BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18163_g1_i1 len=1119 path=[2611:0-403 3015:404-456 3068:457-1118]

Length=1119
                                                                      Score     E

ref|XP_006354365.1|  PREDICTED: mannan synthase 1-like                  588   0.0      
ref|XP_009765562.1|  PREDICTED: mannan synthase 1-like isoform X2       587   0.0      
ref|XP_009765561.1|  PREDICTED: mannan synthase 1-like isoform X1       588   0.0      
ref|XP_009597671.1|  PREDICTED: mannan synthase 1-like isoform X1       588   0.0      
ref|XP_009597672.1|  PREDICTED: mannan synthase 1-like isoform X2       586   0.0      
ref|XP_004246627.1|  PREDICTED: mannan synthase 1-like                  585   0.0      
emb|CDP06773.1|  unnamed protein product                                573   0.0      
ref|XP_011094610.1|  PREDICTED: mannan synthase 1-like                  573   0.0      
gb|ACE60600.1|  mannan synthase                                         568   0.0      Coffea canephora [robusta coffee]
gb|ACE60601.1|  mannan synthase                                         568   0.0      Coffea arabica [arabica coffee]
gb|EYU29872.1|  hypothetical protein MIMGU_mgv1a023425mg                567   0.0      
gb|EYU38560.1|  hypothetical protein MIMGU_mgv1a017694mg                563   0.0      
gb|EPS59546.1|  mannan synthase                                         542   0.0      
ref|XP_002277171.1|  PREDICTED: mannan synthase 1-like                  547   0.0      Vitis vinifera
emb|CAN74410.1|  hypothetical protein VITISV_013215                     546   0.0      Vitis vinifera
gb|KHN02317.1|  Mannan synthase 1                                       541   0.0      
ref|XP_003553558.1|  PREDICTED: mannan synthase 1-like                  541   0.0      
ref|XP_010096071.1|  hypothetical protein L484_000910                   540   0.0      
gb|KEH24032.1|  cellulose synthase-like protein A1                      540   0.0      
gb|AFV79650.1|  mannan synthase                                         538   0.0      
ref|XP_004493996.1|  PREDICTED: mannan synthase 1-like                  536   0.0      
sp|Q6UDF0.1|CSLA1_CYATE  RecName: Full=Mannan synthase 1; AltName...    535   0.0      Cyamopsis tetragonoloba [cluster bean]
ref|XP_003520655.1|  PREDICTED: mannan synthase 1-like                  535   0.0      
gb|KDO49989.1|  hypothetical protein CISIN_1g044519mg                   534   0.0      
emb|CBI32777.3|  unnamed protein product                                516   1e-178   
ref|XP_008800552.1|  PREDICTED: mannan synthase 1-like                  518   3e-178   
ref|XP_006428366.1|  hypothetical protein CICLE_v10013685mg             507   4e-175   
ref|XP_010935704.1|  PREDICTED: mannan synthase 1-like isoform X3       509   5e-175   
ref|XP_010935702.1|  PREDICTED: mannan synthase 1-like isoform X1       510   5e-175   
ref|XP_010935703.1|  PREDICTED: mannan synthase 1-like isoform X2       509   6e-175   
ref|XP_006851749.1|  hypothetical protein AMTR_s00040p00223350          505   5e-173   
ref|XP_009385870.1|  PREDICTED: mannan synthase 1-like                  503   2e-172   
gb|EYU41550.1|  hypothetical protein MIMGU_mgv1a004346mg                501   3e-171   
gb|ABG34547.1|  cellulose synthase-like A1                              499   1e-170   Pinus taeda
ref|XP_002283672.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    499   2e-170   Vitis vinifera
ref|XP_010243535.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    498   2e-170   
emb|CBI30236.3|  unnamed protein product                                498   3e-170   
gb|KDP42759.1|  hypothetical protein JCGZ_23699                         498   4e-170   
ref|XP_003521436.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    498   5e-170   
ref|XP_009353014.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    498   5e-170   
ref|XP_009774056.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    497   6e-170   
ref|XP_010423663.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    497   7e-170   
ref|XP_007027602.1|  Nucleotide-diphospho-sugar transferases supe...    492   7e-170   
ref|XP_010452272.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    497   8e-170   
ref|XP_010490868.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    497   9e-170   
ref|XP_010543471.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    497   9e-170   
ref|XP_011094427.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    496   1e-169   
ref|XP_003554414.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    496   1e-169   
ref|XP_006287469.1|  hypothetical protein CARUB_v10000681mg             496   2e-169   
ref|NP_195996.1|  glucomannan 4-beta-mannosyltransferase 9              496   2e-169   Arabidopsis thaliana [mouse-ear cress]
dbj|BAE98718.1|  hypothetical protein                                   496   2e-169   Arabidopsis thaliana [mouse-ear cress]
gb|ABG34548.1|  cellulose synthase-like A2                              496   3e-169   Pinus taeda
gb|KFK24842.1|  hypothetical protein AALP_AA8G031700                    495   4e-169   
emb|CDP15350.1|  unnamed protein product                                495   4e-169   
gb|KHN09524.1|  Mannan synthase 1                                       493   4e-169   
emb|CDY11268.1|  BnaA03g01040D                                          495   5e-169   
ref|XP_010683891.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    495   5e-169   
ref|XP_009623019.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    495   5e-169   
ref|XP_009130779.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    495   6e-169   
ref|XP_002873112.1|  ATCSLA09                                           495   6e-169   
ref|XP_010050059.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    494   8e-169   
gb|KCW89261.1|  hypothetical protein EUGRSUZ_A01558                     494   1e-168   
ref|XP_007027601.1|  Nucleotide-diphospho-sugar transferases supe...    493   1e-168   
ref|XP_009365313.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    494   1e-168   
gb|AGE09561.1|  CSLA9-like protein                                      494   1e-168   
ref|XP_006398833.1|  hypothetical protein EUTSA_v10013220mg             494   1e-168   
emb|CDX70286.1|  BnaA10g26350D                                          494   1e-168   
emb|CDY10358.1|  BnaCnng02590D                                          494   2e-168   
ref|XP_008462529.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    493   2e-168   
ref|XP_009601859.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    493   3e-168   
gb|KHG19821.1|  Glucomannan 4-beta-mannosyltransferase 9 -like pr...    493   4e-168   
ref|XP_009122674.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    493   4e-168   
ref|XP_004143300.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    492   7e-168   
ref|XP_004164074.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    492   7e-168   
emb|CAN74357.1|  hypothetical protein VITISV_042153                     492   8e-168   Vitis vinifera
ref|XP_007162846.1|  hypothetical protein PHAVU_001G185800g             492   8e-168   
ref|XP_008359466.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    492   8e-168   
ref|XP_007027600.1|  Nucleotide-diphospho-sugar transferases supe...    491   1e-167   
gb|KDO61015.1|  hypothetical protein CISIN_1g0413332mg                  486   2e-167   
ref|XP_006339112.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    491   3e-167   
ref|XP_010558212.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    490   3e-167   
ref|XP_008804385.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    490   4e-167   
ref|XP_007010197.1|  Nucleotide-diphospho-sugar transferases supe...    490   4e-167   
ref|XP_004494136.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    490   4e-167   
ref|XP_009771587.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    490   4e-167   
ref|XP_010694523.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    489   9e-167   
ref|XP_004249461.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    489   1e-166   
ref|XP_008241312.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    489   2e-166   
gb|KEH24115.1|  cellulose synthase-like protein A1                      488   3e-166   
ref|XP_007145259.1|  hypothetical protein PHAVU_007G223800g             487   4e-166   
gb|KDP45030.1|  hypothetical protein JCGZ_01530                         488   5e-166   
ref|XP_003590384.1|  Glucomannan 4-beta-mannosyltransferase             484   7e-166   
ref|XP_006481909.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    486   1e-165   
ref|XP_010912224.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    486   2e-165   
ref|XP_002269110.2|  PREDICTED: glucomannan 4-beta-mannosyltransf...    485   4e-165   Vitis vinifera
ref|XP_006430317.1|  hypothetical protein CICLE_v10011455mg             485   4e-165   
ref|XP_010940677.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    484   8e-165   
gb|AES60635.2|  cellulose synthase-like protein A1                      484   1e-164   
ref|XP_006492171.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    482   4e-164   
ref|XP_006436686.1|  hypothetical protein CICLE_v10031284mg             481   5e-164   
ref|XP_007203625.1|  hypothetical protein PRUPE_ppa004037mg             482   7e-164   
ref|XP_006381326.1|  hypothetical protein POPTR_0006s11810g             481   1e-163   
ref|XP_002315357.1|  4-mannan synthase family protein                   481   1e-163   Populus trichocarpa [western balsam poplar]
ref|XP_009379774.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    481   1e-163   
ref|XP_011018871.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    481   2e-163   
ref|XP_009401015.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    481   2e-163   
ref|XP_006341174.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    481   2e-163   
ref|XP_010325939.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    481   2e-163   
ref|XP_004497598.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    480   2e-163   
gb|KHN45690.1|  Glucomannan 4-beta-mannosyltransferase 9                478   7e-163   
ref|XP_003535285.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    478   9e-163   
gb|KDO40534.1|  hypothetical protein CISIN_1g009761mg                   479   9e-163   
ref|XP_004496174.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    478   1e-162   
ref|XP_009404378.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    478   2e-162   
ref|XP_008462530.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    472   2e-162   
gb|KHN48194.1|  Glucomannan 4-beta-mannosyltransferase 9                475   2e-161   
ref|XP_010520406.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    476   2e-161   
ref|XP_002269677.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    475   4e-161   Vitis vinifera
ref|XP_003542549.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    474   5e-161   
ref|XP_009603325.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    474   6e-161   
ref|XP_003571119.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    474   7e-161   
ref|XP_004137864.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    474   1e-160   
ref|XP_006287471.1|  hypothetical protein CARUB_v10000683mg             473   2e-160   
ref|XP_002963530.1|  glycosyltransferase family 2 protein               473   2e-160   
ref|XP_007015963.1|  Cellulose synthase-like A02 isoform 3              472   2e-160   
gb|EMS67675.1|  hypothetical protein TRIUR3_27071                       473   2e-160   
ref|XP_002981551.1|  family 2 glycosyltransferase                       473   2e-160   
ref|XP_003535494.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    473   3e-160   
gb|KHN37850.1|  Glucomannan 4-beta-mannosyltransferase 9                472   3e-160   
ref|XP_007015962.1|  Cellulose synthase-like A02 isoform 2              471   3e-160   
ref|XP_008456578.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    472   4e-160   
ref|NP_197666.1|  glucomannan 4-beta-mannosyltransferase 2              473   4e-160   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002874083.1|  hypothetical protein ARALYDRAFT_489123             473   4e-160   
ref|XP_009421122.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    472   5e-160   
dbj|BAK03076.1|  predicted protein                                      471   5e-160   
ref|XP_009390016.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    472   7e-160   
gb|KHN00923.1|  Glucomannan 4-beta-mannosyltransferase 9                471   9e-160   
ref|XP_003556282.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    471   9e-160   
ref|XP_008442792.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    471   1e-159   
gb|KFK39910.1|  hypothetical protein AALP_AA3G305000                    471   2e-159   
ref|XP_008232025.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    470   2e-159   
gb|AFW66231.1|  hypothetical protein ZEAMMB73_021965                    465   2e-159   
ref|XP_007220072.1|  hypothetical protein PRUPE_ppa024741mg             470   2e-159   
ref|XP_010421063.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    470   2e-159   
ref|XP_010493365.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    470   2e-159   
ref|XP_010454539.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    470   3e-159   
ref|XP_007015961.1|  Cellulose synthase-like A02 isoform 1              470   3e-159   
gb|KHF98868.1|  Glucomannan 4-beta-mannosyltransferase 2 -like pr...    470   3e-159   
ref|XP_010278246.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    470   4e-159   
ref|XP_008659807.1|  PREDICTED: probable mannan synthase 9              469   5e-159   
ref|XP_007208459.1|  hypothetical protein PRUPE_ppa003918mg             469   7e-159   
ref|XP_002453460.1|  hypothetical protein SORBIDRAFT_04g006260          469   7e-159   Sorghum bicolor [broomcorn]
ref|XP_007208460.1|  hypothetical protein PRUPE_ppa003918mg             469   8e-159   
gb|KHG21024.1|  Glucomannan 4-beta-mannosyltransferase 2 -like pr...    469   8e-159   
emb|CDX88785.1|  BnaA03g08640D                                          468   9e-159   
gb|AAQ62570.1|  glycosyltransferase 1                                   469   1e-158   Ipomoea trifida
gb|AAQ62571.1|  glycosyltransferase 5                                   468   1e-158   Ipomoea trifida
ref|XP_009760346.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    468   1e-158   
gb|AAQ62572.1|  glycosyltransferase 10                                  469   1e-158   Ipomoea trifida
ref|XP_004497599.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    468   2e-158   
ref|XP_009126562.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    468   3e-158   
ref|XP_002311972.2|  4-mannan synthase family protein                   468   3e-158   Populus trichocarpa [western balsam poplar]
ref|XP_007132379.1|  hypothetical protein PHAVU_011G089900g             468   3e-158   
ref|XP_006400777.1|  hypothetical protein EUTSA_v10013221mg             468   3e-158   
ref|XP_002312893.1|  glycosyl transferase family 2 family protein       468   3e-158   Populus trichocarpa [western balsam poplar]
ref|XP_006347222.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    467   4e-158   
ref|XP_009403735.1|  PREDICTED: probable mannan synthase 9 isofor...    467   4e-158   
ref|XP_010031452.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    467   4e-158   
ref|XP_010089159.1|  hypothetical protein L484_003290                   467   5e-158   
dbj|BAF36300.1|  hypothetical protein                                   468   5e-158   Ipomoea trifida
emb|CDX71011.1|  BnaC03g10950D                                          466   5e-158   
ref|XP_011005673.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    467   6e-158   
gb|KDP34366.1|  hypothetical protein JCGZ_11249                         467   6e-158   
ref|XP_010038980.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    467   7e-158   
ref|XP_007143832.1|  hypothetical protein PHAVU_007G105400g             466   7e-158   
ref|XP_004951606.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    466   7e-158   
ref|XP_010535659.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    466   8e-158   
ref|XP_011010407.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    466   9e-158   
ref|XP_008227108.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    466   1e-157   
ref|XP_006384673.1|  glycosyl transferase family 2 family protein       466   1e-157   
ref|XP_004239715.2|  PREDICTED: glucomannan 4-beta-mannosyltransf...    466   1e-157   
ref|XP_009364844.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    466   1e-157   
ref|XP_002527445.1|  transferase, transferring glycosyl groups, p...    466   1e-157   Ricinus communis
ref|XP_011044347.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    466   1e-157   
gb|KHN38673.1|  Glucomannan 4-beta-mannosyltransferase 2                466   2e-157   
ref|XP_003538146.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    466   2e-157   
ref|XP_009629011.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    466   2e-157   
ref|XP_009403734.1|  PREDICTED: probable mannan synthase 9 isofor...    466   2e-157   
ref|XP_003539806.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    466   2e-157   
ref|NP_001131007.1|  uncharacterized protein LOC100192112               465   2e-157   Zea mays [maize]
ref|XP_003551076.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    465   2e-157   
gb|KEH42109.1|  cellulose synthase-like protein A1                      465   3e-157   
gb|AFZ78578.1|  cellulose synthase-like protein                         465   3e-157   
ref|XP_008385455.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    466   3e-157   
ref|XP_011010406.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    465   3e-157   
ref|XP_009337395.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    465   4e-157   
ref|XP_008360269.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    465   4e-157   
ref|XP_006484970.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    464   5e-157   
ref|XP_004170553.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    464   5e-157   
ref|XP_004143299.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    464   5e-157   
ref|XP_008458630.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    464   6e-157   
gb|KEH42113.1|  cellulose synthase-like protein A1                      464   6e-157   
ref|XP_004303037.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    464   9e-157   
ref|XP_004145779.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    464   9e-157   
gb|AFZ78579.1|  cellulose synthase-like protein                         464   1e-156   
sp|Q67VS7.1|CSLA9_ORYSJ  RecName: Full=Probable mannan synthase 9...    463   1e-156   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004241301.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    463   1e-156   
ref|XP_004294040.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    464   1e-156   
ref|XP_011024272.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    463   1e-156   
ref|XP_010112526.1|  hypothetical protein L484_012804                   465   1e-156   
gb|KEH42110.1|  cellulose synthase-like protein A1                      463   2e-156   
ref|XP_006424348.1|  hypothetical protein CICLE_v10028164mg             463   2e-156   
ref|XP_004506130.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    463   3e-156   
ref|XP_011088835.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    461   1e-155   
ref|XP_004151323.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    458   2e-155   
ref|XP_009769755.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    460   3e-155   
ref|XP_004307031.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    458   3e-155   
ref|XP_009769757.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    459   3e-155   
emb|CDP06989.1|  unnamed protein product                                459   9e-155   
ref|XP_009794211.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    458   1e-154   
ref|NP_001046164.1|  Os02g0192500                                       457   2e-154   Oryza sativa Japonica Group [Japonica rice]
gb|EAY84833.1|  hypothetical protein OsI_06199                          457   2e-154   Oryza sativa Indica Group [Indian rice]
gb|ACV71015.1|  UPA15                                                   457   3e-154   Capsicum annuum
ref|XP_009603535.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    457   4e-154   
ref|XP_007219015.1|  hypothetical protein PRUPE_ppa004315mg             456   4e-154   
ref|XP_006656269.1|  PREDICTED: probable mannan synthase 9-like         456   4e-154   
ref|XP_004251009.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    456   7e-154   
emb|CAN82595.1|  hypothetical protein VITISV_013708                     456   8e-154   Vitis vinifera
ref|XP_008363208.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    454   1e-153   
ref|XP_006349077.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    456   1e-153   
ref|XP_011089999.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    456   2e-153   
ref|XP_009120642.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    455   2e-153   
gb|KGN63048.1|  hypothetical protein Csa_2G386160                       460   4e-153   
ref|XP_009335111.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    454   5e-153   
ref|XP_010690012.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    454   6e-153   
ref|XP_001759209.1|  cellulose synthase-like A3, glycosyltransfer...    454   6e-153   
emb|CDY26949.1|  BnaC09g36340D                                          453   8e-153   
ref|XP_009590983.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    453   9e-153   
gb|ACF33171.1|  mannan synthase                                         454   1e-152   Coffea canephora [robusta coffee]
ref|XP_009361452.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    451   1e-152   
ref|XP_010110184.1|  hypothetical protein L484_016805                   453   1e-152   
ref|XP_004965827.1|  PREDICTED: probable mannan synthase 9-like         453   1e-152   
ref|XP_003606274.1|  Glucomannan 4-beta-mannosyltransferase             451   2e-152   
gb|KEH43412.1|  cellulose synthase-like protein A1                      452   3e-152   
ref|XP_009793131.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    451   8e-152   
ref|XP_010067160.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    449   1e-151   
emb|CDY09164.1|  BnaA02g05900D                                          450   1e-151   
emb|CDY35710.1|  BnaC02g09760D                                          449   2e-151   
ref|XP_003606273.1|  Glucomannan 4-beta-mannosyltransferase             450   2e-151   
gb|EYU36982.1|  hypothetical protein MIMGU_mgv1a004240mg                450   2e-151   
gb|ABD79100.1|  cellulose synthase-like A2                              449   4e-151   Physcomitrella patens
ref|XP_008363527.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    448   4e-151   
ref|XP_001759264.1|  cellulose synthase-like A2, glycosyltransfer...    449   5e-151   
ref|XP_002528577.1|  conserved hypothetical protein                     447   6e-151   Ricinus communis
gb|AFW87395.1|  hypothetical protein ZEAMMB73_638072                    445   3e-150   
ref|XP_006646997.1|  PREDICTED: LOW QUALITY PROTEIN: glucomannan ...    447   3e-150   
ref|XP_006345855.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    445   5e-150   
ref|XP_001764061.1|  cellulose synthase-like A1, glycosyltransfer...    446   7e-150   
emb|CDX92340.1|  BnaA10g13790D                                          456   2e-148   
ref|XP_004250002.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    442   2e-148   
ref|XP_006360487.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    442   3e-148   
ref|XP_010525608.1|  PREDICTED: probable mannan synthase 3 isofor...    442   6e-148   
ref|XP_010525610.1|  PREDICTED: probable mannan synthase 3 isofor...    441   7e-148   
dbj|BAK08066.1|  predicted protein                                      441   7e-148   
ref|XP_010554514.1|  PREDICTED: probable mannan synthase 7 isofor...    442   9e-148   
ref|XP_008787118.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    438   5e-147   
ref|XP_010937165.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    438   2e-146   
ref|XP_006416081.1|  hypothetical protein EUTSA_v10007266mg             438   2e-146   
ref|NP_001183100.1|  hypothetical protein                               437   2e-146   
ref|XP_009793130.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    438   2e-146   
ref|XP_003560565.2|  PREDICTED: probable mannan synthase 9              435   4e-146   
ref|XP_010937166.1|  PREDICTED: probable mannan synthase 11             436   1e-145   
ref|XP_006661580.1|  PREDICTED: mannan synthase 1-like                  434   1e-145   
ref|XP_003578707.1|  PREDICTED: mannan synthase 1-like                  434   2e-145   
ref|XP_008232088.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    432   2e-145   
gb|EEE56486.1|  hypothetical protein OsJ_05716                          432   3e-145   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002459874.1|  hypothetical protein SORBIDRAFT_02g012870          434   5e-145   Sorghum bicolor [broomcorn]
ref|XP_010505088.1|  PREDICTED: probable mannan synthase 7              434   6e-145   
dbj|BAD46620.1|  putative beta-1,4-mannan synthase                      434   6e-145   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001063998.1|  Os09g0572500                                       434   7e-145   
ref|XP_010509580.1|  PREDICTED: probable mannan synthase 7              434   7e-145   
gb|KGN46914.1|  hypothetical protein Csa_6G150530                       433   8e-145   
ref|XP_009403159.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    434   8e-145   
ref|XP_008783962.1|  PREDICTED: probable mannan synthase 9 isofor...    434   8e-145   
ref|XP_006307154.1|  hypothetical protein CARUB_v10008745mg             434   9e-145   
ref|XP_009382953.1|  PREDICTED: probable mannan synthase 11             432   2e-144   
ref|XP_010492500.1|  PREDICTED: probable mannan synthase 11             431   2e-144   
ref|XP_002890585.1|  hypothetical protein ARALYDRAFT_889889             433   2e-144   
ref|XP_010462862.1|  PREDICTED: probable mannan synthase 3              432   3e-144   
ref|XP_008783939.1|  PREDICTED: probable mannan synthase 4 isofor...    431   3e-144   
ref|XP_004959258.1|  PREDICTED: mannan synthase 1-like                  432   4e-144   
ref|XP_008787138.1|  PREDICTED: probable mannan synthase 11             430   4e-144   
ref|XP_010521855.1|  PREDICTED: probable mannan synthase 3              432   5e-144   
ref|XP_010453775.1|  PREDICTED: probable mannan synthase 11             430   6e-144   
ref|XP_010477641.1|  PREDICTED: probable mannan synthase 3              432   7e-144   
ref|XP_010516764.1|  PREDICTED: probable mannan synthase 7 isofor...    431   9e-144   
ref|NP_850952.1|  putative mannan synthase 3                            431   9e-144   
gb|AAM61171.1|  putative glucosyltransferase                            431   1e-143   
ref|XP_010420302.1|  PREDICTED: probable mannan synthase 11             429   1e-143   
ref|XP_010937167.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    432   1e-143   
ref|XP_009410399.1|  PREDICTED: probable mannan synthase 11 isofo...    430   1e-143   
ref|XP_002879565.1|  hypothetical protein ARALYDRAFT_482526             431   2e-143   
gb|EEC85104.1|  hypothetical protein OsI_32487                          430   2e-143   
ref|NP_565813.1|  putative mannan synthase 7                            431   2e-143   
ref|XP_008783930.1|  PREDICTED: probable mannan synthase 3 isofor...    431   3e-143   
ref|XP_010554517.1|  PREDICTED: probable mannan synthase 11             430   3e-143   
ref|XP_008783921.1|  PREDICTED: probable mannan synthase 3 isofor...    431   3e-143   
ref|XP_009410012.1|  PREDICTED: probable mannan synthase 9 isofor...    429   7e-143   
ref|XP_009410011.1|  PREDICTED: probable mannan synthase 9 isofor...    429   9e-143   
gb|EMT23763.1|  hypothetical protein F775_17087                         437   1e-142   
ref|XP_009131529.1|  PREDICTED: probable mannan synthase 11             426   1e-142   
ref|XP_008780561.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    426   2e-142   
ref|XP_010540228.1|  PREDICTED: probable mannan synthase 11 isofo...    427   2e-142   
ref|XP_010498857.1|  PREDICTED: probable mannan synthase 3              428   2e-142   
ref|XP_008664730.1|  PREDICTED: uncharacterized protein LOC100216...    428   2e-142   
ref|XP_008787126.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    425   4e-142   
ref|XP_008780554.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    427   4e-142   
gb|ADW77641.1|  putative mannan synthase                                426   4e-142   
emb|CBI40224.3|  unnamed protein product                                423   4e-142   
ref|XP_008783951.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    424   6e-142   
ref|XP_010917051.1|  PREDICTED: probable mannan synthase 4 isofor...    428   7e-142   
ref|XP_010937164.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    427   7e-142   
ref|XP_009139628.1|  PREDICTED: probable mannan synthase 15 isofo...    426   8e-142   
emb|CDY26505.1|  BnaC09g41630D                                          425   8e-142   
ref|XP_009139627.1|  PREDICTED: probable mannan synthase 15 isofo...    426   1e-141   
gb|KFK25840.1|  hypothetical protein AALP_AA8G168900                    422   2e-141   
gb|EMT23300.1|  hypothetical protein F775_52157                         424   2e-141   
ref|XP_006414327.1|  hypothetical protein EUTSA_v10024828mg             419   2e-141   
ref|XP_008802588.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    425   3e-141   
ref|XP_006287553.1|  hypothetical protein CARUB_v10000762mg             423   3e-141   
ref|XP_006647880.1|  PREDICTED: probable mannan synthase 6-like         424   3e-141   
ref|XP_010554516.1|  PREDICTED: probable mannan synthase 7 isofor...    422   3e-141   
ref|NP_193077.2|  putative mannan synthase 15                           424   4e-141   
ref|XP_006606289.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    421   6e-141   
gb|KFK25839.1|  hypothetical protein AALP_AA8G168900                    422   7e-141   
ref|XP_006589371.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    422   1e-140   
ref|XP_010540227.1|  PREDICTED: probable mannan synthase 11 isofo...    422   1e-140   
emb|CDY40448.1|  BnaA04g20690D                                          424   2e-140   
ref|XP_009121507.1|  PREDICTED: probable mannan synthase 11             421   2e-140   
ref|XP_009380154.1|  PREDICTED: probable mannan synthase 4              424   2e-140   
emb|CDY32098.1|  BnaC04g44680D                                          422   4e-140   
ref|XP_010917052.1|  PREDICTED: probable mannan synthase 4 isofor...    422   6e-140   
gb|AED99880.1|  glycosyltransferase                                     418   7e-140   
emb|CDY40295.1|  BnaA07g09050D                                          421   8e-140   
emb|CDY44151.1|  BnaA09g31010D                                          421   8e-140   
ref|XP_009141504.1|  PREDICTED: probable mannan synthase 7              421   9e-140   
ref|XP_009115523.1|  PREDICTED: probable mannan synthase 3              421   9e-140   
ref|XP_009103139.1|  PREDICTED: probable mannan synthase 10             421   1e-139   
ref|XP_010912225.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    419   1e-139   
emb|CDO99850.1|  unnamed protein product                                417   2e-139   
emb|CDY01129.1|  BnaA04g06900D                                          419   2e-139   
ref|XP_006414326.1|  hypothetical protein EUTSA_v10024828mg             420   3e-139   
ref|XP_006282581.1|  hypothetical protein CARUB_v10004510mg             420   3e-139   
gb|KDO45609.1|  hypothetical protein CISIN_1g040333mg                   418   3e-139   
emb|CDX79614.1|  BnaC03g19500D                                          419   3e-139   
ref|XP_004973516.1|  PREDICTED: probable mannan synthase 11-like        420   4e-139   
ref|XP_010434799.1|  PREDICTED: probable mannan synthase 1 isofor...    419   4e-139   
gb|EEC73998.1|  hypothetical protein OsI_08915                          419   5e-139   
emb|CDY04707.1|  BnaC05g18820D                                          419   5e-139   
ref|XP_010434800.1|  PREDICTED: probable mannan synthase 1 isofor...    419   6e-139   
ref|XP_010449754.1|  PREDICTED: probable mannan synthase 1              419   9e-139   
ref|XP_010440127.1|  PREDICTED: probable mannan synthase 1              418   2e-138   
dbj|BAD94168.1|  cellulose synthase like protein                        415   2e-138   
ref|XP_009410398.1|  PREDICTED: probable mannan synthase 11 isofo...    417   3e-138   
ref|XP_009133031.1|  PREDICTED: probable mannan synthase 7              417   4e-138   
gb|EEE57800.1|  hypothetical protein OsJ_08359                          416   4e-138   
sp|Q6Z2T9.2|CSLA6_ORYSJ  RecName: Full=Probable mannan synthase 6...    417   4e-138   
emb|CDY09672.1|  BnaC07g33890D                                          409   7e-138   
gb|KFK36462.1|  hypothetical protein AALP_AA4G127800                    413   1e-137   
sp|Q84W54.1|CSLA1_ARATH  RecName: Full=Probable mannan synthase 1...    415   1e-137   
ref|XP_009419094.1|  PREDICTED: probable mannan synthase 4              415   2e-137   
ref|XP_002870144.1|  hypothetical protein ARALYDRAFT_915064             415   2e-137   
ref|XP_003572230.2|  PREDICTED: probable mannan synthase 11 isofo...    415   2e-137   
ref|XP_010450207.1|  PREDICTED: probable mannan synthase 15 isofo...    414   4e-137   
ref|XP_010450208.1|  PREDICTED: probable mannan synthase 15 isofo...    414   5e-137   
gb|AAF87149.1|AC002423_14  T23E23.23                                    413   5e-137   
ref|XP_010440584.1|  PREDICTED: probable mannan synthase 15 isofo...    413   6e-137   
ref|XP_010440585.1|  PREDICTED: probable mannan synthase 15 isofo...    413   6e-137   
ref|NP_001031084.1|  putative mannan synthase 3                         411   7e-137   
ref|NP_173818.1|  cellulose synthase-like A10                           413   9e-137   
ref|XP_006833228.1|  hypothetical protein AMTR_s00072p00194730          405   9e-137   
ref|XP_008806011.1|  PREDICTED: probable mannan synthase 4              414   1e-136   
ref|XP_009390887.1|  PREDICTED: probable mannan synthase 11             412   1e-136   
ref|XP_009353016.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    410   2e-136   
ref|XP_010498927.1|  PREDICTED: probable mannan synthase 10             412   2e-136   
ref|XP_010516765.1|  PREDICTED: probable mannan synthase 7 isofor...    410   2e-136   
dbj|BAD15538.1|  putative glycosyltransferase 10                        412   6e-136   
ref|XP_006283494.1|  hypothetical protein CARUB_v10004546mg             410   7e-136   
gb|EYU36983.1|  hypothetical protein MIMGU_mgv1a004073mg                410   1e-135   
emb|CDX90506.1|  BnaA03g42750D                                          410   1e-135   
ref|XP_006307167.1|  hypothetical protein CARUB_v10008757mg             410   1e-135   
ref|XP_008677729.1|  PREDICTED: uncharacterized protein LOC100501...    410   2e-135   
ref|XP_009136796.1|  PREDICTED: probable mannan synthase 1              410   2e-135   
ref|XP_002893324.1|  hypothetical protein ARALYDRAFT_313253             410   2e-135   
ref|XP_006606290.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    405   2e-135   
ref|XP_010435266.1|  PREDICTED: probable mannan synthase 15 isofo...    409   2e-135   
ref|XP_010477728.1|  PREDICTED: probable mannan synthase 10             409   3e-135   
ref|XP_010460178.1|  PREDICTED: probable mannan synthase 10             409   3e-135   
ref|XP_009116294.1|  PREDICTED: probable mannan synthase 14             408   4e-135   
ref|XP_006416032.1|  hypothetical protein EUTSA_v10007269mg             409   7e-135   
ref|XP_011088832.1|  PREDICTED: probable mannan synthase 11             409   8e-135   
gb|KFK44470.1|  hypothetical protein AALP_AA1G260600                    408   9e-135   
gb|KFK26523.1|  hypothetical protein AALP_AA8G260200                    408   1e-134   
ref|XP_006403035.1|  hypothetical protein EUTSA_v10005891mg             407   1e-134   
emb|CDY54604.1|  BnaA05g28600D                                          406   2e-134   
gb|EMT24748.1|  hypothetical protein F775_52670                         405   5e-134   
gb|EYU36103.1|  hypothetical protein MIMGU_mgv1a004186mg                405   6e-134   
ref|XP_008673321.1|  PREDICTED: hypothetical protein isoform X1         402   8e-134   
sp|Q6YWK8.1|CSLAB_ORYSJ  RecName: Full=Probable mannan synthase 1...    405   2e-133   
sp|Q8S7W0.1|CSLA4_ORYSJ  RecName: Full=Probable mannan synthase 4...    405   2e-133   
ref|XP_002878056.1|  hypothetical protein ARALYDRAFT_907034             404   2e-133   
emb|CDX72181.1|  BnaC08g26930D                                          404   3e-133   
ref|XP_008681194.1|  PREDICTED: hypothetical protein isoform X1         404   3e-133   
ref|NP_001132315.1|  hypothetical protein                               404   4e-133   
ref|XP_002452557.1|  hypothetical protein SORBIDRAFT_04g028070          404   6e-133   
gb|KFK34844.1|  hypothetical protein AALP_AA5G200500                    402   6e-133   
gb|EPS67079.1|  hypothetical protein M569_07697                         393   1e-132   
gb|KCW89263.1|  hypothetical protein EUGRSUZ_A01558                     398   2e-132   
ref|XP_010427404.1|  PREDICTED: probable mannan synthase 14             400   5e-132   
ref|XP_010516194.1|  PREDICTED: probable mannan synthase 14 isofo...    400   9e-132   
gb|EMT15170.1|  hypothetical protein F775_14200                         399   9e-132   
ref|XP_004953872.1|  PREDICTED: probable mannan synthase 6-like         399   2e-131   
gb|EMT01783.1|  hypothetical protein F775_21241                         400   2e-131   
ref|XP_006290419.1|  hypothetical protein CARUB_v10019203mg             399   2e-131   
ref|XP_002530892.1|  transferase, transferring glycosyl groups, p...    395   3e-131   
ref|NP_191159.2|  cellulose synthase like A14                           398   4e-131   
ref|XP_010504474.1|  PREDICTED: probable mannan synthase 14             398   5e-131   
ref|XP_002468429.1|  hypothetical protein SORBIDRAFT_01g045850          398   8e-131   
gb|EEE68748.1|  hypothetical protein OsJ_27439                          397   9e-131   
emb|CDM86569.1|  unnamed protein product                                398   1e-130   
gb|AAO42815.1|  At3g56000                                               397   2e-130   
ref|XP_011089998.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    394   2e-130   
ref|XP_002863134.1|  predicted protein                                  395   3e-130   
ref|XP_006660158.1|  PREDICTED: LOW QUALITY PROTEIN: probable man...    396   3e-130   
emb|CBI17089.3|  unnamed protein product                                392   5e-130   
ref|XP_010325940.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    393   2e-129   
ref|XP_008363207.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    389   4e-129   
ref|XP_010440586.1|  PREDICTED: probable mannan synthase 15 isofo...    390   9e-129   
ref|XP_008658026.1|  PREDICTED: hypothetical protein isoform X1         392   1e-128   
ref|XP_008783968.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    391   2e-128   
emb|CDX70677.1|  BnaC03g07610D                                          388   2e-128   
ref|NP_197123.3|  cellulose synthase like A11                           388   3e-128   
ref|XP_003570663.2|  PREDICTED: probable mannan synthase 6              389   4e-128   
ref|XP_003560885.1|  PREDICTED: probable mannan synthase 3 isofor...    390   5e-128   
gb|EPS58942.1|  mannan synthase                                         388   7e-128   
ref|XP_010554515.1|  PREDICTED: probable mannan synthase 7 isofor...    387   1e-127   
ref|XP_010435267.1|  PREDICTED: probable mannan synthase 15 isofo...    387   2e-127   
tpg|DAA01745.1|  TPA: cellulose synthase-like A4                        390   4e-127   
ref|XP_006400152.1|  hypothetical protein EUTSA_v100135780mg            377   6e-127   
gb|EPS65070.1|  hypothetical protein M569_09709                         378   9e-127   
gb|EMS50576.1|  hypothetical protein TRIUR3_00182                       386   1e-126   
ref|XP_010234713.1|  PREDICTED: probable mannan synthase 4              387   1e-126   
ref|XP_002461072.1|  hypothetical protein SORBIDRAFT_02g040200          387   2e-126   
ref|XP_006662343.1|  PREDICTED: probable mannan synthase 2-like         384   2e-126   
emb|CAB87854.1|  putative protein                                       385   4e-126   
gb|EMS50191.1|  hypothetical protein TRIUR3_23716                       387   4e-126   
ref|XP_002873761.1|  hypothetical protein ARALYDRAFT_488470             382   8e-126   
ref|XP_006651080.1|  PREDICTED: probable mannan synthase 4-like         384   1e-125   
emb|CDX69464.1|  BnaA10g18130D                                          381   1e-125   
emb|CAC01860.1|  putative protein                                       377   1e-125   
dbj|BAK06422.1|  predicted protein                                      383   3e-125   
ref|XP_008664979.1|  PREDICTED: probable mannan synthase 2 isofor...    381   3e-125   
dbj|BAK05964.1|  predicted protein                                      383   4e-125   
ref|XP_006656810.1|  PREDICTED: probable mannan synthase 3-like         380   5e-125   
tpg|DAA50027.1|  TPA: hypothetical protein ZEAMMB73_959739              382   7e-125   
ref|XP_004958412.1|  PREDICTED: probable mannan synthase 7-like         384   7e-125   
ref|XP_006657995.1|  PREDICTED: probable mannan synthase 7-like         381   1e-124   
ref|XP_004966838.1|  PREDICTED: probable mannan synthase 3-like         382   1e-124   
sp|Q67X45.1|CSLA3_ORYSJ  RecName: Full=Probable mannan synthase 3...    382   1e-124   
emb|CDM86475.1|  unnamed protein product                                381   2e-124   
gb|AFW73395.1|  hypothetical protein ZEAMMB73_786146                    379   3e-124   
ref|XP_008653381.1|  PREDICTED: probable mannan synthase 7              381   6e-124   
ref|XP_010440588.1|  PREDICTED: probable mannan synthase 15 isofo...    377   8e-124   
ref|XP_008664977.1|  PREDICTED: probable mannan synthase 4 isofor...    382   8e-124   
gb|AAC98005.1|  Similar to gi|2245014 glucosyltransferase homolog...    376   1e-123   
ref|XP_008649263.1|  PREDICTED: probable mannan synthase 3 isofor...    379   1e-123   
ref|XP_004987156.1|  PREDICTED: LOW QUALITY PROTEIN: probable man...    377   2e-123   
ref|XP_008649262.1|  PREDICTED: probable mannan synthase 3 isofor...    378   3e-123   
ref|XP_008780566.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    376   7e-123   
ref|XP_010435268.1|  PREDICTED: probable mannan synthase 15 isofo...    374   1e-122   
ref|XP_003562630.1|  PREDICTED: probable mannan synthase 7              377   2e-122   
sp|Q7XIF5.1|CSLA7_ORYSJ  RecName: Full=Probable mannan synthase 7...    377   2e-122   
tpg|DAA01755.1|  TPA: cellulose synthase-like A2                        374   6e-122   
ref|XP_004984220.1|  PREDICTED: probable mannan synthase 5-like i...    373   8e-122   
ref|XP_009603536.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    373   1e-121   
sp|Q7PC67.2|CSLA2_ORYSJ  RecName: Full=Probable mannan synthase 2...    375   1e-121   
ref|XP_004983152.1|  PREDICTED: probable mannan synthase 2-like         375   2e-121   
gb|EMS51579.1|  hypothetical protein TRIUR3_28386                       375   2e-121   
ref|XP_003606275.1|  Glucomannan 4-beta-mannosyltransferase             370   6e-121   
emb|CDP15609.1|  unnamed protein product                                370   2e-120   
ref|NP_001050229.1|  Os03g0377700                                       372   2e-120   
ref|XP_004984219.1|  PREDICTED: probable mannan synthase 5-like i...    372   2e-120   
ref|XP_007027415.1|  Nucleotide-diphospho-sugar transferases supe...    368   3e-120   
ref|XP_004984218.1|  PREDICTED: probable mannan synthase 5-like i...    372   3e-120   
gb|AAK98678.1|AC021893_12  Putative glucosyltransferase                 368   6e-120   
ref|XP_010235155.1|  PREDICTED: probable mannan synthase 11 isofo...    361   2e-119   
ref|XP_009793132.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    367   2e-119   
gb|EMS51475.1|  hypothetical protein TRIUR3_09357                       366   3e-119   
gb|EEE67643.1|  hypothetical protein OsJ_25231                          369   4e-119   
gb|EAY85180.1|  hypothetical protein OsI_06538                          369   4e-119   



>ref|XP_006354365.1| PREDICTED: mannan synthase 1-like [Solanum tuberosum]
Length=527

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/331 (81%), Positives = 304/331 (92%), Gaps = 0/331 (0%)
 Frame = -1

Query  993  MRGIVFSEPGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAI  814
            MR +VF +PG  + T   +SL HAW+ IRVP++VP L +AM  CI MSVMLFLERIYMAI
Sbjct  1    MRNLVFQDPGIRVSTNTTQSLNHAWERIRVPVVVPALHLAMYICIAMSVMLFLERIYMAI  60

Query  813  VIVVVKCFGRKRYTRYKLDALKEDLEQNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWP  634
            VI  VKCFG+KRYT+YKL+++KEDLE+N+NYP VLVQ+PMFNEKEVYKLSIGAVCG +WP
Sbjct  61   VIAGVKCFGKKRYTKYKLESVKEDLEKNKNYPMVLVQIPMFNEKEVYKLSIGAVCGLSWP  120

Query  633  SDRLIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYV  454
            SDRL+VQ+LDDSTN+ LR LV+ EC+ WM RG+NVKYETRNNRNGYKAGAL+EGLKKQYV
Sbjct  121  SDRLVVQVLDDSTNEVLRTLVDLECRKWMERGINVKYETRNNRNGYKAGALKEGLKKQYV  180

Query  453  DDCEFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDY  274
            DDCEFV IFDADFQP+ DFLWRTIPYLL+NPELALVQARWKFVNADEC+MTRLQEMSLDY
Sbjct  181  DDCEFVVIFDADFQPEEDFLWRTIPYLLDNPELALVQARWKFVNADECLMTRLQEMSLDY  240

Query  273  HFTVEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLY  94
            HF+VEQEVGSSTCSFFGFNGTAGVWR++A++DAGGWKDRTTVEDMDLAVRASL+GWKFL+
Sbjct  241  HFSVEQEVGSSTCSFFGFNGTAGVWRIRAVNDAGGWKDRTTVEDMDLAVRASLKGWKFLF  300

Query  93   IGDLEVKNELPSTFKAYRFQQHRWSCGPANL  1
            +GDL VKNELPSTFKAYRFQQHRWSCGPANL
Sbjct  301  VGDLAVKNELPSTFKAYRFQQHRWSCGPANL  331



>ref|XP_009765562.1| PREDICTED: mannan synthase 1-like isoform X2 [Nicotiana sylvestris]
Length=527

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/331 (81%), Positives = 304/331 (92%), Gaps = 0/331 (0%)
 Frame = -1

Query  993  MRGIVFSEPGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAI  814
            MR ++F EPG  + T   +S+ HAW+ IRVP++VP L +AM  CI MS+MLFLERIYMAI
Sbjct  1    MRNLIFEEPGIRVNTNTTQSINHAWERIRVPVVVPALHLAMYICIGMSIMLFLERIYMAI  60

Query  813  VIVVVKCFGRKRYTRYKLDALKEDLEQNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWP  634
            VI  VKCFGRKRYT+YKL+++KEDLE+++NYP VLVQ+PMFNEKEVYKLSIGAVCG +WP
Sbjct  61   VIAGVKCFGRKRYTKYKLESVKEDLEKHKNYPMVLVQIPMFNEKEVYKLSIGAVCGLSWP  120

Query  633  SDRLIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYV  454
            SDRLIVQ+LDDSTN+ LR LV+ EC+ W+ RG+NVKYETRNNRNGYKAGAL+EGLKKQYV
Sbjct  121  SDRLIVQVLDDSTNEVLRTLVDLECRKWIERGINVKYETRNNRNGYKAGALKEGLKKQYV  180

Query  453  DDCEFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDY  274
            DDCEFV IFDADFQPD DFLWRTIPYLL+NPELALVQARWKFVNADEC+MTRLQEMSLDY
Sbjct  181  DDCEFVVIFDADFQPDEDFLWRTIPYLLDNPELALVQARWKFVNADECLMTRLQEMSLDY  240

Query  273  HFTVEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLY  94
            HF+VEQEVGSSTCSFFGFNGTAGVWR+QA++DAGGWKDRTTVEDMDLAVRASL+GWKF++
Sbjct  241  HFSVEQEVGSSTCSFFGFNGTAGVWRIQAVNDAGGWKDRTTVEDMDLAVRASLKGWKFVF  300

Query  93   IGDLEVKNELPSTFKAYRFQQHRWSCGPANL  1
            +GDL VKNELPSTFKAYRFQQHRWSCGPANL
Sbjct  301  VGDLAVKNELPSTFKAYRFQQHRWSCGPANL  331



>ref|XP_009765561.1| PREDICTED: mannan synthase 1-like isoform X1 [Nicotiana sylvestris]
Length=556

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/331 (81%), Positives = 304/331 (92%), Gaps = 0/331 (0%)
 Frame = -1

Query  993  MRGIVFSEPGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAI  814
            MR ++F EPG  + T   +S+ HAW+ IRVP++VP L +AM  CI MS+MLFLERIYMAI
Sbjct  1    MRNLIFEEPGIRVNTNTTQSINHAWERIRVPVVVPALHLAMYICIGMSIMLFLERIYMAI  60

Query  813  VIVVVKCFGRKRYTRYKLDALKEDLEQNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWP  634
            VI  VKCFGRKRYT+YKL+++KEDLE+++NYP VLVQ+PMFNEKEVYKLSIGAVCG +WP
Sbjct  61   VIAGVKCFGRKRYTKYKLESVKEDLEKHKNYPMVLVQIPMFNEKEVYKLSIGAVCGLSWP  120

Query  633  SDRLIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYV  454
            SDRLIVQ+LDDSTN+ LR LV+ EC+ W+ RG+NVKYETRNNRNGYKAGAL+EGLKKQYV
Sbjct  121  SDRLIVQVLDDSTNEVLRTLVDLECRKWIERGINVKYETRNNRNGYKAGALKEGLKKQYV  180

Query  453  DDCEFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDY  274
            DDCEFV IFDADFQPD DFLWRTIPYLL+NPELALVQARWKFVNADEC+MTRLQEMSLDY
Sbjct  181  DDCEFVVIFDADFQPDEDFLWRTIPYLLDNPELALVQARWKFVNADECLMTRLQEMSLDY  240

Query  273  HFTVEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLY  94
            HF+VEQEVGSSTCSFFGFNGTAGVWR+QA++DAGGWKDRTTVEDMDLAVRASL+GWKF++
Sbjct  241  HFSVEQEVGSSTCSFFGFNGTAGVWRIQAVNDAGGWKDRTTVEDMDLAVRASLKGWKFVF  300

Query  93   IGDLEVKNELPSTFKAYRFQQHRWSCGPANL  1
            +GDL VKNELPSTFKAYRFQQHRWSCGPANL
Sbjct  301  VGDLAVKNELPSTFKAYRFQQHRWSCGPANL  331



>ref|XP_009597671.1| PREDICTED: mannan synthase 1-like isoform X1 [Nicotiana tomentosiformis]
Length=556

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/331 (81%), Positives = 304/331 (92%), Gaps = 0/331 (0%)
 Frame = -1

