ++ +  +R   R+ ERIH LE++MG +ML CA Y++IF +D F+
Sbjct  447  EWIVTEKLGNALKQKYSIPKVSKRPRSRIAERIHFLELIMGMYMLHCAFYNMIFANDHFF  506

Query  243  IYLVLQALAFFAVGFSFVGTQVPT  172
            IYL+LQA AFF +G  ++GT VPT
Sbjct  507  IYLLLQAGAFFTIGLGYIGTIVPT  530



>sp|Q6UDF0.1|CSLA1_CYATE RecName: Full=Mannan synthase 1; AltName: Full=CtManS [Cyamopsis 
tetragonoloba]
 gb|AAR23313.1| beta-1,4-mannan synthase [Cyamopsis tetragonoloba]
 gb|ADF47159.1| beta-1,4-mannan synthase [Cyamopsis tetragonoloba]
Length=526

 Score =   303 bits (775),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 144/203 (71%), Positives = 168/203 (83%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLF+KM KEI+  +RV L K+ HLIYAFFFVRKI+AHWVTFFFYC+VIP  +++P
Sbjct  324  SCGPANLFKKMTKEIICCKRVPLLKRLHLIYAFFFVRKIVAHWVTFFFYCIVIPACVIVP  383

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E++L K IAIY+PATITILNA  T RS HLLV+WILFENVMSLHRTKAAIIGLLEANR N
Sbjct  384  EVNLKKQIAIYIPATITILNAVSTPRSMHLLVLWILFENVMSLHRTKAAIIGLLEANRVN  443

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLGNA KQR   R  R    R+ ERIH LEI++G +ML CA+YD++FGHD F++
Sbjct  444  EWVVTEKLGNAMKQRNNARPSRASRFRIIERIHPLEIIVGMYMLHCATYDLLFGHDHFFV  503

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL+LQA AFF +GF  VGT VPT
Sbjct  504  YLLLQAGAFFTMGFGLVGTIVPT  526



>ref|XP_011094610.1| PREDICTED: mannan synthase 1-like [Sesamum indicum]
Length=527

 Score =   302 bits (773),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/203 (70%), Positives = 170/203 (84%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKMFKEI+  ERVS++KK+H+IYAFFFVRKIIAHWVTFFFYC+VIP  I++P
Sbjct  325  SCGPANLFRKMFKEIIICERVSIWKKWHVIYAFFFVRKIIAHWVTFFFYCIVIPATILVP  384

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+HL KP+AIYLPA ITILNAA T RS HLLV WILFENVMSLHR+KAAIIGLLEANR N
Sbjct  385  EVHLPKPLAIYLPAGITILNAASTLRSIHLLVFWILFENVMSLHRSKAAIIGLLEANRVN  444

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLGN  KQ+   +A +R   R  ER+ +LE+++G ++L CA Y+I+FGH+ F+I
Sbjct  445  EWVVTEKLGNTMKQKHNTKASKRPRSRTGERVQILELVVGLYLLHCAIYNILFGHNHFFI  504

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL+LQA AFF VG  +VGT VP 
Sbjct  505  YLLLQAGAFFIVGVGYVGTFVPN  527



>gb|ACE60600.1| mannan synthase [Coffea canephora]
Length=530

 Score =   302 bits (773),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/204 (70%), Positives = 173/204 (85%), Gaps = 1/204 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKMFKEIL  ERVS++KKFH+IYAF FVRKI+AHWVTFFFYC+VIP  I++P
Sbjct  327  SCGPANLFRKMFKEILLCERVSIWKKFHVIYAFSFVRKIVAHWVTFFFYCIVIPATILVP  386

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+HL KPIA+YLPATIT+LNAA T RS HLLV WILFENVMSLHR+KAAIIGLLEA+R N
Sbjct  387  EVHLPKPIAVYLPATITLLNAASTPRSLHLLVFWILFENVMSLHRSKAAIIGLLEASRVN  446

Query  420  EWVVTEKLGNAAKQRQAV-RAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFY  244
            EW+VTEKLGNA KQ+ ++ +  +R   R+ ERIH LE++MG +ML CA Y++IF +D F+
Sbjct  447  EWIVTEKLGNALKQKYSIPKVSKRPRSRIAERIHFLELIMGMYMLHCAFYNMIFANDHFF  506

Query  243  IYLVLQALAFFAVGFSFVGTQVPT  172
            IYL+LQA AFF +G  ++GT VPT
Sbjct  507  IYLLLQAGAFFIIGLGYIGTIVPT  530



>ref|XP_010096071.1| hypothetical protein L484_000910 [Morus notabilis]
 gb|EXC42303.1| hypothetical protein L484_000910 [Morus notabilis]
Length=527

 Score =   301 bits (772),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 173/206 (84%), Gaps = 6/206 (3%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM KEI+  ERVS++K+ HLIYAFFFVRKI+AHWVTFFFYC+VIP ++V+P
Sbjct  325  SCGPANLFRKMTKEIILCERVSIWKRLHLIYAFFFVRKIVAHWVTFFFYCIVIPASVVVP  384

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ LTKPIA+Y+PATITILNA CT RS HL+V WILFENVMSLHRTKAAIIGLLEANRAN
Sbjct  385  EVKLTKPIAVYIPATITILNAVCTPRSLHLVVFWILFENVMSLHRTKAAIIGLLEANRAN  444

Query  420  EWVVTEKLGNAAKQRQA---VRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDL  250
            EWVVTEKLGN  K + +   ++ PR RT    ERIH+LE++MG FML CA YD+++G D 
Sbjct  445  EWVVTEKLGNTMKLKNSLTILKKPRSRTV---ERIHVLELLMGMFMLHCAVYDMLYGKDH  501

Query  249  FYIYLVLQALAFFAVGFSFVGTQVPT  172
            F++YL++QA AFF +GF +VGT V +
Sbjct  502  FFLYLMMQAGAFFIMGFGYVGTFVSS  527



>gb|ACE60601.1| mannan synthase [Coffea arabica]
Length=530

 Score =   300 bits (768),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 142/204 (70%), Positives = 172/204 (84%), Gaps = 1/204 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKMFKEIL  ERVS++KKFH+IYAFFFVRKI+AHWVTFFFYC+VIP  I++P
Sbjct  327  SCGPANLFRKMFKEILLCERVSIWKKFHVIYAFFFVRKIVAHWVTFFFYCIVIPATILVP  386

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+HL KPIA+Y PATIT+LNAA T RS HLLV WILFENVMSLHR+KAAIIGLLEA+R N
Sbjct  387  EVHLPKPIAVYPPATITLLNAASTPRSLHLLVFWILFENVMSLHRSKAAIIGLLEASRVN  446

Query  420  EWVVTEKLGNAAKQRQAV-RAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFY  244
            EW+VTEKLGNA KQ+ ++ +  +R   R+ ERIH LE++MG +ML CA Y++IF +D F+
Sbjct  447  EWIVTEKLGNALKQKYSIPKVSKRPGSRIAERIHFLELIMGMYMLHCAFYNLIFANDHFF  506

Query  243  IYLVLQALAFFAVGFSFVGTQVPT  172
            IY +LQA AFF +G  ++GT VPT
Sbjct  507  IYPLLQAGAFFIIGLGYIGTIVPT  530



>ref|XP_009597671.1| PREDICTED: mannan synthase 1-like isoform X1 [Nicotiana tomentosiformis]
Length=556

 Score =   301 bits (770),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 150/232 (65%), Positives = 173/232 (75%), Gaps = 29/232 (13%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSE-----------------------------RVSLYKKFHLIY  688
            SCGPANLFRKM KEI+  E                             RVS++KKFHLIY
Sbjct  325  SCGPANLFRKMMKEIMLCEVILFSKFCLLLKKEAFLSTSHITPFLLMQRVSIWKKFHLIY  384

Query  687  AFFFVRKIIAHWVTFFFYCVVIPFAIVIPELHLTKPIAIYLPATITILNAACTKRSFHLL  508
             FFFVRKIIAHWVTFFFYCVVIP  I++PE+HLTKP+AIYLPATITILNAACT RSFHLL
Sbjct  385  GFFFVRKIIAHWVTFFFYCVVIPATILVPEVHLTKPLAIYLPATITILNAACTPRSFHLL  444

Query  507  VVWILFENVMSLHRTKAAIIGLLEANRANEWVVTEKLGNAAKQRQAVRAPRRRTCRLRER  328
            V WILFENVMSLHR+KA IIGLLEANR NEWVVTEKLGN  KQ+ + +A +R   R+ ER
Sbjct  445  VFWILFENVMSLHRSKATIIGLLEANRVNEWVVTEKLGNMMKQKYSAKASKRPRSRIGER  504

Query  327  IHLLEIMMGFFMLQCASYDIIFGHDLFYIYLVLQALAFFAVGFSFVGTQVPT  172
            IH+LE++MG +ML CA Y+++FG+D F+IYL LQA AFF VG  +VGT VP 
Sbjct  505  IHVLELLMGMYMLYCAIYNMLFGNDHFFIYLFLQAGAFFIVGVGYVGTFVPN  556



>ref|XP_009765561.1| PREDICTED: mannan synthase 1-like isoform X1 [Nicotiana sylvestris]
Length=556

 Score =   300 bits (769),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 150/232 (65%), Positives = 173/232 (75%), Gaps = 29/232 (13%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSE-----------------------------RVSLYKKFHLIY  688
            SCGPANLFRKM KEI+  E                             RVS++KKFHLIY
Sbjct  325  SCGPANLFRKMMKEIMLCEVILFSKFCLFLKKEAFLSTSHITPFLLMQRVSIWKKFHLIY  384

Query  687  AFFFVRKIIAHWVTFFFYCVVIPFAIVIPELHLTKPIAIYLPATITILNAACTKRSFHLL  508
             FFFVRKIIAHWVTFFFYCVVIP  I++PE+HLTKP+AIYLPATITILNAACT RSFHLL
Sbjct  385  GFFFVRKIIAHWVTFFFYCVVIPATILVPEVHLTKPLAIYLPATITILNAACTPRSFHLL  444

Query  507  VVWILFENVMSLHRTKAAIIGLLEANRANEWVVTEKLGNAAKQRQAVRAPRRRTCRLRER  328
            V WILFENVMSLHR+KA IIGLLEANR NEWVVTEKLGN  KQ+ + +A +R   R+ ER
Sbjct  445  VFWILFENVMSLHRSKATIIGLLEANRVNEWVVTEKLGNMMKQKYSAKASKRPRSRIGER  504

Query  327  IHLLEIMMGFFMLQCASYDIIFGHDLFYIYLVLQALAFFAVGFSFVGTQVPT  172
            IH+LE++MG +ML CA Y+++FG+D F+IYL LQA AFF VG  +VGT VP 
Sbjct  505  IHVLELLMGMYMLYCAIYNMLFGNDHFFIYLFLQAGAFFIVGVGYVGTFVPN  556



>ref|XP_002277171.1| PREDICTED: mannan synthase 1-like [Vitis vinifera]
Length=526

 Score =   299 bits (766),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 143/199 (72%), Positives = 168/199 (84%), Gaps = 1/199 (1%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM KEI+  E+VS +KKFH+IYAFFFVRKIIAHWVTFFFYCVVIP ++++P
Sbjct  325  SCGPANLFRKMTKEIILCEKVSTWKKFHVIYAFFFVRKIIAHWVTFFFYCVVIPLSVLVP  384

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ L KPIAIY+PATIT LNA CT RS HL+V WILFENVMSLHRTKAAIIGLLEANR N
Sbjct  385  EVALPKPIAIYIPATITFLNAVCTPRSLHLVVFWILFENVMSLHRTKAAIIGLLEANRVN  444

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLGN  KQ+ A +A ++   R+ ERIHLLE++MG FML CA Y+++F  D F+I
Sbjct  445  EWVVTEKLGNLMKQKNA-KASKKSRSRVGERIHLLELIMGMFMLHCAIYNLLFREDHFFI  503

Query  240  YLVLQALAFFAVGFSFVGT  184
            YL+LQA AFF +GF +VGT
Sbjct  504  YLILQAGAFFIMGFGYVGT  522



>gb|KEH24032.1| cellulose synthase-like protein A1 [Medicago truncatula]
Length=529

 Score =   296 bits (759),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 145/205 (71%), Positives = 165/205 (80%), Gaps = 2/205 (1%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANL +KM KEIL  +RVSL K+ HLIYAFFFVRKIIAHWVTFFFYC+VIP  +V+P
Sbjct  325  SCGPANLLKKMTKEILFCKRVSLLKRLHLIYAFFFVRKIIAHWVTFFFYCIVIPACVVVP  384

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ LTK +AIY+PATITILNA  T RS HLLV+WILFENVMSLHRTKAAIIGLLEANR N
Sbjct  385  EVSLTKKVAIYIPATITILNAVSTPRSVHLLVLWILFENVMSLHRTKAAIIGLLEANRVN  444

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTC--RLRERIHLLEIMMGFFMLQCASYDIIFGHDLF  247
            EWVVTEKLGN  KQR   R    R+   R+ ERIH LEI++G +ML CA YD++FG D F
Sbjct  445  EWVVTEKLGNTMKQRNNARPSTSRSPWFRITERIHPLEIIVGMYMLHCAIYDLLFGRDHF  504

Query  246  YIYLVLQALAFFAVGFSFVGTQVPT  172
            Y+YL+LQA AFF +GF  VGT VP 
Sbjct  505  YLYLLLQAGAFFTMGFGIVGTIVPN  529



>gb|KHN09524.1| Mannan synthase 1 [Glycine soja]
Length=481

 Score =   293 bits (751),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/202 (70%), Positives = 164/202 (81%), Gaps = 0/202 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLF+KM  EIL   RV L K+ HL+YAFFFVRKI+AHWVTFFFYC+VIP  +++P
Sbjct  279  SCGPANLFKKMTMEILYCHRVPLLKRLHLVYAFFFVRKIVAHWVTFFFYCIVIPACVIVP  338

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ L K IAIY+PATITILNA  T RS HLLV+WILFENVMSLHRTKAAIIGLLEANR N
Sbjct  339  EVSLKKQIAIYIPATITILNAVSTPRSMHLLVLWILFENVMSLHRTKAAIIGLLEANRVN  398

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLGNA KQR+  +  R    R+ +RIH LEI++G +ML CA YD++FGHD F+I
Sbjct  399  EWVVTEKLGNAMKQRKNAKPSRTSWFRIIDRIHPLEIIVGMYMLHCAIYDLLFGHDHFFI  458

Query  240  YLVLQALAFFAVGFSFVGTQVP  175
            YL+LQA AFF +GF  VGT VP
Sbjct  459  YLLLQAGAFFTMGFGQVGTIVP  480



>ref|XP_004493996.1| PREDICTED: mannan synthase 1-like [Cicer arietinum]
Length=527

 Score =   295 bits (754),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 143/205 (70%), Positives = 165/205 (80%), Gaps = 2/205 (1%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANL +KM KEIL  +RVSL K+ HLIYAFFFVRKIIAHWVTFFFYC+VIP  +V+P
Sbjct  323  SCGPANLLKKMTKEILFCQRVSLLKRLHLIYAFFFVRKIIAHWVTFFFYCIVIPACVVVP  382

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ L K IA+Y+PATITILNA  T RS HL+V+WILFENVMSLHRTKAAIIGLLEANR N
Sbjct  383  EVSLKKQIAVYIPATITILNAVSTPRSMHLVVLWILFENVMSLHRTKAAIIGLLEANRVN  442

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTC--RLRERIHLLEIMMGFFMLQCASYDIIFGHDLF  247
            EWVVTEKLGN  KQR   +    +T   R+ ERIHLLEI++G +ML CA YD++FG D F
Sbjct  443  EWVVTEKLGNTMKQRNNAKPSTSKTPWFRITERIHLLEIIVGIYMLHCAIYDLLFGRDHF  502

Query  246  YIYLVLQALAFFAVGFSFVGTQVPT  172
            +IYL+LQA AFF +GF  VGT VP 
Sbjct  503  FIYLLLQAGAFFTMGFGLVGTIVPN  527



>gb|EYU38560.1| hypothetical protein MIMGU_mgv1a017694mg [Erythranthe guttata]
Length=527

 Score =   294 bits (753),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/203 (68%), Positives = 170/203 (84%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKMFKEI+  ERVS++KK+H+IYAFFFVRKIIAHWVTFFFYC++IP  I++P
Sbjct  325  SCGPANLFRKMFKEIILCERVSIWKKWHVIYAFFFVRKIIAHWVTFFFYCIIIPATILVP  384

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ L +P+AIYLPA ITILNAA T RS HLLV WILFENVMSLHR+KAAIIGLLEANR N
Sbjct  385  EVDLPRPLAIYLPACITILNAASTFRSMHLLVFWILFENVMSLHRSKAAIIGLLEANRVN  444

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLGN  KQ+   +  +R   R+ ERIH+LEI++G ++L CA Y++++GH+ F+I
Sbjct  445  EWVVTEKLGNTMKQKYNAKTFKRPRSRITERIHILEIVVGMYLLHCAIYNMLYGHNHFFI  504

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL+LQA AFF +G  ++GT VP 
Sbjct  505  YLLLQAGAFFIIGVGYIGTFVPN  527



>ref|XP_003520655.1| PREDICTED: mannan synthase 1-like [Glycine max]
Length=527

 Score =   293 bits (751),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 141/202 (70%), Positives = 164/202 (81%), Gaps = 0/202 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLF+KM  EIL   RV L K+ HL+YAFFFVRKI+AHWVTFFFYC+VIP  +++P
Sbjct  325  SCGPANLFKKMTMEILYCHRVPLLKRLHLVYAFFFVRKIVAHWVTFFFYCIVIPACVIVP  384

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ L K IAIY+PATITILNA  T RS HLLV+WILFENVMSLHRTKAAIIGLLEANR N
Sbjct  385  EVSLKKQIAIYIPATITILNAVSTPRSMHLLVLWILFENVMSLHRTKAAIIGLLEANRVN  444

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLGNA KQR+  +  R    R+ +RIH LEI++G +ML CA YD++FGHD F+I
Sbjct  445  EWVVTEKLGNAMKQRKNAKPSRTSWFRIIDRIHPLEIIVGMYMLHCAIYDLLFGHDHFFI  504

Query  240  YLVLQALAFFAVGFSFVGTQVP  175
            YL+LQA AFF +GF  VGT VP
Sbjct  505  YLLLQAGAFFTMGFGQVGTIVP  526



>gb|AFV79650.1| mannan synthase [Trigonella foenum-graecum]
Length=534

 Score =   291 bits (746),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 148/210 (70%), Positives = 166/210 (79%), Gaps = 7/210 (3%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANL +KM KEIL  +RVSL K+ HLIYAFFFVRKIIAHWVTFFFYC+VIP  +V+P
Sbjct  325  SCGPANLLKKMTKEILFCQRVSLLKRLHLIYAFFFVRKIIAHWVTFFFYCIVIPACVVVP  384

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ LTK IAIY+PATITILNA  T RS HLLV+WILFENVMSLHRTKAAIIGLLEANR N
Sbjct  385  EVSLTKKIAIYIPATITILNAVSTPRSRHLLVLWILFENVMSLHRTKAAIIGLLEANRVN  444

Query  420  EWVVTEKLGNAAKQRQAVR-APRRRTCRLR------ERIHLLEIMMGFFMLQCASYDIIF  262
            EWVVTEKLGN  KQ Q+ R   R  T R R      ERIH LEI++G +ML CA YD++F
Sbjct  445  EWVVTEKLGNTMKQSQSQRNNARPSTSRSRWFRTIIERIHPLEIIVGMYMLHCAIYDLLF  504

Query  261  GHDLFYIYLVLQALAFFAVGFSFVGTQVPT  172
            G D F+IYL+LQA AFF +GF  VGT VP 
Sbjct  505  GRDHFFIYLLLQAGAFFTMGFGAVGTIVPN  534



>gb|KDO49989.1| hypothetical protein CISIN_1g044519mg [Citrus sinensis]
Length=534

 Score =   286 bits (732),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 132/203 (65%), Positives = 166/203 (82%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGP+NLF KM +EI+  ERVS++K+ +LIYAFF VRKIIAHWVTFFFYC+VIP ++++P
Sbjct  332  SCGPSNLFSKMTREIILCERVSVWKRLYLIYAFFIVRKIIAHWVTFFFYCIVIPTSVLVP  391

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ LTKPIAIY+PATIT+LNA CT RSFHL+V WILFENVMSL R KAAIIGLLEANR N
Sbjct  392  EIQLTKPIAIYIPATITLLNAVCTPRSFHLIVFWILFENVMSLLRAKAAIIGLLEANRVN  451

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEK GN  KQ+  ++  ++   ++ ER+H+LE++MG FML CA Y++IF  D F++
Sbjct  452  EWVVTEKHGNTKKQKNNIKTLKKSRSQVGERLHVLELIMGTFMLYCAIYNLIFCQDHFFV  511

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL+LQA AFF +GF +VG  VP 
Sbjct  512  YLLLQAGAFFIMGFGYVGPSVPN  534



>ref|XP_003553558.1| PREDICTED: mannan synthase 1-like [Glycine max]
Length=528

 Score =   286 bits (731),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 163/203 (80%), Gaps = 1/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEI-LKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVI  604
            SCGPANLF+KM  E  +   RV L K+ HL+YAFFFVRKI+AHWVTFFFYC+VIP  +++
Sbjct  325  SCGPANLFKKMTMESSIAMYRVPLLKRLHLVYAFFFVRKIVAHWVTFFFYCIVIPACVIV  384

Query  603  PELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRA  424
            PE+ L K IAIY+PATITILNA  T RS HLLV+WILFENVMSLHRTKAAIIGLLEANR 
Sbjct  385  PEVSLKKQIAIYIPATITILNAVSTPRSMHLLVLWILFENVMSLHRTKAAIIGLLEANRV  444

Query  423  NEWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFY  244
            NEWVVTEKLGNA KQR+  R  R    R+ +R+H LEI++G +ML CA YD++FGHD F+
Sbjct  445  NEWVVTEKLGNAMKQRKNARPSRTSWFRIIDRVHPLEIIVGMYMLHCAIYDLLFGHDHFF  504

Query  243  IYLVLQALAFFAVGFSFVGTQVP  175
            IYL+LQA AFF +GF  VGT VP
Sbjct  505  IYLLLQAGAFFTMGFGQVGTIVP  527



>ref|XP_008800552.1| PREDICTED: mannan synthase 1-like [Phoenix dactylifera]
Length=530

 Score =   280 bits (717),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 164/204 (80%), Gaps = 1/204 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKMFKEI   ERVS++KKFH++YAFFFVRKI+AH+VTFFFYCVVIP  +++ 
Sbjct  327  SCGPANLFRKMFKEIANCERVSIWKKFHVLYAFFFVRKIVAHFVTFFFYCVVIPACVLVQ  386

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            ++ L K +A+Y+PATITILNA  T RS HLL+ WILFENVMS+HR KA IIGLLEANR N
Sbjct  387  DIPLPKFVAVYIPATITILNAISTPRSIHLLIFWILFENVMSMHRAKATIIGLLEANRVN  446

Query  420  EWVVTEKLGNAAKQR-QAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFY  244
            EWVVT+KLG+A KQ+    ++  ++  ++ +RIHLLEI MG F+L CA YD  FGHD FY
Sbjct  447  EWVVTDKLGSALKQKANTTKSKTKKRPQIGDRIHLLEIFMGSFLLYCAIYDYTFGHDHFY  506

Query  243  IYLVLQALAFFAVGFSFVGTQVPT  172
            IYL LQA AFF  GF +VGT VP+
Sbjct  507  IYLFLQASAFFIAGFGYVGTFVPS  530



>ref|XP_010935702.1| PREDICTED: mannan synthase 1-like isoform X1 [Elaeis guineensis]
Length=528

 Score =   271 bits (693),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/203 (64%), Positives = 159/203 (78%), Gaps = 1/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKMFKEI   ERVS++KK H++YAFFFVRKI+AH+VTFFFYC+VIP  +++ 
Sbjct  325  SCGPANLFRKMFKEIAYCERVSIWKKIHVLYAFFFVRKIVAHFVTFFFYCIVIPACVLVQ  384

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            ++ L K +A+Y+PA IT+LN   T RS HLL+ WILFENVMS+HR KA IIGLLEANRAN
Sbjct  385  DIPLPKFVAVYIPAIITVLNCVTTPRSMHLLIFWILFENVMSMHRVKATIIGLLEANRAN  444

Query  420  EWVVTEKLGNAAKQRQAVRAPR-RRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFY  244
            EWVVT+KLGNA KQ+      R ++  +  +RIHL+EI MG F+L C  YD  FG+DLFY
Sbjct  445  EWVVTDKLGNALKQKANTSKSRTKKRFQFGDRIHLMEIFMGSFLLYCGIYDYTFGNDLFY  504

Query  243  IYLVLQALAFFAVGFSFVGTQVP  175
            +YL+ QA AFF  GF +VGT VP
Sbjct  505  VYLLFQASAFFIAGFGYVGTFVP  527



>ref|XP_009385870.1| PREDICTED: mannan synthase 1-like [Musa acuminata subsp. malaccensis]
Length=526

 Score =   271 bits (693),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/203 (64%), Positives = 164/203 (81%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM KEIL  +RVS +KKFH+IY FFFVRKI+AH+VTFFFYCV+IP  +++P
Sbjct  324  SCGPANLFRKMLKEILCCKRVSAWKKFHVIYDFFFVRKIVAHFVTFFFYCVIIPACVLLP  383

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            ++HL K IA+Y+P+  T+LNA CT RSFHL++ WILFENVM++HR KA IIGLLEANR  
Sbjct  384  DVHLPKFIAVYIPSATTVLNAICTPRSFHLIIFWILFENVMAMHRAKATIIGLLEANRVY  443

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EW+VT KLGNA++ + + R+ RR  CR+ ERIHL+E++MG F+L C  YDI+FG DLFY+
Sbjct  444  EWIVTAKLGNASRNKNSSRSHRRSRCRIVERIHLMEVLMGLFLLYCTIYDIMFGRDLFYV  503

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL  Q++AFF VGF +VG  V  
Sbjct  504  YLFAQSMAFFVVGFGYVGVYVSN  526



>gb|ABG34548.1| cellulose synthase-like A2 [Pinus taeda]
Length=534

 Score =   270 bits (691),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 129/203 (64%), Positives = 160/203 (79%), Gaps = 1/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM +EI+ +++VS +KKFH+IY FFFVRKI+AH VTF FYCVVIP  +++P
Sbjct  332  SCGPANLFRKMVREIIANKKVSAWKKFHVIYGFFFVRKIVAHIVTFVFYCVVIPTTVLVP  391

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ L K  A+Y+P+TIT+LNA  T RS HLLV WILFENVMSLHRTKA IIGL EA R N
Sbjct  392  EVQLPKWGAVYIPSTITLLNAVSTPRSLHLLVFWILFENVMSLHRTKATIIGLFEAGRVN  451

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A K + A +  +R   R+ ERIH+LE++ G ++  CASYD+ FG + FYI
Sbjct  452  EWVVTEKLGDALKHKTA-KQMKRSQSRIGERIHVLEVLTGVYLFFCASYDLAFGKNHFYI  510

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL LQA AFF +GF ++GT VPT
Sbjct  511  YLFLQAGAFFIMGFGYIGTFVPT  533



>emb|CAN74410.1| hypothetical protein VITISV_013215 [Vitis vinifera]
Length=529

 Score =   270 bits (689),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 132/202 (65%), Positives = 160/202 (79%), Gaps = 4/202 (2%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYA---FFFVRKIIAHWVTFFFYCVVIPFAI  610
            SCGPANLFRKM KEI+  E   + K F +  +   F+ ++KIIAHWVTFFFYCVVIP ++
Sbjct  325  SCGPANLFRKMTKEIILCEANCVKKSFTMKKSHRTFYLLQKIIAHWVTFFFYCVVIPLSV  384

Query  609  VIPELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEAN  430
            ++PE+ L KPIAIY+PATIT LNA CT RS HL+V WILFENVMSLHRTKAAIIGLLEAN
Sbjct  385  LVPEVALPKPIAIYIPATITFLNAVCTPRSLHLVVFWILFENVMSLHRTKAAIIGLLEAN  444

Query  429  RANEWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDL  250
            R NEWVVTEKLGN  KQ+ A +A ++   R+ ERIHLLE++MG FML CA Y+++F  D 
Sbjct  445  RVNEWVVTEKLGNLMKQKNA-KASKKSRSRVGERIHLLELIMGMFMLHCAIYNLLFREDH  503

Query  249  FYIYLVLQALAFFAVGFSFVGT  184
            F+IYL+LQA AFF +GF +VGT
Sbjct  504  FFIYLILQAGAFFIMGFGYVGT  525



>gb|ABR16486.1| unknown [Picea sitchensis]
Length=385

 Score =   263 bits (672),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 124/203 (61%), Positives = 160/203 (79%), Gaps = 1/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EIL++++V+ +KK H+IYAFFFVRKI+AH VTF FYCVVIP  +++P
Sbjct  183  SCGPANLFRKMVMEILRNKKVTAWKKLHVIYAFFFVRKIVAHIVTFAFYCVVIPATVLVP  242

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ IT+LNA  T +S HLLV WILFENVMSLHRTKA IIGLLEA R N
Sbjct  243  EVQVPKWGAVYIPSIITLLNAVSTPKSLHLLVFWILFENVMSLHRTKATIIGLLEAGRVN  302

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A K +   +  + R+ R+ ER+H+LE++ G ++  CASYD+ FG + FYI
Sbjct  303  EWVVTEKLGDAMKHKSGKQMKKSRS-RIGERLHVLELLAGVYLFFCASYDLAFGKNHFYI  361

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL LQA AFF +GF ++GT +PT
Sbjct  362  YLYLQAAAFFVMGFGYIGTFIPT  384



>gb|ABG34547.1| cellulose synthase-like A1 [Pinus taeda]
Length=530

 Score =   263 bits (673),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 126/203 (62%), Positives = 159/203 (78%), Gaps = 1/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EIL+++RV+ +KKFH+IYAFFFVRKI+AH VTF FYCVVIP  +++P
Sbjct  328  SCGPANLFRKMVMEILRNKRVTPWKKFHVIYAFFFVRKIVAHIVTFTFYCVVIPATVLVP  387

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ IT+LNA  T +S HLLV WILFENVMSLHRTKA  IGLLEA R N
Sbjct  388  EVQVPKWGAVYIPSIITLLNAVSTPKSLHLLVFWILFENVMSLHRTKATFIGLLEAGRVN  447

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A K +   +  + R+ R+ ER+H+LE+  G ++  CASYD+ FG + FYI
Sbjct  448  EWVVTEKLGDAMKHKSGKQIKKSRS-RIGERLHVLELFAGVYLFFCASYDLAFGRNHFYI  506

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL LQA AFF +GF ++GT VPT
Sbjct  507  YLYLQAAAFFVMGFGYIGTFVPT  529



>ref|XP_002530892.1| transferase, transferring glycosyl groups, putative [Ricinus 
communis]
 gb|EEF31498.1| transferase, transferring glycosyl groups, putative [Ricinus 
communis]
Length=425

 Score =   260 bits (664),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 119/203 (59%), Positives = 158/203 (78%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLF+KM  EI ++++VSL+KKF++IY+FFFVRKI+AH VTF FYCVV+P  +++P
Sbjct  222  SCGPANLFKKMAMEICRNKKVSLWKKFYVIYSFFFVRKIVAHIVTFLFYCVVLPATVLVP  281

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  ++Y+P+T+TILNA  T RS HLLV W+LFENVMSLHRTKA +IGLLEA R N
Sbjct  282  EVEVPKWGSVYIPSTVTILNAVGTPRSLHLLVFWVLFENVMSLHRTKATLIGLLEAGRVN  341

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A K +   +APR+   R+ ER+HLLE+ +G ++  C  YD  FG + ++I
Sbjct  342  EWVVTEKLGDALKTKSTAKAPRKPRIRIGERLHLLELGVGAYLFICGCYDFTFGKNRYFI  401

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL LQ++AFF  G  +VGT VP 
Sbjct  402  YLFLQSIAFFISGIGYVGTFVPN  424



>ref|XP_011094427.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Sesamum 
indicum]
Length=532

 Score =   262 bits (670),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 124/203 (61%), Positives = 159/203 (78%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++ +VSL+KK H+IY+FFF+RKI+AH VTF FYCVV+P  +++P
Sbjct  330  SCGPANLFRKMLVEIIRNTKVSLWKKVHVIYSFFFIRKIVAHIVTFVFYCVVLPATVLVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ IT+LNA  T RS HLLV WILFENVMSLHRTKA  IGLLEA R N
Sbjct  390  EVQIPKWGAVYVPSIITLLNAVGTPRSLHLLVFWILFENVMSLHRTKATFIGLLEAGRVN  449

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EW+VTEKLG+A K + A++A RR   RL ERIHLLE+  G ++  C  YDI+FG + ++I
Sbjct  450  EWIVTEKLGDAHKLKSALKAFRRPRFRLGERIHLLELATGGYLFFCGCYDIVFGKNHYFI  509

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL LQA AFF +GF ++GT VP+
Sbjct  510  YLFLQATAFFIMGFGYIGTFVPS  532



>gb|AEZ00898.1| putative beta-14-mannan synthase, partial [Elaeis guineensis]
Length=243

 Score =   253 bits (646),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 120/199 (60%), Positives = 154/199 (77%), Gaps = 0/199 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI K+++VSL+KK H+IY FF VRKI+AH VT  FYC+VIP  +++P
Sbjct  40   SCGPANLFRKMLLEIAKNKKVSLFKKVHVIYNFFLVRKIVAHIVTSVFYCMVIPATVLVP  99

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ IT+LNA  T RS HLLV WILFENVMSLHRTKA  IGLLEA R N
Sbjct  100  EVEIPKWGAVYIPSIITLLNAVGTPRSLHLLVFWILFENVMSLHRTKATFIGLLEAGRVN  159

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A+K + A +A R+   R+ +R+HLLE+ +G ++  C  YD+ FG + ++I
Sbjct  160  EWVVTEKLGDASKTKVAAKAARKPRIRIGDRLHLLELGVGAYLFFCGCYDVAFGKNHYFI  219

Query  240  YLVLQALAFFAVGFSFVGT  184
            YL LQA+AFF VGF +VGT
Sbjct  220  YLFLQAIAFFIVGFGYVGT  238



>ref|XP_009404378.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Musa 
acuminata subsp. malaccensis]
Length=533

 Score =   261 bits (666),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 122/202 (60%), Positives = 157/202 (78%), Gaps = 0/202 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI  +++VSL+KK H+IY+FFFVRK++AH VTF FYCVVIP A+++P
Sbjct  330  SCGPANLFRKMAMEIANNKKVSLWKKVHVIYSFFFVRKVVAHIVTFVFYCVVIPAAVLVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + +  AIY+P+ I +LNA  T RS HLLV WILFENVMSLHRTKA +IGLLEA R N
Sbjct  390  EVEIPRWGAIYIPSIIALLNAVGTPRSLHLLVFWILFENVMSLHRTKATLIGLLEAGRVN  449

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+  K + AV+A R+   R+ +R+HLLE+  G ++  C  YD+ FG + +++
Sbjct  450  EWVVTEKLGDTVKAKMAVKAARKPPIRIGDRLHLLELWTGAYLFFCGCYDVAFGKNHYFL  509

Query  240  YLVLQALAFFAVGFSFVGTQVP  175
            YL LQA+AFF VGF +VGT VP
Sbjct  510  YLFLQAIAFFVVGFGYVGTFVP  531



>ref|XP_009601859.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Nicotiana 
tomentosiformis]
Length=533

 Score =   260 bits (664),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 124/203 (61%), Positives = 158/203 (78%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKMF EI+++++VSL+KK H+IY+FFFVRK+IAH VTF FY VV+P  +++P
Sbjct  330  SCGPANLFRKMFMEIVRNKKVSLWKKVHVIYSFFFVRKVIAHIVTFVFYVVVLPATVLVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+PA IT+LNA  T RS HLLV WILFENVMSLHRTKA  IGLLEA R N
Sbjct  390  EVEVPKWGAVYIPAIITLLNAVGTPRSLHLLVFWILFENVMSLHRTKATFIGLLEAGRVN  449

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EW+VTEKLG+A K + A +A R+   RL +RIHLLE+  G ++  C  YDI FG++ +++
Sbjct  450  EWIVTEKLGDALKLKSAAKAFRKHRMRLGDRIHLLELAAGAYLFFCGCYDIAFGNNHYFL  509

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL +QA AFF VGF +VGT VP 
Sbjct  510  YLFIQAFAFFIVGFGYVGTFVPN  532



>ref|XP_008456578.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
melo]
Length=518

 Score =   259 bits (661),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 119/203 (59%), Positives = 158/203 (78%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLF+KM  EI+++++VSL+KK +LIY+FFFVRKI+AH VTF FYCV++P  +++P
Sbjct  315  SCGPANLFKKMVTEIMRNKKVSLWKKLYLIYSFFFVRKIVAHIVTFVFYCVILPATVLVP  374

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+TIT+LNA  T RSFHL++ WILFENVMSLHRTKA  IGLLEA R N
Sbjct  375  EVSVPKWGAVYIPSTITLLNAVGTPRSFHLIIFWILFENVMSLHRTKATFIGLLEAGRVN  434

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A K +   +APR+   RL ER+H+LE+ +G ++  C  YD+ FG + ++I
Sbjct  435  EWVVTEKLGDALKTKLGSKAPRKPRFRLGERLHILELCVGAYLFFCGWYDLNFGKNQYFI  494

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL LQ+ AFF  G  +VGT VP 
Sbjct  495  YLFLQSFAFFIAGVGYVGTMVPN  517



>ref|XP_004307031.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Fragaria 
vesca subsp. vesca]
Length=483

 Score =   256 bits (655),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/203 (59%), Positives = 158/203 (78%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EIL++++VS  KKFH+IY+FFFVRKI+AH VTF FYCV++P  +++P
Sbjct  280  SCGPANLFRKMIMEILRNKKVSPLKKFHVIYSFFFVRKIVAHIVTFVFYCVILPATVLVP  339

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ +    A+Y+P+TIT+LNA  T RS HLL+ WILFENVMSLHRTKA  IGL EA R +
Sbjct  340  EVQVPIWGAVYIPSTITLLNAVGTPRSLHLLIFWILFENVMSLHRTKATFIGLFEAGRVD  399