Query  993  MRGIVFSEPGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAI  814
            MR ++F EPG  + T   ++L HAW+ IRVP++VP L +AM  CI MS+MLFLERIYMAI
Sbjct  1    MRNLIFEEPGIRVNTNTTQNLNHAWERIRVPVVVPALHLAMYICIGMSIMLFLERIYMAI  60

Query  813  VIVVVKCFGRKRYTRYKLDALKEDLEQNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWP  634
            VI  VKCFGRKRYT+YKL+++KEDLE+++NYP VLVQ+PMFNEKEVYKLSIGAVCG +WP
Sbjct  61   VIAGVKCFGRKRYTKYKLESVKEDLEKHKNYPMVLVQIPMFNEKEVYKLSIGAVCGLSWP  120

Query  633  SDRLIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYV  454
            SDRLIVQ+LDDSTN+ LR LV+ EC+ W+ RG+NVKYETRNNRNGYKAGAL+EGLKKQYV
Sbjct  121  SDRLIVQVLDDSTNEVLRTLVDLECRKWIERGINVKYETRNNRNGYKAGALKEGLKKQYV  180

Query  453  DDCEFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDY  274
            DDCEFV IFDADFQPD DFLWRTIPYLL+NPELALVQARWKFVNADEC+MTRLQEMSLDY
Sbjct  181  DDCEFVVIFDADFQPDEDFLWRTIPYLLDNPELALVQARWKFVNADECLMTRLQEMSLDY  240

Query  273  HFTVEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLY  94
            HF+VEQEVGSSTCSFFGFNGTAGVWR+QA++DAGGWKDRTTVEDMDLAVRASL+GWKF++
Sbjct  241  HFSVEQEVGSSTCSFFGFNGTAGVWRIQAVNDAGGWKDRTTVEDMDLAVRASLKGWKFVF  300

Query  93   IGDLEVKNELPSTFKAYRFQQHRWSCGPANL  1
            +GDL VKNELPSTFKAYRFQQHRWSCGPANL
Sbjct  301  VGDLAVKNELPSTFKAYRFQQHRWSCGPANL  331



>ref|XP_009597672.1| PREDICTED: mannan synthase 1-like isoform X2 [Nicotiana tomentosiformis]
Length=527

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/331 (81%), Positives = 304/331 (92%), Gaps = 0/331 (0%)
 Frame = -1

Query  993  MRGIVFSEPGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAI  814
            MR ++F EPG  + T   ++L HAW+ IRVP++VP L +AM  CI MS+MLFLERIYMAI
Sbjct  1    MRNLIFEEPGIRVNTNTTQNLNHAWERIRVPVVVPALHLAMYICIGMSIMLFLERIYMAI  60

Query  813  VIVVVKCFGRKRYTRYKLDALKEDLEQNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWP  634
            VI  VKCFGRKRYT+YKL+++KEDLE+++NYP VLVQ+PMFNEKEVYKLSIGAVCG +WP
Sbjct  61   VIAGVKCFGRKRYTKYKLESVKEDLEKHKNYPMVLVQIPMFNEKEVYKLSIGAVCGLSWP  120

Query  633  SDRLIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYV  454
            SDRLIVQ+LDDSTN+ LR LV+ EC+ W+ RG+NVKYETRNNRNGYKAGAL+EGLKKQYV
Sbjct  121  SDRLIVQVLDDSTNEVLRTLVDLECRKWIERGINVKYETRNNRNGYKAGALKEGLKKQYV  180

Query  453  DDCEFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDY  274
            DDCEFV IFDADFQPD DFLWRTIPYLL+NPELALVQARWKFVNADEC+MTRLQEMSLDY
Sbjct  181  DDCEFVVIFDADFQPDEDFLWRTIPYLLDNPELALVQARWKFVNADECLMTRLQEMSLDY  240

Query  273  HFTVEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLY  94
            HF+VEQEVGSSTCSFFGFNGTAGVWR+QA++DAGGWKDRTTVEDMDLAVRASL+GWKF++
Sbjct  241  HFSVEQEVGSSTCSFFGFNGTAGVWRIQAVNDAGGWKDRTTVEDMDLAVRASLKGWKFVF  300

Query  93   IGDLEVKNELPSTFKAYRFQQHRWSCGPANL  1
            +GDL VKNELPSTFKAYRFQQHRWSCGPANL
Sbjct  301  VGDLAVKNELPSTFKAYRFQQHRWSCGPANL  331



>ref|XP_004246627.1| PREDICTED: mannan synthase 1-like [Solanum lycopersicum]
Length=527

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/331 (80%), Positives = 304/331 (92%), Gaps = 0/331 (0%)
 Frame = -1

Query  993  MRGIVFSEPGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAI  814
            MR +VF +PG  + T   +SL HAW+ IRVP++VP L +AM  CI MSVMLFLERIYMAI
Sbjct  1    MRNLVFQDPGIRVSTNSTQSLNHAWERIRVPVVVPALHLAMYICIAMSVMLFLERIYMAI  60

Query  813  VIVVVKCFGRKRYTRYKLDALKEDLEQNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWP  634
            VI  VKCFG+KRYT+YKL+++KEDLE+N+NYP VLVQ+PMFNEKEVYKLSIGAVCG +WP
Sbjct  61   VIAGVKCFGKKRYTKYKLESVKEDLEKNKNYPMVLVQIPMFNEKEVYKLSIGAVCGLSWP  120

Query  633  SDRLIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYV  454
            SDRL+VQ+LDDSTN+ LR LV+ EC+ W+ RG+NVKYETRNNRNGYKAGAL+EGLKKQYV
Sbjct  121  SDRLVVQVLDDSTNEVLRTLVDLECRKWIERGINVKYETRNNRNGYKAGALKEGLKKQYV  180

Query  453  DDCEFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDY  274
            DDCE+V IFDADFQP+ DFLWRTIPYL++NPELALVQARWKFVNADEC+MTRLQEMSLDY
Sbjct  181  DDCEYVVIFDADFQPEEDFLWRTIPYLIDNPELALVQARWKFVNADECLMTRLQEMSLDY  240

Query  273  HFTVEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLY  94
            HF+VEQEVGSSTCSFFGFNGTAGVWR++A++DAGGWKDRTTVEDMDLAVRASL+GWKFL+
Sbjct  241  HFSVEQEVGSSTCSFFGFNGTAGVWRIRAVNDAGGWKDRTTVEDMDLAVRASLKGWKFLF  300

Query  93   IGDLEVKNELPSTFKAYRFQQHRWSCGPANL  1
            +GDL VKNELPSTFKAYRFQQHRWSCGPANL
Sbjct  301  VGDLAVKNELPSTFKAYRFQQHRWSCGPANL  331



>emb|CDP06773.1| unnamed protein product [Coffea canephora]
Length=530

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/333 (80%), Positives = 296/333 (89%), Gaps = 2/333 (1%)
 Frame = -1

Query  993  MRGIVF--SEPGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYM  820
            MR  VF   EP   +Y     SL  AWD IRVPI+VPIL+ A+  CI MSVMLF+ER+YM
Sbjct  1    MRNSVFLEPEPEVNLYDDTGRSLSQAWDRIRVPIIVPILRFALYVCIAMSVMLFIERVYM  60

Query  819  AIVIVVVKCFGRKRYTRYKLDALKEDLEQNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFT  640
            AIVI  VKC GRKRYT+Y LDA+KEDLEQN+NYP VLVQ+PMFNEKEVYKLSIGA CG +
Sbjct  61   AIVIGCVKCLGRKRYTKYNLDAIKEDLEQNRNYPMVLVQIPMFNEKEVYKLSIGAACGLS  120

Query  639  WPSDRLIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQ  460
            WPSDRLIVQ+LDDSTN+ LR LVE EC+ W+ +GVNVKYETRNNRNGYKAGALR+GLKK 
Sbjct  121  WPSDRLIVQVLDDSTNEVLRALVELECQRWIEKGVNVKYETRNNRNGYKAGALRDGLKKP  180

Query  459  YVDDCEFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSL  280
            YV+DCEFV IFDADFQP+ DFLWRT+PYLLENPELALVQARWKFVNA+EC+MTRLQEMSL
Sbjct  181  YVEDCEFVVIFDADFQPEEDFLWRTVPYLLENPELALVQARWKFVNANECLMTRLQEMSL  240

Query  279  DYHFTVEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKF  100
            DYHF+VEQEVGSSTCSFFGFNGTAGVWR+QA+ DAGGWKDRTTVEDMDLAVRASL+GWKF
Sbjct  241  DYHFSVEQEVGSSTCSFFGFNGTAGVWRIQAVSDAGGWKDRTTVEDMDLAVRASLKGWKF  300

Query  99   LYIGDLEVKNELPSTFKAYRFQQHRWSCGPANL  1
            +++GDL VKNELPSTFKAYRFQQHRWSCGPANL
Sbjct  301  IFVGDLSVKNELPSTFKAYRFQQHRWSCGPANL  333



>ref|XP_011094610.1| PREDICTED: mannan synthase 1-like [Sesamum indicum]
Length=527

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/331 (80%), Positives = 297/331 (90%), Gaps = 0/331 (0%)
 Frame = -1

Query  993  MRGIVFSEPGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAI  814
            MR IVF E        P   L HAWDSIRVPI+VP+L+ A+  CI MS+MLF+ER+YMAI
Sbjct  1    MRDIVFREVEMNETYDPTMRLIHAWDSIRVPIIVPLLRFAVYICIGMSIMLFIERVYMAI  60

Query  813  VIVVVKCFGRKRYTRYKLDALKEDLEQNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWP  634
            VI  VKC G+KRYT+Y+LDA+KEDLE+N+NYPKVLVQ+PMFNEKEVYKLSIGAV   +WP
Sbjct  61   VIACVKCLGKKRYTKYQLDAIKEDLEKNKNYPKVLVQIPMFNEKEVYKLSIGAVSALSWP  120

Query  633  SDRLIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYV  454
            SDRLIVQ+LDDSTN+ LR +VE EC+ W+ +GVNVKYETRNNRNGYKAGALREGLKK YV
Sbjct  121  SDRLIVQVLDDSTNEVLRTMVELECRKWIEKGVNVKYETRNNRNGYKAGALREGLKKHYV  180

Query  453  DDCEFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDY  274
            +DCEFV IFDADFQP+ DFLWRTIPYLLENPEL LVQARWKFVNADEC+MTRLQEMSLDY
Sbjct  181  EDCEFVIIFDADFQPEEDFLWRTIPYLLENPELGLVQARWKFVNADECLMTRLQEMSLDY  240

Query  273  HFTVEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLY  94
            HF+VEQEVGSSTCSFFGFNGTAGVWR++A++DAGGWKDRTTVEDMDLAVRASL+GWKFL+
Sbjct  241  HFSVEQEVGSSTCSFFGFNGTAGVWRMRAINDAGGWKDRTTVEDMDLAVRASLKGWKFLF  300

Query  93   IGDLEVKNELPSTFKAYRFQQHRWSCGPANL  1
            +GDL VKNELPSTFKAYR+QQHRWSCGPANL
Sbjct  301  VGDLAVKNELPSTFKAYRYQQHRWSCGPANL  331



>gb|ACE60600.1| mannan synthase [Coffea canephora]
Length=530

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/333 (80%), Positives = 294/333 (88%), Gaps = 2/333 (1%)
 Frame = -1

Query  993  MRGIVF--SEPGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYM  820
            MR  VF   EP   +Y     SL  AWD IRVPI+VPIL+ A+  CI MSVM F+ER+YM
Sbjct  1    MRNSVFLEPEPEVNLYDDTGRSLSQAWDRIRVPIIVPILRFALYVCIAMSVMRFIERVYM  60

Query  819  AIVIVVVKCFGRKRYTRYKLDALKEDLEQNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFT  640
            AIVI  VKC GRKRYT+Y LDA+KEDLEQN+NYP VLVQ+PMFNEKEVYKLSIGA CG +
Sbjct  61   AIVIGCVKCLGRKRYTKYNLDAIKEDLEQNRNYPMVLVQIPMFNEKEVYKLSIGAACGLS  120

Query  639  WPSDRLIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQ  460
            WPSDRLIVQ+LDDSTN+ LR LVE EC+ W+ +GVNVKYETRNNRNGYKAGALR+GLKK 
Sbjct  121  WPSDRLIVQVLDDSTNEVLRALVELECQRWIEKGVNVKYETRNNRNGYKAGALRDGLKKP  180

Query  459  YVDDCEFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSL  280
            YV+DCEFV IFDADFQP+ DFLWRT+PYLLENPELALVQARWKFVNA+EC+MTRLQEM L
Sbjct  181  YVEDCEFVVIFDADFQPEEDFLWRTVPYLLENPELALVQARWKFVNANECLMTRLQEMPL  240

Query  279  DYHFTVEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKF  100
            DYHF+VEQEVGSSTCSFFGFNGTAGVWR+QA+ DAGGWKDRTTVEDMDLAVRASL+GWKF
Sbjct  241  DYHFSVEQEVGSSTCSFFGFNGTAGVWRIQAVSDAGGWKDRTTVEDMDLAVRASLKGWKF  300

Query  99   LYIGDLEVKNELPSTFKAYRFQQHRWSCGPANL  1
            +++GDL VKNELPSTFKAYRFQQHRWSCGPANL
Sbjct  301  IFVGDLSVKNELPSTFKAYRFQQHRWSCGPANL  333



>gb|ACE60601.1| mannan synthase [Coffea arabica]
Length=530

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/333 (80%), Positives = 295/333 (89%), Gaps = 2/333 (1%)
 Frame = -1

Query  993  MRGIVF--SEPGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYM  820
            MR  VF   EP   +Y     SL  AWD IRVPI+VPIL+ A+  CI MSVMLF+ER+YM
Sbjct  1    MRNSVFLEPEPEVNLYDDTGRSLSQAWDRIRVPIIVPILRFALYVCIAMSVMLFIERVYM  60

Query  819  AIVIVVVKCFGRKRYTRYKLDALKEDLEQNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFT  640
            AIVI  VKC GRKRYT+Y LDA+KEDLEQN+NYP VLVQ+PMFNEKEVYKLSIGA CG +
Sbjct  61   AIVIGCVKCLGRKRYTKYNLDAIKEDLEQNRNYPMVLVQIPMFNEKEVYKLSIGAACGLS  120

Query  639  WPSDRLIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQ  460
             PSDRLIVQ+LDDSTN+ LR LVE EC+ W+ +GVNVKYETRNNRNGYKAGALR+GLKK 
Sbjct  121  RPSDRLIVQVLDDSTNEVLRALVELECQRWIEKGVNVKYETRNNRNGYKAGALRDGLKKP  180

Query  459  YVDDCEFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSL  280
            YV+DCEFV IFDADFQP+ DFLWRT+PYLLENPELALVQARWKFVNA+EC+MTRLQEMSL
Sbjct  181  YVEDCEFVVIFDADFQPEEDFLWRTVPYLLENPELALVQARWKFVNANECLMTRLQEMSL  240

Query  279  DYHFTVEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKF  100
            DYHF+VEQEVGSSTCSFFGFNGTAGVWR+QA+ DAGGWKDRTTVEDMDLAVRASL+GWKF
Sbjct  241  DYHFSVEQEVGSSTCSFFGFNGTAGVWRIQAVSDAGGWKDRTTVEDMDLAVRASLKGWKF  300

Query  99   LYIGDLEVKNELPSTFKAYRFQQHRWSCGPANL  1
            +++GDL VKNELPSTFKAYRFQQHRWSCGPANL
Sbjct  301  IFVGDLSVKNELPSTFKAYRFQQHRWSCGPANL  333



>gb|EYU29872.1| hypothetical protein MIMGU_mgv1a023425mg [Erythranthe guttata]
Length=515

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/315 (82%), Positives = 293/315 (93%), Gaps = 0/315 (0%)
 Frame = -1

Query  945  PVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRY  766
            P  SL + WDSIRVPI+VP+L++A+  CI MSVMLF+ERIYMA VIV VKC G+KRYT+Y
Sbjct  17   PTMSLINTWDSIRVPIIVPVLRVAVYVCICMSVMLFVERIYMAAVIVCVKCLGKKRYTKY  76

Query  765  KLDALKEDLEQNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDN  586
            +LDA+K+DLE+N+N+PKVLVQ+PMFNEKEVYKLSIGAV G +WPSD+LIVQ+LDDSTN+ 
Sbjct  77   QLDAIKQDLERNKNHPKVLVQIPMFNEKEVYKLSIGAVSGLSWPSDKLIVQVLDDSTNET  136

Query  585  LRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPD  406
            LR +VE EC+ W+ +GVNVKYETRNNRNGYKAGALREGLKK+Y D+CE+V IFDADFQPD
Sbjct  137  LRVMVELECRKWIEKGVNVKYETRNNRNGYKAGALREGLKKRYADECEYVIIFDADFQPD  196

Query  405  HDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFF  226
             D+LWRTIPYL+ENPELALVQARWKFVNADEC+MTRLQEMSLDYHFTVEQEVGSSTCSFF
Sbjct  197  EDYLWRTIPYLIENPELALVQARWKFVNADECLMTRLQEMSLDYHFTVEQEVGSSTCSFF  256

Query  225  GFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKA  46
            GFNGTAGVWR++AL DAGGWKDRTTVEDMDLAVRASLRGWKFL++GDL VKNELPSTFKA
Sbjct  257  GFNGTAGVWRIKALKDAGGWKDRTTVEDMDLAVRASLRGWKFLFVGDLSVKNELPSTFKA  316

Query  45   YRFQQHRWSCGPANL  1
            YR+QQHRWSCGPANL
Sbjct  317  YRYQQHRWSCGPANL  331



>gb|EYU38560.1| hypothetical protein MIMGU_mgv1a017694mg [Erythranthe guttata]
Length=527

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/315 (81%), Positives = 290/315 (92%), Gaps = 0/315 (0%)
 Frame = -1

Query  945  PVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRY  766
            P   L +AWD IRVPI+VP+L+ A+  C+ MSVMLF+ERIYMA+VIV VKC G+KRYT+Y
Sbjct  17   PARRLSYAWDCIRVPIIVPLLRTAVYICLTMSVMLFIERIYMAVVIVCVKCLGKKRYTKY  76

Query  765  KLDALKEDLEQNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDN  586
            +LDA+KEDLE+N+ +PK+LVQ+PMFNEKEVYKLSIGA CG +WPSDRLIVQ+LDDSTN+ 
Sbjct  77   QLDAIKEDLEKNKKHPKLLVQIPMFNEKEVYKLSIGAACGLSWPSDRLIVQVLDDSTNEA  136

Query  585  LRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPD  406
            LR +VE EC+ W+ +GVNVKYETRNNRNGYKAGALREGLKK YV+DCEFV IFDADFQP 
Sbjct  137  LRTMVELECRKWIEKGVNVKYETRNNRNGYKAGALREGLKKHYVNDCEFVVIFDADFQPA  196

Query  405  HDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFF  226
             D+LWRT+PYLLENPELALVQARWKFVNADEC+MTRLQEMSL YHF+VEQEVGSSTCSFF
Sbjct  197  EDYLWRTVPYLLENPELALVQARWKFVNADECLMTRLQEMSLHYHFSVEQEVGSSTCSFF  256

Query  225  GFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKA  46
            GFNGTAGVWR++AL DAGGWKDRTTVEDMDLAVRASL+GWKFL++GDLEVKNELPSTFKA
Sbjct  257  GFNGTAGVWRIRALIDAGGWKDRTTVEDMDLAVRASLKGWKFLFVGDLEVKNELPSTFKA  316

Query  45   YRFQQHRWSCGPANL  1
            YR+QQHRWSCGPANL
Sbjct  317  YRYQQHRWSCGPANL  331



>gb|EPS59546.1| mannan synthase, partial [Genlisea aurea]
Length=344

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 243/315 (77%), Positives = 284/315 (90%), Gaps = 0/315 (0%)
 Frame = -1

Query  945  PVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRY  766
            P   L   W++IR PI+ P L+ A+  CI MSVM+F+ER+YMA+VI  VKC G+KRYT+Y
Sbjct  4    PAVRLFSIWEAIRGPIIAPPLRFAVYLCIGMSVMMFIERVYMAVVISCVKCLGKKRYTKY  63

Query  765  KLDALKEDLEQNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDN  586
            +LD +KE LE+N+ YPKVLVQ+PMFNEKEVYKLSIGA CG +WPSD+L+VQ+LDDSTN+ 
Sbjct  64   QLDKIKEALERNKKYPKVLVQIPMFNEKEVYKLSIGAACGLSWPSDKLVVQVLDDSTNEL  123

Query  585  LRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPD  406
            L+ +VE ECK WM +GVN+KYETRNNRNGYKAGALR+GLKK YV+DCEFV IFDADFQP+
Sbjct  124  LKAMVELECKKWMEKGVNIKYETRNNRNGYKAGALRDGLKKHYVEDCEFVIIFDADFQPE  183

Query  405  HDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFF  226
             DF+WRT+PYLLENPEL LVQARW+FVNADEC+MTRLQ+MSLDYHF+VEQEVGSSTCSFF
Sbjct  184  EDFIWRTVPYLLENPELGLVQARWEFVNADECLMTRLQQMSLDYHFSVEQEVGSSTCSFF  243

Query  225  GFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKA  46
            GFNGTAG+WR++ALHDAGGWKDRTTVEDMDLAVRASL+GWKFL++GDL VKNELPSTFKA
Sbjct  244  GFNGTAGIWRIKALHDAGGWKDRTTVEDMDLAVRASLKGWKFLFVGDLAVKNELPSTFKA  303

Query  45   YRFQQHRWSCGPANL  1
            YR+QQHRWSCGPANL
Sbjct  304  YRYQQHRWSCGPANL  318



>ref|XP_002277171.1| PREDICTED: mannan synthase 1-like [Vitis vinifera]
Length=526

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/331 (75%), Positives = 290/331 (88%), Gaps = 0/331 (0%)
 Frame = -1

Query  993  MRGIVFSEPGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAI  814
            MR +V  EP   +      SL +AW  IRVP++ P+L  A+  C  MS+MLF+ER+YMAI
Sbjct  1    MRNLVLQEPEVRVTDDVTSSLSYAWQCIRVPVIAPLLWFAIFVCAAMSIMLFIERVYMAI  60

Query  813  VIVVVKCFGRKRYTRYKLDALKEDLEQNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWP  634
            +I+ VK   +KRYT+YKLD +KEDLE N++YPKVL+Q+PM+NEKEVYKLSIGA C  +WP
Sbjct  61   IILCVKVMRKKRYTKYKLDTMKEDLELNKSYPKVLIQIPMYNEKEVYKLSIGAACSVSWP  120

Query  633  SDRLIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYV  454
            SDR I+Q+LDDSTN+ LR +VE EC+ W+ +GVNVKYETRNNRNGYKAGALREGL+KQYV
Sbjct  121  SDRFIIQVLDDSTNEALRVMVELECRKWIDKGVNVKYETRNNRNGYKAGALREGLQKQYV  180

Query  453  DDCEFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDY  274
            +DCEFVAIFDADFQP+ +FLWRTIP+LLENP L LVQARWKFVNADEC+MTRLQEMSLDY
Sbjct  181  EDCEFVAIFDADFQPEENFLWRTIPFLLENPGLGLVQARWKFVNADECLMTRLQEMSLDY  240

Query  273  HFTVEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLY  94
            HF+VEQEVGSSTCSFFGFNGTAGVWR+QA++DAGGWKDRTTVEDMDLAVRASL+GWKFL+
Sbjct  241  HFSVEQEVGSSTCSFFGFNGTAGVWRIQAINDAGGWKDRTTVEDMDLAVRASLKGWKFLF  300

Query  93   IGDLEVKNELPSTFKAYRFQQHRWSCGPANL  1
            +GDL VKNELPSTFKAYR+QQHRWSCGPANL
Sbjct  301  VGDLSVKNELPSTFKAYRYQQHRWSCGPANL  331



>emb|CAN74410.1| hypothetical protein VITISV_013215 [Vitis vinifera]
Length=529

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/331 (75%), Positives = 289/331 (87%), Gaps = 0/331 (0%)
 Frame = -1

Query  993  MRGIVFSEPGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAI  814
            MR +V  EP   +      SL +AW  IRVP++ P+L  A+  C  MS+MLF+ER+YMAI
Sbjct  1    MRNLVLQEPEVRVTDDVTSSLSYAWQCIRVPVIAPLLWFAIFVCAAMSIMLFIERVYMAI  60

Query  813  VIVVVKCFGRKRYTRYKLDALKEDLEQNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWP  634
            +I+ VK   +KRYT+YKLD +KEDLE N++YPKVL+Q+PM+NEKEVYKLSIGA C  +WP
Sbjct  61   IILCVKVMRKKRYTKYKLDTMKEDLELNKSYPKVLIQIPMYNEKEVYKLSIGAACSVSWP  120

Query  633  SDRLIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYV  454
            SD  I+Q+LDDSTN+ LR +VE EC+ W+ +GVNVKYETRNNRNGYKAGALREGL+KQYV
Sbjct  121  SDXFIIQVLDDSTNEALRVMVELECRKWIDKGVNVKYETRNNRNGYKAGALREGLQKQYV  180

Query  453  DDCEFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDY  274
            +DCEFVAIFDADFQP+ +FLWRTIP+LLENP L LVQARWKFVNADEC+MTRLQEMSLDY
Sbjct  181  EDCEFVAIFDADFQPEENFLWRTIPFLLENPGLGLVQARWKFVNADECLMTRLQEMSLDY  240

Query  273  HFTVEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLY  94
            HF+VEQEVGSSTCSFFGFNGTAGVWR+QA++DAGGWKDRTTVEDMDLAVRASL+GWKFL+
Sbjct  241  HFSVEQEVGSSTCSFFGFNGTAGVWRIQAINDAGGWKDRTTVEDMDLAVRASLKGWKFLF  300

Query  93   IGDLEVKNELPSTFKAYRFQQHRWSCGPANL  1
            +GDL VKNELPSTFKAYR+QQHRWSCGPANL
Sbjct  301  VGDLSVKNELPSTFKAYRYQQHRWSCGPANL  331



>gb|KHN02317.1| Mannan synthase 1 [Glycine soja]
Length=496

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 239/331 (72%), Positives = 296/331 (89%), Gaps = 0/331 (0%)
 Frame = -1

Query  993  MRGIVFSEPGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAI  814
            MR ++F EP   +      SL++AW+SIR P+++P+LK+A+  C +MS+MLF+ER+ MAI
Sbjct  1    MRNLIFEEPEVRVPGDTSSSLRYAWESIRAPVIIPVLKLAVILCSIMSIMLFVERVAMAI  60

Query  813  VIVVVKCFGRKRYTRYKLDALKEDLEQNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWP  634
            VI+VVK  G+KRYT+Y L+A+K+ LE+N+ +P VL+Q+PM+NEKEVYKLSIGAVCG +WP
Sbjct  61   VILVVKVLGKKRYTKYNLEAMKQKLERNKRFPMVLIQIPMYNEKEVYKLSIGAVCGLSWP  120

Query  633  SDRLIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYV  454
            +DR IVQ+LDDSTN +LR+ V+ EC+ WM++GVNVKYETR NRNGYKAGA++EGL+K+YV
Sbjct  121  ADRFIVQVLDDSTNQSLRECVQIECQRWMQKGVNVKYETRTNRNGYKAGAMKEGLEKEYV  180

Query  453  DDCEFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDY  274
            +DCEFVAIFDADFQPD DFLW TIPYLLENP+L LVQARWKFVN+ EC+MTRLQEMSLDY
Sbjct  181  EDCEFVAIFDADFQPDADFLWNTIPYLLENPKLGLVQARWKFVNSKECMMTRLQEMSLDY  240

Query  273  HFTVEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLY  94
            HF+VEQEVGSST SFFGFNGTAG+WR+QA+ DAGGWKDRTTVEDMDLAVRASL+GW+F++
Sbjct  241  HFSVEQEVGSSTYSFFGFNGTAGIWRIQAIKDAGGWKDRTTVEDMDLAVRASLQGWEFVF  300

Query  93   IGDLEVKNELPSTFKAYRFQQHRWSCGPANL  1
            +GD++VKNELPSTFKAYR+QQHRWSCGPANL
Sbjct  301  VGDIKVKNELPSTFKAYRYQQHRWSCGPANL  331



>ref|XP_003553558.1| PREDICTED: mannan synthase 1-like [Glycine max]
Length=528

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 239/331 (72%), Positives = 296/331 (89%), Gaps = 0/331 (0%)
 Frame = -1

Query  993  MRGIVFSEPGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAI  814
            MR ++F EP   +      SL++AW+SIR P+++P+LK+A+  C +MS+MLF+ER+ MAI
Sbjct  1    MRNLIFEEPEVRVPGDTSSSLRYAWESIRAPVIIPVLKLAVILCSIMSIMLFVERVAMAI  60

Query  813  VIVVVKCFGRKRYTRYKLDALKEDLEQNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWP  634
            VI+VVK  G+KRYT+Y L+A+K+ LE+N+ +P VL+Q+PM+NEKEVYKLSIGAVCG +WP
Sbjct  61   VILVVKVLGKKRYTKYNLEAMKQKLERNKRFPMVLIQIPMYNEKEVYKLSIGAVCGLSWP  120

Query  633  SDRLIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYV  454
            +DR IVQ+LDDSTN +LR+ V+ EC+ WM++GVNVKYETR NRNGYKAGA++EGL+K+YV
Sbjct  121  ADRFIVQVLDDSTNQSLRECVQIECQRWMQKGVNVKYETRTNRNGYKAGAMKEGLEKEYV  180

Query  453  DDCEFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDY  274
            +DCEFVAIFDADFQPD DFLW TIPYLLENP+L LVQARWKFVN+ EC+MTRLQEMSLDY
Sbjct  181  EDCEFVAIFDADFQPDADFLWNTIPYLLENPKLGLVQARWKFVNSKECMMTRLQEMSLDY  240

Query  273  HFTVEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLY  94
            HF+VEQEVGSST SFFGFNGTAG+WR+QA+ DAGGWKDRTTVEDMDLAVRASL+GW+F++
Sbjct  241  HFSVEQEVGSSTYSFFGFNGTAGIWRIQAIKDAGGWKDRTTVEDMDLAVRASLQGWEFVF  300

Query  93   IGDLEVKNELPSTFKAYRFQQHRWSCGPANL  1
            +GD++VKNELPSTFKAYR+QQHRWSCGPANL
Sbjct  301  VGDIKVKNELPSTFKAYRYQQHRWSCGPANL  331



>ref|XP_010096071.1| hypothetical protein L484_000910 [Morus notabilis]
 gb|EXC42303.1| hypothetical protein L484_000910 [Morus notabilis]
Length=527

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/331 (76%), Positives = 294/331 (89%), Gaps = 0/331 (0%)
 Frame = -1

Query  993  MRGIVFSEPGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAI  814
            MR  V  EP   +      S+  AWDSIRVP++VP+L++AM  C +MS++LF+ER+YMAI
Sbjct  1    MRDRVLQEPEVRVIINVTNSVNCAWDSIRVPVIVPLLRLAMILCSVMSILLFVERLYMAI  60

Query  813  VIVVVKCFGRKRYTRYKLDALKEDLEQNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWP  634
            VI+ +K  G+KRYT+Y+L+ +KEDLE N++YP VLVQ+PMFNEKEVY+LSIGA CG TWP
Sbjct  61   VILCLKVLGKKRYTKYRLERMKEDLELNKSYPLVLVQIPMFNEKEVYRLSIGAACGITWP  120

Query  633  SDRLIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYV  454
            SDRLI+Q+LDDSTN+ L++LVE EC  W+ +GVN+KYETRNNRNGYKAGAL+EGL+K YV
Sbjct  121  SDRLIIQVLDDSTNEELKELVELECHRWLEKGVNIKYETRNNRNGYKAGALKEGLEKHYV  180

Query  453  DDCEFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDY  274
            +DCEFVAIFDADFQPD DFLWRTIPYLLENPEL LVQARWKFVNADEC+MTRLQEMSLDY
Sbjct  181  EDCEFVAIFDADFQPDEDFLWRTIPYLLENPELGLVQARWKFVNADECMMTRLQEMSLDY  240

Query  273  HFTVEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLY  94
            HF+VEQEVGSSTCSFFGFNG+AGVWR+QA+ DAGGWKDRTTVEDMDLAVRASL+GWKF++
Sbjct  241  HFSVEQEVGSSTCSFFGFNGSAGVWRIQAIKDAGGWKDRTTVEDMDLAVRASLKGWKFVF  300

Query  93   IGDLEVKNELPSTFKAYRFQQHRWSCGPANL  1
            +GDL VKNELPSTFKAY +QQHRWSCGPANL
Sbjct  301  VGDLAVKNELPSTFKAYLYQQHRWSCGPANL  331



>gb|KEH24032.1| cellulose synthase-like protein A1 [Medicago truncatula]
Length=529

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 242/331 (73%), Positives = 295/331 (89%), Gaps = 0/331 (0%)
 Frame = -1

Query  993  MRGIVFSEPGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAI  814
            M+ ++F EP   +       L++AW SIR P+++P+LK+A+  C +MSVMLF+ER+ MA+
Sbjct  1    MKNLIFEEPEVDIPGYASSGLRYAWQSIRAPVIIPLLKLAVIICSIMSVMLFIERVGMAL  60

Query  813  VIVVVKCFGRKRYTRYKLDALKEDLEQNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWP  634
            VI+VVK    K+YT+YKLDA+K+++E+N+ YP VL+Q+PMFNEKEVYKLSIGAVCG +WP
Sbjct  61   VILVVKVLRIKKYTKYKLDAMKQNIERNKRYPMVLIQIPMFNEKEVYKLSIGAVCGLSWP  120

Query  633  SDRLIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYV  454
             DRLIVQ+LDDSTN  LR+LVE EC  W+ +GVNVKYETR+NRNGYKAGAL+EGL+KQYV
Sbjct  121  GDRLIVQVLDDSTNQVLRELVELECHKWIEKGVNVKYETRSNRNGYKAGALKEGLQKQYV  180

Query  453  DDCEFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDY  274
            +DCEFVAIFDADFQPD DFLW+TIPYLLENP+L LVQARWKFVN++EC+MTRLQEMSLDY
Sbjct  181  EDCEFVAIFDADFQPDPDFLWKTIPYLLENPKLGLVQARWKFVNSEECMMTRLQEMSLDY  240

Query  273  HFTVEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLY  94
            HF+VEQEVGSST SFFGFNGTAG+WR+QA+ DAGGWKDRTTVEDMDLAVRASL+GW+F++
Sbjct  241  HFSVEQEVGSSTYSFFGFNGTAGIWRIQAIKDAGGWKDRTTVEDMDLAVRASLKGWEFVF  300

Query  93   IGDLEVKNELPSTFKAYRFQQHRWSCGPANL  1
            +GD++VKNELPSTFKAYR+QQHRWSCGPANL
Sbjct  301  VGDVKVKNELPSTFKAYRYQQHRWSCGPANL  331



>gb|AFV79650.1| mannan synthase [Trigonella foenum-graecum]
Length=534

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 244/331 (74%), Positives = 290/331 (88%), Gaps = 0/331 (0%)
 Frame = -1

Query  993  MRGIVFSEPGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAI  814
            MR ++F EP   +       L++AW SIR P+++P+LK+A+  C +MSVMLF+ER+ MA 
Sbjct  1    MRNLIFEEPEVNIPGDASSGLRYAWQSIRAPVIIPLLKLAVIICSIMSVMLFIERVGMAA  60

Query  813  VIVVVKCFGRKRYTRYKLDALKEDLEQNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWP  634
            VI+VVK    K+YT+YKLDA+K+++E+N  YP VLVQ+PMFNEKEVYKLSIGAVCG +WP
Sbjct  61   VILVVKVLRWKKYTKYKLDAVKQNIERNNKYPMVLVQIPMFNEKEVYKLSIGAVCGLSWP  120

Query  633  SDRLIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYV  454
             DRLIVQ+LDDSTN  LR+LVE EC  W+ +GVNVKYETR NRNGYKAGAL+EGL+KQYV
Sbjct  121  RDRLIVQVLDDSTNQVLRELVELECHKWIEKGVNVKYETRTNRNGYKAGALKEGLEKQYV  180

Query  453  DDCEFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDY  274
            +DCEFVAIFDADFQPD DFLWRT+PYLLENP+L LVQARWKFVN +ECIMTRLQEMSLDY
Sbjct  181  EDCEFVAIFDADFQPDPDFLWRTVPYLLENPKLGLVQARWKFVNTEECIMTRLQEMSLDY  240

Query  273  HFTVEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLY  94
            HF+VEQEVGSST SFFGFNGTAG+WR+QA+ DAGGWKDRTTVEDMDLAVRASL+GW+F++
Sbjct  241  HFSVEQEVGSSTYSFFGFNGTAGIWRIQAIKDAGGWKDRTTVEDMDLAVRASLKGWEFVF  300

Query  93   IGDLEVKNELPSTFKAYRFQQHRWSCGPANL  1
            +GD+ VKNELPST+KAYR+QQHRWSCGPANL
Sbjct  301  VGDVTVKNELPSTYKAYRYQQHRWSCGPANL  331



>ref|XP_004493996.1| PREDICTED: mannan synthase 1-like [Cicer arietinum]
Length=527

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 242/331 (73%), Positives = 293/331 (89%), Gaps = 2/331 (1%)
 Frame = -1

Query  993  MRGIVFSEPGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAI  814
            MR ++F EP  G+      SL++AW SIR P+++P+LK+A+  C +MSVMLFLER+ MA 
Sbjct  1    MRSLIFEEPEAGIPGYASSSLRYAWQSIRAPVIIPLLKLAVILCSIMSVMLFLERVGMAA  60

Query  813  VIVVVKCFGRKRYTRYKLDALKEDLEQNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWP  634
            VI++VK   +K+YT+YKLDA+K+++E+N+ YP VL+Q+PM+NEKEVYKLSIGAVCG +WP
Sbjct  61   VILIVKVLRKKKYTKYKLDAMKQNIERNKRYPMVLIQIPMYNEKEVYKLSIGAVCGLSWP  120

Query  633  SDRLIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYV  454
            +DRL+VQ+LDDSTN  LR+LVE EC  WM +GVNVKYETR NRNGYKAGAL+EGL+KQYV
Sbjct  121  ADRLVVQVLDDSTNQVLRELVELECHKWMEKGVNVKYETRRNRNGYKAGALKEGLEKQYV  180

Query  453  DDCEFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDY  274
            +DCEFVAIFDADFQPD DFLW+TIPYLLEN +L LVQARWKFVN++EC+MTRLQEMSLDY
Sbjct  181  EDCEFVAIFDADFQPDPDFLWKTIPYLLENQKLGLVQARWKFVNSEECMMTRLQEMSLDY  240

Query  273  HFTVEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLY  94
            HF+VEQEVGSST SFFGFN  AG+WR+QA+ DAGGWKDRTTVEDMDLAVRASL+GW+F++
Sbjct  241  HFSVEQEVGSSTYSFFGFN--AGIWRIQAIKDAGGWKDRTTVEDMDLAVRASLKGWEFVF  298

Query  93   IGDLEVKNELPSTFKAYRFQQHRWSCGPANL  1
            +GD+ VKNELPSTFKAYRFQQHRWSCGPANL
Sbjct  299  VGDVTVKNELPSTFKAYRFQQHRWSCGPANL  329



>sp|Q6UDF0.1|CSLA1_CYATE RecName: Full=Mannan synthase 1; AltName: Full=CtManS [Cyamopsis 
tetragonoloba]
 gb|AAR23313.1| beta-1,4-mannan synthase [Cyamopsis tetragonoloba]
 gb|ADF47159.1| beta-1,4-mannan synthase [Cyamopsis tetragonoloba]
Length=526

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 241/331 (73%), Positives = 293/331 (89%), Gaps = 1/331 (0%)
 Frame = -1

Query  993  MRGIVFSEPGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAI  814
            MR ++F EP  G+      SL++AW SIR P+++P+LK+A+  C +MS+MLF+ER+ MA 
Sbjct  1    MRNLIFEEP-EGIPGNSSSSLRYAWQSIRAPVIIPLLKLAVIVCSVMSIMLFVERVAMAA  59

Query  813  VIVVVKCFGRKRYTRYKLDALKEDLEQNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWP  634
            VI++VK   +KRYT+Y L+A+K+ LE+++ YP VL+Q+PM+NEKEVYKLSIGAVCG +WP
Sbjct  60   VILIVKVLRKKRYTKYNLEAMKQKLERSKKYPMVLIQIPMYNEKEVYKLSIGAVCGLSWP  119

Query  633  SDRLIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYV  454
            +DR IVQ+LDDSTN  LR+LVE EC+ W+++GVNVKYE R NRNGYKAGAL+EGL+KQYV
Sbjct  120  ADRFIVQVLDDSTNPVLRELVEMECQKWIQKGVNVKYENRRNRNGYKAGALKEGLEKQYV  179

Query  453  DDCEFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDY  274
            +DCEFVAIFDADFQPD DFLW TIPYLLENP+L LVQARWKFVN++EC+MTRLQEMSLDY
Sbjct  180  EDCEFVAIFDADFQPDADFLWNTIPYLLENPKLGLVQARWKFVNSEECMMTRLQEMSLDY  239

Query  273  HFTVEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLY  94
            HF+VEQEVGSST SFFGFNGTAGVWR+QA+ DAGGWKDRTTVEDMDLAVRASL GW+F++
Sbjct  240  HFSVEQEVGSSTYSFFGFNGTAGVWRIQAIKDAGGWKDRTTVEDMDLAVRASLHGWEFVF  299

Query  93   IGDLEVKNELPSTFKAYRFQQHRWSCGPANL  1
            +GD++VKNELPSTFKAYRFQQHRWSCGPANL
Sbjct  300  VGDVKVKNELPSTFKAYRFQQHRWSCGPANL  330



>ref|XP_003520655.1| PREDICTED: mannan synthase 1-like [Glycine max]
Length=527

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 236/331 (71%), Positives = 296/331 (89%), Gaps = 0/331 (0%)
 Frame = -1

Query  993  MRGIVFSEPGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAI  814
            MR ++F EP   +      SL++AW+SIR P+++P+LK+A+  C +MS+MLF+ER+ MAI
Sbjct  1    MRNLIFEEPEVRVPGDTSSSLRYAWESIRAPVIIPLLKLAVILCSIMSIMLFVERVAMAI  60

Query  813  VIVVVKCFGRKRYTRYKLDALKEDLEQNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWP  634
            VI+VVK  G+KRYT+Y L+A+K+ LE+N+ +P VL+Q+PM+NEKEVYKLSIGAVCG +WP
Sbjct  61   VILVVKVLGKKRYTKYNLEAMKQKLERNKRFPMVLIQIPMYNEKEVYKLSIGAVCGLSWP  120

Query  633  SDRLIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYV  454
            +DR IVQ+LDDSTN +LR+ V+ EC+ W+++GVNVKYETR NRNGYKAGA++EGL+K+YV
Sbjct  121  ADRFIVQVLDDSTNQSLRECVQMECQRWIQKGVNVKYETRTNRNGYKAGAMKEGLEKEYV  180

Query  453  DDCEFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDY  274
            +DCE+VAIFDADFQPD DFLW TIPYLLENP+L LVQARWKFVN+ EC+MT+LQEMSLDY
Sbjct  181  EDCEYVAIFDADFQPDADFLWNTIPYLLENPKLGLVQARWKFVNSKECMMTKLQEMSLDY  240

Query  273  HFTVEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLY  94
            HF+VEQEVGSST SFFGFNGTAG+WR+QA+ DAGGWKDRTTVEDMDLAVRASL+GW+F++
Sbjct  241  HFSVEQEVGSSTYSFFGFNGTAGIWRIQAIKDAGGWKDRTTVEDMDLAVRASLQGWEFVF  300

Query  93   IGDLEVKNELPSTFKAYRFQQHRWSCGPANL  1
            +GD++VKNELPSTFKAYR+QQHRWSCGPANL
Sbjct  301  VGDIKVKNELPSTFKAYRYQQHRWSCGPANL  331



>gb|KDO49989.1| hypothetical protein CISIN_1g044519mg [Citrus sinensis]
Length=534

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/339 (73%), Positives = 289/339 (85%), Gaps = 9/339 (3%)
 Frame = -1

Query  993  MRGIVFSEPGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAI  814
            M+ ++F EP   + T     + +AW+SIR  ++VP+L +A+  C +MS+MLF+ER+YMAI
Sbjct  1    MKNLIFQEPKERV-TDGTSGISYAWNSIRASVIVPLLHLAIILCSVMSLMLFIERVYMAI  59

Query  813  VIVVVKCFGRKRYTRYKLDALKEDLEQNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWP  634
            VI+ VK   +KRYT YKL+ +KEDLE N++YP VLVQ+PM+NEKEVYKLSIGA CG +WP
Sbjct  60   VILYVKVLRKKRYTEYKLEEMKEDLELNKSYPMVLVQIPMYNEKEVYKLSIGAACGLSWP  119

Query  633  SDRLIVQILDDSTNDNLR--------KLVEDECKMWMRRGVNVKYETRNNRNGYKAGALR  478
            SDRLIVQ+LDDSTN+ LR        KLVE EC  W+ +GVNVKYETR NRNGYKAGAL+
Sbjct  120  SDRLIVQVLDDSTNEVLRTDFFQYTQKLVELECLKWIEKGVNVKYETRKNRNGYKAGALK  179

Query  477  EGLKKQYVDDCEFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTR  298
            EGL+KQYV DC+FV IFDADFQPD DFLWRTIPYLLEN EL LVQARWKFVNADEC+MTR
Sbjct  180  EGLEKQYVKDCQFVVIFDADFQPDEDFLWRTIPYLLENKELGLVQARWKFVNADECLMTR  239

Query  297  LQEMSLDYHFTVEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRAS  118
            LQEMSLDYHF+VEQEVGSSTC FFGFNGTAGVWR+QA+ DAGGWKDRTTVEDMDLAVRAS
Sbjct  240  LQEMSLDYHFSVEQEVGSSTCQFFGFNGTAGVWRIQAIEDAGGWKDRTTVEDMDLAVRAS  299

Query  117  LRGWKFLYIGDLEVKNELPSTFKAYRFQQHRWSCGPANL  1
            L+GWKF+++GDL VKNELPSTFKAYR+QQHRWSCGP+NL
Sbjct  300  LKGWKFVFVGDLGVKNELPSTFKAYRYQQHRWSCGPSNL  338



>emb|CBI32777.3| unnamed protein product [Vitis vinifera]
Length=443

 Score =   516 bits (1329),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 231/285 (81%), Positives = 266/285 (93%), Gaps = 0/285 (0%)
 Frame = -1

Query  855  MSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKEDLEQNQNYPKVLVQVPMFNEKEV  676
            MS+MLF+ER+YMAI+I+ VK   +KRYT+YKLD +KEDLE N++YPKVL+Q+PM+NEKEV
Sbjct  1    MSIMLFIERVYMAIIILCVKVMRKKRYTKYKLDTMKEDLELNKSYPKVLIQIPMYNEKEV  60

Query  675  YKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGY  496
            YKLSIGA C  +WPSDR I+Q+LDDSTN+ LR +VE EC+ W+ +GVNVKYETRNNRNGY
Sbjct  61   YKLSIGAACSVSWPSDRFIIQVLDDSTNEALRVMVELECRKWIDKGVNVKYETRNNRNGY  120

Query  495  KAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNAD  316
            KAGALREGL+KQYV+DCEFVAIFDADFQP+ +FLWRTIP+LLENP L LVQARWKFVNAD
Sbjct  121  KAGALREGLQKQYVEDCEFVAIFDADFQPEENFLWRTIPFLLENPGLGLVQARWKFVNAD  180

Query  315  ECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMD  136
            EC+MTRLQEMSLDYHF+VEQEVGSSTCSFFGFNGTAGVWR+QA++DAGGWKDRTTVEDMD
Sbjct  181  ECLMTRLQEMSLDYHFSVEQEVGSSTCSFFGFNGTAGVWRIQAINDAGGWKDRTTVEDMD  240

Query  135  LAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHRWSCGPANL  1
            LAVRASL+GWKFL++GDL VKNELPSTFKAYR+QQHRWSCGPANL
Sbjct  241  LAVRASLKGWKFLFVGDLSVKNELPSTFKAYRYQQHRWSCGPANL  285



>ref|XP_008800552.1| PREDICTED: mannan synthase 1-like [Phoenix dactylifera]
Length=530