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A K + AV+A R+   R+ ER+HLLE+++G ++  C  YD+ +G + F+I
Sbjct  400  EWVVTEKLGDALKTKSAVKAHRKPRVRIGERLHLLELIVGLYLFFCGCYDLAYGKNRFFI  459

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL LQ++AFF  G  +VGT VP+
Sbjct  460  YLFLQSIAFFIAGVGYVGTFVPS  482



>ref|XP_008232025.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Prunus 
mume]
Length=517

 Score =   257 bits (657),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/203 (58%), Positives = 158/203 (78%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++++VS  KKFH+IY+FFFVRKI+AH VTF FYCV++P  +++P
Sbjct  314  SCGPANLFRKMVMEIVRNKKVSPLKKFHVIYSFFFVRKIVAHIVTFVFYCVILPATVLVP  373

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ +    A+Y+P+TIT+LNA  T RS HLL+ WILFENVMSLHRTKA  IGL EA R N
Sbjct  374  EVQVPIWGAVYIPSTITLLNAVGTPRSLHLLIFWILFENVMSLHRTKATFIGLFEAGRVN  433

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A K++   +APR+   R+ ER+H+LE+++GF++  C  YD+ FG + ++I
Sbjct  434  EWVVTEKLGDALKKKLGAKAPRKPRLRIGERLHMLELIVGFYLFFCGCYDLAFGKNGYFI  493

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL +Q++AFF  G  +VGT VP 
Sbjct  494  YLFIQSVAFFIAGVGYVGTFVPN  516



>ref|XP_009771587.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Nicotiana 
sylvestris]
Length=533

 Score =   258 bits (658),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 122/203 (60%), Positives = 157/203 (77%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKMF EI+++++VSL+KK H+IY+FFFVRK++AH VTF FY VV+P  +++P
Sbjct  330  SCGPANLFRKMFMEIVRNKKVSLWKKVHVIYSFFFVRKVVAHIVTFVFYVVVLPATVLVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+PA IT+LNA  T RS HLLV WILFENVMSLHRTKA  IGLLE  R N
Sbjct  390  EVEVPKWGAVYIPAIITLLNAVGTPRSLHLLVFWILFENVMSLHRTKATFIGLLEVGRVN  449

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EW+VTEKLG+A K + A +A R+   RL +RIHLLE+  G ++  C  YDI FG++ +++
Sbjct  450  EWIVTEKLGDALKLKSAAKAFRKHRMRLGDRIHLLELAAGAYLFFCGCYDIAFGNNHYFL  509

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL +QA AFF VGF +VGT VP 
Sbjct  510  YLFIQAFAFFIVGFGYVGTFVPN  532



>ref|XP_007219015.1| hypothetical protein PRUPE_ppa004315mg [Prunus persica]
 gb|EMJ20214.1| hypothetical protein PRUPE_ppa004315mg [Prunus persica]
Length=517

 Score =   257 bits (656),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 117/203 (58%), Positives = 158/203 (78%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++++VS  KKFH+IY+FFFVRKI+AH VTF FYCV++P  +++P
Sbjct  314  SCGPANLFRKMVMEIVRNKKVSPLKKFHVIYSFFFVRKIVAHIVTFVFYCVILPATVLVP  373

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ +    A+Y+P+TIT+LNA  T RS HLL+ WILFENVMSLHRTKA  IGL EA R N
Sbjct  374  EVQVPIWGAVYIPSTITLLNAVGTPRSLHLLIFWILFENVMSLHRTKATFIGLFEAGRVN  433

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A K++   +APR+   R+ ER+H+LE+++GF++  C  YD+ FG + ++I
Sbjct  434  EWVVTEKLGDALKKKLGAKAPRKPRLRIGERLHVLELIVGFYLFFCGCYDLAFGKNGYFI  493

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL +Q++AFF  G  +VGT VP 
Sbjct  494  YLFIQSVAFFIAGVGYVGTFVPN  516



>gb|KDP45030.1| hypothetical protein JCGZ_01530 [Jatropha curcas]
Length=533

 Score =   257 bits (656),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 116/203 (57%), Positives = 158/203 (78%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLF+KM  EI+++++VSL+KK ++IY+FFFVRKI+AH VTF FYCVV+P  +++P
Sbjct  330  SCGPANLFKKMAMEIVRNKKVSLWKKLYVIYSFFFVRKIVAHIVTFLFYCVVLPATVLVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  ++Y+P+TIT+LNA  T RS HLL+ W+LFENVMSLHRTKA  IGL+EA R N
Sbjct  390  EVQVPKWGSVYIPSTITLLNAVGTPRSLHLLIFWVLFENVMSLHRTKATFIGLVEAGRVN  449

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A K + + +AP++   R+ ERIHLLE+ +G ++  C  YD  FG + ++I
Sbjct  450  EWVVTEKLGDALKSKGSAKAPKKPRIRIGERIHLLELGVGAYLFFCGCYDFAFGKNSYFI  509

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL LQ++AFF  G  +VGT VP 
Sbjct  510  YLFLQSIAFFVAGIGYVGTFVPN  532



>ref|XP_008673321.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=443

 Score =   254 bits (650),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 165/214 (77%), Gaps = 14/214 (7%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRK+  EIL+S+RVSL KKFHL+YAFFFVRK++AH VTF FYCVVIP  +++ 
Sbjct  233  SCGPANLFRKVLPEILRSDRVSLGKKFHLLYAFFFVRKVVAHLVTFLFYCVVIPACVLVQ  292

Query  600  -ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRA  424
             ++ L K +A+Y+PA IT+LNAACT RS HLL+ WILFENVMS+HR+KAAIIGLLEA+RA
Sbjct  293  GDVRLPKYVAMYVPALITLLNAACTPRSCHLLIFWILFENVMSMHRSKAAIIGLLEASRA  352

Query  423  NEWVVTEKLGNA---------AKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYD  271
            NEWVVT+KLG++          K++Q VR+   R C  R  +H+LE+ MG  +L CA YD
Sbjct  353  NEWVVTDKLGSSKAAAAVVAKKKKQQLVRS---RCCSTRREMHVLELAMGVCLLYCAVYD  409

Query  270  II-FGHDLFYIYLVLQALAFFAVGFSFVGTQVPT  172
            I+ FG D +Y+YL+LQ+ A F VGF +VGT  P+
Sbjct  410  IVFFGRDHYYMYLLLQSAAAFIVGFGYVGTTTPS  443



>ref|XP_010912225.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X2 [Elaeis guineensis]
Length=500

 Score =   256 bits (654),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 154/199 (77%), Gaps = 0/199 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++++VSL+KK H+IY FFFVRKI+AH VTF FYC+VIP  +++P
Sbjct  297  SCGPANLFRKMLLEIVRNKKVSLFKKVHVIYNFFFVRKIVAHIVTFVFYCLVIPATVLVP  356

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ IT+LNA  T RS HLLV WILFENVMSLHRTKA  IGLLE  R N
Sbjct  357  EVQIPKWGAVYIPSIITLLNAVGTPRSLHLLVFWILFENVMSLHRTKATFIGLLEVGRVN  416

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A K + A +A R+   R+ +R+HLLE+ +G ++  C  YD+ FG + F+I
Sbjct  417  EWVVTEKLGDALKMKMAAKAARKPRIRIGDRLHLLELGVGAYLFFCGCYDVAFGKNHFFI  476

Query  240  YLVLQALAFFAVGFSFVGT  184
            YL LQA AFF VGF +VGT
Sbjct  477  YLFLQATAFFIVGFGYVGT  495



>ref|XP_007220072.1| hypothetical protein PRUPE_ppa024741mg [Prunus persica]
 gb|EMJ21271.1| hypothetical protein PRUPE_ppa024741mg [Prunus persica]
Length=517

 Score =   256 bits (654),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 116/203 (57%), Positives = 158/203 (78%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++++VS  KKFH+IY+FFFVRK++AH VTF FYCV++P  +++P
Sbjct  314  SCGPANLFRKMVMEIVRNKKVSPLKKFHVIYSFFFVRKVVAHIVTFVFYCVILPATVLVP  373

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ +    A+Y+P+TIT+LNA  T RS HLL+ WILFENVMSLHRTKA  IGL EA R N
Sbjct  374  EVQVPIWGAVYIPSTITLLNAVGTPRSLHLLIFWILFENVMSLHRTKATFIGLFEAGRVN  433

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A K++   +APR+   R+ ER+H+LE+++GF++  C  YD+ FG + ++I
Sbjct  434  EWVVTEKLGDALKKKLGAKAPRKPRLRIGERLHVLELIVGFYLFFCGCYDLAFGKNGYFI  493

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL +Q++AFF  G  +VGT VP 
Sbjct  494  YLFIQSVAFFIAGVGYVGTFVPN  516



>ref|XP_010912224.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X1 [Elaeis guineensis]
Length=533

 Score =   256 bits (655),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 154/199 (77%), Gaps = 0/199 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++++VSL+KK H+IY FFFVRKI+AH VTF FYC+VIP  +++P
Sbjct  330  SCGPANLFRKMLLEIVRNKKVSLFKKVHVIYNFFFVRKIVAHIVTFVFYCLVIPATVLVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ IT+LNA  T RS HLLV WILFENVMSLHRTKA  IGLLE  R N
Sbjct  390  EVQIPKWGAVYIPSIITLLNAVGTPRSLHLLVFWILFENVMSLHRTKATFIGLLEVGRVN  449

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A K + A +A R+   R+ +R+HLLE+ +G ++  C  YD+ FG + F+I
Sbjct  450  EWVVTEKLGDALKMKMAAKAARKPRIRIGDRLHLLELGVGAYLFFCGCYDVAFGKNHFFI  509

Query  240  YLVLQALAFFAVGFSFVGT  184
            YL LQA AFF VGF +VGT
Sbjct  510  YLFLQATAFFIVGFGYVGT  528



>ref|XP_007010197.1| Nucleotide-diphospho-sugar transferases superfamily protein [Theobroma 
cacao]
 gb|EOY19007.1| Nucleotide-diphospho-sugar transferases superfamily protein [Theobroma 
cacao]
Length=535

 Score =   256 bits (655),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 119/203 (59%), Positives = 157/203 (77%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++ +VSL+KKF++IY+FFFVRKI+AH VTF FYCVV+P  + +P
Sbjct  332  SCGPANLFRKMAVEIIRNRKVSLWKKFYVIYSFFFVRKIVAHLVTFIFYCVVLPATVFVP  391

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ +T+LNA  T RS HLL+ WILFENVMSLHRTKA  IGLLEA R N
Sbjct  392  EVEVPKWGAVYIPSIVTLLNAVGTPRSLHLLIFWILFENVMSLHRTKATFIGLLEAGRVN  451

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A K +   +APR+   ++ ERIHLLE+ +G ++  C  YD+ FG + ++I
Sbjct  452  EWVVTEKLGDALKTKLGGKAPRKPRIQIGERIHLLELAVGAYLFFCGCYDLAFGKNRYFI  511

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            +L LQ++AFF  G  +VGT VPT
Sbjct  512  FLFLQSIAFFIAGVGYVGTFVPT  534



>ref|XP_007027600.1| Nucleotide-diphospho-sugar transferases superfamily protein isoform 
1 [Theobroma cacao]
 gb|EOY08102.1| Nucleotide-diphospho-sugar transferases superfamily protein isoform 
1 [Theobroma cacao]
Length=533

 Score =   256 bits (654),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/203 (59%), Positives = 154/203 (76%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+ +++VS +KK H+IY+FF VRK++AH VTF FYCVV+P  +++P
Sbjct  330  SCGPANLFRKMVMEIITNKKVSSWKKVHVIYSFFVVRKLVAHIVTFIFYCVVLPATVLVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P  ITILNA  T RS HLLV WILFENVMSLHRTKA  IGLLEA R N
Sbjct  390  EVEVPKWGAVYIPTIITILNAVGTPRSLHLLVFWILFENVMSLHRTKATFIGLLEAGRVN  449

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EW+VTEKLG+A K +   +APR+   R  ER+HLLE+ +G ++  C  YD++FG + ++I
Sbjct  450  EWIVTEKLGDALKAKAGTKAPRKPRFRFGERLHLLELCVGAYLFFCGCYDVVFGKNHYFI  509

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL  QA+AFF +GF +VGT VP 
Sbjct  510  YLFAQAIAFFIMGFGYVGTIVPN  532



>ref|XP_004151323.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
sativus]
 ref|XP_004165881.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
sativus]
Length=483

 Score =   254 bits (650),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/203 (58%), Positives = 157/203 (77%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANL +KM  EI+++++VSL+KK +LIY+FFFVRKI+AH VTF FYCV++P  +++P
Sbjct  280  SCGPANLLKKMVIEIMRNKKVSLWKKLYLIYSFFFVRKIVAHIVTFVFYCVILPATVLVP  339

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+TIT+LNA  T RSFHL++ WILFENVMSLHRTKA  IGLLEA R N
Sbjct  340  EVSVPKWGAVYIPSTITLLNAVGTPRSFHLIIFWILFENVMSLHRTKATFIGLLEAGRVN  399

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A K +   +APR+   R+ ER+H+LE+ +G ++  C  YD+ FG + ++I
Sbjct  400  EWVVTEKLGDALKTKLGSKAPRKPRFRMGERLHMLELCVGGYLFFCGWYDLNFGKNGYFI  459

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL LQ+ AFF  G  +VGT VP 
Sbjct  460  YLFLQSFAFFIAGVGYVGTLVPN  482



>ref|XP_002283672.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Vitis vinifera]
Length=533

 Score =   256 bits (653),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/202 (58%), Positives = 157/202 (78%), Gaps = 0/202 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++++VSL+KK H+IY+FF VRK++AH VTF FYCVV+P  +++P
Sbjct  330  SCGPANLFRKMVMEIVRNKKVSLWKKVHVIYSFFIVRKLVAHIVTFVFYCVVLPATVLVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            ++ + +  A+Y+P  ITILNA  T RS HL+V WILFENVMSLHRTKA  IGLLE  R N
Sbjct  390  DVEVPRWGAVYIPTIITILNAVGTPRSLHLMVFWILFENVMSLHRTKATFIGLLEGGRVN  449

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A K + A +AP++   ++ ER+HLLE+ +G F+  C  YD+ FG + ++I
Sbjct  450  EWVVTEKLGDALKVKAATKAPKKPRFKIGERLHLLELGVGAFLFFCGCYDVAFGRNHYFI  509

Query  240  YLVLQALAFFAVGFSFVGTQVP  175
            YL +QA+AFF VGF +VGT VP
Sbjct  510  YLYVQAIAFFIVGFGYVGTFVP  531



>gb|EYU41550.1| hypothetical protein MIMGU_mgv1a004346mg [Erythranthe guttata]
Length=532

 Score =   255 bits (652),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/203 (58%), Positives = 161/203 (79%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++++V+L+KK H+IY+FFF+RKI+AH VTF FYCVV+P  +++P
Sbjct  330  SCGPANLFRKMVVEIIRNKKVTLWKKVHVIYSFFFIRKIVAHIVTFVFYCVVLPATVLVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+++ K  AIY+P+ ITILNA  T RS HLLV WILFENVMSLHRTKA  IGLLEA R N
Sbjct  390  EVYIPKWGAIYIPSIITILNAVGTPRSLHLLVFWILFENVMSLHRTKATFIGLLEAGRVN  449

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EW+VTEKLG+A K + A++A ++   ++ ER+H LE+  G ++  C  YD++FG + +YI
Sbjct  450  EWIVTEKLGDAFKLKSALKAFKKPRFKIGERVHFLEVATGAYLFFCGCYDVVFGKNHYYI  509

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
             L +QA+AFF +GFS++GT VP+
Sbjct  510  CLYVQAIAFFIMGFSYIGTFVPS  532



>ref|XP_009774056.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Nicotiana 
sylvestris]
Length=526

 Score =   255 bits (651),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/203 (58%), Positives = 157/203 (77%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKMF EI+++ +VSL+KK H+IY+FFFVRK++AH VTF FYC+V+P  +++P
Sbjct  323  SCGPANLFRKMFTEIIRNRKVSLWKKIHVIYSFFFVRKVVAHIVTFVFYCIVLPATVLVP  382

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ IT+LNA  T RSFHL++ WILFENVMSLHRTKA  IGLLEA R N
Sbjct  383  EVEVPKWGAVYIPSIITLLNAVGTPRSFHLIIFWILFENVMSLHRTKATFIGLLEAGRVN  442

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EW+VTEKLG+A K + A++A ++   R  +R+HLLE+  G ++  C  YDI FG + +++
Sbjct  443  EWIVTEKLGDAFKIKSAIKAFKKPRFRFGDRLHLLELATGAYLFFCGCYDIAFGKNHYFL  502

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL +QA AFF +GF  VGT VP 
Sbjct  503  YLFIQAFAFFIIGFGHVGTFVPN  525



>ref|XP_007162846.1| hypothetical protein PHAVU_001G185800g [Phaseolus vulgaris]
 gb|ESW34840.1| hypothetical protein PHAVU_001G185800g [Phaseolus vulgaris]
Length=533

 Score =   254 bits (650),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 118/202 (58%), Positives = 159/202 (79%), Gaps = 0/202 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+ +++VSL+KK H+IY+FFFVRK++AH  TF FYC+V+P  +++P
Sbjct  330  SCGPANLFRKMVLEIINNKKVSLWKKIHVIYSFFFVRKVVAHINTFVFYCIVLPATVLVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ ITILNA  T RS HLLV WILFENVMSLHRTKA IIGLLEA+R N
Sbjct  390  EVVVPKWGAVYIPSVITILNAVGTPRSLHLLVFWILFENVMSLHRTKATIIGLLEASRVN  449

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A K +   +AP++   ++ +RIHLLE+ + F++  C  YD++FG + ++I
Sbjct  450  EWVVTEKLGDALKAKAGGKAPKKPRFKIGDRIHLLELGVAFYLFFCGCYDVMFGKNHYFI  509

Query  240  YLVLQALAFFAVGFSFVGTQVP  175
            +L +QALAFF + F +VGT VP
Sbjct  510  FLFIQALAFFIMAFGYVGTIVP  531



>ref|NP_001183100.1| hypothetical protein [Zea mays]
 gb|ACR35695.1| unknown [Zea mays]
 tpg|DAA57951.1| TPA: hypothetical protein ZEAMMB73_947398 [Zea mays]
Length=537

 Score =   254 bits (650),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 165/214 (77%), Gaps = 14/214 (7%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRK+  EIL+S+RVSL KKFHL+YAFFFVRK++AH VTF FYCVVIP  +++ 
Sbjct  327  SCGPANLFRKVLPEILRSDRVSLGKKFHLLYAFFFVRKVVAHLVTFLFYCVVIPACVLVQ  386

Query  600  -ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRA  424
             ++ L K +A+Y+PA IT+LNAACT RS HLL+ WILFENVMS+HR+KAAIIGLLEA+RA
Sbjct  387  GDVRLPKYVAMYVPALITLLNAACTPRSCHLLIFWILFENVMSMHRSKAAIIGLLEASRA  446

Query  423  NEWVVTEKLGNA---------AKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYD  271
            NEWVVT+KLG++          K++Q VR+   R C  R  +H+LE+ MG  +L CA YD
Sbjct  447  NEWVVTDKLGSSKAAAAVVAKKKKQQLVRS---RCCSTRREMHVLELAMGVCLLYCAVYD  503

Query  270  II-FGHDLFYIYLVLQALAFFAVGFSFVGTQVPT  172
            I+ FG D +Y+YL+LQ+ A F VGF +VGT  P+
Sbjct  504  IVFFGRDHYYMYLLLQSAAAFIVGFGYVGTTTPS  537



>emb|CDO99850.1| unnamed protein product [Coffea canephora]
Length=450

 Score =   252 bits (644),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 118/203 (58%), Positives = 154/203 (76%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI++ ++VS +KKF+LIY+FF VRKI+AH VTF FYCVV+P  IVIP
Sbjct  246  SCGPANLFRKMAMEIVRCKKVSPWKKFYLIYSFFLVRKIVAHMVTFIFYCVVLPATIVIP  305

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ +    A+Y+P+ IT+LNA  T RSFHL++ WILFENVMSLHRTKA  IGLLEA R N
Sbjct  306  EVQVPVWGAVYIPSVITLLNAVGTPRSFHLVIFWILFENVMSLHRTKATFIGLLEAGRVN  365

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EW+VTEKLG+  + +   + P++   R+ +R+HLLE+ +GF++  C  YD+ FG   F+I
Sbjct  366  EWIVTEKLGHVLQTKLGSKVPKKPRFRMGDRLHLLELFVGFYLFFCGCYDVAFGKSHFFI  425

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL LQ+ AFF  GF +VGT VP+
Sbjct  426  YLFLQSTAFFTAGFGYVGTFVPS  448



>ref|XP_002459874.1| hypothetical protein SORBIDRAFT_02g012870 [Sorghum bicolor]
 gb|EER96395.1| hypothetical protein SORBIDRAFT_02g012870 [Sorghum bicolor]
Length=527

 Score =   254 bits (649),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 127/212 (60%), Positives = 162/212 (76%), Gaps = 11/212 (5%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRK+  EIL+S+RVSL KK HL+YAFFFVRK++AH VTF FYCVVIP  +++ 
Sbjct  318  SCGPANLFRKVLPEILRSDRVSLGKKLHLLYAFFFVRKVVAHLVTFLFYCVVIPACVLVQ  377

Query  600  -ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRA  424
             ++ L K +A+Y+PA IT+LNAACT RS HLL+ WILFENVMS+HR+KAA+IGLLEA+RA
Sbjct  378  GDVRLPKYVAMYVPALITLLNAACTPRSCHLLIFWILFENVMSMHRSKAAVIGLLEASRA  437

Query  423  NEWVVTEKLGN-------AAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDII  265
            NEWVVT+KLG+       A K++Q V   R R C  R  +H+LE+ MG  +L CA YDI+
Sbjct  438  NEWVVTDKLGSGKAAPVVARKKKQQVL--RSRCCSTRREMHVLELAMGACLLYCAVYDIV  495

Query  264  -FGHDLFYIYLVLQALAFFAVGFSFVGTQVPT  172
             FG D +Y+YL+LQ+ A F VGF +VG   P+
Sbjct  496  FFGRDHYYMYLLLQSAAAFIVGFGYVGASAPS  527



>ref|XP_010940677.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Elaeis 
guineensis]
Length=533

 Score =   254 bits (649),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 120/199 (60%), Positives = 154/199 (77%), Gaps = 0/199 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI K+++VSL+KK H+IY FF VRKI+AH VT  FYC+VIP  +++P
Sbjct  330  SCGPANLFRKMLLEIAKNKKVSLFKKVHVIYNFFLVRKIVAHIVTSVFYCMVIPATVLVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ IT+LNA  T RS HLLV WILFENVMSLHRTKA  IGLLEA R N
Sbjct  390  EVEIPKWGAVYIPSIITLLNAVGTPRSLHLLVFWILFENVMSLHRTKATFIGLLEAGRVN  449

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A+K + A +A R+   R+ +R+HLLE+ +G ++  C  YD+ FG + ++I
Sbjct  450  EWVVTEKLGDASKTKVAAKAARKPRIRIGDRLHLLELGVGAYLFFCGCYDVAFGKNHYFI  509

Query  240  YLVLQALAFFAVGFSFVGT  184
            YL LQA+AFF VGF +VGT
Sbjct  510  YLFLQAIAFFIVGFGYVGT  528



>ref|XP_003554414.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Glycine 
max]
 gb|KHN02265.1| Glucomannan 4-beta-mannosyltransferase 9 [Glycine soja]
Length=533

 Score =   254 bits (648),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 118/203 (58%), Positives = 158/203 (78%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+ +++VSL+KK H+IY+FFFVRK++AH  TF FYC+V+P  +++P
Sbjct  330  SCGPANLFRKMVMEIINNKKVSLWKKIHVIYSFFFVRKVVAHINTFVFYCIVLPATVLVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ ITILNA  T RS HL+V WILFENVMSLHRTKA IIGLLEA+R N
Sbjct  390  EVVVPKWGAVYIPSIITILNAVGTPRSLHLMVFWILFENVMSLHRTKATIIGLLEASRVN  449

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A K +   +AP++   R+ +RIHLLE+ + F++  C  YDI+FG + F+I
Sbjct  450  EWVVTEKLGDALKTKAGGKAPKKPRFRIGDRIHLLELGVAFYLFFCGCYDIMFGKNHFFI  509

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            +L +Q+LAF  + F +VGT VP 
Sbjct  510  FLFIQSLAFLIMAFGYVGTIVPN  532



>ref|XP_008804385.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Phoenix 
dactylifera]
Length=533

 Score =   254 bits (648),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 118/199 (59%), Positives = 154/199 (77%), Gaps = 0/199 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI ++++VSL+KK H+IY FFFVRKI+AH VTF FYC+VIP  +++P
Sbjct  330  SCGPANLFRKMLLEIARNKKVSLFKKVHVIYNFFFVRKIVAHIVTFVFYCLVIPATVLVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ IT+LNA  T RS HLLV WILFENVMSLHRTKA +IGLLEA R N
Sbjct  390  EVEIPKWGAVYIPSIITLLNAVGTPRSLHLLVFWILFENVMSLHRTKATLIGLLEAGRVN  449

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A K + A ++ R+   R+ +R+HLLE+ +G ++  C  YD+  G + ++I
Sbjct  450  EWVVTEKLGDALKMKMATKSARKPRIRIGDRLHLLELGVGSYLFFCGCYDVALGKNHYFI  509

Query  240  YLVLQALAFFAVGFSFVGT  184
            YL +QA AFF VGF +VGT
Sbjct  510  YLFVQAAAFFIVGFGYVGT  528



>ref|XP_008363207.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X1 [Malus domestica]
Length=425

 Score =   250 bits (639),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 114/203 (56%), Positives = 155/203 (76%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++++VS  KKFH+IY+FFFVRKI+AH VTF FYC+++P  + +P
Sbjct  222  SCGPANLFRKMAMEIVRNKKVSPMKKFHVIYSFFFVRKIVAHVVTFVFYCIILPATVFVP  281

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ +    A+Y+P+TIT+LNA  T RS HLL+ WILFENVMSLHRTKA +IGL EA R N
Sbjct  282  EIQVPIWGAVYIPSTITLLNAVGTPRSLHLLIFWILFENVMSLHRTKATLIGLFEAGRVN  341

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A K +   +A R+   R+ ER+H+LE+++GF++  C  YD+ FG + ++I
Sbjct  342  EWVVTEKLGDALKTKSGAKASRKPRIRIGERLHMLELIVGFYLFFCGCYDLSFGKNGYFI  401

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
             L +Q++AFF  G  +VGT VP 
Sbjct  402  XLFIQSIAFFIAGVGYVGTFVPN  424



>emb|CDP15350.1| unnamed protein product [Coffea canephora]
Length=533

 Score =   253 bits (646),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/203 (57%), Positives = 155/203 (76%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++++V+L+KK H+IY+FF VRKIIAH +TF FYCV++P  +++P
Sbjct  330  SCGPANLFRKMVMEIIRNKKVTLWKKVHVIYSFFLVRKIIAHLITFVFYCVLLPSTVLVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P  IT+LNA  T RS HL+V WILFENVMSLHRTKA  +GLLE++R N
Sbjct  390  EVQVPKWGAVYIPCVITLLNAVGTPRSLHLMVFWILFENVMSLHRTKATFVGLLESSRVN  449

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A K + AV+A R+   R  ER+HLLE+  G ++  C  YD+ FG + +Y+
Sbjct  450  EWVVTEKLGDALKNKSAVKAIRKPRFRFGERLHLLELGTGAYLFFCGCYDVAFGKNHYYL  509

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL  QA+AFF  GF ++GT VP 
Sbjct  510  YLFTQAIAFFIAGFGYIGTFVPN  532



>ref|XP_004494136.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cicer 
arietinum]
Length=533

 Score =   253 bits (646),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/203 (57%), Positives = 160/203 (79%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++++VSL+KK H+IY+FFFVRK+IAH  TF FYC+V+P  +++P
Sbjct  330  SCGPANLFRKMVMEIIRNKKVSLWKKIHVIYSFFFVRKVIAHINTFVFYCIVLPATVLVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ IT+LNA  T RS HLLV WI+FENVMSLHR KA IIGLLEA+R N
Sbjct  390  EVSVPKWGAVYIPSLITLLNAVGTPRSLHLLVFWIMFENVMSLHRAKATIIGLLEASRVN  449

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EW+VTEKLG+A K +   +A ++   ++++RIHLLE+ +G +++ C  YD++FG + FYI
Sbjct  450  EWIVTEKLGDAVKTKVRTKALKKPRFKIQDRIHLLELGVGMYLVICGCYDVMFGKNHFYI  509

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            +L +QA+AFF + F +VGT VP 
Sbjct  510  FLFIQAMAFFIMAFGYVGTFVPN  532



>ref|XP_004959258.1| PREDICTED: mannan synthase 1-like [Setaria italica]
Length=549

 Score =   253 bits (646),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 123/206 (60%), Positives = 160/206 (78%), Gaps = 3/206 (1%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRK+  E+L+ +RVS +KK HL+YAFFFVRK++AH VTF FYCVVIP  +++ 
Sbjct  341  SCGPANLFRKVLPEVLRCDRVSPWKKLHLLYAFFFVRKVVAHLVTFLFYCVVIPACVLVQ  400

Query  600  -ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRA  424
             ++HL + +A+Y+PA IT+LNAACT RS HLLV WILFENVMS+HR+KAA+IGLLEA+RA
Sbjct  401  GDVHLPRYVAMYVPAAITLLNAACTPRSCHLLVFWILFENVMSMHRSKAAVIGLLEASRA  460

Query  423  NEWVVTEKLGNAAKQRQAVRAPRRRTCRLRER-IHLLEIMMGFFMLQCASYDII-FGHDL  250
            NEWVVT+KLG++          RR+   +R R +H+LE++MG  +L CA YDI+ FG D 
Sbjct  461  NEWVVTDKLGSSKAAAAPPAIARRKKQPVRRREVHVLELVMGVCLLYCAIYDIVFFGQDH  520

Query  249  FYIYLVLQALAFFAVGFSFVGTQVPT  172
            FY+YL+LQ+ A F VGF +VG  VP 
Sbjct  521  FYLYLLLQSAAAFIVGFGYVGASVPA  546



>ref|XP_006606290.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X3 [Glycine max]
 ref|XP_006606291.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X4 [Glycine max]
Length=436

 Score =   250 bits (638),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 157/203 (77%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLF+KM  EI+++++VS++KK ++IY+FFFVRKI+AH VTF FYCV++P  +++P
Sbjct  233  SCGPANLFKKMAMEIMRNKKVSMWKKLYVIYSFFFVRKIVAHVVTFVFYCVIMPATVLVP  292

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ IT+LNA  T RS HLLV WILFENVMS+HRTKA + GLLEA R N
Sbjct  293  EVEVPKWGAVYIPSIITLLNAVGTPRSIHLLVFWILFENVMSMHRTKATLTGLLEAGRVN  352

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A K +   +A R+   R+ ER+H LE+++G ++  CA YD+ +G + ++I
Sbjct  353  EWVVTEKLGDALKTKSGGKAARKPRIRIGERLHFLELLVGAYLFFCACYDLKYGKNHYFI  412

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL LQ++AFF  G  +VGT VP 
Sbjct  413  YLFLQSMAFFVAGVGYVGTFVPN  435



>ref|XP_010325940.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X2 [Solanum lycopersicum]
Length=496

 Score =   251 bits (642),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/203 (59%), Positives = 154/203 (76%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++++VSL+KK H+IY+FFFVRK++AH VTF FY VV+P  +++P
Sbjct  293  SCGPANLFRKMCMEIIRNKKVSLWKKVHVIYSFFFVRKVVAHIVTFVFYVVVLPATVLVP  352

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+PA IT+LNA  T RS HLLV WILFENVMSLHRTKA  IGLLEA R N
Sbjct  353  EVEVPKWGAVYIPAIITLLNAVGTPRSLHLLVFWILFENVMSLHRTKATFIGLLEAGRVN  412

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EW+VTEKLG+A K + A +A ++   RL +RIHLLE   G ++  C  YDI FG + +++
Sbjct  413  EWIVTEKLGDALKLKSATKAFKKHRMRLGDRIHLLEFAAGAYLFFCGCYDIAFGTNHYFL  472

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL +QA AF  VGF +VGT VP 
Sbjct  473  YLFIQAFAFLIVGFGYVGTFVPN  495



>ref|XP_009623019.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Nicotiana 
tomentosiformis]
Length=526

 Score =   252 bits (643),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 117/203 (58%), Positives = 156/203 (77%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKMF EI+++ +VSL+KK H+IY+FFFVRK+IAH VTF FYC+V+P  +++P
Sbjct  323  SCGPANLFRKMFTEIIRNRKVSLWKKIHVIYSFFFVRKVIAHIVTFVFYCIVLPATVLVP  382

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ IT+LNA  T RSFHL++ WILFENVMSLHRTKA  IGLLEA R N
Sbjct  383  EVEVPKWGAVYIPSIITLLNAVGTPRSFHLIIFWILFENVMSLHRTKATFIGLLEAGRVN  442

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EW+VTEKLG+A K + A++A ++   R  +R+HLLE+  G ++  C  YDI FG + +++
Sbjct  443  EWIVTEKLGDAFKIKSAMKAFKKPRFRFGDRLHLLELATGAYLFFCGCYDIAFGKNHYFL  502

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL +QA AF  +GF  VGT VP 
Sbjct  503  YLFIQAFAFLIMGFGHVGTFVPN  525



>ref|XP_008363208.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X2 [Malus domestica]
Length=483

 Score =   250 bits (639),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 114/203 (56%), Positives = 155/203 (76%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++++VS  KKFH+IY+FFFVRKI+AH VTF FYC+++P  + +P
Sbjct  280  SCGPANLFRKMAMEIVRNKKVSPMKKFHVIYSFFFVRKIVAHVVTFVFYCIILPATVFVP  339

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ +    A+Y+P+TIT+LNA  T RS HLL+ WILFENVMSLHRTKA +IGL EA R N
Sbjct  340  EIQVPIWGAVYIPSTITLLNAVGTPRSLHLLIFWILFENVMSLHRTKATLIGLFEAGRVN  399

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A K +   +A R+   R+ ER+H+LE+++GF++  C  YD+ FG + ++I
Sbjct  400  EWVVTEKLGDALKTKSGAKASRKPRIRIGERLHMLELIVGFYLFFCGCYDLSFGKNGYFI  459

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
             L +Q++AFF  G  +VGT VP 
Sbjct  460  XLFIQSIAFFIAGVGYVGTFVPN  482



>gb|KDP42759.1| hypothetical protein JCGZ_23699 [Jatropha curcas]
Length=532

 Score =   251 bits (642),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 118/202 (58%), Positives = 157/202 (78%), Gaps = 1/202 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+ +++V+L+KK H+IY+FF VRKI+AH VTF FYCVV+P  +++P
Sbjct  330  SCGPANLFRKMVMEIIINKKVTLWKKVHVIYSFFLVRKIVAHIVTFIFYCVVLPATVLVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ IT+LNA  T RS HLLV WILFENVMSLHRTKA  IGLLEA+R N
Sbjct  390  EVEVPKWGAVYIPSIITLLNAVGTPRSLHLLVFWILFENVMSLHRTKATFIGLLEASRVN  449

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EW+VTEKLG+A K + AV+AP++   +  ER+HLLE+  G ++  C  YD+ FG + +++
Sbjct  450  EWIVTEKLGDAVKSK-AVKAPKKPRFKFGERLHLLELGTGAYLFFCGCYDVAFGKNHYFL  508

Query  240  YLVLQALAFFAVGFSFVGTQVP  175
            YL  QA+AFF +GF +VGT VP
Sbjct  509  YLFAQAIAFFIIGFGYVGTFVP  530



>dbj|BAK03076.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=518

 Score =   251 bits (641),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 119/203 (59%), Positives = 155/203 (76%), Gaps = 1/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+ +++V+++KKFH+IY FF VRKI+AH VTF FYC++IP  I +P
Sbjct  314  SCGPANLFRKMLLEIVTNKKVTIWKKFHVIYNFFLVRKIVAHIVTFTFYCIIIPTTIFVP  373

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+H+ K   +Y+P  IT+LN+  T RSFHLL  WILFENVMSLHRTKA +IGLLEA RAN
Sbjct  374  EVHIPKWGCVYIPTIITLLNSVGTPRSFHLLFFWILFENVMSLHRTKATLIGLLEAGRAN  433

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRT-CRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFY  244
            EWVVTEKLG+A K + A +A  R++  R+ ER+++ E+ +G F+  C  YD+ FG D F+
Sbjct  434  EWVVTEKLGSAMKMKSANKASARKSFMRMWERLNVPELGVGAFLFSCGWYDVAFGKDNFF  493

Query  243  IYLVLQALAFFAVGFSFVGTQVP  175
            IYL  Q++AFF VG  +VGT VP
Sbjct  494  IYLFFQSMAFFVVGVGYVGTIVP  516



>ref|XP_010325939.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X1 [Solanum lycopersicum]
Length=533

 Score =   251 bits (642),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 120/203 (59%), Positives = 154/203 (76%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++++VSL+KK H+IY+FFFVRK++AH VTF FY VV+P  +++P
Sbjct  330  SCGPANLFRKMCMEIIRNKKVSLWKKVHVIYSFFFVRKVVAHIVTFVFYVVVLPATVLVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+PA IT+LNA  T RS HLLV WILFENVMSLHRTKA  IGLLEA R N
Sbjct  390  EVEVPKWGAVYIPAIITLLNAVGTPRSLHLLVFWILFENVMSLHRTKATFIGLLEAGRVN  449

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EW+VTEKLG+A K + A +A ++   RL +RIHLLE   G ++  C  YDI FG + +++
Sbjct  450  EWIVTEKLGDALKLKSATKAFKKHRMRLGDRIHLLEFAAGAYLFFCGCYDIAFGTNHYFL  509

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL +QA AF  VGF +VGT VP 
Sbjct  510  YLFIQAFAFLIVGFGYVGTFVPN  532



>ref|XP_009361452.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Pyrus 
x bretschneideri]
Length=483

 Score =   250 bits (638),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 155/203 (76%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++++VS  KKFH+IY+FFFVRKI+AH VTF FYC+++P  +++P
Sbjct  280  SCGPANLFRKMVMEIVRNKKVSPMKKFHVIYSFFFVRKIVAHIVTFVFYCIILPATVLVP  339

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ +    A+Y+P+ IT+LNA  T RS HL++ WILFENVMSLHRTKA  IGL EA R N
Sbjct  340  EVQVPIWGAVYIPSIITLLNAVGTPRSLHLMIFWILFENVMSLHRTKATFIGLFEAGRVN  399

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A K +   +A RR   R+ ER+H+LE+++GF++  C  YD+ FG + ++I
Sbjct  400  EWVVTEKLGDALKTKSGGKAARRPRSRIGERLHMLELIVGFYLFFCGCYDLAFGKNGYFI  459

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            +L +Q++AFF  G  +VGT VP 
Sbjct  460  FLFIQSIAFFIAGVGYVGTFVPN  482



>ref|XP_009365313.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Pyrus 
x bretschneideri]
Length=534

 Score =   251 bits (642),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 119/204 (58%), Positives = 157/204 (77%), Gaps = 1/204 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++++V+ +KK H+IY+FFFVRKIIAH   F FYC+V+P  +++P
Sbjct  330  SCGPANLFRKMVMEIIRNKKVTCWKKVHVIYSFFFVRKIIAHINAFVFYCIVLPATVLVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K   IY+P+ IT+LNA  T RS HLLV WILFENVMSLHRTKA IIGLLEA+R N
Sbjct  390  EVVVPKWGGIYIPSLITLLNAVGTPRSIHLLVFWILFENVMSLHRTKATIIGLLEASRVN  449

Query  420  EWVVTEKLGNAAKQ-RQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFY  244
            EW+VTEKLG+A K  + A + PR+   R+ ER+HLLE+ +G +++ C  YD IFG + FY
Sbjct  450  EWIVTEKLGDALKTLKVATKLPRKSRFRIGERLHLLELAVGLYLIFCGCYDFIFGKNYFY  509

Query  243  IYLVLQALAFFAVGFSFVGTQVPT  172
            ++L +QA AFF +GF +VGT VP 
Sbjct  510  LFLYIQATAFFIIGFGYVGTFVPN  533



>ref|XP_003521436.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Glycine 
max]
 gb|KHN18723.1| Glucomannan 4-beta-mannosyltransferase 9 [Glycine soja]
Length=533

 Score =   251 bits (642),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 116/203 (57%), Positives = 157/203 (77%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+ +++VSL+KK H+IY+FFFVRK++AH  TF FYC+V+P  +++P
Sbjct  330  SCGPANLFRKMAMEIINNKKVSLWKKIHVIYSFFFVRKVVAHINTFVFYCIVLPATVLVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ ITILNA  T RS HL+V WILFENVMSLHRTKA IIGLLEA+R N
Sbjct  390  EVVVPKWGAVYIPSIITILNAVGTPRSLHLMVFWILFENVMSLHRTKATIIGLLEASRVN  449

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A K +   +AP++   R+ +RIHLLE+ + F++  C  YD++FG + F+I
Sbjct  450  EWVVTEKLGDALKAKAGGKAPKKPRFRIGDRIHLLELGVAFYLFFCGCYDVMFGKNHFFI  509

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            +L +Q+ AF  + F +VGT VP 
Sbjct  510  FLFIQSFAFLIMAFGYVGTIVPN  532



>ref|XP_008241312.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Prunus mume]
Length=534

 Score =   251 bits (642),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 119/204 (58%), Positives = 157/204 (77%), Gaps = 1/204 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++++VSL+KK H+IY+FFFVRKIIAH   F FYC+V+P  +++P
Sbjct  330  SCGPANLFRKMVMEIIRNKKVSLWKKVHVIYSFFFVRKIIAHINAFVFYCIVLPATVLVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K   IY+P+ IT+LNA  T RS HLLV WILFENVMSLHRTKA IIGLLEA+R N
Sbjct  390  EVVVPKWGGIYIPSIITLLNAVGTPRSLHLLVFWILFENVMSLHRTKATIIGLLEASRVN  449

Query  420  EWVVTEKLGNAAKQRQ-AVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFY  244
            EW+VTEKLG+A K    A + PR+   R+ ER+HLLE+ +G ++  C +YD  FG + FY
Sbjct  450  EWIVTEKLGDALKTLTVAAKLPRKPRIRIGERLHLLELAVGCYLFFCGTYDFAFGKNYFY  509

Query  243  IYLVLQALAFFAVGFSFVGTQVPT  172
            ++L +QA+AF+ +GF +VGT VP 
Sbjct  510  LFLYIQAMAFYIIGFGYVGTFVPN  533



>ref|XP_008671633.1| PREDICTED: mannan synthase 1-like [Zea mays]
Length=225

 Score =   242 bits (617),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 124/210 (59%), Positives = 160/210 (76%), Gaps = 14/210 (7%)
 Frame = -1

Query  768  ANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP-ELH  592
            ANLFRK+  EIL+S+RVSL KKFHL+YAFFFVRK++AH VTF FYCVVIP  +++  ++ 
Sbjct  19   ANLFRKVLLEILRSDRVSLGKKFHLLYAFFFVRKVVAHLVTFLFYCVVIPACVLVQGDVR  78

Query  591  LTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRANEWV  412
            L K +A+Y+PA IT+LNAACT RS HLL+ WILFENVMS+HR+KAA+IGLLEA+RANEWV
Sbjct  79   LPKYVAMYVPALITLLNAACTPRSCHLLIFWILFENVMSMHRSKAAVIGLLEASRANEWV  138

Query  411  VTEKLGNA---------AKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDII-F  262
            VT+KLG++          K++Q VR+   R C  R  +H+LE+ MG  +L CA YDI+ F
Sbjct  139  VTDKLGSSKAAAAVVAKKKKQQLVRS---RCCSTRREMHVLELAMGACLLYCAVYDIVFF  195

Query  261  GHDLFYIYLVLQALAFFAVGFSFVGTQVPT  172
            G D +Y+YL+LQ  A F VGF +VGT  P+
Sbjct  196  GRDHYYMYLLLQLAAAFIVGFGYVGTSAPS  225



>ref|XP_006606289.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X2 [Glycine max]
Length=472

 Score =   249 bits (637),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 157/203 (77%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLF+KM  EI+++++VS++KK ++IY+FFFVRKI+AH VTF FYCV++P  +++P
Sbjct  269  SCGPANLFKKMAMEIMRNKKVSMWKKLYVIYSFFFVRKIVAHVVTFVFYCVIMPATVLVP  328

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ IT+LNA  T RS HLLV WILFENVMS+HRTKA + GLLEA R N
Sbjct  329  EVEVPKWGAVYIPSIITLLNAVGTPRSIHLLVFWILFENVMSMHRTKATLTGLLEAGRVN  388

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A K +   +A R+   R+ ER+H LE+++G ++  CA YD+ +G + ++I
Sbjct  389  EWVVTEKLGDALKTKSGGKAARKPRIRIGERLHFLELLVGAYLFFCACYDLKYGKNHYFI  448

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL LQ++AFF  G  +VGT VP 
Sbjct  449  YLFLQSMAFFVAGVGYVGTFVPN  471



>ref|XP_006851749.1| hypothetical protein AMTR_s00040p00223350 [Amborella trichopoda]
 gb|ERN13216.1| hypothetical protein AMTR_s00040p00223350 [Amborella trichopoda]
Length=533

 Score =   251 bits (641),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 119/202 (59%), Positives = 156/202 (77%), Gaps = 0/202 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI +++RVSL+KK H+IY FFFVRKI+AH VTF FYCVVIP  +++P
Sbjct  330  SCGPANLFRKMAMEIFRNKRVSLWKKIHVIYNFFFVRKIVAHIVTFVFYCVVIPATVLVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+TITILNA  + RS HL+V WILFENVMSLHRTKA  IGL EA R N
Sbjct  390  EVEIPKWGAVYIPSTITILNALSSPRSLHLVVFWILFENVMSLHRTKATFIGLAEARRVN  449

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A K +   ++ ++   R+  ++HLLE+ +G ++  CA YD+ FG + ++I
Sbjct  450  EWVVTEKLGDALKGKAGGKSVKKFWIRIGGKLHLLELGVGAYLFFCACYDLAFGKNHYFI  509

Query  240  YLVLQALAFFAVGFSFVGTQVP  175
            YL LQA+AFF +GF ++GT VP
Sbjct  510  YLYLQAMAFFIMGFGYIGTFVP  531



>ref|XP_009353016.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X2 [Pyrus x bretschneideri]
Length=497

 Score =   250 bits (638),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 116/204 (57%), Positives = 156/204 (76%), Gaps = 1/204 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++++V+ +KK H+IY+FFFVRKIIAH   F FYC+V+P  +++P
Sbjct  293  SCGPANLFRKMVMEIVRNKKVTFWKKVHVIYSFFFVRKIIAHINAFVFYCIVLPSTVMVP  352

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K   IY+P+ ITILNA  T RS HLLV WILFENVMSLHRTKA IIGLLEA+R N
Sbjct  353  EVEVPKWGGIYIPSMITILNAVGTPRSIHLLVFWILFENVMSLHRTKATIIGLLEASRVN  412

Query  420  EWVVTEKLGNAAKQ-RQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFY  244
            EW+VTEKLG+A +  + A + PR+   R+ ER+H+LE+ +G ++  C  YD +FG + F+
Sbjct  413  EWIVTEKLGDALRTLKAATKLPRKSRFRIGERLHVLELAVGLYLFFCGCYDFVFGKNYFF  472

Query  243  IYLVLQALAFFAVGFSFVGTQVPT  172
            ++L +QA AFF +GF +VGT VP 
Sbjct  473  MFLYIQATAFFIIGFGYVGTFVPN  496



>ref|XP_007143832.1| hypothetical protein PHAVU_007G105400g [Phaseolus vulgaris]
 gb|ESW15826.1| hypothetical protein PHAVU_007G105400g [Phaseolus vulgaris]
Length=530

 Score =   251 bits (640),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 114/203 (56%), Positives = 157/203 (77%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLF+KM  EI+++++VS +KKF++IY+FFFVRKI+AH VTF FYCVV+P  +++P
Sbjct  327  SCGPANLFKKMAMEIMRNKKVSTWKKFYVIYSFFFVRKIVAHVVTFVFYCVVMPATVLVP  386

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ IT+LNA  T RS HLLV WILFENVMS+HRTKA + GLLEA R N
Sbjct  387  EVEVPKWGAVYIPSIITLLNAVGTPRSIHLLVFWILFENVMSMHRTKATLTGLLEAGRVN  446

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A K +   +A R+   ++ ER+H LE+++G ++  C  YD+ +G + ++I
Sbjct  447  EWVVTEKLGDALKTKSGGKAVRKPRIKIGERLHFLELLVGAYLFFCGCYDLTYGKNHYFI  506

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL LQ++AFF VG  +VGT VP 
Sbjct  507  YLFLQSIAFFVVGVGYVGTFVPN  529



>ref|XP_006339112.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Solanum 
tuberosum]
Length=533

 Score =   251 bits (640),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/203 (57%), Positives = 156/203 (77%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKMF EI+++++VSL+KK H+IY+FFFVRK++AH VTF FYCVV+P  +++P
Sbjct  330  SCGPANLFRKMFMEIIRNKKVSLWKKIHVIYSFFFVRKVVAHIVTFVFYCVVLPATVLVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ ITILNA  T RSFHL++ WILFENVMSLHRTKA  IGLLEA R N
Sbjct  390  EVEVPKWGAVYIPSIITILNAVGTPRSFHLIIFWILFENVMSLHRTKATFIGLLEAGRVN  449

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EW+VTEKLG+  K + A +A ++   R+ +R+ LLE+  G ++  C  YD+ FG + +++
Sbjct  450  EWIVTEKLGDVLKMKSASKAVKKPRFRVGDRLLLLELATGAYLFFCGCYDVAFGKNHYFL  509

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL +QA AFF +GF  +GT VP 
Sbjct  510  YLFIQAFAFFIIGFGHIGTFVPN  532



>ref|XP_003556282.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoformX1 
[Glycine max]
Length=529

 Score =   251 bits (640),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 157/203 (77%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLF+KM  EI+++++VS++KK ++IY+FFFVRKI+AH VTF FYCV++P  +++P
Sbjct  326  SCGPANLFKKMAMEIMRNKKVSMWKKLYVIYSFFFVRKIVAHVVTFVFYCVIMPATVLVP  385

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ IT+LNA  T RS HLLV WILFENVMS+HRTKA + GLLEA R N
Sbjct  386  EVEVPKWGAVYIPSIITLLNAVGTPRSIHLLVFWILFENVMSMHRTKATLTGLLEAGRVN  445

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A K +   +A R+   R+ ER+H LE+++G ++  CA YD+ +G + ++I
Sbjct  446  EWVVTEKLGDALKTKSGGKAARKPRIRIGERLHFLELLVGAYLFFCACYDLKYGKNHYFI  505

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL LQ++AFF  G  +VGT VP 
Sbjct  506  YLFLQSMAFFVAGVGYVGTFVPN  528



>gb|KHN00923.1| Glucomannan 4-beta-mannosyltransferase 9 [Glycine soja]
Length=517

 Score =   250 bits (638),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 157/203 (77%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLF+KM  EI+++++VS++KK ++IY+FFFVRKI+AH VTF FYCV++P  +++P
Sbjct  314  SCGPANLFKKMAMEIMRNKKVSMWKKLYVIYSFFFVRKIVAHVVTFVFYCVIMPATVLVP  373

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ IT+LNA  T RS HLLV WILFENVMS+HRTKA + GLLEA R N
Sbjct  374  EVEVPKWGAVYIPSIITLLNAVGTPRSIHLLVFWILFENVMSMHRTKATLTGLLEAGRVN  433

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A K +   +A R+   R+ ER+H LE+++G ++  CA YD+ +G + ++I
Sbjct  434  EWVVTEKLGDALKTKSGGKAARKPRIRIGERLHFLELLVGAYLFFCACYDLKYGKNHYFI  493

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL LQ++AFF  G  +VGT VP 
Sbjct  494  YLFLQSMAFFVAGVGYVGTFVPN  516



>ref|XP_004249461.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Solanum 
lycopersicum]
Length=533

 Score =   250 bits (639),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/203 (57%), Positives = 155/203 (76%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKMF EI+++++VSL+KK H+IY+FFFVRK++AH VTF FYCVV+P  +++P
Sbjct  330  SCGPANLFRKMFMEIIRNKKVSLWKKIHVIYSFFFVRKVVAHIVTFVFYCVVLPATVLVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ ITILNA  T RS HL++ WILFENVMSLHRTKA  IGLLEA R N
Sbjct  390  EVEVPKWGAVYIPSIITILNAVGTPRSLHLIIFWILFENVMSLHRTKATFIGLLEAGRVN  449

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EW+VTEKLG+  K + A++A ++   R  +R+ LLE+  G ++  C  YD+ FG + +++
Sbjct  450  EWIVTEKLGDVLKMKSAIKAVKKPRFRFGDRLLLLELATGAYLFFCGCYDVAFGKNHYFL  509

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL LQA AFF +GF  +GT VP 
Sbjct  510  YLFLQAFAFFIIGFGHIGTFVPN  532



>ref|XP_009390016.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Musa 
acuminata subsp. malaccensis]
Length=533

 Score =   250 bits (639),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/205 (59%), Positives = 156/205 (76%), Gaps = 3/205 (1%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANL RKM  EI  +++V+L+KK H+IY+FFFVRK++AH VTF FYC+VIP  +++P
Sbjct  330  SCGPANLLRKMLMEIASNKKVNLWKKVHVIYSFFFVRKVVAHIVTFVFYCIVIPATVLVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ IT+LNA  T RS HLLV WILFENVMSLHRTKA  IGLLE  RAN
Sbjct  390  EVEIPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILFENVMSLHRTKATFIGLLEGGRAN  449

Query  420  EWVVTEKLGNAAKQRQAVRAPRR--RTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLF  247
            EW+VTEKLG+  K + A +A ++  RT R+ +R+HLLE+  G F+  C  YD+ FG + +
Sbjct  450  EWIVTEKLGDTMKVKMATKAVKKPPRT-RIGDRLHLLELGTGAFLFFCGCYDVAFGKNHY  508

Query  246  YIYLVLQALAFFAVGFSFVGTQVPT  172
            +IYL LQA+AFF VGF  VGT VP+
Sbjct  509  FIYLFLQAIAFFVVGFGHVGTFVPS  533



>ref|XP_009401015.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009401017.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Musa 
acuminata subsp. malaccensis]
Length=533

 Score =   250 bits (639),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/202 (58%), Positives = 152/202 (75%), Gaps = 0/202 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  +I +++ V+L+ K H+IY+FFFVRKI+AH VTF FYCVVIP  +++P
Sbjct  330  SCGPANLFRKMAMDIARNKNVTLWTKVHVIYSFFFVRKIVAHIVTFVFYCVVIPATVLVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ +     +Y+P+TIT+LNA  T RS HLLV WILFENVMSLHR KA +IGLLEA R N
Sbjct  390  EVEVPNWGLVYIPSTITLLNAVGTPRSLHLLVFWILFENVMSLHRAKATLIGLLEAGRVN  449

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+  K + A +A R+   R+ +R+HLLE+  G ++  C  YD+ FG + +Y+
Sbjct  450  EWVVTEKLGDVMKTKVAAKAARKPRIRIGDRLHLLELFTGAYLFFCGCYDLSFGKNHYYL  509

Query  240  YLVLQALAFFAVGFSFVGTQVP  175
            YL LQA+ FF VGF +VGT VP
Sbjct  510  YLFLQAITFFVVGFGYVGTFVP  531



>emb|CBI30236.3| unnamed protein product [Vitis vinifera]
Length=540

 Score =   250 bits (639),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/199 (58%), Positives = 154/199 (77%), Gaps = 0/199 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++++VSL+KK H+IY+FF VRK++AH VTF FYCVV+P  +++P
Sbjct  330  SCGPANLFRKMVMEIVRNKKVSLWKKVHVIYSFFIVRKLVAHIVTFVFYCVVLPATVLVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            ++ + +  A+Y+P  ITILNA  T RS HL+V WILFENVMSLHRTKA  IGLLE  R N
Sbjct  390  DVEVPRWGAVYIPTIITILNAVGTPRSLHLMVFWILFENVMSLHRTKATFIGLLEGGRVN  449

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A K + A +AP++   ++ ER+HLLE+ +G F+  C  YD+ FG + ++I
Sbjct  450  EWVVTEKLGDALKVKAATKAPKKPRFKIGERLHLLELGVGAFLFFCGCYDVAFGRNHYFI  509

Query  240  YLVLQALAFFAVGFSFVGT  184
            YL +QA+AFF VGF +V T
Sbjct  510  YLYVQAIAFFIVGFGYVAT  528



>ref|XP_002311972.2| 4-mannan synthase family protein [Populus trichocarpa]
 gb|EEE89339.2| 4-mannan synthase family protein [Populus trichocarpa]
Length=530

 Score =   250 bits (638),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/202 (58%), Positives = 155/202 (77%), Gaps = 0/202 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+K+++VSL+KK ++IY+FFFVRKI+AH VTF FYCVV+P  +++P
Sbjct  327  SCGPANLFRKMAIEIVKNKKVSLWKKCYVIYSFFFVRKIVAHIVTFLFYCVVLPATVLVP  386

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ +T+LNA  T RS HL+V WILFENVMSLHRTKA  IGLLEA R N
Sbjct  387  EVTVPKWGAVYIPSVVTLLNAVGTPRSLHLMVFWILFENVMSLHRTKATFIGLLEAGRVN  446

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A K +   +A ++   R+ ER+HLLE+  G ++  C  YD  FG + +YI
Sbjct  447  EWVVTEKLGDALKAKLPAKATKKPRIRIGERLHLLELCAGAYLFFCGCYDFAFGKNRYYI  506

Query  240  YLVLQALAFFAVGFSFVGTQVP  175
            +L LQ++AFF  GF ++GT VP
Sbjct  507  FLFLQSIAFFIAGFGYIGTFVP  528



>ref|XP_008359466.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Malus 
domestica]
Length=534

 Score =   250 bits (638),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/204 (58%), Positives = 156/204 (76%), Gaps = 1/204 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++++V+ +KK H+IY+FFFVRKIIAH   F FYC+V+P  +++P
Sbjct  330  SCGPANLFRKMVMEIIRNKKVTFWKKVHVIYSFFFVRKIIAHINAFVFYCIVLPATVLVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K   IY+P+ IT+LNA  T RS HLLV WILFEN+MSLHRTKA IIGLLEA+R N
Sbjct  390  EVVVPKWGGIYIPSLITLLNAVGTPRSIHLLVFWILFENIMSLHRTKATIIGLLEASRVN  449

Query  420  EWVVTEKLGNAAKQ-RQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFY  244
            EW+VTEKLG+A K  + A + PR+   R+ ER+HLLE+ +G ++  C  YD IFG + FY
Sbjct  450  EWIVTEKLGDALKTLKVATKLPRKPRFRIGERLHLLELAVGLYLFFCGCYDFIFGKNYFY  509

Query  243  IYLVLQALAFFAVGFSFVGTQVPT  172
            ++L +QA AFF +GF +VGT VP 
Sbjct  510  LFLYIQATAFFIIGFGYVGTFVPN  533



>ref|XP_003535494.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X1 [Glycine max]
Length=529

 Score =   249 bits (637),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 156/203 (77%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLF+KM  EI+++++VS++KK ++IY+FFFVRKI+AH VTF FYCV++P  ++ P
Sbjct  326  SCGPANLFKKMAMEIMRNKKVSMWKKLYVIYSFFFVRKIVAHVVTFVFYCVIMPATVLFP  385

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ IT+LNA  T RS HLLV WILFENVMS+HRTKA + GLLEA R N
Sbjct  386  EVEVPKWGAVYIPSIITLLNAVGTPRSIHLLVFWILFENVMSMHRTKATLTGLLEAGRVN  445

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A K +   +A R+   R+ ER+H LE+++G ++  CA YD+ +G + ++I
Sbjct  446  EWVVTEKLGDALKTKSGGKAARKSRIRIGERLHFLELLVGAYLFFCACYDLKYGKNHYFI  505

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL LQ++AFF  G  +VGT VP 
Sbjct  506  YLFLQSMAFFVAGVGYVGTFVPN  528



>ref|XP_009353014.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X1 [Pyrus x bretschneideri]
Length=534

 Score =   249 bits (637),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 116/204 (57%), Positives = 156/204 (76%), Gaps = 1/204 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++++V+ +KK H+IY+FFFVRKIIAH   F FYC+V+P  +++P
Sbjct  330  SCGPANLFRKMVMEIVRNKKVTFWKKVHVIYSFFFVRKIIAHINAFVFYCIVLPSTVMVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K   IY+P+ ITILNA  T RS HLLV WILFENVMSLHRTKA IIGLLEA+R N
Sbjct  390  EVEVPKWGGIYIPSMITILNAVGTPRSIHLLVFWILFENVMSLHRTKATIIGLLEASRVN  449

Query  420  EWVVTEKLGNAAKQ-RQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFY  244
            EW+VTEKLG+A +  + A + PR+   R+ ER+H+LE+ +G ++  C  YD +FG + F+
Sbjct  450  EWIVTEKLGDALRTLKAATKLPRKSRFRIGERLHVLELAVGLYLFFCGCYDFVFGKNYFF  509

Query  243  IYLVLQALAFFAVGFSFVGTQVPT  172
            ++L +QA AFF +GF +VGT VP 
Sbjct  510  MFLYIQATAFFIIGFGYVGTFVPN  533



>ref|XP_006341174.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Solanum 
tuberosum]
Length=533

 Score =   249 bits (637),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/203 (58%), Positives = 154/203 (76%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++++VSL+KK H+IY+FFFVRK++AH VTF FY VV+P  +++P
Sbjct  330  SCGPANLFRKMCMEIIRNKKVSLWKKVHVIYSFFFVRKVVAHIVTFVFYVVVLPATVLVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+PA IT+LNA  T RS HLLV WILFENVMSLHRTKA  IGLLEA R N
Sbjct  390  EVEVPKWGAVYIPAIITLLNAVGTPRSLHLLVFWILFENVMSLHRTKATFIGLLEAGRVN  449

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EW+VTEKLG+A K + A +A ++   RL +RIHLLE   G ++  C  YDI FG + +++
Sbjct  450  EWIVTEKLGDALKLKSATKAFKKHRMRLGDRIHLLEFAAGAYLFFCGCYDIAFGTNHYFL  509

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL +Q+ AF  VGF +VGT +P 
Sbjct  510  YLFIQSFAFLIVGFGYVGTFIPN  532



>gb|KHN37850.1| Glucomannan 4-beta-mannosyltransferase 9 [Glycine soja]
Length=517

 Score =   249 bits (636),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 156/203 (77%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLF+KM  EI+++++VS++KK ++IY+FFFVRKI+AH VTF FYCV++P  ++ P
Sbjct  314  SCGPANLFKKMAMEIMRNKKVSMWKKLYVIYSFFFVRKIVAHVVTFVFYCVIMPATVLFP  373

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ IT+LNA  T RS HLLV WILFENVMS+HRTKA + GLLEA R N
Sbjct  374  EVEVPKWGAVYIPSIITLLNAVGTPRSIHLLVFWILFENVMSMHRTKATLTGLLEAGRVN  433

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A K +   +A R+   R+ ER+H LE+++G ++  CA YD+ +G + ++I
Sbjct  434  EWVVTEKLGDALKTKSGGKAARKSRIRIGERLHFLELLVGAYLFFCACYDLKYGKNHYFI  493

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL LQ++AFF  G  +VGT VP 
Sbjct  494  YLFLQSMAFFVAGVGYVGTFVPN  516



>ref|XP_002315357.1| 4-mannan synthase family protein [Populus trichocarpa]
 gb|EEF01528.1| 4-mannan synthase family protein [Populus trichocarpa]
Length=530

 Score =   249 bits (637),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 116/203 (57%), Positives = 155/203 (76%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLF+KM  EI+K+++VSL+KK ++IY+FFFVRKI+AH VTF FYCVV+P  +++P
Sbjct  327  SCGPANLFKKMAIEIIKNKKVSLWKKCYVIYSFFFVRKIVAHIVTFVFYCVVLPSTVLVP  386

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ +T+LNA  T RS HL+V WILFENVMSLHRTKA  IGLLE  R N
Sbjct  387  EVSVPKWGAVYIPSIVTLLNAVGTPRSLHLMVFWILFENVMSLHRTKATFIGLLEIGRVN  446

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A K +   +A ++   R+RER+HLLE+  G ++  C  YD  FG + +YI
Sbjct  447  EWVVTEKLGDALKGKLPAKATKKPRIRIRERLHLLELCAGAYLFFCGCYDFAFGKNRYYI  506

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            +L LQ++AFF  GF ++GT VP 
Sbjct  507  FLFLQSIAFFIAGFGYIGTFVPN  529



>ref|XP_006589371.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X2 [Glycine max]
Length=502

 Score =   248 bits (634),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 156/203 (77%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLF+KM  EI+++++VS++KK ++IY+FFFVRKI+AH VTF FYCV++P  ++ P
Sbjct  299  SCGPANLFKKMAMEIMRNKKVSMWKKLYVIYSFFFVRKIVAHVVTFVFYCVIMPATVLFP  358

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ IT+LNA  T RS HLLV WILFENVMS+HRTKA + GLLEA R N
Sbjct  359  EVEVPKWGAVYIPSIITLLNAVGTPRSIHLLVFWILFENVMSMHRTKATLTGLLEAGRVN  418

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A K +   +A R+   R+ ER+H LE+++G ++  CA YD+ +G + ++I
Sbjct  419  EWVVTEKLGDALKTKSGGKAARKSRIRIGERLHFLELLVGAYLFFCACYDLKYGKNHYFI  478

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL LQ++AFF  G  +VGT VP 
Sbjct  479  YLFLQSMAFFVAGVGYVGTFVPN  501



>gb|AES60635.2| cellulose synthase-like protein A1 [Medicago truncatula]
Length=523

 Score =   249 bits (635),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 114/203 (56%), Positives = 160/203 (79%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+ +++VSL+KK +++Y+FFFVRKI+AH  TF FYC+V+P  +++P
Sbjct  320  SCGPANLFRKMVMEIVTNKKVSLWKKIYVVYSFFFVRKIVAHINTFVFYCIVLPATVMVP  379

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ IT+LNA  T RSFHLLV WILFEN MSLHRTKA IIGLLEA+R N
Sbjct  380  EVVVPKWGAVYIPSIITLLNAVGTPRSFHLLVFWILFENTMSLHRTKATIIGLLEASRVN  439

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EW+VTEKLG+A K + + +  ++   R+ +RIH+LE+++GF++L C  YD+++G + F+I
Sbjct  440  EWIVTEKLGDAFKGKASGKGLKKLRFRIGDRIHMLELVVGFYLLLCGCYDLMYGKNHFFI  499

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            +L +QA AFF + F +VGT VP 
Sbjct  500  FLYIQAFAFFIMAFGYVGTFVPN  522



>ref|XP_010554515.1| PREDICTED: probable mannan synthase 7 isoform X2 [Tarenaya hassleriana]
Length=453

 Score =   246 bits (629),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 112/202 (55%), Positives = 152/202 (75%), Gaps = 0/202 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            +CGP+NLFRKM  +I++SE VSL KKF++IY+FF VRKI++H +TFFFYC+V+P  ++IP
Sbjct  249  TCGPSNLFRKMAGKIIRSENVSLGKKFYMIYSFFLVRKILSHIITFFFYCIVLPTTVMIP  308

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A YLP+TIT+  A    RSFHLL  W+LFEN MSL RTKA ++GLLE  R N
Sbjct  309  EVEVPKWAAFYLPSTITLFIATGRPRSFHLLAFWVLFENTMSLLRTKALVMGLLETGRVN  368

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+  K +    AP+    R R+R+HLLE+ +G ++L C  YD+ +G++  ++
Sbjct  369  EWVVTEKLGDPLKTKLIAEAPKEPQARFRDRVHLLEVCVGAYLLFCGCYDVAYGNNFLFV  428

Query  240  YLVLQALAFFAVGFSFVGTQVP  175
            YL+LQ++AFF VGF FVGT VP
Sbjct  429  YLLLQSMAFFLVGFGFVGTLVP  450



>ref|XP_009335111.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Pyrus 
x bretschneideri]
 ref|XP_009335114.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Pyrus 
x bretschneideri]
Length=517

 Score =   248 bits (634),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 154/203 (76%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++++VS  KK H+IY+FFFVRKI+AH VTF FYC+++P  +++P
Sbjct  314  SCGPANLFRKMVMEIVRNKKVSPMKKLHVIYSFFFVRKIVAHIVTFVFYCIILPATVLVP  373

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ +    A+Y+P+ IT+LNA  T RS HL++ WILFENVMSLHRTKA  IGL EA R N
Sbjct  374  EVQVPIWGAVYIPSIITLLNAVGTPRSLHLMIFWILFENVMSLHRTKATFIGLFEAGRVN  433

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A K +   +A RR   R+ ER+H+LE+++GF++  C  YD+ FG + ++I
Sbjct  434  EWVVTEKLGDALKTKSGGKAARRPRSRIGERLHMLELIVGFYLFFCGCYDLAFGKNGYFI  493

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            +L +Q++AFF  G  +VGT VP 
Sbjct  494  FLFIQSIAFFIAGVGYVGTFVPN  516



>ref|XP_010554516.1| PREDICTED: probable mannan synthase 7 isoform X3 [Tarenaya hassleriana]
Length=484

 Score =   247 bits (630),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 112/202 (55%), Positives = 152/202 (75%), Gaps = 0/202 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            +CGP+NLFRKM  +I++SE VSL KKF++IY+FF VRKI++H +TFFFYC+V+P  ++IP
Sbjct  280  TCGPSNLFRKMAGKIIRSENVSLGKKFYMIYSFFLVRKILSHIITFFFYCIVLPTTVMIP  339

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A YLP+TIT+  A    RSFHLL  W+LFEN MSL RTKA ++GLLE  R N
Sbjct  340  EVEVPKWAAFYLPSTITLFIATGRPRSFHLLAFWVLFENTMSLLRTKALVMGLLETGRVN  399

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+  K +    AP+    R R+R+HLLE+ +G ++L C  YD+ +G++  ++
Sbjct  400  EWVVTEKLGDPLKTKLIAEAPKEPQARFRDRVHLLEVCVGAYLLFCGCYDVAYGNNFLFV  459

Query  240  YLVLQALAFFAVGFSFVGTQVP  175
            YL+LQ++AFF VGF FVGT VP
Sbjct  460  YLLLQSMAFFLVGFGFVGTLVP  481



>ref|XP_010694523.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Beta 
vulgaris subsp. vulgaris]
Length=526

 Score =   248 bits (633),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/203 (57%), Positives = 155/203 (76%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+K+++VS++KK H+IY+FFFVRKI+AH VTF FYCVV+P  +++P
Sbjct  323  SCGPANLFRKMVNEIIKNKKVSIWKKVHVIYSFFFVRKIVAHVVTFIFYCVVLPTTVLVP  382

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  AIY+P  IT+LNA  T RS HL+V WILFENVMSLHRTKA  IGLLEA R N
Sbjct  383  EVEVPKWGAIYIPMIITLLNAVGTPRSLHLVVFWILFENVMSLHRTKATFIGLLEAGRVN  442

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A K +   ++ ++   R+ ++I++LE+++G ++  C  YDI  G + ++I
Sbjct  443  EWVVTEKLGDALKNKFDTKSFKKPRSRIIDKIYMLELVVGAYLFFCGCYDIALGKNHYFI  502

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL LQ+ AFF  GF +VG  VPT
Sbjct  503  YLFLQSFAFFIAGFGYVGIIVPT  525



>ref|XP_003578707.1| PREDICTED: mannan synthase 1-like [Brachypodium distachyon]
Length=529

 Score =   248 bits (632),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 154/205 (75%), Gaps = 5/205 (2%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANL RKMF+EI+ S +VS +KK HL+Y FFFVRK++AH VTF FYCVVIP  +++ 
Sbjct  325  SCGPANLMRKMFREIVVSRQVSAWKKLHLLYGFFFVRKVVAHLVTFLFYCVVIPACVLVQ  384

Query  600  -ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRA  424
             ++ L K +A+Y+PA IT+LNAACT RS+HLLV WILFENVMS+HR+KA IIGL+EA+RA
Sbjct  385  GDVRLPKYVAMYVPAVITLLNAACTPRSWHLLVFWILFENVMSMHRSKATIIGLMEASRA  444

Query  423  NEWVVTEKLGNAAKQRQAVRAPRRRTCRL----RERIHLLEIMMGFFMLQCASYDIIFGH  256
            NEWVVTEKLG+++    A         +      +  H  EI+MG  ML CA YDIIFGH
Sbjct  445  NEWVVTEKLGSSSTTVTATTTTAAAKGKKKRDQNQSFHAAEILMGLCMLYCAIYDIIFGH  504

Query  255  DLFYIYLVLQALAFFAVGFSFVGTQ  181
            D FY+YL++Q+ A F +GF +VGTQ
Sbjct  505  DHFYVYLLMQSAAAFIIGFGYVGTQ  529



>gb|KCW89263.1| hypothetical protein EUGRSUZ_A01558 [Eucalyptus grandis]
Length=425

 Score =   244 bits (624),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 154/203 (76%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++++V+L+KK H+IY+FF VRKI+AH VTF FYCVV+P  + +P
Sbjct  222  SCGPANLFRKMAMEIIRNKKVTLWKKVHVIYSFFLVRKIVAHIVTFIFYCVVLPATVFVP  281

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ IT+LNA  T RS HL+V WILFENVMS HRTKA  IGLLEA R N
Sbjct  282  EVTVPKWGAVYIPSIITVLNAVGTPRSLHLVVFWILFENVMSFHRTKATFIGLLEAGRVN  341

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EW+VTEKLG+A K + + + P++   R  +R+H+LE+ +G ++  C  YDI FG + +++
Sbjct  342  EWIVTEKLGDALKVKASNKVPKKPKFRFGDRLHVLELGVGAYLFFCGCYDIAFGRNHYFM  401

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL  QA+AFF +GF ++GT VP 
Sbjct  402  YLFAQAIAFFIMGFGYIGTFVPN  424



>gb|AFW66233.1| hypothetical protein ZEAMMB73_021965 [Zea mays]
Length=245

 Score =   239 bits (609),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 151/203 (74%), Gaps = 1/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+ +++V+++KK H+IY FF +RKIIAH +TF FYCV+IP  I +P
Sbjct  41   SCGPANLFRKMLMEIVTNKKVTIWKKIHVIYNFFLIRKIIAHIITFSFYCVIIPATIFVP  100

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K   +Y+P+ IT+LN+  T RSFHLL  W+ FENVMSLHRTKA +IGLLEA RAN
Sbjct  101  EVRIPKWGCVYIPSAITLLNSVGTPRSFHLLFFWVAFENVMSLHRTKATLIGLLEAGRAN  160

Query  420  EWVVTEKLGNAAKQRQAVRAP-RRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFY  244
            EWVVT KLG+A K + A +A  R++  R+ ER+H+ E+ +  F+  C  YD+ +G D F+
Sbjct  161  EWVVTAKLGSAMKMKSANKAGLRKQFMRIWERLHVTELGVAAFLFSCGWYDLAYGRDHFF  220

Query  243  IYLVLQALAFFAVGFSFVGTQVP  175
            IYL  Q++AFF VG  +VGT VP
Sbjct  221  IYLFFQSVAFFIVGVGYVGTIVP  243



>ref|XP_010525611.1| PREDICTED: probable mannan synthase 3 isoform X3 [Tarenaya hassleriana]
Length=396

 Score =   243 bits (621),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/202 (55%), Positives = 147/202 (73%), Gaps = 0/202 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLF+KM  EI++++RVSL+KK +LIY+FFFVRKI+ H  TF FYC+++P ++   
Sbjct  194  SCGPANLFKKMTVEIIENKRVSLWKKLYLIYSFFFVRKIVVHIFTFVFYCLILPTSVFFS  253

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  ++Y+P TIT+LNA  T RS HLLV WILFENVMS+HRTKA +IGLL+A R N
Sbjct  254  EIEIPKWASVYIPTTITLLNAVATPRSLHLLVFWILFENVMSMHRTKATLIGLLDAGRVN  313