 Score =   518 bits (1335),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 242/333 (73%), Positives = 280/333 (84%), Gaps = 2/333 (1%)
 Frame = -1

Query  993  MRGIVFSEPGN--GMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYM  820
            MR ++F EP    G      + +  AW  IR P+++P L+IA+  C  MSVMLFLER+YM
Sbjct  1    MRDLIFKEPEPDIGASNGIADDIMLAWRQIRKPLVLPFLQIALILCGSMSVMLFLERVYM  60

Query  819  AIVIVVVKCFGRKRYTRYKLDALKEDLEQNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFT  640
            AIVI+ VK   +KRYT+YKLDA++ +LE  +NYP VLVQ+PM+NEKEVYKLSI AVCG  
Sbjct  61   AIVILSVKLLRKKRYTKYKLDAVRRELEATKNYPMVLVQIPMYNEKEVYKLSISAVCGMH  120

Query  639  WPSDRLIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQ  460
            WPSD+L+VQ+LDDST+   R LVE EC+ W  +GVN+KYE R+NRNGYKAGALREGL K 
Sbjct  121  WPSDKLVVQVLDDSTDPVTRDLVELECQRWASKGVNIKYENRHNRNGYKAGALREGLSKS  180

Query  459  YVDDCEFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSL  280
            YV DC+FV IFDADFQP+ D+L RTIPYLL N +LALVQARW+FVNADEC++TRLQEMSL
Sbjct  181  YVRDCQFVVIFDADFQPEPDYLMRTIPYLLSNDDLALVQARWRFVNADECLLTRLQEMSL  240

Query  279  DYHFTVEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKF  100
            DYHF VEQEVGSSTCSFFGFNGTAGVWR+QALHDAGGWKDRTTVEDMDLAVRASLRGWKF
Sbjct  241  DYHFGVEQEVGSSTCSFFGFNGTAGVWRIQALHDAGGWKDRTTVEDMDLAVRASLRGWKF  300

Query  99   LYIGDLEVKNELPSTFKAYRFQQHRWSCGPANL  1
            ++IGDL VKNELPSTFKAYR+QQHRWSCGPANL
Sbjct  301  VFIGDLSVKNELPSTFKAYRYQQHRWSCGPANL  333



>ref|XP_006428366.1| hypothetical protein CICLE_v10013685mg [Citrus clementina]
 gb|ESR41606.1| hypothetical protein CICLE_v10013685mg [Citrus clementina]
Length=434

 Score =   507 bits (1305),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 231/285 (81%), Positives = 260/285 (91%), Gaps = 0/285 (0%)
 Frame = -1

Query  855  MSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKEDLEQNQNYPKVLVQVPMFNEKEV  676
            MS+MLF+ER+YMAIVI+ VK   +KRYT YKL+ +KEDLE N++YP VLVQ+PM+NEKEV
Sbjct  1    MSLMLFIERVYMAIVILYVKVLRKKRYTEYKLEEMKEDLELNKSYPMVLVQIPMYNEKEV  60

Query  675  YKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGY  496
            YKLSIGA CG +WPSDRLIVQ+LDDSTN+ LRKLVE EC  W  +GVNVKYETR NRNGY
Sbjct  61   YKLSIGAACGLSWPSDRLIVQVLDDSTNEVLRKLVELECLKWTEKGVNVKYETRKNRNGY  120

Query  495  KAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNAD  316
            KAGAL+EGL+KQYV DC+FV IFDADFQPD DFLWRTIPYLLEN EL LVQARWKFVNAD
Sbjct  121  KAGALKEGLEKQYVKDCQFVVIFDADFQPDEDFLWRTIPYLLENKELGLVQARWKFVNAD  180

Query  315  ECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMD  136
            EC+MTRLQEMSLDYHF++EQEVGSSTC FFGFNGTAGVWR+QA+ DAGGWKDRTTVEDMD
Sbjct  181  ECLMTRLQEMSLDYHFSIEQEVGSSTCQFFGFNGTAGVWRIQAIEDAGGWKDRTTVEDMD  240

Query  135  LAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHRWSCGPANL  1
            LAVRASL+GWKF+++GDL VKNELPSTFKAYR+QQHRWSCGP+NL
Sbjct  241  LAVRASLKGWKFVFVGDLGVKNELPSTFKAYRYQQHRWSCGPSNL  285



>ref|XP_010935704.1| PREDICTED: mannan synthase 1-like isoform X3 [Elaeis guineensis]
Length=505

 Score =   509 bits (1312),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 234/331 (71%), Positives = 276/331 (83%), Gaps = 0/331 (0%)
 Frame = -1

Query  993  MRGIVFSEPGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAI  814
            MR ++  EP  G +    + +  AW  IR P+++P L+IA+  C  MS M F+ER+YMAI
Sbjct  1    MRDLILKEPIVGSFNGITDDILLAWKQIRNPLVLPFLRIALIICGSMSAMTFIERVYMAI  60

Query  813  VIVVVKCFGRKRYTRYKLDALKEDLEQNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWP  634
            VI++VK    KRYT+YKL+A +  LE  +NYP VLVQ+PM+NEKEVYKLSI AVCG  WP
Sbjct  61   VILLVKLLRIKRYTKYKLEAAERQLETTKNYPMVLVQIPMYNEKEVYKLSISAVCGMHWP  120

Query  633  SDRLIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYV  454
             D+L+VQ+LDDST+  +R+LVE EC+ W  +GVN+ YE R+NRNGYKAGALREGL K YV
Sbjct  121  RDKLVVQVLDDSTDHAIRELVELECQRWATKGVNITYENRHNRNGYKAGALREGLSKTYV  180

Query  453  DDCEFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDY  274
             DC+FV IFDADFQP+ D+L RT+PYLL N +LALVQARW+FVNADEC++TRLQEMSLDY
Sbjct  181  RDCQFVVIFDADFQPEQDYLMRTMPYLLTNDDLALVQARWRFVNADECLLTRLQEMSLDY  240

Query  273  HFTVEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLY  94
            HF VEQEVGSSTCSFFGFNGTAGVWR++ALHDAGGWKDRTTVEDMDLAVRASLRGWKFL+
Sbjct  241  HFGVEQEVGSSTCSFFGFNGTAGVWRIRALHDAGGWKDRTTVEDMDLAVRASLRGWKFLF  300

Query  93   IGDLEVKNELPSTFKAYRFQQHRWSCGPANL  1
            +GDL VKNELPSTFKAYRFQQHRWSCGPANL
Sbjct  301  VGDLSVKNELPSTFKAYRFQQHRWSCGPANL  331



>ref|XP_010935702.1| PREDICTED: mannan synthase 1-like isoform X1 [Elaeis guineensis]
Length=528

 Score =   510 bits (1313),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 234/331 (71%), Positives = 276/331 (83%), Gaps = 0/331 (0%)
 Frame = -1

Query  993  MRGIVFSEPGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAI  814
            MR ++  EP  G +    + +  AW  IR P+++P L+IA+  C  MS M F+ER+YMAI
Sbjct  1    MRDLILKEPIVGSFNGITDDILLAWKQIRNPLVLPFLRIALIICGSMSAMTFIERVYMAI  60

Query  813  VIVVVKCFGRKRYTRYKLDALKEDLEQNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWP  634
            VI++VK    KRYT+YKL+A +  LE  +NYP VLVQ+PM+NEKEVYKLSI AVCG  WP
Sbjct  61   VILLVKLLRIKRYTKYKLEAAERQLETTKNYPMVLVQIPMYNEKEVYKLSISAVCGMHWP  120

Query  633  SDRLIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYV  454
             D+L+VQ+LDDST+  +R+LVE EC+ W  +GVN+ YE R+NRNGYKAGALREGL K YV
Sbjct  121  RDKLVVQVLDDSTDHAIRELVELECQRWATKGVNITYENRHNRNGYKAGALREGLSKTYV  180

Query  453  DDCEFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDY  274
             DC+FV IFDADFQP+ D+L RT+PYLL N +LALVQARW+FVNADEC++TRLQEMSLDY
Sbjct  181  RDCQFVVIFDADFQPEQDYLMRTMPYLLTNDDLALVQARWRFVNADECLLTRLQEMSLDY  240

Query  273  HFTVEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLY  94
            HF VEQEVGSSTCSFFGFNGTAGVWR++ALHDAGGWKDRTTVEDMDLAVRASLRGWKFL+
Sbjct  241  HFGVEQEVGSSTCSFFGFNGTAGVWRIRALHDAGGWKDRTTVEDMDLAVRASLRGWKFLF  300

Query  93   IGDLEVKNELPSTFKAYRFQQHRWSCGPANL  1
            +GDL VKNELPSTFKAYRFQQHRWSCGPANL
Sbjct  301  VGDLSVKNELPSTFKAYRFQQHRWSCGPANL  331



>ref|XP_010935703.1| PREDICTED: mannan synthase 1-like isoform X2 [Elaeis guineensis]
Length=507

 Score =   509 bits (1311),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 234/331 (71%), Positives = 276/331 (83%), Gaps = 0/331 (0%)
 Frame = -1

Query  993  MRGIVFSEPGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAI  814
            MR ++  EP  G +    + +  AW  IR P+++P L+IA+  C  MS M F+ER+YMAI
Sbjct  1    MRDLILKEPIVGSFNGITDDILLAWKQIRNPLVLPFLRIALIICGSMSAMTFIERVYMAI  60

Query  813  VIVVVKCFGRKRYTRYKLDALKEDLEQNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWP  634
            VI++VK    KRYT+YKL+A +  LE  +NYP VLVQ+PM+NEKEVYKLSI AVCG  WP
Sbjct  61   VILLVKLLRIKRYTKYKLEAAERQLETTKNYPMVLVQIPMYNEKEVYKLSISAVCGMHWP  120

Query  633  SDRLIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYV  454
             D+L+VQ+LDDST+  +R+LVE EC+ W  +GVN+ YE R+NRNGYKAGALREGL K YV
Sbjct  121  RDKLVVQVLDDSTDHAIRELVELECQRWATKGVNITYENRHNRNGYKAGALREGLSKTYV  180

Query  453  DDCEFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDY  274
             DC+FV IFDADFQP+ D+L RT+PYLL N +LALVQARW+FVNADEC++TRLQEMSLDY
Sbjct  181  RDCQFVVIFDADFQPEQDYLMRTMPYLLTNDDLALVQARWRFVNADECLLTRLQEMSLDY  240

Query  273  HFTVEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLY  94
            HF VEQEVGSSTCSFFGFNGTAGVWR++ALHDAGGWKDRTTVEDMDLAVRASLRGWKFL+
Sbjct  241  HFGVEQEVGSSTCSFFGFNGTAGVWRIRALHDAGGWKDRTTVEDMDLAVRASLRGWKFLF  300

Query  93   IGDLEVKNELPSTFKAYRFQQHRWSCGPANL  1
            +GDL VKNELPSTFKAYRFQQHRWSCGPANL
Sbjct  301  VGDLSVKNELPSTFKAYRFQQHRWSCGPANL  331



>ref|XP_006851749.1| hypothetical protein AMTR_s00040p00223350 [Amborella trichopoda]
 gb|ERN13216.1| hypothetical protein AMTR_s00040p00223350 [Amborella trichopoda]
Length=533

 Score =   505 bits (1301),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 225/308 (73%), Positives = 276/308 (90%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W  IR P++VP+LK+A+  C++MS+MLF+ER+YMA+VIV+VK FG+K   RYK +A+K+D
Sbjct  29   WQQIRAPLIVPLLKLAVFLCLIMSLMLFMERVYMAVVIVLVKLFGKKPGKRYKWEAIKDD  88

Query  741  LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            LE  N NYP VLVQ+PM+NEKEVY+LSIGA CG +WPSDR+I+Q+LDDST+  ++ LVE 
Sbjct  89   LELGNANYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRIIIQVLDDSTDPTIKDLVEL  148

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC+ W  +G+N+KYE R+NRNGYKAGAL+EG+K  YV DC++VAIFDADFQP+ DFLWRT
Sbjct  149  ECQRWASKGINIKYEIRDNRNGYKAGALKEGMKHGYVRDCDYVAIFDADFQPEPDFLWRT  208

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            IP+L+ NPE+ LVQARWKFVN+DEC+MTR+QEMSLDYHFTVEQEVGSST +FFGFNGTAG
Sbjct  209  IPFLIHNPEIGLVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAG  268

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKF+Y+GDL+VKNELPSTFKAYR+QQHR
Sbjct  269  VWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGDLKVKNELPSTFKAYRYQQHR  328

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  329  WSCGPANL  336



>ref|XP_009385870.1| PREDICTED: mannan synthase 1-like [Musa acuminata subsp. malaccensis]
Length=526

 Score =   503 bits (1296),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 236/331 (71%), Positives = 280/331 (85%), Gaps = 1/331 (0%)
 Frame = -1

Query  993  MRGIVFSEPGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAI  814
            MR  V  E G G      E L   W  IR P++VP+L   M  C  MSVMLF+ER+YMAI
Sbjct  1    MRNPVLVE-GAGDGAAVGERLLVLWRQIRTPMVVPLLWALMYACAFMSVMLFVERVYMAI  59

Query  813  VIVVVKCFGRKRYTRYKLDALKEDLEQNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWP  634
            VIV+VK    KRYT+YKLD++++++E  +++P VLVQ+PMFNEKEVY+LSIGA C  +WP
Sbjct  60   VIVLVKLLRIKRYTKYKLDSMRQEMEAEESHPMVLVQIPMFNEKEVYRLSIGAACAMSWP  119

Query  633  SDRLIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYV  454
            S+++IVQ+LDDST+  ++++VE EC+ W  +GVNV+YE RN+R+GYKAGALREGL+K Y 
Sbjct  120  SNKMIVQVLDDSTDPVIKEMVEYECQSWASKGVNVEYEFRNSRSGYKAGALREGLEKSYA  179

Query  453  DDCEFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDY  274
             DC+FVAIFDADFQPD D+LWRTIP+LL NPELALVQARWKFVNADEC++TRLQEMSLDY
Sbjct  180  KDCDFVAIFDADFQPDPDYLWRTIPFLLTNPELALVQARWKFVNADECLLTRLQEMSLDY  239

Query  273  HFTVEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLY  94
            HF+VEQEVGSST SFFGFNGTAGVWR+QAL DAGGWKDRTTVEDMDLAVRASLRGWKF++
Sbjct  240  HFSVEQEVGSSTYSFFGFNGTAGVWRMQALVDAGGWKDRTTVEDMDLAVRASLRGWKFVF  299

Query  93   IGDLEVKNELPSTFKAYRFQQHRWSCGPANL  1
            +GDL VKNELPSTFKAYRFQQHRWSCGPANL
Sbjct  300  VGDLAVKNELPSTFKAYRFQQHRWSCGPANL  330



>gb|EYU41550.1| hypothetical protein MIMGU_mgv1a004346mg [Erythranthe guttata]
Length=532

 Score =   501 bits (1289),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 228/328 (70%), Positives = 275/328 (84%), Gaps = 1/328 (0%)
 Frame = -1

Query  981  VFSEPGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVV  802
            V  EP +G      E     W  I+ P++VP+L IA+  C+ MS MLF+ER+YMA+VI +
Sbjct  9    VLPEPFSGARDDITEQFMIIWGQIKAPLIVPLLNIAVFLCLTMSAMLFIERVYMAVVISL  68

Query  801  VKCFGRKRYTRYKLDALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDR  625
            +K FGRK   RYK + LK+DLE  N +YP VLVQ+PM+NEKEVY+LSIGA CG +WPSDR
Sbjct  69   IKLFGRKPDKRYKWEPLKDDLELGNSSYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDR  128

Query  624  LIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDC  445
            +IVQ+LDDST+  ++ +VE EC+ W  +G+N+KYE R+NRNGYKAGAL++GLK  YV  C
Sbjct  129  IIVQVLDDSTDPIIKNMVEIECQRWASKGINIKYEIRDNRNGYKAGALKQGLKHSYVKQC  188

Query  444  EFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFT  265
            +FVAIFDADFQP+ DFLW+TIP+L+ NPELALVQARWKFVNADEC+MTR+QEMSLDYHFT
Sbjct  189  DFVAIFDADFQPEPDFLWKTIPFLVHNPELALVQARWKFVNADECLMTRMQEMSLDYHFT  248

Query  264  VEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGD  85
            VEQEVGSST +FFGFNGTAGVWR+ A+ +AGGWKDRTTVEDMDLAVRASL+GWKFLY+G 
Sbjct  249  VEQEVGSSTYAFFGFNGTAGVWRIAAIDEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGS  308

Query  84   LEVKNELPSTFKAYRFQQHRWSCGPANL  1
            L+VKNELPSTFKAYR+QQHRWSCGPANL
Sbjct  309  LQVKNELPSTFKAYRYQQHRWSCGPANL  336



>gb|ABG34547.1| cellulose synthase-like A1 [Pinus taeda]
Length=530

 Score =   499 bits (1284),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 222/326 (68%), Positives = 280/326 (86%), Gaps = 5/326 (2%)
 Frame = -1

Query  975  SEPGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVK  796
            S P N M     E L   W  IR P++ P+L+ A+  C++MS+MLF+ER+YMA+VIV+VK
Sbjct  13   SFPSNDM----TEQLALIWRQIRAPLIAPLLRFAVGICLIMSLMLFIERVYMAVVIVLVK  68

Query  795  CFGRKRYTRYKLDALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLI  619
             FG++   RYK + +++D+E  N  YP VLVQ+PM+NEKEVY+LSIGA CG +WPSDR+I
Sbjct  69   LFGKRPEKRYKWEPIRDDIELGNSAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRII  128

Query  618  VQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEF  439
            +Q+LDDST+  +++LV  EC+ W  +G+N+KYE R+NRNGYKAGAL+EG+K+ YV DC++
Sbjct  129  IQVLDDSTDPAIKELVTMECQRWASKGINIKYEIRDNRNGYKAGALKEGMKRSYVKDCDY  188

Query  438  VAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVE  259
            VAIFDADFQP+ D+LWRT+P+L+ NPELALVQARWKFVN+DEC+MTR+QEMSLDYHFTVE
Sbjct  189  VAIFDADFQPEPDYLWRTVPFLVHNPELALVQARWKFVNSDECLMTRMQEMSLDYHFTVE  248

Query  258  QEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLE  79
            QEVGSST +FFGFNGTAGVWR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKF+++GDL+
Sbjct  249  QEVGSSTHAFFGFNGTAGVWRINALNEAGGWKDRTTVEDMDLAVRASLKGWKFVFVGDLK  308

Query  78   VKNELPSTFKAYRFQQHRWSCGPANL  1
            VKNELPSTFKAYR+QQHRWSCGPANL
Sbjct  309  VKNELPSTFKAYRYQQHRWSCGPANL  334



>ref|XP_002283672.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Vitis vinifera]
Length=533

 Score =   499 bits (1284),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 221/314 (70%), Positives = 274/314 (87%), Gaps = 1/314 (0%)
 Frame = -1

Query  939  ESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKL  760
            E L   W  I+ P++VP++ IA++ C+ MS+MLF ER+Y++IVIV+VK FGRK   RYK 
Sbjct  23   EQLGVVWSQIKAPVIVPLMSIAVAVCLAMSLMLFFERVYLSIVIVLVKLFGRKPDKRYKW  82

Query  759  DALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNL  583
            + +K+D+E  N  YP VLVQ+PM+NEKEVY+LSIGA CG +WPSDR+I+Q+LDDST+  +
Sbjct  83   EPMKDDVELGNSAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRIIIQVLDDSTDPTI  142

Query  582  RKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDH  403
            + LVE EC+ W  +G+N+KYE RNNRNGYKAGAL+EG+K  YV +C++VAIFDADFQP+ 
Sbjct  143  KDLVELECQRWASKGINIKYEIRNNRNGYKAGALKEGMKHSYVKECDYVAIFDADFQPEP  202

Query  402  DFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFG  223
            DFLWRT+P+L+ NPE+ALVQARWKFVN+DEC+MTR+QEMSLDYHFTVEQEVGSST +FFG
Sbjct  203  DFLWRTVPFLVHNPEIALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVGSSTYAFFG  262

Query  222  FNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAY  43
            FNGTAGVWR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKF+Y+G L+VKNELPSTFKAY
Sbjct  263  FNGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGTLKVKNELPSTFKAY  322

Query  42   RFQQHRWSCGPANL  1
            R+QQHRWSCGPANL
Sbjct  323  RYQQHRWSCGPANL  336



>ref|XP_010243535.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Nelumbo 
nucifera]
Length=533

 Score =   498 bits (1283),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 219/312 (70%), Positives = 276/312 (88%), Gaps = 1/312 (0%)
 Frame = -1

Query  933  LKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDA  754
            L   W+ I+ P++VP+LKIA+  C++MS+MLF+ER+YM IVI++VK FGRK   RYK + 
Sbjct  25   LGFIWEQIKAPLIVPLLKIAVFVCLIMSIMLFVERVYMGIVIILVKVFGRKPEKRYKWEP  84

Query  753  LKEDLEQ-NQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRK  577
            +K+D+E  N  YP VLVQ+PM+NEKEVY+LSIGA CG +WPSDR+I+Q+LDDST+  ++ 
Sbjct  85   MKDDVEMGNSAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRIIIQVLDDSTDSTIKS  144

Query  576  LVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDF  397
            LVE EC+ W  +G+N++YE R+NRNGYKAGAL+EG+K+ YV +C++VAIFDADFQP+ DF
Sbjct  145  LVELECQRWASKGINIRYEIRDNRNGYKAGALKEGMKRSYVRECDYVAIFDADFQPEPDF  204

Query  396  LWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFN  217
            LWRTIP+L+ NP++ALVQARWKFVN+DEC+MTR+QEMSL+YHFTVEQEVGSST +FFGFN
Sbjct  205  LWRTIPFLVHNPDIALVQARWKFVNSDECLMTRMQEMSLNYHFTVEQEVGSSTYAFFGFN  264

Query  216  GTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRF  37
            GTAGVWR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKF+Y+G L+VKNELPSTFKAYR+
Sbjct  265  GTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFVYVGGLQVKNELPSTFKAYRY  324

Query  36   QQHRWSCGPANL  1
            QQHRWSCGPANL
Sbjct  325  QQHRWSCGPANL  336



>emb|CBI30236.3| unnamed protein product [Vitis vinifera]
Length=540

 Score =   498 bits (1283),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 221/314 (70%), Positives = 274/314 (87%), Gaps = 1/314 (0%)
 Frame = -1

Query  939  ESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKL  760
            E L   W  I+ P++VP++ IA++ C+ MS+MLF ER+Y++IVIV+VK FGRK   RYK 
Sbjct  23   EQLGVVWSQIKAPVIVPLMSIAVAVCLAMSLMLFFERVYLSIVIVLVKLFGRKPDKRYKW  82

Query  759  DALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNL  583
            + +K+D+E  N  YP VLVQ+PM+NEKEVY+LSIGA CG +WPSDR+I+Q+LDDST+  +
Sbjct  83   EPMKDDVELGNSAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRIIIQVLDDSTDPTI  142

Query  582  RKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDH  403
            + LVE EC+ W  +G+N+KYE RNNRNGYKAGAL+EG+K  YV +C++VAIFDADFQP+ 
Sbjct  143  KDLVELECQRWASKGINIKYEIRNNRNGYKAGALKEGMKHSYVKECDYVAIFDADFQPEP  202

Query  402  DFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFG  223
            DFLWRT+P+L+ NPE+ALVQARWKFVN+DEC+MTR+QEMSLDYHFTVEQEVGSST +FFG
Sbjct  203  DFLWRTVPFLVHNPEIALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVGSSTYAFFG  262

Query  222  FNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAY  43
            FNGTAGVWR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKF+Y+G L+VKNELPSTFKAY
Sbjct  263  FNGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGTLKVKNELPSTFKAY  322

Query  42   RFQQHRWSCGPANL  1
            R+QQHRWSCGPANL
Sbjct  323  RYQQHRWSCGPANL  336



>gb|KDP42759.1| hypothetical protein JCGZ_23699 [Jatropha curcas]
Length=532

 Score =   498 bits (1281),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 219/308 (71%), Positives = 273/308 (89%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            WD I+ P++VP+L++A++ C++MS+MLF+ER+YM IVI++VK FGRK   RYK + LK+D
Sbjct  29   WDQIKAPLIVPLLRLAVAICLIMSLMLFIERVYMGIVIILVKLFGRKPEKRYKWEPLKDD  88

Query  741  LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            +E  N  YP VLVQ+PM+NE+EVY+LSIGA CG +WPSDR+I+Q+LDDST+  ++ LVE 
Sbjct  89   VELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIIIQVLDDSTDPTIKDLVEL  148

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC+ W  +G+N+KYE R+NRNGYKAGAL+EG+K+ YV  C++V IFDADFQP+ DFLWRT
Sbjct  149  ECQRWASKGINIKYEIRDNRNGYKAGALKEGMKRSYVKHCDYVVIFDADFQPEPDFLWRT  208

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            IP+L+ NP+LALVQARWKFVN+DEC+MTR+QEMSLDYHFTVEQEVGSST +FFGFNGTAG
Sbjct  209  IPFLVHNPQLALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAG  268

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKFLY+G L+VKNELPST KAYR+QQHR
Sbjct  269  VWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTLKAYRYQQHR  328

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  329  WSCGPANL  336



>ref|XP_003521436.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Glycine 
max]
 gb|KHN18723.1| Glucomannan 4-beta-mannosyltransferase 9 [Glycine soja]
Length=533

 Score =   498 bits (1281),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 221/312 (71%), Positives = 274/312 (88%), Gaps = 1/312 (0%)
 Frame = -1

Query  933  LKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDA  754
            L   W+ I+ P++VP+L+I +  C++MSVM+F+ER+YM IVI +VK FGRK   RYK + 
Sbjct  25   LALVWNQIKAPLIVPLLRITVFLCLIMSVMMFIERVYMGIVITLVKLFGRKPEKRYKWEP  84

Query  753  LKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRK  577
            +K+D+E  N +YP VLVQVPM+NE+EVY+LSIGA CG +WPSDR+I+Q+LDDST+  +++
Sbjct  85   MKDDIELGNSSYPMVLVQVPMYNEREVYQLSIGAACGLSWPSDRIIIQVLDDSTDPTIKE  144

Query  576  LVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDF  397
            LV+ EC+ W  +GVN+KYE R+NRNGYKAGAL+EG+K+ YV  C+ VAIFDADFQP+ DF
Sbjct  145  LVQLECQRWASKGVNIKYEVRDNRNGYKAGALKEGMKRSYVKQCDCVAIFDADFQPEPDF  204

Query  396  LWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFN  217
            LWRT+P+L+ NPELAL+QARWKFVNADEC+MTR+QEMSLDYHFTVEQEVGSST +FFGFN
Sbjct  205  LWRTVPFLVHNPELALIQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGSSTYAFFGFN  264

Query  216  GTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRF  37
            GTAGVWR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKFLY+ DL+VKNELPSTFKAYR+
Sbjct  265  GTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLSDLKVKNELPSTFKAYRY  324

Query  36   QQHRWSCGPANL  1
            QQHRWSCGPANL
Sbjct  325  QQHRWSCGPANL  336



>ref|XP_009353014.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X1 [Pyrus x bretschneideri]
Length=534

 Score =   498 bits (1281),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 218/308 (71%), Positives = 275/308 (89%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            WD I+ P++VP+L++A+  C++MSVMLF+ER+YMA+VIV++K FGRK   RYK + +K+D
Sbjct  29   WDQIKAPLIVPMLRLAVVLCLIMSVMLFVERLYMAVVIVLIKFFGRKPEKRYKWEPMKDD  88

Query  741  LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            +E  N  YP VLVQ+PM+NE+EVY++SIGA CG +WPSDR+IVQ+LDDST+  ++++VE 
Sbjct  89   VELGNSAYPMVLVQIPMYNEREVYQISIGAACGLSWPSDRIIVQVLDDSTDTTIKEMVEL  148

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC+ W  +G+N+KYE R+NRNGYKAGAL+EG+K+ YV  C+FVAIFDADFQP+ DFLWRT
Sbjct  149  ECQRWASKGINIKYEIRDNRNGYKAGALKEGMKRSYVKSCDFVAIFDADFQPEPDFLWRT  208

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            IP+LL NPELALVQ RWKFVN++EC+MTR+QEMSLDYHFTVEQEVGSST +FFGFNGTAG
Sbjct  209  IPFLLHNPELALVQTRWKFVNSNECLMTRMQEMSLDYHFTVEQEVGSSTHAFFGFNGTAG  268

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ A+++AGGWKDRTTVEDMDLAVRASL+GWKF+Y+G ++VKNELPSTFKAYR+QQHR
Sbjct  269  VWRITAINEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGSIQVKNELPSTFKAYRYQQHR  328

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  329  WSCGPANL  336



>ref|XP_009774056.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Nicotiana 
sylvestris]
Length=526

 Score =   497 bits (1280),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 222/308 (72%), Positives = 272/308 (88%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W+ I+ P++VP+L+IA+  C++MS+MLF+ER+YM IVI++VK FG+K   RYK ++LK+D
Sbjct  22   WEQIKAPLIVPLLRIAVFLCLLMSIMLFIERVYMGIVIILVKFFGKKPEKRYKWESLKDD  81

Query  741  LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            +E  N +YP VLVQ+PM+NEKEVY+LSIGA CG +WPSDR+IVQ+LDDST+  +R LV  
Sbjct  82   VELGNSSYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRIIVQVLDDSTDPIIRNLVSM  141

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC+ W  +G+N+KYE R+NRNGYKAGAL+EGLK QYV  C++VAIFDADFQP+ DFLWRT
Sbjct  142  ECQRWASKGINIKYEIRDNRNGYKAGALKEGLKHQYVKQCDYVAIFDADFQPEPDFLWRT  201

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            IP+L+ NPEL LVQARWK+VNADEC+MTR+QEMSLDYHFTVEQEVGSST +FFGFNGTAG
Sbjct  202  IPFLVHNPELGLVQARWKYVNADECLMTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAG  261

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ A+ +AGGWKDRTTVEDMDLAVRASL+GWKFLY+  L+VKNELPSTFKAYR+QQHR
Sbjct  262  VWRIAAIDEAGGWKDRTTVEDMDLAVRASLKGWKFLYLSSLKVKNELPSTFKAYRYQQHR  321

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  322  WSCGPANL  329



>ref|XP_010423663.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Camelina 
sativa]
Length=534

 Score =   497 bits (1280),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 220/307 (72%), Positives = 270/307 (88%), Gaps = 1/307 (0%)
 Frame = -1

Query  918  DSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKEDL  739
            D IR P++VP+L++ +  C+ MSVMLF+ER+YM IVI +VK FGRK   R+K +A+K+D+
Sbjct  31   DQIRAPLIVPVLRLGVYICLTMSVMLFVERVYMGIVISLVKLFGRKPDKRFKYEAIKDDM  90

Query  738  E-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVEDE  562
            E  N  YP VLVQ+PM+NE+EVY+LSIGA CG +WPSDR+++Q+LDDST+  ++ LVE E
Sbjct  91   ELGNSVYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIVIQVLDDSTDPTIKDLVEME  150

Query  561  CKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRTI  382
            C  W  +GVN+KYE R+NRNGYKAGAL+EG+KK YV  C++VAIFDADFQP+ DFLWRT+
Sbjct  151  CSRWASKGVNIKYEIRDNRNGYKAGALKEGMKKSYVKSCDYVAIFDADFQPESDFLWRTV  210

Query  381  PYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAGV  202
            P+LL NP+LALVQARWKFVN+DEC+MTR+QEMSLDYHFTVEQEVGSST +FFGFNGTAG+
Sbjct  211  PFLLHNPKLALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAGI  270

Query  201  WRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHRW  22
            WR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKFLY+G L+VKNELPSTFKAYR+QQHRW
Sbjct  271  WRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTFKAYRYQQHRW  330

Query  21   SCGPANL  1
            SCGPANL
Sbjct  331  SCGPANL  337



>ref|XP_007027602.1| Nucleotide-diphospho-sugar transferases superfamily protein isoform 
3 [Theobroma cacao]
 gb|EOY08104.1| Nucleotide-diphospho-sugar transferases superfamily protein isoform 
3 [Theobroma cacao]
Length=398

 Score =   492 bits (1267),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 218/308 (71%), Positives = 270/308 (88%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W  I+ P++VP+L++ +  C++MS+MLF+ER+YM IVI++VK FGRK   RYK + +K+D
Sbjct  29   WGQIKAPLIVPLLRLTVIVCLIMSLMLFIERVYMGIVIMLVKLFGRKPERRYKWEPIKDD  88

Query  741  LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            +E  N  YP VLVQ+PM+NE+EVY+LSIGA CG +WPSDR+I+Q+LDDST+  ++ LVE 
Sbjct  89   VELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIIIQVLDDSTDPTIKDLVEL  148

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC+ W  +G+N+KYE R+NRNGYKAGAL+EG+K+ YV  C++V IFDADFQP+ DFLWRT
Sbjct  149  ECQRWASKGINIKYEIRDNRNGYKAGALKEGMKRSYVKHCDYVVIFDADFQPEPDFLWRT  208

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            IP+L+ NPELALVQARWKFVNADEC+MTR+QEMSLDYHFTVEQEVGSST +FFGFNGTAG
Sbjct  209  IPFLVHNPELALVQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAG  268

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKFLY+G L+VKNELPST KAYR+QQHR
Sbjct  269  VWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTLKAYRYQQHR  328

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  329  WSCGPANL  336



>ref|XP_010452272.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Camelina 
sativa]
Length=534

 Score =   497 bits (1280),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 220/307 (72%), Positives = 270/307 (88%), Gaps = 1/307 (0%)
 Frame = -1

Query  918  DSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKEDL  739
            D IR P++VP+L++ +  C+ MSVMLF+ER+YM IVI +VK FGRK   R+K +A+K+D+
Sbjct  31   DQIRAPLIVPVLRLGVYICLTMSVMLFVERVYMGIVISLVKLFGRKPDKRFKYEAIKDDM  90

Query  738  E-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVEDE  562
            E  N  YP VLVQ+PM+NE+EVY+LSIGA CG +WPSDR+++Q+LDDST+  ++ LVE E
Sbjct  91   ELGNSVYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIVIQVLDDSTDPTIKDLVEME  150

Query  561  CKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRTI  382
            C  W  +GVN+KYE R+NRNGYKAGAL+EG+KK YV  C++VAIFDADFQP+ DFLWRT+
Sbjct  151  CSRWASKGVNIKYEIRDNRNGYKAGALKEGMKKSYVKSCDYVAIFDADFQPESDFLWRTV  210

Query  381  PYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAGV  202
            P+LL NP+LALVQARWKFVN+DEC+MTR+QEMSLDYHFTVEQEVGSST +FFGFNGTAG+
Sbjct  211  PFLLHNPKLALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAGI  270

Query  201  WRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHRW  22
            WR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKFLY+G L+VKNELPSTFKAYR+QQHRW
Sbjct  271  WRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTFKAYRYQQHRW  330

Query  21   SCGPANL  1
            SCGPANL
Sbjct  331  SCGPANL  337



>ref|XP_010490868.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Camelina 
sativa]
Length=534

 Score =   497 bits (1279),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 220/307 (72%), Positives = 271/307 (88%), Gaps = 1/307 (0%)
 Frame = -1

Query  918  DSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKEDL  739
            + IR P++VP+L++A+  C+ MSVMLF+ER+YM IVI +VK FGRK   R+K +A+K+D+
Sbjct  31   NQIRAPLIVPVLRLAVYICLTMSVMLFVERVYMGIVISLVKLFGRKPDKRFKYEAIKDDM  90

Query  738  E-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVEDE  562
            E  N  YP VLVQ+PM+NE+EVY+LSIGA CG +WPSDR+++Q+LDDST+  ++ LVE E
Sbjct  91   ELGNSVYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIVIQVLDDSTDPTIKDLVEME  150

Query  561  CKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRTI  382
            C  W  +GVN+KYE R+NRNGYKAGAL+EG+KK YV  C++VAIFDADFQP+ DFLWRT+
Sbjct  151  CSRWASKGVNIKYEIRDNRNGYKAGALKEGMKKSYVKSCDYVAIFDADFQPESDFLWRTV  210

Query  381  PYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAGV  202
            P+LL NP+LALVQARWKFVN+DEC+MTR+QEMSLDYHFTVEQEVGSST +FFGFNGTAG+
Sbjct  211  PFLLHNPKLALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAGI  270

Query  201  WRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHRW  22
            WR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKFLY+G L+VKNELPSTFKAYR+QQHRW
Sbjct  271  WRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTFKAYRYQQHRW  330

Query  21   SCGPANL  1
            SCGPANL
Sbjct  331  SCGPANL  337



>ref|XP_010543471.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Tarenaya 
hassleriana]
Length=533

 Score =   497 bits (1279),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 222/308 (72%), Positives = 270/308 (88%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            WD +R P++VP+L++A+  C++MSVMLF+ER+YM IVI +VK FGRK   RYK + +K+D
Sbjct  29   WDQMRAPLIVPLLRLAVYVCLVMSVMLFVERVYMGIVISLVKLFGRKPEKRYKWEPMKDD  88

Query  741  LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            +E  N  YP VLVQ+PM+NE+EVY+LSIGA CG +WPSDR+I+Q+LDDST+  ++ LVE 
Sbjct  89   IELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIIIQVLDDSTDPTIKDLVEL  148

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC  W  +GVN+KYE R+NR+GYKAGAL+EG+KK YV  C++VAIFDADFQP+ DFLWRT
Sbjct  149  ECHRWASKGVNIKYEIRDNRSGYKAGALKEGMKKSYVKSCDYVAIFDADFQPEPDFLWRT  208

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            IP+L+ NP LALVQARWKFVNADEC+MTR+QEMSLDYHFTVEQEVGSST +FFGFNGTAG
Sbjct  209  IPFLVHNPRLALVQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAG  268

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKFLY+G L+VKNELPST KAYR+QQHR
Sbjct  269  VWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTLKAYRYQQHR  328

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  329  WSCGPANL  336



>ref|XP_011094427.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Sesamum 
indicum]
Length=532

 Score =   496 bits (1278),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 224/308 (73%), Positives = 269/308 (87%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W  IR P++VP+L++A+  C+ MS MLF+ER+YMA+VI +VK FGRK   RYK + LK+D
Sbjct  29   WSQIRAPLIVPLLRVAVFLCLAMSAMLFVERVYMAVVITLVKLFGRKPDKRYKWEPLKDD  88

Query  741  LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            LE  N  YP VLVQ+PM+NEKEVY+LSIGA CG +WPSDR+I+Q+LDDST+  ++ LVE 
Sbjct  89   LELGNSAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRIIIQVLDDSTDPIIKNLVEM  148

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC+ W  +G+N+KYE R+NRNGYKAGAL+EGLK  YV  C++VAIFDADFQP+ DFLWRT
Sbjct  149  ECQRWASKGINIKYEIRDNRNGYKAGALKEGLKHSYVKQCDYVAIFDADFQPEPDFLWRT  208

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            IP+L+ N +LALVQARWKFVNADEC+MTRLQEMSLDYHFTVEQEVGSST +FFGFNGTAG
Sbjct  209  IPFLVHNSQLALVQARWKFVNADECLMTRLQEMSLDYHFTVEQEVGSSTYAFFGFNGTAG  268

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ A+++AGGWKDRTTVEDMDLAVRASL+GWKFLY+G L+VKNELPSTFKAYR+QQHR
Sbjct  269  VWRIAAINEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTFKAYRYQQHR  328

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  329  WSCGPANL  336



>ref|XP_003554414.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Glycine 
max]
 gb|KHN02265.1| Glucomannan 4-beta-mannosyltransferase 9 [Glycine soja]
Length=533

 Score =   496 bits (1278),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 221/312 (71%), Positives = 274/312 (88%), Gaps = 1/312 (0%)
 Frame = -1

Query  933  LKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDA  754
            L   W+ I+ P++VP+L++A+  C++MSVM+F+ER+YM IVI +VK FGRK   RYK + 
Sbjct  25   LALVWNQIKAPLIVPLLRLAVFLCLIMSVMMFIERVYMGIVITLVKLFGRKPEKRYKWEP  84

Query  753  LKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRK  577
            +K+D+E  N  YP VLVQVPM+NE+EVY+LSIGA CG +WPSDR+I+Q+LDDST+  +++
Sbjct  85   MKDDIELGNSCYPMVLVQVPMYNEREVYQLSIGAACGLSWPSDRIIIQVLDDSTDPTIKE  144

Query  576  LVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDF  397
            LV+ EC+ W  +GVN+KYE R+NRNGYKAGAL+EG+K+ YV  C+ VAIFDADFQP+ DF
Sbjct  145  LVQLECQRWASKGVNIKYEVRDNRNGYKAGALKEGMKRSYVKQCDCVAIFDADFQPEPDF  204

Query  396  LWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFN  217
            LWRT+P+L+ NPELAL+QARWKFVNADEC+MTR+QEMSLDYHFTVEQEVGSST +FFGFN
Sbjct  205  LWRTVPFLVHNPELALIQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGSSTYAFFGFN  264

Query  216  GTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRF  37
            GTAGVWR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKFLY+ DL+VKNELPSTFKAYR+
Sbjct  265  GTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLSDLKVKNELPSTFKAYRY  324

Query  36   QQHRWSCGPANL  1
            QQHRWSCGPANL
Sbjct  325  QQHRWSCGPANL  336



>ref|XP_006287469.1| hypothetical protein CARUB_v10000681mg [Capsella rubella]
 gb|EOA20367.1| hypothetical protein CARUB_v10000681mg [Capsella rubella]
Length=533

 Score =   496 bits (1277),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 221/307 (72%), Positives = 270/307 (88%), Gaps = 1/307 (0%)
 Frame = -1

Query  918  DSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKEDL  739
            D IR P++VP+L++A+  C+ MSVMLF+ER+YM IVI +VK FGRK   R+K + +K+DL
Sbjct  31   DQIRAPLIVPVLRLAVYICLTMSVMLFVERVYMGIVISLVKLFGRKPDKRFKYEPIKDDL  90

Query  738  E-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVEDE  562
            E  N  YP VLVQ+PMFNE+EVY+LSIGA CG +WPSDR+++Q+LDDST+  ++ LVE E
Sbjct  91   ELGNSVYPMVLVQIPMFNEREVYQLSIGAACGLSWPSDRIVIQVLDDSTDPTIKDLVEME  150

Query  561  CKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRTI  382
            C  W  +GVN+KYE R+NRNGYKAGAL+EG+KK YV  C++VAIFDADFQP+ D+LWRT+
Sbjct  151  CSRWASKGVNIKYEIRDNRNGYKAGALKEGMKKSYVKSCDYVAIFDADFQPEPDYLWRTV  210

Query  381  PYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAGV  202
            P+LL NP+LALVQARWKFVN+DEC+MTR+QEMSLDYHFTVEQEVGSST +FFGFNGTAG+
Sbjct  211  PFLLHNPKLALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAGI  270

Query  201  WRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHRW  22
            WR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKFLY+G L+VKNELPSTFKAYR+QQHRW
Sbjct  271  WRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTFKAYRYQQHRW  330

Query  21   SCGPANL  1
            SCGPANL
Sbjct  331  SCGPANL  337



>ref|NP_195996.1| glucomannan 4-beta-mannosyltransferase 9 [Arabidopsis thaliana]
 sp|Q9LZR3.1|CSLA9_ARATH RecName: Full=Glucomannan 4-beta-mannosyltransferase 9; AltName: 
Full=Cellulose synthase-like protein A9; Short=AtCslA9; 
AltName: Full=Glucomannan synthase; AltName: Full=Mannan synthase 
9; AltName: Full=Protein RESISTANT TO AGROBACTERIUM TRANSFORMATION 
4 [Arabidopsis thaliana]
 emb|CAB82941.1| putative protein [Arabidopsis thaliana]
 dbj|BAB08601.1| glucosyltransferase-like protein [Arabidopsis thaliana]
 gb|AAL31192.1| AT5g03760/F17C15_180 [Arabidopsis thaliana]
 gb|AAN31089.1| At5g03760/F17C15_180 [Arabidopsis thaliana]
 gb|AED90651.1| glucomannan 4-beta-mannosyltransferase 9 [Arabidopsis thaliana]
 gb|AHL38649.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=533

 Score =   496 bits (1277),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 220/307 (72%), Positives = 268/307 (87%), Gaps = 1/307 (0%)
 Frame = -1

Query  918  DSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKEDL  739
            D IR P++VP L++ +  C+ MSVMLF+ER+YM IVI +VK FGRK   R+K + +K+D+
Sbjct  30   DQIRAPLIVPALRLGVYICLTMSVMLFVERVYMGIVISLVKLFGRKPDKRFKYEPIKDDI  89

Query  738  E-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVEDE  562
            E  N  YP VL+Q+PMFNE+EVY+LSIGA CG +WPSDR+++Q+LDDST+  ++ LVE E
Sbjct  90   ELGNSAYPMVLIQIPMFNEREVYQLSIGAACGLSWPSDRIVIQVLDDSTDPTIKDLVEME  149

Query  561  CKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRTI  382
            C  W  +GVN+KYE R+NRNGYKAGAL+EG+KK YV  C++VAIFDADFQP+ DFLWRT+
Sbjct  150  CSRWASKGVNIKYEIRDNRNGYKAGALKEGMKKSYVKSCDYVAIFDADFQPEADFLWRTV  209

Query  381  PYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAGV  202
            PYLL NP+LALVQARWKFVN+DEC+MTR+QEMSLDYHFTVEQEVGSST +FFGFNGTAG+
Sbjct  210  PYLLHNPKLALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAGI  269

Query  201  WRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHRW  22
            WR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKFLY+G L+VKNELPSTFKAYR+QQHRW
Sbjct  270  WRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTFKAYRYQQHRW  329

Query  21   SCGPANL  1
            SCGPANL
Sbjct  330  SCGPANL  336



>dbj|BAE98718.1| hypothetical protein [Arabidopsis thaliana]
Length=533

 Score =   496 bits (1277),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 220/307 (72%), Positives = 268/307 (87%), Gaps = 1/307 (0%)
 Frame = -1

Query  918  DSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKEDL  739
            D IR P++VP L++ +  C+ MSVMLF+ER+YM IVI +VK FGRK   R+K + +K+D+
Sbjct  30   DQIRAPLIVPALRLGVYICLTMSVMLFVERVYMGIVISLVKLFGRKPDKRFKYEPIKDDI  89

Query  738  E-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVEDE  562
            E  N  YP VL+Q+PMFNE+EVY+LSIGA CG +WPSDR+++Q+LDDST+  ++ LVE E
Sbjct  90   ELGNSAYPMVLIQIPMFNEREVYQLSIGAACGLSWPSDRIVIQVLDDSTDPTIKDLVEME  149

Query  561  CKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRTI  382
            C  W  +GVN+KYE R+NRNGYKAGAL+EG+KK YV  C++VAIFDADFQP+ DFLWRT+
Sbjct  150  CSRWASKGVNIKYEIRDNRNGYKAGALKEGMKKSYVKSCDYVAIFDADFQPEADFLWRTV  209

Query  381  PYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAGV  202
            PYLL NP+LALVQARWKFVN+DEC+MTR+QEMSLDYHFTVEQEVGSST +FFGFNGTAG+
Sbjct  210  PYLLHNPKLALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAGI  269

Query  201  WRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHRW  22
            WR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKFLY+G L+VKNELPSTFKAYR+QQHRW
Sbjct  270  WRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTFKAYRYQQHRW  329

Query  21   SCGPANL  1
            SCGPANL
Sbjct  330  SCGPANL  336



>gb|ABG34548.1| cellulose synthase-like A2 [Pinus taeda]
Length=534

 Score =   496 bits (1276),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 222/315 (70%), Positives = 272/315 (86%), Gaps = 1/315 (0%)
 Frame = -1

Query  942  VESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYK  763
            VE +   W  IR P++ P+L I + FC++MSVMLF+ER+YMA+VIV++K FG+K   RYK
Sbjct  24   VEQIALLWQQIRAPLVAPLLNICIYFCLLMSVMLFIERVYMAVVIVLIKLFGKKPEKRYK  83

Query  762  LDALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDN  586
              A+KED+E  N  YP VLVQ+PM+NE+EVY+LSIGA C  +WPS+R+I+Q+LDDST+  
Sbjct  84   WGAIKEDVELGNSVYPMVLVQIPMYNEREVYQLSIGAACALSWPSNRVIIQVLDDSTDLT  143