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+  K +   + P +R     ERIH  E++ G ++  C  YD  FG   FY+
Sbjct  314  EWVVTEKLGDTLKMKLISKVPTKRRSEFGERIHWRELVAGLYIFLCGCYDFAFGKTFFYV  373

Query  240  YLVLQALAFFAVGFSFVGTQVP  175
            YL LQ++AFF  GF +VGT VP
Sbjct  374  YLFLQSVAFFVAGFGYVGTFVP  395



>gb|AFZ78578.1| cellulose synthase-like protein [Populus tomentosa]
Length=530

 Score =   247 bits (631),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 154/202 (76%), Gaps = 0/202 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+K+++VS++KK ++IY+FFFVRKI+AH VTF FYCVV+P  ++ P
Sbjct  327  SCGPANLFRKMAIEIVKNKKVSVWKKCYVIYSFFFVRKIVAHIVTFLFYCVVLPATVLFP  386

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ +T+LNA  T RS HL+V WILFENVMSLHRTKA  IGLLEA R N
Sbjct  387  EVTVPKWGAVYIPSVVTLLNAVGTPRSLHLMVFWILFENVMSLHRTKATFIGLLEAGRVN  446

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A K +   +A ++   R+ ER+HLLE+  G ++  C  YD  FG + +YI
Sbjct  447  EWVVTEKLGDALKAKLPAKATKKPRIRIGERLHLLELCAGAYLFFCGCYDFAFGKNRYYI  506

Query  240  YLVLQALAFFAVGFSFVGTQVP  175
            +L LQ++AFF  GF ++GT VP
Sbjct  507  FLFLQSIAFFIAGFGYIGTFVP  528



>gb|KGN63048.1| hypothetical protein Csa_2G386160 [Cucumis sativus]
Length=706

 Score =   251 bits (641),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/199 (58%), Positives = 155/199 (78%), Gaps = 0/199 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANL +KM  EI+++++VSL+KK +LIY+FFFVRKI+AH VTF FYCV++P  +++P
Sbjct  280  SCGPANLLKKMVIEIMRNKKVSLWKKLYLIYSFFFVRKIVAHIVTFVFYCVILPATVLVP  339

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+TIT+LNA  T RSFHL++ WILFENVMSLHRTKA  IGLLEA R N
Sbjct  340  EVSVPKWGAVYIPSTITLLNAVGTPRSFHLIIFWILFENVMSLHRTKATFIGLLEAGRVN  399

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A K +   +APR+   R+ ER+H+LE+ +G ++  C  YD+ FG + ++I
Sbjct  400  EWVVTEKLGDALKTKLGSKAPRKPRFRMGERLHMLELCVGGYLFFCGWYDLNFGKNGYFI  459

Query  240  YLVLQALAFFAVGFSFVGT  184
            YL LQ+ AFF  G  +VGT
Sbjct  460  YLFLQSFAFFIAGVGYVGT  478



>gb|KEH24115.1| cellulose synthase-like protein A1 [Medicago truncatula]
Length=531

 Score =   247 bits (631),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/203 (56%), Positives = 157/203 (77%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++++VSL+KK H+IY+FFFVRK+IAH  TF FYC+V+P  +++P
Sbjct  329  SCGPANLFRKMVLEIIRNKKVSLWKKIHVIYSFFFVRKVIAHINTFVFYCIVLPATVLVP  388

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ IT+LNA  T RS HLLV WILFENVMSLHR KA +IGLLEA+R N
Sbjct  389  EVAVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILFENVMSLHRAKATVIGLLEASRVN  448

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EW+VTEKLG+A K +   +A ++   R+ +RIHLLE+ +G ++     YD++FG + F+I
Sbjct  449  EWIVTEKLGDALKAKAGTKALKKPRFRIEDRIHLLELGVGMYLFFIGCYDVMFGKNHFFI  508

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            +L +QA+AFF + F +VGT VP 
Sbjct  509  FLFIQAIAFFIMAFGYVGTFVPN  531



>ref|XP_007203625.1| hypothetical protein PRUPE_ppa004037mg [Prunus persica]
 gb|EMJ04824.1| hypothetical protein PRUPE_ppa004037mg [Prunus persica]
Length=534

 Score =   247 bits (631),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/204 (57%), Positives = 156/204 (76%), Gaps = 1/204 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++++VSL+KK H+IY+FFFVRKIIAH   F FYC+V+P  +++P
Sbjct  330  SCGPANLFRKMVMEIIRNKKVSLWKKIHVIYSFFFVRKIIAHINAFVFYCIVLPATVLVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K   IY+P+ IT+LNA  T RS HLLV WILFENVMSLHRTKA IIGLLEA+R N
Sbjct  390  EVVVPKWGGIYIPSIITLLNAVGTPRSLHLLVFWILFENVMSLHRTKATIIGLLEASRVN  449

Query  420  EWVVTEKLGNAAKQRQ-AVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFY  244
            EW+VTEKLG+A K    A + PR+   R+ ER+HLLE+ +G ++  C +YD  FG +  +
Sbjct  450  EWIVTEKLGDALKTLTVAAKLPRKPRIRIGERLHLLELAVGCYLFFCGTYDFAFGKNYVF  509

Query  243  IYLVLQALAFFAVGFSFVGTQVPT  172
            ++L +QA+AF+ +GF +VGT VP 
Sbjct  510  LFLYIQAMAFYIIGFGYVGTFVPN  533



>ref|XP_009603536.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X2 [Nicotiana tomentosiformis]
Length=494

 Score =   246 bits (627),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/203 (57%), Positives = 150/203 (74%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM KEI  +++VS++KKF+LIY+FFFVRKIIAH VTF  YCVV+P  + +P
Sbjct  291  SCGPANLFRKMAKEIATNKKVSVWKKFYLIYSFFFVRKIIAHVVTFVLYCVVMPATVFVP  350

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  AIY+P+ IT+LN   + RS +L+V WILFENVMSLHRTKA  +GL E+ R N
Sbjct  351  EVQVPKWGAIYIPSAITLLNVLGSTRSMYLVVYWILFENVMSLHRTKATFVGLFESGRVN  410

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EW+VTEKLG+A K +   +A R+   R+ ER+H+LE+ +G  +L C  YD  FG   FY+
Sbjct  411  EWIVTEKLGDALKTKMGSKASRKLRFRVGERVHVLELFVGLHLLFCGWYDFSFGKSRFYV  470

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL LQA AFF VGF ++G  VP 
Sbjct  471  YLFLQAAAFFVVGFGYIGVFVPN  493



>ref|XP_011024272.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Populus 
euphratica]
Length=530

 Score =   247 bits (630),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 115/203 (57%), Positives = 154/203 (76%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLF+KM  EI+K+++VSL+KK ++IY+FFFVRKI+AH VTF FYCVV+P  +++P
Sbjct  327  SCGPANLFKKMAIEIVKNKKVSLWKKCYVIYSFFFVRKIVAHIVTFVFYCVVLPSTVLVP  386

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ +T+LNA  T RS HL+V WILFENVMSLHRTKA  IGLLE  R N
Sbjct  387  EVSVPKWGAVYIPSIVTLLNAVGTPRSLHLMVFWILFENVMSLHRTKATFIGLLEVGRVN  446

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A K +   +A ++   R+ ER+HLLE+  G ++  C  YD  FG + +YI
Sbjct  447  EWVVTEKLGDALKAKLPAKATKKPRIRIGERLHLLELCAGAYLFFCGCYDFAFGKNRYYI  506

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            +L LQ++AFF  GF ++GT VP 
Sbjct  507  FLFLQSIAFFIAGFGYIGTFVPN  529



>ref|XP_009379774.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Musa 
acuminata subsp. malaccensis]
Length=533

 Score =   247 bits (630),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 121/203 (60%), Positives = 155/203 (76%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI  +++V L+KK H+IY+FFFVRK++AH VTF FYC+VIP  +++P
Sbjct  330  SCGPANLFRKMVMEIKNNKKVGLWKKVHVIYSFFFVRKVVAHIVTFVFYCIVIPATVLVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ IT+LNA  T RS HLLV WILFENVMSLHRTKA  IGLLEA R N
Sbjct  390  EVEIPKWGAVYIPSIITLLNAVGTPRSLHLLVFWILFENVMSLHRTKATFIGLLEAGRVN  449

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+  K + A +A R+   R+ +R+HLLE+  G ++  C  YD+ FG+  F+I
Sbjct  450  EWVVTEKLGDTKKPKMAAKAARKLRIRIGDRLHLLELWTGAYLFVCGCYDVAFGNSHFFI  509

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL LQA+AFF VGF +VGT VP+
Sbjct  510  YLFLQAMAFFIVGFGYVGTFVPS  532



>ref|XP_010110184.1| hypothetical protein L484_016805 [Morus notabilis]
 gb|EXC25422.1| hypothetical protein L484_016805 [Morus notabilis]
Length=541

 Score =   247 bits (630),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 114/203 (56%), Positives = 155/203 (76%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLF+KM  EI+++++VS  KKFH++Y+FFFVRKI+AH VTF FYCVV+P  ++ P
Sbjct  338  SCGPANLFKKMAMEIVRNKKVSPLKKFHVLYSFFFVRKIVAHIVTFVFYCVVLPATVLAP  397

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ IT+LNA  T RSFHLL+ WILFENVMSLHRTKA  IGLLEA R N
Sbjct  398  EVEVPKWGAVYIPSVITLLNAVGTPRSFHLLIFWILFENVMSLHRTKATFIGLLEAGRVN  457

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EW+VT+KLG+A K +   ++ ++   R+ ER+HLLE+ +G ++  C  YD+ FG + ++I
Sbjct  458  EWIVTDKLGDALKTKAGAKSFKKPRFRIGERLHLLELTVGAYLFFCGCYDLSFGKNRYFI  517

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL LQ+ AFF  G  +VGT VP+
Sbjct  518  YLFLQSFAFFIAGVGYVGTFVPS  540



>gb|ACR38199.1| unknown [Zea mays]
 gb|AFW66232.1| hypothetical protein ZEAMMB73_021965 [Zea mays]
Length=300

 Score =   239 bits (611),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 151/203 (74%), Gaps = 1/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+ +++V+++KK H+IY FF +RKIIAH +TF FYCV+IP  I +P
Sbjct  96   SCGPANLFRKMLMEIVTNKKVTIWKKIHVIYNFFLIRKIIAHIITFSFYCVIIPATIFVP  155

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K   +Y+P+ IT+LN+  T RSFHLL  W+ FENVMSLHRTKA +IGLLEA RAN
Sbjct  156  EVRIPKWGCVYIPSAITLLNSVGTPRSFHLLFFWVAFENVMSLHRTKATLIGLLEAGRAN  215

Query  420  EWVVTEKLGNAAKQRQAVRAP-RRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFY  244
            EWVVT KLG+A K + A +A  R++  R+ ER+H+ E+ +  F+  C  YD+ +G D F+
Sbjct  216  EWVVTAKLGSAMKMKSANKAGLRKQFMRIWERLHVTELGVAAFLFSCGWYDLAYGRDHFF  275

Query  243  IYLVLQALAFFAVGFSFVGTQVP  175
            IYL  Q++AFF VG  +VGT VP
Sbjct  276  IYLFFQSVAFFIVGVGYVGTIVP  298



>ref|XP_008232088.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Prunus 
mume]
Length=477

 Score =   245 bits (625),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 115/203 (57%), Positives = 155/203 (76%), Gaps = 5/203 (2%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++++VS  KKFH+IY+FFFVRKI+AH VTF FY V++P  +++P
Sbjct  279  SCGPANLFRKMVMEIVRNKKVSPLKKFHVIYSFFFVRKIVAHIVTFVFYSVILPATVLVP  338

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+H+    A+Y+P+TIT+LNA  T RS HLL+ WILFENVMSLHRTKA  IGL EA R N
Sbjct  339  EVHVPMWGAVYIPSTITLLNAVGTPRSLHLLIFWILFENVMSLHRTKATFIGLFEAGRVN  398

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG++ K     + PR+   R+ ER+H+LE+++GF++  C  YD+ F  + ++I
Sbjct  399  EWVVTEKLGDSLK-----KDPRKPRLRIGERLHMLELIVGFYVFFCGCYDLAFVKNGYFI  453

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL +Q++AFF  GF +VGT VP 
Sbjct  454  YLFIQSVAFFIAGFGYVGTFVPN  476



>ref|XP_003571119.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 1 [Brachypodium 
distachyon]
Length=518

 Score =   246 bits (628),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 117/203 (58%), Positives = 153/203 (75%), Gaps = 1/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+ +++V+++KKFH+IY FF VRKI+AH VTF FYC++IP  I +P
Sbjct  314  SCGPANLFRKMLLEIVTNKKVTIWKKFHVIYNFFLVRKIVAHIVTFTFYCIIIPTTIFVP  373

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+H+ K   +Y+P  IT+LN+  T RSFHLL  WILFENVMSLHRTKA +IGLLEA R N
Sbjct  374  EVHIPKWGCVYIPTIITLLNSVGTPRSFHLLFFWILFENVMSLHRTKATLIGLLEAGRVN  433

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRT-CRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFY  244
            EWVVTEKLGNA K + A +A  R++  R+ +R+++ E+ +G F+     YD+ FG D F+
Sbjct  434  EWVVTEKLGNAMKMKSASKASARKSFMRIWDRLNVPELGVGAFLFSIGWYDVAFGKDNFF  493

Query  243  IYLVLQALAFFAVGFSFVGTQVP  175
            IYL  Q++AFF VG  +VGT VP
Sbjct  494  IYLFFQSMAFFIVGVGYVGTIVP  516



>ref|XP_010554514.1| PREDICTED: probable mannan synthase 7 isoform X1 [Tarenaya hassleriana]
Length=565

 Score =   247 bits (631),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 112/202 (55%), Positives = 152/202 (75%), Gaps = 0/202 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            +CGP+NLFRKM  +I++SE VSL KKF++IY+FF VRKI++H +TFFFYC+V+P  ++IP
Sbjct  361  TCGPSNLFRKMAGKIIRSENVSLGKKFYMIYSFFLVRKILSHIITFFFYCIVLPTTVMIP  420

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A YLP+TIT+  A    RSFHLL  W+LFEN MSL RTKA ++GLLE  R N
Sbjct  421  EVEVPKWAAFYLPSTITLFIATGRPRSFHLLAFWVLFENTMSLLRTKALVMGLLETGRVN  480

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+  K +    AP+    R R+R+HLLE+ +G ++L C  YD+ +G++  ++
Sbjct  481  EWVVTEKLGDPLKTKLIAEAPKEPQARFRDRVHLLEVCVGAYLLFCGCYDVAYGNNFLFV  540

Query  240  YLVLQALAFFAVGFSFVGTQVP  175
            YL+LQ++AFF VGF FVGT VP
Sbjct  541  YLLLQSMAFFLVGFGFVGTLVP  562



>gb|KCW48370.1| hypothetical protein EUGRSUZ_K02079 [Eucalyptus grandis]
Length=296

 Score =   239 bits (610),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 112/202 (55%), Positives = 148/202 (73%), Gaps = 0/202 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  +I+K+++VS +KK ++IY+FF VRKI+AH VTF FYC+V+P  ++ P
Sbjct  93   SCGPANLFRKMVFDIIKNKKVSTWKKLYVIYSFFMVRKIVAHIVTFLFYCIVLPATVLTP  152

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  +IY+P+ IT LNA  T RS HL+V WILFENVMSLHRTKA IIGLLE NR N
Sbjct  153  EVAVPKWASIYIPSIITALNALSTPRSLHLMVFWILFENVMSLHRTKATIIGLLEGNRVN  212

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EW+VTEKLG+A K +       R   R  ER H LEI +G ++  C  YD+ FG + +++
Sbjct  213  EWIVTEKLGDALKNKAITSFAERTRLRFTERFHFLEIGVGVYLCFCGCYDVAFGKNHYFL  272

Query  240  YLVLQALAFFAVGFSFVGTQVP  175
            +L +QA+AFF +GF +VG  VP
Sbjct  273  FLYVQAVAFFIMGFGYVGIFVP  294



>emb|CBI40224.3| unnamed protein product [Vitis vinifera]
Length=449

 Score =   244 bits (622),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 151/203 (74%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLF+KM  EI ++++V+L+KK ++IY+FFFVRKI+AH VTF FYCVV P  +  P
Sbjct  246  SCGPANLFKKMAIEIARNKKVNLWKKVYVIYSFFFVRKIVAHIVTFLFYCVVFPATVFFP  305

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ +    A+Y+P+TIT+LNA  T RS HLLV WILFENVMSLHRTKA  +GLLE  R N
Sbjct  306  EVEVPMWGAVYIPSTITLLNAVGTPRSLHLLVFWILFENVMSLHRTKATFMGLLEVGRVN  365

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A K + + +  ++   R+ ER+HLLE+ +G ++  C  YD+ +G + F+I
Sbjct  366  EWVVTEKLGDALKMKSSTKTSKKPRIRIGERMHLLELGVGAYLFFCGCYDVTYGKNGFFI  425

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL  Q++AFF  GF +VGT VP 
Sbjct  426  YLFFQSMAFFIAGFGYVGTFVPN  448



>ref|XP_010112526.1| hypothetical protein L484_012804 [Morus notabilis]
 gb|EXC33914.1| hypothetical protein L484_012804 [Morus notabilis]
Length=574

 Score =   247 bits (631),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 121/203 (60%), Positives = 160/203 (79%), Gaps = 1/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI ++++V+L+KK H+IY+FFFVRKI+AH +TF FYCVV+P  +++P
Sbjct  372  SCGPANLFRKMVMEIARNKKVTLWKKVHVIYSFFFVRKIVAHIITFVFYCVVLPATVLVP  431

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+H+ K  A+Y+P+ IT+LNA  T RS HLLV WILFENVMSLHRTKA IIGLLEA+R N
Sbjct  432  EVHVPKWGAVYIPSIITLLNAVGTPRSLHLLVFWILFENVMSLHRTKATIIGLLEASRVN  491

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A K + A    + R  ++ ER+HLLE+ +G ++  C  YD++FG + F+I
Sbjct  492  EWVVTEKLGDALKGKAAKAPKKPR-FKIGERLHLLELGVGVYLFFCGWYDVLFGKNHFFI  550

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL +QA+AFF +GF +VGT VP 
Sbjct  551  YLFVQAIAFFIMGFGYVGTFVPN  573



>ref|XP_009760346.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Nicotiana 
sylvestris]
Length=530

 Score =   246 bits (628),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 118/205 (58%), Positives = 153/205 (75%), Gaps = 2/205 (1%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI  +++VSL+KK +LIY+FFFVRKI+AH VTF FYCVV+P  ++IP
Sbjct  325  SCGPANLFRKMALEIAANKKVSLWKKCYLIYSFFFVRKIVAHIVTFIFYCVVMPATVLIP  384

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ +    A+Y+P+TIT+LNA  T RS HLLV WILFENVMSLHRT+A  IGL E  R N
Sbjct  385  EVQVPIWGAVYIPSTITLLNAVGTPRSLHLLVFWILFENVMSLHRTRATFIGLFEVGRVN  444

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRER--IHLLEIMMGFFMLQCASYDIIFGHDLF  247
            EW+VTEKLG+A K + + +A ++   R+ ER  +H +EI +G ++L C  YD  FG + F
Sbjct  445  EWIVTEKLGDALKTKMSSKASKKDRFRIGERYKLHFMEIFVGLYLLLCGWYDYSFGKNRF  504

Query  246  YIYLVLQALAFFAVGFSFVGTQVPT  172
            YIYL LQ++AFF  GFS++G  VP 
Sbjct  505  YIYLFLQSMAFFVAGFSYIGVFVPN  529



>ref|XP_002437311.1| hypothetical protein SORBIDRAFT_10g024640 [Sorghum bicolor]
 gb|EER88678.1| hypothetical protein SORBIDRAFT_10g024640 [Sorghum bicolor]
Length=429

 Score =   243 bits (620),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 112/202 (55%), Positives = 154/202 (76%), Gaps = 0/202 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++++V+L+KK H+IY FF VRKIIAH VTF FYC+VIP  +++P
Sbjct  226  SCGPANLFRKMLMEIVRNKKVTLWKKIHVIYNFFLVRKIIAHIVTFVFYCIVIPATVLVP  285

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  ++Y+P  I++LNA  T RS HL+V WILFENVMSLHRTKA  IGLLEA R N
Sbjct  286  EVEIPKWGSVYIPTIISLLNAVGTPRSVHLIVFWILFENVMSLHRTKATFIGLLEAGRVN  345

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A + +   +A ++   ++ +R+H+LE+ +  ++  C  YDI FG++ +YI
Sbjct  346  EWVVTEKLGDALRMKMPAKACKKPRIKIGDRLHILELGVAAYLFFCGCYDIAFGNNHYYI  405

Query  240  YLVLQALAFFAVGFSFVGTQVP  175
            +L LQ++AFF VG  +VGT VP
Sbjct  406  FLFLQSIAFFIVGIGYVGTFVP  427



>ref|XP_009603535.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X1 [Nicotiana tomentosiformis]
Length=531

 Score =   246 bits (627),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 116/203 (57%), Positives = 150/203 (74%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM KEI  +++VS++KKF+LIY+FFFVRKIIAH VTF  YCVV+P  + +P
Sbjct  328  SCGPANLFRKMAKEIATNKKVSVWKKFYLIYSFFFVRKIIAHVVTFVLYCVVMPATVFVP  387

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  AIY+P+ IT+LN   + RS +L+V WILFENVMSLHRTKA  +GL E+ R N
Sbjct  388  EVQVPKWGAIYIPSAITLLNVLGSTRSMYLVVYWILFENVMSLHRTKATFVGLFESGRVN  447

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EW+VTEKLG+A K +   +A R+   R+ ER+H+LE+ +G  +L C  YD  FG   FY+
Sbjct  448  EWIVTEKLGDALKTKMGSKASRKLRFRVGERVHVLELFVGLHLLFCGWYDFSFGKSRFYV  507

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL LQA AFF VGF ++G  VP 
Sbjct  508  YLFLQAAAFFVVGFGYIGVFVPN  530



>gb|KEH43412.1| cellulose synthase-like protein A1 [Medicago truncatula]
Length=530

 Score =   245 bits (626),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/202 (56%), Positives = 153/202 (76%), Gaps = 0/202 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++++V++ KKF++IY+FFFVRKIIAH VTF FYCV++P  +++P
Sbjct  327  SCGPANLFRKMAMEIIRNKKVTMLKKFYVIYSFFFVRKIIAHVVTFTFYCVILPATVLVP  386

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P  IT+LNA  T RSFHL+++WILFENVMS+HRTKA +IGL EA R N
Sbjct  387  EVEVPKWGAVYIPCIITLLNAVGTPRSFHLVILWILFENVMSMHRTKATLIGLFEAGRVN  446

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A K +   +A R+    +  RIH LE+ +G ++  C  YD+ FG +  YI
Sbjct  447  EWVVTEKLGDALKIKSGGKAARKPRITIDGRIHFLELGVGAYLFLCGCYDLAFGKNQCYI  506

Query  240  YLVLQALAFFAVGFSFVGTQVP  175
            YL LQ++AFF VG  +VG  VP
Sbjct  507  YLFLQSIAFFVVGVGYVGIYVP  528



>ref|XP_006360487.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Solanum 
tuberosum]
Length=530

 Score =   245 bits (626),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/203 (58%), Positives = 151/203 (74%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI  +++VS++KKF+LIY+FFFVRKIIAH VTF  YCVVIP  I IP
Sbjct  327  SCGPANLFRKMAMEIATNKKVSVWKKFYLIYSFFFVRKIIAHVVTFILYCVVIPATIFIP  386

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + +   IY+P  IT+LN   + RS  L+V WILFENVMSLHRTKA  IGL E+ R N
Sbjct  387  EVQVPRWGTIYIPTAITLLNILGSARSMQLVVYWILFENVMSLHRTKATFIGLFESGRVN  446

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EW+VTEKLG+A K ++  +A ++   R+ ER+H+LE+ +G ++L C  YD  FG + FY+
Sbjct  447  EWIVTEKLGDALKTKKGSKALKKLQFRVGERVHVLELFVGLYLLFCGWYDYSFGRNRFYV  506

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL+LQA+AFF VGF +VG  VP 
Sbjct  507  YLLLQAMAFFVVGFGYVGVFVPN  529



>ref|XP_011010407.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X2 [Populus euphratica]
Length=530

 Score =   245 bits (626),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/202 (56%), Positives = 153/202 (76%), Gaps = 0/202 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+K+++VS++KK ++IY+FFFVRKI+AH VTF FYCVV+P  +++P
Sbjct  327  SCGPANLFRKMAIEIVKNKKVSVWKKCYVIYSFFFVRKIVAHIVTFLFYCVVLPATVLVP  386

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ +T+LNA  T RS HL+V WILFENVMSLHRTKA  IGLLE  R N
Sbjct  387  EVTVPKWGAVYIPSVVTLLNAVGTPRSLHLMVFWILFENVMSLHRTKATFIGLLEGGRVN  446

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEK+G+A K +   +A ++   R+ ER+HLLE   G ++  C  YD  FG + +YI
Sbjct  447  EWVVTEKIGDALKAKLPAKATKKPRIRIGERLHLLEFCAGAYLFFCGCYDFAFGKNRYYI  506

Query  240  YLVLQALAFFAVGFSFVGTQVP  175
            +L LQ++AFF  GF ++GT VP
Sbjct  507  FLFLQSIAFFIAGFGYIGTFVP  528



>gb|AFW73370.1| hypothetical protein ZEAMMB73_956340 [Zea mays]
Length=295

 Score =   238 bits (608),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/202 (55%), Positives = 152/202 (75%), Gaps = 3/202 (1%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRK   EI+++++V+L+KK H+IY FF VRKI+AH VTF FYC+VIP  +++P
Sbjct  96   SCGPANLFRKTLVEIVRNKKVTLWKKIHVIYNFFLVRKIVAHAVTFVFYCIVIPTTVLVP  155

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  ++Y+P  IT+L+A  T RS HL+V W LFENVMSLHRTKA  IGLLEA R N
Sbjct  156  EVQVPKWGSVYIPTVITLLSAVATPRSAHLVVFWTLFENVMSLHRTKATFIGLLEAGRVN  215

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A + +   + PR    R+ +R+H+LE+ +  ++L C  YDI FG++ +YI
Sbjct  216  EWVVTEKLGDALRTKVPGKKPR---MRIGDRLHVLELGVAAYLLFCGCYDIAFGNNRYYI  272

Query  240  YLVLQALAFFAVGFSFVGTQVP  175
            +L LQ++AFF VG  +VGT VP
Sbjct  273  FLFLQSIAFFIVGIGYVGTFVP  294



>ref|XP_010243535.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Nelumbo 
nucifera]
Length=533

 Score =   245 bits (626),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/203 (59%), Positives = 160/203 (79%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  E++++++V+L+KKFH+IY+FFFVRKI+AH VTF FYCVV+P  +++P
Sbjct  330  SCGPANLFRKMVMEVVRNKKVTLWKKFHVIYSFFFVRKIVAHIVTFVFYCVVMPLTVLVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  ++Y+P+ ITILN+  T RS HLLV WILFENVMSLHRTKA  IGLLEA R N
Sbjct  390  EVEVPKWGSVYIPSIITILNSVGTLRSLHLLVFWILFENVMSLHRTKATFIGLLEAGRVN  449

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A K + A +A ++   R+ ER+HLLE+ +G F+   A YD+ +G + +++
Sbjct  450  EWVVTEKLGDALKVKAASKAAKKPRVRIGERLHLLELGVGMFLFFIACYDLAYGKNHYFL  509

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL LQ+LAFF VGF +VGT VP 
Sbjct  510  YLYLQSLAFFIVGFGYVGTFVPN  532



>ref|XP_009603325.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Nicotiana 
tomentosiformis]
Length=530

 Score =   245 bits (625),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/205 (58%), Positives = 153/205 (75%), Gaps = 2/205 (1%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI  +++VS++KK +LIY+FFFVRKI+AH VTF FYCVV+P  I+IP
Sbjct  325  SCGPANLFRKMALEIAANKKVSMWKKCYLIYSFFFVRKIVAHIVTFVFYCVVMPATILIP  384

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ +    A+Y+P+TIT+LNA  T RS HLLV WILFENVMSLHRT+A  IGL EA R N
Sbjct  385  EVQVPIWGAVYIPSTITLLNAVGTPRSLHLLVFWILFENVMSLHRTRATFIGLFEAGRVN  444

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRER--IHLLEIMMGFFMLQCASYDIIFGHDLF  247
            EWVVTEKLG+A K + + +A ++   R+ ER  +H +EI +G ++L C  YD  FG + F
Sbjct  445  EWVVTEKLGDALKTKMSSKASKKDRFRIGERYKLHFMEIFVGLYLLFCGWYDYSFGKNRF  504

Query  246  YIYLVLQALAFFAVGFSFVGTQVPT  172
            YIYL LQ++AFF  GF ++G  VP 
Sbjct  505  YIYLFLQSMAFFVGGFGYIGVFVPN  529



>ref|XP_009793132.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X3 [Nicotiana sylvestris]
Length=494

 Score =   244 bits (623),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/203 (57%), Positives = 150/203 (74%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM KEI  +++VS++KKF+LIY+FFFVRKIIAH VTF  YCVV+P  + +P
Sbjct  291  SCGPANLFRKMAKEIATNKKVSVWKKFYLIYSFFFVRKIIAHIVTFVLYCVVMPATVFVP  350

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  AIY+P+ ITILN   + RS +L+V WILFENVMSLHRTKA  +GL E+ R N
Sbjct  351  EVQVPKWGAIYIPSAITILNVLGSPRSMYLVVYWILFENVMSLHRTKATFVGLFESGRVN  410

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EW+VTEKLG+A K + + +  R+   R+ ER+HLLE+ +G ++  C  YD  FG   F++
Sbjct  411  EWIVTEKLGDALKTKVSSKTSRKLRFRVGERVHLLELFVGLYLWFCGWYDFSFGKSRFHV  470

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL LQA AFF VGF +VG  VP 
Sbjct  471  YLFLQAAAFFVVGFGYVGVFVPN  493



>ref|XP_010050059.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Eucalyptus 
grandis]
 gb|KCW89262.1| hypothetical protein EUGRSUZ_A01558 [Eucalyptus grandis]
Length=533

 Score =   245 bits (625),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 154/203 (76%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++++V+L+KK H+IY+FF VRKI+AH VTF FYCVV+P  + +P
Sbjct  330  SCGPANLFRKMAMEIIRNKKVTLWKKVHVIYSFFLVRKIVAHIVTFIFYCVVLPATVFVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ IT+LNA  T RS HL+V WILFENVMS HRTKA  IGLLEA R N
Sbjct  390  EVTVPKWGAVYIPSIITVLNAVGTPRSLHLVVFWILFENVMSFHRTKATFIGLLEAGRVN  449

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EW+VTEKLG+A K + + + P++   R  +R+H+LE+ +G ++  C  YDI FG + +++
Sbjct  450  EWIVTEKLGDALKVKASNKVPKKPKFRFGDRLHVLELGVGAYLFFCGCYDIAFGRNHYFM  509

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL  QA+AFF +GF ++GT VP 
Sbjct  510  YLFAQAIAFFIMGFGYIGTFVPN  532



>gb|KHG19821.1| Glucomannan 4-beta-mannosyltransferase 9 -like protein [Gossypium 
arboreum]
Length=529

 Score =   244 bits (624),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 121/203 (60%), Positives = 158/203 (78%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+K+++VS +KK H+IY+FF VRK++AH VTF FYCVV+P  +++P
Sbjct  326  SCGPANLFRKMVMEIIKNKKVSTWKKVHVIYSFFVVRKLVAHIVTFIFYCVVLPATVLVP  385

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ ITILNA  T RSFHLLV WILFENVMSLHRTKA  IGLLEA R N
Sbjct  386  EVEVPKWGAVYIPSIITILNAVGTPRSFHLLVFWILFENVMSLHRTKATFIGLLEAGRVN  445

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EW+VTEKLG+A K + A +APR+   R  ER+H+LE+ +G ++  C  YD++FG + ++I
Sbjct  446  EWIVTEKLGDAFKSKAAAKAPRKPRFRFGERLHVLELCVGAYLFFCGCYDVVFGKNHYFI  505

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL  QA+AFF +GF +VGT VP 
Sbjct  506  YLFAQAIAFFIMGFGYVGTIVPN  528



>ref|XP_010521855.1| PREDICTED: probable mannan synthase 3 [Tarenaya hassleriana]
Length=564

 Score =   245 bits (626),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/204 (56%), Positives = 151/204 (74%), Gaps = 1/204 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLF+KM  EI++++RVSL+KK +LIY+FFFVRKII H  TFFFYCV++P +++ P
Sbjct  361  SCGPANLFKKMTVEIIENKRVSLWKKLYLIYSFFFVRKIIVHTFTFFFYCVILPTSVLFP  420

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K   +Y+PATIT+LNAA T RS HLLV WILFENVM++HRTKA  IGL +A R N
Sbjct  421  EIEVPKWATVYVPATITLLNAAATPRSLHLLVCWILFENVMAMHRTKATFIGLFDAGRVN  480

Query  420  EWVVTEKLGNAAKQRQAVRA-PRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFY  244
            EWVVTEKLG+  K +    A P +R  R  ER++  E++ G ++  C  YD+ FG   FY
Sbjct  481  EWVVTEKLGDTLKAKLICDASPTKRRSRFGERMNWRELVAGLYIFLCGCYDVAFGKTYFY  540

Query  243  IYLVLQALAFFAVGFSFVGTQVPT  172
            +YL LQ++AFF  G  +VGT VP+
Sbjct  541  VYLFLQSIAFFVAGVGYVGTIVPS  564



>ref|XP_004250002.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Solanum 
lycopersicum]
Length=529

 Score =   244 bits (623),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 150/198 (76%), Gaps = 0/198 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI  +++VS++KKF+LIY+FFFVRKIIAH VTF  YCVVIP  I IP
Sbjct  327  SCGPANLFRKMAMEIATNKKVSVWKKFYLIYSFFFVRKIIAHVVTFILYCVVIPATIFIP  386

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + +   IY+P  IT+LN   + RS  L+V WILFENVMSLHRTKA +IGL E+ R N
Sbjct  387  EVQVPRWGTIYIPTAITVLNILGSARSMQLVVYWILFENVMSLHRTKAMLIGLFESERVN  446

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EW+VTEKLG+A K ++  +A +R   R+ ER+H+LE+ +G ++L C  YD  FG + FY+
Sbjct  447  EWIVTEKLGDALKTKKGSKALKRLQFRVGERVHVLELFVGLYLLFCGWYDYSFGRNKFYV  506

Query  240  YLVLQALAFFAVGFSFVG  187
            YL+LQA+AFF VGF +VG
Sbjct  507  YLLLQAMAFFVVGFGYVG  524



>ref|XP_002269110.2| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Vitis vinifera]
 emb|CAN62185.1| hypothetical protein VITISV_019367 [Vitis vinifera]
Length=529

 Score =   244 bits (622),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 151/203 (74%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLF+KM  EI ++++V+L+KK ++IY+FFFVRKI+AH VTF FYCVV P  +  P
Sbjct  326  SCGPANLFKKMAIEIARNKKVNLWKKVYVIYSFFFVRKIVAHIVTFLFYCVVFPATVFFP  385

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ +    A+Y+P+TIT+LNA  T RS HLLV WILFENVMSLHRTKA  +GLLE  R N
Sbjct  386  EVEVPMWGAVYIPSTITLLNAVGTPRSLHLLVFWILFENVMSLHRTKATFMGLLEVGRVN  445

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A K + + +  ++   R+ ER+HLLE+ +G ++  C  YD+ +G + F+I
Sbjct  446  EWVVTEKLGDALKMKSSTKTSKKPRIRIGERMHLLELGVGAYLFFCGCYDVTYGKNGFFI  505

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL  Q++AFF  GF +VGT VP 
Sbjct  506  YLFFQSMAFFIAGFGYVGTFVPN  528



>ref|XP_010525610.1| PREDICTED: probable mannan synthase 3 isoform X2 [Tarenaya hassleriana]
Length=532

 Score =   244 bits (622),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 112/202 (55%), Positives = 147/202 (73%), Gaps = 0/202 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLF+KM  EI++++RVSL+KK +LIY+FFFVRKI+ H  TF FYC+++P ++   
Sbjct  330  SCGPANLFKKMTVEIIENKRVSLWKKLYLIYSFFFVRKIVVHIFTFVFYCLILPTSVFFS  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  ++Y+P TIT+LNA  T RS HLLV WILFENVMS+HRTKA +IGLL+A R N
Sbjct  390  EIEIPKWASVYIPTTITLLNAVATPRSLHLLVFWILFENVMSMHRTKATLIGLLDAGRVN  449

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+  K +   + P +R     ERIH  E++ G ++  C  YD  FG   FY+
Sbjct  450  EWVVTEKLGDTLKMKLISKVPTKRRSEFGERIHWRELVAGLYIFLCGCYDFAFGKTFFYV  509

Query  240  YLVLQALAFFAVGFSFVGTQVP  175
            YL LQ++AFF  GF +VGT VP
Sbjct  510  YLFLQSVAFFVAGFGYVGTFVP  531



>ref|XP_009793131.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X2 [Nicotiana sylvestris]
Length=531

 Score =   244 bits (622),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 116/203 (57%), Positives = 150/203 (74%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM KEI  +++VS++KKF+LIY+FFFVRKIIAH VTF  YCVV+P  + +P
Sbjct  328  SCGPANLFRKMAKEIATNKKVSVWKKFYLIYSFFFVRKIIAHIVTFVLYCVVMPATVFVP  387

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  AIY+P+ ITILN   + RS +L+V WILFENVMSLHRTKA  +GL E+ R N
Sbjct  388  EVQVPKWGAIYIPSAITILNVLGSPRSMYLVVYWILFENVMSLHRTKATFVGLFESGRVN  447

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EW+VTEKLG+A K + + +  R+   R+ ER+HLLE+ +G ++  C  YD  FG   F++
Sbjct  448  EWIVTEKLGDALKTKVSSKTSRKLRFRVGERVHLLELFVGLYLWFCGWYDFSFGKSRFHV  507

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL LQA AFF VGF +VG  VP 
Sbjct  508  YLFLQAAAFFVVGFGYVGVFVPN  530



>ref|XP_010525608.1| PREDICTED: probable mannan synthase 3 isoform X1 [Tarenaya hassleriana]
 ref|XP_010525609.1| PREDICTED: probable mannan synthase 3 isoform X1 [Tarenaya hassleriana]
Length=546

 Score =   244 bits (623),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 112/202 (55%), Positives = 147/202 (73%), Gaps = 0/202 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLF+KM  EI++++RVSL+KK +LIY+FFFVRKI+ H  TF FYC+++P ++   
Sbjct  344  SCGPANLFKKMTVEIIENKRVSLWKKLYLIYSFFFVRKIVVHIFTFVFYCLILPTSVFFS  403

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  ++Y+P TIT+LNA  T RS HLLV WILFENVMS+HRTKA +IGLL+A R N
Sbjct  404  EIEIPKWASVYIPTTITLLNAVATPRSLHLLVFWILFENVMSMHRTKATLIGLLDAGRVN  463

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+  K +   + P +R     ERIH  E++ G ++  C  YD  FG   FY+
Sbjct  464  EWVVTEKLGDTLKMKLISKVPTKRRSEFGERIHWRELVAGLYIFLCGCYDFAFGKTFFYV  523

Query  240  YLVLQALAFFAVGFSFVGTQVP  175
            YL LQ++AFF  GF +VGT VP
Sbjct  524  YLFLQSVAFFVAGFGYVGTFVP  545



>ref|XP_010543471.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Tarenaya 
hassleriana]
Length=533

 Score =   244 bits (622),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 151/202 (75%), Gaps = 0/202 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLF KM  EI+ ++ VSL+KK H+IY+FF VRKI+AH VTF FYCVV+P  +++P
Sbjct  330  SCGPANLFMKMILEIITNKNVSLWKKCHVIYSFFVVRKIVAHIVTFVFYCVVLPATVMVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ IT+LNA  T RS HL+V WILFENVMSLHRTKA  IGL+ A R N
Sbjct  390  EVTVPKWGAVYIPSIITLLNAVGTPRSLHLMVFWILFENVMSLHRTKATFIGLIGAGRVN  449

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EW+VTEKLG+A K + A +APR+   R  ER+H+LE+ +G ++L    YD+ FG + +Y+
Sbjct  450  EWIVTEKLGDAIKAKSASKAPRKPRFRFGERMHVLELGVGMYLLLVGVYDLSFGKNHYYL  509

Query  240  YLVLQALAFFAVGFSFVGTQVP  175
            YL  QA AFF +GF  VGT VP
Sbjct  510  YLFAQAFAFFVMGFGQVGTFVP  531



>ref|XP_004496174.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cicer 
arietinum]
Length=529

 Score =   243 bits (621),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 153/203 (75%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI++++RVS++KKF++IY+FFFVRKIIAH VTF FYCV++P  +++P
Sbjct  326  SCGPANLFRKMAMEIIRNKRVSMWKKFYVIYSFFFVRKIIAHVVTFTFYCVILPATVLVP  385

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P  IT+LNA  T RS HLL++WILFENVMS+HRTKA +IGLLE  R N
Sbjct  386  EVEVPKWGAVYIPCIITLLNAVGTPRSLHLLILWILFENVMSMHRTKATLIGLLEVGRVN  445

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+  K +   +A R+   RL  R+H LE+ +G ++     YD+ FG +  +I
Sbjct  446  EWVVTEKLGDVLKTKSGGKAARKPRIRLDGRLHFLELGVGVYLFFIGCYDVAFGKNHCFI  505

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL +Q++AFF VG  +VG  VP+
Sbjct  506  YLFMQSIAFFVVGVGYVGIFVPS  528



>ref|XP_009421122.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Musa 
acuminata subsp. malaccensis]
Length=533

 Score =   243 bits (620),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 119/202 (59%), Positives = 153/202 (76%), Gaps = 0/202 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI K+++V+L+ K H+IY+FFFVRKI+AH VTF FYCVVIP  +++P
Sbjct  330  SCGPANLFRKMVLEIAKNKKVTLWTKVHVIYSFFFVRKIVAHIVTFIFYCVVIPATVLVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K   +Y+P+ IT+LNA  T RS HLLV WILFENVMSLHRTKA  IGLLEA R N
Sbjct  390  EVQVPKWGLVYIPSIITLLNAVGTPRSLHLLVFWILFENVMSLHRTKATFIGLLEAGRVN  449

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+  K +   +A +    R+ ER+HLLE++ G +++ C  YD+ FG + +Y+
Sbjct  450  EWVVTEKLGDGMKTKAGAKAAKIPRIRIGERLHLLELLTGAYLVFCGCYDLAFGKNYYYL  509

Query  240  YLVLQALAFFAVGFSFVGTQVP  175
            YL  QA+AFF VGF +VGT VP
Sbjct  510  YLFFQAVAFFIVGFGYVGTFVP  531



>ref|XP_004143299.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
sativus]
 gb|KGN48230.1| hypothetical protein Csa_6G450350 [Cucumis sativus]
Length=537

 Score =   243 bits (620),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/206 (56%), Positives = 155/206 (75%), Gaps = 3/206 (1%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+ + RV+ +KK H+IY+FFFVRK++AH  TF FYC+V+P  +++ 
Sbjct  332  SCGPANLFRKMVVEIITNNRVTTWKKVHVIYSFFFVRKVVAHINTFIFYCLVLPATVLVQ  391

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            ++ + K   +Y+PA IT+LN+  T RSFHLLV WILFENVM++HRTK  IIGLLEA+R N
Sbjct  392  DVEVPKWGYVYIPAIITLLNSVGTPRSFHLLVYWILFENVMAMHRTKGTIIGLLEASRVN  451

Query  420  EWVVTEKLGNAAKQRQA-VRAPRRRTCRLR--ERIHLLEIMMGFFMLQCASYDIIFGHDL  250
            EW+VTEKLG+A+K +   +R P   T RLR  ER+ + E+ +G ++L C  YDI FG + 
Sbjct  452  EWIVTEKLGDASKPKSTDLRTPLIATPRLRIGERVLMWELGVGMYLLLCGVYDIFFGKNQ  511

Query  249  FYIYLVLQALAFFAVGFSFVGTQVPT  172
            FYI+L LQA+ FF VGF +VGT VP+
Sbjct  512  FYIFLFLQAITFFIVGFGYVGTYVPS  537



>ref|XP_009793130.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X1 [Nicotiana sylvestris]
Length=553

 Score =   243 bits (621),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/203 (57%), Positives = 150/203 (74%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM KEI  +++VS++KKF+LIY+FFFVRKIIAH VTF  YCVV+P  + +P
Sbjct  350  SCGPANLFRKMAKEIATNKKVSVWKKFYLIYSFFFVRKIIAHIVTFVLYCVVMPATVFVP  409

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  AIY+P+ ITILN   + RS +L+V WILFENVMSLHRTKA  +GL E+ R N
Sbjct  410  EVQVPKWGAIYIPSAITILNVLGSPRSMYLVVYWILFENVMSLHRTKATFVGLFESGRVN  469

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EW+VTEKLG+A K + + +  R+   R+ ER+HLLE+ +G ++  C  YD  FG   F++
Sbjct  470  EWIVTEKLGDALKTKVSSKTSRKLRFRVGERVHLLELFVGLYLWFCGWYDFSFGKSRFHV  529

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL LQA AFF VGF +VG  VP 
Sbjct  530  YLFLQAAAFFVVGFGYVGVFVPN  552



>ref|XP_004170553.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
sativus]
Length=537

 Score =   243 bits (620),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/206 (56%), Positives = 155/206 (75%), Gaps = 3/206 (1%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+ + RV+ +KK H+IY+FFFVRK++AH  TF FYC+V+P  +++ 
Sbjct  332  SCGPANLFRKMVVEIITNNRVTTWKKVHVIYSFFFVRKVVAHINTFIFYCLVLPATVLVQ  391

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            ++ + K   +Y+PA IT+LN+  T RSFHLLV WILFENVM++HRTK  IIGLLEA+R N
Sbjct  392  DVEVPKWGYVYIPAIITLLNSVGTPRSFHLLVYWILFENVMAMHRTKGTIIGLLEASRVN  451

Query  420  EWVVTEKLGNAAKQRQA-VRAPRRRTCRLR--ERIHLLEIMMGFFMLQCASYDIIFGHDL  250
            EW+VTEKLG+A+K +   +R P   T RLR  ER+ + E+ +G ++L C  YDI FG + 
Sbjct  452  EWIVTEKLGDASKPKSTDLRTPLIATPRLRIGERVLMWELGVGMYLLLCGVYDIFFGKNQ  511

Query  249  FYIYLVLQALAFFAVGFSFVGTQVPT  172
            FYI+L LQA+ FF VGF +VGT VP+
Sbjct  512  FYIFLFLQAITFFIVGFGYVGTYVPS  537



>ref|XP_004239715.2| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Solanum 
lycopersicum]
Length=526

 Score =   243 bits (619),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/206 (54%), Positives = 150/206 (73%), Gaps = 3/206 (1%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLF+KM  EI  +++VS++K+F+LIY+FFFVRKIIAH VTF FYCV+IP  ++IP
Sbjct  320  SCGPANLFKKMVGEIASNKKVSIWKRFYLIYSFFFVRKIIAHMVTFIFYCVIIPTTVLIP  379

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ +    A+Y+P+TIT+LNA  T RSF+LL+ WILFENVMSLHRT+A  IGL E  R N
Sbjct  380  EVQVPIWGAVYIPSTITLLNAVGTPRSFYLLIFWILFENVMSLHRTRATFIGLFEVGRVN  439

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRE---RIHLLEIMMGFFMLQCASYDIIFGHDL  250
            EWVVTEKLG+  K + + +  RR   R+ E   ++H +E+ +G +++ C  YD  FG + 
Sbjct  440  EWVVTEKLGDGIKAKTSTKGSRRSRFRIGEWYNKVHFVEVFVGLYLMLCGWYDYSFGKNR  499

Query  249  FYIYLVLQALAFFAVGFSFVGTQVPT  172
            FYIYL LQ +AF   GF ++G  VP 
Sbjct  500  FYIYLFLQGVAFLVAGFGYIGVFVPN  525



>ref|XP_004951606.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 1-like [Setaria 
italica]
Length=521

 Score =   242 bits (617),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 152/203 (75%), Gaps = 1/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+ +++V+++KK H+IY FF +RKIIAH +TF FYC++IP  I +P
Sbjct  317  SCGPANLFRKMLMEIVTNKKVTIWKKIHVIYNFFLIRKIIAHIITFSFYCLIIPATIFVP  376

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K   +Y+P+ IT+LN+  T RSFHLL  W+ FENVMSLHRTKA +IGLLEA RAN
Sbjct  377  EVRIPKWGCVYIPSAITLLNSVGTPRSFHLLFFWVAFENVMSLHRTKATLIGLLEAGRAN  436

Query  420  EWVVTEKLGNAAKQRQAVRAP-RRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFY  244
            EWVVT KLG+A K + A +   +++  R+ ER+H+ E+ +G F+  C  YD+ +G D FY
Sbjct  437  EWVVTAKLGSAMKMKSANKGGLKKQFMRIWERLHITELGVGTFLFSCGWYDLAYGRDHFY  496

Query  243  IYLVLQALAFFAVGFSFVGTQVP  175
            IYL  Q++AFF +GF +VGT VP
Sbjct  497  IYLFFQSIAFFIIGFGYVGTIVP  519



>gb|EPS66478.1| hypothetical protein M569_08299, partial [Genlisea aurea]
Length=230

 Score =   233 bits (593),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 147/203 (72%), Gaps = 1/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++++VS +KK H+IY+FFFVRKI+AH VTFFFYC+V P  +++P
Sbjct  28   SCGPANLFRKMVVEIIRNKKVSTWKKIHVIYSFFFVRKIVAHIVTFFFYCIVFPATVLVP  87

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            ++ + K  ++Y+P TITILN+  T RS HLLV WILFENVMSLHR KA IIGL  A R N
Sbjct  88   QVQIPKWASVYIPFTITILNSVGTPRSLHLLVFWILFENVMSLHRAKATIIGLFGARRVN  147

Query  420  EWVVTEKLGNAAKQRQAVRA-PRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFY  244
            EW+VTEKLG+  K +   +A     +  L  R + LE+  G ++  C  YD I+G++ +Y
Sbjct  148  EWIVTEKLGDVRKSKPVKKAFYTSMSFNLFRRFYSLEVATGVYLSFCGCYDFIYGNNHYY  207

Query  243  IYLVLQALAFFAVGFSFVGTQVP  175
            IYL LQA AF  VGF +VGT VP
Sbjct  208  IYLFLQAAAFLIVGFGYVGTFVP  230



>gb|EMT23763.1| hypothetical protein F775_17087 [Aegilops tauschii]
Length=819

 Score =   247 bits (631),  Expect = 3e-72, Method: Composition-based stats.
 Identities = 114/194 (59%), Positives = 149/194 (77%), Gaps = 1/194 (1%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+ +++V+++KKFH+IY FF VRKI+AH VTF FYC++IP  I +P
Sbjct  377  SCGPANLFRKMLVEIVTNKKVTIWKKFHVIYNFFLVRKIVAHIVTFTFYCIIIPTTIFVP  436

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+H+ K   +Y+P  IT+LN+  T RSFHLL  WILFENVMSLHRTKA +IGLLEA RAN
Sbjct  437  EVHIPKWGCVYIPTIITLLNSVGTPRSFHLLFFWILFENVMSLHRTKATLIGLLEAGRAN  496

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRT-CRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFY  244
            EWVVTEKLG+A K + A +A  R++  R+ ER+++ E+ +G F+  C  YD+ FG D F+
Sbjct  497  EWVVTEKLGSAMKMKSANKASARKSFMRMWERLNVPELGVGAFLFSCGWYDVAFGKDNFF  556

Query  243  IYLVLQALAFFAVG  202
            IYL  Q++AFF VG
Sbjct  557  IYLFFQSMAFFVVG  570



>ref|XP_004303037.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Fragaria 
vesca subsp. vesca]
Length=533

 Score =   241 bits (616),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 110/203 (54%), Positives = 153/203 (75%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLF+KM  EI+ +++VS+++K H+IY+FFFVRKIIAH   FFFYC+V+P  I++P
Sbjct  330  SCGPANLFKKMVMEIITNKKVSVWQKVHVIYSFFFVRKIIAHIFAFFFYCIVLPATILVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K   +Y+P  IT+LN+  T RS HL+V WILFENVMSLHRTKA IIG+LE +R N
Sbjct  390  EVTVPKWGGVYIPTIITLLNSVGTPRSIHLVVFWILFENVMSLHRTKATIIGILEFSRVN  449

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EW+VTEKLG+  K +   +AP++    + +R+H LE+ +G ++  CA YD +FG D ++I
Sbjct  450  EWIVTEKLGDFLKNKVGAKAPKKFRLNIGDRLHFLELAVGCYLFFCACYDFVFGKDNYFI  509

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            +   Q+LAFF +GF +VGT VPT
Sbjct  510  FFYTQSLAFFIMGFGYVGTIVPT  532



>ref|XP_010911245.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 1-like [Elaeis 
guineensis]
Length=294

 Score =   234 bits (598),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 107/203 (53%), Positives = 150/203 (74%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            +CGPA LFRKMF EI+K+++VS++KK H+IY FF  R+II+H+VTF FYCVVIP ++  P
Sbjct  90   ACGPAVLFRKMFWEIVKAKKVSIWKKLHVIYNFFLARRIISHFVTFSFYCVVIPLSVFFP  149

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K   IY+P TIT+LN+  T  SFHL++ W+LFENVMSLHR KA +IGLLEA RAN
Sbjct  150  EVEIPKWGMIYVPTTITLLNSVGTPSSFHLIIFWVLFENVMSLHRCKAVLIGLLEAGRAN  209

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EW+VTEKLG+  K +  +   ++   +  +R HLLE+ +  F++ CA YD I+  D F+I
Sbjct  210  EWIVTEKLGDMLKTKSNISVTQKIRFKFWDRFHLLELGLAVFLMICACYDCIYRQDYFFI  269

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            Y+  Q++ FF +GF +VGT +P+
Sbjct  270  YIFPQSITFFIMGFGYVGTIIPS  292



>ref|XP_006436686.1| hypothetical protein CICLE_v10031284mg [Citrus clementina]
 gb|ESR49926.1| hypothetical protein CICLE_v10031284mg [Citrus clementina]
Length=508

 Score =   240 bits (613),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 111/203 (55%), Positives = 153/203 (75%), Gaps = 1/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLF+KM  EI+++++V+L+KK ++IY+FFFVRK++AH VTF FYCV++P  ++ P
Sbjct  306  SCGPANLFKKMVGEIMRTKKVTLWKKLYVIYSFFFVRKVVAHIVTFVFYCVLLPATVLFP  365

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ IT+LNA  T RS HLLV WILFENVMSLHRTKA  IGLLEA R N
Sbjct  366  EVEVPKWGAVYIPSIITLLNAVGTPRSLHLLVFWILFENVMSLHRTKATFIGLLEAGRVN  425

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+  K +   +  ++   R+ ER+H+LE+ +G ++  C  YD+ FG + ++I
Sbjct  426  EWVVTEKLGD-VKSKLGGKTLKKPRIRIGERVHVLELGVGAYLFLCGCYDVAFGKNHYFI  484

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL LQ++AFF  G  +VGT VP 
Sbjct  485  YLFLQSIAFFVAGVGYVGTFVPN  507



>gb|AGE09561.1| CSLA9-like protein [Eucalyptus cladocalyx]
Length=532

 Score =   241 bits (615),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 153/203 (75%), Gaps = 1/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++ +V+L+KK H+IY+FF VRKI+AH VTF FYCVV+P  + +P
Sbjct  330  SCGPANLFRKMAMEIIRN-KVTLWKKLHVIYSFFLVRKIVAHIVTFIFYCVVLPATVFVP  388

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ IT+LNA  T RS HL+V WILFENVMS HRTKA  IGLLEA R N
Sbjct  389  EVTVPKWGAVYIPSIITVLNAVGTPRSLHLVVFWILFENVMSFHRTKATFIGLLEAGRVN  448

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EW+VTEKLG+A K + + + P++   R  +R+H+LE+ +G ++  C  YDI FG + +++
Sbjct  449  EWIVTEKLGDALKVKASSKVPKKPKFRFGDRLHVLELGVGAYLFFCGCYDIAFGRNHYFM  508

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL  QA+AFF +GF ++GT VP 
Sbjct  509  YLFAQAIAFFIMGFGYIGTFVPN  531



>gb|KDO40534.1| hypothetical protein CISIN_1g009761mg [Citrus sinensis]
Length=526

 Score =   241 bits (614),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 111/203 (55%), Positives = 153/203 (75%), Gaps = 1/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLF+KM  EI+++++V+L+KK ++IY+FFFVRK++AH VTF FYCV++P  ++ P
Sbjct  324  SCGPANLFKKMVGEIMRTKKVTLWKKLYVIYSFFFVRKVVAHIVTFVFYCVLLPATVLFP  383

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ IT+LNA  T RS HLLV WILFENVMSLHRTKA  IGLLEA R N
Sbjct  384  EVEVPKWGAVYIPSIITLLNAVGTPRSLHLLVFWILFENVMSLHRTKATFIGLLEAGRVN  443

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+  K +   +  ++   R+ ER+H+LE+ +G ++  C  YD+ FG + ++I
Sbjct  444  EWVVTEKLGD-VKSKLGGKTLKKPRIRIGERVHVLELGVGAYLFLCGCYDVAFGKNHYFI  502

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL LQ++AFF  G  +VGT VP 
Sbjct  503  YLFLQSIAFFVAGVGYVGTFVPN  525



>ref|XP_006492171.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Citrus 
sinensis]
Length=526

 Score =   241 bits (614),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 111/203 (55%), Positives = 153/203 (75%), Gaps = 1/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLF+KM  EI+++++V+L+KK ++IY+FFFVRK++AH VTF FYCV++P  ++ P
Sbjct  324  SCGPANLFKKMVGEIMRTKKVTLWKKLYVIYSFFFVRKVVAHIVTFVFYCVLLPATVLFP  383

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ IT+LNA  T RS HLLV WILFENVMSLHRTKA  IGLLEA R N
Sbjct  384  EVEVPKWGAVYIPSIITLLNAVGTPRSLHLLVFWILFENVMSLHRTKATFIGLLEAGRVN  443

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+  K +   +  ++   R+ ER+H+LE+ +G ++  C  YD+ FG + ++I
Sbjct  444  EWVVTEKLGD-VKSKLGGKTLKKPRIRIGERVHVLELGVGAYLFLCGCYDVAFGKNHYFI  502

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL LQ++AFF  G  +VGT VP 
Sbjct  503  YLFLQSIAFFVAGVGYVGTFVPN  525



>gb|EMT02496.1| hypothetical protein F775_10659 [Aegilops tauschii]
Length=366

 Score =   236 bits (602),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 116/208 (56%), Positives = 154/208 (74%), Gaps = 8/208 (4%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVI-  604
            SCGPANL RKMF EI+ S +VS +KK H++Y FFFVRK++AH VTF FYCVVIP  +++ 
Sbjct  159  SCGPANLMRKMFWEIVASRQVSAWKKVHVLYGFFFVRKVVAHLVTFLFYCVVIPAYVLVG  218

Query  603  -PELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANR  427
              ++ L K +A+Y+PA IT+LNA CT RS+HLLV WILFENVMS+HR+KA IIGL+EA+R
Sbjct  219  GQDVRLPKYVAMYVPAIITLLNAVCTPRSWHLLVFWILFENVMSMHRSKATIIGLVEASR  278

Query  426  ANEWVVTEKLGN----AAKQRQAVRAPRRRTCRLRERIHLL--EIMMGFFMLQCASYDII  265
            ANEWVVTEKLG+           +   +  T + + +  +L  EI+MG  +L CA YDI+
Sbjct  279  ANEWVVTEKLGSVTSSTPAATTTMATNKGATKKKKSQSSILAPEIVMGLCLLYCAVYDIV  338

Query  264  FGHDLFYIYLVLQALAFFAVGFSFVGTQ  181
            FGHD FY+YL++Q+ A F +GF +VG+Q
Sbjct  339  FGHDHFYVYLLMQSAAAFVIGFGYVGSQ  366



>gb|KCW89261.1| hypothetical protein EUGRSUZ_A01558 [Eucalyptus grandis]
Length=532

 Score =   240 bits (612),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 153/203 (75%), Gaps = 1/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++ +V+L+KK H+IY+FF VRKI+AH VTF FYCVV+P  + +P
Sbjct  330  SCGPANLFRKMAMEIIRN-KVTLWKKVHVIYSFFLVRKIVAHIVTFIFYCVVLPATVFVP  388

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ IT+LNA  T RS HL+V WILFENVMS HRTKA  IGLLEA R N
Sbjct  389  EVTVPKWGAVYIPSIITVLNAVGTPRSLHLVVFWILFENVMSFHRTKATFIGLLEAGRVN  448

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EW+VTEKLG+A K + + + P++   R  +R+H+LE+ +G ++  C  YDI FG + +++
Sbjct  449  EWIVTEKLGDALKVKASNKVPKKPKFRFGDRLHVLELGVGAYLFFCGCYDIAFGRNHYFM  508

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL  QA+AFF +GF ++GT VP 
Sbjct  509  YLFAQAIAFFIMGFGYIGTFVPN  531



>emb|CDP06989.1| unnamed protein product [Coffea canephora]
Length=537

 Score =   240 bits (612),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 114/205 (56%), Positives = 151/205 (74%), Gaps = 2/205 (1%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++++++++KK ++IY+FFFVRK+IAH VTFFFYCVV+P  I++P
Sbjct  332  SCGPANLFRKMVMEIVRNKKIAVWKKVYVIYSFFFVRKVIAHMVTFFFYCVVLPLTILVP  391

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  AIY+P  IT LN+  T RS HLL  WILFENVMSLHRTKA  IGLLEA RAN
Sbjct  392  EVEVPKWGAIYIPCIITALNSVGTPRSIHLLFYWILFENVMSLHRTKATFIGLLEAKRAN  451

Query  420  EWVVTEKLGNAAKQRQAV--RAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLF  247
            EWVVTEKLG+A K +  V    P++   ++ +RIHL E+    F+  C  YD ++G + +
Sbjct  452  EWVVTEKLGDALKNKSNVVKAKPKKIGLKIGDRIHLTELGFAVFLFFCGCYDFLYGKNNY  511

Query  246  YIYLVLQALAFFAVGFSFVGTQVPT  172
            +IYL LQ + F   GF ++GT VPT
Sbjct  512  FIYLFLQVITFTIAGFGYIGTIVPT  536



>gb|ACF33171.1| mannan synthase [Coffea canephora]
Length=537

 Score =   240 bits (612),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/205 (56%), Positives = 151/205 (74%), Gaps = 2/205 (1%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++++++++KK ++IY+FFFVRK+IAH VTFFFYCVV+P  I++P
Sbjct  332  SCGPANLFRKMVMEIVRNKKIAVWKKVYVIYSFFFVRKVIAHMVTFFFYCVVLPLTILVP  391

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  AIY+P  IT LN+  T RS HLL  WILFENVMSLHRTKA  IGLLEA RAN
Sbjct  392  EVEVPKWGAIYIPCIITALNSVGTPRSIHLLFYWILFENVMSLHRTKATFIGLLEAKRAN  451

Query  420  EWVVTEKLGNAAKQRQAV--RAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLF  247
            EWVVTEKLG+A K +  V    P++   ++ +RIHL E+    F+  C  YD ++G + +
Sbjct  452  EWVVTEKLGDALKNKSNVVKAKPKKIGLKIGDRIHLTELGFAVFLFFCGCYDFLYGKNNY  511

Query  246  YIYLVLQALAFFAVGFSFVGTQVPT  172
            +IYL LQ + F   GF ++GT VPT
Sbjct  512  FIYLFLQVITFTIAGFGYIGTIVPT  536



>gb|AFW87395.1| hypothetical protein ZEAMMB73_638072, partial [Zea mays]
Length=479

 Score =   238 bits (607),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/202 (55%), Positives = 152/202 (75%), Gaps = 3/202 (1%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRK   EI+++++V+L+KK H+IY FF VRKI+AH VTF FYC+VIP  +++P
Sbjct  281  SCGPANLFRKTLVEIVRNKKVTLWKKIHVIYNFFLVRKIVAHAVTFVFYCIVIPTTVLVP  340

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  ++Y+P  IT+L+A  T RS HL+V W LFENVMSLHRTKA  IGLLEA R N
Sbjct  341  EVQVPKWGSVYIPTVITLLSAVATPRSAHLVVFWTLFENVMSLHRTKATFIGLLEAGRVN  400

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A + +   + PR    R+ +R+H+LE+ +  ++L C  YDI FG++ +YI
Sbjct  401  EWVVTEKLGDALRTKVPGKKPR---MRIGDRLHVLELGVAAYLLFCGCYDIAFGNNRYYI  457

Query  240  YLVLQALAFFAVGFSFVGTQVP  175
            +L LQ++AFF VG  +VGT VP
Sbjct  458  FLFLQSIAFFIVGIGYVGTFVP  479



>ref|XP_008462529.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
melo]
Length=536

 Score =   239 bits (610),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/203 (54%), Positives = 153/203 (75%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANL RKM  EI+ +++VS +KK H+IY+FFFVRK++AH  TF FYC+V+P  +++P
Sbjct  333  SCGPANLLRKMIMEIITNKKVSAWKKVHVIYSFFFVRKVVAHINTFVFYCLVLPATVLVP  392

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  ++Y+P+ IT+LNA  T RS HLLV WILFENVM++HRTK  IIGLLEA+R N
Sbjct  393  EVEVPKWGSVYIPSIITLLNAVGTPRSLHLLVYWILFENVMAMHRTKGTIIGLLEASRVN  452

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EW+VTEKLG+A+K + A + P++    + ER+ + E+ +G ++  C  YDI FG + ++I
Sbjct  453  EWIVTEKLGDASKPKLAAKTPKKTRFWIGERVLMWELGVGAYLFICGIYDIFFGKNQYFI  512

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            +L LQA+AF  VGF FVGT V +
Sbjct  513  FLFLQAIAFCIVGFGFVGTHVSS  535



>ref|XP_010038980.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Eucalyptus 
grandis]
Length=533

 Score =   239 bits (610),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/202 (55%), Positives = 148/202 (73%), Gaps = 0/202 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  +I+K+++VS +KK ++IY+FF VRKI+AH VTF FYC+V+P  ++ P
Sbjct  330  SCGPANLFRKMVFDIIKNKKVSTWKKLYVIYSFFMVRKIVAHIVTFLFYCIVLPATVLTP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  +IY+P+ IT LNA  T RS HL+V WILFENVMSLHRTKA IIGLLE NR N
Sbjct  390  EVAVPKWASIYIPSIITALNALSTPRSLHLMVFWILFENVMSLHRTKATIIGLLEGNRVN  449

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EW+VTEKLG+A K +       R   R  ER H LEI +G ++  C  YD+ FG + +++
Sbjct  450  EWIVTEKLGDALKNKAITSFAERTRLRFTERFHFLEIGVGVYLCFCGCYDVAFGKNHYFL  509

Query  240  YLVLQALAFFAVGFSFVGTQVP  175
            +L +QA+AFF +GF +VG  VP
Sbjct  510  FLYVQAVAFFIMGFGYVGIFVP  531



>ref|XP_006345855.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Solanum 
tuberosum]
Length=486

 Score =   238 bits (607),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/206 (53%), Positives = 150/206 (73%), Gaps = 3/206 (1%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLF+KM  EI  +++VS++KKF+LIY+FFFVRKIIAH VTF FYCV++P  ++IP
Sbjct  280  SCGPANLFKKMVGEIASNKKVSIWKKFYLIYSFFFVRKIIAHIVTFIFYCVIMPTTVLIP  339

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ +    A+Y+P+TIT+LNA  T RSF+LL+ WILFENVMSLHRT+A  IGL E  + N
Sbjct  340  EVQVPIWGAVYIPSTITLLNAVGTPRSFYLLIFWILFENVMSLHRTRATFIGLFEVGKVN  399

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRE---RIHLLEIMMGFFMLQCASYDIIFGHDL  250
            EWVVTEKLG+  K + +++  ++   R+ E   ++H  E+ +G +++ C  YD  FG + 
Sbjct  400  EWVVTEKLGDGIKAKTSMKVSKKSRFRIGEWYNKVHFAEVFVGLYLMLCGWYDYSFGKNR  459

Query  249  FYIYLVLQALAFFAVGFSFVGTQVPT  172
            FYIYL LQ +AF   GF ++G  VP 
Sbjct  460  FYIYLFLQGMAFLVAGFGYIGVFVPN  485



>ref|NP_001131007.1| uncharacterized protein LOC100192112 [Zea mays]
 gb|ACF79431.1| unknown [Zea mays]
 gb|ACG40011.1| CSLA1 - cellulose synthase-like family A; mannan synthase [Zea 
mays]
 gb|AFW66229.1| CSLA1-cellulose synthase-like family isoform 1 [Zea mays]
 gb|AFW66230.1| CSLA1-cellulose synthase-like family isoform 2 [Zea mays]
Length=514

 Score =   238 bits (608),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 151/203 (74%), Gaps = 1/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+ +++V+++KK H+IY FF +RKIIAH +TF FYCV+IP  I +P
Sbjct  310  SCGPANLFRKMLMEIVTNKKVTIWKKIHVIYNFFLIRKIIAHIITFSFYCVIIPATIFVP  369

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K   +Y+P+ IT+LN+  T RSFHLL  W+ FENVMSLHRTKA +IGLLEA RAN
Sbjct  370  EVRIPKWGCVYIPSAITLLNSVGTPRSFHLLFFWVAFENVMSLHRTKATLIGLLEAGRAN  429

Query  420  EWVVTEKLGNAAKQRQAVRAP-RRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFY  244
            EWVVT KLG+A K + A +A  R++  R+ ER+H+ E+ +  F+  C  YD+ +G D F+
Sbjct  430  EWVVTAKLGSAMKMKSANKAGLRKQFMRIWERLHVTELGVAAFLFSCGWYDLAYGRDHFF  489

Query  243  IYLVLQALAFFAVGFSFVGTQVP  175
            IYL  Q++AFF VG  +VGT VP
Sbjct  490  IYLFFQSVAFFIVGVGYVGTIVP  512



>ref|XP_010067160.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Eucalyptus 
grandis]
 gb|KCW65234.1| hypothetical protein EUGRSUZ_G02715 [Eucalyptus grandis]
Length=482

 Score =   237 bits (605),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 108/203 (53%), Positives = 155/203 (76%), Gaps = 1/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++++VS++KKF++IY+FFFVRKI+AH VTF FYC+V+P  +++P
Sbjct  280  SCGPANLFRKMAVEIIQNKKVSMWKKFYVIYSFFFVRKIVAHVVTFVFYCIVMPATVLVP  339

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P T+T+LN+  T RS HLLV W+LFENVM+LHRTKA  IGLLEA R N
Sbjct  340  EVEVPKWGAVYIPCTVTLLNSVGTPRSLHLLVFWVLFENVMALHRTKATFIGLLEAGRVN  399

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVT+KLG+A K +   +A RR    + +R+H++E+ +G ++  C  YD+  G + +++
Sbjct  400  EWVVTQKLGDALKTKPG-KAHRRLRIWIGQRVHVVELCVGAYLFVCGCYDLAHGKNRYFL  458

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL LQ+ AFF  G  +VGT +P+
Sbjct  459  YLFLQSFAFFVAGIGYVGTFIPS  481



>ref|XP_008659807.1| PREDICTED: probable mannan synthase 9 [Zea mays]
Length=526

 Score =   238 bits (608),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 112/202 (55%), Positives = 152/202 (75%), Gaps = 3/202 (1%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRK   EI+++++V+L+KK H+IY FF VRKI+AH VTF FYC+VIP  +++P
Sbjct  327  SCGPANLFRKTLVEIVRNKKVTLWKKIHVIYNFFLVRKIVAHAVTFVFYCIVIPTTVLVP  386

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  ++Y+P  IT+L+A  T RS HL+V W LFENVMSLHRTKA  IGLLEA R N
Sbjct  387  EVQVPKWGSVYIPTVITLLSAVATPRSAHLVVFWTLFENVMSLHRTKATFIGLLEAGRVN  446

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A + +   + PR    R+ +R+H+LE+ +  ++L C  YDI FG++ +YI
Sbjct  447  EWVVTEKLGDALRTKVPGKKPR---MRIGDRLHVLELGVAAYLLFCGCYDIAFGNNRYYI  503

Query  240  YLVLQALAFFAVGFSFVGTQVP  175
            +L LQ++AFF VG  +VGT VP
Sbjct  504  FLFLQSIAFFIVGIGYVGTFVP  525



>ref|XP_004143300.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
sativus]
 gb|KGN48231.1| hypothetical protein Csa_6G450360 [Cucumis sativus]
Length=537

 Score =   238 bits (608),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 108/203 (53%), Positives = 153/203 (75%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANL RKM  EI+ +++V+ +KK H+IY+FFFVRK++AH  TF FYC+V+P  +++P
Sbjct  334  SCGPANLLRKMIMEIITNKKVTAWKKVHVIYSFFFVRKVVAHINTFVFYCIVLPATVLVP  393

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  ++Y+P+ IT+LNA  T RS HLLV WILFENVM++HRTK  IIGLLEA+R N
Sbjct  394  EVEVPKWGSVYIPSIITLLNAVGTPRSLHLLVYWILFENVMAMHRTKGTIIGLLEASRVN  453

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EW+VTEKLG+A+K + A + P++    + ER+ + E+ +G ++  C  YDI FG + ++I
Sbjct  454  EWIVTEKLGDASKPKLAAKTPKKPRFWIGERVLMWELGVGAYLFICGIYDIFFGKNQYFI  513

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            +L LQA+AF  VGF FVGT V +
Sbjct  514  FLFLQAIAFCIVGFGFVGTHVSS  536



>ref|XP_007145259.1| hypothetical protein PHAVU_007G223800g [Phaseolus vulgaris]
 gb|ESW17253.1| hypothetical protein PHAVU_007G223800g [Phaseolus vulgaris]
Length=523

 Score =   238 bits (607),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 114/203 (56%), Positives = 160/203 (79%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++++VSL+KK +++Y+FFFVRK++AH  TF FYC+V+P  +V+P
Sbjct  320  SCGPANLFRKMVMEIIRNKKVSLWKKIYVVYSFFFVRKVVAHLNTFVFYCIVLPATVVVP  379

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ IT+LNA  T RS HLLV WILFEN MSLHRTKA IIGLLEA+R N
Sbjct  380  EVAVPKWGAVYIPSIITLLNAVGTPRSLHLLVFWILFENTMSLHRTKATIIGLLEASRVN  439

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EW+VTEKLG+A K +   +A ++   R+ +RIH+LE+++GF++  C  YD++FG + FYI
Sbjct  440  EWIVTEKLGDALKGKGGGKAAKKIRFRIGDRIHMLELLVGFYLFFCGCYDVMFGKNRFYI  499

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            +L +Q++AFF + F +VGT VP 
Sbjct  500  FLYIQSIAFFIMAFGYVGTIVPN  522



>ref|XP_004164074.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
sativus]
Length=537

 Score =   238 bits (608),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 108/203 (53%), Positives = 153/203 (75%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANL RKM  EI+ +++V+ +KK H+IY+FFFVRK++AH  TF FYC+V+P  +++P
Sbjct  334  SCGPANLLRKMIMEIITNKKVTAWKKVHVIYSFFFVRKVVAHINTFVFYCIVLPATVLVP  393

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  ++Y+P+ IT+LNA  T RS HLLV WILFENVM++HRTK  IIGLLEA+R N
Sbjct  394  EVEVPKWGSVYIPSIITLLNAVGTPRSIHLLVYWILFENVMAMHRTKGTIIGLLEASRVN  453

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EW+VTEKLG+A+K + A + P++    + ER+ + E+ +G ++  C  YDI FG + ++I
Sbjct  454  EWIVTEKLGDASKPKLAAKTPKKPRFWIGERVLMWELGVGAYLFICGIYDIFFGKNQYFI  513

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            +L LQA+AF  VGF FVGT V +
Sbjct  514  FLFLQAIAFCIVGFGFVGTHVSS  536



>ref|XP_006430317.1| hypothetical protein CICLE_v10011455mg [Citrus clementina]
 gb|ESR43557.1| hypothetical protein CICLE_v10011455mg [Citrus clementina]
Length=533