Query  585  LRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPD  406
            ++ LVE EC+ W  +G+N+KYE R NRNGYKAGAL+EG+K  YV +C++V IFDADFQPD
Sbjct  144  IKDLVEMECQKWASKGINIKYEIRGNRNGYKAGALKEGMKHSYVRECDYVVIFDADFQPD  203

Query  405  HDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFF  226
             DFL RTIP+L+ NPELALVQARWKFVNADEC+MTR+QEMSLDYHFTVEQEVGS+T +FF
Sbjct  204  RDFLSRTIPFLVHNPELALVQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGSATHAFF  263

Query  225  GFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKA  46
            GFNGTAGVWR++AL++AGGWKDRTTVEDMDLAVRASLRGWKF+++GDL VKNELPSTFKA
Sbjct  264  GFNGTAGVWRIKALNEAGGWKDRTTVEDMDLAVRASLRGWKFVFVGDLGVKNELPSTFKA  323

Query  45   YRFQQHRWSCGPANL  1
            YR+QQHRWSCGPANL
Sbjct  324  YRYQQHRWSCGPANL  338



>gb|KFK24842.1| hypothetical protein AALP_AA8G031700 [Arabis alpina]
Length=533

 Score =   495 bits (1275),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 219/312 (70%), Positives = 272/312 (87%), Gaps = 1/312 (0%)
 Frame = -1

Query  933  LKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDA  754
            +   +D IR P++VP+L++ +  C++MSVMLF+ER+YM IVI +VK FGRK   R+K + 
Sbjct  25   MSMVFDQIRAPLIVPVLRLGVYICLVMSVMLFVERVYMGIVISLVKLFGRKPDKRFKYEP  84

Query  753  LKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRK  577
            +K+D+E  N  YP VLVQ+PM+NE+EVY+LSIGA CG +WPSDR+++Q+LDDST+  ++ 
Sbjct  85   IKDDIELGNSVYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIVIQVLDDSTDPTIKD  144

Query  576  LVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDF  397
            LVE EC  W  +GVN+KYE R+NRNGYKAGAL+EG+KK YV  C++VAIFDADFQP+ D+
Sbjct  145  LVEMECSRWASKGVNIKYEIRDNRNGYKAGALKEGMKKSYVKSCDYVAIFDADFQPEPDY  204

Query  396  LWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFN  217
            LWRT+PYLL NP+LALVQARWKFVN+DEC+MTR+QEMSLDYHFTVEQEVGSST +FFGFN
Sbjct  205  LWRTVPYLLHNPKLALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVGSSTYAFFGFN  264

Query  216  GTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRF  37
            GTAG+WR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKFLY+G L+VKNELPSTFKAYR+
Sbjct  265  GTAGIWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTFKAYRY  324

Query  36   QQHRWSCGPANL  1
            QQHRWSCGPANL
Sbjct  325  QQHRWSCGPANL  336



>emb|CDP15350.1| unnamed protein product [Coffea canephora]
Length=533

 Score =   495 bits (1275),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 224/314 (71%), Positives = 269/314 (86%), Gaps = 1/314 (0%)
 Frame = -1

Query  939  ESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKL  760
            E     W  I+ P++VP+LK+A+  C++MSVMLF+ER+YM +VI++VK F RK   RYK 
Sbjct  23   EQFSMVWAQIKAPLIVPLLKLAVMVCLIMSVMLFIERVYMGVVILLVKLFARKPEKRYKW  82

Query  759  DALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNL  583
            + +K+DLE  N  YP VLVQ+PM+NEKEVY+LSIGA CG +WPSDR+I+Q+LDDST+  +
Sbjct  83   EPIKDDLELGNSAYPVVLVQIPMYNEKEVYQLSIGAACGLSWPSDRIIIQVLDDSTDPII  142

Query  582  RKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDH  403
            + LVE EC+ W  +GVN+KYE R+NRNGYKAGAL+EGL   YV  C++VAIFDADFQP+ 
Sbjct  143  KALVETECQRWASKGVNIKYEIRDNRNGYKAGALKEGLNHAYVKQCDYVAIFDADFQPEP  202

Query  402  DFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFG  223
            DFLWRTIP+L+ NP+LALVQARWKFVNADEC+MTR+QEMSLDYHFTVEQEVGSST +FFG
Sbjct  203  DFLWRTIPFLVHNPQLALVQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGSSTYAFFG  262

Query  222  FNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAY  43
            FNGTAGVWRL A+ +AGGWKDRTTVEDMDLAVRASLRGWKF+Y+G L VKNELPSTFKAY
Sbjct  263  FNGTAGVWRLAAIDEAGGWKDRTTVEDMDLAVRASLRGWKFVYLGSLVVKNELPSTFKAY  322

Query  42   RFQQHRWSCGPANL  1
            R+QQHRWSCGPANL
Sbjct  323  RYQQHRWSCGPANL  336



>gb|KHN09524.1| Mannan synthase 1 [Glycine soja]
Length=481

 Score =   493 bits (1270),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 218/285 (76%), Positives = 265/285 (93%), Gaps = 0/285 (0%)
 Frame = -1

Query  855  MSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKEDLEQNQNYPKVLVQVPMFNEKEV  676
            MS+MLF+ER+ MAIVI+VVK  G+KRYT+Y L+A+K+ LE+N+ +P VL+Q+PM+NEKEV
Sbjct  1    MSIMLFVERVAMAIVILVVKVLGKKRYTKYNLEAMKQKLERNKRFPMVLIQIPMYNEKEV  60

Query  675  YKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGY  496
            YKLSIGAVCG +WP+DR IVQ+LDDSTN +LR+ V+ EC+ W+++GVNVKYETR NRNGY
Sbjct  61   YKLSIGAVCGLSWPADRFIVQVLDDSTNQSLRECVQMECQRWIQKGVNVKYETRTNRNGY  120

Query  495  KAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNAD  316
            KAGA++EGL+K+YV+DCE+VAIFDADFQPD DFLW TIPYLLENP+L LVQARWKFVN+ 
Sbjct  121  KAGAMKEGLEKEYVEDCEYVAIFDADFQPDADFLWNTIPYLLENPKLGLVQARWKFVNSK  180

Query  315  ECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMD  136
            EC+MT+LQEMSLDYHF+VEQEVGSST SFFGFNGTAG+WR+QA+ DAGGWKDRTTVEDMD
Sbjct  181  ECMMTKLQEMSLDYHFSVEQEVGSSTDSFFGFNGTAGIWRIQAIKDAGGWKDRTTVEDMD  240

Query  135  LAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHRWSCGPANL  1
            LAVRASL+GW+F+++GD++VKNELPSTFKAYR+QQHRWSCGPANL
Sbjct  241  LAVRASLQGWEFVFVGDIKVKNELPSTFKAYRYQQHRWSCGPANL  285



>emb|CDY11268.1| BnaA03g01040D [Brassica napus]
Length=532

 Score =   495 bits (1274),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 218/307 (71%), Positives = 269/307 (88%), Gaps = 1/307 (0%)
 Frame = -1

Query  918  DSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKEDL  739
            D IR P++VP+L++A+  C+ MSVMLF+ER+YM IVI +VK FGRK   R+K + +K+D+
Sbjct  30   DQIRAPLIVPVLRLAVYICLTMSVMLFVERVYMGIVISLVKLFGRKPEKRFKWEPMKDDI  89

Query  738  EQ-NQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVEDE  562
            E  N  YP VLVQ+PM+NE+EVY+LSIGA CG +WPSDR+++Q+LDDST+  ++ LVE E
Sbjct  90   EHGNSVYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIVIQVLDDSTDPTIKDLVEKE  149

Query  561  CKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRTI  382
            C  W  +G+N+KYE R+NRNGYKAGAL+EG+KK YV  C++VAIFDADFQP+ D+LWRT+
Sbjct  150  CSRWASKGINIKYEIRDNRNGYKAGALKEGMKKSYVKSCDYVAIFDADFQPEPDYLWRTV  209

Query  381  PYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAGV  202
            P+LL NP+LALVQARWKFVN+DEC+MTR+QEMSLDYHFTVEQEVGSST +FFGFNGTAG+
Sbjct  210  PFLLHNPKLALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAGI  269

Query  201  WRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHRW  22
            WR+ AL +AGGWKDRTTVEDMDLAVRASL+GWKFLY+G L+VKNELPSTFKAYR+QQHRW
Sbjct  270  WRISALSEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTFKAYRYQQHRW  329

Query  21   SCGPANL  1
            SCGPANL
Sbjct  330  SCGPANL  336



>ref|XP_010683891.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Beta vulgaris 
subsp. vulgaris]
Length=533

 Score =   495 bits (1274),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 218/308 (71%), Positives = 270/308 (88%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W+ I+ P  VPILK+A+  C+ MS+MLF+ER+YM IVI ++K FGRK   RYK + +K+D
Sbjct  29   WEQIKAPFFVPILKLAVLICLGMSIMLFIERVYMGIVITLLKLFGRKPEKRYKWETIKDD  88

Query  741  LEQNQN-YPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            +E   + YP VLVQ+PM+NEKEVY+LSIGA CG +WPSDR+I+Q+LDDST+  +++LV  
Sbjct  89   VELGSSVYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRIIIQVLDDSTDSTIKELVAM  148

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            ECK W  +G+N+KYE R+NRNGYKAGAL+EG+K  YV +C++VAIFDADFQP+ DFLWR+
Sbjct  149  ECKRWASKGINIKYEIRDNRNGYKAGALKEGMKHNYVKNCDYVAIFDADFQPEPDFLWRS  208

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            +P+L+ NP+LALVQARWKFVN+DEC+MTR+QEMSLDYHFTVEQEVGSST +FFGFNGTAG
Sbjct  209  VPFLMHNPQLALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAG  268

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ A+++AGGWKDRTTVEDMDLAVRASL+GWKFLY+G L+VKNELPSTFKAYRFQQHR
Sbjct  269  VWRISAINEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLQVKNELPSTFKAYRFQQHR  328

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  329  WSCGPANL  336



>ref|XP_009623019.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Nicotiana 
tomentosiformis]
Length=526

 Score =   495 bits (1274),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 220/308 (71%), Positives = 272/308 (88%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W+ I+ P++VP+L+IA+  C++MS+MLF+ER+YM IVI++VK FG+K   RYK ++LK+D
Sbjct  22   WEQIKAPLIVPLLRIAVFLCLLMSIMLFIERVYMGIVIILVKFFGKKPEKRYKWESLKDD  81

Query  741  LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            +E  N +YP VLVQ+PM+NE+EVY+LSIGA CG +WPSDR+IVQ+LDDST+  ++ LV  
Sbjct  82   VELGNSSYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIIVQVLDDSTDPIIKNLVSM  141

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC+ W  +G+N+KYE R+NRNGYKAGAL+EGLK QYV  C++VAIFDADFQP+ DFLWRT
Sbjct  142  ECQRWASKGINIKYEIRDNRNGYKAGALKEGLKHQYVKQCDYVAIFDADFQPEPDFLWRT  201

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            IP+L+ NPEL LVQARWK+VNADEC+MTR+QEMSLDYHFTVEQEVGSST +FFGFNGTAG
Sbjct  202  IPFLVHNPELGLVQARWKYVNADECLMTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAG  261

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ A+ +AGGWKDRTTVEDMDLAVRASL+GWKFLY+  L+VKNELPSTFKAYR+QQHR
Sbjct  262  VWRIAAIDEAGGWKDRTTVEDMDLAVRASLKGWKFLYLSSLKVKNELPSTFKAYRYQQHR  321

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  322  WSCGPANL  329



>ref|XP_009130779.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Brassica 
rapa]
Length=532

 Score =   495 bits (1274),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 218/307 (71%), Positives = 269/307 (88%), Gaps = 1/307 (0%)
 Frame = -1

Query  918  DSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKEDL  739
            D IR P++VP+L++A+  C+ MSVMLF+ER+YM IVI +VK FGRK   R+K + +K+D+
Sbjct  30   DQIRAPLIVPVLRLAVYICLTMSVMLFVERVYMGIVISLVKLFGRKPEKRFKWEPMKDDI  89

Query  738  EQ-NQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVEDE  562
            E  N  YP VLVQ+PM+NE+EVY+LSIGA CG +WPSDR+++Q+LDDST+  ++ LVE E
Sbjct  90   EHGNSVYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIVIQVLDDSTDPTIKDLVEKE  149

Query  561  CKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRTI  382
            C  W  +G+N+KYE R+NRNGYKAGAL+EG+KK YV  C++VAIFDADFQP+ D+LWRT+
Sbjct  150  CSRWASKGINIKYEIRDNRNGYKAGALKEGMKKSYVKSCDYVAIFDADFQPEPDYLWRTV  209

Query  381  PYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAGV  202
            P+LL NP+LALVQARWKFVN+DEC+MTR+QEMSLDYHFTVEQEVGSST +FFGFNGTAG+
Sbjct  210  PFLLHNPKLALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAGI  269

Query  201  WRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHRW  22
            WR+ AL +AGGWKDRTTVEDMDLAVRASL+GWKFLY+G L+VKNELPSTFKAYR+QQHRW
Sbjct  270  WRISALSEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTFKAYRYQQHRW  329

Query  21   SCGPANL  1
            SCGPANL
Sbjct  330  SCGPANL  336



>ref|XP_002873112.1| ATCSLA09 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49371.1| ATCSLA09 [Arabidopsis lyrata subsp. lyrata]
Length=534

 Score =   495 bits (1274),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 220/307 (72%), Positives = 268/307 (87%), Gaps = 1/307 (0%)
 Frame = -1

Query  918  DSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKEDL  739
            D IR P++VP+L++ +  C+ MSVMLF+ER+YM IVI +VK FGRK   R+K + +K+D+
Sbjct  31   DQIRAPLIVPVLRLGVYICLTMSVMLFVERVYMGIVISLVKLFGRKPDKRFKYEPMKDDI  90

Query  738  E-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVEDE  562
            E  N  YP VLVQ+PMFNE+EVY+LSIGA CG +WPSDR+++Q+LDDST+  ++ LVE E
Sbjct  91   ELGNSVYPMVLVQIPMFNEREVYQLSIGAACGLSWPSDRIVIQVLDDSTDPTIKDLVEME  150

Query  561  CKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRTI  382
            C  W  +GVN+KYE R+NR GYKAGAL+EG+KK YV  C++VAIFDADFQP+ DFLWRT+
Sbjct  151  CSRWASKGVNIKYEIRDNRKGYKAGALKEGMKKSYVKSCDYVAIFDADFQPEPDFLWRTV  210

Query  381  PYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAGV  202
            PYLL NP+LALVQARWKFVN+DEC+MTR+QEMSLDYHFTVEQEVGSST +FFGFNGTAG+
Sbjct  211  PYLLHNPKLALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAGI  270

Query  201  WRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHRW  22
            WR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKFLY+G L+VKNELPSTFKAYR+QQHRW
Sbjct  271  WRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTFKAYRYQQHRW  330

Query  21   SCGPANL  1
            SCGPANL
Sbjct  331  SCGPANL  337



>ref|XP_010050059.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Eucalyptus 
grandis]
 gb|KCW89262.1| hypothetical protein EUGRSUZ_A01558 [Eucalyptus grandis]
Length=533

 Score =   494 bits (1273),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 220/312 (71%), Positives = 273/312 (88%), Gaps = 1/312 (0%)
 Frame = -1

Query  933  LKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDA  754
            L   W  I+ P+LVP+L++A+  C+ MS+MLFLER+YMA+VI++VK FGRK   RY+ + 
Sbjct  25   LSLIWAQIKAPLLVPLLRVAVFLCLAMSLMLFLERVYMAVVILLVKLFGRKPEKRYRWEP  84

Query  753  LKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRK  577
            +K+D+E  N  YP VLVQ+PM+NE+EVY+LSIGA CG +WPSDR+I+Q+LDDST+  ++ 
Sbjct  85   IKDDVELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIIIQVLDDSTDPTIKD  144

Query  576  LVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDF  397
            LVE EC+ W  +G+N++YE R+NRNGYKAGAL+EG+K+ YV  C++VAI DADFQP+ DF
Sbjct  145  LVELECQRWASKGINIRYEIRDNRNGYKAGALKEGMKRSYVKQCDYVAILDADFQPEPDF  204

Query  396  LWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFN  217
            LWRTIP+L+ NPE+ALVQARWKFVNADEC+MTR+QEMSLDYHFTVEQEVGSST +FFGFN
Sbjct  205  LWRTIPFLVHNPEVALVQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGSSTHAFFGFN  264

Query  216  GTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRF  37
            GTAGVWR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKF+Y+G L+VKNELPSTFKAYRF
Sbjct  265  GTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGSLKVKNELPSTFKAYRF  324

Query  36   QQHRWSCGPANL  1
            QQHRWSCGPANL
Sbjct  325  QQHRWSCGPANL  336



>gb|KCW89261.1| hypothetical protein EUGRSUZ_A01558 [Eucalyptus grandis]
Length=532

 Score =   494 bits (1272),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 220/312 (71%), Positives = 273/312 (88%), Gaps = 1/312 (0%)
 Frame = -1

Query  933  LKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDA  754
            L   W  I+ P+LVP+L++A+  C+ MS+MLFLER+YMA+VI++VK FGRK   RY+ + 
Sbjct  25   LSLIWAQIKAPLLVPLLRVAVFLCLAMSLMLFLERVYMAVVILLVKLFGRKPEKRYRWEP  84

Query  753  LKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRK  577
            +K+D+E  N  YP VLVQ+PM+NE+EVY+LSIGA CG +WPSDR+I+Q+LDDST+  ++ 
Sbjct  85   IKDDVELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIIIQVLDDSTDPTIKD  144

Query  576  LVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDF  397
            LVE EC+ W  +G+N++YE R+NRNGYKAGAL+EG+K+ YV  C++VAI DADFQP+ DF
Sbjct  145  LVELECQRWASKGINIRYEIRDNRNGYKAGALKEGMKRSYVKQCDYVAILDADFQPEPDF  204

Query  396  LWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFN  217
            LWRTIP+L+ NPE+ALVQARWKFVNADEC+MTR+QEMSLDYHFTVEQEVGSST +FFGFN
Sbjct  205  LWRTIPFLVHNPEVALVQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGSSTHAFFGFN  264

Query  216  GTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRF  37
            GTAGVWR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKF+Y+G L+VKNELPSTFKAYRF
Sbjct  265  GTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGSLKVKNELPSTFKAYRF  324

Query  36   QQHRWSCGPANL  1
            QQHRWSCGPANL
Sbjct  325  QQHRWSCGPANL  336



>ref|XP_007027601.1| Nucleotide-diphospho-sugar transferases superfamily protein isoform 
2, partial [Theobroma cacao]
 gb|EOY08103.1| Nucleotide-diphospho-sugar transferases superfamily protein isoform 
2, partial [Theobroma cacao]
Length=485

 Score =   493 bits (1268),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 218/308 (71%), Positives = 270/308 (88%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W  I+ P++VP+L++ +  C++MS+MLF+ER+YM IVI++VK FGRK   RYK + +K+D
Sbjct  29   WGQIKAPLIVPLLRLTVIVCLIMSLMLFIERVYMGIVIMLVKLFGRKPERRYKWEPIKDD  88

Query  741  LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            +E  N  YP VLVQ+PM+NE+EVY+LSIGA CG +WPSDR+I+Q+LDDST+  ++ LVE 
Sbjct  89   VELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIIIQVLDDSTDPTIKDLVEL  148

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC+ W  +G+N+KYE R+NRNGYKAGAL+EG+K+ YV  C++V IFDADFQP+ DFLWRT
Sbjct  149  ECQRWASKGINIKYEIRDNRNGYKAGALKEGMKRSYVKHCDYVVIFDADFQPEPDFLWRT  208

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            IP+L+ NPELALVQARWKFVNADEC+MTR+QEMSLDYHFTVEQEVGSST +FFGFNGTAG
Sbjct  209  IPFLVHNPELALVQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAG  268

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKFLY+G L+VKNELPST KAYR+QQHR
Sbjct  269  VWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTLKAYRYQQHR  328

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  329  WSCGPANL  336



>ref|XP_009365313.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Pyrus 
x bretschneideri]
Length=534

 Score =   494 bits (1272),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 217/308 (70%), Positives = 273/308 (89%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W  I+ P++VP+L++A+  C++MSVMLF+ER+YMAIVIV++K FGRK   RYK + +K+D
Sbjct  29   WSQIKAPLIVPLLRLAVVLCLIMSVMLFVERLYMAIVIVLIKLFGRKPEKRYKWEPMKDD  88

Query  741  LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            +E  N  YP VLVQ+PM+NE+EVY+LSIGA CG +WPSDR+I+Q+LDDST+  ++ +VE 
Sbjct  89   VELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIIIQVLDDSTDPTIKDMVEL  148

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC+ W  +G+N+KYE R+NRNGYKAGAL+EG+K+ YV  C+FVAIFDADFQP+ DFLWRT
Sbjct  149  ECQRWASKGINIKYEIRDNRNGYKAGALKEGMKRSYVKSCDFVAIFDADFQPEPDFLWRT  208

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            IP+LL +PELALVQ RWKFVN++EC+MTR+QEMSLDYHFTVEQEVGSST +FFGFNGTAG
Sbjct  209  IPFLLHSPELALVQTRWKFVNSNECLMTRMQEMSLDYHFTVEQEVGSSTHAFFGFNGTAG  268

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ A+++AGGWKDRTTVEDMDLAVRASL+GWKF+Y+G ++VKNELPSTFKAYR+QQHR
Sbjct  269  VWRIAAINEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGSIQVKNELPSTFKAYRYQQHR  328

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  329  WSCGPANL  336



>gb|AGE09561.1| CSLA9-like protein [Eucalyptus cladocalyx]
Length=532

 Score =   494 bits (1272),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 219/312 (70%), Positives = 273/312 (88%), Gaps = 1/312 (0%)
 Frame = -1

Query  933  LKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDA  754
            L   W  I+ P+LVP+L++A+  C+ MS+MLF+ER+YMA+VI++VK FGRK   RY+ + 
Sbjct  25   LSLIWAQIKAPLLVPLLRVAVFLCLAMSLMLFVERVYMAVVILLVKLFGRKPEKRYRWEP  84

Query  753  LKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRK  577
            +K+D+E  N  YP VLVQ+PM+NE+EVY+LSIGA CG +WPSDR+I+Q+LDDST+  ++ 
Sbjct  85   MKDDIELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIIIQVLDDSTDPTIKD  144

Query  576  LVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDF  397
            LVE EC+ W  +G+N++YE R+NRNGYKAGAL+EG+K+ YV  C++VAI DADFQP+ DF
Sbjct  145  LVELECQRWASKGINIRYEIRDNRNGYKAGALKEGMKRSYVKQCDYVAILDADFQPEPDF  204

Query  396  LWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFN  217
            LWRT+P+L+ NPE+ALVQARWKFVNADEC+MTR+QEMSLDYHFTVEQEVGSST +FFGFN
Sbjct  205  LWRTVPFLVHNPEVALVQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGSSTHAFFGFN  264

Query  216  GTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRF  37
            GTAGVWR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKFLY+G L+VKNELPSTFKAYRF
Sbjct  265  GTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTFKAYRF  324

Query  36   QQHRWSCGPANL  1
            QQHRWSCGPANL
Sbjct  325  QQHRWSCGPANL  336



>ref|XP_006398833.1| hypothetical protein EUTSA_v10013220mg [Eutrema salsugineum]
 dbj|BAJ34228.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ40286.1| hypothetical protein EUTSA_v10013220mg [Eutrema salsugineum]
Length=532

 Score =   494 bits (1272),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 218/307 (71%), Positives = 269/307 (88%), Gaps = 1/307 (0%)
 Frame = -1

Query  918  DSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKEDL  739
            D IR P++VP+L++ +  C+ MSVMLF+ER+YM IVI +VK FGRK   R+K + +K+D+
Sbjct  30   DQIRAPLIVPVLRLGVYICLTMSVMLFVERVYMGIVISLVKLFGRKPEKRFKWEPMKDDI  89

Query  738  EQ-NQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVEDE  562
            E  N  YP VLVQ+PM+NE+EVY+LSIGA CG +WPSDR+++Q+LDDST+  ++ LVE E
Sbjct  90   EHGNSVYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIVIQVLDDSTDQTIKDLVEME  149

Query  561  CKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRTI  382
            C  W  +GVN+KYE R+NRNGYKAGAL+EG+KK YV  C++VAIFDADFQP+ DFLW+T+
Sbjct  150  CSRWASKGVNIKYEIRDNRNGYKAGALKEGMKKSYVKSCDYVAIFDADFQPESDFLWKTV  209

Query  381  PYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAGV  202
            P+LL NP+LALVQARWKFVN+DEC+MTR+QEMSLDYHFTVEQEVGSST +FFGFNGTAG+
Sbjct  210  PFLLHNPKLALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAGI  269

Query  201  WRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHRW  22
            WR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKFLY+G L+VKNELPSTFKAYR+QQHRW
Sbjct  270  WRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTFKAYRYQQHRW  329

Query  21   SCGPANL  1
            SCGPANL
Sbjct  330  SCGPANL  336



>emb|CDX70286.1| BnaA10g26350D [Brassica napus]
Length=532

 Score =   494 bits (1272),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 219/307 (71%), Positives = 270/307 (88%), Gaps = 1/307 (0%)
 Frame = -1

Query  918  DSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKEDL  739
            D IR P++VP+L++A+  C+ MSVMLF+ER+YM IVI +VK FGRK   R+K + +K+D+
Sbjct  30   DQIRAPLIVPVLRLAVYICLTMSVMLFVERVYMGIVISLVKLFGRKPEKRFKWEPMKDDI  89

Query  738  E-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVEDE  562
            E  N  YP VLVQ+PM+NE+EVY+LSIGA CG +WPSDR+++Q+LDDST+  ++ LVE E
Sbjct  90   ELGNSVYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIVIQVLDDSTDPTIKDLVEME  149

Query  561  CKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRTI  382
            C  W  +GVN+KYE R+NRNGYKAGAL+EG+KK YV  C++VAIFDADFQP+ D+LWRT+
Sbjct  150  CSRWASKGVNIKYEIRDNRNGYKAGALKEGMKKSYVKSCDYVAIFDADFQPEPDYLWRTV  209

Query  381  PYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAGV  202
            P+LL NP+LALVQARWKFVN+DEC+MTR+QEMSLDYHFTVEQEVGSST +FFGFNGTAG+
Sbjct  210  PFLLHNPKLALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAGI  269

Query  201  WRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHRW  22
            WR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKFLY+G L+VKNELPSTFKAYR+QQHRW
Sbjct  270  WRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTFKAYRYQQHRW  329

Query  21   SCGPANL  1
            SCGPANL
Sbjct  330  SCGPANL  336



>emb|CDY10358.1| BnaCnng02590D [Brassica napus]
Length=532

 Score =   494 bits (1271),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 219/307 (71%), Positives = 270/307 (88%), Gaps = 1/307 (0%)
 Frame = -1

Query  918  DSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKEDL  739
            D IR P++VP+L++A+  C+ MSVMLF+ER+YM IVI +VK FGRK   R+K + +K+D+
Sbjct  30   DQIRAPLIVPVLRLAVYICLTMSVMLFVERVYMGIVISLVKLFGRKPEKRFKWEPMKDDI  89

Query  738  E-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVEDE  562
            E  N  YP VLVQ+PM+NE+EVY+LSIGA CG +WPSDR+++Q+LDDST+  ++ LVE E
Sbjct  90   ELGNSVYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIVIQVLDDSTDPTIKDLVEME  149

Query  561  CKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRTI  382
            C  W  +GVN+KYE R+NRNGYKAGAL+EG+KK YV  C++VAIFDADFQP+ D+LWRT+
Sbjct  150  CSRWASKGVNIKYEIRDNRNGYKAGALKEGMKKSYVKSCDYVAIFDADFQPEPDYLWRTV  209

Query  381  PYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAGV  202
            P+LL NP+LALVQARWKFVN+DEC+MTR+QEMSLDYHFTVEQEVGSST +FFGFNGTAG+
Sbjct  210  PFLLHNPKLALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAGI  269

Query  201  WRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHRW  22
            WR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKFLY+G L+VKNELPSTFKAYR+QQHRW
Sbjct  270  WRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTFKAYRYQQHRW  329

Query  21   SCGPANL  1
            SCGPANL
Sbjct  330  SCGPANL  336



>ref|XP_008462529.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
melo]
Length=536

 Score =   493 bits (1270),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 219/308 (71%), Positives = 271/308 (88%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            WD+IR P++VP+L++++  C++MS+MLF+ER+YM IVI  VK FGRK   RYK + +K+D
Sbjct  32   WDTIRAPLVVPLLRLSVFLCLIMSLMLFVERVYMGIVISFVKLFGRKPEKRYKWEPMKDD  91

Query  741  LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            +E  N  YP VL+Q+PM+NEKEVY+LSIGA CG +WPSDR+I+Q+LDDST+  ++ LVE 
Sbjct  92   IELGNSVYPMVLIQIPMYNEKEVYQLSIGAACGLSWPSDRIIIQVLDDSTDPIIKDLVEM  151

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC+ W  +G+N+KYE R+NRNGYKAGAL+EGLK+ YV  C+FVAIFDADFQP+ DFLWRT
Sbjct  152  ECQRWASKGINIKYEIRDNRNGYKAGALKEGLKRSYVKQCDFVAIFDADFQPEPDFLWRT  211

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            +P+LL NP +ALVQARWKFVNA+EC +TR+QEMSLDYHFTVEQEVGSST +FFGFNGTAG
Sbjct  212  VPFLLHNPNIALVQARWKFVNANECFLTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAG  271

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKFLY+GDL+VKNELPS+ KAYR+QQHR
Sbjct  272  VWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGDLKVKNELPSSLKAYRYQQHR  331

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  332  WSCGPANL  339



>ref|XP_009601859.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Nicotiana 
tomentosiformis]
Length=533

 Score =   493 bits (1269),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 224/314 (71%), Positives = 268/314 (85%), Gaps = 1/314 (0%)
 Frame = -1

Query  939  ESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKL  760
            E     W  I+ P++VP+L+IA+  C+ MSVMLF+ER+YM IVI +VK FGRK   RYK 
Sbjct  23   EQFAIMWGQIKAPLIVPLLRIAVLLCLTMSVMLFIERVYMFIVISLVKLFGRKPEKRYKW  82

Query  759  DALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNL  583
            + LK+D+E  N +YP VLVQ+PM+NEKEVY+LSIGA CG +WPSDR+IVQ+LDDST+   
Sbjct  83   EPLKDDVELGNSSYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRIIVQVLDDSTDPIT  142

Query  582  RKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDH  403
            + LVE EC+ W  +G+N+KYE RNNR+GYKAGAL+EGLK  YV  C+FVAIFDADFQP+ 
Sbjct  143  KNLVEIECQRWASKGINIKYEVRNNRSGYKAGALKEGLKHSYVKQCDFVAIFDADFQPEP  202

Query  402  DFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFG  223
            DFLWRTIP+L+ NPEL+LVQARWK+VNADEC+MTR+QEMSLDYHFTVEQEVGS+T +FFG
Sbjct  203  DFLWRTIPFLVHNPELSLVQARWKYVNADECLMTRMQEMSLDYHFTVEQEVGSATHAFFG  262

Query  222  FNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAY  43
            FNGTAGVWR+ A+ +AGGWKDRTTVEDMDLAVRASL+GWKFLY+  L VKNELPSTFKAY
Sbjct  263  FNGTAGVWRIAAIDEAGGWKDRTTVEDMDLAVRASLKGWKFLYLSSLMVKNELPSTFKAY  322

Query  42   RFQQHRWSCGPANL  1
            R+QQHRWSCGPANL
Sbjct  323  RYQQHRWSCGPANL  336



>gb|KHG19821.1| Glucomannan 4-beta-mannosyltransferase 9 -like protein [Gossypium 
arboreum]
Length=529

 Score =   493 bits (1268),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 219/308 (71%), Positives = 270/308 (88%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W  I+ P++VP+LK+A+  C++MSVMLF+ER+YM IVI +VK FGRK   R+K +A+K+D
Sbjct  25   WGQIKAPLIVPLLKLAVVVCLIMSVMLFVERVYMGIVIALVKLFGRKPDKRFKWEAIKDD  84

Query  741  LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            +E  N  YP VLVQ+PM+NE+EVY+LSIGA CG +WPSDR+++Q+LDDST+  ++ +VE 
Sbjct  85   VELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIVIQVLDDSTDPTIKDMVEL  144

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC+ W  +G+N+KYE R+NRNGYKAGAL+EG+K  YV  C++V IFDADFQP+ DFLWRT
Sbjct  145  ECQRWASKGINIKYEIRDNRNGYKAGALKEGMKHSYVKHCDYVVIFDADFQPEPDFLWRT  204

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            IP+L+ NPELALVQARWKFVN+DEC+MTR+QEMSLDYHFTVEQEVGSST SFFGFNGTAG
Sbjct  205  IPFLVHNPELALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVGSSTYSFFGFNGTAG  264

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKFLY+G L+VKNELPST KAYR+QQHR
Sbjct  265  VWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTLKAYRYQQHR  324

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  325  WSCGPANL  332



>ref|XP_009122674.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Brassica 
rapa]
Length=532

 Score =   493 bits (1268),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 218/307 (71%), Positives = 270/307 (88%), Gaps = 1/307 (0%)
 Frame = -1

Query  918  DSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKEDL  739
            D IR P++VP+L++A+  C+ MSVMLF+ER+YM IVI +VK FGRK   R+K + +K+D+
Sbjct  30   DQIRAPLIVPVLRLAVYICLTMSVMLFVERVYMGIVISLVKLFGRKPEKRFKWEPMKDDI  89

Query  738  E-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVEDE  562
            E  N  YP VLVQ+PM+NE+EVY+LSIGA CG +WPSDR+++Q+LDDST+  ++ LVE E
Sbjct  90   ELGNSVYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIVIQVLDDSTDPTIKDLVEME  149

Query  561  CKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRTI  382
            C  W  +GVN+KYE R+NRNGYKAGAL+EG+KK YV  C++VAIFDADFQP+ D+LW+T+
Sbjct  150  CSRWASKGVNIKYEIRDNRNGYKAGALKEGMKKSYVKSCDYVAIFDADFQPEPDYLWKTV  209

Query  381  PYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAGV  202
            P+LL NP+LALVQARWKFVN+DEC+MTR+QEMSLDYHFTVEQEVGSST +FFGFNGTAG+
Sbjct  210  PFLLHNPKLALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAGI  269

Query  201  WRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHRW  22
            WR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKFLY+G L+VKNELPSTFKAYR+QQHRW
Sbjct  270  WRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTFKAYRYQQHRW  329

Query  21   SCGPANL  1
            SCGPANL
Sbjct  330  SCGPANL  336



>ref|XP_004143300.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
sativus]
 gb|KGN48231.1| hypothetical protein Csa_6G450360 [Cucumis sativus]
Length=537

 Score =   492 bits (1267),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 218/308 (71%), Positives = 271/308 (88%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            WD+IR P++VP+L++++  C++MS+MLF+ER+YM IVI  VK FGRK   R+K + +K+D
Sbjct  33   WDAIRAPLVVPLLRLSVFLCLIMSLMLFVERVYMGIVISFVKLFGRKPEKRFKWEPMKDD  92

Query  741  LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            +E  N  YP VL+Q+PM+NEKEVY+LSIGA CG +WPSDR+I+Q+LDDST+  ++ LVE 
Sbjct  93   IELGNSVYPMVLIQIPMYNEKEVYQLSIGAACGLSWPSDRIIIQVLDDSTDPMIKDLVEM  152

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC+ W  +G+N+KYE R+NRNGYKAGAL+EGLK+ YV  C+FVAIFDADFQP+ DFLWRT
Sbjct  153  ECQRWASKGINIKYEIRDNRNGYKAGALKEGLKRSYVKQCDFVAIFDADFQPEPDFLWRT  212

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            +P+LL NP +ALVQARWKFVNA+EC +TR+QEMSLDYHFTVEQEVGSST +FFGFNGTAG
Sbjct  213  VPFLLHNPNIALVQARWKFVNANECFLTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAG  272

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKFLY+GDL+VKNELPS+ KAYR+QQHR
Sbjct  273  VWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGDLKVKNELPSSLKAYRYQQHR  332

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  333  WSCGPANL  340



>ref|XP_004164074.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
sativus]
Length=537

 Score =   492 bits (1267),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 218/308 (71%), Positives = 271/308 (88%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            WD+IR P++VP+L++++  C++MS+MLF+ER+YM IVI  VK FGRK   R+K + +K+D
Sbjct  33   WDAIRAPLVVPLLRLSVFLCLIMSLMLFVERVYMGIVISFVKLFGRKPEKRFKWEPMKDD  92

Query  741  LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            +E  N  YP VL+Q+PM+NEKEVY+LSIGA CG +WPSDR+I+Q+LDDST+  ++ LVE 
Sbjct  93   IELGNSVYPMVLIQIPMYNEKEVYQLSIGAACGLSWPSDRIIIQVLDDSTDPMIKDLVEM  152

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC+ W  +G+N+KYE R+NRNGYKAGAL+EGLK+ YV  C+FVAIFDADFQP+ DFLWRT
Sbjct  153  ECQRWASKGINIKYEIRDNRNGYKAGALKEGLKRSYVKQCDFVAIFDADFQPEPDFLWRT  212

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            +P+LL NP +ALVQARWKFVNA+EC +TR+QEMSLDYHFTVEQEVGSST +FFGFNGTAG
Sbjct  213  VPFLLHNPNIALVQARWKFVNANECFLTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAG  272

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKFLY+GDL+VKNELPS+ KAYR+QQHR
Sbjct  273  VWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGDLKVKNELPSSLKAYRYQQHR  332

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  333  WSCGPANL  340



>emb|CAN74357.1| hypothetical protein VITISV_042153 [Vitis vinifera]
Length=533

 Score =   492 bits (1266),  Expect = 8e-168, Method: Compositional matrix adjust.
 Identities = 218/314 (69%), Positives = 272/314 (87%), Gaps = 1/314 (0%)
 Frame = -1

Query  939  ESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKL  760
            E L   W  I+ P++VP++ IA++ C+ MS+MLF ER+Y++IVIV+VK FGRK    YK 
Sbjct  23   EQLGVVWSQIKAPVIVPLMSIAVAVCLAMSLMLFFERVYLSIVIVLVKLFGRKPDKSYKW  82

Query  759  DALKEDLEQNQN-YPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNL  583
            + +K+D+E   + YP VLVQ+PM+NEKEVY+LSIGA CG +WPSDR+I+Q+LDDST+  +
Sbjct  83   EPMKDDVELGXSAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRIIIQVLDDSTDPTI  142

Query  582  RKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDH  403
            + LVE EC+ W  +G+N+KYE RNNRNGYKAGAL+EG+K  YV +C++VAIFDADFQP+ 
Sbjct  143  KDLVELECQRWASKGINIKYEIRNNRNGYKAGALKEGMKHSYVKECDYVAIFDADFQPEP  202

Query  402  DFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFG  223
            DFLWRT+P+L+ N E+ALVQARWKFVN+DEC+MTR+QEMSLDYHFTVEQEVGSST +FFG
Sbjct  203  DFLWRTVPFLVHNXEIALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVGSSTYAFFG  262

Query  222  FNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAY  43
            FNGTAGVWR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKF+Y+G L+VKNELPSTFKAY
Sbjct  263  FNGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGTLKVKNELPSTFKAY  322

Query  42   RFQQHRWSCGPANL  1
            R+QQHRWSCGPANL
Sbjct  323  RYQQHRWSCGPANL  336



>ref|XP_007162846.1| hypothetical protein PHAVU_001G185800g [Phaseolus vulgaris]
 gb|ESW34840.1| hypothetical protein PHAVU_001G185800g [Phaseolus vulgaris]
Length=533

 Score =   492 bits (1266),  Expect = 8e-168, Method: Compositional matrix adjust.
 Identities = 218/312 (70%), Positives = 273/312 (88%), Gaps = 1/312 (0%)
 Frame = -1

Query  933  LKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDA  754
            L   W+ I+ P++VP+L++A+  C++MSVM+F+ER+YM +VI +VK F RK   RYK + 
Sbjct  25   LALVWNQIKAPLIVPLLRLAVFLCLIMSVMMFIERVYMGVVITLVKLFVRKPEKRYKWEP  84

Query  753  LKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRK  577
            +K+D+E  N +YP VLVQVPM+NE+EVY+LSIGA CG +WPSDR+I+Q+LDDST+  +++
Sbjct  85   MKDDIELGNSSYPMVLVQVPMYNEREVYQLSIGAACGLSWPSDRIIIQVLDDSTDPTIKE  144

Query  576  LVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDF  397
            LV+ EC+ W  +GVN+KYE R+NRNGYKAGAL+EG+K+ YV  C+ VAIFDADFQP+ DF
Sbjct  145  LVQLECQRWASKGVNIKYEVRDNRNGYKAGALKEGMKRSYVKQCDCVAIFDADFQPEPDF  204

Query  396  LWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFN  217
            LWRT+P+L+ NPELAL+QARWKFVNADEC+MTR+QEMSLDYHFTVEQEVGSST +FFGFN
Sbjct  205  LWRTVPFLVHNPELALIQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGSSTYAFFGFN  264

Query  216  GTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRF  37
            GTAGVWR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKFLY+ DL+VKNELPST KAYR+
Sbjct  265  GTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLSDLKVKNELPSTLKAYRY  324

Query  36   QQHRWSCGPANL  1
            QQHRWSCGPANL
Sbjct  325  QQHRWSCGPANL  336



>ref|XP_008359466.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Malus 
domestica]
Length=534

 Score =   492 bits (1266),  Expect = 8e-168, Method: Compositional matrix adjust.
 Identities = 216/308 (70%), Positives = 272/308 (88%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W  I+ P++VP+L++A+  C +MSVMLF+ER+YMA+VIV++K FGRK   RYK + +K+D
Sbjct  29   WSQIKAPLIVPLLRLAVVLCXIMSVMLFVERLYMAVVIVLIKLFGRKPEKRYKWEPMKDD  88

Query  741  LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            +E  N  YP VLVQ+PM+NE+EVY+LSIGA CG +WPSDR+I+Q+LDDST+  ++ +VE 
Sbjct  89   VELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIIIQVLDDSTDPTIKDMVEL  148

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC+ W  +G+N+KYE R+NRNGYKAGAL+EG+K+ YV  C+FVAIFDADFQP+ DFLWRT
Sbjct  149  ECQRWASKGINIKYEIRDNRNGYKAGALKEGMKRSYVKSCDFVAIFDADFQPEPDFLWRT  208

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            IP+LL NPELALVQ RWKFVN++EC+MTR+QEMSLDYHFTVEQEVGSST +FFGFNGTAG
Sbjct  209  IPFLLHNPELALVQTRWKFVNSNECLMTRMQEMSLDYHFTVEQEVGSSTHAFFGFNGTAG  268

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ A+++AGGWKDRTTVEDMDLAVRASL+GWKF+Y+G ++VK+ELPSTFKAYR+QQHR
Sbjct  269  VWRIAAINEAGGWKDRTTVEDMDLAVRASLQGWKFVYLGSIQVKSELPSTFKAYRYQQHR  328

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  329  WSCGPANL  336



>ref|XP_007027600.1| Nucleotide-diphospho-sugar transferases superfamily protein isoform 
1 [Theobroma cacao]
 gb|EOY08102.1| Nucleotide-diphospho-sugar transferases superfamily protein isoform 
1 [Theobroma cacao]
Length=533

 Score =   491 bits (1265),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 218/308 (71%), Positives = 270/308 (88%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W  I+ P++VP+L++ +  C++MS+MLF+ER+YM IVI++VK FGRK   RYK + +K+D
Sbjct  29   WGQIKAPLIVPLLRLTVIVCLIMSLMLFIERVYMGIVIMLVKLFGRKPERRYKWEPIKDD  88

Query  741  LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            +E  N  YP VLVQ+PM+NE+EVY+LSIGA CG +WPSDR+I+Q+LDDST+  ++ LVE 
Sbjct  89   VELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIIIQVLDDSTDPTIKDLVEL  148

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC+ W  +G+N+KYE R+NRNGYKAGAL+EG+K+ YV  C++V IFDADFQP+ DFLWRT
Sbjct  149  ECQRWASKGINIKYEIRDNRNGYKAGALKEGMKRSYVKHCDYVVIFDADFQPEPDFLWRT  208

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            IP+L+ NPELALVQARWKFVNADEC+MTR+QEMSLDYHFTVEQEVGSST +FFGFNGTAG
Sbjct  209  IPFLVHNPELALVQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAG  268

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKFLY+G L+VKNELPST KAYR+QQHR
Sbjct  269  VWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTLKAYRYQQHR  328

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  329  WSCGPANL  336



>gb|KDO61015.1| hypothetical protein CISIN_1g0413332mg, partial [Citrus sinensis]
Length=394

 Score =   486 bits (1250),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 218/312 (70%), Positives = 269/312 (86%), Gaps = 1/312 (0%)
 Frame = -1

Query  933  LKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDA  754
            L   W  I+ P++VP+L IA+  C++MS+ML +ER+YM+IVI+++K  GR   TRYK   
Sbjct  25   LSLLWGWIKAPLIVPLLNIAVFLCLIMSLMLLIERVYMSIVILLLKLSGRSPETRYKFQP  84

Query  753  LKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRK  577
            +KED+E  N +YP VLVQ+PMFNE+EVY+LSIGA CG +WPSDRLI+Q+LDDST+  ++ 
Sbjct  85   MKEDVELGNSSYPMVLVQIPMFNEREVYQLSIGAACGLSWPSDRLIIQVLDDSTDLTIKD  144

Query  576  LVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDF  397
            +VE EC+ W  +G+N+KYE R+NR GYKAGALREG+K+ YV  C+FV IFDADFQP+ DF
Sbjct  145  MVELECQRWASKGINIKYEVRDNRKGYKAGALREGMKRGYVKSCDFVVIFDADFQPESDF  204

Query  396  LWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFN  217
            L RTIP+L+ NP+LALVQARW+FVNADEC+MTRLQEMSLDYHFTVEQEVGSST +FFGFN
Sbjct  205  LTRTIPFLVHNPQLALVQARWEFVNADECLMTRLQEMSLDYHFTVEQEVGSSTHAFFGFN  264

Query  216  GTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRF  37
            GTAGVWR+ A+++AGGWKDRTTVEDMDLAVRASL+GWKFLY+G ++VKNELPSTFKAYR+
Sbjct  265  GTAGVWRIAAVNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGTVKVKNELPSTFKAYRY  324

Query  36   QQHRWSCGPANL  1
            QQHRWSCGPANL
Sbjct  325  QQHRWSCGPANL  336



>ref|XP_006339112.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Solanum 
tuberosum]
Length=533

 Score =   491 bits (1263),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 222/328 (68%), Positives = 275/328 (84%), Gaps = 1/328 (0%)
 Frame = -1

Query  981  VFSEPGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVV  802
            +F +   G      E L   W+ I+ P++VP+L+IA+  C++MS++LF+ER+YM IVI +
Sbjct  9    LFPDTLAGTRDDLTEQLTIIWEQIKAPLIVPLLRIAVFLCLLMSILLFIERVYMGIVITL  68

Query  801  VKCFGRKRYTRYKLDALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDR  625
            VK FGRK   RYK ++LK+D+E  N  YP VLVQ+PM+NEKEVY+LSIGA CG +WPSDR
Sbjct  69   VKLFGRKSDKRYKWESLKDDVEIGNSCYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDR  128

Query  624  LIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDC  445
            +I+Q+LDDST+  ++ LV  EC+ W  +G++++YE R+NRNGYKAGAL+EGLK  YV  C
Sbjct  129  IIIQVLDDSTDPIIKNLVSMECQRWASKGIDIRYEIRDNRNGYKAGALKEGLKHPYVKQC  188

Query  444  EFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFT  265
            ++VAIFDADFQP+ DFLWRTIP+L+ NP+L LVQARWKFVNADEC+MTR+QEMSLDYHFT
Sbjct  189  DYVAIFDADFQPEPDFLWRTIPFLVHNPQLGLVQARWKFVNADECLMTRMQEMSLDYHFT  248