 Score =   238 bits (607),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 122/202 (60%), Positives = 154/202 (76%), Gaps = 0/202 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++++VSL+KK H+IY+FFFVRKIIAH +TF  YCVV+P  +VIP
Sbjct  330  SCGPANLFRKMVMEIVRNKKVSLWKKVHVIYSFFFVRKIIAHIITFVLYCVVLPATVVIP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P  ITILNA  T RS HLLV WILFENVMSLHRT A  IGLLE  R N
Sbjct  390  EVQVPKWAAVYIPTVITILNAVGTPRSIHLLVFWILFENVMSLHRTMATFIGLLEGVRVN  449

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EW+VTEKLG A K + A +APR R     +RI+LLE+ +G F+  C  YD++FG++ ++I
Sbjct  450  EWIVTEKLGGALKAKAAAKAPRLRRFFFGDRIYLLELGVGAFLFSCGCYDVLFGNNHYFI  509

Query  240  YLVLQALAFFAVGFSFVGTQVP  175
            YL +QALAFF +GF +VG  VP
Sbjct  510  YLFVQALAFFVMGFGYVGIYVP  531



>gb|KDO45609.1| hypothetical protein CISIN_1g040333mg [Citrus sinensis]
Length=513

 Score =   237 bits (605),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 114/208 (55%), Positives = 148/208 (71%), Gaps = 7/208 (3%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++++V  +KK ++IY+FFFVRKIIAH VTF FYCVV+P  I++P
Sbjct  306  SCGPANLFRKMVMEIIRNKKVKFWKKVYVIYSFFFVRKIIAHMVTFSFYCVVLPLTILVP  365

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ +    A+Y+P+ ITILN+  T RS HLL  WILFENVMSLHRTKA  IGLLEA RAN
Sbjct  366  EVQVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLHRTKATFIGLLEAGRAN  425

Query  420  EWVVTEKLGNA-------AKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIF  262
            EWVVTEKLG+A       AK +   +AP++   +  ER+H LE+  G F+  C  YD + 
Sbjct  426  EWVVTEKLGDALKNKAADAKNKTNTKAPKKPKIKFAERMHTLELGFGVFLFFCGCYDFVH  485

Query  261  GHDLFYIYLVLQALAFFAVGFSFVGTQV  178
            G + ++IYL LQ + F   GF ++GT V
Sbjct  486  GKNNYFIYLFLQTITFLIAGFGYIGTIV  513



>ref|XP_004965827.1| PREDICTED: probable mannan synthase 9-like [Setaria italica]
Length=538

 Score =   238 bits (606),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/202 (54%), Positives = 152/202 (75%), Gaps = 0/202 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++++V+L+KK H+IY FF VRKIIAH VTF FYC+VIP  +++P
Sbjct  335  SCGPANLFRKMLMEIVRNKKVTLWKKIHVIYNFFLVRKIIAHIVTFVFYCIVIPATVLVP  394

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + +  ++Y+P  IT+LNA  T RS HL+V WILFENVM+LHR KA  IGLLEA R N
Sbjct  395  EVEIPRWGSVYIPTIITLLNAVGTPRSVHLIVFWILFENVMALHRMKATFIGLLEAGRVN  454

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A + +   +  ++   R+ +R+H+LE+ +G ++  C  YD+  G++ +YI
Sbjct  455  EWVVTEKLGDALRMKMPGKGFKKPRMRIVDRLHILELCVGAYLFFCGCYDVTVGNNHYYI  514

Query  240  YLVLQALAFFAVGFSFVGTQVP  175
            +L LQ++AFF VG  +VGT VP
Sbjct  515  FLFLQSIAFFIVGLGYVGTFVP  536



>ref|XP_011089999.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Sesamum 
indicum]
Length=536

 Score =   238 bits (606),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 115/206 (56%), Positives = 148/206 (72%), Gaps = 3/206 (1%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  +I  +++VSLYKKF++IY+FFFVRK+IAH  TFFFYCVV+P +I++P
Sbjct  330  SCGPANLFRKMVMDIATNKKVSLYKKFYVIYSFFFVRKLIAHMFTFFFYCVVLPLSILVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  AIY+P  IT LN+  T RSFHLL  W+LFENVMS HRTKA  IGLLEA R N
Sbjct  390  EVDVPKWGAIYIPCIITTLNSVGTPRSFHLLFYWVLFENVMSFHRTKATFIGLLEAKRVN  449

Query  420  EWVVTEKLGNAAKQRQAVR--APRRRTCR-LRERIHLLEIMMGFFMLQCASYDIIFGHDL  250
            EWVVTEKLG+  K +   +  APRR   + L +RI L E+    F+  C  YD ++G + 
Sbjct  450  EWVVTEKLGDTLKNKSHSKSAAPRRSLSKFLGDRIQLQELGFALFLFICGCYDFLYGKNN  509

Query  249  FYIYLVLQALAFFAVGFSFVGTQVPT  172
            ++IYL LQ + F   GF ++GT VP+
Sbjct  510  YFIYLFLQVITFTIAGFGYIGTIVPS  535



>ref|XP_004137864.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
sativus]
 ref|XP_004170538.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
sativus]
 gb|KGN59050.1| hypothetical protein Csa_3G748790 [Cucumis sativus]
Length=532

 Score =   237 bits (605),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 105/203 (52%), Positives = 153/203 (75%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI K++RV+L+KK ++IY+FFFVRKIIAH   F F+C+ +P  +V+P
Sbjct  330  SCGPANLFRKMVMEIAKNKRVTLWKKVYVIYSFFFVRKIIAHINNFLFFCIALPATVVVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ +     +Y+P   TI+NA  T +SFHL + WI+FENVMSLHR KA IIGLLE +RAN
Sbjct  390  EVEIPTWGGVYIPTATTIINAIGTPKSFHLTIFWIMFENVMSLHRAKATIIGLLEGSRAN  449

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+  K + A +A ++   R+ +RIH+ E+ +G ++  C  Y++++G + F++
Sbjct  450  EWVVTEKLGDILKGKTASKATKKPIFRIGDRIHITELGVGAYLFFCGCYNMLYGENYFFV  509

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            +L++QA++FF VGF ++GT VP+
Sbjct  510  FLLVQAISFFIVGFGYIGTIVPS  532



>ref|XP_010558212.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Tarenaya 
hassleriana]
Length=526

 Score =   237 bits (604),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/202 (55%), Positives = 148/202 (73%), Gaps = 0/202 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+ ++ VS++KK H+IY+FF VRKI+AH VTF FYCVV+P  +++P
Sbjct  323  SCGPANLFRKMLFEIITNKNVSVWKKVHVIYSFFVVRKIVAHIVTFIFYCVVLPATVLVP  382

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ IT+LNA  T RS HLLV WI+FENVMSLHRTKA  IGLLEA R N
Sbjct  383  EVTVPKWGAVYIPSIITLLNAIGTPRSLHLLVFWIMFENVMSLHRTKATFIGLLEAGRVN  442

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EW+VTEKLG+A K +     P++   R  ERIH+LE+ +G ++      D++ G + +Y+
Sbjct  443  EWIVTEKLGDALKSKVKSPHPKKPRFRFGERIHVLEVGVGMYLFIVGCCDVMLGKNRYYL  502

Query  240  YLVLQALAFFAVGFSFVGTQVP  175
            YL  Q+ AFF +GF  VGT VP
Sbjct  503  YLFGQSFAFFVMGFGLVGTFVP  524



>ref|XP_010477641.1| PREDICTED: probable mannan synthase 3 [Camelina sativa]
 ref|XP_010477642.1| PREDICTED: probable mannan synthase 3 [Camelina sativa]
Length=556

 Score =   238 bits (606),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/203 (55%), Positives = 145/203 (71%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANL RKM  EIL++++VS +KK +LIY FFF+RKI+ H  TF FYC+++P +++ P
Sbjct  353  SCGPANLCRKMTMEILQNKKVSAWKKLYLIYNFFFIRKIVVHIFTFVFYCLILPTSVLFP  412

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            EL + K   +Y P TIT+LNA  T RSFHLLV WILFENVMS+HRTKA  IGLLEA R N
Sbjct  413  ELQVPKWATVYFPTTITLLNAIATPRSFHLLVFWILFENVMSMHRTKATFIGLLEAGRVN  472

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+  K +   +A  +   R  +RI+  E+++G ++  C  YD+ +G   FY+
Sbjct  473  EWVVTEKLGDTLKSKLITKATTKLYTRFGQRINWRELVVGLYIFLCGCYDVAYGRSYFYV  532

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL LQ+ AFF  G  F+GT VPT
Sbjct  533  YLFLQSCAFFVAGVGFIGTFVPT  555



>ref|XP_006424348.1| hypothetical protein CICLE_v10028164mg [Citrus clementina]
 gb|ESR37588.1| hypothetical protein CICLE_v10028164mg [Citrus clementina]
Length=537

 Score =   237 bits (605),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/208 (55%), Positives = 148/208 (71%), Gaps = 7/208 (3%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++++V  +KK ++IY+FFFVRKIIAH VTF FYCVV+P  I++P
Sbjct  330  SCGPANLFRKMVMEIIRNKKVKFWKKVYVIYSFFFVRKIIAHMVTFSFYCVVLPLTILVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ +    A+Y+P+ ITILN+  T RS HLL  WILFENVMSLHRTKA  IGLLEA RAN
Sbjct  390  EVQVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLHRTKATFIGLLEAGRAN  449

Query  420  EWVVTEKLGNA-------AKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIF  262
            EWVVTEKLG+A       AK +   +AP++   +  ER+H LE+  G F+  C  YD + 
Sbjct  450  EWVVTEKLGDALKNKAADAKNKTNTKAPKKPKIKFAERMHTLELGFGVFLFFCGCYDFVH  509

Query  261  GHDLFYIYLVLQALAFFAVGFSFVGTQV  178
            G + ++IYL LQ + F   GF ++GT V
Sbjct  510  GKNNYFIYLFLQTITFLIAGFGYIGTIV  537



>ref|XP_009122674.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Brassica 
rapa]
Length=532

 Score =   237 bits (604),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 149/203 (73%), Gaps = 1/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+ ++ V+L+KK H+IY+FF VRKI+AH VTF FYCVV+P  +++P
Sbjct  330  SCGPANLFRKMAFEIMTNKNVTLWKKVHVIYSFFVVRKIVAHIVTFIFYCVVLPATVLVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ IT+LNA  T RS HL+V WILFENVMSLHRTKA  IGLLE  R N
Sbjct  390  EVIVPKWGAVYIPSIITLLNAVGTPRSLHLMVFWILFENVMSLHRTKATFIGLLEGGRVN  449

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EW+VTEKLG+  K + A +AP++   R  +RIH+LE+ +G ++     YD +FG + +Y+
Sbjct  450  EWIVTEKLGD-LKAKSATKAPKKLRFRFGDRIHVLELGVGMYLFSIGCYDALFGKNHYYL  508

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL  QA+AFF  G   +GT VP 
Sbjct  509  YLFAQAIAFFIAGCGQIGTVVPN  531



>emb|CDX70286.1| BnaA10g26350D [Brassica napus]
Length=532

 Score =   237 bits (604),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 149/203 (73%), Gaps = 1/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+ ++ V+L+KK H+IY+FF VRKI+AH VTF FYCVV+P  +++P
Sbjct  330  SCGPANLFRKMAFEIMTNKNVTLWKKVHVIYSFFVVRKIVAHIVTFIFYCVVLPATVLVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ IT+LNA  T RS HL+V WILFENVMSLHRTKA  IGLLE  R N
Sbjct  390  EVIVPKWGAVYIPSIITLLNAVGTPRSLHLMVFWILFENVMSLHRTKATFIGLLEGGRVN  449

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EW+VTEKLG+  K + A +AP++   R  +RIH+LE+ +G ++     YD +FG + +Y+
Sbjct  450  EWIVTEKLGD-LKAKSATKAPKKLRFRFGDRIHVLELGVGMYLFSIGCYDALFGKNHYYL  508

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL  QA+AFF  G   +GT VP 
Sbjct  509  YLFAQAIAFFIAGCGQIGTVVPN  531



>ref|XP_011018871.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Populus 
euphratica]
Length=532

 Score =   237 bits (604),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 117/202 (58%), Positives = 150/202 (74%), Gaps = 1/202 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+ +++V+ +KK H+IY+FF VRKI+AH VTF FYCVV+P  +++P
Sbjct  330  SCGPANLFRKMLMEIITNKKVTSWKKVHVIYSFFLVRKIVAHLVTFIFYCVVLPATVLVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ ITILNA  T RS HLLV WILFENVMSLHRTKA  IGLLEA R N
Sbjct  390  EVEVPKWGAVYIPSIITILNAVGTPRSLHLLVFWILFENVMSLHRTKATFIGLLEAGRVN  449

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EW+VTEKLG+A K +    + + R  R  ER+HLLE+  G ++  C  YD++FG + ++I
Sbjct  450  EWIVTEKLGDALKSKANKASKKPR-FRFGERLHLLELGTGAYLFFCGCYDVVFGKNHYFI  508

Query  240  YLVLQALAFFAVGFSFVGTQVP  175
            YL  QA+AFF VG   VGT VP
Sbjct  509  YLYAQAIAFFIVGLGCVGTFVP  530



>ref|XP_006481909.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Citrus 
sinensis]
Length=533

 Score =   237 bits (604),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 121/202 (60%), Positives = 154/202 (76%), Gaps = 0/202 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++++VSL+KK H+IY+FFFVRKIIAH +TF  YCVV+P  +VIP
Sbjct  330  SCGPANLFRKMVMEIVRNKKVSLWKKVHVIYSFFFVRKIIAHIITFVLYCVVLPATVVIP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P  IT+LNA  T RS HLLV WILFENVMSLHRT A  IGLLE  R N
Sbjct  390  EVQVPKWAAVYIPTVITMLNAVGTPRSIHLLVFWILFENVMSLHRTMATFIGLLEGVRVN  449

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EW+VTEKLG A K + A +APR R     +RI+LLE+ +G F+  C  YD++FG++ ++I
Sbjct  450  EWIVTEKLGGALKAKAAAKAPRIRRFFFGDRIYLLELGVGAFLFSCGCYDVLFGNNHYFI  509

Query  240  YLVLQALAFFAVGFSFVGTQVP  175
            YL +QALAFF +GF +VG  VP
Sbjct  510  YLFVQALAFFVMGFGYVGIYVP  531



>ref|XP_008442792.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
melo]
Length=532

 Score =   236 bits (603),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 105/203 (52%), Positives = 154/203 (76%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI K+++V+L+KK ++IY+FFFVRKIIAH   F F+C+ +P  +V+P
Sbjct  330  SCGPANLFRKMVLEIAKNKKVTLWKKVYVIYSFFFVRKIIAHINNFLFFCIALPATVVVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + +   +Y+P   TI+NA  T +SFHL + WI+FENVMSLHR KA +IGLLE +RAN
Sbjct  390  EVAIPRWGGVYIPTATTIINAIGTPKSFHLTIFWIMFENVMSLHRAKATLIGLLEGSRAN  449

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+  K + A +A ++   R+ ERIH+ E+ +G ++  C  Y++++G + F++
Sbjct  450  EWVVTEKLGDILKGKTASKATKKPMFRIGERIHITELGVGAYLFFCGCYNMLYGENYFFV  509

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            +L++QA++FF VGF +VGT VP+
Sbjct  510  FLLVQAISFFIVGFGYVGTIVPS  532



>ref|XP_006661580.1| PREDICTED: mannan synthase 1-like [Oryza brachyantha]
Length=500

 Score =   236 bits (601),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 117/200 (59%), Positives = 147/200 (74%), Gaps = 8/200 (4%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKMF+E+L S RVS +KK HL+Y FFFVRK++AH VTF FYCVVIP  ++  
Sbjct  303  SCGPANLFRKMFREVLASGRVSPWKKLHLLYGFFFVRKVVAHLVTFCFYCVVIPACVLAG  362

Query  600  -ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRA  424
             ++ L K +A+Y+PA IT+LNAACT RS+HLL+ WILFENVMS+ R+KA +IGLLEA+RA
Sbjct  363  GDVRLPKYVALYVPAAITLLNAACTPRSWHLLIFWILFENVMSMQRSKATVIGLLEASRA  422

Query  423  NEWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFY  244
            NEWVVTEKLG         +            +H+ EI++G  +L CA YDI +G D FY
Sbjct  423  NEWVVTEKLGAKTTTTARKKTS-------GVHVHVAEILLGACLLYCAVYDIAYGRDSFY  475

Query  243  IYLVLQALAFFAVGFSFVGT  184
            IYL+LQ+ A F VGF +VGT
Sbjct  476  IYLLLQSAAAFIVGFGYVGT  495



>ref|XP_006484970.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Citrus 
sinensis]
Length=537

 Score =   236 bits (602),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 113/208 (54%), Positives = 148/208 (71%), Gaps = 7/208 (3%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++++V  +KK ++IY+FFFVRKIIAH VTF FYCVV+P  I++P
Sbjct  330  SCGPANLFRKMVMEIIRNKKVKFWKKVYVIYSFFFVRKIIAHMVTFSFYCVVLPLTILVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ +    A+Y+P+ ITILN+  T RS HLL  WILFENVMSLHRTKA  IGLLEA RAN
Sbjct  390  EVQVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLHRTKATFIGLLEAGRAN  449

Query  420  EWVVTEKLGNA-------AKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIF  262
            EWVVTEKLG+A       AK +   +AP++   +  +R+H LE+  G F+  C  YD + 
Sbjct  450  EWVVTEKLGDALKNKAADAKNKTNTKAPKKPKIKFADRMHTLELGFGVFLFFCGCYDFVH  509

Query  261  GHDLFYIYLVLQALAFFAVGFSFVGTQV  178
            G + ++IYL LQ + F   GF ++GT V
Sbjct  510  GKNNYFIYLFLQTITFLIAGFGYIGTIV  537



>ref|XP_006384673.1| glycosyl transferase family 2 family protein [Populus trichocarpa]
 gb|ERP62470.1| glycosyl transferase family 2 family protein [Populus trichocarpa]
Length=540

 Score =   236 bits (602),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 117/208 (56%), Positives = 152/208 (73%), Gaps = 5/208 (2%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI++++RV+ +KK ++IY+FFFVRKIIAH VTF FYCVV+P  I++P
Sbjct  332  SCGPANLFRKMVMEIVRNKRVNFWKKVYVIYSFFFVRKIIAHMVTFCFYCVVLPLTILVP  391

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ +    A+Y+P+ ITILN+  T RS HLL  WILFENVMSLHRTKAA+IGLLEA R N
Sbjct  392  EVKVPIWGAVYIPSVITILNSVGTPRSIHLLFYWILFENVMSLHRTKAALIGLLEAGRVN  451

Query  420  EWVVTEKLGN----AAKQRQA-VRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGH  256
            EWVVTEKLGN    AA  R+A  +APR+   +  +RI+ LE+    F+  C  YD + G 
Sbjct  452  EWVVTEKLGNTLQKAADARKANTKAPRKFRFKFTDRINTLELGFAAFLFLCGCYDFVNGK  511

Query  255  DLFYIYLVLQALAFFAVGFSFVGTQVPT  172
            + ++IYL LQ + FF  G  +VGT +P+
Sbjct  512  NNYFIYLWLQTVTFFITGIGYVGTIIPS  539



>ref|XP_003560565.2| PREDICTED: probable mannan synthase 9 [Brachypodium distachyon]
Length=488

 Score =   235 bits (599),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 110/202 (54%), Positives = 149/202 (74%), Gaps = 0/202 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  +I+++++V+L++K H+IY FF VRKII H VTF F C+VIP  +++P
Sbjct  286  SCGPANLFRKMLMDIVRNKKVTLWRKIHVIYNFFLVRKIIGHVVTFVFCCLVIPATVLVP  345

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K   IY+P+ IT+LNA  T RS HLLV W LFENVMSLHRTKA  IGLLE  R N
Sbjct  346  EVEIPKWGYIYIPSIITLLNAVGTPRSVHLLVFWTLFENVMSLHRTKATFIGLLEIGRVN  405

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A K +   + P++   R+ ER+HLLE+ +  ++  C  YDI FG++ ++I
Sbjct  406  EWVVTEKLGDALKMKTPSKVPKKLRMRIGERLHLLELGVAAYLFFCGCYDISFGNNHYFI  465

Query  240  YLVLQALAFFAVGFSFVGTQVP  175
            +L +Q++ FF VG  +VGT VP
Sbjct  466  FLFMQSITFFVVGVGYVGTFVP  487



>ref|XP_002453460.1| hypothetical protein SORBIDRAFT_04g006260 [Sorghum bicolor]
 gb|EES06436.1| hypothetical protein SORBIDRAFT_04g006260 [Sorghum bicolor]
Length=521

 Score =   236 bits (601),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 150/203 (74%), Gaps = 1/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+ +++V+++KK H+IY FF +RKIIAH +TF FYC+VIP  I +P
Sbjct  317  SCGPANLFRKMLMEIVTNKKVTIWKKIHVIYNFFLIRKIIAHIITFSFYCLVIPATIFVP  376

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K   +Y+P+ IT++N+  T RSFHLL  W+ FENVMSLHRTKA +IGLLEA RAN
Sbjct  377  EVRIPKWGCVYIPSAITLMNSVGTPRSFHLLFFWVAFENVMSLHRTKATLIGLLEAGRAN  436

Query  420  EWVVTEKLGNAAKQRQAVRAP-RRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFY  244
            EWVVT KLG+A K + A +A  R++  R+ ER+H+ E+ +  F+  C  YD  +G D F+
Sbjct  437  EWVVTAKLGSAMKMKAANKAGLRKQFMRIWERLHVTELGVAAFLFSCGWYDFAYGRDHFF  496

Query  243  IYLVLQALAFFAVGFSFVGTQVP  175
            IYL  Q++AFF VG  +VGT VP
Sbjct  497  IYLFFQSVAFFIVGIGYVGTIVP  519



>gb|EMS50576.1| hypothetical protein TRIUR3_00182 [Triticum urartu]
Length=505

 Score =   235 bits (599),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 116/207 (56%), Positives = 151/207 (73%), Gaps = 7/207 (3%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVI-  604
            SCGPANL RKMF EI+ S +VS +KK H++Y FFFVRK++AH VTF FYCVVIP  +++ 
Sbjct  299  SCGPANLMRKMFWEIVASRQVSAWKKVHVLYGFFFVRKVVAHLVTFLFYCVVIPAYVLVG  358

Query  603  -PELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANR  427
              ++ L K +A+Y+PA IT+LNA CT RS+HLLV WILFENVMS+HR+KA IIGL+EA+R
Sbjct  359  GQDVRLPKYVAMYVPAIITLLNAVCTPRSWHLLVFWILFENVMSMHRSKATIIGLVEASR  418

Query  426  ANEWVVTEKLGNAAKQRQAVRAPRRRTCRLRER-----IHLLEIMMGFFMLQCASYDIIF  262
            ANEWVVTEKLG+      A          ++++     I   EI+MG  +L CA YDI F
Sbjct  419  ANEWVVTEKLGSVTSTPAATTTMATNKGAMKKKKSQSSILAPEIVMGLCLLYCAVYDIFF  478

Query  261  GHDLFYIYLVLQALAFFAVGFSFVGTQ  181
            GHD FY+YL++Q+ A F +GF +VG+Q
Sbjct  479  GHDHFYVYLLMQSAAAFVIGFGYVGSQ  505



>ref|XP_003539806.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Glycine 
max]
 gb|KHN21108.1| Glucomannan 4-beta-mannosyltransferase 2 [Glycine soja]
Length=543

 Score =   236 bits (601),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 119/214 (56%), Positives = 151/214 (71%), Gaps = 13/214 (6%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++++V  +KK ++IY+FFFVRKIIAH VTFFFYCVVIP  I++P
Sbjct  330  SCGPANLFRKMVMEIVRNKKVKFWKKVYVIYSFFFVRKIIAHMVTFFFYCVVIPLTILVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+H+    A+Y+P+ ITILN+  T RS HLL  WILFENVMSLHRTKA  IGLLE  RAN
Sbjct  390  EVHVPIWGAVYIPSVITILNSVGTPRSIHLLFYWILFENVMSLHRTKATFIGLLEYGRAN  449

Query  420  EWVVTEKL------------GNAAKQRQAVRA-PRRRTCRLRERIHLLEIMMGFFMLQCA  280
            EWVVTEKL            G+AAK+  A++A P++   +  ER++LLE+    F+  C 
Sbjct  450  EWVVTEKLGDSVNNNNKNKSGDAAKKNNAIKATPKKTRSKFVERLNLLELGFAVFLFVCG  509

Query  279  SYDIIFGHDLFYIYLVLQALAFFAVGFSFVGTQV  178
             YD + G   ++IYL LQ L F  VGF +VGT V
Sbjct  510  CYDYVHGKHNYFIYLFLQTLTFSIVGFGYVGTIV  543



>gb|EYU36101.1| hypothetical protein MIMGU_mgv1a0044822mg, partial [Erythranthe 
guttata]
Length=406

 Score =   232 bits (592),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 110/203 (54%), Positives = 145/203 (71%), Gaps = 1/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  +I  +++V+LYKKF++IY+FFFVRKIIAH  TF FYCVV+P  I++P
Sbjct  202  SCGPANLFRKMMMDIAMNKKVTLYKKFYVIYSFFFVRKIIAHMFTFVFYCVVLPLTILVP  261

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+++ K  AIYLP  IT+LN+  T RSFHLL  W+LFENVMS HRTKA IIGLLEA R N
Sbjct  262  EVYVPKWGAIYLPCIITLLNSVGTPRSFHLLFYWVLFENVMSFHRTKATIIGLLEAKRVN  321

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCR-LRERIHLLEIMMGFFMLQCASYDIIFGHDLFY  244
            EWVVTEKLG+  K +    APRR   + + +R+ + E+     +     YD ++G + ++
Sbjct  322  EWVVTEKLGDTLKNKSKSSAPRRSLSKFIGDRVLVHELGFAVLLFVSGCYDFLYGKNYYF  381

Query  243  IYLVLQALAFFAVGFSFVGTQVP  175
            +YL LQ + F   GF ++GT VP
Sbjct  382  VYLFLQTITFTIAGFGYIGTIVP  404



>ref|XP_010498857.1| PREDICTED: probable mannan synthase 3 [Camelina sativa]
 ref|XP_010498858.1| PREDICTED: probable mannan synthase 3 [Camelina sativa]
Length=555

 Score =   236 bits (602),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 110/203 (54%), Positives = 144/203 (71%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANL RKM  EIL++++VS +KK +LIY FFF+RKI+ H  TF FYC+++P  ++ P
Sbjct  352  SCGPANLCRKMTMEILQNKKVSAWKKLYLIYNFFFIRKIVVHIFTFVFYCLILPTTVLFP  411

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            EL + K   +Y P TIT+LNA  T RSFHLLV WILFENVMS+HRTKA  IGLLEA R N
Sbjct  412  ELQVPKWATVYFPTTITLLNAIATPRSFHLLVFWILFENVMSMHRTKATFIGLLEAGRVN  471

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+  K +   +A  +   R  +R++  E+++G ++  C  YD+ +G   FY+
Sbjct  472  EWVVTEKLGDTLKSKLITKATTKLYTRFGQRLNWRELVVGLYIFLCGCYDVAYGRSYFYV  531

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL LQ+ AFF  G  F+GT VPT
Sbjct  532  YLFLQSCAFFVAGVGFIGTFVPT  554



>ref|XP_006398833.1| hypothetical protein EUTSA_v10013220mg [Eutrema salsugineum]
 dbj|BAJ34228.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ40286.1| hypothetical protein EUTSA_v10013220mg [Eutrema salsugineum]
Length=532

 Score =   235 bits (600),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 110/203 (54%), Positives = 148/203 (73%), Gaps = 1/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+ ++ V+L+KK H+IY+FF VRK++AH VTF FYCV++P  +++P
Sbjct  330  SCGPANLFRKMAFEIMTNKNVTLWKKVHVIYSFFVVRKLVAHIVTFIFYCVILPATVLVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ IT+LNA  T RS HL+V WILFENVMSLHRTKA  IGLLE  R N
Sbjct  390  EVSVPKWGAVYIPSVITLLNAVGTPRSLHLMVFWILFENVMSLHRTKATFIGLLEGGRVN  449

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EW+VTEKLG+  K + A + P++   R  +RIH+LE+ +G ++     YD  FG + +Y+
Sbjct  450  EWIVTEKLGD-LKAKSATKTPKKLRFRFGDRIHVLELGVGMYLFFVGCYDAFFGKNHYYL  508

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL  QA+AFF  GF  +GT VP 
Sbjct  509  YLFAQAIAFFIAGFGQIGTFVPN  531



>ref|XP_006307154.1| hypothetical protein CARUB_v10008745mg [Capsella rubella]
 gb|EOA40052.1| hypothetical protein CARUB_v10008745mg [Capsella rubella]
Length=555

 Score =   236 bits (601),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 110/203 (54%), Positives = 144/203 (71%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANL+RKM  EIL++++VS +KK +LIY FFF+RKI+ H  TF FYC+++P  ++ P
Sbjct  352  SCGPANLWRKMTMEILQNKKVSAWKKLYLIYNFFFIRKIVVHIFTFVFYCLILPTTVLFP  411

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            EL + K   +Y P TITILNA  T RSFHLLV WILFENVMS+HRTKA  IGLLEA R N
Sbjct  412  ELQVPKWATVYFPTTITILNAIATPRSFHLLVFWILFENVMSMHRTKATFIGLLEAGRVN  471

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+  K +   +A  +   R  +R++  E+++G ++  C  YD  +G   FY+
Sbjct  472  EWVVTEKLGDTLKSKLIAKATTKLYTRFGQRLNWRELVVGLYIFLCGCYDFAYGGSYFYV  531

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL LQ+ AFF  G  ++GT VPT
Sbjct  532  YLFLQSCAFFVAGVGYIGTFVPT  554



>ref|XP_006381326.1| hypothetical protein POPTR_0006s11810g [Populus trichocarpa]
 gb|ERP59123.1| hypothetical protein POPTR_0006s11810g [Populus trichocarpa]
Length=532

 Score =   235 bits (600),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 118/202 (58%), Positives = 150/202 (74%), Gaps = 1/202 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKMF EI+ ++ ++ +KK H+IY+FF VRKI+AH VTF FYCVV+P  +++P
Sbjct  330  SCGPANLFRKMFMEIITNKAMTSWKKVHVIYSFFLVRKIVAHLVTFIFYCVVLPATVLVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ ITILNA  T RS HLLV WILFENVMSLHRTKA  IGLLEA R N
Sbjct  390  EVEVPKWGAVYIPSIITILNAVGTPRSLHLLVFWILFENVMSLHRTKATFIGLLEAGRVN  449

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EW+VTEKLG+A K +    A + R  R  ER+HLLE+  G ++  C  YD++FG + ++I
Sbjct  450  EWIVTEKLGDALKSKANKAAKKPR-FRFGERLHLLELGTGAYLFFCGCYDVVFGKNHYFI  508

Query  240  YLVLQALAFFAVGFSFVGTQVP  175
            YL  QA+AFF VG   VGT VP
Sbjct  509  YLYAQAIAFFIVGLGCVGTIVP  530



>ref|XP_003538146.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Glycine 
max]
Length=542

 Score =   235 bits (600),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 119/213 (56%), Positives = 151/213 (71%), Gaps = 12/213 (6%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++++V  +KK ++IY+FFFVRKIIAH VTFFFYCVVIP  I++P
Sbjct  330  SCGPANLFRKMVMEIVRNKKVRFWKKVYVIYSFFFVRKIIAHMVTFFFYCVVIPLTILVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+H+    A+Y+P+ ITILN+  T RS HLL  WILFENVMSLHRTKA  IGLLE  RAN
Sbjct  390  EVHVPIWGAVYIPSVITILNSVGTPRSIHLLFYWILFENVMSLHRTKATFIGLLEYGRAN  449

Query  420  EWVVTEKL-----------GNAAKQRQAVRA-PRRRTCRLRERIHLLEIMMGFFMLQCAS  277
            EWVVTEKL           G+AAK+  A++A P++   +  ER++LLE+    F+  C  
Sbjct  450  EWVVTEKLGDSVNNNKNKSGDAAKKNNAIKATPKKTRSKFVERLNLLELGFAAFLFVCGC  509

Query  276  YDIIFGHDLFYIYLVLQALAFFAVGFSFVGTQV  178
            YD + G   ++IYL LQ L F  VGF +VGT V
Sbjct  510  YDYVHGKHNYFIYLFLQTLTFSIVGFGYVGTIV  542



>emb|CAB10434.1| cellulose synthase like protein [Arabidopsis thaliana]
 emb|CAB78701.1| cellulose synthase like protein [Arabidopsis thaliana]
Length=351

 Score =   230 bits (586),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/199 (53%), Positives = 148/199 (74%), Gaps = 2/199 (1%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+ ++RVS++KKF++IY+FFFVRK+  H++TFFFYC+++P ++  P
Sbjct  155  SCGPANLFRKMTMEIIFNKRVSIWKKFYVIYSFFFVRKVAVHFLTFFFYCIIVPTSVFFP  214

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+H+     IY+P+ I+I +   T RSF+L++ W+LFENVM++HRTK   IGLLE  R N
Sbjct  215  EIHIPSWSTIYVPSLISIFHTLATPRSFYLVIFWVLFENVMAMHRTKGTCIGLLEGGRVN  274

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A K +   R  +R++C   +R++  E+M+G ++L CA Y +I+GH   + 
Sbjct  275  EWVVTEKLGDALKSKLLSRVVQRKSC--YQRVNSKEVMVGVYILGCALYGLIYGHTWLHF  332

Query  240  YLVLQALAFFAVGFSFVGT  184
            YL LQA AFF  GF FVGT
Sbjct  333  YLFLQATAFFVSGFGFVGT  351



>gb|KHN38673.1| Glucomannan 4-beta-mannosyltransferase 2 [Glycine soja]
Length=543

 Score =   235 bits (599),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 119/214 (56%), Positives = 151/214 (71%), Gaps = 13/214 (6%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++++V  +KK ++IY+FFFVRKIIAH VTFFFYCVVIP  I++P
Sbjct  330  SCGPANLFRKMVMEIVRNKKVRFWKKVYVIYSFFFVRKIIAHMVTFFFYCVVIPLTILVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+H+    A+Y+P+ ITILN+  T RS HLL  WILFENVMSLHRTKA  IGLLE  RAN
Sbjct  390  EVHVPIWGAVYIPSVITILNSVGTPRSIHLLFYWILFENVMSLHRTKATFIGLLEYGRAN  449

Query  420  EWVVTEKL------------GNAAKQRQAVRA-PRRRTCRLRERIHLLEIMMGFFMLQCA  280
            EWVVTEKL            G+AAK+  A++A P++   +  ER++LLE+    F+  C 
Sbjct  450  EWVVTEKLGDSVNNNNKNKSGDAAKKNNAIKATPKKTRSKFVERLNLLELGFAAFLFVCG  509

Query  279  SYDIIFGHDLFYIYLVLQALAFFAVGFSFVGTQV  178
             YD + G   ++IYL LQ L F  VGF +VGT V
Sbjct  510  CYDYVHGKHNYFIYLFLQTLTFSIVGFGYVGTIV  543



>ref|XP_006416081.1| hypothetical protein EUTSA_v10007266mg [Eutrema salsugineum]
 gb|ESQ34434.1| hypothetical protein EUTSA_v10007266mg [Eutrema salsugineum]
Length=555

 Score =   234 bits (598),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/203 (54%), Positives = 144/203 (71%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANL+RKM  EIL++++VS +KK +LIY FFF+RKI+ H  TF FYC+++P  ++ P
Sbjct  352  SCGPANLWRKMTMEILQNKKVSAWKKLYLIYNFFFIRKIVVHIFTFVFYCLILPTIVLFP  411

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            EL + K   +Y+P TITILNA  T RS HLLV WILFENVMS+HRTKA  IGLLEA R N
Sbjct  412  ELQVPKWATVYVPTTITILNALATPRSLHLLVFWILFENVMSMHRTKATFIGLLEAGRVN  471

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+  + +   +A  +   R  +RI+  E+++G ++  C  YD  +G   FY+
Sbjct  472  EWVVTEKLGDTLRSKLIAKATTKLYTRFGQRINWRELVVGLYIFLCGCYDFAYGGSYFYV  531

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL LQA AFF  G  ++GT VPT
Sbjct  532  YLFLQACAFFVAGVGYIGTIVPT  554



>ref|XP_009337395.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Pyrus 
x bretschneideri]
Length=549

 Score =   234 bits (596),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 115/220 (52%), Positives = 152/220 (69%), Gaps = 18/220 (8%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++++V+L+KKF+ IY+FFFVRKIIAH VTFFFYCVV+P  I++P
Sbjct  330  SCGPANLFRKMAMEIIRTKKVTLWKKFYTIYSFFFVRKIIAHMVTFFFYCVVLPLTILVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+++    A+Y+P+ ITILN+  T RS HLL  WILFENVMSLHRTKA +IGLLE  R+N
Sbjct  390  EVYVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLHRTKATLIGLLETARSN  449

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTC-----------------RLRERIHLLEIMMGFFM  292
            EWVVTEKLG+  K + A  A + +T                  +   R+HLLE+  G F+
Sbjct  450  EWVVTEKLGDIVKNK-AAEAAKNKTADANKTKPASKLFKKPRFKFGNRLHLLELGFGVFL  508

Query  291  LQCASYDIIFGHDLFYIYLVLQALAFFAVGFSFVGTQVPT  172
              C  YD + G + ++IYL LQ + F   GF +VGT +P+
Sbjct  509  FICGCYDFVHGKNNYFIYLFLQTITFLICGFGYVGTIIPS  548



>ref|XP_002873112.1| ATCSLA09 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49371.1| ATCSLA09 [Arabidopsis lyrata subsp. lyrata]
Length=534

 Score =   233 bits (595),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 111/204 (54%), Positives = 149/204 (73%), Gaps = 2/204 (1%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+ ++ V+L+KK H+IY+FF VRK++AH VTF FYCV++P  +++P
Sbjct  331  SCGPANLFRKMAFEIMTNKNVTLWKKVHVIYSFFVVRKLVAHIVTFIFYCVILPATVLVP  390