Query  264  VEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGD  85
            VEQEVGSST +FFGFNGTAGVWR+ AL +AGGWKDRTTVEDMDLAVRASL+GWKFLY+  
Sbjct  249  VEQEVGSSTYAFFGFNGTAGVWRIAALEEAGGWKDRTTVEDMDLAVRASLKGWKFLYLSA  308

Query  84   LEVKNELPSTFKAYRFQQHRWSCGPANL  1
            L+VKNELPSTFKAYR+QQHRWSCGPANL
Sbjct  309  LKVKNELPSTFKAYRYQQHRWSCGPANL  336



>ref|XP_010558212.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Tarenaya 
hassleriana]
Length=526

 Score =   490 bits (1262),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 218/308 (71%), Positives = 269/308 (87%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            WD +R P++ P+L++A+  C+ MSVMLF+ER+YM IVI ++K FGRK   RYK + +K+D
Sbjct  22   WDQMRTPLVAPLLRLAVYVCLAMSVMLFVERVYMGIVISLLKLFGRKPEKRYKWEPMKDD  81

Query  741  LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            +E  +  YP VLVQ+PM+NE+EVY+LSIGA CG +WPSDR+I+Q+LDDST+  ++ LVE 
Sbjct  82   IELGDSAYPVVLVQIPMYNEREVYQLSIGAACGLSWPSDRIIIQVLDDSTDPTIKDLVEM  141

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC+ W  +GVN+KYE R+NR GYKAGAL+EG+KK YV  C++VAIFDADFQP+ DFLWRT
Sbjct  142  ECQRWASKGVNIKYEVRDNRKGYKAGALKEGMKKSYVKSCDYVAIFDADFQPEPDFLWRT  201

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            IP+L+ NP LALVQARWKFVN+DEC+MTR+QE+SLDYHFTVEQEVGSST +FFGFNGTAG
Sbjct  202  IPFLVHNPSLALVQARWKFVNSDECLMTRMQEISLDYHFTVEQEVGSSTYAFFGFNGTAG  261

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKFLY+G L+VKNELPSTFKAYR+QQHR
Sbjct  262  VWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELPSTFKAYRYQQHR  321

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  322  WSCGPANL  329



>ref|XP_008804385.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Phoenix 
dactylifera]
Length=533

 Score =   490 bits (1262),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 219/328 (67%), Positives = 274/328 (84%), Gaps = 1/328 (0%)
 Frame = -1

Query  981  VFSEPGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVV  802
            +  E   G      E +   W  I+ P++VP+L++ +  C+ MSVMLF+E++YMA+VIV+
Sbjct  9    ILPETLQGARDDITEQMGLVWQQIKAPVIVPLLRLTVFLCLAMSVMLFVEKVYMAVVIVI  68

Query  801  VKCFGRKRYTRYKLDALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDR  625
            VK  G++   RYK + +++DLE  N  YP VLVQ+PM+NEKEVY+LSIGA CG +WPSDR
Sbjct  69   VKLLGKRPEKRYKWEPMRDDLELGNSAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDR  128

Query  624  LIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDC  445
            +I+Q+LDDST+  ++ LVE ECK W  +G+N+KYE R+NRNGYKAGAL+EG+K  YV DC
Sbjct  129  IIIQVLDDSTDPVIKDLVEVECKRWASKGINIKYEIRDNRNGYKAGALKEGMKHSYVKDC  188

Query  444  EFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFT  265
            ++VAIFDADFQP+ DFL RTIP+L+ NPE+ALVQARWKFVN+DEC+MTR+QEMSLDYHFT
Sbjct  189  DYVAIFDADFQPEPDFLSRTIPFLVHNPEIALVQARWKFVNSDECLMTRMQEMSLDYHFT  248

Query  264  VEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGD  85
            VEQEVGSST +FFGFNGTAGVWRL AL +AGGWKDRTTVEDMDLAVRASL+GWKF+++GD
Sbjct  249  VEQEVGSSTYAFFGFNGTAGVWRLSALSEAGGWKDRTTVEDMDLAVRASLKGWKFVFLGD  308

Query  84   LEVKNELPSTFKAYRFQQHRWSCGPANL  1
            ++VKNELPST KAYR+QQHRWSCGPANL
Sbjct  309  IKVKNELPSTLKAYRYQQHRWSCGPANL  336



>ref|XP_007010197.1| Nucleotide-diphospho-sugar transferases superfamily protein [Theobroma 
cacao]
 gb|EOY19007.1| Nucleotide-diphospho-sugar transferases superfamily protein [Theobroma 
cacao]
Length=535

 Score =   490 bits (1262),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 218/308 (71%), Positives = 268/308 (87%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W   + P++VP+LK  +  C+ MS+MLF+ER+YM IVIV VK FGRK    YKL+ +K+D
Sbjct  31   WQQTKAPLIVPVLKGMVVLCLAMSIMLFVERVYMGIVIVFVKLFGRKPEKMYKLEPMKDD  90

Query  741  LEQNQN-YPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            +E   + YP VLVQ+PM+NEKEVY+LSIGA CG +WP+DR+I+Q+LDDST+  ++ LVE 
Sbjct  91   VELGYSAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPADRIIIQVLDDSTDPAIKTLVEL  150

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC+ W  +G+NVKYE R+NRNGYKAGAL+EG+K  YV+ C++VAIFDADFQP+ DFLWRT
Sbjct  151  ECQRWASKGINVKYEIRDNRNGYKAGALKEGMKHSYVNQCDYVAIFDADFQPEPDFLWRT  210

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            IP+L+ NPE+ALVQARWKFVN+DEC+MTR+QEMSLDYHF VEQEVGSST +FFGFNGTAG
Sbjct  211  IPFLVSNPEIALVQARWKFVNSDECLMTRMQEMSLDYHFIVEQEVGSSTHAFFGFNGTAG  270

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKF+Y+GDL+VKNELPSTFKAYR+QQHR
Sbjct  271  VWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFVYVGDLKVKNELPSTFKAYRYQQHR  330

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  331  WSCGPANL  338



>ref|XP_004494136.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cicer 
arietinum]
Length=533

 Score =   490 bits (1262),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 216/308 (70%), Positives = 270/308 (88%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W  I+ P++VP+L++A+  C++MSVM+F+ER+YM IVI +VK FG+K   RYK + +K+D
Sbjct  29   WSQIKAPLIVPLLRLAVFLCLIMSVMMFIERVYMGIVITLVKLFGKKPEKRYKWEPIKDD  88

Query  741  LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            +E  N  YP VLVQ+PM+NE+EVY+LSIGA CG +WPSDR+IVQ+LDDST+  +++LV+ 
Sbjct  89   IELGNSCYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIIVQVLDDSTDPTIKELVQL  148

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC+ W  +GVN+KYE R+NRNGYKAGAL+EG+K  YV  C+ VAIFDADFQP+ DFLWR+
Sbjct  149  ECQRWASKGVNIKYEVRDNRNGYKAGALKEGMKHSYVKQCDLVAIFDADFQPEPDFLWRS  208

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            +P+L+ NPEL L+QARWKFVNADEC+MTR+QEMSLDYHFTVEQEVGSST +FFGFNGTAG
Sbjct  209  VPFLVHNPELGLIQARWKFVNADECMMTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAG  268

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKFLY+ +L+VKNELPSTFKAYR+QQHR
Sbjct  269  VWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLSNLKVKNELPSTFKAYRYQQHR  328

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  329  WSCGPANL  336



>ref|XP_009771587.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Nicotiana 
sylvestris]
Length=533

 Score =   490 bits (1262),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 222/314 (71%), Positives = 269/314 (86%), Gaps = 1/314 (0%)
 Frame = -1

Query  939  ESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKL  760
            E     W+ I+ P++VP+L+IA+  C+ MSVMLF+ER+YM IVI +VK FGRK   RYK 
Sbjct  23   EQFAIMWEQIKAPLIVPLLRIAVLLCLAMSVMLFIERVYMFIVISLVKLFGRKPEKRYKW  82

Query  759  DALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNL  583
            + +K+D+E  N +YP VLVQ+PM+NEKEVY+LSIGA CG +WPSDR+IVQILDDST+   
Sbjct  83   EPIKDDVELGNSSYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRIIVQILDDSTDPIT  142

Query  582  RKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDH  403
            + LVE EC+ W  +G+N+KYE R+NR+GYKAGAL++GLK  YV  C+FVAIFDADFQP+ 
Sbjct  143  KNLVEMECQRWASKGINIKYEVRDNRSGYKAGALKQGLKHSYVKQCDFVAIFDADFQPEP  202

Query  402  DFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFG  223
            DFLWRTIP+L+ NPEL+LVQARWK+VNADEC+MTR+QEMSLDYHFTVEQEVGS+T +FFG
Sbjct  203  DFLWRTIPFLVHNPELSLVQARWKYVNADECLMTRMQEMSLDYHFTVEQEVGSATHAFFG  262

Query  222  FNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAY  43
            FNGTAGVWR+ A+ +AGGWKDRTTVEDMDLAVRASL+GWKFLY+  L VKNELPSTFKAY
Sbjct  263  FNGTAGVWRIAAIDEAGGWKDRTTVEDMDLAVRASLKGWKFLYLSSLMVKNELPSTFKAY  322

Query  42   RFQQHRWSCGPANL  1
            R+QQHRWSCGPANL
Sbjct  323  RYQQHRWSCGPANL  336



>ref|XP_010694523.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Beta 
vulgaris subsp. vulgaris]
Length=526

 Score =   489 bits (1259),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 218/308 (71%), Positives = 268/308 (87%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W   + P+LVP+LK+ ++ C+ MS+MLF+ER+YM  VI++VK FGRK   +Y  + LK+D
Sbjct  22   WVQAKAPLLVPLLKLFVTLCLGMSIMLFVERVYMGFVILLVKIFGRKPEKKYNWEPLKDD  81

Query  741  LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            LE  N  YP VLVQ+PM+NEKEVY+LSIGA CG +WPSDR++VQ+LDDST+   + LVE 
Sbjct  82   LEIGNSTYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRIVVQVLDDSTDPVTKNLVEM  141

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC  W  +G+N+KYE R+NRNGYKAGAL+EG+K  YV +C+FVAIFDADFQP+ DFLWRT
Sbjct  142  ECHRWASKGINIKYEIRDNRNGYKAGALKEGMKHSYVKECDFVAIFDADFQPEPDFLWRT  201

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            IP+L+ NP++ALVQARWKFVNADEC+MTR+QEMSLDYHFTVEQEVGSST +FFGFNGTAG
Sbjct  202  IPFLVHNPQIALVQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAG  261

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ A+++AGGWKDRTTVEDMDLAVRASL+GWKF+Y+G+L+VKNELPSTFKAYR+QQHR
Sbjct  262  VWRISAINEAGGWKDRTTVEDMDLAVRASLKGWKFVYVGELKVKNELPSTFKAYRYQQHR  321

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  322  WSCGPANL  329



>ref|XP_004249461.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Solanum 
lycopersicum]
Length=533

 Score =   489 bits (1258),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 219/308 (71%), Positives = 269/308 (87%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W+ I+ P++VP+L+IA+  C++MS++LF+ER+YM IVI +VK FGRK   RYK ++LK+D
Sbjct  29   WEQIKAPLIVPLLRIAVFLCLLMSILLFIERVYMGIVITLVKMFGRKPDKRYKWESLKDD  88

Query  741  LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            +E  N  YP VLVQ+PM+NEKEVY+LSIGA CG +WPSDR+I+Q+LDDST+  ++ LV  
Sbjct  89   VEIGNSCYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRIIIQVLDDSTDPIIKNLVSM  148

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC+ W  +G+++KYE R+NRNGYKAGAL+EGLK  YV  C++VAIFDADFQP+ DFLWRT
Sbjct  149  ECQRWASKGIDIKYEIRDNRNGYKAGALKEGLKHPYVKQCDYVAIFDADFQPEPDFLWRT  208

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            IP+L+ NP+L LVQARWKFVNADEC+MTR+QEMSLDYHFTVEQEVGSST +FFGFNGTAG
Sbjct  209  IPFLVHNPQLGLVQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAG  268

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ AL +AGGWKDRTTVEDMDLAVRASL+GWKFLY+  L+VKNELPSTFKAYR+QQHR
Sbjct  269  VWRIAALEEAGGWKDRTTVEDMDLAVRASLKGWKFLYLSALKVKNELPSTFKAYRYQQHR  328

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  329  WSCGPANL  336



>ref|XP_008241312.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Prunus mume]
Length=534

 Score =   489 bits (1258),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 216/308 (70%), Positives = 270/308 (88%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W  IR P++VP+L+I +  C++MSVMLF+ER+YMAIVIV++K FGRK   RY  + +K+D
Sbjct  29   WSKIRAPLIVPLLRITIVLCLIMSVMLFIERLYMAIVIVLIKLFGRKPDKRYNWEPMKDD  88

Query  741  LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            +E  N  YP VLVQ+PM+NE+EVY+LSIGA CG +WPSDR+I+Q+LDDST+  ++ +VE 
Sbjct  89   VELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIIIQVLDDSTDSTVKDMVEL  148

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC+ W  +G+N+KYE R+NRNGYKAGAL+EGLK+ YV  C++VAIFDADFQP+ DFL RT
Sbjct  149  ECQRWASKGINIKYEIRDNRNGYKAGALKEGLKRSYVKHCDYVAIFDADFQPESDFLCRT  208

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            IP+L+ NPELALVQ RWKFVN++EC+MTR+QEMSLDYHFTVEQEVGSST +FFGFNGTAG
Sbjct  209  IPFLVHNPELALVQTRWKFVNSNECLMTRMQEMSLDYHFTVEQEVGSSTHAFFGFNGTAG  268

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ A+++AGGWKDRTTVEDMDLAVRASL+GWKF+Y+G ++VKNELPSTFKAYR+QQHR
Sbjct  269  VWRIAAINEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGSIKVKNELPSTFKAYRYQQHR  328

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  329  WSCGPANL  336



>gb|KEH24115.1| cellulose synthase-like protein A1 [Medicago truncatula]
Length=531

 Score =   488 bits (1256),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 213/308 (69%), Positives = 270/308 (88%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W  I+ P++VP+L+I++  C++MSVM+F+ER+YM +VI +VK FGRK   RYK + +K+D
Sbjct  28   WSQIKAPLIVPLLRISVFLCLIMSVMMFIERVYMGVVITLVKLFGRKPEKRYKWEPIKDD  87

Query  741  LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            +E  N  YP VLVQ+PM+NE+EVY+LSIGA CG +WPSDR+I+Q+LDDST+  +++LV+ 
Sbjct  88   IELGNSCYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIIIQVLDDSTDPTIKELVQL  147

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC+ W  +GVN+KYE R+NRNGYKAGAL+EG+K  YV  C+ VAIFDADFQP+ DFLWRT
Sbjct  148  ECQRWASKGVNIKYEVRDNRNGYKAGALKEGMKHSYVKQCDHVAIFDADFQPEPDFLWRT  207

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            +P+++ NPE+ L+QARWKFVN+DEC+MTR+QEMSLDYHFTVEQEVGSST +FFGFNGTAG
Sbjct  208  VPFMVHNPEIGLIQARWKFVNSDECMMTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAG  267

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKFLY+ +L+VKNELPSTFKAYR+QQHR
Sbjct  268  VWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLSNLKVKNELPSTFKAYRYQQHR  327

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  328  WSCGPANL  335



>ref|XP_007145259.1| hypothetical protein PHAVU_007G223800g [Phaseolus vulgaris]
 gb|ESW17253.1| hypothetical protein PHAVU_007G223800g [Phaseolus vulgaris]
Length=523

 Score =   487 bits (1254),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 216/308 (70%), Positives = 270/308 (88%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W  ++ P++VP+L++A+  C+ MS+M+ +ER+YM  VI +VK FGR+   RYK ++LKED
Sbjct  19   WSQVKEPVMVPLLRVAVFVCLGMSIMMLVERVYMGFVICLVKLFGRRPEKRYKWESLKED  78

Query  741  LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            +E  N +YP VLVQVPM+NE+EVY+LSIGA CG +WPSDR+IVQILDDST+ ++++LV+ 
Sbjct  79   VELGNSSYPMVLVQVPMYNEREVYQLSIGAACGLSWPSDRIIVQILDDSTDPSIKELVQM  138

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC  W  +GVN+KYE R+NRNGYKAGAL+EG+K+ YV  C++VAIFDADFQP+ DFLWRT
Sbjct  139  ECSRWASKGVNIKYEVRDNRNGYKAGALKEGMKRSYVKQCDYVAIFDADFQPEPDFLWRT  198

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            +P+L+ NPEL LVQARWKFVNA+EC+MTR+QEMSLDYHFTVEQEVGSST +FFGFNGTAG
Sbjct  199  VPFLVNNPELGLVQARWKFVNANECLMTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAG  258

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKFLY+ +L+VKNELPST KAYR+QQHR
Sbjct  259  VWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLANLKVKNELPSTLKAYRYQQHR  318

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  319  WSCGPANL  326



>gb|KDP45030.1| hypothetical protein JCGZ_01530 [Jatropha curcas]
Length=533

 Score =   488 bits (1255),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 217/312 (70%), Positives = 266/312 (85%), Gaps = 1/312 (0%)
 Frame = -1

Query  933  LKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDA  754
            L   W  ++ PILVP+LK+ ++ C+ MS+MLF+ER+YM +VI  VK  GRK   RYK + 
Sbjct  25   LNLVWQVLKAPILVPVLKLLVTMCLAMSIMLFIERVYMGVVIAFVKLLGRKPSKRYKWEP  84

Query  753  LKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRK  577
            +K+D+E  N +YP VLVQ+PM+NEKEVY+LSIGA CG +WPSDR+I+Q+LDDST+  ++ 
Sbjct  85   MKDDIELGNSSYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRIIIQVLDDSTDPAIKS  144

Query  576  LVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDF  397
            LVE EC+    +G+N+KYE R+NRNGYKAGAL+EG+K  YV  C++VAIFDADFQP+ DF
Sbjct  145  LVEMECQRRASKGINIKYEIRDNRNGYKAGALKEGMKHSYVKQCDYVAIFDADFQPEPDF  204

Query  396  LWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFN  217
            LWR IP+LL NP++ LVQARWKFVNADEC+MTR+QEMSLDYHF VEQEVGSST +FFGFN
Sbjct  205  LWRAIPFLLHNPQIGLVQARWKFVNADECLMTRMQEMSLDYHFKVEQEVGSSTYAFFGFN  264

Query  216  GTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRF  37
            GTAGVWR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKF+YI DL+VKNELPSTFKAYR+
Sbjct  265  GTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFVYIADLKVKNELPSTFKAYRY  324

Query  36   QQHRWSCGPANL  1
            QQHRWSCGPANL
Sbjct  325  QQHRWSCGPANL  336



>ref|XP_003590384.1| Glucomannan 4-beta-mannosyltransferase, partial [Medicago truncatula]
Length=461

 Score =   484 bits (1247),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 218/315 (69%), Positives = 271/315 (86%), Gaps = 3/315 (1%)
 Frame = -1

Query  936  SLKHA--WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYK  763
             L+H   W  IR P++VP+L++A+  C+ MS+M+ +ER+YM IVI  VK FGRK   RYK
Sbjct  12   GLQHEFLWRQIREPLIVPLLRVAVFVCLGMSLMMLVERVYMGIVISYVKLFGRKPEKRYK  71

Query  762  LDALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDN  586
             + +K+D+E  N NYP VLVQVPM+NE+EVY+LSIGA CG +WPSDR+I+QILDDST+  
Sbjct  72   WETIKDDVELGNSNYPMVLVQVPMYNEREVYQLSIGAACGLSWPSDRIIIQILDDSTDPT  131

Query  585  LRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPD  406
            +++LV+ EC+ W  +GVN+KYE R+NRNGYKAGAL+EG+K  YV  C++VAIFDADFQP+
Sbjct  132  IKELVQVECRRWRSKGVNIKYEVRDNRNGYKAGALKEGMKHSYVKQCDYVAIFDADFQPE  191

Query  405  HDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFF  226
             DFLWRTIP+L+ NP++ LVQARWKFVNADEC+MTR+QEMSL+YHFTVEQEVGSS+ +FF
Sbjct  192  PDFLWRTIPFLVNNPDIGLVQARWKFVNADECLMTRMQEMSLNYHFTVEQEVGSSSYAFF  251

Query  225  GFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKA  46
            GFNGTAGVWR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKFLY+ DL+VKNELPST KA
Sbjct  252  GFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLSDLQVKNELPSTLKA  311

Query  45   YRFQQHRWSCGPANL  1
            +R+QQHRWSCGPANL
Sbjct  312  FRYQQHRWSCGPANL  326



>ref|XP_006481909.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Citrus 
sinensis]
Length=533

 Score =   486 bits (1252),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 219/312 (70%), Positives = 269/312 (86%), Gaps = 1/312 (0%)
 Frame = -1

Query  933  LKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDA  754
            L   W  I+ P++VP L IA+  C++MS+ML +ER+YM+IVI+++K  GR   TRYK + 
Sbjct  25   LSLLWGWIKAPLIVPFLNIAVFLCLIMSLMLLIERVYMSIVILLLKLSGRSPETRYKFEP  84

Query  753  LKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRK  577
            +KED+E  N +YP VLVQ+PMFNE+EVY+LSIGA CG +WPSDRLI+Q+LDDST+  ++ 
Sbjct  85   MKEDIELGNSSYPMVLVQIPMFNEREVYQLSIGAACGLSWPSDRLIIQVLDDSTDLTIKD  144

Query  576  LVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDF  397
            +VE EC+ W  +G+N+KYE R+NR GYKAGALREG+K+ YV  C+FV IFDADFQP+ DF
Sbjct  145  MVELECQRWASKGINIKYEVRDNRKGYKAGALREGMKRGYVKSCDFVVIFDADFQPESDF  204

Query  396  LWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFN  217
            L RTIP+L+ NP+LALVQARW+FVNADEC+MTRLQEMSLDYHFTVEQEVGSST +FFGFN
Sbjct  205  LTRTIPFLVHNPQLALVQARWEFVNADECLMTRLQEMSLDYHFTVEQEVGSSTYAFFGFN  264

Query  216  GTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRF  37
            GTAGVWR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKFLY+G ++VKNELPSTFKAYR+
Sbjct  265  GTAGVWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGTVKVKNELPSTFKAYRY  324

Query  36   QQHRWSCGPANL  1
            QQHRWSCGPANL
Sbjct  325  QQHRWSCGPANL  336



>ref|XP_010912224.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X1 [Elaeis guineensis]
Length=533

 Score =   486 bits (1251),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 216/328 (66%), Positives = 274/328 (84%), Gaps = 1/328 (0%)
 Frame = -1

Query  981  VFSEPGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVV  802
            +  E   G      E +   W  I+ P++VP+L++ +  C+ MSVMLF+E++YMA+VIV+
Sbjct  9    ILPEAFQGARDDITEQMGLVWQQIKAPVIVPLLRLTVFLCLAMSVMLFVEKVYMAVVIVI  68

Query  801  VKCFGRKRYTRYKLDALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDR  625
            VK  G++   RY+ + +++DLE  N  YP VL+Q+PM+NEKEVY+LSIGA CG +WPSDR
Sbjct  69   VKLLGKRPEKRYRWEPMRDDLELGNSAYPMVLLQIPMYNEKEVYQLSIGAACGLSWPSDR  128

Query  624  LIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDC  445
            +I+Q+LDDST+  ++ LVE EC+ W  +G+N+KYE R+NRNGYKAGAL+EG+K  YV DC
Sbjct  129  IIIQVLDDSTDPVIKDLVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKHSYVKDC  188

Query  444  EFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFT  265
            ++VAIFDADFQP+ DFL+RTIP+L+ NPELALVQARWKFVN+DEC+MTR+QEMSLDYHFT
Sbjct  189  DYVAIFDADFQPEPDFLFRTIPFLVHNPELALVQARWKFVNSDECLMTRMQEMSLDYHFT  248

Query  264  VEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGD  85
            VEQEVGS T +FFGFNGTAGVWR+ AL +AGGWKDRTTVEDMDLAVRASL+GWKF+++GD
Sbjct  249  VEQEVGSLTYAFFGFNGTAGVWRISALREAGGWKDRTTVEDMDLAVRASLKGWKFVFLGD  308

Query  84   LEVKNELPSTFKAYRFQQHRWSCGPANL  1
            L+VKNELPST KAYR+QQHRWSCGPANL
Sbjct  309  LKVKNELPSTLKAYRYQQHRWSCGPANL  336



>ref|XP_002269110.2| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Vitis vinifera]
 emb|CAN62185.1| hypothetical protein VITISV_019367 [Vitis vinifera]
Length=529

 Score =   485 bits (1248),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 215/308 (70%), Positives = 266/308 (86%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W+  R P++VP+LK+ +  C+ MSVMLF+ER+YM IVI +VK FGRK   RY  + +K+D
Sbjct  25   WEQTREPLMVPLLKLMVVVCLTMSVMLFVERVYMGIVIALVKLFGRKPEQRYNWEPMKDD  84

Query  741  LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            +E  N  YP VLVQ+PM+NEKEVY+LSIGA CG +WPS+R+I+Q+LDDST+  ++ LVE 
Sbjct  85   VELGNSAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSERIIIQVLDDSTDPTIKDLVEM  144

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC+ W  +G+N+KYE R NR+GYKAGAL+EG+K  YV  C++VAIFDADFQP+ DFLWRT
Sbjct  145  ECQRWASKGINIKYEIRGNRHGYKAGALKEGMKHSYVKQCDYVAIFDADFQPEPDFLWRT  204

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            IP+L+ NPE+ LVQARWKFVN+DEC+MTR+QEMSLDYHFTVEQEVGSS+ +FFGFNGTAG
Sbjct  205  IPFLVHNPEIGLVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVGSSSHAFFGFNGTAG  264

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKF+Y+G L+VKNELPSTFKAYR+QQHR
Sbjct  265  VWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFVYVGALKVKNELPSTFKAYRYQQHR  324

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  325  WSCGPANL  332



>ref|XP_006430317.1| hypothetical protein CICLE_v10011455mg [Citrus clementina]
 gb|ESR43557.1| hypothetical protein CICLE_v10011455mg [Citrus clementina]
Length=533

 Score =   485 bits (1248),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 218/312 (70%), Positives = 269/312 (86%), Gaps = 1/312 (0%)
 Frame = -1

Query  933  LKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDA  754
            L   W  I+ P++VP+L IA+  C++MS+ML +ER+YM+IVI+++K  GR   TRYK   
Sbjct  25   LSLLWGWIKAPLIVPLLNIAVFLCLIMSLMLLIERVYMSIVILLLKLSGRSPETRYKFQP  84

Query  753  LKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRK  577
            +KED+E  N +YP VLVQ+PMFNE+EVY+LSIGA CG +WPSDRLI+Q+LDDST+  ++ 
Sbjct  85   MKEDVELGNSSYPMVLVQIPMFNEREVYQLSIGAACGLSWPSDRLIIQVLDDSTDLTIKD  144

Query  576  LVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDF  397
            +VE EC+ W  +G+N+KYE R+NR GYKAGALREG+K+ YV  C+FV IFDADFQP+ DF
Sbjct  145  MVELECQRWASKGINIKYEVRDNRKGYKAGALREGMKRGYVKSCDFVVIFDADFQPESDF  204

Query  396  LWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFN  217
            L RTIP+L+ NP+LALVQARW+FVNADEC+MTRLQEMSLDYHFTVEQEVGSST +FFGFN
Sbjct  205  LTRTIPFLVHNPQLALVQARWEFVNADECLMTRLQEMSLDYHFTVEQEVGSSTHAFFGFN  264

Query  216  GTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRF  37
            GTAGVWR+ A+++AGGWKDRTTVEDMDLAVRASL+GWKFLY+G ++VKNELPSTFKAYR+
Sbjct  265  GTAGVWRIAAVNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGTIKVKNELPSTFKAYRY  324

Query  36   QQHRWSCGPANL  1
            QQHRWSCGPANL
Sbjct  325  QQHRWSCGPANL  336



>ref|XP_010940677.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Elaeis 
guineensis]
Length=533

 Score =   484 bits (1246),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 219/314 (70%), Positives = 274/314 (87%), Gaps = 1/314 (0%)
 Frame = -1

Query  939  ESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKL  760
            E +   W  I+ P++VP+L++A+  C+ MSVMLF+ER+YM +VI++VK FG++   RYK 
Sbjct  23   EQMGLVWQQIKAPVIVPLLRLAVLLCLAMSVMLFVERVYMGVVILIVKLFGKRPEKRYKW  82

Query  759  DALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNL  583
            + +++DLE  N  YP VLVQ+PM+NEKEVY+LSIGA CG +WPSDR+I+Q+LDDST+  +
Sbjct  83   EPMRDDLELGNSAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRIIIQVLDDSTDPVI  142

Query  582  RKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDH  403
            + LVE EC+ W  +G+N+KYE R+NRNGYKAGAL+EG+K  YV DC++VAIFDADFQP+ 
Sbjct  143  KDLVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKHSYVKDCDYVAIFDADFQPEP  202

Query  402  DFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFG  223
            DFLWRTIP+L+ NPELALVQARWKFVN+DEC+MTR+QEMSLDYHFTVEQEVGSST +FFG
Sbjct  203  DFLWRTIPFLVRNPELALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVGSSTYAFFG  262

Query  222  FNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAY  43
            FNGTAGVWR+ A+++AGGWKDRTTVEDMDLAVRASL+GWKFL++GDL+VKNELPST KAY
Sbjct  263  FNGTAGVWRISAINEAGGWKDRTTVEDMDLAVRASLKGWKFLFLGDLKVKNELPSTLKAY  322

Query  42   RFQQHRWSCGPANL  1
            R+QQHRWSCGPANL
Sbjct  323  RYQQHRWSCGPANL  336



>gb|AES60635.2| cellulose synthase-like protein A1 [Medicago truncatula]
Length=523

 Score =   484 bits (1245),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 216/308 (70%), Positives = 268/308 (87%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W  IR P++VP+L++A+  C+ MS+M+ +ER+YM IVI  VK FGRK   RYK + +K+D
Sbjct  19   WRQIREPLIVPLLRVAVFVCLGMSLMMLVERVYMGIVISYVKLFGRKPEKRYKWETIKDD  78

Query  741  LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            +E  N NYP VLVQVPM+NE+EVY+LSIGA CG +WPSDR+I+QILDDST+  +++LV+ 
Sbjct  79   VELGNSNYPMVLVQVPMYNEREVYQLSIGAACGLSWPSDRIIIQILDDSTDPTIKELVQV  138

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC+ W  +GVN+KYE R+NRNGYKAGAL+EG+K  YV  C++VAIFDADFQP+ DFLWRT
Sbjct  139  ECRRWRSKGVNIKYEVRDNRNGYKAGALKEGMKHSYVKQCDYVAIFDADFQPEPDFLWRT  198

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            IP+L+ NP++ LVQARWKFVNADEC+MTR+QEMSL+YHFTVEQEVGSS+ +FFGFNGTAG
Sbjct  199  IPFLVNNPDIGLVQARWKFVNADECLMTRMQEMSLNYHFTVEQEVGSSSYAFFGFNGTAG  258

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKFLY+ DL+VKNELPST KA+R+QQHR
Sbjct  259  VWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLSDLQVKNELPSTLKAFRYQQHR  318

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  319  WSCGPANL  326



>ref|XP_006492171.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Citrus 
sinensis]
Length=526

 Score =   482 bits (1241),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 218/308 (71%), Positives = 270/308 (88%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W   + P++VP+LK+ +  C+ +S+MLF+ER+YM IVIV++K FGRK   RYK +A+K+D
Sbjct  23   WQQTKAPLIVPLLKLLVYLCLALSIMLFVERVYMGIVIVLLKLFGRKPEKRYKWEAIKDD  82

Query  741  LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            +E  N  YP VLVQ+PM+NEKEVY+LSIGA CG +WPSDR+ +Q+LDDST+  ++ LVE 
Sbjct  83   VELGNSAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRITIQVLDDSTDPTIKDLVEL  142

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC+ W  +G+N+KYE R+NRNGYKAGAL+EG+K  YV  C++VAIFDADFQP+ DFLWRT
Sbjct  143  ECQRWASKGINIKYEIRDNRNGYKAGALKEGMKHSYVKQCDYVAIFDADFQPEPDFLWRT  202

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            IP+L+ NP++ALVQARWKFVNADEC+MTR+QEMSLDYHFTVEQEVGSST +FFGFNGTAG
Sbjct  203  IPFLVHNPDIALVQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAG  262

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKF+Y+GDL+VKNELPSTFKAYR+QQHR
Sbjct  263  VWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFVYVGDLKVKNELPSTFKAYRYQQHR  322

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  323  WSCGPANL  330



>ref|XP_006436686.1| hypothetical protein CICLE_v10031284mg [Citrus clementina]
 gb|ESR49926.1| hypothetical protein CICLE_v10031284mg [Citrus clementina]
Length=508

 Score =   481 bits (1239),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 218/308 (71%), Positives = 270/308 (88%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W   + P++VP+LK+ +  C+ +S+MLF+ER+YM IVIV++K FGRK   RYK +A+K+D
Sbjct  5    WQQTKAPLIVPLLKLLVYLCLALSIMLFVERVYMGIVIVLLKLFGRKPEKRYKWEAIKDD  64

Query  741  LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            +E  N  YP VLVQ+PM+NEKEVY+LSIGA CG +WPSDR+ +Q+LDDST+  ++ LVE 
Sbjct  65   VELGNSAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRITIQVLDDSTDPTIKDLVEL  124

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC+ W  +G+N+KYE R+NRNGYKAGAL+EG+K  YV  C++VAIFDADFQP+ DFLWRT
Sbjct  125  ECQRWASKGINIKYEIRDNRNGYKAGALKEGMKHSYVKQCDYVAIFDADFQPEPDFLWRT  184

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            IP+L+ NP++ALVQARWKFVNADEC+MTR+QEMSLDYHFTVEQEVGSST +FFGFNGTAG
Sbjct  185  IPFLVHNPDIALVQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAG  244

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKF+Y+GDL+VKNELPSTFKAYR+QQHR
Sbjct  245  VWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFVYVGDLKVKNELPSTFKAYRYQQHR  304

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  305  WSCGPANL  312



>ref|XP_007203625.1| hypothetical protein PRUPE_ppa004037mg [Prunus persica]
 gb|EMJ04824.1| hypothetical protein PRUPE_ppa004037mg [Prunus persica]
Length=534

 Score =   482 bits (1240),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 212/308 (69%), Positives = 268/308 (87%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W  IR P++VP+L+I +  C++MSVMLF+ER+YM IVIV++K FGRK   RY  + +K+D
Sbjct  29   WSKIRAPLIVPLLRITIVLCLIMSVMLFIERLYMGIVIVLIKLFGRKPDKRYNWEPMKDD  88

Query  741  LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            +E  N  YP VLVQ+PM+NE+EVY+LSI A CG +WPSDR+I+Q+LDDST+  ++ +VE 
Sbjct  89   VELGNSAYPMVLVQIPMYNEREVYQLSIRAACGLSWPSDRIIIQVLDDSTDSTVKDMVEL  148

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC+ W  +G+N+KYE R+NRNGYKAGAL+EG+K+ YV  C++VAIFDADFQP+ DFL RT
Sbjct  149  ECQRWASKGINIKYEIRDNRNGYKAGALKEGMKRSYVKHCDYVAIFDADFQPESDFLCRT  208

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            IP+L+ NPE+ALVQ RWKFVN++EC+MTR+QEMSLDYHFTVEQEVGSST +FFGFNGTAG
Sbjct  209  IPFLVHNPEIALVQTRWKFVNSNECLMTRMQEMSLDYHFTVEQEVGSSTHAFFGFNGTAG  268

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ A+++AGGWKDRTTVEDMDLAVRASL+GWKF+Y+G ++VKNELPSTFKAYR+QQHR
Sbjct  269  VWRIAAINEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGSIKVKNELPSTFKAYRYQQHR  328

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  329  WSCGPANL  336



>ref|XP_006381326.1| hypothetical protein POPTR_0006s11810g [Populus trichocarpa]
 gb|ERP59123.1| hypothetical protein POPTR_0006s11810g [Populus trichocarpa]
Length=532

 Score =   481 bits (1239),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 212/308 (69%), Positives = 269/308 (87%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W  I+ P++VP+L++A++ C++MS+MLF+ER+YM IVIV+VK FGRK   RYK + +K+D
Sbjct  29   WGQIKAPLIVPLLRLAVAICLIMSLMLFIERVYMGIVIVLVKLFGRKPDRRYKWEPMKDD  88

Query  741  LEQ-NQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            +E  N  YP VLVQ+PM+NE+EVY+LSIGA CG +WPSDR+I+Q+LDDST+  ++ +VE 
Sbjct  89   VEAGNSTYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIIIQVLDDSTDPTIKDMVEL  148

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC+ W  +G+N+KYE R++RNGYK+GAL+EG+K+ YV  C++VAIFDADFQP+ DFL RT
Sbjct  149  ECQRWASKGINIKYEVRDSRNGYKSGALKEGMKRSYVKSCDYVAIFDADFQPEPDFLRRT  208

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            IP+L+ NPEL LVQ RWKFVNADEC+MTR+QEMSLDYHFTVEQEVGSST +FFGFNGTAG
Sbjct  209  IPFLVHNPELGLVQTRWKFVNADECLMTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAG  268

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ AL++AGGWKDRTTVEDMDLAVRASL+GW+FLY+  ++VKNELPST KAYR+QQHR
Sbjct  269  VWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWEFLYLSSVKVKNELPSTLKAYRYQQHR  328

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  329  WSCGPANL  336



>ref|XP_002315357.1| 4-mannan synthase family protein [Populus trichocarpa]
 gb|EEF01528.1| 4-mannan synthase family protein [Populus trichocarpa]
Length=530

 Score =   481 bits (1238),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 213/308 (69%), Positives = 267/308 (87%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W  ++ P++VP LK+ +  C+ MS+MLF+ER+YM IVIV VK FG+K    YK + +K+D
Sbjct  26   WQVLKEPLIVPALKLLVVVCLGMSIMLFIERVYMGIVIVFVKLFGKKPNKMYKWEPMKDD  85

Query  741  LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            +E  N  YP VLVQ+PM+NEKEVY+LSIGA CG +WPSDR+I+Q+LDDST+  ++ LVE 
Sbjct  86   IEVGNSAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRIIIQVLDDSTDPAIKSLVEL  145

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC+ W  +G+N+KYE R+NR GYKAGAL+EG+K  YV  C++VAIFDADFQP+ ++LWRT
Sbjct  146  ECQRWASKGINIKYEIRDNRKGYKAGALKEGMKHSYVKQCDYVAIFDADFQPEPNYLWRT  205

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            IP+L+ NPE+ALVQARWKFVN+DEC+MTR+QEMSLDYHFTVEQEVGS+T +FFGFNGTAG
Sbjct  206  IPFLVHNPEIALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVGSATYAFFGFNGTAG  265

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ A+++AGGWKDRTTVEDMDLAVRASL+GWKF+Y+GDL+VKNELPSTFKAYR+QQHR
Sbjct  266  VWRISAVNEAGGWKDRTTVEDMDLAVRASLKGWKFVYVGDLKVKNELPSTFKAYRYQQHR  325

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  326  WSCGPANL  333



>ref|XP_009379774.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Musa 
acuminata subsp. malaccensis]
Length=533

 Score =   481 bits (1238),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 212/309 (69%), Positives = 270/309 (87%), Gaps = 1/309 (0%)
 Frame = -1

Query  924  AWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKE  745
             W  I+ P++VP+L++A+  C++MSVML +E++YMA+VIV+VK  GR+   RYK + +++
Sbjct  28   VWQQIKAPVIVPLLRLAVFLCLVMSVMLVVEKVYMAVVIVLVKLLGRRPEKRYKWEPMRD  87

Query  744  DLEQNQN-YPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVE  568
            DLE   + YP VLVQ+PM+NEKEVY+LSIGA CG +WPSDR+I+Q+LDDST+  ++ LVE
Sbjct  88   DLEVGSSAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRIIIQVLDDSTDPVIKDLVE  147

Query  567  DECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWR  388
             EC+ W  +GV++KYE R+NRNGYKAGAL+EG+K+ YV  C++V IFDADFQP+ DFLWR
Sbjct  148  LECQRWASKGVDIKYEIRDNRNGYKAGALKEGMKRSYVKHCDYVVIFDADFQPEPDFLWR  207

Query  387  TIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTA  208
             IP+L+ NP++ LVQARWKFVN+DEC+MTR+QEMSLDYHFTVEQEVGSST +FFGFNGTA
Sbjct  208  AIPFLIHNPDVGLVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTA  267

Query  207  GVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQH  28
            GVWR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKF+++GDL+VKNELPSTFKAYR+QQH
Sbjct  268  GVWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWKFVFLGDLKVKNELPSTFKAYRYQQH  327

Query  27   RWSCGPANL  1
            RWSCGPANL
Sbjct  328  RWSCGPANL  336



>ref|XP_011018871.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Populus 
euphratica]
Length=532

 Score =   481 bits (1238),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 212/308 (69%), Positives = 269/308 (87%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W  I+ P++VP+L++A++ C++MS+MLF+ER+YM IVIV+VK FGRK   RYK + +K+D
Sbjct  29   WGQIKAPLIVPLLRLAVAICLIMSLMLFIERVYMGIVIVLVKLFGRKPDRRYKWEPMKDD  88

Query  741  LEQ-NQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            +E  N  YP VLVQ+PM+NE+EVY+LSIGA CG +WPSDR+I+Q+LDDST+  ++ +VE 
Sbjct  89   VEAGNSTYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIIIQVLDDSTDPTIKDMVEL  148

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC+ W  +G+N+KYE R++RNGYK+GAL+EG+K+ YV  C++VAIFDADFQP+ DFL RT
Sbjct  149  ECQRWASKGINIKYEIRDSRNGYKSGALKEGMKRSYVKSCDYVAIFDADFQPEPDFLRRT  208

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            IP+L+ NPEL LVQ RWKFVNADEC+MTR+QEMSLDYHFTVEQEVGSST +FFGFNGTAG
Sbjct  209  IPFLVHNPELGLVQTRWKFVNADECLMTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAG  268

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ AL++AGGWKDRTTVEDMDLAVRASL+GW+FLY+  ++VKNELPST KAYR+QQHR
Sbjct  269  VWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWEFLYLSSVKVKNELPSTLKAYRYQQHR  328

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  329  WSCGPANL  336



>ref|XP_009401015.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009401017.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Musa 
acuminata subsp. malaccensis]
Length=533

 Score =   481 bits (1238),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 214/328 (65%), Positives = 273/328 (83%), Gaps = 1/328 (0%)
 Frame = -1

Query  981  VFSEPGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVV  802
            +  E   G      E L   W  I+ P++VP L++++  C+ MSVMLF+E++YMA+VIV+
Sbjct  9    ILPEAFQGARDDITEQLGVVWQQIKAPVIVPPLRLSVLLCLAMSVMLFVEKVYMAVVIVL  68

Query  801  VKCFGRKRYTRYKLDALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDR  625
            VK F R+  TRYK + + +D E  N  YP VLVQ+PM+NEKEVY+LSIGA CG +WPSDR
Sbjct  69   VKLFRRRPETRYKWEPMGDDAELGNAAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDR  128

Query  624  LIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDC  445
            +I+Q+LDDST+  +++LV+ EC+ W  +GVN+KYE R+NRNGYKAGAL+EG+K  YV  C
Sbjct  129  IIIQVLDDSTDPAIKELVQIECRRWASKGVNIKYEIRDNRNGYKAGALKEGMKHNYVKQC  188

Query  444  EFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFT  265
            ++VA+FDADFQP+ DFLWRTIP+L+ NP++ LVQ RWKFVN++EC+MTR+QEMSLDYHFT
Sbjct  189  DYVAVFDADFQPEPDFLWRTIPFLVHNPQIGLVQGRWKFVNSNECLMTRMQEMSLDYHFT  248

Query  264  VEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGD  85
            VEQEVGSST +FFGFNGTAGVWR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKF+++GD
Sbjct  249  VEQEVGSSTYAFFGFNGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWKFIFLGD  308

Query  84   LEVKNELPSTFKAYRFQQHRWSCGPANL  1
            L+VK+ELPST KAYR+QQHRWSCGPANL
Sbjct  309  LKVKSELPSTLKAYRYQQHRWSCGPANL  336



>ref|XP_006341174.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Solanum 
tuberosum]
Length=533

 Score =   481 bits (1237),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 215/314 (68%), Positives = 268/314 (85%), Gaps = 1/314 (0%)
 Frame = -1

Query  939  ESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKL  760
            E     W  I+ P++VP+L+I++  C+ MSVMLF+ER+YM +VI ++K FG K   RYK 
Sbjct  23   EQFGIMWGQIKAPLIVPLLRISVFLCLAMSVMLFIERVYMFVVITLLKVFGTKPEKRYKW  82

Query  759  DALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNL  583
            + LK+D+E  N +YP VLVQ+PM+NEKEVY+LSIGA CG +WPSDR+IVQ+LDDST+   
Sbjct  83   EPLKDDVELGNSSYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRIIVQVLDDSTDPIT  142

Query  582  RKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDH  403
            + LV+ EC+ W  +G+N+KYE R+NR+GYKAGAL+EGLK  YV  C+FVAIFDADFQP+ 
Sbjct  143  KNLVDIECQRWASKGINIKYEVRDNRSGYKAGALKEGLKHSYVKQCDFVAIFDADFQPEP  202

Query  402  DFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFG  223
            DFLW+TIP+L+ NPEL+LVQARWK+VNADEC+MTR+QEMSLDYHF+VEQEVGSST +FFG
Sbjct  203  DFLWQTIPFLVHNPELSLVQARWKYVNADECLMTRMQEMSLDYHFSVEQEVGSSTHAFFG  262

Query  222  FNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAY  43
            FNGTAGVWR+ A+ +AGGWKDRTTVEDMDLAVRASL+GWKFL++G ++VKNELPST KAY
Sbjct  263  FNGTAGVWRIAAIDEAGGWKDRTTVEDMDLAVRASLKGWKFLFLGSVKVKNELPSTLKAY  322

Query  42   RFQQHRWSCGPANL  1
            R+QQHRWSCGPANL
Sbjct  323  RYQQHRWSCGPANL  336



>ref|XP_010325939.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X1 [Solanum lycopersicum]
Length=533

 Score =   481 bits (1237),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 214/314 (68%), Positives = 269/314 (86%), Gaps = 1/314 (0%)
 Frame = -1

Query  939  ESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKL  760
            E     W  I+ P++VP+L+I++  C++MSVMLF+ER+YM +VI ++K FG+K   +YK 
Sbjct  23   EQFGIMWGQIKAPLIVPLLRISVFLCLVMSVMLFVERVYMFVVITLLKVFGKKPQKKYKW  82

Query  759  DALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNL  583
            + LK+D+E  N +YP VLVQ+PM+NEKEVY+LSIGA CG +WPSDR+IVQ+LDDST+   
Sbjct  83   EPLKDDVELANSSYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRIIVQVLDDSTDPIT  142

Query  582  RKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDH  403
            + LVE EC+ W ++G+N+KYE R+NRNGYKAGAL+EGLK  YV  C+FV IFDADFQP+ 
Sbjct  143  KNLVEIECQKWAKKGINIKYEVRDNRNGYKAGALKEGLKHSYVKQCDFVGIFDADFQPEP  202

Query  402  DFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFG  223
            DFLW+TIP+L+ N EL+LVQARWK+VNADEC+MTR+QEMSLDYHF+VEQEVGSST +FFG
Sbjct  203  DFLWQTIPFLVHNHELSLVQARWKYVNADECLMTRMQEMSLDYHFSVEQEVGSSTHAFFG  262

Query  222  FNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAY  43
            FNGTAGVWR+ A+ +AGGWKDRTTVEDMDLAVRASL+GWKFL++G ++VKNELPST KAY
Sbjct  263  FNGTAGVWRIAAIDEAGGWKDRTTVEDMDLAVRASLKGWKFLFLGSVKVKNELPSTLKAY  322

Query  42   RFQQHRWSCGPANL  1
            R+QQHRWSCGPANL
Sbjct  323  RYQQHRWSCGPANL  336



>ref|XP_004497598.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cicer 
arietinum]
Length=523