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ IT+LNA  T RS HL+V WILFENVMSLHRTKA  IGLLE  R N
Sbjct  391  EVSVPKWGAVYIPSVITLLNAVGTPRSLHLMVFWILFENVMSLHRTKATFIGLLEGGRVN  450

Query  420  EWVVTEKLGNAAKQRQAVRAPRR-RTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFY  244
            EW+VTEKLG+  K + A + P++    R  +RIH+LE+ +G ++L    YD  FG + +Y
Sbjct  451  EWIVTEKLGD-VKAKSATKTPKKVLRFRFGDRIHVLELGVGMYLLFVGCYDAFFGKNHYY  509

Query  243  IYLVLQALAFFAVGFSFVGTQVPT  172
            +YL  QA+AFF  GF  +GT VP 
Sbjct  510  LYLFAQAIAFFIAGFGQIGTIVPN  533



>ref|NP_193392.3| cellulose synthase-like A01 [Arabidopsis thaliana]
 gb|AEE83774.1| cellulose synthase-like A01 [Arabidopsis thaliana]
 gb|AHL38690.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=401

 Score =   229 bits (585),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 105/199 (53%), Positives = 148/199 (74%), Gaps = 2/199 (1%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+ ++RVS++KKF++IY+FFFVRK+  H++TFFFYC+++P ++  P
Sbjct  205  SCGPANLFRKMTMEIIFNKRVSIWKKFYVIYSFFFVRKVAVHFLTFFFYCIIVPTSVFFP  264

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+H+     IY+P+ I+I +   T RSF+L++ W+LFENVM++HRTK   IGLLE  R N
Sbjct  265  EIHIPSWSTIYVPSLISIFHTLATPRSFYLVIFWVLFENVMAMHRTKGTCIGLLEGGRVN  324

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A K +   R  +R++C   +R++  E+M+G ++L CA Y +I+GH   + 
Sbjct  325  EWVVTEKLGDALKSKLLSRVVQRKSC--YQRVNSKEVMVGVYILGCALYGLIYGHTWLHF  382

Query  240  YLVLQALAFFAVGFSFVGT  184
            YL LQA AFF  GF FVGT
Sbjct  383  YLFLQATAFFVSGFGFVGT  401



>ref|XP_008647195.1| PREDICTED: uncharacterized protein LOC103628848 [Zea mays]
Length=949

 Score =   239 bits (610),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 112/202 (55%), Positives = 152/202 (75%), Gaps = 3/202 (1%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRK   EI+++++V+L+KK H+IY FF VRKI+AH VTF FYC+VIP  +++P
Sbjct  750  SCGPANLFRKTLVEIVRNKKVTLWKKIHVIYNFFLVRKIVAHAVTFVFYCIVIPTTVLVP  809

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  ++Y+P  IT+L+A  T RS HL+V W LFENVMSLHRTKA  IGLLEA R N
Sbjct  810  EVQVPKWGSVYIPTVITLLSAVATPRSAHLVVFWTLFENVMSLHRTKATFIGLLEAGRVN  869

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A + +   + PR    R+ +R+H+LE+ +  ++L C  YDI FG++ +YI
Sbjct  870  EWVVTEKLGDALRTKVPGKKPR---MRIGDRLHVLELGVAAYLLFCGCYDIAFGNNRYYI  926

Query  240  YLVLQALAFFAVGFSFVGTQVP  175
            +L LQ++AFF VG  +VGT VP
Sbjct  927  FLFLQSIAFFIVGIGYVGTFVP  948



>ref|NP_001031084.1| putative mannan synthase 3 [Arabidopsis thaliana]
 gb|AEE30393.1| putative mannan synthase 3 [Arabidopsis thaliana]
Length=484

 Score =   232 bits (591),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 109/203 (54%), Positives = 143/203 (70%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANL+RKM  EIL++++VS +KK +LIY FFF+RKI+ H  TF FYC+++P  ++ P
Sbjct  281  SCGPANLWRKMTMEILQNKKVSAWKKLYLIYNFFFIRKIVVHIFTFVFYCLILPTTVLFP  340

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            EL + K   +Y P TITILNA  T RS HLLV WILFENVMS+HRTKA  IGLLEA R N
Sbjct  341  ELQVPKWATVYFPTTITILNAIATPRSLHLLVFWILFENVMSMHRTKATFIGLLEAGRVN  400

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+  K +   +A  +   R  +R++  E+++G ++  C  YD  +G   FY+
Sbjct  401  EWVVTEKLGDTLKSKLIGKATTKLYTRFGQRLNWRELVVGLYIFFCGCYDFAYGGSYFYV  460

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL LQ+ AFF  G  ++GT VPT
Sbjct  461  YLFLQSCAFFVAGVGYIGTFVPT  483



>ref|XP_010490868.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Camelina 
sativa]
Length=534

 Score =   233 bits (593),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 110/204 (54%), Positives = 150/204 (74%), Gaps = 2/204 (1%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+ ++ V+L+KK H+IY+FF VRK++AH VTF FYCV++P  +++P
Sbjct  331  SCGPANLFRKMAFEIMTNKNVTLWKKVHVIYSFFVVRKLVAHIVTFIFYCVILPATVLVP  390

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ IT+LNA  T RS HL+V WILFENVMSLHRTKA  IGLLE  R N
Sbjct  391  EVSVPKWGAVYIPSVITLLNAVGTPRSLHLMVFWILFENVMSLHRTKATFIGLLEGGRVN  450

Query  420  EWVVTEKLGNAAKQRQAVRAPRR-RTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFY  244
            EW+VTEKLG+  K + + + P++    R  +RIH+LE+ +G ++L    YD+ FG + +Y
Sbjct  451  EWIVTEKLGD-LKAKSSGKTPKKLLRFRFGDRIHVLELGVGMYLLFVGCYDVFFGKNHYY  509

Query  243  IYLVLQALAFFAVGFSFVGTQVPT  172
            +YL  QA+AFF  GF  +GT VP 
Sbjct  510  LYLFAQAIAFFIAGFGQIGTIVPN  533



>ref|XP_009115523.1| PREDICTED: probable mannan synthase 3 [Brassica rapa]
 ref|XP_009115524.1| PREDICTED: probable mannan synthase 3 [Brassica rapa]
Length=555

 Score =   233 bits (594),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 109/202 (54%), Positives = 144/202 (71%), Gaps = 0/202 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANL+RKM  EIL++++VS +KK +LIY FFF+RKI+ H  TF FYC+++P  ++ P
Sbjct  352  SCGPANLWRKMTMEILQNKKVSAWKKLYLIYNFFFIRKIVVHIFTFVFYCLILPATVLFP  411

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            EL + K   +Y+P+TIT+LNA  T RS HLLV WILFENVMS+HRTKA  IGLLEA R N
Sbjct  412  ELQVPKWATVYVPSTITLLNALATPRSLHLLVFWILFENVMSMHRTKATFIGLLEAGRVN  471

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+  K +   +A  +   R  +RI+  E+++G ++  C  YD  +G   FY+
Sbjct  472  EWVVTEKLGDTLKSKLITKATTKLYTRFGQRINWRELVVGLYIFICGCYDFAYGGSYFYV  531

Query  240  YLVLQALAFFAVGFSFVGTQVP  175
            YL LQA AFF  G  ++GT VP
Sbjct  532  YLFLQACAFFVAGVGYIGTIVP  553



>gb|KDP34366.1| hypothetical protein JCGZ_11249 [Jatropha curcas]
Length=538

 Score =   233 bits (593),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 110/208 (53%), Positives = 150/208 (72%), Gaps = 5/208 (2%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++++V  +KK ++IY+FFFVRKIIAH VTF+FYCVV+P  I++P
Sbjct  330  SCGPANLFRKMVMEIVRNKKVRFWKKVYVIYSFFFVRKIIAHMVTFWFYCVVLPLTILVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ +    A+Y+P+ ITILN+  T RS HLL  WILFENVMSLHRTKA +IGLLEA RAN
Sbjct  390  EVKVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLHRTKATLIGLLEAGRAN  449

Query  420  EWVVTEKLG-----NAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGH  256
            EWVVTEKLG     NA  ++  ++ PR+   +  +R++ LE+    F+  C  YD + G 
Sbjct  450  EWVVTEKLGNTLQKNAEAKKNNLKPPRKLRFKFGDRLNTLELGFAAFLFLCGCYDFVNGK  509

Query  255  DLFYIYLVLQALAFFAVGFSFVGTQVPT  172
            + +++YL LQ + FF  G  +VGT +P+
Sbjct  510  NNYFVYLFLQTITFFITGIGYVGTIIPS  537



>ref|XP_008385455.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2 [Malus domestica]
Length=549

 Score =   233 bits (594),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 151/219 (69%), Gaps = 16/219 (7%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++++V+++KKF+ IY+FFFVRKIIAH VTFFFYCVV+P  I++P
Sbjct  330  SCGPANLFRKMAMEIIRTKKVTVWKKFYTIYSFFFVRKIIAHMVTFFFYCVVLPLTILVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+++    A+Y+P+ ITILN+  T RS HLL  WILFENVMSLHRTKA +IGLLE  R+N
Sbjct  390  EVYVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLHRTKATLIGLLETARSN  449

Query  420  EWVVTEKLGNAAKQRQAVRAP----------------RRRTCRLRERIHLLEIMMGFFML  289
            EWVVTEKLG+  K + A  A                 +R   +   R+HLLE+  G F+ 
Sbjct  450  EWVVTEKLGDIVKNKAAEAAKNKTADANKTKPASKLFKRPRFKFGNRLHLLELGFGVFLF  509

Query  288  QCASYDIIFGHDLFYIYLVLQALAFFAVGFSFVGTQVPT  172
             C  YD + G + ++IYL LQ + F   GF +VGT +P+
Sbjct  510  ICGCYDFVHGKNNYFIYLFLQTITFLICGFGYVGTIIPS  548



>gb|AFZ78579.1| cellulose synthase-like protein [Populus tomentosa]
Length=540

 Score =   233 bits (593),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 116/208 (56%), Positives = 149/208 (72%), Gaps = 5/208 (2%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI++++RV  +KK ++IY+FFFVRKIIAH VTF FYCVV+P  I++P
Sbjct  332  SCGPANLFRKMVMEIVRNKRVKFWKKVYVIYSFFFVRKIIAHMVTFCFYCVVLPLTILVP  391

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ +    A+Y+P+ ITILN+  T RS HLL  WILFENVMSLHRTKA +IGLLEA R N
Sbjct  392  EVKVPIWGAVYIPSVITILNSVGTPRSIHLLFYWILFENVMSLHRTKATLIGLLEAGRVN  451

Query  420  EWVVTEKLGN----AAKQRQA-VRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGH  256
            EWVVTEKLGN    AA  R+A  +APR+   +  ER++ LE+    F+  C  YD + G 
Sbjct  452  EWVVTEKLGNTLQKAADARKANTKAPRKFRFKFTERLNTLELGFAAFLFLCGCYDFVNGK  511

Query  255  DLFYIYLVLQALAFFAVGFSFVGTQVPT  172
            + ++IYL LQ + FF  G  +VGT  P+
Sbjct  512  NNYFIYLWLQTVTFFITGIGYVGTIFPS  539



>emb|CDY44151.1| BnaA09g31010D [Brassica napus]
Length=555

 Score =   233 bits (594),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/202 (54%), Positives = 144/202 (71%), Gaps = 0/202 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANL+RKM  EIL++++VS +KK +LIY FFF+RKI+ H  TF FYC+++P  ++ P
Sbjct  352  SCGPANLWRKMTMEILQNKKVSAWKKLYLIYNFFFIRKIVVHIFTFVFYCLILPATVLFP  411

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            EL + K   +Y+P+TIT+LNA  T RS HLLV WILFENVMS+HRTKA  IGLLEA R N
Sbjct  412  ELQVPKWATVYVPSTITLLNALATPRSLHLLVFWILFENVMSMHRTKATFIGLLEAGRVN  471

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+  K +   +A  +   R  +RI+  E+++G ++  C  YD  +G   FY+
Sbjct  472  EWVVTEKLGDTLKSKLIAKATTKLYTRFGQRINWRELVVGLYIFICGCYDFAYGGSYFYV  531

Query  240  YLVLQALAFFAVGFSFVGTQVP  175
            YL LQA AFF  G  ++GT VP
Sbjct  532  YLFLQACAFFVAGVGYIGTIVP  553



>ref|XP_010452272.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Camelina 
sativa]
Length=534

 Score =   232 bits (592),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/204 (54%), Positives = 149/204 (73%), Gaps = 2/204 (1%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+ ++ V+L+KK H+IY+FF VRK++AH VTF FYCV++P  +++P
Sbjct  331  SCGPANLFRKMAFEIMTNKNVTLWKKVHVIYSFFVVRKLVAHIVTFIFYCVILPATVLVP  390

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ IT+LNA  T RS HL+V WILFENVMSLHRTKA  IGLLE  R N
Sbjct  391  EVSVPKWGAVYIPSVITLLNAVGTPRSLHLMVFWILFENVMSLHRTKATFIGLLEGGRVN  450

Query  420  EWVVTEKLGNAAKQRQAVRAPRR-RTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFY  244
            EW+VTEKLG+  K + A + P++    R  +RIH+LE+ +G ++L    YD  FG + +Y
Sbjct  451  EWIVTEKLGD-LKAKSASKTPKKLLRFRFGDRIHVLELGVGMYLLFVGCYDAFFGKNHYY  509

Query  243  IYLVLQALAFFAVGFSFVGTQVPT  172
            +YL  QA+AFF  GF  +GT VP 
Sbjct  510  LYLFAQAIAFFIAGFGQIGTIVPN  533



>ref|XP_010937165.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 1-like [Elaeis 
guineensis]
Length=541

 Score =   233 bits (593),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/203 (51%), Positives = 152/203 (75%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  +I+K+++VS++KKF++IY+FF  R++++++VTFFFYCVVIP ++  P
Sbjct  337  SCGPANLFRKMLCDIVKAKKVSIWKKFYVIYSFFLARRVLSNFVTFFFYCVVIPLSVFFP  396

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + +   +Y+P+TITILNA  T  SFHL++ WILFENVMSLHR KA IIGLLEA RAN
Sbjct  397  EVKIPRWGMVYIPSTITILNAVGTPSSFHLIIFWILFENVMSLHRCKAVIIGLLEAGRAN  456

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+  K +  ++  ++   +  ER+H LE+ +  +++ CA YD  F  D +++
Sbjct  457  EWVVTEKLGDLLKTKSNIKVAKKYRSKFWERLHFLELGLAVYLMICACYDYYFRKDYYFV  516

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
             L  QA+AF  +G  ++GT +P+
Sbjct  517  ILFPQAMAFVIMGVGYIGTIIPS  539



>ref|XP_002870144.1| hypothetical protein ARALYDRAFT_915064 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46403.1| hypothetical protein ARALYDRAFT_915064 [Arabidopsis lyrata subsp. 
lyrata]
Length=553

 Score =   233 bits (593),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/199 (53%), Positives = 149/199 (75%), Gaps = 2/199 (1%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++++VS++KKF++IY+FFFVRK+  H++TFFFYC+++P ++  P
Sbjct  357  SCGPANLFRKMTMEIIRNKKVSIWKKFYVIYSFFFVRKVAVHFLTFFFYCIIVPTSVFFP  416

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+++     IY+P+ ITI +   T RSF+L++ WILFENVM++HRTK   IGLLE  R N
Sbjct  417  EIYIPSWSTIYIPSLITIFHTMATPRSFYLVIFWILFENVMAMHRTKGTCIGLLEGGRVN  476

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A K +   R  +R++C   ER++  E+M+G ++L CA Y +I+GH   + 
Sbjct  477  EWVVTEKLGDALKNKLLSRVVQRKSC--YERVNSKEVMVGVYILGCALYGLIYGHTWLHF  534

Query  240  YLVLQALAFFAVGFSFVGT  184
            YL LQA AFF  GF FVGT
Sbjct  535  YLFLQATAFFVSGFGFVGT  553



>emb|CDY11268.1| BnaA03g01040D [Brassica napus]
Length=532

 Score =   232 bits (591),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/203 (54%), Positives = 147/203 (72%), Gaps = 1/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+ ++ V+L+KK H+IY+FF VRKI+AH VTF FYCVV+P  +++P
Sbjct  330  SCGPANLFRKMALEIMTNKNVTLWKKVHVIYSFFVVRKIVAHIVTFIFYCVVLPATVLVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ IT+LNA  T RS HL+V WILFENVMSLHRTKA  IGLLE  R N
Sbjct  390  EVTVPKWGAVYIPSIITLLNAVGTPRSLHLMVFWILFENVMSLHRTKATFIGLLEGGRVN  449

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EW+VTEKLG+  K + A +  ++   R  +RIH+LE+ +G ++     YD+ FG + +Y+
Sbjct  450  EWIVTEKLGD-LKAKSATKTLKKLRFRFGDRIHVLELGVGMYLFFVGCYDVFFGKNHYYL  508

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL  QA+AFF  G   +GT VP 
Sbjct  509  YLFAQAIAFFIAGLGQIGTIVPN  531



>ref|XP_010031452.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2 [Eucalyptus 
grandis]
 gb|KCW50751.1| hypothetical protein EUGRSUZ_J00420 [Eucalyptus grandis]
Length=527

 Score =   232 bits (591),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 112/201 (56%), Positives = 145/201 (72%), Gaps = 3/201 (1%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++++V  +KK ++IY+FFFVRKIIAH VTFFFYCVV+P  I +P
Sbjct  330  SCGPANLFRKMVMEIVRNKKVRFWKKVYVIYSFFFVRKIIAHMVTFFFYCVVLPLTIWVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+H+    A+Y+P+ ITILN+  T RS HLL  WILFENVMS+HRTKA  IGLLEA RAN
Sbjct  390  EVHVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILFENVMSMHRTKATFIGLLEAGRAN  449

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+  K +       R T    +R+HLLE+  G F+     YD ++G + +++
Sbjct  450  EWVVTEKLGDTLKNKS---KKLRFTFNFADRLHLLELGFGVFLFVTGCYDFLYGKNNYFV  506

Query  240  YLVLQALAFFAVGFSFVGTQV  178
            YL LQ + FF  GF ++GT V
Sbjct  507  YLWLQTITFFIAGFGYIGTIV  527



>gb|EEC85104.1| hypothetical protein OsI_32487 [Oryza sativa Indica Group]
Length=531

 Score =   232 bits (591),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 119/214 (56%), Positives = 148/214 (69%), Gaps = 15/214 (7%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSE--RVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIV  607
            SCGPANLFRK+F E+L S   RVS +KK HL+Y FFF+RK++AH +TF FYCVVIP  ++
Sbjct  318  SCGPANLFRKIFLEVLSSPTARVSPWKKLHLLYDFFFLRKLVAHLLTFSFYCVVIPACVL  377

Query  606  IPELHLTKP--IAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEA  433
                H+  P  +A+Y+PA IT+LNAACT RS HLL+ WILFENVMS+HRTKA +IGLLEA
Sbjct  378  AGSDHVRLPKYVALYVPAAITLLNAACTPRSCHLLIFWILFENVMSMHRTKATLIGLLEA  437

Query  432  NRANEWVVTEKLGNAAKQRQAVRAPRRRTCR-----------LRERIHLLEIMMGFFMLQ  286
             RANEWVVT+K GNA  + Q       R  R               +H+ EI++G  +L 
Sbjct  438  TRANEWVVTDKRGNANPKHQQPANTTTRPGRKTTTSSSRTSFFNNDVHVAEILLGACLLY  497

Query  285  CASYDIIFGHDLFYIYLVLQALAFFAVGFSFVGT  184
            CA YDI +G D FYIYL+LQ+ A F VGF +VGT
Sbjct  498  CALYDIAYGRDSFYIYLLLQSAAAFIVGFGYVGT  531



>emb|CDY04707.1| BnaC05g18820D [Brassica napus]
Length=555

 Score =   232 bits (592),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/202 (54%), Positives = 144/202 (71%), Gaps = 0/202 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANL+RKM  EIL++++VS +KK +LIY FFF+RKI+ H  TF FYC+++P  ++ P
Sbjct  352  SCGPANLWRKMTIEILQNKKVSAWKKLYLIYNFFFIRKIVVHIFTFVFYCLILPATVMFP  411

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            EL + K   +Y+P+TIT+LNA  T RS HLLV WILFENVMS+HRTKA  IGLLEA R N
Sbjct  412  ELQVPKWATVYVPSTITLLNALATPRSLHLLVFWILFENVMSMHRTKATFIGLLEAGRVN  471

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+  K +   +A  +   R  +RI+  E+++G ++  C  YD  +G   FY+
Sbjct  472  EWVVTEKLGDTLKSKLIAKATTKLYTRFGQRINWRELVVGLYIFICGCYDFAYGGSYFYV  531

Query  240  YLVLQALAFFAVGFSFVGTQVP  175
            YL LQA AFF  G  ++GT VP
Sbjct  532  YLFLQACAFFVAGVGYIGTIVP  553



>ref|XP_004497598.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cicer 
arietinum]
Length=523

 Score =   231 bits (590),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/203 (56%), Positives = 159/203 (78%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKMF+EI+ +++VS +KK +++Y+FFFVRKI+AH  TF FYC+V+P  +V+P
Sbjct  320  SCGPANLFRKMFREIVTNKKVSFWKKIYVVYSFFFVRKIVAHINTFVFYCIVLPATVVVP  379

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ IT+LNA  T RS HLL+ WILFEN MSLHRTKA IIGLLEA+R N
Sbjct  380  EVVVPKWGAVYIPSIITLLNAVGTPRSLHLLLFWILFENTMSLHRTKATIIGLLEASRVN  439

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A K +   +  +    R+ +RIH+LE+++GF++L C  YD+++G + F+I
Sbjct  440  EWVVTEKLGDALKGKVGGKGLKTFRFRIVDRIHMLELLVGFYLLFCGCYDLMYGKNHFFI  499

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            +L +QALAFF + F +VGT +P 
Sbjct  500  FLYIQALAFFIMAFGYVGTFIPN  522



>ref|XP_009403735.1| PREDICTED: probable mannan synthase 9 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=528

 Score =   231 bits (590),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/202 (52%), Positives = 148/202 (73%), Gaps = 0/202 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI K+++VSL+ K ++IY+FFF+RKI+ H VTF FYC+VIP  + +P
Sbjct  325  SCGPANLFRKMVVEISKNKKVSLWTKVYVIYSFFFIRKIVGHIVTFIFYCLVIPATVFVP  384

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ +     +YLP+ IT+LN+  T RS HLLV W+LFENVMSLHRTKA + GLL+  R N
Sbjct  385  EVEIPMWGLVYLPSVITMLNSVGTPRSLHLLVFWVLFENVMSLHRTKATLSGLLDLGRVN  444

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+  K +   +A ++   R+ +R+H +E+  G ++  CA YD+ +G + +++
Sbjct  445  EWVVTEKLGDIMKTKLPTKAAKKPRVRIGDRLHKMELFTGAYLFFCACYDLKYGKNHYFL  504

Query  240  YLVLQALAFFAVGFSFVGTQVP  175
            YL LQ++ FF VGF +VGT +P
Sbjct  505  YLFLQSITFFIVGFGYVGTYIP  526



>ref|NP_850952.1| putative mannan synthase 3 [Arabidopsis thaliana]
 ref|NP_173762.4| putative mannan synthase 3 [Arabidopsis thaliana]
 sp|Q9LQC9.1|CSLA3_ARATH RecName: Full=Probable mannan synthase 3; AltName: Full=Cellulose 
synthase-like protein A3; Short=AtCslA3 [Arabidopsis thaliana]
 gb|AAF79586.1|AC007945_6 F28C11.11 [Arabidopsis thaliana]
 gb|AAM20620.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15522.1| unknown protein [Arabidopsis thaliana]
 gb|AEE30391.1| putative mannan synthase 3 [Arabidopsis thaliana]
 gb|AEE30392.1| putative mannan synthase 3 [Arabidopsis thaliana]
 gb|AHL38929.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=556

 Score =   232 bits (592),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/203 (54%), Positives = 143/203 (70%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANL+RKM  EIL++++VS +KK +LIY FFF+RKI+ H  TF FYC+++P  ++ P
Sbjct  353  SCGPANLWRKMTMEILQNKKVSAWKKLYLIYNFFFIRKIVVHIFTFVFYCLILPTTVLFP  412

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            EL + K   +Y P TITILNA  T RS HLLV WILFENVMS+HRTKA  IGLLEA R N
Sbjct  413  ELQVPKWATVYFPTTITILNAIATPRSLHLLVFWILFENVMSMHRTKATFIGLLEAGRVN  472

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+  K +   +A  +   R  +R++  E+++G ++  C  YD  +G   FY+
Sbjct  473  EWVVTEKLGDTLKSKLIGKATTKLYTRFGQRLNWRELVVGLYIFFCGCYDFAYGGSYFYV  532

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL LQ+ AFF  G  ++GT VPT
Sbjct  533  YLFLQSCAFFVAGVGYIGTFVPT  555



>gb|ABD79100.1| cellulose synthase-like A2 [Physcomitrella patens]
Length=538

 Score =   232 bits (591),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 116/214 (54%), Positives = 149/214 (70%), Gaps = 12/214 (6%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRK+   ILK++ + L+K+ H+IYAFFFVRK++AH VTF FYCVVIP ++++P
Sbjct  322  SCGPANLFRKVLPSILKNQNLKLWKRLHMIYAFFFVRKVVAHIVTFTFYCVVIPASVLVP  381

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ L    A+Y+P+ IT+LNA  T +S HLLV WILFENVMSLHRTKA IIGL +    N
Sbjct  382  EVDLPFWGAVYVPSIITLLNAITTPKSLHLLVFWILFENVMSLHRTKATIIGLFDIGNVN  441

Query  420  EWVVTEKLGNAAKQRQAVRAPR-----------RRTCRLRERIHLLEIMMGFFMLQCASY  274
            EWVVTEKLGN  K R +    +            R  ++ ER+HLLE+  G F++ CA Y
Sbjct  442  EWVVTEKLGNLMKYRSSKYGKKYTLQRMASNMLARGWKMSERMHLLEVWTGGFLMFCAVY  501

Query  273  DIIF-GHDLFYIYLVLQALAFFAVGFSFVGTQVP  175
            D  F G + FY+YL LQ+ AF  +GF +VGT VP
Sbjct  502  DFYFQGKNHFYVYLFLQSCAFLVMGFGYVGTFVP  535



>ref|XP_010278246.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Nelumbo 
nucifera]
Length=527

 Score =   231 bits (590),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/203 (53%), Positives = 150/203 (74%), Gaps = 3/203 (1%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI++++ V+ +KKF++IY+FF VRKIIAH +TF FYC+V+P  ++IP
Sbjct  328  SCGPANLFRKMAMEIIRNKNVTTFKKFYVIYSFFLVRKIIAHIITFVFYCIVLPLTVLIP  387

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  +IY+P  IT+LN+  T RS HLL  W+LFENVM+LHR+KA I GLL A +AN
Sbjct  388  EVEVPKWGSIYMPCIITLLNSVGTPRSVHLLFFWVLFENVMALHRSKATIAGLLGAKKAN  447

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
             WVVTEKLG+     +A + PR    R+RER+HL E+  G F+   + YD ++G + ++I
Sbjct  448  VWVVTEKLGSKTTNSKAPKKPR---FRIRERLHLTELAFGLFLALVSCYDFVYGKNNYFI  504

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            +L LQA+ FF VGF +VGT +P+
Sbjct  505  FLSLQAITFFIVGFGYVGTIIPS  527



>ref|XP_011005673.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Populus 
euphratica]
Length=540

 Score =   231 bits (590),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 114/208 (55%), Positives = 150/208 (72%), Gaps = 5/208 (2%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI++++RV  +KK ++IY+FFFVRKIIAH VTF FYCVV+P  I++P
Sbjct  332  SCGPANLFRKMVMEIVRNKRVKFWKKVYVIYSFFFVRKIIAHMVTFCFYCVVLPLTILVP  391

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ +    A+Y+P+ ITILN+  T RS HLL  WILFENVMSLHRTKA +IGLLEA R N
Sbjct  392  EVKVPIWGAVYIPSVITILNSVGTPRSIHLLFYWILFENVMSLHRTKATLIGLLEAGRVN  451

Query  420  EWVVTEKLGN----AAKQRQA-VRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGH  256
            EWVVTEKLGN    AA  R+A  +APR+   +  +R++ LE+    F+  C  +D + G 
Sbjct  452  EWVVTEKLGNTVQKAADARKANTKAPRKFRFKFTDRLNTLELGFAAFLFLCGCFDFVNGK  511

Query  255  DLFYIYLVLQALAFFAVGFSFVGTQVPT  172
            + ++IYL LQ + FF  G  +VGT +P+
Sbjct  512  NNYFIYLWLQTVTFFITGIGYVGTIIPS  539



>gb|AAQ62571.1| glycosyltransferase 5, partial [Ipomoea trifida]
Length=508

 Score =   231 bits (588),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 114/205 (56%), Positives = 146/205 (71%), Gaps = 2/205 (1%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKMF EI++++RV+++KK ++IY+FF VRKI AH VTFFFYCVV+P  I++P
Sbjct  304  SCGPANLFRKMFMEIVRNKRVNVWKKVYVIYSFFLVRKITAHMVTFFFYCVVLPLTILVP  363

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  AIY+P  ITILN+  T RS HLL  WILFENVMS HRTKA +IGLLE  RAN
Sbjct  364  EVEVPKWGAIYIPCIITILNSVGTPRSIHLLFYWILFENVMSFHRTKATLIGLLEFKRAN  423

Query  420  EWVVTEKLGNAAKQRQAVR--APRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLF  247
            EWVVTEKLG+A    ++    AP++     R+RI L E+    F+  C  YD + G + +
Sbjct  424  EWVVTEKLGDAINNNKSNSKPAPKKTKSIFRDRILLHELGFAVFLFVCGVYDYLHGKNHY  483

Query  246  YIYLVLQALAFFAVGFSFVGTQVPT  172
            YIYL LQ + F   G  +VGT VP+
Sbjct  484  YIYLFLQVITFTIAGVGWVGTIVPS  508



>ref|XP_001759209.1| cellulose synthase-like A3, glycosyltransferase family 2 protein; 
mannan synthase [Physcomitrella patens]
 gb|EDQ75893.1| cellulose synthase-like A3, glycosyltransferase family 2 protein; 
mannan synthase [Physcomitrella patens]
Length=538

 Score =   231 bits (590),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 116/214 (54%), Positives = 150/214 (70%), Gaps = 12/214 (6%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRK+   ILK++++ L+K+ H+IYAFFFVRKI+AH VTF FYC+VIP ++++P
Sbjct  322  SCGPANLFRKVLPSILKNQKLKLWKRLHMIYAFFFVRKIVAHIVTFTFYCLVIPASVLVP  381

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ L    A+Y+P+ IT+LNA  T +S HLLV WILFENVMSLHRTKA IIGL +    N
Sbjct  382  EVDLPFWGAVYVPSIITLLNAITTPKSLHLLVFWILFENVMSLHRTKATIIGLFDIGNVN  441

Query  420  EWVVTEKLGNAAKQRQAVRAPR-----------RRTCRLRERIHLLEIMMGFFMLQCASY  274
            EWVVTEKLGN  K R A    +            R  R+ ER+H+LE+  G F++ CA+Y
Sbjct  442  EWVVTEKLGNLMKYRSAKYGKKYTLQRMASNVLARGWRMSERMHILELWTGGFLMFCAAY  501

Query  273  DIIF-GHDLFYIYLVLQALAFFAVGFSFVGTQVP  175
            D  F G + FY+YL LQ+ AF  +G  +VGT VP
Sbjct  502  DFYFQGKNHFYVYLFLQSFAFIIMGLGYVGTFVP  535



>ref|XP_009130779.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Brassica 
rapa]
Length=532

 Score =   231 bits (589),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 109/203 (54%), Positives = 147/203 (72%), Gaps = 1/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+ ++ V+L+KK H+IY+FF VRKI+AH VTF FYCV++P  +++P
Sbjct  330  SCGPANLFRKMAFEIMTNKNVTLWKKVHVIYSFFVVRKIVAHIVTFIFYCVILPATVLVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ IT+LNA  T RS HL+V WILFENVMSLHRTKA  IGLLE  R N
Sbjct  390  EVTVPKWGAVYIPSIITLLNAVGTPRSLHLMVFWILFENVMSLHRTKATFIGLLEGGRVN  449

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EW+VTEKLG+  K + A +  ++   R  +RIH+LE+ +G ++     YD+ FG + +Y+
Sbjct  450  EWIVTEKLGD-LKAKSATKTLKKLRFRFGDRIHVLELGVGMYLFFVGCYDVFFGKNHYYL  508

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL  QA+AFF  G   +GT VP 
Sbjct  509  YLFAQAIAFFIAGLGQIGTIVPN  531



>ref|XP_010516765.1| PREDICTED: probable mannan synthase 7 isoform X2 [Camelina sativa]
Length=482

 Score =   229 bits (585),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 109/202 (54%), Positives = 146/202 (72%), Gaps = 3/202 (1%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            +CGPANLFRKM  +IL+SE VSL+KK +++Y+FFF+RKI+AH +TF FYCV++P  ++ P
Sbjct  280  TCGPANLFRKMAGKILRSENVSLWKKLYMLYSFFFIRKIVAHVLTFCFYCVILPATVLFP  339

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A YLP+ IT+  A    RS HLL  W+LFEN MSL RTKA ++GLLE  R  
Sbjct  340  EVTVPKWAAFYLPSLITLFIAIGRLRSIHLLAFWVLFENSMSLVRTKALVMGLLETGRVQ  399

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEK G+A K +   + P     R RER+HLLE+++G ++L C  YDII+G +  Y+
Sbjct  400  EWVVTEKSGDALKTKLIPQVP---NVRFRERVHLLELLVGAYLLSCGIYDIIYGKNTLYV  456

Query  240  YLVLQALAFFAVGFSFVGTQVP  175
            YL+ Q+LAFF VGF +VG  VP
Sbjct  457  YLLFQSLAFFVVGFGYVGKYVP  478



>emb|CDX80885.1| BnaC03g01390D [Brassica napus]
Length=525

 Score =   231 bits (588),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 109/203 (54%), Positives = 146/203 (72%), Gaps = 1/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+ ++ V+L+KK H+IY+FF VRKI+AH VTF FYCV++P  + +P
Sbjct  323  SCGPANLFRKMAFEIMTNKNVTLWKKVHVIYSFFVVRKIVAHIVTFIFYCVILPATVFVP  382

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ IT+LNA  T RS HL+V WILFENVMSLHRTKA  IGLLE  R N
Sbjct  383  EVTVPKWGAVYIPSIITLLNAVGTPRSLHLMVFWILFENVMSLHRTKATFIGLLEGGRVN  442

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EW+VTEKLG+  K + A +  ++   R  +RIH+LE+ +G ++     YD+ FG + +Y+
Sbjct  443  EWIVTEKLGD-LKAKSATKTSKKLRFRFGDRIHVLELGVGMYLFFVGCYDVFFGKNHYYL  501

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL  QA+AFF  G   +GT VP 
Sbjct  502  YLFAQAIAFFIAGLGQIGTIVPN  524



>gb|KFK24842.1| hypothetical protein AALP_AA8G031700 [Arabis alpina]
Length=533

 Score =   231 bits (588),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 110/204 (54%), Positives = 149/204 (73%), Gaps = 2/204 (1%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+ ++ V+L+KK H+IY+FF VRK++AH VTF FYCV++P  +++P
Sbjct  330  SCGPANLFRKMAFEIMTNKNVTLWKKVHVIYSFFVVRKLVAHIVTFIFYCVILPATVLVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ IT+LNA  T RS HL+V WILFENVMSLHRTKA  IGLLE  R N
Sbjct  390  EVTVPKWGAVYIPSVITLLNAVGTPRSLHLMVFWILFENVMSLHRTKATFIGLLEGGRVN  449

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRT-CRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFY  244
            EW+VTEKLG+  K + A +AP++    R  +RIH+LE+ +G ++     YD  FG + +Y
Sbjct  450  EWIVTEKLGD-LKAKSASKAPKKIIRFRFGDRIHVLELGVGMYLFFVGCYDAFFGKNHYY  508

Query  243  IYLVLQALAFFAVGFSFVGTQVPT  172
            +YL  Q++AFF  GF  +GT VP 
Sbjct  509  LYLFAQSIAFFIAGFGQIGTIVPN  532



>ref|XP_006414326.1| hypothetical protein EUTSA_v10024828mg [Eutrema salsugineum]
 gb|ESQ55779.1| hypothetical protein EUTSA_v10024828mg [Eutrema salsugineum]
Length=553

 Score =   231 bits (589),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 147/199 (74%), Gaps = 2/199 (1%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+ ++RVS++KKF++IY+FFFVRK+  H++TFFFYC+++P ++  P
Sbjct  357  SCGPANLFRKMTMEIIYNKRVSIWKKFYVIYSFFFVRKVAVHFLTFFFYCIIVPTSVFFP  416

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+H+     IY+P+ I+I +   T RSF+L++ WILFENVM++HRTK   IGLLE  R N
Sbjct  417  EIHIPSWSTIYVPSLISIFHTMATPRSFYLVIFWILFENVMAMHRTKGTCIGLLEGGRVN  476

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A K +   R  +R++C   ER++  E+M+G ++L CA Y +I GH   + 
Sbjct  477  EWVVTEKLGDALKNKLLSRVVQRKSC--YERVNSKEVMVGIYILGCAFYGLINGHTWLHF  534

Query  240  YLVLQALAFFAVGFSFVGT  184
            YL LQA AFF  GF FVGT
Sbjct  535  YLFLQATAFFVSGFGFVGT  553



>ref|XP_009629011.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Nicotiana 
tomentosiformis]
Length=533

 Score =   231 bits (588),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 108/204 (53%), Positives = 148/204 (73%), Gaps = 1/204 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI++++RV+++KKF++IY+FFFVRKIIAH VTFFF+CVV+P ++++P
Sbjct  330  SCGPANLFRKMVMEIVRNKRVNIWKKFYVIYSFFFVRKIIAHMVTFFFFCVVLPLSLLVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ +    AIY+P  ITILN+  T RS HLL  WILFENVM+ HRTKA  IGLLEA RAN
Sbjct  390  EVEIPVWAAIYIPCIITILNSVGTPRSIHLLFYWILFENVMAFHRTKATFIGLLEAKRAN  449

Query  420  EWVVTEKLGNAAKQRQAVRAPRR-RTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFY  244
            EWVVTEKLG+A K +   +  ++ R     +RI   E+    F+  C  YD+++G   ++
Sbjct  450  EWVVTEKLGDALKNKDKTKQTKKPRGSLFGDRILPQELGFALFLFFCGCYDVLYGKSQYF  509

Query  243  IYLVLQALAFFAVGFSFVGTQVPT  172
            +Y+ LQ + F   GF ++GT VP+
Sbjct  510  LYIFLQVVTFTIAGFGYIGTIVPS  533



>ref|XP_010937163.1| PREDICTED: probable mannan synthase 11 isoform X2 [Elaeis guineensis]
Length=317

 Score =   224 bits (571),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 108/220 (49%), Positives = 148/220 (67%), Gaps = 18/220 (8%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLF+KM  EI+++E+VS++KKFH+IY+FFFV KI+AH VTF FYCV+IP ++++P
Sbjct  96   SCGPANLFKKMAMEIIRNEKVSMWKKFHVIYSFFFVGKIVAHTVTFVFYCVIIPVSVLVP  155

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + +   +Y+P  IT+L A  T  SFHLL++W+LFENVMS HR KAAI GLLEA R N
Sbjct  156  EVDIPQWGVVYVPTIITLLKAFGTPSSFHLLILWVLFENVMSFHRIKAAITGLLEAARVN  215

Query  420  EWVVTEKLGNAAKQRQAVR------------------APRRRTCRLRERIHLLEIMMGFF  295
            EWVVTEKLG+A K + A++                   P++   R   R +  E+ +G F
Sbjct  216  EWVVTEKLGDAHKTKPALKMEDSKKLRDAQETKPLIDKPKKHRPRFWHRFYFSELGLGVF  275

Query  294  MLQCASYDIIFGHDLFYIYLVLQALAFFAVGFSFVGTQVP  175
            +L C  YD+      +++YL LQ LAF  +GF +VG  VP
Sbjct  276  LLLCGYYDLANEGQGYFVYLFLQGLAFLIIGFGYVGIHVP  315



>ref|XP_010423663.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Camelina 
sativa]
Length=534

 Score =   230 bits (587),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 110/204 (54%), Positives = 148/204 (73%), Gaps = 2/204 (1%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+ ++ V+L+KK H+IY+FF VRK++AH VTF FYCV++P  +++P
Sbjct  331  SCGPANLFRKMAFEIMTNKNVTLWKKVHVIYSFFVVRKLVAHIVTFIFYCVILPATVLVP  390

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ IT+LNA  T RS HL+V WILFENVMSLHRTKA  IGLLE  R N
Sbjct  391  EVSVPKWGAVYIPSVITLLNAVGTPRSLHLMVFWILFENVMSLHRTKATFIGLLEGGRVN  450

Query  420  EWVVTEKLGNAAKQRQAVRAPRR-RTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFY  244
            EW+VTEKLG+  K + A + P++    R  +RIH+LE+ +G ++L    YD   G + +Y
Sbjct  451  EWIVTEKLGD-LKAKSASKTPKKLLRFRFGDRIHVLELGVGIYLLFVGCYDAFLGKNHYY  509

Query  243  IYLVLQALAFFAVGFSFVGTQVPT  172
            +YL  QA+AFF  GF  +GT VP 
Sbjct  510  LYLFAQAIAFFIAGFGQIGTIVPN  533



>ref|NP_195996.1| glucomannan 4-beta-mannosyltransferase 9 [Arabidopsis thaliana]
 sp|Q9LZR3.1|CSLA9_ARATH RecName: Full=Glucomannan 4-beta-mannosyltransferase 9; AltName: 
Full=Cellulose synthase-like protein A9; Short=AtCslA9; 
AltName: Full=Glucomannan synthase; AltName: Full=Mannan synthase 
9; AltName: Full=Protein RESISTANT TO AGROBACTERIUM TRANSFORMATION 
4 [Arabidopsis thaliana]
 emb|CAB82941.1| putative protein [Arabidopsis thaliana]
 dbj|BAB08601.1| glucosyltransferase-like protein [Arabidopsis thaliana]
 gb|AAL31192.1| AT5g03760/F17C15_180 [Arabidopsis thaliana]
 gb|AAN31089.1| At5g03760/F17C15_180 [Arabidopsis thaliana]
 gb|AED90651.1| glucomannan 4-beta-mannosyltransferase 9 [Arabidopsis thaliana]
 gb|AHL38649.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=533

 Score =   230 bits (586),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 108/203 (53%), Positives = 145/203 (71%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+ ++ V+L+KK H+IY+FF VRK++AH VTF FYCV++P  +++P
Sbjct  330  SCGPANLFRKMAFEIMTNKNVTLWKKVHVIYSFFVVRKLVAHIVTFIFYCVILPATVLVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A+Y+P+ IT+LNA  T RS HL+V WILFENVMSLHRTKA  IGLLE  R N
Sbjct  390  EVTVPKWGAVYIPSVITLLNAVGTPRSLHLMVFWILFENVMSLHRTKATFIGLLEGGRVN  449

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EW+VTEKLG+   +     + +    R  +RIH+LE+ +G ++L    YD  FG + +Y+
Sbjct  450  EWIVTEKLGDVKAKSATKTSKKVIRFRFGDRIHVLELGVGMYLLFVGCYDAFFGKNHYYL  509

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL  QA+AFF  GF  +GT VP 
Sbjct  510  YLFAQAIAFFIAGFGQIGTIVPN  532



>ref|XP_010505088.1| PREDICTED: probable mannan synthase 7 [Camelina sativa]
Length=554

 Score =   230 bits (587),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 109/202 (54%), Positives = 146/202 (72%), Gaps = 3/202 (1%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            +CGPANLFRKM  +IL+SE VSL+KK +++Y+FFF+RKI+AH +TF FYCV++P  ++ P
Sbjct  352  TCGPANLFRKMAGQILRSENVSLWKKLYMLYSFFFIRKIVAHALTFCFYCVILPATVLFP  411

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A YLP+ IT+  A    RS HLL  W+LFEN MSL RTKA ++GLLE  R  
Sbjct  412  EVTVPKWAAFYLPSLITLFIAIGRLRSIHLLAFWVLFENSMSLVRTKALVMGLLETGRVQ  471

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEK G+A K +   + P     R RER+HLLE+++G ++L C  YDII+G +  Y+
Sbjct  472  EWVVTEKSGDALKTKLIPQVP---NVRFRERVHLLELLVGAYLLSCGIYDIIYGKNTLYV  528

Query  240  YLVLQALAFFAVGFSFVGTQVP  175
            YL+ Q+LAFF VGF +VG  VP
Sbjct  529  YLLFQSLAFFVVGFGYVGKYVP  550



>sp|Q84W54.1|CSLA1_ARATH RecName: Full=Probable mannan synthase 1; AltName: Full=Cellulose 
synthase-like protein A1; Short=AtCslA1 [Arabidopsis thaliana]
 gb|AAO42230.1| putative cellulose synthase [Arabidopsis thaliana]
Length=553

 Score =   230 bits (587),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/199 (53%), Positives = 148/199 (74%), Gaps = 2/199 (1%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+ ++RVS++KKF++IY+FFFVRK+  H++TFFFYC+++P ++  P
Sbjct  357  SCGPANLFRKMTMEIIFNKRVSIWKKFYVIYSFFFVRKVAVHFLTFFFYCIIVPTSVFFP  416

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+H+     IY+P+ I+I +   T RSF+L++ W+LFENVM++HRTK   IGLLE  R N
Sbjct  417  EIHIPSWSTIYVPSLISIFHTLATPRSFYLVIFWVLFENVMAMHRTKGTCIGLLEGGRVN  476

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A K +   R  +R++C   +R++  E+M+G ++L CA Y +I+GH   + 
Sbjct  477  EWVVTEKLGDALKSKLLSRVVQRKSC--YQRVNSKEVMVGVYILGCALYGLIYGHTWLHF  534

Query  240  YLVLQALAFFAVGFSFVGT  184
            YL LQA AFF  GF FVGT
Sbjct  535  YLFLQATAFFVSGFGFVGT  553



>ref|XP_004160102.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Cucumis 
sativus]
Length=359

 Score =   225 bits (573),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 114/210 (54%), Positives = 150/210 (71%), Gaps = 7/210 (3%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++++V  +KK ++IY+FFFVRKIIAH VTFFFYCVV+P  I++P
Sbjct  149  SCGPANLFRKMVMEIVRNKKVRFWKKVYVIYSFFFVRKIIAHMVTFFFYCVVLPLTILVP  208

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+++    A+Y+P+ ITILN+  T RS HLL  WILFENVMSLHRTKA +IGLLEA RAN
Sbjct  209  EVYVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLHRTKATLIGLLEAGRAN  268

Query  420  EWVVTEKLGNAAKQRQAVRA------PR-RRTCRLRERIHLLEIMMGFFMLQCASYDIIF  262
            EWVVTEKLG+A K + A         P+ R  C+  +RI+ LE+    F+  C  YD + 
Sbjct  269  EWVVTEKLGDALKNKAAADKKAGGKIPKVRLRCKFGDRINTLELGFAAFLFLCGCYDFVH  328

Query  261  GHDLFYIYLVLQALAFFAVGFSFVGTQVPT  172
            G + ++IYL LQ  +F   G  +VGT +P+
Sbjct  329  GKNNYFIYLFLQTFSFLITGIGYVGTIIPS  358



>ref|XP_003551076.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Glycine 
max]
 gb|KHN21460.1| Glucomannan 4-beta-mannosyltransferase 2 [Glycine soja]
Length=533

 Score =   229 bits (585),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/204 (54%), Positives = 145/204 (71%), Gaps = 3/204 (1%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++++V  +KK ++IY+FFFVRKIIAH VTFFFYCVV+P  I++P
Sbjct  330  SCGPANLFRKMVMEIVRNKKVKFWKKVYVIYSFFFVRKIIAHMVTFFFYCVVLPLTILVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ +    A+Y+P+ IT LN+  T RS HLL  WILFEN MSLHRTKA  IGLLEA RAN
Sbjct  390  EVRVPIWGAVYIPSIITTLNSVGTPRSIHLLFYWILFENAMSLHRTKATFIGLLEAGRAN  449

Query  420  EWVVTEKLGNAAKQR---QAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDL  250
            EWVVTEKLG++   +      +A R+   +  ER+HLLE+    F+  C  YD + G + 
Sbjct  450  EWVVTEKLGDSVNNKNKSNVTKAIRKSRFKFGERLHLLELGFAAFLFLCGCYDYVHGKNN  509

Query  249  FYIYLVLQALAFFAVGFSFVGTQV  178
            +++YL LQ + F  VGF +VGT V
Sbjct  510  YFLYLFLQTITFSIVGFGYVGTIV  533



>ref|XP_006282581.1| hypothetical protein CARUB_v10004510mg [Capsella rubella]
 gb|EOA15479.1| hypothetical protein CARUB_v10004510mg [Capsella rubella]
Length=554

 Score =   230 bits (586),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 147/199 (74%), Gaps = 2/199 (1%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+ ++RVS++KKF++IY+FFFVRK+  H++TFFFYCV++P ++  P
Sbjct  358  SCGPANLFRKMTMEIIHNKRVSIWKKFYVIYSFFFVRKVAVHFLTFFFYCVIVPTSVFFP  417

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+++     IY+P+ ITI +   T RSF+L++ WILFENVM++HRTK   IGLLE  R N
Sbjct  418  EIYIPSWSTIYVPSLITIFHTMATPRSFYLVIFWILFENVMAMHRTKGTCIGLLEGGRVN  477

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEKLG+A K +   R  +R++C   + I+  E+M+G ++L CA Y +I+GH   + 
Sbjct  478  EWVVTEKLGDALKNKLLSRVVQRKSC--YQTINAKEVMVGIYILGCALYGLIYGHTWLHF  535

Query  240  YLVLQALAFFAVGFSFVGT  184
            YL LQA AFF  GF FVGT
Sbjct  536  YLFLQATAFFVSGFGFVGT  554



>ref|XP_002963530.1| glycosyltransferase family 2 protein [Selaginella moellendorffii]
 gb|EFJ35401.1| glycosyltransferase family 2 protein [Selaginella moellendorffii]
Length=528

 Score =   229 bits (584),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 109/209 (52%), Positives = 151/209 (72%), Gaps = 6/209 (3%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM   +L +++VS+ KKF ++Y+FF VRKI+AH VTF F+CVV+P  +++P
Sbjct  319  SCGPANLFRKMIPGVLAAKKVSMLKKFSILYSFFLVRKIVAHLVTFIFFCVVVPTCVLVP  378

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E++L K  +IYLP+ IT+LN   T +S   LV W+LFENVMS+HRTKA I GLL+  R N
Sbjct  379  EVNLPKWGSIYLPSMITLLNCMATPKSLPFLVFWVLFENVMSMHRTKATITGLLDIGRVN  438

Query  420  EWVVTEKLGNAAKQRQA--VRAPRR----RTCRLRERIHLLEIMMGFFMLQCASYDIIFG  259
            EW+VTEKLG+A K + A   + P++    R   +  R H+  +++G ++  CASYD+ FG
Sbjct  439  EWIVTEKLGDALKIKFAKLKQKPKQKIGERQAYISRRFHVFHLIVGLYIFFCASYDLAFG  498

Query  258  HDLFYIYLVLQALAFFAVGFSFVGTQVPT  172
             D +YIYL LQA+AFF +GF ++GT VP 
Sbjct  499  RDRYYIYLYLQAVAFFIMGFGYIGTYVPN  527



>ref|XP_001764061.1| cellulose synthase-like A1, glycosyltransferase family 2 protein; 
mannan synthase [Physcomitrella patens]
 gb|ABD79099.1| cellulose synthase-like A1 [Physcomitrella patens]
 gb|EDQ71200.1| cellulose synthase-like A1, glycosyltransferase family 2 protein; 
mannan synthase [Physcomitrella patens]
Length=538

 Score =   229 bits (585),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 117/214 (55%), Positives = 149/214 (70%), Gaps = 12/214 (6%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRK+   ILK++ + L+K+ H+IYAFFFVRKI+AH VTF FYCVVIP ++++P
Sbjct  322  SCGPANLFRKVLFTILKNQNLRLWKRLHMIYAFFFVRKIVAHIVTFTFYCVVIPASVLVP  381

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ L    A+Y+P+ IT+LNA  T +S HLLV WILFENVMSLHRTKA IIGL +    N
Sbjct  382  EVDLPFWGAVYVPSIITLLNAITTPKSLHLLVFWILFENVMSLHRTKATIIGLFDIGNVN  441

Query  420  EWVVTEKLGNAAKQRQAVRAPR-----------RRTCRLRERIHLLEIMMGFFMLQCASY  274
            EWVVTEKLGN  K R A    +            R  ++ ER+H+LE+  G F++ CA Y
Sbjct  442  EWVVTEKLGNLMKYRSAKYGKKYTLQRMASNMLARGWKMSERLHILELWTGGFLMFCAVY  501

Query  273  DIIF-GHDLFYIYLVLQALAFFAVGFSFVGTQVP  175
            D  F G + FY+YL LQ+ AF  +GF +VGT VP
Sbjct  502  DFYFQGKNHFYVYLFLQSCAFLIMGFGYVGTFVP  535



>ref|XP_010516764.1| PREDICTED: probable mannan synthase 7 isoform X1 [Camelina sativa]
Length=555

 Score =   230 bits (586),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/202 (54%), Positives = 146/202 (72%), Gaps = 3/202 (1%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            +CGPANLFRKM  +IL+SE VSL+KK +++Y+FFF+RKI+AH +TF FYCV++P  ++ P
Sbjct  353  TCGPANLFRKMAGKILRSENVSLWKKLYMLYSFFFIRKIVAHVLTFCFYCVILPATVLFP  412

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A YLP+ IT+  A    RS HLL  W+LFEN MSL RTKA ++GLLE  R  
Sbjct  413  EVTVPKWAAFYLPSLITLFIAIGRLRSIHLLAFWVLFENSMSLVRTKALVMGLLETGRVQ  472

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EWVVTEK G+A K +   + P     R RER+HLLE+++G ++L C  YDII+G +  Y+
Sbjct  473  EWVVTEKSGDALKTKLIPQVP---NVRFRERVHLLELLVGAYLLSCGIYDIIYGKNTLYV  529

Query  240  YLVLQALAFFAVGFSFVGTQVP  175
            YL+ Q+LAFF VGF +VG  VP
Sbjct  530  YLLFQSLAFFVVGFGYVGKYVP  551



>ref|XP_002874083.1| hypothetical protein ARALYDRAFT_489123 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50342.1| hypothetical protein ARALYDRAFT_489123 [Arabidopsis lyrata subsp. 
lyrata]
Length=534

 Score =   229 bits (584),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/205 (53%), Positives = 147/205 (72%), Gaps = 2/205 (1%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++++V  +KK ++IY+FFFVRKIIAHWVTF FYCVV+P  I++P
Sbjct  330  SCGPANLFRKMVMEIIRNKKVRFWKKVYVIYSFFFVRKIIAHWVTFCFYCVVLPLTILVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ +    ++Y+P+ ITILN+  T RS HLL  WILFENVMSLHRTKA +IGL EA RAN
Sbjct  390  EVKVPIWGSVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLHRTKATLIGLFEAGRAN  449

Query  420  EWVVTEKLGNAAKQRQAVRAPRR--RTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLF  247
            EWVVT KLG+    +   +  +R  R  +L +R++ LE+    F+  C  YD + G + +
Sbjct  450  EWVVTAKLGSGQSAKGNTKGLKRFPRIFKLPDRLNTLELGFAAFLFVCGCYDFVHGKNNY  509

Query  246  YIYLVLQALAFFAVGFSFVGTQVPT  172
            +IYL LQ ++FF  G  ++GT VP+
Sbjct  510  FIYLFLQTMSFFISGLGWIGTYVPS  534



>gb|KEH42109.1| cellulose synthase-like protein A1 [Medicago truncatula]
Length=522

 Score =   229 bits (583),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/203 (52%), Positives = 148/203 (73%), Gaps = 1/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EIL +++VSL+KK +++Y+FFFVRKI+ H  TF  YC+V+P  +++P
Sbjct  320  SCGPANLFRKMIMEILTNKKVSLWKKTYMVYSFFFVRKIVVHINTFVLYCIVLPATVMVP  379

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K   +Y+P  IT+LNA    RS HL+V WILFEN MSL+R KA IIG+LE +R N
Sbjct  380  EIVVPKWGTVYIPTIITLLNAVAAPRSLHLVVFWILFENTMSLNRAKATIIGILETSRVN  439

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EW+VTEKLGNA K  Q  +   +   ++  RIH+ E+ +GF++L C  YD+++G + +YI
Sbjct  440  EWIVTEKLGNALKD-QDSKGLEKLQFKIGNRIHMSELFVGFYLLFCGCYDLMYGKNYYYI  498

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            +L +QA+AFF + F +VGT VP 
Sbjct  499  FLYMQAIAFFLLAFGYVGTFVPN  521



>ref|XP_007132379.1| hypothetical protein PHAVU_011G089900g [Phaseolus vulgaris]
 gb|ESW04373.1| hypothetical protein PHAVU_011G089900g [Phaseolus vulgaris]
Length=542

 Score =   229 bits (584),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/213 (54%), Positives = 148/213 (69%), Gaps = 12/213 (6%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++++V  +KK ++IY+FFFVRKIIAH VTFFF+CVVIP  I+IP
Sbjct  330  SCGPANLFRKMVMEIVRNKKVRFWKKVYVIYSFFFVRKIIAHMVTFFFFCVVIPITILIP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+++    A+Y+P+ ITILN+  T RS HLL  WILFENVMSLHRTKA  IGLLE  RAN
Sbjct  390  EVYVPIWGAVYIPSVITILNSVGTPRSIHLLFYWILFENVMSLHRTKATFIGLLEYGRAN  449

Query  420  EWVVTEKL------------GNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCAS  277
            EWVVTEKL            G+AAK+    +AP++   +  ER++ LE+    F+  C  
Sbjct  450  EWVVTEKLGDSVNSNTKNKTGDAAKKNNVSKAPKKTRSKFVERLNFLELGFAAFLFFCGC  509

Query  276  YDIIFGHDLFYIYLVLQALAFFAVGFSFVGTQV  178
            YD + G   ++IYL LQ + F  VGF +VGT V
Sbjct  510  YDFVHGKHNYFIYLFLQTITFSIVGFGYVGTIV  542



>gb|EEE56486.1| hypothetical protein OsJ_05716 [Oryza sativa Japonica Group]
Length=485

 Score =   228 bits (581),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 151/203 (74%), Gaps = 1/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++++V+++KK H+IY FF +RKIIAH VTF FYC++IP  I +P
Sbjct  281  SCGPANLFRKMLMEIVRNKKVTIWKKIHVIYNFFLIRKIIAHIVTFAFYCLIIPATIFVP  340

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K   +Y+P  IT+LN+  T RSFHLL  WILFENVMSLHRTKA +IGLLEA RAN
Sbjct  341  EVRIPKWGCVYIPTIITLLNSVGTPRSFHLLFFWILFENVMSLHRTKATLIGLLEAGRAN  400

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRT-CRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFY  244
            EWVVTEKLGNA K + + ++  +++  R+ +R+++ E+ +  F+  C  YD+ FG D F+
Sbjct  401  EWVVTEKLGNALKMKSSSKSSAKKSFMRVWDRLNVTELGVAAFLFSCGWYDLAFGKDHFF  460

Query  243  IYLVLQALAFFAVGFSFVGTQVP  175
            IYL  Q  AFF VG  +VGT VP
Sbjct  461  IYLFFQGAAFFIVGIGYVGTIVP  483



>ref|NP_197666.1| glucomannan 4-beta-mannosyltransferase 2 [Arabidopsis thaliana]
 sp|Q9FNI7.1|CSLA2_ARATH RecName: Full=Glucomannan 4-beta-mannosyltransferase 2; AltName: 
Full=Cellulose synthase-like protein A2; Short=AtCslA2; 
AltName: Full=Glucomannan synthase; AltName: Full=Mannan synthase 
2 [Arabidopsis thaliana]
 dbj|BAB11680.1| glucosyltransferase-like protein [Arabidopsis thaliana]
 gb|AAL25573.1| AT5g22740/MDJ22_16 [Arabidopsis thaliana]
 gb|AAL24334.1| glucosyltransferase-like protein [Arabidopsis thaliana]
 gb|AAM13292.1| glucosyltransferase-like protein [Arabidopsis thaliana]
 gb|AED93069.1| glucomannan 4-beta-mannosyltransferase 2 [Arabidopsis thaliana]
 gb|AHL38612.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=534

 Score =   229 bits (584),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/205 (53%), Positives = 147/205 (72%), Gaps = 2/205 (1%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++++V  +KK ++IY+FFFVRKIIAHWVTF FYCVV+P  I++P
Sbjct  330  SCGPANLFRKMVMEIVRNKKVRFWKKVYVIYSFFFVRKIIAHWVTFCFYCVVLPLTILVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ +    ++Y+P+ ITILN+  T RS HLL  WILFENVMSLHRTKA +IGL EA RAN
Sbjct  390  EVKVPIWGSVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLHRTKATLIGLFEAGRAN  449

Query  420  EWVVTEKLGNAAKQRQAVRAPRR--RTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLF  247
            EWVVT KLG+    +   +  +R  R  +L +R++ LE+    F+  C  YD + G + +
Sbjct  450  EWVVTAKLGSGQSAKGNTKGIKRFPRIFKLPDRLNTLELGFAAFLFVCGCYDFVHGKNNY  509

Query  246  YIYLVLQALAFFAVGFSFVGTQVPT  172
            +IYL LQ ++FF  G  ++GT VP+
Sbjct  510  FIYLFLQTMSFFISGLGWIGTYVPS  534



>ref|NP_001046164.1| Os02g0192500 [Oryza sativa Japonica Group]
 sp|Q7PC76.1|CSLA1_ORYSJ RecName: Full=Glucomannan 4-beta-mannosyltransferase 1; AltName: 
Full=Cellulose synthase-like protein A1; AltName: Full=Glucomannan-synthase 
1; Short=Mannan synthase 1; AltName: Full=OsCslA1; 
AltName: Full=OsCslA9 [Oryza sativa Japonica Group]
 tpg|DAA01743.1| TPA_exp: cellulose synthase-like A1 [Oryza sativa (japonica cultivar-group)]
 dbj|BAD15390.1| putative cellulose synthase-like protein OsCslA9 [Oryza sativa 
Japonica Group]
 dbj|BAD34025.1| putative cellulose synthase-like protein OsCslA9 [Oryza sativa 
Japonica Group]
 dbj|BAF08078.1| Os02g0192500 [Oryza sativa Japonica Group]
 dbj|BAG95675.1| unnamed protein product [Oryza sativa Japonica Group]
Length=521

 Score =   228 bits (582),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 151/203 (74%), Gaps = 1/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++++V+++KK H+IY FF +RKIIAH VTF FYC++IP  I +P
Sbjct  317  SCGPANLFRKMLMEIVRNKKVTIWKKIHVIYNFFLIRKIIAHIVTFAFYCLIIPATIFVP  376

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K   +Y+P  IT+LN+  T RSFHLL  WILFENVMSLHRTKA +IGLLEA RAN
Sbjct  377  EVRIPKWGCVYIPTIITLLNSVGTPRSFHLLFFWILFENVMSLHRTKATLIGLLEAGRAN  436

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRT-CRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFY  244
            EWVVTEKLGNA K + + ++  +++  R+ +R+++ E+ +  F+  C  YD+ FG D F+
Sbjct  437  EWVVTEKLGNALKMKSSSKSSAKKSFMRVWDRLNVTELGVAAFLFSCGWYDLAFGKDHFF  496

Query  243  IYLVLQALAFFAVGFSFVGTQVP  175
            IYL  Q  AFF VG  +VGT VP
Sbjct  497  IYLFFQGAAFFIVGIGYVGTIVP  519



>ref|XP_011044347.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Populus 
euphratica]
Length=537

 Score =   229 bits (583),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 112/204 (55%), Positives = 146/204 (72%), Gaps = 5/204 (2%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++++V  +KKF++IY+FFFVRKIIAH VTF FYCVV+P  I++P
Sbjct  332  SCGPANLFRKMAMEIVRNKKVRFWKKFYVIYSFFFVRKIIAHMVTFSFYCVVLPLTILVP  391

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ +    A+Y+P+ ITILN+  T RS HLL  WILFENVMSLHRTKA  IGLLEA RAN
Sbjct  392  EVKVPIWGAVYIPSVITILNSVGTPRSIHLLFYWILFENVMSLHRTKATFIGLLEAGRAN  451

Query  420  EWVVTEKLGN-----AAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGH  256
            EWVVTEKLGN     A  ++  ++APR+   +  +R++ LE+    F+  C  YD   G 
Sbjct  452  EWVVTEKLGNTLQKAAEAKKSNLKAPRKFRFKFTDRLNTLELGFSAFLFLCGCYDFANGK  511

Query  255  DLFYIYLVLQALAFFAVGFSFVGT  184
            + ++IYL LQ + FF  G  +VGT
Sbjct  512  NNYFIYLWLQTVTFFITGIGYVGT  535



>ref|XP_007208459.1| hypothetical protein PRUPE_ppa003918mg [Prunus persica]
 gb|EMJ09658.1| hypothetical protein PRUPE_ppa003918mg [Prunus persica]
Length=516

 Score =   228 bits (582),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/210 (55%), Positives = 153/210 (73%), Gaps = 7/210 (3%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+K+++V+L+KKF++IY+FFFVRKIIAH VTFFFYCVV+P  I++P
Sbjct  306  SCGPANLFRKMVMEIVKTKKVTLWKKFYVIYSFFFVRKIIAHMVTFFFYCVVLPLTILVP  365

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+++    A+Y+P+ ITILN+  T RS HLL  WILFENVMSLHRTKA +IGLLE  RAN
Sbjct  366  EVYVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLHRTKATLIGLLETGRAN  425

Query  420  EWVVTEKLGN-------AAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIF  262
            EWVVTEKLG+        A ++ A +  +R   +   R+HLLE+  G F+  C  YD + 
Sbjct  426  EWVVTEKLGDIVKNKAAEAAKKPAPKFFKRPKFKFGNRLHLLELGFGAFLFVCGCYDYVH  485

Query  261  GHDLFYIYLVLQALAFFAVGFSFVGTQVPT  172
            G + +++YL LQ + F   GF +VGT +P+
Sbjct  486  GKNNYFVYLFLQTITFLICGFGYVGTIIPS  515



>ref|XP_007208460.1| hypothetical protein PRUPE_ppa003918mg [Prunus persica]
 gb|EMJ09659.1| hypothetical protein PRUPE_ppa003918mg [Prunus persica]
Length=540

 Score =   229 bits (583),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 115/210 (55%), Positives = 153/210 (73%), Gaps = 7/210 (3%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+K+++V+L+KKF++IY+FFFVRKIIAH VTFFFYCVV+P  I++P
Sbjct  330  SCGPANLFRKMVMEIVKTKKVTLWKKFYVIYSFFFVRKIIAHMVTFFFYCVVLPLTILVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+++    A+Y+P+ ITILN+  T RS HLL  WILFENVMSLHRTKA +IGLLE  RAN
Sbjct  390  EVYVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLHRTKATLIGLLETGRAN  449

Query  420  EWVVTEKLGN-------AAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIF  262
            EWVVTEKLG+        A ++ A +  +R   +   R+HLLE+  G F+  C  YD + 
Sbjct  450  EWVVTEKLGDIVKNKAAEAAKKPAPKFFKRPKFKFGNRLHLLELGFGAFLFVCGCYDYVH  509

Query  261  GHDLFYIYLVLQALAFFAVGFSFVGTQVPT  172
            G + +++YL LQ + F   GF +VGT +P+
Sbjct  510  GKNNYFVYLFLQTITFLICGFGYVGTIIPS  539



>ref|XP_008227108.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2 [Prunus mume]
Length=540

 Score =   229 bits (583),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 115/210 (55%), Positives = 153/210 (73%), Gaps = 7/210 (3%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+K+++V+L+KKF++IY+FFFVRKIIAH VTFFFYCVV+P  I++P
Sbjct  330  SCGPANLFRKMVMEIVKTKKVTLWKKFYVIYSFFFVRKIIAHMVTFFFYCVVLPLTILVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+++    A+Y+P+ ITILN+  T RS HLL  WILFENVMSLHRTKA +IGLLE  RAN
Sbjct  390  EVYVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLHRTKATLIGLLETGRAN  449

Query  420  EWVVTEKLGN-------AAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIF  262
            EWVVTEKLG+        A ++ A +  +R   +   R+HLLE+  G F+  C  YD + 
Sbjct  450  EWVVTEKLGDIVKNKAAEAAKKPAPKFFKRPKFKFGNRLHLLELGFGAFLFVCGCYDYVH  509

Query  261  GHDLFYIYLVLQALAFFAVGFSFVGTQVPT  172
            G + +++YL LQ + F   GF +VGT +P+
Sbjct  510  GKNNYFVYLFLQTITFLICGFGYVGTIIPS  539



>dbj|BAE98718.1| hypothetical protein [Arabidopsis thaliana]
Length=533

 Score =   228 bits (582),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 108/203 (53%), Positives = 144/203 (71%), Gaps = 0/203 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+ ++ V+L+KK H+IY+FF VRK++AH VTF FYCV++P  +++P
Sbjct  330  SCGPANLFRKMAFEIMTNKNVTLWKKVHVIYSFFVVRKLVAHIVTFIFYCVILPATVLVP  389

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  A Y+P+ IT+LNA  T RS HL+V WILFENVMSLHRTKA  IGLLE  R N
Sbjct  390  EVTVPKWGAFYIPSVITLLNAVGTPRSLHLMVFWILFENVMSLHRTKATFIGLLEGGRVN  449

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFYI  241
            EW+VTEKLG+   +     + +    R  +RIH+LE+ +G ++L    YD  FG + +Y+
Sbjct  450  EWIVTEKLGDVKAKSATKTSKKVIRFRFGDRIHVLELGVGMYLLFVGCYDAFFGKNHYYL  509

Query  240  YLVLQALAFFAVGFSFVGTQVPT  172
            YL  QA+AFF  GF  +GT VP 
Sbjct  510  YLFAQAIAFFIAGFGQIGTIVPN  532



>ref|XP_010453775.1| PREDICTED: probable mannan synthase 11 [Camelina sativa]
Length=506

 Score =   228 bits (580),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 108/202 (53%), Positives = 147/202 (73%), Gaps = 5/202 (2%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+ ++RV+++KK ++IY+FFFVRKII H+ TFFFYC+++P ++  P
Sbjct  308  SCGPANLFRKMTMEIISNKRVTIWKKLYVIYSFFFVRKIIVHFFTFFFYCLILPTSVFFP  367

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+++     +Y P  IT+ NA  T RSF+L+V W+LFENVM++HRTK   IGLLE  R N
Sbjct  368  EVNIPTWSTVYFPLMITLFNAIATPRSFYLVVFWVLFENVMAMHRTKGTFIGLLEGGRVN  427

Query  420  EWVVTEKLGNAAKQR--QAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDLF  247
            EWVVTEKLG+A + +    +R PR       +RI+  E+M+G ++L CASY+++FG  L 
Sbjct  428  EWVVTEKLGDALETKLLPQIRKPRNGVL---DRINSKEMMVGIYILCCASYNLVFGKTLL  484

Query  246  YIYLVLQALAFFAVGFSFVGTQ  181
            YIYL +QALAF   GF FVGT 
Sbjct  485  YIYLYMQALAFIISGFGFVGTN  506



>tpg|DAA57949.1| TPA: hypothetical protein ZEAMMB73_988025 [Zea mays]
Length=411

 Score =   225 bits (573),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 120/213 (56%), Positives = 159/213 (75%), Gaps = 12/213 (6%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRK+  EIL S+RVSL KKFHL+YAFFFVRK++AH VTF FYCV+IP  +++ 
Sbjct  201  SCGPANLFRKVLPEILHSDRVSLGKKFHLLYAFFFVRKVVAHLVTFLFYCVIIPACMLVQ  260

Query  600  -ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRA  424
             ++ L K +A+Y+ A IT+LNAACT RS HLL+ WILFENVMS+HR+KAA+I LLEA+R+
Sbjct  261  GDVCLPKYVAMYVSALITLLNAACTPRSCHLLIFWILFENVMSMHRSKAAVICLLEASRS  320

Query  423  NEWVVTEKLGNAAKQRQAVRAPRRRTCRL--------RERIHLLEIMMGFFMLQCASYDI  268
            NEWVVT KL  A+ +  A    +++  +L        R R+H+LE+ MG  +L CA YDI
Sbjct  321  NEWVVTAKL--ASDKAAASVFAKKKNLQLFRTRCSTTRRRMHVLELTMGACLLYCAVYDI  378

Query  267  I-FGHDLFYIYLVLQALAFFAVGFSFVGTQVPT  172
            + FG + +Y+YL+LQ+ A F VGF +VGT  P+
Sbjct  379  VFFGRNHYYMYLLLQSAAAFIVGFGYVGTLAPS  411



>emb|CBI17089.3| unnamed protein product [Vitis vinifera]
Length=429

 Score =   225 bits (574),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 109/204 (53%), Positives = 145/204 (71%), Gaps = 1/204 (0%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKM  EI+++++V  +KK ++IY+FF VRKI+AH VTF  YCVV+P  I+IP
Sbjct  226  SCGPANLFRKMVMEIVRNKKVRFWKKVYVIYSFFLVRKIVAHMVTFCLYCVVLPLTILIP  285

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ +     +Y+P+ IT LNA  T RS HLL  WILFENVMS HRTKA +IGLLEA RAN
Sbjct  286  EVEIPIWGIVYIPSIITTLNAVGTPRSIHLLFYWILFENVMSFHRTKATLIGLLEAGRAN  345

Query  420  EWVVTEKLGNAAKQRQAVRAPRRRT-CRLRERIHLLEIMMGFFMLQCASYDIIFGHDLFY  244
            EWVVTEKLG+  K +   +A  +R   ++ +RI+ +E+    F+  CA YD ++G   FY
Sbjct  346  EWVVTEKLGDTLKNKANTKAAAKRPRFKIGDRINTMELGFSAFLFFCACYDFLYGKYYFY  405

Query  243  IYLVLQALAFFAVGFSFVGTQVPT  172
            +YL LQ + +F VG  +VGT VP+
Sbjct  406  VYLFLQTITYFIVGIGYVGTIVPS  429



>gb|AAQ62570.1| glycosyltransferase 1 [Ipomoea trifida]
 gb|AAS79578.1| putative glycosyltransferase [Ipomoea trifida]
Length=537

 Score =   228 bits (581),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 114/206 (55%), Positives = 146/206 (71%), Gaps = 3/206 (1%)
 Frame = -1

Query  780  SCGPANLFRKMFKEILKSERVSLYKKFHLIYAFFFVRKIIAHWVTFFFYCVVIPFAIVIP  601
            SCGPANLFRKMF EI++++RV+++KK ++IY+FF VRKI AH VTFFFYCVV+P  I++P
Sbjct  332  SCGPANLFRKMFIEIVRNKRVNVWKKVYVIYSFFLVRKITAHMVTFFFYCVVLPLTILVP  391

Query  600  ELHLTKPIAIYLPATITILNAACTKRSFHLLVVWILFENVMSLHRTKAAIIGLLEANRAN  421
            E+ + K  AIY+P  ITILN+  T RS HLL  WILFENVMS HRTKA +IGLLE  RAN
Sbjct  392  EVEVPKWGAIYIPCIITILNSVGTPRSIHLLFYWILFENVMSFHRTKATLIGLLEFKRAN  451

Query  420  EWVVTEKLGNA---AKQRQAVRAPRRRTCRLRERIHLLEIMMGFFMLQCASYDIIFGHDL  250
            EWVVTEKLG+A     +  +  AP++     R+RI L E+    F+  C  YD + G + 
Sbjct  452  EWVVTEKLGDAINNNNKSNSKPAPKKSKSMFRDRILLHELGFAVFLFVCGVYDFLHGKNH  511

Query  249  FYIYLVLQALAFFAVGFSFVGTQVPT  172
            +YIYL LQ + F   G  +VGT VP+
Sbjct  512  YYIYLFLQVITFTIAGVGWVGTIVPS  537



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1434617960664