 Score =   480 bits (1236),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 217/312 (70%), Positives = 266/312 (85%), Gaps = 1/312 (0%)
 Frame = -1

Query  933  LKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDA  754
            L+  W  +R P++VPIL++A+  C+ MS+M+ +ER+YM IVI +VK F RK   +YK ++
Sbjct  15   LEFIWRQVREPLIVPILRVAVFLCLTMSLMMLVERVYMGIVICLVKLFDRKPEKQYKWES  74

Query  753  LKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRK  577
             K+D+E  N NYP VLVQVPM+NE+EVY+LSIGA CG +WPSDR+I+QILDDST+  +++
Sbjct  75   FKDDVELGNSNYPMVLVQVPMYNEREVYQLSIGAACGLSWPSDRIIIQILDDSTDPTIKE  134

Query  576  LVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDF  397
            LVE EC  W  +GVN+KYE R+NRNGYKAGAL+EG+K  YV  C++VAIFDADFQP+ DF
Sbjct  135  LVELECHKWRSKGVNIKYEVRDNRNGYKAGALKEGMKHSYVKQCDYVAIFDADFQPEPDF  194

Query  396  LWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFN  217
            LWRTIP+ + NPE+ LVQARWKFVNADEC+MTR+QEMSLDYHF VEQEVGSST +FFGFN
Sbjct  195  LWRTIPFFVNNPEIGLVQARWKFVNADECLMTRMQEMSLDYHFRVEQEVGSSTYAFFGFN  254

Query  216  GTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRF  37
            GTAGVWR  AL++AGGWKDRTTVEDMDLAVRASL+GWKFLY+ +L+VKNELPST KAYR+
Sbjct  255  GTAGVWRTLALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLSNLKVKNELPSTLKAYRY  314

Query  36   QQHRWSCGPANL  1
            QQHRWSCGPANL
Sbjct  315  QQHRWSCGPANL  326



>gb|KHN45690.1| Glucomannan 4-beta-mannosyltransferase 9 [Glycine soja]
Length=497

 Score =   478 bits (1230),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 211/308 (69%), Positives = 266/308 (86%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W  ++ P++VP+L++++  C+ MS+M+ +ER+YM IVI +VK FGR+   RYK + +K+D
Sbjct  5    WSQVKEPVIVPMLRVSVFLCLAMSLMMLVERVYMGIVICLVKLFGRRPEKRYKWEPMKDD  64

Query  741  LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            +E  N +YP VLVQVPM+NE+EVY+LSIGA CG +WPSDR+I+Q+LDDSTN  +++LV+ 
Sbjct  65   VELGNSSYPMVLVQVPMYNEREVYQLSIGAACGLSWPSDRIIIQVLDDSTNPTIKELVQM  124

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC  W  +GVN+KYE R+NR+GYKAGAL+EG+K+ YV  C++VAIFDADFQPD DFLWRT
Sbjct  125  ECSRWASKGVNIKYEVRDNRDGYKAGALKEGMKRNYVKQCDYVAIFDADFQPDPDFLWRT  184

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            +P+L+ NPELALVQARWKFVNA+EC+MTR+QEMSLDYHFTVEQEVGS T +FFGFNGTAG
Sbjct  185  VPFLVNNPELALVQARWKFVNANECLMTRMQEMSLDYHFTVEQEVGSCTYAFFGFNGTAG  244

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ AL+++GGW  RTTVEDMDLAVRASLRGWKFLY+ +L+VKNELPST  AYRFQQHR
Sbjct  245  VWRISALYESGGWNHRTTVEDMDLAVRASLRGWKFLYLPNLKVKNELPSTLNAYRFQQHR  304

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  305  WSCGPANL  312



>ref|XP_003535285.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Glycine 
max]
Length=511

 Score =   478 bits (1231),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 211/308 (69%), Positives = 266/308 (86%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W  ++ P++VP+L++++  C+ MS+M+ +ER+YM IVI +VK FGR+   RYK + +K+D
Sbjct  19   WSQVKEPVIVPMLRVSVFLCLAMSLMMLVERVYMGIVICLVKLFGRRPEKRYKWEPMKDD  78

Query  741  LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            +E  N +YP VLVQVPM+NE+EVY+LSIGA CG +WPSDR+I+Q+LDDSTN  +++LV+ 
Sbjct  79   VELGNSSYPMVLVQVPMYNEREVYQLSIGAACGLSWPSDRIIIQVLDDSTNPTIKELVQM  138

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC  W  +GVN+KYE R+NR+GYKAGAL+EG+K+ YV  C++VAIFDADFQPD DFLWRT
Sbjct  139  ECSRWASKGVNIKYEVRDNRDGYKAGALKEGMKRNYVKQCDYVAIFDADFQPDPDFLWRT  198

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            +P+L+ NPELALVQARWKFVNA+EC+MTR+QEMSLDYHFTVEQEVGS T +FFGFNGTAG
Sbjct  199  VPFLVNNPELALVQARWKFVNANECLMTRMQEMSLDYHFTVEQEVGSCTYAFFGFNGTAG  258

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ AL+++GGW  RTTVEDMDLAVRASLRGWKFLY+ +L+VKNELPST  AYRFQQHR
Sbjct  259  VWRISALYESGGWNHRTTVEDMDLAVRASLRGWKFLYLPNLKVKNELPSTLNAYRFQQHR  318

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  319  WSCGPANL  326



>gb|KDO40534.1| hypothetical protein CISIN_1g009761mg [Citrus sinensis]
Length=526

 Score =   479 bits (1232),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 216/308 (70%), Positives = 270/308 (88%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W   + P++VP+LK+ +  C+ +S+MLF+ER+YM IVIV++K FGRK   RYK +A+K+D
Sbjct  23   WQQTKAPLIVPLLKLLVYLCLALSIMLFVERVYMGIVIVLLKLFGRKPEKRYKWEAIKDD  82

Query  741  LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            +E  N  YP VLVQ+PM+NEKEVY+LSIGA CG +WPSDR+ +Q+LDDST+  ++ LVE 
Sbjct  83   VELGNSAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRITIQVLDDSTDPTIKDLVEL  142

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC+ W  +G+N+KYE R++RNGYKAGAL+EG+K  YV  C++VAIFDADF+P+ DFLWRT
Sbjct  143  ECQRWASKGINIKYEIRDSRNGYKAGALKEGMKHSYVKQCDYVAIFDADFEPEPDFLWRT  202

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            IP+L+ NP++ALVQARWKFVNADEC+MTR+QEMSLDYHFTVEQEVGSST +FFGFNGTAG
Sbjct  203  IPFLVHNPDIALVQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAG  262

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKF+Y+GDL+VKNELPSTFKAYR+QQHR
Sbjct  263  VWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFVYVGDLKVKNELPSTFKAYRYQQHR  322

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  323  WSCGPANL  330



>ref|XP_004496174.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cicer 
arietinum]
Length=529

 Score =   478 bits (1231),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 217/315 (69%), Positives = 267/315 (85%), Gaps = 1/315 (0%)
 Frame = -1

Query  942  VESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYK  763
            V  +   W+ +RVP++VP+LK+ +  C+ MS+MLF+E++YM IVIV VK FG K    YK
Sbjct  18   VSQMSFIWEQVRVPLIVPMLKVLVFLCLAMSIMLFVEKVYMGIVIVFVKLFGHKPDKHYK  77

Query  762  LDALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDN  586
             + LK+DLE  N  +P VLVQ+PM+NEKEVY+LSIGA CG +WPSDR+I+Q+LDDST+  
Sbjct  78   WEPLKDDLELGNSAFPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRIIIQVLDDSTDPI  137

Query  585  LRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPD  406
            ++ +VE ECK W R+G+N+KYE R NRNGYKAGAL+EG+K  YV  C++VAIFDADFQPD
Sbjct  138  IKNMVEVECKRWGRKGINIKYEIRENRNGYKAGALKEGMKHSYVKLCDYVAIFDADFQPD  197

Query  405  HDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFF  226
             +FL RTIP+L +N ++ALVQARW+FVNADEC+MTR+QEMSLDYHF VEQEVGSST +FF
Sbjct  198  PNFLHRTIPFLDQNQKVALVQARWQFVNADECLMTRMQEMSLDYHFLVEQEVGSSTHAFF  257

Query  225  GFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKA  46
            GFNGTAGVWR+ AL++AGGWKDRTTVEDMDLAVRA LRGWKF+Y+ DL+VKNELPSTFKA
Sbjct  258  GFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRAGLRGWKFVYLSDLKVKNELPSTFKA  317

Query  45   YRFQQHRWSCGPANL  1
            YR+QQHRWSCGPANL
Sbjct  318  YRYQQHRWSCGPANL  332



>ref|XP_009404378.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Musa 
acuminata subsp. malaccensis]
Length=533

 Score =   478 bits (1231),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 210/314 (67%), Positives = 271/314 (86%), Gaps = 1/314 (0%)
 Frame = -1

Query  939  ESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKL  760
            E +   W  I+ P++VP+L++A+  C++MSVML +E+ YMA+VIV+VK FGR+   RY+ 
Sbjct  23   EQMGMVWQQIKAPVMVPLLRLAVFLCLVMSVMLVVEKAYMAVVIVLVKLFGRRPEKRYRW  82

Query  759  DALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNL  583
            + +++DLE  + +YP VLVQ+PM+NEKEVY+LSIGA CG +WPSDR+I+Q+LDDST+  +
Sbjct  83   EPMRDDLELGSSSYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRIIIQVLDDSTDPVI  142

Query  582  RKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDH  403
            + LVE EC+ W  +GVN+KYE R+NR+GYKAGAL+EG+K  YV+ C++VAIFDADFQP+ 
Sbjct  143  KDLVEAECRRWASKGVNIKYEIRDNRSGYKAGALKEGMKHSYVNHCDYVAIFDADFQPEP  202

Query  402  DFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFG  223
            DFL+RT+P+LL NP + LVQARWKFVN+DEC+M R+QEMSLDYHFTVEQEVGSS  +FFG
Sbjct  203  DFLYRTVPFLLHNPAVGLVQARWKFVNSDECLMARMQEMSLDYHFTVEQEVGSSAYAFFG  262

Query  222  FNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAY  43
            FNGTAGVWR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKF+++GDL+VKNELPST +AY
Sbjct  263  FNGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWKFVFLGDLKVKNELPSTLRAY  322

Query  42   RFQQHRWSCGPANL  1
            R+QQHRWSCGPANL
Sbjct  323  RYQQHRWSCGPANL  336



>ref|XP_008462530.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
melo]
Length=359

 Score =   472 bits (1214),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 210/308 (68%), Positives = 267/308 (87%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W+ I+  I+VP+L+ A+  C+ MS+ML +ER+YM IVI +VK F RK   RYK + +++D
Sbjct  31   WEGIKSAIVVPLLRGAVYICLTMSLMLLIERVYMGIVIGLVKLFKRKPEKRYKWEPMEDD  90

Query  741  LEQNQN-YPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            +E   + YP VLVQ+PM+NEKEVY+LSIGA CG +WPSDR+I+Q+LDDST+  +++LVE 
Sbjct  91   IELGSSVYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRIIIQVLDDSTDPIVKELVEK  150

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC+ W  +G+N+KYE R+NRNGYKAGAL+EGLK+ YV  C++V IFDADFQP+ DFL RT
Sbjct  151  ECERWASKGINIKYEIRDNRNGYKAGALKEGLKRSYVKLCDYVVIFDADFQPEPDFLRRT  210

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            +P+L+ NP++ALVQARWKFVNA+EC+MTR+QEMSLDYHFTVEQEVGSST +FFGFNGTAG
Sbjct  211  VPFLIHNPKIALVQARWKFVNANECLMTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAG  270

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKFLY+G+++VKNELPST KA+R+QQHR
Sbjct  271  VWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGNIQVKNELPSTLKAFRYQQHR  330

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  331  WSCGPANL  338



>gb|KHN48194.1| Glucomannan 4-beta-mannosyltransferase 9 [Glycine soja]
Length=511

 Score =   475 bits (1222),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 209/308 (68%), Positives = 265/308 (86%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W  ++ P++VP+L++++  C+ MS+M+ +ER+YM IVI +VK FGR+   RYK + +K+D
Sbjct  19   WSQVKEPVIVPMLRVSVFLCLAMSLMMLVERVYMGIVICLVKLFGRRPEKRYKWEPMKDD  78

Query  741  LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            +E  N +YP VLVQVPM+NE+EVY+LSIGA CG +WPSDR+I+Q+LDDSTN  +++LV+ 
Sbjct  79   VELGNSSYPMVLVQVPMYNEREVYQLSIGAACGLSWPSDRIIIQVLDDSTNPTIKELVQM  138

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC  W  +GVN+KYE R+NR+GYKAGAL+EG+K+ YV  C++VAIFDADFQP+ DFLWRT
Sbjct  139  ECSRWASKGVNIKYEVRDNRDGYKAGALKEGMKRSYVKQCDYVAIFDADFQPEPDFLWRT  198

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            +P+L+ NPEL LVQARWKFVNA+EC+MTR+QEMSLDYHFTVEQEVGS T +FFGFNGTAG
Sbjct  199  VPFLVNNPELGLVQARWKFVNANECLMTRMQEMSLDYHFTVEQEVGSCTYAFFGFNGTAG  258

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ AL+++GGW  RTTVEDMDLAVRASLRGWKFLY+ +L+VKNELPST  AYRFQQHR
Sbjct  259  VWRISALYESGGWNHRTTVEDMDLAVRASLRGWKFLYLPNLKVKNELPSTLNAYRFQQHR  318

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  319  WSCGPANL  326



>ref|XP_010520406.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2 [Tarenaya 
hassleriana]
Length=536

 Score =   476 bits (1224),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 211/328 (64%), Positives = 275/328 (84%), Gaps = 1/328 (0%)
 Frame = -1

Query  981  VFSEPGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVV  802
            V  E  +G+ +     L   W+ ++ P++VP+L++A+  C+ MS+MLF ER+YM +VI++
Sbjct  9    VLPETFDGVKSEITGQLGMIWELVKAPVIVPLLRLAVYLCLAMSLMLFFERLYMGVVIIL  68

Query  801  VKCFGRKRYTRYKLDALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDR  625
            VK F +K   RYK + ++ED E  N N+P VLVQ+PMFNE+EVYKLSIGA CG +WPSDR
Sbjct  69   VKLFWKKPEKRYKFEPIQEDEELGNSNFPVVLVQIPMFNEREVYKLSIGAACGLSWPSDR  128

Query  624  LIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDC  445
            L++Q+LDDST+  ++++VE EC+ W  +G+N++Y+ R NR GYKAGAL+EGLK+ YV   
Sbjct  129  LVIQVLDDSTDPTVKQMVEMECQRWASKGLNIRYQIRENRVGYKAGALKEGLKRSYVKHS  188

Query  444  EFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFT  265
            E+V IFDADFQP+ DFL R+IP+L+ NP++ALVQARW+FVNADEC++TR+QEMSLDYHFT
Sbjct  189  EYVVIFDADFQPEPDFLRRSIPFLVHNPDIALVQARWRFVNADECLLTRMQEMSLDYHFT  248

Query  264  VEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGD  85
            VEQEVGSST +FFGFNGTAG+WR+ A++DAGGWKDRTTVEDMDLAVRASLRGWKFLY+GD
Sbjct  249  VEQEVGSSTHAFFGFNGTAGIWRIAAINDAGGWKDRTTVEDMDLAVRASLRGWKFLYLGD  308

Query  84   LEVKNELPSTFKAYRFQQHRWSCGPANL  1
            L+V++ELPSTF+A+RFQQHRWSCGPANL
Sbjct  309  LQVRSELPSTFRAFRFQQHRWSCGPANL  336



>ref|XP_002269677.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2 [Vitis vinifera]
Length=533

 Score =   475 bits (1222),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 209/308 (68%), Positives = 268/308 (87%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W+ ++ P++VP+L++A+  C+ MS+MLF+ER+YM IVI++VK F +K   RYK + L+ED
Sbjct  29   WELVKAPLIVPLLRVAVYICLTMSLMLFVERLYMGIVIILVKIFWKKPDKRYKWEPLRED  88

Query  741  LEQ-NQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            LE  N N+P V+VQ+PM+NEKEVYKLSIGA CG +WP+DRL++Q+LDDST+  ++ LVE 
Sbjct  89   LESGNSNFPHVVVQIPMYNEKEVYKLSIGAACGLSWPADRLVIQVLDDSTDPAIKNLVET  148

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC+ W  +G+N++Y+ R NR GYKAGALREGLK+ YV  CE+VAIFDADFQP+ D+L R 
Sbjct  149  ECQRWAAKGINIRYQIRENRVGYKAGALREGLKRSYVKHCEYVAIFDADFQPEPDYLKRA  208

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            IP+L+ N ++ALVQ RW+FVNADEC+MTR+QEMSLDYHFTVEQEVGS+T +FFGFNGTAG
Sbjct  209  IPFLVYNSDIALVQGRWRFVNADECLMTRMQEMSLDYHFTVEQEVGSATHAFFGFNGTAG  268

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ A+++AGGWKDRTTVEDMDLAVRASL+GWKF+Y+GDL+VK+ELPSTFKA+RFQQHR
Sbjct  269  VWRIAAINEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGDLQVKSELPSTFKAFRFQQHR  328

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  329  WSCGPANL  336



>ref|XP_003542549.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Glycine 
max]
Length=511

 Score =   474 bits (1220),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 209/308 (68%), Positives = 264/308 (86%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W  ++ P++VP+L++A+  C+ MS+M+ +ER+YM IVI +VK F R+   RYK + +K+D
Sbjct  19   WSQVKEPVIVPMLRVAVFLCLAMSLMMLVERVYMGIVICLVKLFSRRPEKRYKWEPMKDD  78

Query  741  LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            +E  N +YP VLVQVPM+NE+EVY+LSIGA CG +WPSDR+I+Q+LDDSTN  +++LV+ 
Sbjct  79   VELGNSSYPMVLVQVPMYNEREVYQLSIGAACGLSWPSDRIIIQVLDDSTNPTIKELVQM  138

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC  W  +GVN+KYE R+NR+GYKAGAL+EG+K+ YV  C++VAIFDADFQP+ DFLWRT
Sbjct  139  ECSRWASKGVNIKYEVRDNRDGYKAGALKEGMKRSYVKQCDYVAIFDADFQPEPDFLWRT  198

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            +P+L+ NPEL LVQARWKFVNA+EC+MTR+QEMSLDYHFTVEQEVGS T +FFGFNGTAG
Sbjct  199  VPFLVNNPELGLVQARWKFVNANECLMTRMQEMSLDYHFTVEQEVGSCTYAFFGFNGTAG  258

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ AL+++GGW  RTTVEDMDLAVRASLRGWKFLY+ +L+VKNELPST  AYRFQQHR
Sbjct  259  VWRISALYESGGWNHRTTVEDMDLAVRASLRGWKFLYLPNLKVKNELPSTLNAYRFQQHR  318

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  319  WSCGPANL  326



>ref|XP_009603325.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Nicotiana 
tomentosiformis]
Length=530

 Score =   474 bits (1221),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 211/308 (69%), Positives = 263/308 (85%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W  +RVP+LVP L+I +  C+ MS+MLF+ER+YM IVI  +K   RK   +YK + +K+D
Sbjct  24   WQQVRVPLLVPFLRIMVVLCLAMSLMLFVERVYMGIVIAFIKLLRRKPEKKYKWEPVKDD  83

Query  741  LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            LE  N +YP VLVQ+PM+NE+EVY+LSIGA C  +WP+DR+++Q+LDDST+  ++ +VE 
Sbjct  84   LELANYSYPIVLVQIPMYNEREVYQLSIGAACNLSWPADRILIQVLDDSTDPTIKAMVEQ  143

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC+ W  +GVN+KYE R+NR GYKAGAL+EG+K  YV  C++VAIFDADFQPD DFL RT
Sbjct  144  ECRRWTGKGVNIKYEIRDNRKGYKAGALKEGMKHNYVKLCDYVAIFDADFQPDSDFLMRT  203

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            IP+L+ NPE+ LVQARWKFVN+DEC++TR+QEMSLDYHFTVEQEVGS+T +FFGFNGTAG
Sbjct  204  IPFLVHNPEVGLVQARWKFVNSDECLLTRMQEMSLDYHFTVEQEVGSATHAFFGFNGTAG  263

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ AL++AGGWKDRTTVEDMDLAVRA L+GWKF+YIGDL+VKNELPSTFKAYR+QQHR
Sbjct  264  VWRIAALNEAGGWKDRTTVEDMDLAVRAGLKGWKFVYIGDLKVKNELPSTFKAYRYQQHR  323

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  324  WSCGPANL  331



>ref|XP_003571119.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 1 [Brachypodium 
distachyon]
Length=518

 Score =   474 bits (1219),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 211/315 (67%), Positives = 267/315 (85%), Gaps = 3/315 (1%)
 Frame = -1

Query  936  SLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLD  757
             L  AW  +R P++VP+L++A++ C+ MSV+LFLER+YMA+VIV VK  GR+   RYK D
Sbjct  6    GLPEAWSQVRAPVIVPLLRLAVAVCLGMSVLLFLERLYMAVVIVGVKLLGRRPDRRYKCD  65

Query  756  ALKEDLEQ---NQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDN  586
             + ED +    +  +P VLVQ+PMFNE+EVY+LSIGAVCG +WPSDRL+VQ+LDDST+  
Sbjct  66   PISEDDDPELGSAAFPVVLVQIPMFNEREVYQLSIGAVCGLSWPSDRLVVQVLDDSTDAV  125

Query  585  LRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPD  406
            ++++V  EC+ W  +G+N+ Y+ R +R GYKAGAL++G+K  YV +CE+V IFDADFQPD
Sbjct  126  VKEMVRMECERWAHKGINITYQIREDRKGYKAGALKQGMKHGYVRECEYVVIFDADFQPD  185

Query  405  HDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFF  226
             DFL RTIPYL  NPE+ALVQARW+FVNADEC+MTR+QEMSLDYHFTVEQEV SS C+FF
Sbjct  186  PDFLHRTIPYLHHNPEIALVQARWRFVNADECLMTRMQEMSLDYHFTVEQEVSSSVCAFF  245

Query  225  GFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKA  46
            GFNGTAGVWR+ A+++AGGWKDRTTVEDMDLA+RASL+GWKF+Y+GD++VK+ELPSTFKA
Sbjct  246  GFNGTAGVWRISAVNEAGGWKDRTTVEDMDLAIRASLKGWKFVYLGDVQVKSELPSTFKA  305

Query  45   YRFQQHRWSCGPANL  1
            +RFQQHRWSCGPANL
Sbjct  306  FRFQQHRWSCGPANL  320



>ref|XP_004137864.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
sativus]
 ref|XP_004170538.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
sativus]
 gb|KGN59050.1| hypothetical protein Csa_3G748790 [Cucumis sativus]
Length=532

 Score =   474 bits (1219),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 213/327 (65%), Positives = 265/327 (81%), Gaps = 5/327 (2%)
 Frame = -1

Query  978  FSEPGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVV  799
            F  PG+G+       L   WD +R P++ P+L++ M  C  +S+M F+ERIYM +VIV V
Sbjct  14   FPTPGDGIPAL----LLFVWDVVRAPLIAPLLRVIMVICSALSIMQFVERIYMGVVIVAV  69

Query  798  KCFGRKRYTRYKLDALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRL  622
            K   R    RYK + +K+D E  N  YP VL+Q+PMFNEKEVY++SI A CG +WPSDR+
Sbjct  70   KLLRRTPEKRYKWEPIKDDSELGNSAYPMVLIQIPMFNEKEVYQMSIRAACGLSWPSDRM  129

Query  621  IVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCE  442
            I+Q+LDDST   ++ +VE ECK W  +G+++KYE R+NR GYKAGAL+EG+K+ Y  DC+
Sbjct  130  IIQVLDDSTIPAIKNMVELECKKWASKGIDIKYEVRDNRTGYKAGALKEGMKRSYAKDCD  189

Query  441  FVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTV  262
            +V IFDADFQP+ DFL R+IPYL+ NP+LAL+QARW FVN+DEC+MTRLQEMSLDYHFTV
Sbjct  190  YVVIFDADFQPESDFLHRSIPYLIHNPQLALIQARWIFVNSDECMMTRLQEMSLDYHFTV  249

Query  261  EQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDL  82
            EQEVGSST +FFGFNGTAG+WR+ A+ +AGGWKDRTTVEDMDLAVRASL+GWKFLY+GDL
Sbjct  250  EQEVGSSTHAFFGFNGTAGIWRIAAIDEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGDL  309

Query  81   EVKNELPSTFKAYRFQQHRWSCGPANL  1
            +VKNELPSTFKA+RFQQHRWSCGPANL
Sbjct  310  QVKNELPSTFKAFRFQQHRWSCGPANL  336



>ref|XP_006287471.1| hypothetical protein CARUB_v10000683mg [Capsella rubella]
 gb|EOA20369.1| hypothetical protein CARUB_v10000683mg [Capsella rubella]
Length=533

 Score =   473 bits (1218),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 212/328 (65%), Positives = 273/328 (83%), Gaps = 1/328 (0%)
 Frame = -1

Query  981  VFSEPGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVV  802
            V  E  +G+       L   W+ ++ P++VP+L++A+  C++MSVML  ER+YM IVIV+
Sbjct  9    VLPETFDGVRMEITGQLGMIWELVKAPVIVPLLQLAVYICLVMSVMLLCERVYMGIVIVL  68

Query  801  VKCFGRKRYTRYKLDALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDR  625
            VK F +K   RYK D + +D E  + N+P VLVQ+PMFNE+EVYKLSIGA CG +WPSDR
Sbjct  69   VKLFWKKPDKRYKFDPIHDDEELGSSNFPVVLVQIPMFNEREVYKLSIGAACGLSWPSDR  128

Query  624  LIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDC  445
            L++Q+LDDST+  ++++VE EC+ W  +G+N++Y+ R NR GYKAGAL+EGLK+ YV  C
Sbjct  129  LVIQVLDDSTDPTVKQMVEMECQRWASKGINIRYQIRENRVGYKAGALKEGLKRSYVKHC  188

Query  444  EFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFT  265
            E+V IFDADFQP+ DFL R+IP+L+ NP +ALVQARW+FVN+DEC++TR+QEMSLDYHFT
Sbjct  189  EYVVIFDADFQPEPDFLRRSIPFLIHNPNIALVQARWRFVNSDECLLTRMQEMSLDYHFT  248

Query  264  VEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGD  85
            VEQEVGSST +FFGFNGTAG+WR+ A+++AGGWKDRTTVEDMDLAVRASLRGWKFLY+GD
Sbjct  249  VEQEVGSSTHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGD  308

Query  84   LEVKNELPSTFKAYRFQQHRWSCGPANL  1
            L+VK+ELPSTF+A+RFQQHRWSCGPANL
Sbjct  309  LQVKSELPSTFRAFRFQQHRWSCGPANL  336



>ref|XP_002963530.1| glycosyltransferase family 2 protein [Selaginella moellendorffii]
 gb|EFJ35401.1| glycosyltransferase family 2 protein [Selaginella moellendorffii]
Length=528

 Score =   473 bits (1217),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 211/315 (67%), Positives = 264/315 (84%), Gaps = 1/315 (0%)
 Frame = -1

Query  942  VESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYK  763
            ++ +   W  IR P + P L++ ++ C++M +MLF+ER+YMA+V+V+VK  G++   +YK
Sbjct  11   IDQINAMWLQIRAPYIAPALQVGVNICLVMLLMLFVERLYMALVMVLVKLSGKRPENKYK  70

Query  762  LDALKEDLEQ-NQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDN  586
             + +K+DLE  N  YP VLVQVPM+NE+EVY+LSIGA CG +WPSDR+IVQILDDST+  
Sbjct  71   WEPIKDDLESGNSAYPMVLVQVPMYNEREVYQLSIGAACGLSWPSDRIIVQILDDSTDLT  130

Query  585  LRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPD  406
            ++ LVE EC+ W  +GVN+KYE R+NRNGYKAGAL+EG+K+ YV DC++VAIFDADFQP+
Sbjct  131  IKNLVELECQRWASKGVNIKYEIRDNRNGYKAGALKEGMKRSYVKDCDYVAIFDADFQPE  190

Query  405  HDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFF  226
             DFLWRTIPYL+ N ++ LVQARWKFVNADEC+MTR+QEMSL YHFTVEQ VGS+T +FF
Sbjct  191  PDFLWRTIPYLVHNADIGLVQARWKFVNADECMMTRMQEMSLSYHFTVEQSVGSATYAFF  250

Query  225  GFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKA  46
            GFNGTAGVWR+ A+ +AGGW  RTTVEDMDLAVRA LRGWKF+Y+ DL VKNELPSTFKA
Sbjct  251  GFNGTAGVWRIAAISEAGGWNSRTTVEDMDLAVRAGLRGWKFVYLDDLSVKNELPSTFKA  310

Query  45   YRFQQHRWSCGPANL  1
            YR+QQHRWSCGPANL
Sbjct  311  YRYQQHRWSCGPANL  325



>ref|XP_007015963.1| Cellulose synthase-like A02 isoform 3 [Theobroma cacao]
 gb|EOY33582.1| Cellulose synthase-like A02 isoform 3 [Theobroma cacao]
Length=499

 Score =   472 bits (1214),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 204/308 (66%), Positives = 268/308 (87%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W+ I+ P++VP+L++ +  C++MS+MLF+ER+YM IVI++VK F +K   RY  + +++D
Sbjct  29   WELIKAPLIVPLLQLGVYICLIMSLMLFMERVYMGIVIILVKLFWKKPEKRYNFELIQDD  88

Query  741  LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            +E  + N+P VLVQ+PMFNEKEVYK+SIGA CG +WPSDRL++Q+LDDST+  ++ +VE 
Sbjct  89   VELGSSNFPVVLVQIPMFNEKEVYKISIGAACGLSWPSDRLVIQVLDDSTDPAIKLMVEQ  148

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC+ W  +G+N+ Y+ R NR GYKAGAL+EGLK+ YV  CE+VAIFDADF+P+ DFL R+
Sbjct  149  ECQRWASKGINITYQIRENRTGYKAGALKEGLKRSYVKHCEYVAIFDADFRPEPDFLRRS  208

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            IP+L  NP++ALVQARW+FVNADEC++TR+QEMSLDYHFTVEQEVGS+T +FFGFNGTAG
Sbjct  209  IPFLARNPDIALVQARWRFVNADECLLTRMQEMSLDYHFTVEQEVGSATHAFFGFNGTAG  268

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            +WR+ A+++AGGWKDRTTVEDMDLAVR+SLRGWKF+Y+GDL+VK+ELPSTFKA+RFQQHR
Sbjct  269  IWRIAAINEAGGWKDRTTVEDMDLAVRSSLRGWKFVYLGDLQVKSELPSTFKAFRFQQHR  328

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  329  WSCGPANL  336



>gb|EMS67675.1| hypothetical protein TRIUR3_27071 [Triticum urartu]
Length=522

 Score =   473 bits (1216),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 216/326 (66%), Positives = 273/326 (84%), Gaps = 9/326 (3%)
 Frame = -1

Query  969  PGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCF  790
            PG GM      +L  AW  +R P++VP+L+ ++  C+ MS MLF E++YMA+V++ ++  
Sbjct  7    PGTGM------TLSGAWQQVRGPVIVPLLRASVLLCVAMSAMLFTEKVYMAVVVLALRLL  60

Query  789  GR--KRYTRYKLDALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLI  619
            GR  KR +R++     ED E  +  YP VLVQ+PM+NE+EVY+LSIGA CG +WPSDR+I
Sbjct  61   GRRPKRQSRWEPMRDGEDPELGSAAYPMVLVQIPMYNEREVYRLSIGAACGLSWPSDRII  120

Query  618  VQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEF  439
            VQ+LDDST+  +++LV+ EC+ W R+GVN+KYETRNNR GYKAGAL+EG+K  YV DC+ 
Sbjct  121  VQVLDDSTDPVVKELVQVECQRWARKGVNIKYETRNNRCGYKAGALKEGMKHGYVKDCDL  180

Query  438  VAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVE  259
            VAIFDADFQP+ DFL R++P+L+ NP++ALVQARWKFVNADEC+MTR+QEMSLDYHF VE
Sbjct  181  VAIFDADFQPEPDFLSRSVPFLVHNPDIALVQARWKFVNADECLMTRMQEMSLDYHFKVE  240

Query  258  QEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLE  79
            QEVGSST +FFGFNGTAGVWR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKF+Y+GDL+
Sbjct  241  QEVGSSTYAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGDLK  300

Query  78   VKNELPSTFKAYRFQQHRWSCGPANL  1
            VKNELPSTFKA+R+QQHRWSCGPANL
Sbjct  301  VKNELPSTFKAFRYQQHRWSCGPANL  326



>ref|XP_002981551.1| family 2 glycosyltransferase [Selaginella moellendorffii]
 gb|EFJ17366.1| family 2 glycosyltransferase [Selaginella moellendorffii]
Length=529

 Score =   473 bits (1216),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 211/315 (67%), Positives = 264/315 (84%), Gaps = 1/315 (0%)
 Frame = -1

Query  942  VESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYK  763
            ++ +   W  IR P + P L++ ++ C++M +MLF+ER+YMA+V+V+VK  G++   +YK
Sbjct  11   IDQINAMWLQIRAPYIAPALQVGVNICLVMLLMLFVERLYMALVMVLVKLSGKRPENKYK  70

Query  762  LDALKEDLEQ-NQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDN  586
             + +K+DLE  N  YP VLVQVPM+NE+EVY+LSIGA CG +WPSDR+IVQILDDST+  
Sbjct  71   WEPIKDDLESGNSAYPMVLVQVPMYNEREVYQLSIGAACGLSWPSDRIIVQILDDSTDLT  130

Query  585  LRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPD  406
            ++ LVE EC+ W  +GVN+KYE R+NRNGYKAGAL+EG+K+ YV DC++VAIFDADFQP+
Sbjct  131  IKNLVELECQRWASKGVNIKYEIRDNRNGYKAGALKEGMKRSYVKDCDYVAIFDADFQPE  190

Query  405  HDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFF  226
             DFLWRTIPYL+ N ++ LVQARWKFVNADEC+MTR+QEMSL YHFTVEQ VGS+T +FF
Sbjct  191  PDFLWRTIPYLVHNADIGLVQARWKFVNADECMMTRMQEMSLSYHFTVEQSVGSATYAFF  250

Query  225  GFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKA  46
            GFNGTAGVWR+ A+ +AGGW  RTTVEDMDLAVRA LRGWKF+Y+ DL VKNELPSTFKA
Sbjct  251  GFNGTAGVWRIAAISEAGGWNSRTTVEDMDLAVRAGLRGWKFVYLDDLSVKNELPSTFKA  310

Query  45   YRFQQHRWSCGPANL  1
            YR+QQHRWSCGPANL
Sbjct  311  YRYQQHRWSCGPANL  325



>ref|XP_003535494.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X1 [Glycine max]
Length=529

 Score =   473 bits (1216),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 213/320 (67%), Positives = 265/320 (83%), Gaps = 1/320 (0%)
 Frame = -1

Query  957  MYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKR  778
            M+      +   W   R P++VP++K+ +  C+ MS+MLF+ER+YM IVI+ VK F  K 
Sbjct  13   MHYGSASQMGLIWQQARAPLVVPLMKLLVVLCLAMSLMLFVERVYMGIVIIFVKLFRYKP  72

Query  777  YTRYKLDALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDD  601
              +YK + L++DLE  N  YP VLVQ+PM+NEKEVY+LSIGA CG +WPSDR+I+Q+LDD
Sbjct  73   EKKYKWEPLRDDLEFGNSAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRIIIQVLDD  132

Query  600  STNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDA  421
            ST+  ++ +VE EC+ W  +GVN+KYE R NRNGYKAGAL+EG+K  YV+ C++VAIFDA
Sbjct  133  STDPIIKNMVEMECQRWASKGVNIKYEIRKNRNGYKAGALKEGMKHSYVNLCDYVAIFDA  192

Query  420  DFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSS  241
            DFQP+ +FLWRTIP+L  NPE+ALVQARWKFVNADEC+MTR+QEMSLDYHF VEQEVGSS
Sbjct  193  DFQPEPNFLWRTIPFLAHNPEVALVQARWKFVNADECLMTRMQEMSLDYHFLVEQEVGSS  252

Query  240  TCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELP  61
            T +FFGFNGTAGVWR+ AL++AGGWKDRTTVEDMDLAVRA L+G KF+Y+ DL+VK+ELP
Sbjct  253  TYAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRAGLKGGKFVYLSDLKVKSELP  312

Query  60   STFKAYRFQQHRWSCGPANL  1
            STFKAYR+QQHRWSCGPANL
Sbjct  313  STFKAYRYQQHRWSCGPANL  332



>gb|KHN37850.1| Glucomannan 4-beta-mannosyltransferase 9 [Glycine soja]
Length=517

 Score =   472 bits (1215),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 213/320 (67%), Positives = 265/320 (83%), Gaps = 1/320 (0%)
 Frame = -1

Query  957  MYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKR  778
            M+      +   W   R P++VP++K+ +  C+ MS+MLF+ER+YM IVI+ VK F  K 
Sbjct  1    MHYGSASQMGLIWQQARAPLVVPLMKLLVVLCLAMSLMLFVERVYMGIVIIFVKLFRYKP  60

Query  777  YTRYKLDALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDD  601
              +YK + L++DLE  N  YP VLVQ+PM+NEKEVY+LSIGA CG +WPSDR+I+Q+LDD
Sbjct  61   EKKYKWEPLRDDLEFGNSAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRIIIQVLDD  120

Query  600  STNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDA  421
            ST+  ++ +VE EC+ W  +GVN+KYE R NRNGYKAGAL+EG+K  YV+ C++VAIFDA
Sbjct  121  STDPIIKNMVEMECQRWASKGVNIKYEIRKNRNGYKAGALKEGMKHSYVNLCDYVAIFDA  180

Query  420  DFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSS  241
            DFQP+ +FLWRTIP+L  NPE+ALVQARWKFVNADEC+MTR+QEMSLDYHF VEQEVGSS
Sbjct  181  DFQPEPNFLWRTIPFLAHNPEVALVQARWKFVNADECLMTRMQEMSLDYHFLVEQEVGSS  240

Query  240  TCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELP  61
            T +FFGFNGTAGVWR+ AL++AGGWKDRTTVEDMDLAVRA L+G KF+Y+ DL+VK+ELP
Sbjct  241  TYAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRAGLKGGKFVYLSDLKVKSELP  300

Query  60   STFKAYRFQQHRWSCGPANL  1
            STFKAYR+QQHRWSCGPANL
Sbjct  301  STFKAYRYQQHRWSCGPANL  320



>ref|XP_007015962.1| Cellulose synthase-like A02 isoform 2, partial [Theobroma cacao]
 gb|EOY33581.1| Cellulose synthase-like A02 isoform 2, partial [Theobroma cacao]
Length=486

 Score =   471 bits (1211),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 204/308 (66%), Positives = 268/308 (87%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W+ I+ P++VP+L++ +  C++MS+MLF+ER+YM IVI++VK F +K   RY  + +++D
Sbjct  29   WELIKAPLIVPLLQLGVYICLIMSLMLFMERVYMGIVIILVKLFWKKPEKRYNFELIQDD  88

Query  741  LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            +E  + N+P VLVQ+PMFNEKEVYK+SIGA CG +WPSDRL++Q+LDDST+  ++ +VE 
Sbjct  89   VELGSSNFPVVLVQIPMFNEKEVYKISIGAACGLSWPSDRLVIQVLDDSTDPAIKLMVEQ  148

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC+ W  +G+N+ Y+ R NR GYKAGAL+EGLK+ YV  CE+VAIFDADF+P+ DFL R+
Sbjct  149  ECQRWASKGINITYQIRENRTGYKAGALKEGLKRSYVKHCEYVAIFDADFRPEPDFLRRS  208

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            IP+L  NP++ALVQARW+FVNADEC++TR+QEMSLDYHFTVEQEVGS+T +FFGFNGTAG
Sbjct  209  IPFLARNPDIALVQARWRFVNADECLLTRMQEMSLDYHFTVEQEVGSATHAFFGFNGTAG  268

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            +WR+ A+++AGGWKDRTTVEDMDLAVR+SLRGWKF+Y+GDL+VK+ELPSTFKA+RFQQHR
Sbjct  269  IWRIAAINEAGGWKDRTTVEDMDLAVRSSLRGWKFVYLGDLQVKSELPSTFKAFRFQQHR  328

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  329  WSCGPANL  336



>ref|XP_008456578.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
melo]
Length=518

 Score =   472 bits (1214),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 210/308 (68%), Positives = 263/308 (85%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W     P++ P LK+ +S C++MS+MLF ER+YM IVI+ VK F +  +  YK + +++D
Sbjct  14   WHQTTSPLIAPFLKLFVSICLVMSLMLFFERVYMGIVILFVKLFRKNPHKTYKWEPIRDD  73

Query  741  LEQNQ-NYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            LE     YP VLVQ+PM+NEKEVY+LSIGA CG +WP++R+I+Q+LDDST+ +++ LVE 
Sbjct  74   LELAHFAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPTNRIIIQVLDDSTDLSIKDLVEL  133

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            ECK W  +G+N+KYE R+NRNGYKAGAL+EG+K  YV  C++VAIFDADFQP+ DFLWRT
Sbjct  134  ECKRWANKGINIKYEIRDNRNGYKAGALKEGMKHNYVKLCDYVAIFDADFQPEPDFLWRT  193

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            +P+L  NPE+ALVQARWKFVN+DEC+MTR+QEMSLDYHF VEQEVGS+T +FFGFNGTAG
Sbjct  194  VPFLTNNPEIALVQARWKFVNSDECLMTRMQEMSLDYHFKVEQEVGSATYAFFGFNGTAG  253

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKF+Y+GDL+VKNELPSTFKAYR+QQHR
Sbjct  254  VWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWKFVYVGDLKVKNELPSTFKAYRYQQHR  313

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  314  WSCGPANL  321



>ref|NP_197666.1| glucomannan 4-beta-mannosyltransferase 2 [Arabidopsis thaliana]
 sp|Q9FNI7.1|CSLA2_ARATH RecName: Full=Glucomannan 4-beta-mannosyltransferase 2; AltName: 
Full=Cellulose synthase-like protein A2; Short=AtCslA2; 
AltName: Full=Glucomannan synthase; AltName: Full=Mannan synthase 
2 [Arabidopsis thaliana]
 dbj|BAB11680.1| glucosyltransferase-like protein [Arabidopsis thaliana]
 gb|AAL25573.1| AT5g22740/MDJ22_16 [Arabidopsis thaliana]
 gb|AAL24334.1| glucosyltransferase-like protein [Arabidopsis thaliana]
 gb|AAM13292.1| glucosyltransferase-like protein [Arabidopsis thaliana]
 gb|AED93069.1| glucomannan 4-beta-mannosyltransferase 2 [Arabidopsis thaliana]
 gb|AHL38612.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=534

 Score =   473 bits (1216),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 211/328 (64%), Positives = 273/328 (83%), Gaps = 1/328 (0%)
 Frame = -1

Query  981  VFSEPGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVV  802
            V  E  +G+       L   W+ ++ P++VP+L++A+  C++MSVML  ER+YM IVIV+
Sbjct  9    VLPETFDGVRMEITGQLGMIWELVKAPVIVPLLQLAVYICLLMSVMLLCERVYMGIVIVL  68

Query  801  VKCFGRKRYTRYKLDALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDR  625
            VK F +K   RYK + + +D E  + N+P VLVQ+PMFNE+EVYKLSIGA CG +WPSDR
Sbjct  69   VKLFWKKPDKRYKFEPIHDDEELGSSNFPVVLVQIPMFNEREVYKLSIGAACGLSWPSDR  128

Query  624  LIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDC  445
            L++Q+LDDST+  ++++VE EC+ W  +G+N++Y+ R NR GYKAGAL+EGLK+ YV  C
Sbjct  129  LVIQVLDDSTDPTVKQMVEVECQRWASKGINIRYQIRENRVGYKAGALKEGLKRSYVKHC  188

Query  444  EFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFT  265
            E+V IFDADFQP+ DFL R+IP+L+ NP +ALVQARW+FVN+DEC++TR+QEMSLDYHFT
Sbjct  189  EYVVIFDADFQPEPDFLRRSIPFLMHNPNIALVQARWRFVNSDECLLTRMQEMSLDYHFT  248

Query  264  VEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGD  85
            VEQEVGSST +FFGFNGTAG+WR+ A+++AGGWKDRTTVEDMDLAVRASLRGWKFLY+GD
Sbjct  249  VEQEVGSSTHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGD  308

Query  84   LEVKNELPSTFKAYRFQQHRWSCGPANL  1
            L+VK+ELPSTF+A+RFQQHRWSCGPANL
Sbjct  309  LQVKSELPSTFRAFRFQQHRWSCGPANL  336



>ref|XP_002874083.1| hypothetical protein ARALYDRAFT_489123 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50342.1| hypothetical protein ARALYDRAFT_489123 [Arabidopsis lyrata subsp. 
lyrata]
Length=534

 Score =   473 bits (1216),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 211/328 (64%), Positives = 273/328 (83%), Gaps = 1/328 (0%)
 Frame = -1

Query  981  VFSEPGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVV  802
            V  E  +G+       L   W+ ++ P++VP+L++A+  C++MSVML  ER+YM IVIV+
Sbjct  9    VLPETFDGVRMEITGQLGMIWELVKAPVIVPLLQLAVYICLLMSVMLLCERVYMGIVIVL  68

Query  801  VKCFGRKRYTRYKLDALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDR  625
            VK F +K   RYK + + +D E  + N+P VLVQ+PMFNE+EVYKLSIGA CG +WPSDR
Sbjct  69   VKLFWKKPDKRYKFEPIHDDEELGSSNFPVVLVQIPMFNEREVYKLSIGAACGLSWPSDR  128

Query  624  LIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDC  445
            L++Q+LDDST+  ++++VE EC+ W  +G+N++Y+ R NR GYKAGAL+EGLK+ YV  C
Sbjct  129  LVIQVLDDSTDPTVKQMVEMECQRWASKGINIRYQIRENRVGYKAGALKEGLKRSYVKHC  188

Query  444  EFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFT  265
            E+V IFDADFQP+ DFL R+IP+L+ NP +ALVQARW+FVN+DEC++TR+QEMSLDYHFT
Sbjct  189  EYVVIFDADFQPEPDFLRRSIPFLMHNPNIALVQARWRFVNSDECLLTRMQEMSLDYHFT  248

Query  264  VEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGD  85
            VEQEVGSST +FFGFNGTAG+WR+ A+++AGGWKDRTTVEDMDLAVRASLRGWKFLY+GD
Sbjct  249  VEQEVGSSTHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGD  308

Query  84   LEVKNELPSTFKAYRFQQHRWSCGPANL  1
            L+VK+ELPSTF+A+RFQQHRWSCGPANL
Sbjct  309  LQVKSELPSTFRAFRFQQHRWSCGPANL  336



>ref|XP_009421122.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Musa 
acuminata subsp. malaccensis]
Length=533

 Score =   472 bits (1215),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 210/328 (64%), Positives = 271/328 (83%), Gaps = 1/328 (0%)
 Frame = -1

Query  981  VFSEPGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVV  802
            +  E   G      + +   W+ IR P++VP+L++++  C++MSVMLF+E++YMA+VIV+
Sbjct  9    ILPEAFQGTRDDITQQMGIVWEQIRTPVVVPLLRLSVFLCLVMSVMLFVEKVYMAVVIVL  68

Query  801  VKCFGRKRYTRYKLDALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDR  625
            VK F  +  TRYK + + +D E  N  YP VL+Q+PM+NEKEVY+LSIGA CG +WPSDR
Sbjct  69   VKLFRWRPETRYKCEPMGDDPELGNAGYPMVLIQIPMYNEKEVYQLSIGAACGLSWPSDR  128

Query  624  LIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDC  445
            +I+Q+LDDST+  +++LV+ EC+ W  +GVN+KYE R+NRNGYKAGAL+EG+K  YV  C
Sbjct  129  IIIQVLDDSTDPAIKELVQIECQRWASKGVNIKYEIRDNRNGYKAGALKEGMKHSYVKHC  188

Query  444  EFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFT  265
            ++VAIFDADFQP+ DFLWRTIP+L  NP + LVQ RWKFVN+++C+MTR+QEMSLDYHFT
Sbjct  189  DYVAIFDADFQPEPDFLWRTIPFLEHNPRIGLVQGRWKFVNSNDCLMTRMQEMSLDYHFT  248

Query  264  VEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGD  85
            VEQEVGSST +FFGFNGTAGVWR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKF+++GD
Sbjct  249  VEQEVGSSTYAFFGFNGTAGVWRINALNEAGGWKDRTTVEDMDLAVRASLKGWKFIFLGD  308

Query  84   LEVKNELPSTFKAYRFQQHRWSCGPANL  1
            L VK+ELPST  AYR+QQHRWSCGPANL
Sbjct  309  LRVKSELPSTLTAYRYQQHRWSCGPANL  336



>dbj|BAK03076.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=518

 Score =   471 bits (1213),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 210/315 (67%), Positives = 266/315 (84%), Gaps = 3/315 (1%)
 Frame = -1

Query  936  SLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLD  757
             L  AW  +R P++VP+LK+A++ C++MSV+LFLER+YMA+VIV VK  GR+   RYK D
Sbjct  6    GLPDAWSQVRAPVIVPLLKLAVAVCLLMSVLLFLERLYMAVVIVGVKLLGRRPERRYKCD  65

Query  756  ALKEDLEQ---NQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDN  586
             + ED +    +  +P VLVQ+PMFNE+EVY+LSIGAVCG +WPSDRL+VQ+LDDST+  
Sbjct  66   PISEDDDPELGSAAFPVVLVQIPMFNEREVYQLSIGAVCGLSWPSDRLVVQVLDDSTDPL  125

Query  585  LRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPD  406
            ++++V  EC+ W  +G+N+ Y+ R +R GYKAGAL+ G+K  YV +CE++ IFDADFQPD
Sbjct  126  IKEMVRMECERWAHKGINITYQIREDRKGYKAGALKAGMKHGYVRECEYMVIFDADFQPD  185

Query  405  HDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFF  226
             DFL RTIPYL  NPE+ALVQARW+FVNADEC+MTR+QEMSLDYHF VEQEV SS C+FF
Sbjct  186  PDFLHRTIPYLHHNPEIALVQARWRFVNADECLMTRMQEMSLDYHFKVEQEVSSSVCAFF  245

Query  225  GFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKA  46
            GFNGTAGVWR+ A+++AGGWKDRTTVEDMDLA+RASL+GWKF+Y+GD++VK+ELPSTFKA
Sbjct  246  GFNGTAGVWRISAVNEAGGWKDRTTVEDMDLAIRASLKGWKFVYLGDVQVKSELPSTFKA  305

Query  45   YRFQQHRWSCGPANL  1
            +RFQQHRWSCGPANL
Sbjct  306  FRFQQHRWSCGPANL  320



>ref|XP_009390016.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Musa 
acuminata subsp. malaccensis]
Length=533

 Score =   472 bits (1214),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 209/314 (67%), Positives = 268/314 (85%), Gaps = 1/314 (0%)
 Frame = -1

Query  939  ESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKL  760
            E +   W  I+ P++VP+L++A+  C++MSVML +ER+YMA VI +VK  GR+   RYK 
Sbjct  23   EQMGVVWQQIKAPVIVPLLRLAVFVCLVMSVMLVVERVYMAAVIALVKFLGRRPEKRYKW  82

Query  759  DALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNL  583
            + +++DLE  +  YP VLVQ+PM+NEKEVY+LS+GA CG +WP+DR+I+Q+LDDST+   
Sbjct  83   EPIRDDLELGSAAYPMVLVQIPMYNEKEVYQLSVGAACGLSWPADRIIIQVLDDSTDPVT  142

Query  582  RKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDH  403
            + LVE EC  W  +GV++KYE R+NR+GYKAGALR+G+K+ YV+ C++V IFDADFQP+ 
Sbjct  143  KDLVEMECNRWASKGVHIKYERRDNRSGYKAGALRDGMKRGYVEHCDYVVIFDADFQPEP  202

Query  402  DFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFG  223
            DFLWRT+P+L+ NP+LALVQARWKFVN+DEC+MTR+QEMSLDYHF VEQEVGS T +FFG
Sbjct  203  DFLWRTVPFLIHNPDLALVQARWKFVNSDECLMTRIQEMSLDYHFAVEQEVGSFTHAFFG  262

Query  222  FNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAY  43
            FNGTAGVWR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKF+++GDL+VKNELPST KAY
Sbjct  263  FNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFVFLGDLKVKNELPSTLKAY  322

Query  42   RFQQHRWSCGPANL  1
            R+QQHRWSCGPANL
Sbjct  323  RYQQHRWSCGPANL  336



>gb|KHN00923.1| Glucomannan 4-beta-mannosyltransferase 9 [Glycine soja]
Length=517

 Score =   471 bits (1212),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 213/320 (67%), Positives = 265/320 (83%), Gaps = 1/320 (0%)
 Frame = -1

Query  957  MYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKR  778
            M+      +   W   R P++VP++K+ +  C+ MS+MLF+ER+YM IVI+ VK F  K 
Sbjct  1    MHYGSASQMGLIWQQARAPLVVPLMKLLVVLCLAMSLMLFVERVYMGIVIIFVKLFRYKP  60

Query  777  YTRYKLDALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDD  601
              +YK + L++DLE  N  YP VLVQ+PM+NEKEVY+LSIGA CG +WPSDR+I+Q+LDD
Sbjct  61   EKKYKWEPLRDDLEFGNSAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRVIIQVLDD  120

Query  600  STNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDA  421
            ST+  ++ +VE EC+ W  +GVN+KYE R NRNGYKAGAL+EG+K  YV+ C++VAIFDA
Sbjct  121  STDPIIKNMVEVECQRWASKGVNIKYEIRENRNGYKAGALKEGMKHSYVNLCDYVAIFDA  180

Query  420  DFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSS  241
            DFQP+ +FLWRTIP+L  NPE+ALVQARWKFVNADEC+MTR+QEMSLDYHF VEQEVGSS
Sbjct  181  DFQPEPNFLWRTIPFLAYNPEVALVQARWKFVNADECLMTRMQEMSLDYHFLVEQEVGSS  240

Query  240  TCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELP  61
            T +FFGFNGTAGVWR+ AL++AGGWKDRTTVEDMDLAVRA L+G KF+Y+ DL+VK+ELP
Sbjct  241  TYAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRAGLKGGKFVYLSDLKVKSELP  300

Query  60   STFKAYRFQQHRWSCGPANL  1
            STFKAYR+QQHRWSCGPANL
Sbjct  301  STFKAYRYQQHRWSCGPANL  320



>ref|XP_003556282.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoformX1 
[Glycine max]
Length=529

 Score =   471 bits (1213),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 213/320 (67%), Positives = 265/320 (83%), Gaps = 1/320 (0%)
 Frame = -1

Query  957  MYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKR  778
            M+      +   W   R P++VP++K+ +  C+ MS+MLF+ER+YM IVI+ VK F  K 
Sbjct  13   MHYGSASQMGLIWQQARAPLVVPLMKLLVVLCLAMSLMLFVERVYMGIVIIFVKLFRYKP  72

Query  777  YTRYKLDALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDD  601
              +YK + L++DLE  N  YP VLVQ+PM+NEKEVY+LSIGA CG +WPSDR+I+Q+LDD
Sbjct  73   EKKYKWEPLRDDLEFGNSAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRVIIQVLDD  132

Query  600  STNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDA  421
            ST+  ++ +VE EC+ W  +GVN+KYE R NRNGYKAGAL+EG+K  YV+ C++VAIFDA
Sbjct  133  STDPIIKNMVEVECQRWASKGVNIKYEIRENRNGYKAGALKEGMKHSYVNLCDYVAIFDA  192

Query  420  DFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSS  241
            DFQP+ +FLWRTIP+L  NPE+ALVQARWKFVNADEC+MTR+QEMSLDYHF VEQEVGSS
Sbjct  193  DFQPEPNFLWRTIPFLAYNPEVALVQARWKFVNADECLMTRMQEMSLDYHFLVEQEVGSS  252

Query  240  TCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELP  61
            T +FFGFNGTAGVWR+ AL++AGGWKDRTTVEDMDLAVRA L+G KF+Y+ DL+VK+ELP
Sbjct  253  TYAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRAGLKGGKFVYLSDLKVKSELP  312

Query  60   STFKAYRFQQHRWSCGPANL  1
            STFKAYR+QQHRWSCGPANL
Sbjct  313  STFKAYRYQQHRWSCGPANL  332



>ref|XP_008442792.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
melo]
Length=532

 Score =   471 bits (1212),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 212/327 (65%), Positives = 265/327 (81%), Gaps = 5/327 (2%)
 Frame = -1

Query  978  FSEPGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVV  799
            F   G+G+       L   WD +R P++ P+L++ M  C  +S+M F+ERIYM +VIV V
Sbjct  14   FPTAGDGIPAL----LLFVWDVVRAPLIAPLLRVIMVICSALSIMQFVERIYMGVVIVAV  69

Query  798  KCFGRKRYTRYKLDALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRL  622
            K   R    RYK + +K+D E  N  YP VL+Q+PMFNEKEVY++SI A CG +WPSDR+
Sbjct  70   KLLRRTPEKRYKWEPIKDDSELGNSVYPMVLIQIPMFNEKEVYQMSIRAACGLSWPSDRM  129

Query  621  IVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCE  442
            ++Q+LDDST   ++ +VE ECK W  +G+N+KYE R+NR GYKAGAL+EG+K+ Y  DC+
Sbjct  130  VIQVLDDSTIPAIKNMVELECKKWASKGINIKYEVRDNRTGYKAGALKEGMKRSYAKDCD  189

Query  441  FVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTV  262
            +V IFDADFQP+ DFL R+IP+L+ NP+LAL+QARW FVN+DEC+MTRLQEMSLDYHFTV
Sbjct  190  YVVIFDADFQPESDFLHRSIPFLVHNPQLALIQARWIFVNSDECMMTRLQEMSLDYHFTV  249

Query  261  EQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDL  82
            EQEVGSST +FFGFNGTAGVWR+ A+++AGGWKDRTTVEDMDLAVRASL+GWKFLY+GDL
Sbjct  250  EQEVGSSTHAFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGDL  309

Query  81   EVKNELPSTFKAYRFQQHRWSCGPANL  1
            +VKNELPSTFKA+RFQQHRWSCGPANL
Sbjct  310  QVKNELPSTFKAFRFQQHRWSCGPANL  336



>gb|KFK39910.1| hypothetical protein AALP_AA3G305000 [Arabis alpina]
Length=537

 Score =   471 bits (1212),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 211/328 (64%), Positives = 271/328 (83%), Gaps = 1/328 (0%)
 Frame = -1

Query  981  VFSEPGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVV  802
            V  E  +G+       L   W+ ++ P++VP+L+ A+  C++MSVML  ER+YM IVIV+
Sbjct  11   VLPETFDGVRMEITGQLGMIWELVKAPVIVPLLQFAVYLCLIMSVMLLCERVYMGIVIVL  70

Query  801  VKCFGRKRYTRYKLDALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDR  625
            VK F +K   RYK + + +D E  + N+P VLVQ+PMFNE+EVYKLSIGA CG  WPSDR
Sbjct  71   VKLFWKKPNKRYKFEPIHDDEELGSSNFPVVLVQIPMFNEREVYKLSIGAACGLAWPSDR  130

Query  624  LIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDC  445
            L++Q+LDDST+  ++++VE EC+ W  +G+N++Y+ R NR GYKAGAL+EGLK+ YV  C
Sbjct  131  LVIQVLDDSTDPTVKQMVEVECQRWASKGINIRYQIRENRVGYKAGALKEGLKRSYVKHC  190

Query  444  EFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFT  265
            EFV IFDADFQP+ DFL R+IP+L+ NP +ALVQARW+FVN++EC++TR+QEMSLDYHFT
Sbjct  191  EFVVIFDADFQPEPDFLRRSIPFLIHNPNIALVQARWRFVNSNECLLTRMQEMSLDYHFT  250

Query  264  VEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGD  85
            VEQEVGSST +FFGFNGTAG+WR+ A+++AGGWKDRTTVEDMDLAVRASLRGWKFLY+GD
Sbjct  251  VEQEVGSSTHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGD  310

Query  84   LEVKNELPSTFKAYRFQQHRWSCGPANL  1
            L+VK+ELPSTF+A+RFQQHRWSCGPANL
Sbjct  311  LQVKSELPSTFRAFRFQQHRWSCGPANL  338



>ref|XP_008232025.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Prunus 
mume]
Length=517

 Score =   470 bits (1209),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 208/304 (68%), Positives = 264/304 (87%), Gaps = 1/304 (0%)
 Frame = -1

Query  909  RVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKEDLE-Q  733
            + P++VP+LK  +  C+ MSVMLF+E++YM I+I+ +K F R+    +K +A+K+D+E  
Sbjct  17   KAPLIVPLLKFLVVVCLGMSVMLFVEKVYMGIIIIFIKLFRRRPLKHWKWEAIKDDVELG  76

Query  732  NQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVEDECKM  553
            N  YP VLVQ+PM+NE+EVY+LSIGA CG +WPSDR+I+Q+LDDST+  ++ LVE EC+ 
Sbjct  77   NSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIIIQVLDDSTDPTIKDLVELECQR  136

Query  552  WMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRTIPYL  373
            W  +G+N+KYE R+NRNGYKAGAL+EG+K  YV  C++VAIFDADFQP+ DFL+RTIP+L
Sbjct  137  WASKGINIKYEIRDNRNGYKAGALKEGMKHSYVKQCDYVAIFDADFQPEPDFLYRTIPFL  196

Query  372  LENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAGVWRL  193
            + N ++ALVQARWKFVN+DEC+MTR+QEMSLDYHFTVEQEVGS+T +FFGFNGTAGVWR+
Sbjct  197  VHNSDIALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVGSATYAFFGFNGTAGVWRI  256

Query  192  QALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHRWSCG  13
             AL++AGGWKDRTTVEDMDLAVRASLRGWKF+Y+ DL+VKNELPSTFKAYR+QQHRWSCG
Sbjct  257  AALNEAGGWKDRTTVEDMDLAVRASLRGWKFVYLSDLKVKNELPSTFKAYRYQQHRWSCG  316

Query  12   PANL  1
            PANL
Sbjct  317  PANL  320



>gb|AFW66231.1| hypothetical protein ZEAMMB73_021965 [Zea mays]
Length=395

 Score =   465 bits (1197),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 208/316 (66%), Positives = 270/316 (85%), Gaps = 2/316 (1%)
 Frame = -1

Query  942  VESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYK  763
            +++L  AW  +R P++VP+L++A++ C+ MSV+LFLER+YMA+VI  V+    +   RY+
Sbjct  1    MDALPEAWSQVRAPVIVPLLRLAVAVCLTMSVLLFLERVYMAVVISGVRLLRLRPDRRYR  60

Query  762  LDALKEDLEQ--NQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTND  589
             D L ED  +  +  +P VLVQ+PMFNE+EVY+LSIGAVCG +WP+DRL+VQ+LDDST++
Sbjct  61   CDPLPEDDPELGSSAFPVVLVQIPMFNEREVYQLSIGAVCGLSWPADRLVVQVLDDSTDE  120

Query  588  NLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQP  409
             ++++V  EC+ W R+G+N+ Y+ R +R GYKAGALR G++  YV DCE+VAIFDADFQP
Sbjct  121  VIKEMVRMECERWARKGINITYQIREDRKGYKAGALRAGMRHAYVRDCEYVAIFDADFQP  180

Query  408  DHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSF  229
            D D+L RTIPYL+ NPE+ALVQARW+FVNADEC+MTR+QEMSLDYHFTVEQEV SS C+F
Sbjct  181  DPDYLKRTIPYLVHNPEIALVQARWRFVNADECLMTRMQEMSLDYHFTVEQEVSSSVCAF  240

Query  228  FGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFK  49
            FGFNGTAGVWR+ A+++AGGWKDRTTVEDMDLA+RASL+GWKF+Y+GD++VK+ELPSTFK
Sbjct  241  FGFNGTAGVWRISAVNEAGGWKDRTTVEDMDLAIRASLKGWKFVYLGDVQVKSELPSTFK  300

Query  48   AYRFQQHRWSCGPANL  1
            A+RFQQHRWSCGPANL
Sbjct  301  AFRFQQHRWSCGPANL  316



>ref|XP_007220072.1| hypothetical protein PRUPE_ppa024741mg [Prunus persica]
 gb|EMJ21271.1| hypothetical protein PRUPE_ppa024741mg [Prunus persica]
Length=517

 Score =   470 bits (1209),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 208/304 (68%), Positives = 264/304 (87%), Gaps = 1/304 (0%)
 Frame = -1

Query  909  RVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKEDLE-Q  733
            + P++VP+LK  +  C+ MSVMLF+E++YM I+I+ +K F R+    +K +A+K+D+E  
Sbjct  17   KAPLIVPLLKFLVVVCLGMSVMLFVEKVYMGIIIIFIKLFRRRPVKHWKWEAIKDDVELG  76

Query  732  NQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVEDECKM  553
            N  YP VLVQ+PM+NE+EVY+LSIGA CG +WPSDR+I+Q+LDDST+  ++ LVE EC+ 
Sbjct  77   NSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIIIQVLDDSTDPTIKDLVELECQR  136

Query  552  WMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRTIPYL  373
            W  +G+N+KYE R+NRNGYKAGAL+EG+K  YV  C++VAIFDADFQP+ DFL+RTIP+L
Sbjct  137  WASKGINIKYEIRDNRNGYKAGALKEGMKHSYVKQCDYVAIFDADFQPEPDFLYRTIPFL  196

Query  372  LENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAGVWRL  193
            + N ++ALVQARWKFVN+DEC+MTR+QEMSLDYHFTVEQEVGS+T +FFGFNGTAGVWR+
Sbjct  197  VHNSDIALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVGSATYAFFGFNGTAGVWRI  256

Query  192  QALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHRWSCG  13
             AL++AGGWKDRTTVEDMDLAVRASLRGWKF+Y+ DL+VKNELPSTFKAYR+QQHRWSCG
Sbjct  257  AALNEAGGWKDRTTVEDMDLAVRASLRGWKFVYLSDLKVKNELPSTFKAYRYQQHRWSCG  316

Query  12   PANL  1
            PANL
Sbjct  317  PANL  320



>ref|XP_010421063.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Camelina 
sativa]
 ref|XP_010454538.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2 isoform X1 
[Camelina sativa]
Length=533

 Score =   470 bits (1210),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 211/328 (64%), Positives = 272/328 (83%), Gaps = 1/328 (0%)
 Frame = -1

Query  981  VFSEPGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVV  802
            V  E  +G+       L   W+ ++ P++VP+L++A+  C++MSVML  ER+YM IVIV+
Sbjct  9    VLPETFDGVRMEITGQLGMIWELVKAPVIVPLLQLAVYICLVMSVMLLCERVYMGIVIVL  68

Query  801  VKCFGRKRYTRYKLDALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDR  625
            VK F +K   RYK D + +D E  + N+P VLVQ+PMFNE+EVYKLSIGA CG +WPSDR
Sbjct  69   VKLFWKKPDKRYKFDPIHDDEELGSSNFPVVLVQIPMFNEREVYKLSIGAACGLSWPSDR  128

Query  624  LIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDC  445
            L++Q+LDDST+  ++++VE EC+ W  +G+N++Y+ R NR GYKAGAL+EGLK+ YV  C
Sbjct  129  LVIQVLDDSTDPTVKQMVEMECQRWASKGINIRYQIRENRVGYKAGALKEGLKRSYVKHC  188

Query  444  EFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFT  265
            E+V IFDADFQP+ DFL R+IP+L+ N  +ALVQARW+FVN+DEC++TR+QEMSLDYHFT
Sbjct  189  EYVVIFDADFQPEPDFLRRSIPFLMHNSNIALVQARWRFVNSDECLLTRMQEMSLDYHFT  248

Query  264  VEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGD  85
            VEQEVGSST +FFGFNGTAG+WR+ A+++AGGWKDRTTVEDMDLAVRASLRGWKFLY+GD
Sbjct  249  VEQEVGSSTHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGD  308

Query  84   LEVKNELPSTFKAYRFQQHRWSCGPANL  1
            L+VK+ELPSTF+A+RFQQHRWSCGPANL
Sbjct  309  LQVKSELPSTFRAFRFQQHRWSCGPANL  336



>ref|XP_010493365.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Camelina 
sativa]
 ref|XP_010493366.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Camelina 
sativa]
Length=533

 Score =   470 bits (1210),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 211/328 (64%), Positives = 272/328 (83%), Gaps = 1/328 (0%)
 Frame = -1

Query  981  VFSEPGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVV  802
            V  E  +G+       L   W+ ++ P++VP+L++A+  C++MSVML  ER+YM IVIV+
Sbjct  9    VLPETFDGVRMEITGQLGMIWELVKAPVIVPLLQLAVYICLVMSVMLLCERVYMGIVIVL  68

Query  801  VKCFGRKRYTRYKLDALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDR  625
            VK F +K   RYK D + +D E  + N+P VLVQ+PMFNE+EVYKLSIGA CG +WPSDR
Sbjct  69   VKLFWKKPDKRYKFDPIHDDEELGSSNFPVVLVQIPMFNEREVYKLSIGAACGLSWPSDR  128

Query  624  LIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDC  445
            L++Q+LDDST+  ++++VE EC+ W  +G+N++Y+ R NR GYKAGAL+EGLK+ YV  C
Sbjct  129  LVIQVLDDSTDPTVKQMVEMECQRWASKGINIRYQIRENRVGYKAGALKEGLKRSYVKHC  188

Query  444  EFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFT  265
            E+V IFDADFQP+ DFL R+IP+L+ N  +ALVQARW+FVN+DEC++TR+QEMSLDYHFT
Sbjct  189  EYVVIFDADFQPEPDFLRRSIPFLIHNSNIALVQARWRFVNSDECLLTRMQEMSLDYHFT  248

Query  264  VEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGD  85
            VEQEVGSST +FFGFNGTAG+WR+ A+++AGGWKDRTTVEDMDLAVRASLRGWKFLY+GD
Sbjct  249  VEQEVGSSTHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGD  308

Query  84   LEVKNELPSTFKAYRFQQHRWSCGPANL  1
            L+VK+ELPSTF+A+RFQQHRWSCGPANL
Sbjct  309  LQVKSELPSTFRAFRFQQHRWSCGPANL  336



>ref|XP_010454539.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2 isoform X2 
[Camelina sativa]
Length=533

 Score =   470 bits (1210),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 211/328 (64%), Positives = 272/328 (83%), Gaps = 1/328 (0%)
 Frame = -1

Query  981  VFSEPGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVV  802
            V  E  +G+       L   W+ ++ P++VP+L++A+  C++MSVML  ER+YM IVIV+
Sbjct  9    VLPETFDGVRMEITGQLGMIWELVKAPVIVPLLQLAVYICLVMSVMLLCERVYMGIVIVL  68

Query  801  VKCFGRKRYTRYKLDALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDR  625
            VK F +K   RYK D + +D E  + N+P VLVQ+PMFNE+EVYKLSIGA CG +WPSDR
Sbjct  69   VKLFWKKPDKRYKFDPIHDDEELGSSNFPVVLVQIPMFNEREVYKLSIGAACGLSWPSDR  128

Query  624  LIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDC  445
            L++Q+LDDST+  ++++VE EC+ W  +G+N++Y+ R NR GYKAGAL+EGLK+ YV  C
Sbjct  129  LVIQVLDDSTDPTVKQMVEMECQRWASKGINIRYQIRENRVGYKAGALKEGLKRSYVKHC  188

Query  444  EFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFT  265
            E+V IFDADFQP+ DFL R+IP+L+ N  +ALVQARW+FVN+DEC++TR+QEMSLDYHFT
Sbjct  189  EYVVIFDADFQPEPDFLRRSIPFLMHNSNIALVQARWRFVNSDECLLTRMQEMSLDYHFT  248

Query  264  VEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGD  85
            VEQEVGSST +FFGFNGTAG+WR+ A+++AGGWKDRTTVEDMDLAVRASLRGWKFLY+GD
Sbjct  249  VEQEVGSSTHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGD  308

Query  84   LEVKNELPSTFKAYRFQQHRWSCGPANL  1
            L+VK+ELPSTF+A+RFQQHRWSCGPANL
Sbjct  309  LQVKSELPSTFRAFRFQQHRWSCGPANL  336



>ref|XP_007015961.1| Cellulose synthase-like A02 isoform 1 [Theobroma cacao]
 gb|EOY33580.1| Cellulose synthase-like A02 isoform 1 [Theobroma cacao]
Length=537

 Score =   470 bits (1210),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 204/308 (66%), Positives = 268/308 (87%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W+ I+ P++VP+L++ +  C++MS+MLF+ER+YM IVI++VK F +K   RY  + +++D
Sbjct  29   WELIKAPLIVPLLQLGVYICLIMSLMLFMERVYMGIVIILVKLFWKKPEKRYNFELIQDD  88

Query  741  LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            +E  + N+P VLVQ+PMFNEKEVYK+SIGA CG +WPSDRL++Q+LDDST+  ++ +VE 
Sbjct  89   VELGSSNFPVVLVQIPMFNEKEVYKISIGAACGLSWPSDRLVIQVLDDSTDPAIKLMVEQ  148

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC+ W  +G+N+ Y+ R NR GYKAGAL+EGLK+ YV  CE+VAIFDADF+P+ DFL R+
Sbjct  149  ECQRWASKGINITYQIRENRTGYKAGALKEGLKRSYVKHCEYVAIFDADFRPEPDFLRRS  208

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            IP+L  NP++ALVQARW+FVNADEC++TR+QEMSLDYHFTVEQEVGS+T +FFGFNGTAG
Sbjct  209  IPFLARNPDIALVQARWRFVNADECLLTRMQEMSLDYHFTVEQEVGSATHAFFGFNGTAG  268

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            +WR+ A+++AGGWKDRTTVEDMDLAVR+SLRGWKF+Y+GDL+VK+ELPSTFKA+RFQQHR
Sbjct  269  IWRIAAINEAGGWKDRTTVEDMDLAVRSSLRGWKFVYLGDLQVKSELPSTFKAFRFQQHR  328

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  329  WSCGPANL  336



>gb|KHF98868.1| Glucomannan 4-beta-mannosyltransferase 2 -like protein [Gossypium 
arboreum]
Length=537

 Score =   470 bits (1210),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 204/308 (66%), Positives = 268/308 (87%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W+ I+ P++VP+L++ +  C+ MS+MLF+ER+YM IVI++VK F +K   RY  + +++D
Sbjct  29   WELIKTPLIVPLLQLGVYICLAMSLMLFMERVYMGIVIILVKLFWKKPEKRYNFELIQDD  88

Query  741  LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            +E  + N+P VL+Q+PMFNEKEVYK+SIGA CG +WPSDRL++Q+LDDST+  ++ +VE 
Sbjct  89   VELGSSNFPVVLIQIPMFNEKEVYKISIGAACGLSWPSDRLVIQVLDDSTDPAIKLMVEQ  148

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC+ W  +G+N+ Y+ R NR GYKAGAL+EGLK+ YV  CE+VAIFDADF+P+ DFL R+
Sbjct  149  ECQRWASKGINITYQIRENRTGYKAGALKEGLKRSYVKHCEYVAIFDADFRPEPDFLRRS  208

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            IP+L+ NP++ALVQARW+FVNADEC++TR+QEMSLDYHFTVEQEVGS+T +FFGFNGTAG
Sbjct  209  IPFLVNNPDIALVQARWRFVNADECLLTRMQEMSLDYHFTVEQEVGSATHAFFGFNGTAG  268

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            +WR+ A+++AGGWKDRTTVEDMDLAVRASLRGWKF+Y+GDL+VK+ELPSTFKA+RFQQHR
Sbjct  269  IWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFVYLGDLQVKSELPSTFKAFRFQQHR  328

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  329  WSCGPANL  336



>ref|XP_010278246.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Nelumbo 
nucifera]
Length=527

 Score =   470 bits (1209),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 210/312 (67%), Positives = 260/312 (83%), Gaps = 1/312 (0%)
 Frame = -1

Query  933  LKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDA  754
            L   W  I+ P++VP+LK+A+  C++ +V+LF+ER+YM IVI  VK FGRK   RYK + 
Sbjct  23   LGFIWQQIKTPLIVPLLKLAVGLCLVFAVLLFMERVYMGIVITYVKWFGRKPEKRYKWEP  82

Query  753  LKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRK  577
            +K+D E  N  YP VLVQ+PM+NEKEVY+LSIGA CG +WPSDR+I+Q+LDDST+  ++ 
Sbjct  83   IKDDPELGNSVYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRIIIQVLDDSTDPTIKS  142

Query  576  LVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDF  397
            +VE EC  W  +G+N+KYE R NR GYKAGAL+EGLK+ Y   C++V IFDADFQP+ DF
Sbjct  143  MVELECHRWASKGINIKYEIRENRVGYKAGALKEGLKRSYSKQCDYVVIFDADFQPEPDF  202

Query  396  LWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFN  217
            LWR+IP+L+ NP++ALVQARW FVNADEC+MTR+QEMSLDYHFTVEQEVGSST +FFGFN
Sbjct  203  LWRSIPFLVHNPDIALVQARWVFVNADECMMTRMQEMSLDYHFTVEQEVGSSTYAFFGFN  262

Query  216  GTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRF  37
            GTAG+WR+ A+  AGGWKDRTTVEDMDLAVRASL+GWKFLY+GDL+VK+ELPSTF A+R 
Sbjct  263  GTAGIWRIAAIEAAGGWKDRTTVEDMDLAVRASLKGWKFLYVGDLQVKSELPSTFNAFRH  322

Query  36   QQHRWSCGPANL  1
            QQ RWSCGPANL
Sbjct  323  QQDRWSCGPANL  334



>ref|XP_008659807.1| PREDICTED: probable mannan synthase 9 [Zea mays]
Length=526

 Score =   469 bits (1207),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 208/309 (67%), Positives = 259/309 (84%), Gaps = 2/309 (1%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKE-  745
            W  ++ P++VP+L+++++ C+ MS MLF E++YMA+V+   +  GR+   RY+   +++ 
Sbjct  25   WQQLKSPVVVPLLRVSVALCLAMSAMLFAEKVYMAVVVAASRLLGRRPERRYRWQPIRDG  84

Query  744  -DLEQNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVE  568
             DLE    YP VLVQ+PMFNE+EVYK+SIGA CG +WPSDR+IVQ+LDDST+  +++LV 
Sbjct  85   DDLEAAAAYPMVLVQIPMFNEREVYKVSIGAACGLSWPSDRIIVQVLDDSTDPVVKELVR  144

Query  567  DECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWR  388
             EC  W  +GVNVKYE R++R GYKAGALREG+K+ Y   C+ VAIFDADFQP+ DFLWR
Sbjct  145  AECWRWASKGVNVKYEVRDSRRGYKAGALREGMKRAYARGCDLVAIFDADFQPEPDFLWR  204

Query  387  TIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTA  208
             +P+LL NP+LALVQARWKFVNADEC+MTR+QEMSLDYHF VEQEVGSST +FFGFNGTA
Sbjct  205  AVPFLLHNPDLALVQARWKFVNADECLMTRMQEMSLDYHFAVEQEVGSSTYAFFGFNGTA  264

Query  207  GVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQH  28
            GVWR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKF+YIGDL VK+ELPST KAYR+QQH
Sbjct  265  GVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFVYIGDLMVKSELPSTLKAYRYQQH  324

Query  27   RWSCGPANL  1
            RWSCGPANL
Sbjct  325  RWSCGPANL  333



>ref|XP_007208459.1| hypothetical protein PRUPE_ppa003918mg [Prunus persica]
 gb|EMJ09658.1| hypothetical protein PRUPE_ppa003918mg [Prunus persica]
Length=516

 Score =   469 bits (1206),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 205/308 (67%), Positives = 267/308 (87%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W+ I+ P++VP+L+I +   + MS+MLF ER+YM IVI++VK F +K   RYK +A++ED
Sbjct  5    WELIKAPLIVPLLRICVYISLAMSLMLFFERLYMGIVIILVKLFWKKPEKRYKYEAIQED  64

Query  741  LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            LE  + N+P VL+Q+PMFNE+EVYK+SIGA CG +WPSDRL++Q+LDDST+  ++++VE 
Sbjct  65   LELGSSNFPVVLIQIPMFNEREVYKISIGAACGLSWPSDRLVIQVLDDSTDPTIKQMVEL  124

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC+ W  +G+N++Y+ R  R GYKAGAL+EGLK+ YV  CE+VAIFDADF+P+ D+L R 
Sbjct  125  ECQRWASKGINIRYQIRETRGGYKAGALKEGLKRSYVKHCEYVAIFDADFRPEPDYLRRA  184

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            IP+L+ NP++ALVQARW+FVN+DEC++TR+QEMSLDYHFTVEQEVGS+T +FFGFNGTAG
Sbjct  185  IPFLVHNPDIALVQARWRFVNSDECLLTRMQEMSLDYHFTVEQEVGSATHAFFGFNGTAG  244

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ A+++AGGWKDRTTVEDMDLAVRASLRGWKFLY+GDL+VK+ELPSTF A+RFQQHR
Sbjct  245  VWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGDLQVKSELPSTFNAFRFQQHR  304

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  305  WSCGPANL  312



>ref|XP_002453460.1| hypothetical protein SORBIDRAFT_04g006260 [Sorghum bicolor]
 gb|EES06436.1| hypothetical protein SORBIDRAFT_04g006260 [Sorghum bicolor]
Length=521

 Score =   469 bits (1206),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 207/313 (66%), Positives = 267/313 (85%), Gaps = 2/313 (1%)
 Frame = -1

Query  933  LKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDA  754
            L  AW  +R P++VP+L++A++ C+ MSV+LFLER+YMAIVI  V+    +   RY+ D 
Sbjct  11   LPEAWSQVRAPVIVPLLRLAVAVCLTMSVLLFLERMYMAIVITGVRLLRFRPDRRYRCDP  70

Query  753  LKEDLEQ--NQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLR  580
            L +D  +  +  +P VLVQ+PMFNE+EVY+LSIGAVCG +WP+DRL+VQ+LDDST++ ++
Sbjct  71   LPDDDPELGSSAFPVVLVQIPMFNEREVYQLSIGAVCGLSWPADRLVVQVLDDSTDEMIK  130

Query  579  KLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHD  400
            ++V  EC+ W R+G+N+ Y+ R++R GYKAGALR G+K  YV +CE+V IFDADFQPD D
Sbjct  131  EMVRLECERWARKGINITYQIRDDRKGYKAGALRAGMKHAYVRECEYVVIFDADFQPDPD  190

Query  399  FLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGF  220
            FL RT+PYL+ NPE+ALVQARW+FVNADEC+MTR+QEMSLDYHFTVEQEV SS C+FFGF
Sbjct  191  FLKRTVPYLVHNPEIALVQARWRFVNADECLMTRMQEMSLDYHFTVEQEVSSSVCAFFGF  250

Query  219  NGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYR  40
            NGTAGVWR+ A+++AGGWKDRTTVEDMDLA+RASL+GWKF+Y+GD++VK+ELPSTFKA+R
Sbjct  251  NGTAGVWRISAINEAGGWKDRTTVEDMDLAIRASLKGWKFVYLGDVQVKSELPSTFKAFR  310

Query  39   FQQHRWSCGPANL  1
            FQQHRWSCGPANL
Sbjct  311  FQQHRWSCGPANL  323



>ref|XP_007208460.1| hypothetical protein PRUPE_ppa003918mg [Prunus persica]
 gb|EMJ09659.1| hypothetical protein PRUPE_ppa003918mg [Prunus persica]
Length=540

 Score =   469 bits (1207),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 205/308 (67%), Positives = 267/308 (87%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W+ I+ P++VP+L+I +   + MS+MLF ER+YM IVI++VK F +K   RYK +A++ED
Sbjct  29   WELIKAPLIVPLLRICVYISLAMSLMLFFERLYMGIVIILVKLFWKKPEKRYKYEAIQED  88

Query  741  LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            LE  + N+P VL+Q+PMFNE+EVYK+SIGA CG +WPSDRL++Q+LDDST+  ++++VE 
Sbjct  89   LELGSSNFPVVLIQIPMFNEREVYKISIGAACGLSWPSDRLVIQVLDDSTDPTIKQMVEL  148

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC+ W  +G+N++Y+ R  R GYKAGAL+EGLK+ YV  CE+VAIFDADF+P+ D+L R 
Sbjct  149  ECQRWASKGINIRYQIRETRGGYKAGALKEGLKRSYVKHCEYVAIFDADFRPEPDYLRRA  208

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            IP+L+ NP++ALVQARW+FVN+DEC++TR+QEMSLDYHFTVEQEVGS+T +FFGFNGTAG
Sbjct  209  IPFLVHNPDIALVQARWRFVNSDECLLTRMQEMSLDYHFTVEQEVGSATHAFFGFNGTAG  268

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ A+++AGGWKDRTTVEDMDLAVRASLRGWKFLY+GDL+VK+ELPSTF A+RFQQHR
Sbjct  269  VWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGDLQVKSELPSTFNAFRFQQHR  328

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  329  WSCGPANL  336



>gb|KHG21024.1| Glucomannan 4-beta-mannosyltransferase 2 -like protein [Gossypium 
arboreum]
 gb|KHG23680.1| Glucomannan 4-beta-mannosyltransferase 2 -like protein [Gossypium 
arboreum]
Length=537

 Score =   469 bits (1207),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 208/308 (68%), Positives = 266/308 (86%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W+ I+ P+LVP+LK+++  C+ M++MLF+ER+YM IVIV+VK F +K   RYK   +++D
Sbjct  29   WELIKAPLLVPMLKLSVYICLGMALMLFMERVYMGIVIVLVKLFWKKPEERYKFVPIEDD  88

Query  741  LEQ-NQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
             E  + N+P VLVQ+PMFNEKEVYK+SIGA CG +WPSDRL++Q+LDDST+  ++ +VE 
Sbjct  89   EEHGSSNFPVVLVQIPMFNEKEVYKISIGAACGLSWPSDRLVIQVLDDSTDSAIKLMVEQ  148

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC+ W  +G+N+ Y+ R NR GYKAGAL+EGLK+ YV  CE+VAI DADF+PD DFL ++
Sbjct  149  ECQRWASKGINITYQIRENRTGYKAGALKEGLKRSYVKHCEYVAIIDADFRPDPDFLRKS  208

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            IP+L  NP++ALVQARW+FVNADEC++TR+QEMSLDYHFTVEQEVGS+T +FFGFNGTAG
Sbjct  209  IPFLDHNPDIALVQARWRFVNADECLLTRMQEMSLDYHFTVEQEVGSATHAFFGFNGTAG  268

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            +WR+ A+++AGGWKDRTTVEDMDLAVRASLRGWKFLY+GDL+VK+ELPSTFKA+RFQQHR
Sbjct  269  IWRIGAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGDLQVKSELPSTFKAFRFQQHR  328

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  329  WSCGPANL  336



>emb|CDX88785.1| BnaA03g08640D [Brassica napus]
Length=510

 Score =   468 bits (1204),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 209/328 (64%), Positives = 274/328 (84%), Gaps = 1/328 (0%)
 Frame = -1

Query  981  VFSEPGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVV  802
            V  E  +G+       L   W+ ++ P++VP+L++A+  C++MSVML  ER+YM IVIV+
Sbjct  9    VLPETFDGVRMEITGQLGMIWELVKAPVIVPLLQLAVYICLLMSVMLLCERVYMGIVIVL  68

Query  801  VKCFGRKRYTRYKLDALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDR  625
            VK F +K   RYK + +++D E  + N+P VLVQ+PMFNE+EVYKLSIGA  G +WPSDR
Sbjct  69   VKLFWKKPDKRYKFEPIQDDEELGSSNFPVVLVQIPMFNEREVYKLSIGAASGLSWPSDR  128

Query  624  LIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDC  445
            L++Q+LDDST+  ++++VE EC+ W  +G+N++Y+ R NR GYKAGAL+EGLK+ YV  C
Sbjct  129  LVIQVLDDSTDPTVKQMVEMECQRWASKGINIRYQIRENRVGYKAGALKEGLKRSYVKHC  188

Query  444  EFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFT  265
            E+V IFDADFQP+ DFL R+IP+L+ NP++ALVQARW+FVN+DEC++TR+QEMSLDYHFT
Sbjct  189  EYVVIFDADFQPEPDFLRRSIPFLVHNPKIALVQARWRFVNSDECLLTRMQEMSLDYHFT  248

Query  264  VEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGD  85
            VEQEVGS+T +FFGFNGTAG+WR+ A+++AGGWKDRTTVEDMDLAVRASLRGWKFLY+GD
Sbjct  249  VEQEVGSATHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGD  308

Query  84   LEVKNELPSTFKAYRFQQHRWSCGPANL  1
            L+VK+ELPSTF+A+RFQQHRWSCGPANL
Sbjct  309  LQVKSELPSTFRAFRFQQHRWSCGPANL  336



>gb|AAQ62570.1| glycosyltransferase 1 [Ipomoea trifida]
 gb|AAS79578.1| putative glycosyltransferase [Ipomoea trifida]
Length=537

 Score =   469 bits (1206),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 209/324 (65%), Positives = 268/324 (83%), Gaps = 5/324 (2%)
 Frame = -1

Query  969  PGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCF  790
            PG  M       ++  +D ++ P++VP+L++A+  C+ MS+MLF+ER+YM IVI++VK F
Sbjct  19   PGGDM----AAQMRLMYDLVKAPLIVPVLRLAVYVCLTMSMMLFVERLYMGIVIILVKIF  74

Query  789  GRKRYTRYKLDALKEDLEQNQN-YPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQ  613
              K   RYK + ++ED E   + +P VL+Q+PMFNEKEVYK+SIGAVC F WPSDRL+VQ
Sbjct  75   CGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQ  134

Query  612  ILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVA  433
            +LDDST+ N++++VE EC  W  +G+N+ Y+TR  R GYKAGAL+EGL   YV DCE+VA
Sbjct  135  VLDDSTDHNIKEMVEKECLRWASKGINITYQTRVTRGGYKAGALKEGLTHDYVQDCEYVA  194

Query  432  IFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQE  253
            IFDADF+P+ DFL R+IP+L+ NPE+AL+QARW+FVNADEC++TR+QEMSLDYHF VEQE
Sbjct  195  IFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQE  254

Query  252  VGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVK  73
            VGSST +FFGFNGT G+WR+ A+++AGGWKDRTTVEDMDLAVRA L+GWKFLY+GDL VK
Sbjct  255  VGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVK  314

Query  72   NELPSTFKAYRFQQHRWSCGPANL  1
            +ELPSTFKA+RFQQHRWSCGPANL
Sbjct  315  SELPSTFKAFRFQQHRWSCGPANL  338



>gb|AAQ62571.1| glycosyltransferase 5, partial [Ipomoea trifida]
Length=508

 Score =   468 bits (1204),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 206/308 (67%), Positives = 263/308 (85%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            +D ++ P++VP+L++A+  C+ MS+MLF+ER+YM IVI++VK F  K   RYK + ++ED
Sbjct  3    YDLVKAPLIVPVLRLAVYVCLTMSMMLFVERLYMGIVIILVKIFCGKPEKRYKWEPMRED  62

Query  741  LEQNQN-YPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
             E   + +P VL+Q+PMFNEKEVYK+SIGAVC F WPSDRL+VQ+LDDST+ N++++VE 
Sbjct  63   YEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTDHNIKEMVEK  122

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC  W  +G+N+ Y+TR  R GYKAGAL+EGL   YV DCE+VAIFDADF+P+ DFL R+
Sbjct  123  ECLRWASKGINITYQTRVTRGGYKAGALKEGLTHDYVQDCEYVAIFDADFRPEPDFLLRS  182

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            IP+L+ NPE+AL+QARW+FVNADEC++TR+QEMSLDYHF VEQEVGSST +FFGFNGT G
Sbjct  183  IPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHAFFGFNGTGG  242

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            +WR+ A+++AGGWKDRTTVEDMDLAVRA L+GWKFLY+GDL VK+ELPSTFKA+RFQQHR
Sbjct  243  IWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTFKAFRFQQHR  302

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  303  WSCGPANL  310



>ref|XP_009760346.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Nicotiana 
sylvestris]
Length=530

 Score =   468 bits (1205),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 208/308 (68%), Positives = 261/308 (85%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W  +R P+LVP L+I +  C+ MS+MLF+ER+YM IVI  +K   RK   +YK + +K+D
Sbjct  24   WQQVRAPLLVPSLRIMVFLCLAMSLMLFVERVYMGIVIAFIKVLRRKPEKKYKWEPVKDD  83

Query  741  LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            LE  N +YP VLVQ+PM+NE+EVY+LSIGA C  +WP+DR++VQ+LDDST+  ++ +VE 
Sbjct  84   LELANYSYPMVLVQIPMYNEREVYQLSIGAACNLSWPADRILVQVLDDSTDLTIKAMVEQ  143

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC+ W  +GVN+KYE R+NR GYKAGAL+EG+K  YV  C++VAIFDADFQPD DFL RT
Sbjct  144  ECRRWAGKGVNIKYEIRDNRKGYKAGALKEGMKHNYVKLCDYVAIFDADFQPDSDFLMRT  203

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            IP+L+ NPE+ LVQ RWKFVN+DEC++TR+QEMSLDYHFTVEQEVGS+T +FFGFNGTAG
Sbjct  204  IPFLVHNPEVGLVQVRWKFVNSDECLLTRMQEMSLDYHFTVEQEVGSATHAFFGFNGTAG  263

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ AL++AGGWKDRTTVEDMDLAVRA L+GWKF+Y+G+L+VKNELPSTFKAYR+QQHR
Sbjct  264  VWRITALNEAGGWKDRTTVEDMDLAVRAGLKGWKFVYVGELKVKNELPSTFKAYRYQQHR  323

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  324  WSCGPANL  331



>gb|AAQ62572.1| glycosyltransferase 10 [Ipomoea trifida]
 dbj|BAF36343.1| hypothetical protein [Ipomoea trifida]
Length=537

 Score =   469 bits (1206),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 209/324 (65%), Positives = 268/324 (83%), Gaps = 5/324 (2%)
 Frame = -1

Query  969  PGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCF  790
            PG  M       ++  +D ++ P++VP+L++A+  C+ MS+MLF+ER+YM IVI++VK F
Sbjct  19   PGGDM----AAQMRLMYDLVKAPLIVPVLRLAVYVCLTMSMMLFVERLYMGIVIILVKIF  74

Query  789  GRKRYTRYKLDALKEDLEQNQN-YPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQ  613
              K   RYK + ++ED E   + +P VL+Q+PMFNEKEVYK+SIGAVC F WPSDRL+VQ
Sbjct  75   CGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQ  134

Query  612  ILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVA  433
            +LDDST+ N++++VE EC  W  +G+N+ Y+TR  R GYKAGAL+EGL   YV DCE+VA
Sbjct  135  VLDDSTDHNIKEMVEKECLRWASKGINITYQTRVTRGGYKAGALKEGLTHDYVQDCEYVA  194

Query  432  IFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQE  253
            IFDADF+P+ DFL R+IP+L+ NPE+AL+QARW+FVNADEC++TR+QEMSLDYHF VEQE
Sbjct  195  IFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQE  254

Query  252  VGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVK  73
            VGSST +FFGFNGT G+WR+ A+++AGGWKDRTTVEDMDLAVRA L+GWKFLY+GDL VK
Sbjct  255  VGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVK  314

Query  72   NELPSTFKAYRFQQHRWSCGPANL  1
            +ELPSTFKA+RFQQHRWSCGPANL
Sbjct  315  SELPSTFKAFRFQQHRWSCGPANL  338



>ref|XP_004497599.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cicer 
arietinum]
Length=524

 Score =   468 bits (1203),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 212/312 (68%), Positives = 264/312 (85%), Gaps = 1/312 (0%)
 Frame = -1

Query  933  LKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDA  754
            L+  W  IR P++VP+L++A+  C+ MS+M+ +E++Y AIVI  VK FGRK    YK ++
Sbjct  23   LELIWKYIRQPLIVPMLRVAVFICLTMSLMMLVEKVYAAIVISWVKLFGRKPEKVYKWES  82

Query  753  LKEDLEQ-NQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRK  577
             ++D+E  + NYP VLVQVPM+NEKEVY+LSIGA CG TWP DR+I+QILDDST+ ++++
Sbjct  83   FEDDVEMGSSNYPMVLVQVPMYNEKEVYQLSIGAACGLTWPCDRIIIQILDDSTDPSIKE  142

Query  576  LVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDF  397
            LVE EC  W  +GVN+KYE R+NRNGYKAGAL+EG+K  YV  C++VAIFDADFQP+ DF
Sbjct  143  LVELECHKWRSKGVNIKYEVRDNRNGYKAGALKEGMKHSYVKQCDYVAIFDADFQPESDF  202

Query  396  LWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFN  217
            L RTIP+L+ NPE+ LVQARW FVNADEC MTR+Q+MSLDYHF VEQEVGSST +FFGFN
Sbjct  203  LLRTIPFLVNNPEIGLVQARWNFVNADECWMTRMQQMSLDYHFKVEQEVGSSTYAFFGFN  262

Query  216  GTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRF  37
            GTAGVWR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKFL++ +++VKNELPST KAYR+
Sbjct  263  GTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLFLSNIQVKNELPSTLKAYRY  322

Query  36   QQHRWSCGPANL  1
            QQHRWSCGPANL
Sbjct  323  QQHRWSCGPANL  334



>ref|XP_009126562.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2 [Brassica 
rapa]
Length=534

 Score =   468 bits (1203),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 209/328 (64%), Positives = 271/328 (83%), Gaps = 1/328 (0%)
 Frame = -1

Query  981  VFSEPGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVV  802
            V  E  +G+       L   W+ ++ P++VP+L++A+  C++MS+ML  ER+YM IVIV+
Sbjct  9    VLPETFDGVKMEITGQLGMIWELVKAPVIVPLLQLAVYICLLMSIMLLCERVYMGIVIVL  68

Query  801  VKCFGRKRYTRYKLDALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDR  625
            VK F +K   RYK + + +D E  + N+P VLVQ+PMFNE+EVYKLSIGA  G +WPSDR
Sbjct  69   VKLFWKKPEKRYKFEPIHDDEELGSSNFPVVLVQIPMFNEREVYKLSIGAASGLSWPSDR  128

Query  624  LIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDC  445
            L++Q+LDDST+  ++++VE EC+ W  +G+N+ Y+ R NR GYKAGAL+EGLK+ YV  C
Sbjct  129  LVIQVLDDSTDPTVKQMVEMECQRWASKGINITYQIRENRVGYKAGALKEGLKRSYVKHC  188

Query  444  EFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFT  265
            E+V IFDADFQP+ DFL R+IP+L+ NP +ALVQARW+FVN+DEC++TR+QEMSLDYHFT
Sbjct  189  EYVVIFDADFQPEPDFLRRSIPFLVHNPNIALVQARWRFVNSDECLLTRMQEMSLDYHFT  248

Query  264  VEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGD  85
            VEQEVGSST +FFGFNGTAG+WR+ A+++AGGWKDRTTVEDMDLAVRASLRGWKFLY+GD
Sbjct  249  VEQEVGSSTHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGD  308

Query  84   LEVKNELPSTFKAYRFQQHRWSCGPANL  1
            L+VK+ELPSTF+A+RFQQHRWSCGPANL
Sbjct  309  LQVKSELPSTFRAFRFQQHRWSCGPANL  336



>ref|XP_002311972.2| 4-mannan synthase family protein [Populus trichocarpa]
 gb|EEE89339.2| 4-mannan synthase family protein [Populus trichocarpa]
Length=530

 Score =   468 bits (1203),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 208/286 (73%), Positives = 253/286 (88%), Gaps = 1/286 (0%)
 Frame = -1

Query  855  MSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKEDLE-QNQNYPKVLVQVPMFNEKE  679
            MS+MLF+ER+YM +VIV VK FG+K   RYK + +K+D+E  N  YP VLVQVPM+NEKE
Sbjct  48   MSIMLFIERVYMGVVIVFVKLFGKKPNKRYKWEPIKDDIELGNSAYPMVLVQVPMYNEKE  107

Query  678  VYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNG  499
            VY+LSIGA CG +WPSDR+I+Q+LDDST+  ++ +VE EC+ W  +G+N+KYE R+NRNG
Sbjct  108  VYQLSIGAACGLSWPSDRIIIQVLDDSTDPAIKSMVEVECQRWASKGINIKYEIRDNRNG  167

Query  498  YKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNA  319
            YKAGAL+EG+K  YV  C++VAIFDADFQP+ DFLWRTIP+L  NPE+ALVQARWKFVN+
Sbjct  168  YKAGALKEGMKHSYVKQCDYVAIFDADFQPEPDFLWRTIPFLAHNPEIALVQARWKFVNS  227

Query  318  DECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDM  139
            DEC+MTR+QEMSLDYHFTVEQEVGS+T +FFGFNGTAGVWR+ A+++AGGWK RTTVEDM
Sbjct  228  DECLMTRMQEMSLDYHFTVEQEVGSATYAFFGFNGTAGVWRISAVNEAGGWKARTTVEDM  287

Query  138  DLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHRWSCGPANL  1
            DLAVRASL+GWKF+Y+GDL+VKNELPSTFKAYR+QQHRWSCGPANL
Sbjct  288  DLAVRASLKGWKFVYVGDLKVKNELPSTFKAYRYQQHRWSCGPANL  333



>ref|XP_007132379.1| hypothetical protein PHAVU_011G089900g [Phaseolus vulgaris]
 gb|ESW04373.1| hypothetical protein PHAVU_011G089900g [Phaseolus vulgaris]
Length=542

 Score =   468 bits (1204),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 202/312 (65%), Positives = 268/312 (86%), Gaps = 1/312 (0%)
 Frame = -1

Query  933  LKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDA  754
            ++  W+ I+ P++VP++ +A+  C+ M++MLF+ER+YM IVI++VK F +K + RYK + 
Sbjct  25   MRMVWEVIKAPLIVPLMNVAVYICLAMALMLFMERVYMGIVIILVKLFWKKPHQRYKFEP  84

Query  753  LKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRK  577
            L+ED E  N N+P VL+Q+PMFNE+EVYK+SIGA C  +WPSDRL++Q+LDDST+  +++
Sbjct  85   LQEDEELGNTNFPVVLIQIPMFNEREVYKVSIGAACNLSWPSDRLVIQVLDDSTDPTIKQ  144

Query  576  LVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDF  397
            +VE EC+ W  +G+N+ Y+ R  R GYKAGAL+EGLK+ YV  CE+VAIFDADF+P+ DF
Sbjct  145  MVEMECQRWASKGINIIYQIRETRGGYKAGALKEGLKRSYVKHCEYVAIFDADFRPEPDF  204

Query  396  LWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFN  217
            L R+IP+L+ NP++ALVQARW+FVN+DEC++TR+QEMSLDYHFTVEQEVGS+T +FFGFN
Sbjct  205  LRRSIPFLVGNPDIALVQARWRFVNSDECLLTRMQEMSLDYHFTVEQEVGSATHAFFGFN  264

Query  216  GTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRF  37
            GTAGVWR+ A+++AGGWKDRTTVEDMDLAVRASLRGWKFLY+GDL+ K+ELPST +A+RF
Sbjct  265  GTAGVWRIGAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGDLQAKSELPSTLRAFRF  324

Query  36   QQHRWSCGPANL  1
            QQHRWSCGPANL
Sbjct  325  QQHRWSCGPANL  336



>ref|XP_006400777.1| hypothetical protein EUTSA_v10013221mg [Eutrema salsugineum]
 gb|ESQ42230.1| hypothetical protein EUTSA_v10013221mg [Eutrema salsugineum]
Length=532

 Score =   468 bits (1203),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 209/328 (64%), Positives = 272/328 (83%), Gaps = 1/328 (0%)
 Frame = -1

Query  981  VFSEPGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVV  802
            V  E  +G+       L   W+ ++ P++VP+L++A+  C++MSVML  ER+YM IVIV+
Sbjct  9    VLPETFDGVRMEMTGQLGMIWELVKAPVIVPLLQLAVYICLIMSVMLLCERVYMGIVIVL  68

Query  801  VKCFGRKRYTRYKLDALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDR  625
            VK F +K   RYK + + +D E  + N+P VLVQ+PMFNE+EVYKLSIGA CG +WPSDR
Sbjct  69   VKLFWKKPDKRYKFEPIHDDEELGSSNFPVVLVQIPMFNEREVYKLSIGAACGLSWPSDR  128

Query  624  LIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDC  445
            L++Q+LDDST+  ++++VE EC+ W  +G+N++Y+ R NR GYKAGAL+EGLK+ YV  C
Sbjct  129  LVIQVLDDSTDPTVKQMVEMECQRWASKGINIRYQIRENRVGYKAGALKEGLKRSYVKHC  188

Query  444  EFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFT  265
            E+V IFDADFQP+ DFL R+IP+L+ N  +ALVQARW+FVN++EC++TR+QEMSLDYHFT
Sbjct  189  EYVVIFDADFQPEPDFLRRSIPFLIHNSNIALVQARWRFVNSNECLLTRMQEMSLDYHFT  248

Query  264  VEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGD  85
            VEQEVGSST +FFGFNGTAG+WR+ A+++AGGWKDRTTVEDMDLAVRASLRGWKFLY+GD
Sbjct  249  VEQEVGSSTHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGD  308

Query  84   LEVKNELPSTFKAYRFQQHRWSCGPANL  1
            L+VK+ELPSTF+A+RFQQHRWSCGPANL
Sbjct  309  LQVKSELPSTFRAFRFQQHRWSCGPANL  336



>ref|XP_002312893.1| glycosyl transferase family 2 family protein [Populus trichocarpa]
 gb|EEE86848.1| glycosyl transferase family 2 family protein [Populus trichocarpa]
Length=537

 Score =   468 bits (1203),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 206/312 (66%), Positives = 266/312 (85%), Gaps = 1/312 (0%)
 Frame = -1

Query  933  LKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDA  754
            L   W+ ++ P++VP+L + +  C+ MS+MLF+ER+YM IVI++VK F +K   RYK + 
Sbjct  27   LTLIWELLKAPLIVPLLTLGVYICLAMSLMLFMERVYMGIVIILVKLFWKKPDKRYKWEP  86

Query  753  LKEDLEQ-NQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRK  577
            +++DLE  N N+P VLVQ+PMFNE+EVYKLSIGA    +WP+DRL++Q+LDDST+  +++
Sbjct  87   MQDDLESGNLNFPVVLVQIPMFNEREVYKLSIGAASNLSWPADRLVIQVLDDSTDPAIKQ  146

Query  576  LVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDF  397
            +VE EC+ W  +G+N++Y+ R NR GYKAGAL+EGLK+ YV  CE+V IFDADFQP+ D+
Sbjct  147  MVELECQRWASKGINIRYQIRENRTGYKAGALKEGLKRSYVKHCEYVCIFDADFQPEPDY  206

Query  396  LWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFN  217
            L R IP+L+ NPE+ALVQ RW+FVNADEC++TR+QEMSLDYHFTVEQEVGS+T +FFGFN
Sbjct  207  LRRAIPFLIHNPEIALVQGRWRFVNADECLLTRMQEMSLDYHFTVEQEVGSATHAFFGFN  266

Query  216  GTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRF  37
            GTAGVWR+ A+++AGGWKDRTTVEDMDLAVRASLRGWKFLY+GDL+VK+ELPSTFKA+RF
Sbjct  267  GTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGDLQVKSELPSTFKAFRF  326

Query  36   QQHRWSCGPANL  1
            QQHRWSCGPANL
Sbjct  327  QQHRWSCGPANL  338



>ref|XP_006347222.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Solanum 
tuberosum]
Length=533

 Score =   467 bits (1202),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 211/328 (64%), Positives = 268/328 (82%), Gaps = 1/328 (0%)
 Frame = -1

Query  981  VFSEPGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVV  802
            +F E   G        +   W+ I+ P++VP+L+ A+  C+ M +MLF+ER+YM IVIV+
Sbjct  9    LFPETFQGTAADIAGQIGLMWELIKAPLIVPLLRAAVYICLAMELMLFIERLYMGIVIVL  68

Query  801  VKCFGRKRYTRYKLDALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDR  625
            VK F +K   RYK + +++DLE  N+ +P VLVQ+PMFNEKEVYK+SIGA C  +WPSDR
Sbjct  69   VKLFMKKPDKRYKWEPMRDDLEIGNEGFPMVLVQIPMFNEKEVYKISIGAACNLSWPSDR  128

Query  624  LIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDC  445
            LI+Q+LDDST+  ++ LVE EC  W  +G+N++Y+ R NR GYKAGAL+EGLK+ YV DC
Sbjct  129  LIIQVLDDSTDHLIKDLVEKECLRWANKGINIRYQIRENRGGYKAGALKEGLKRDYVKDC  188

Query  444  EFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFT  265
            E+V IFDADF+P+ DFL R IP+L+ N E+ALVQ RW+FVNA+EC++TR+QEMSLDYHFT
Sbjct  189  EYVVIFDADFRPEPDFLRRAIPFLVHNSEIALVQGRWRFVNANECLLTRMQEMSLDYHFT  248

Query  264  VEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGD  85
            VEQEVGSST +FFGFNGT GVWR+ A+++AGGWKDRTTVEDMDLAVRASL+GWKFLY+GD
Sbjct  249  VEQEVGSSTHAFFGFNGTGGVWRIAAINEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGD  308

Query  84   LEVKNELPSTFKAYRFQQHRWSCGPANL  1
            L+VK+ELPSTFKA+RFQQHRWSCGPANL
Sbjct  309  LQVKSELPSTFKAFRFQQHRWSCGPANL  336



>ref|XP_009403735.1| PREDICTED: probable mannan synthase 9 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=528

 Score =   467 bits (1202),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 206/315 (65%), Positives = 267/315 (85%), Gaps = 1/315 (0%)
 Frame = -1

Query  942  VESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYK  763
            V  L   W+ ++ P++VP+L+IA+  C+ MSVMLF+E++YMA VI+ VK   R+  TRYK
Sbjct  17   VTQLGMVWEQVKAPVIVPLLRIAVFLCLAMSVMLFVEKVYMATVILAVKLLRRRPETRYK  76

Query  762  LDALKEDLEQ-NQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDN  586
             + +++D+E+ +  YP VLVQ+PMFNEKEVY+LSIGA CG +WPSDRLI+Q+LDDST+  
Sbjct  77   WEPMEDDMERGSAAYPMVLVQIPMFNEKEVYQLSIGAACGLSWPSDRLIIQVLDDSTDPA  136

Query  585  LRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPD  406
            ++++V+ EC+ W  +GVN++YE R+NR GYKAGAL+ G+K +YV DC++V IFDADFQPD
Sbjct  137  IKEMVQVECRRWASKGVNIRYEIRDNRVGYKAGALKMGMKHRYVKDCDYVVIFDADFQPD  196

Query  405  HDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFF  226
             DFL RTIP+L+ NP++ LVQ RW+FVNADEC+MTR+QEMSLDYHF +EQEVGSST +FF
Sbjct  197  PDFLCRTIPFLIHNPQIGLVQGRWRFVNADECLMTRMQEMSLDYHFAIEQEVGSSTYAFF  256

Query  225  GFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKA  46
            GFNGTAGVWR+ A+++AGGWKDRTTVEDMDLAVRASL+GWKF+++ DL VK+ELPSTFKA
Sbjct  257  GFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLKGWKFIFLNDLGVKSELPSTFKA  316

Query  45   YRFQQHRWSCGPANL  1
            +R QQHRWSCGPANL
Sbjct  317  FRHQQHRWSCGPANL  331



>ref|XP_010031452.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2 [Eucalyptus 
grandis]
 gb|KCW50751.1| hypothetical protein EUGRSUZ_J00420 [Eucalyptus grandis]
Length=527

 Score =   467 bits (1201),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 206/312 (66%), Positives = 268/312 (86%), Gaps = 1/312 (0%)
 Frame = -1

Query  933  LKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDA  754
            L   W+ I+ P++VP+L++++  C+ M++MLF+ER+YM IVIV+VK F +K   RY  + 
Sbjct  25   LGMVWELIKAPLIVPVLRLSVYVCLAMALMLFMERVYMGIVIVLVKLFWKKPEKRYNWEP  84

Query  753  LKEDLEQ-NQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRK  577
            ++EDLE  + N+P VLVQ+PM+NEKEVYK+SIGA CG +WP+DRL++Q+LDDST+  +++
Sbjct  85   IEEDLESGSSNFPFVLVQIPMYNEKEVYKISIGAACGLSWPADRLVIQVLDDSTDPVIKQ  144

Query  576  LVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDF  397
            +VE EC+ W  +G+N+ Y+ R  R GYKAGAL+EGLK+ YV  CEFVAIFDADF+P+ D+
Sbjct  145  MVELECQRWASKGINIVYQIRETRGGYKAGALKEGLKRSYVKHCEFVAIFDADFRPEPDY  204

Query  396  LWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFN  217
            L R IPY L NP+LALVQARW+FVN++EC++TR+QEMSLDYHFTVEQEVGS+T +FFGFN
Sbjct  205  LKRAIPYFLRNPDLALVQARWRFVNSNECLLTRMQEMSLDYHFTVEQEVGSATHAFFGFN  264

Query  216  GTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRF  37
            GTAGVWR+ A+++AGGWKDRTTVEDMDLAVRASLRGWKF+Y+GDL+VK+ELPSTFKA+RF
Sbjct  265  GTAGVWRIGAINEAGGWKDRTTVEDMDLAVRASLRGWKFVYLGDLQVKSELPSTFKAFRF  324

Query  36   QQHRWSCGPANL  1
            QQHRWSCGPANL
Sbjct  325  QQHRWSCGPANL  336



>ref|XP_010089159.1| hypothetical protein L484_003290 [Morus notabilis]
 gb|EXB37420.1| hypothetical protein L484_003290 [Morus notabilis]
Length=541

 Score =   467 bits (1202),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 201/308 (65%), Positives = 268/308 (87%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W+ I+ P++VP+L++ +  C+ MS+MLF+ER+YM IVI++VK F +K   RYK + +++D
Sbjct  29   WELIKAPLIVPLLRLGVYICLAMSLMLFMERLYMGIVIILVKLFWKKPEKRYKFEPIQDD  88

Query  741  LEQ-NQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            +E  + N+P VL+Q+PMFNEKEVYK+SIGA CG +WPSDRL++Q+LDDST+  ++++VE 
Sbjct  89   VEMGSSNFPVVLIQIPMFNEKEVYKISIGAACGLSWPSDRLVIQVLDDSTDPVIKQMVEL  148

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC+ W  +G+N+ Y+ R NR GYKAGAL+EGLK+ YV  CE+VAI DADF+P+ DFL R+
Sbjct  149  ECQRWASKGINITYQIRENRTGYKAGALKEGLKRSYVKHCEYVAILDADFRPEPDFLRRS  208

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            IP+L+ NP++ALVQARW+FVN+DEC++TR+QEMSLDYHFTVEQEVGS+T +FFGFNGTAG
Sbjct  209  IPFLVHNPDIALVQARWRFVNSDECLLTRMQEMSLDYHFTVEQEVGSATHAFFGFNGTAG  268

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            +WR+ A+++AGGWKDRTTVEDMDLAVRASLRGWKF+Y+G+L+ K+ELPSTFKA+RFQQHR
Sbjct  269  IWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFVYLGELQAKSELPSTFKAFRFQQHR  328

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  329  WSCGPANL  336



>dbj|BAF36300.1| hypothetical protein [Ipomoea trifida]
Length=571

 Score =   468 bits (1205),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 209/324 (65%), Positives = 268/324 (83%), Gaps = 5/324 (2%)
 Frame = -1

Query  969  PGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCF  790
            PG  M       ++  +D ++ P++VP+L++A+  C+ MS+MLF+ER+YM IVI++VK F
Sbjct  19   PGGDM----AAQMRLMYDLVKAPLIVPVLRLAVYVCLTMSMMLFVERLYMGIVIILVKIF  74

Query  789  GRKRYTRYKLDALKEDLEQNQN-YPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQ  613
              K   RYK + ++ED E   + +P VL+Q+PMFNEKEVYK+SIGAVC F WPSDRL+VQ
Sbjct  75   CGKPEKRYKWEPMREDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQ  134

Query  612  ILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVA  433
            +LDDST+ N++++VE EC  W  +G+N+ Y+TR  R GYKAGAL+EGL   YV DCE+VA
Sbjct  135  VLDDSTDHNIKEMVEKECLRWASKGINITYQTRVTRGGYKAGALKEGLTHDYVQDCEYVA  194

Query  432  IFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQE  253
            IFDADF+P+ DFL R+IP+L+ NPE+AL+QARW+FVNADEC++TR+QEMSLDYHF VEQE
Sbjct  195  IFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQE  254

Query  252  VGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVK  73
            VGSST +FFGFNGT G+WR+ A+++AGGWKDRTTVEDMDLAVRA L+GWKFLY+GDL VK
Sbjct  255  VGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVK  314

Query  72   NELPSTFKAYRFQQHRWSCGPANL  1
            +ELPSTFKA+RFQQHRWSCGPANL
Sbjct  315  SELPSTFKAFRFQQHRWSCGPANL  338



>emb|CDX71011.1| BnaC03g10950D [Brassica napus]
Length=510

 Score =   466 bits (1199),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 209/328 (64%), Positives = 272/328 (83%), Gaps = 1/328 (0%)
 Frame = -1

Query  981  VFSEPGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVV  802
            V  E  +G+       L   W+ ++ P++VP+L++A+  C++MSVML  ER+YM IVIV+
Sbjct  9    VLPETFDGVRMEITGQLGMIWELVKAPVIVPLLQLAVYICLLMSVMLLCERVYMGIVIVL  68

Query  801  VKCFGRKRYTRYKLDALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDR  625
            VK F +K   RYK   +++D E  + N+P VLVQ+PMFNE+EVYKLSIGA  G +WPSDR
Sbjct  69   VKLFWKKPDKRYKFVPIQDDEELGSSNFPVVLVQIPMFNEREVYKLSIGAASGLSWPSDR  128

Query  624  LIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDC  445
            L++Q+LDDST+  ++++VE EC+ W  +G+N++Y+ R NR GYKAGAL+EGLK+ YV  C
Sbjct  129  LVIQVLDDSTDPTVKQMVEMECQRWASKGINIRYQIRENRVGYKAGALKEGLKRSYVKHC  188

Query  444  EFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFT  265
            E+V IFDADFQP+ DFL R+IP+L+ NP +ALVQARW+FVN+DEC++TR+QEMSLDYHFT
Sbjct  189  EYVVIFDADFQPEPDFLRRSIPFLVHNPNIALVQARWRFVNSDECLLTRMQEMSLDYHFT  248

Query  264  VEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGD  85
            VEQEVGS+T +FFGFNGTAG+WR+ A+++AGGWKDRTTVEDMDLAVRASLRGWKFLY+GD
Sbjct  249  VEQEVGSATHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGD  308

Query  84   LEVKNELPSTFKAYRFQQHRWSCGPANL  1
            L+VK+ELPSTF+A+RFQQHRWSCGPANL
Sbjct  309  LQVKSELPSTFRAFRFQQHRWSCGPANL  336



>ref|XP_011005673.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Populus 
euphratica]
Length=540

 Score =   467 bits (1202),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 207/312 (66%), Positives = 267/312 (86%), Gaps = 1/312 (0%)
 Frame = -1

Query  933  LKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDA  754
            LK  W+ I+ P++VP+L + +   + MS+MLF+ER+YM IVI++VK F +K   RYK + 
Sbjct  27   LKLIWELIKAPLIVPLLTLGVYISLAMSLMLFMERVYMGIVIILVKLFWKKPEKRYKWEP  86

Query  753  LKEDLEQ-NQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRK  577
            +++D+E  N N+P VLVQ+PMFNEKEVYKLSIGA    +WP+DRL++Q+LDDST+  +++
Sbjct  87   MQDDIESGNLNFPVVLVQIPMFNEKEVYKLSIGAASNLSWPADRLVIQVLDDSTDPAIKQ  146

Query  576  LVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDF  397
            +VE EC+ W  +G+N++Y+ R NR GYKAGAL+EGLK+ YV  CE+V IFDADFQP+ DF
Sbjct  147  MVELECQRWASKGINIRYQIRENRTGYKAGALKEGLKRSYVKHCEYVCIFDADFQPEPDF  206

Query  396  LWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFN  217
            L R IP+L+ NP++ALVQARW+FVNADEC++TR+QEMSLDYHFTVEQEVGS+T +FFGFN
Sbjct  207  LRRAIPFLVHNPDVALVQARWRFVNADECLLTRMQEMSLDYHFTVEQEVGSATHAFFGFN  266

Query  216  GTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRF  37
            GTAGVWR+ A+++AGGWKDRTTVEDMDLAVRASLRGWKF+Y+GDL+VK+ELPSTFKA+RF
Sbjct  267  GTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFVYLGDLQVKSELPSTFKAFRF  326

Query  36   QQHRWSCGPANL  1
            QQHRWSCGPANL
Sbjct  327  QQHRWSCGPANL  338



>gb|KDP34366.1| hypothetical protein JCGZ_11249 [Jatropha curcas]
Length=538

 Score =   467 bits (1201),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 207/308 (67%), Positives = 263/308 (85%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W+ I+ P++VP+L + +  C+ MS+MLF+ER+YM IVI++VK F +K   RYK + +++D
Sbjct  29   WELIKTPLIVPLLTLGVYVCLAMSLMLFMERLYMGIVIILVKLFWKKPEKRYKWEPIQDD  88

Query  741  LEQ-NQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            LE  N N+P VLVQ+PMFNE+EVYKLSIGA    +WP+DRL++Q+LDDST+  ++K+VE 
Sbjct  89   LESGNSNFPAVLVQIPMFNEREVYKLSIGAASNLSWPADRLVIQVLDDSTDQEIKKMVEL  148

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC+ W  +GVN+ Y+ R  R GYKAGAL+EGLK+ YV  CE+V IFDADFQP+ DFL R 
Sbjct  149  ECQRWASKGVNIVYQIRETRGGYKAGALKEGLKRSYVKHCEYVVIFDADFQPEPDFLRRA  208

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            IP+L+ NP++ALVQARW+FVNADEC++TR+QEMSLDYHFTVEQEVGS+T +FFGFNGTAG
Sbjct  209  IPFLVHNPDIALVQARWRFVNADECLLTRMQEMSLDYHFTVEQEVGSATHAFFGFNGTAG  268

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ A+++AGGWKDRTTVEDMDLAVRASLRGWKF+Y+GDL VK+ELPSTFKA+RFQQHR
Sbjct  269  VWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFVYLGDLHVKSELPSTFKAFRFQQHR  328

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  329  WSCGPANL  336



>ref|XP_010038980.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Eucalyptus 
grandis]
Length=533

 Score =   467 bits (1201),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 205/308 (67%), Positives = 262/308 (85%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W   + P+L+P+L +A+  C  MS+MLF+E++YM+IVI++VK  G++   RY+ + +K+D
Sbjct  29   WTLFKAPLLIPLLNMAILLCSSMSLMLFIEKVYMSIVILLVKVLGQEPEKRYRWEPMKDD  88

Query  741  LEQ-NQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            +E  N  YP VLVQ+PM+NE+EVY+ SIGA CG +WPSDR+I+Q+LDDSTN  ++ +V+ 
Sbjct  89   IEAGNSAYPTVLVQIPMYNEREVYQFSIGAACGLSWPSDRMIIQVLDDSTNPTIKDMVKL  148

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC+ W  +GVN+KYE R++RNGYKAGALREG+K+ Y   C+FVAI DADFQP  DFL RT
Sbjct  149  ECQRWQSKGVNIKYEIRDSRNGYKAGALREGMKRSYAKQCDFVAIIDADFQPKPDFLRRT  208

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            IP+L+ NPELALVQARW FVN+DEC+MTR+QEMSLDYHFTVEQEVGSST +FFGFNGTAG
Sbjct  209  IPFLVHNPELALVQARWTFVNSDECLMTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAG  268

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ A+++AGGWK+RTTVEDMDLAVRASL+GWKF+Y+G L+VK+ELPST KAYR+QQHR
Sbjct  269  VWRISAINEAGGWKERTTVEDMDLAVRASLKGWKFVYVGSLKVKSELPSTLKAYRYQQHR  328

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  329  WSCGPANL  336



>ref|XP_007143832.1| hypothetical protein PHAVU_007G105400g [Phaseolus vulgaris]
 gb|ESW15826.1| hypothetical protein PHAVU_007G105400g [Phaseolus vulgaris]
Length=530

 Score =   466 bits (1200),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 210/308 (68%), Positives = 261/308 (85%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W   R P++VP LK+ ++ C+ MS+MLF+ER+YM IVI+ VK F  K   +YK + L++D
Sbjct  26   WQQARAPLVVPALKLLVALCLAMSIMLFVERVYMGIVIIFVKLFRYKPDKKYKWEPLRDD  85

Query  741  LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            LE  N  YP VLVQ+PM+NEKEVY+LSIGA CG  WPSDR+I+Q+LDDST+  ++K+VE 
Sbjct  86   LEIGNSAYPMVLVQIPMYNEKEVYQLSIGAACGLLWPSDRIIIQVLDDSTDPIIKKMVEV  145

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC+ W  +G+N+KYE R NRNGYKAGAL+EG+K  YV+ C++VAIFDADFQP+ +FL RT
Sbjct  146  ECQRWASKGINIKYEIRQNRNGYKAGALKEGMKHSYVNLCDYVAIFDADFQPEPNFLRRT  205

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            IP+L  NPE+ALVQARWKFVNADEC+MTR+QEMSLDYHF VEQEVGSST +FFGFNGTAG
Sbjct  206  IPFLYHNPEVALVQARWKFVNADECLMTRMQEMSLDYHFLVEQEVGSSTYAFFGFNGTAG  265

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ AL++AGGWKDRTTVEDMDLA+RA L+G KF+Y+ DL+VK+ELPSTFKA+R+QQHR
Sbjct  266  VWRISALNEAGGWKDRTTVEDMDLAIRAGLKGGKFVYLSDLKVKSELPSTFKAFRYQQHR  325

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  326  WSCGPANL  333



>ref|XP_004951606.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 1-like [Setaria 
italica]
Length=521

 Score =   466 bits (1199),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 209/313 (67%), Positives = 269/313 (86%), Gaps = 2/313 (1%)
 Frame = -1

Query  933  LKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDA  754
            L  AW  +R P++VP+L++A++ C+ MSV+LFLER+YMA+VI VV+    +   RY+ + 
Sbjct  11   LPEAWSQVRAPVIVPLLRLAVAVCLTMSVLLFLERMYMAVVIAVVRLLRLRPERRYRCEP  70

Query  753  LKEDLEQ--NQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLR  580
            L ED  +  +  +P VLVQ+PMFNE+EVY+LSIGAVCG +WPSDRL+VQ+LDDST++ ++
Sbjct  71   LPEDDPELGSSAFPSVLVQIPMFNEREVYQLSIGAVCGLSWPSDRLVVQVLDDSTDEVIK  130

Query  579  KLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHD  400
            ++V  EC+ W R+G+N+ Y+ R++R GYKAGAL+ G+K  YV +CE+VAIFDADFQPD D
Sbjct  131  EMVRMECERWARKGINITYQIRDDRRGYKAGALKAGMKHAYVRECEYVAIFDADFQPDPD  190

Query  399  FLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGF  220
            FL RTIPYL+ NPE+ALVQARW+FVNADEC+MTR+QEMSLDYHFTVEQEV SS C+FFGF
Sbjct  191  FLKRTIPYLVHNPEIALVQARWRFVNADECLMTRMQEMSLDYHFTVEQEVSSSVCAFFGF  250

Query  219  NGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYR  40
            NGTAGVWR+ A+++AGGWKDRTTVEDMDLA+RASL+GWKF+Y+GD++VK+ELPSTFKA+R
Sbjct  251  NGTAGVWRIAAVNEAGGWKDRTTVEDMDLAIRASLKGWKFVYLGDVQVKSELPSTFKAFR  310

Query  39   FQQHRWSCGPANL  1
            FQQHRWSCGPANL
Sbjct  311  FQQHRWSCGPANL  323



>ref|XP_010535659.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2 [Tarenaya 
hassleriana]
Length=532

 Score =   466 bits (1200),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 208/328 (63%), Positives = 270/328 (82%), Gaps = 1/328 (0%)
 Frame = -1

Query  981  VFSEPGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVV  802
            V  +  NG+ +     +   W+ ++ P++VP+L++A+  C+ MS+ML +ER+YM IVI++
Sbjct  8    VLPDTFNGVRSEITGQIGMIWELVKAPVIVPLLRLAVYLCLAMSLMLLMERLYMGIVIIL  67

Query  801  VKCFGRKRYTRYKLDALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDR  625
            VK F +K   RYK + +++D E  + N+P VLVQ+PMFNE+EVYKLSIGA CG +WPSDR
Sbjct  68   VKLFWKKPDKRYKFEPIQDDEEFGSSNFPVVLVQIPMFNEREVYKLSIGAACGLSWPSDR  127

Query  624  LIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDC  445
            L++Q+LDDST+  ++ +VE EC+ W  +GVN+ Y+ R  R GYKAGAL+EGLK+ YV  C
Sbjct  128  LVIQVLDDSTDPTVKHMVEMECQRWASKGVNIVYQIRETRGGYKAGALKEGLKRSYVKHC  187

Query  444  EFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFT  265
            E+V IFDADFQP  DFL R+IP+L+ N ++ALVQARW+FVNADEC++TR+QEMSLDYHF 
Sbjct  188  EYVVIFDADFQPKPDFLRRSIPFLIHNSDIALVQARWRFVNADECLLTRMQEMSLDYHFK  247

Query  264  VEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGD  85
            VEQEVGSST +FFGFNGTAG+WR+ A+++AGGWKDRTTVEDMDLAVRASLRGWKFLY+GD
Sbjct  248  VEQEVGSSTHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGD  307

Query  84   LEVKNELPSTFKAYRFQQHRWSCGPANL  1
            L+VK+ELPSTFKA+RFQQHRWSCGPANL
Sbjct  308  LQVKSELPSTFKAFRFQQHRWSCGPANL  335



>ref|XP_011010407.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X2 [Populus euphratica]
Length=530

 Score =   466 bits (1200),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 208/286 (73%), Positives = 252/286 (88%), Gaps = 1/286 (0%)
 Frame = -1

Query  855  MSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKEDLE-QNQNYPKVLVQVPMFNEKE  679
            MS+M+F+ER+YM +VIV VK FG+K   RYK + +K+D+E  N  YP VLVQVPM+NEKE
Sbjct  48   MSIMIFIERVYMGVVIVFVKLFGKKPNKRYKWEPIKDDIELGNSAYPMVLVQVPMYNEKE  107

Query  678  VYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNG  499
            VY+LSIGA CG +WPSDR+I+Q+LDDST+  ++ LVE EC+ W  +G+ +KYE R+NRNG
Sbjct  108  VYQLSIGAACGLSWPSDRIIIQVLDDSTDPAIKSLVEVECQRWASKGITIKYEMRDNRNG  167

Query  498  YKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNA  319
            YKAGAL+EG+K  YV  C F+AIFDADFQP+ DFLWRTIP+L  NPE+ALVQARWKFVN+
Sbjct  168  YKAGALKEGMKHSYVKQCFFLAIFDADFQPEPDFLWRTIPFLAHNPEIALVQARWKFVNS  227

Query  318  DECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDM  139
            DEC+MTR+QEMSLDYHFTVEQEVGS+T +FFGFNGTAGVWR+ A+++AGGWKDRTTVEDM
Sbjct  228  DECLMTRMQEMSLDYHFTVEQEVGSATYAFFGFNGTAGVWRISAVNEAGGWKDRTTVEDM  287

Query  138  DLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHRWSCGPANL  1
            DLAVRASL+GWKF+Y+GDL+VKNELPSTFKAYR+QQHRWSCGPANL
Sbjct  288  DLAVRASLKGWKFVYVGDLKVKNELPSTFKAYRYQQHRWSCGPANL  333



>ref|XP_008227108.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2 [Prunus mume]
Length=540

 Score =   466 bits (1200),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 203/308 (66%), Positives = 266/308 (86%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W+ I+ P++VP+L++ +   + MS+MLF ER+YM IVI++VK F +K   RYK + ++ED
Sbjct  29   WELIKAPLIVPLLRVCVYISLAMSLMLFFERLYMGIVIILVKLFWKKPEKRYKYEPIQED  88

Query  741  LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            LE  + N+P VL+Q+PMFNE+EVYK+SIGA CG +WPSDRL++Q+LDDST+  ++++VE 
Sbjct  89   LELGSSNFPVVLIQIPMFNEREVYKISIGAACGLSWPSDRLVIQVLDDSTDPTIKQMVEL  148

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC+ W  +G+N++Y+ R  R GYKAGAL+EGLK+ YV  CE+VAIFDADF+P+ D+L R 
Sbjct  149  ECQRWASKGINIRYQIRETRGGYKAGALKEGLKRSYVKHCEYVAIFDADFRPEPDYLRRA  208

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            IP+L+ NP++ALVQARW+FVN+DEC++TR+QEMSLDYHFTVEQEVGS+T +FFGFNGTAG
Sbjct  209  IPFLVHNPDIALVQARWRFVNSDECLLTRMQEMSLDYHFTVEQEVGSATHAFFGFNGTAG  268

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ A+++AGGWKDRTTVEDMDLAVRASLRGWKFLY+GDL+VK+ELPSTF A+RFQQHR
Sbjct  269  VWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGDLQVKSELPSTFNAFRFQQHR  328

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  329  WSCGPANL  336



>ref|XP_006384673.1| glycosyl transferase family 2 family protein [Populus trichocarpa]
 gb|ERP62470.1| glycosyl transferase family 2 family protein [Populus trichocarpa]
Length=540

 Score =   466 bits (1200),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 208/312 (67%), Positives = 264/312 (85%), Gaps = 1/312 (0%)
 Frame = -1

Query  933  LKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDA  754
            LK  WD I+ P++VP+L + +   + MS+ML +ER+YM IVI+ VK F +K   RYK + 
Sbjct  27   LKLIWDLIKAPLIVPLLTLGVYISLAMSLMLLMERVYMGIVIIFVKLFWKKPEKRYKWEP  86

Query  753  LKEDLEQ-NQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRK  577
            +++D+E  N N+P VLVQ+PMFNEKEVYKLSIGA    +WP+DRL++Q+LDDST+  +++
Sbjct  87   MQDDIESGNLNFPVVLVQIPMFNEKEVYKLSIGAASNLSWPADRLVIQVLDDSTDPAIKQ  146

Query  576  LVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDF  397
            +VE EC+ W  +G+N++Y+ R NR GYKAGAL+EGLK+ YV  CE+V IFDADFQP+ DF
Sbjct  147  MVELECQRWASKGINIRYQIRENRTGYKAGALKEGLKRSYVKHCEYVCIFDADFQPEPDF  206

Query  396  LWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFN  217
            L R IP+L+ NP++ALVQARW+FVNADEC++TR+QEMSLDYHFTVEQEVGS+T +FFGFN
Sbjct  207  LRRAIPFLVHNPDVALVQARWRFVNADECLLTRMQEMSLDYHFTVEQEVGSATHAFFGFN  266

Query  216  GTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRF  37
            GTAGVWR+ A++DAGGWKDRTTVEDMDLAVRASLRGWKF+Y+GDL VK+ELPSTFKA+RF
Sbjct  267  GTAGVWRIAAINDAGGWKDRTTVEDMDLAVRASLRGWKFVYLGDLHVKSELPSTFKAFRF  326

Query  36   QQHRWSCGPANL  1
            QQHRWSCGPANL
Sbjct  327  QQHRWSCGPANL  338



>ref|XP_004239715.2| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Solanum 
lycopersicum]
Length=526

 Score =   466 bits (1199),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 205/308 (67%), Positives = 261/308 (85%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W  +R P+LVP LKI +  C+ MS+MLF++++YM IVI+ +K   +K   +YK + +K+D
Sbjct  19   WQQVRAPLLVPFLKIMVILCLAMSLMLFVDKVYMGIVIIFIKILRKKPEKKYKWEPIKDD  78

Query  741  LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            LE  N +YP VL+Q+PM+NE+EVY+LSIGA C  +WP++R+++Q+LDDST+  ++ +VE 
Sbjct  79   LELANSSYPMVLIQIPMYNEREVYQLSIGAACNLSWPANRILIQVLDDSTDPIIKVMVEQ  138

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            ECK W  +GVN+KYE R+NR GYKAGAL+EG+K  YV  C+FVAIFDADFQP+ DFL RT
Sbjct  139  ECKRWASKGVNIKYEIRDNRKGYKAGALKEGMKHNYVKMCDFVAIFDADFQPEFDFLLRT  198

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            +P+L+ NPE+ LVQARWKFVN+DEC++TR+QEMSLDYHF VEQEVGSS  +FFGFNGTAG
Sbjct  199  VPFLVHNPEIGLVQARWKFVNSDECLLTRMQEMSLDYHFKVEQEVGSSNHAFFGFNGTAG  258

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ AL++AGGWKDRTTVEDMDLAVRA L+GWKF+YIGDL+VKNELPSTFKAYR+QQHR
Sbjct  259  VWRISALNEAGGWKDRTTVEDMDLAVRAGLKGWKFVYIGDLKVKNELPSTFKAYRYQQHR  318

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  319  WSCGPANL  326



>ref|XP_009364844.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Pyrus 
x bretschneideri]
Length=549

 Score =   466 bits (1200),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 203/309 (66%), Positives = 265/309 (86%), Gaps = 1/309 (0%)
 Frame = -1

Query  924  AWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKE  745
             W+ I+ P++VP+L + +   + MS+MLF ER+YM +VIV+VK F +K   RYK + +++
Sbjct  28   TWELIKAPLIVPLLTVGVYVSLAMSLMLFFERVYMGVVIVLVKLFWKKPEQRYKYEPIQD  87

Query  744  DLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVE  568
            DLE  + N+P VL+Q+PMFNE+EVYK+SIGA CG +WPSDRL++Q+LDDST+  ++++VE
Sbjct  88   DLELGSSNFPPVLIQIPMFNEREVYKVSIGAACGLSWPSDRLVIQVLDDSTDPTIKQMVE  147

Query  567  DECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWR  388
             EC+ W  +G+N++Y+ R  R GYKAGAL+EGLK+ YV  CE+VAIFDADF+P+ D+L R
Sbjct  148  LECQRWASKGINIRYQIRETRGGYKAGALKEGLKRSYVKHCEYVAIFDADFRPEPDYLRR  207

Query  387  TIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTA  208
             IP+L+ NP++ALVQARW+FVNADEC++TR+QEMSLDYHFTVEQEVGS+T +FFGFNGTA
Sbjct  208  AIPFLVHNPDIALVQARWRFVNADECLLTRMQEMSLDYHFTVEQEVGSATHAFFGFNGTA  267

Query  207  GVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQH  28
            GVWR+ A+++AGGWKDRTTVEDMDLAVRASLRGWKFLY+GDL+VK+ELPSTF A+RFQQH
Sbjct  268  GVWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGDLQVKSELPSTFNAFRFQQH  327

Query  27   RWSCGPANL  1
            RWSCGPANL
Sbjct  328  RWSCGPANL  336



>ref|XP_002527445.1| transferase, transferring glycosyl groups, putative [Ricinus 
communis]
 gb|EEF34937.1| transferase, transferring glycosyl groups, putative [Ricinus 
communis]
Length=535

 Score =   466 bits (1199),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 206/308 (67%), Positives = 265/308 (86%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W+ I+ P++VP+L++ +  C+ MS+MLF+ER+YM IVIV+VK F +K   RYK + +++D
Sbjct  29   WELIKAPLIVPLLQLGVYICLTMSLMLFMERLYMGIVIVLVKLFWKKPEKRYKWEPIQDD  88

Query  741  LEQ-NQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            LE  N N+P VLVQ+PMFNE+EVYK+SIGA    +WP+DRL++Q+LDDST+  ++++VE 
Sbjct  89   LESGNSNFPVVLVQIPMFNEREVYKVSIGAASNLSWPADRLVIQVLDDSTDPEIKQMVEL  148

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC+ W  +GVN+ Y+ R  R GYKAGAL+EGLK+ YV  CE+V IFDADFQP+ DFL R 
Sbjct  149  ECQRWASKGVNITYQIRETRGGYKAGALKEGLKRGYVKHCEYVTIFDADFQPEPDFLRRA  208

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            IP+L+ NP++ALVQARW+FVNADEC++TR+QEMSLDYHFTVEQEVGS+T +FFGFNGTAG
Sbjct  209  IPFLVNNPDIALVQARWRFVNADECLLTRMQEMSLDYHFTVEQEVGSATHAFFGFNGTAG  268

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ A+++AGGWKDRTTVEDMDLAVRASLRGWKF+Y+GDL+VK+ELPSTFKA+RFQQHR
Sbjct  269  VWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFVYLGDLQVKSELPSTFKAFRFQQHR  328

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  329  WSCGPANL  336



>ref|XP_011044347.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Populus 
euphratica]
Length=537

 Score =   466 bits (1199),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 205/312 (66%), Positives = 266/312 (85%), Gaps = 1/312 (0%)
 Frame = -1

Query  933  LKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDA  754
            L   W+ I+ P++VP+L + +  C+ MS+MLF+ER+YM IVI++VK F +K   RYK + 
Sbjct  27   LTLIWELIKAPLIVPLLTLGVYICLAMSLMLFMERVYMGIVIILVKLFWKKPDKRYKWEP  86

Query  753  LKEDLEQ-NQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRK  577
            +++DLE  N N+P VLVQ+PMFNE+EVYKLSIGA    +WP+DRL++Q+LDDST+  +++
Sbjct  87   MQDDLESGNLNFPVVLVQIPMFNEREVYKLSIGAASNLSWPADRLVIQVLDDSTDPAIKQ  146

Query  576  LVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDF  397
            +VE EC+ W  +G+N++Y+ R NR GYK+GAL+EGLK+ YV  CE+V IFDADFQP+ D+
Sbjct  147  MVELECQRWASKGINIRYQIRENRTGYKSGALKEGLKRSYVKHCEYVCIFDADFQPEPDY  206

Query  396  LWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFN  217
            L R IP+L+ NP++ALVQ RW+FVNADEC++TR+QEMSLDYHFTVEQEVGS+T +FFGFN
Sbjct  207  LRRAIPFLIHNPDIALVQGRWRFVNADECLLTRMQEMSLDYHFTVEQEVGSATHAFFGFN  266

Query  216  GTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRF  37
            GTAGVWR+ A+++AGGWKDRTTVEDMDLAVRASLRGWKFLY+GDL+VK+ELPSTFKA+RF
Sbjct  267  GTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGDLQVKSELPSTFKAFRF  326

Query  36   QQHRWSCGPANL  1
            QQHRWSCGPANL
Sbjct  327  QQHRWSCGPANL  338



>gb|KHN38673.1| Glucomannan 4-beta-mannosyltransferase 2 [Glycine soja]
Length=543

 Score =   466 bits (1199),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 204/322 (63%), Positives = 270/322 (84%), Gaps = 1/322 (0%)
 Frame = -1

Query  963  NGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGR  784
            NG+       +K  W+ ++ P++VP+L +A+   + M++MLF+ER+YM IVI++VK F +
Sbjct  15   NGVNFDVAAQIKMVWEVMKAPLIVPLLNLAVYISLAMALMLFMERVYMGIVIILVKLFWK  74

Query  783  KRYTRYKLDALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQIL  607
            K + RYK + L++D E  N NYP VLVQ+PMFNEKEVYK+SIGA C  +WP+DRL++Q+L
Sbjct  75   KPHQRYKFEPLQDDEELGNSNYPVVLVQIPMFNEKEVYKVSIGAACNLSWPADRLVIQVL  134

Query  606  DDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIF  427
            DDST+  ++++VE EC+ W  +G+N+ Y+ R  R GYKAGAL+EGLK+ YV  CE+VAIF
Sbjct  135  DDSTDPTVKQMVEMECQRWASKGINIVYQIRETRGGYKAGALKEGLKRNYVKHCEYVAIF  194

Query  426  DADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVG  247
            DADF+P+ DFL R+IP+L+ NP++ALVQARW+FVN+DEC++TR+QEMSLDYHFTVEQEVG
Sbjct  195  DADFRPEPDFLRRSIPFLVGNPDIALVQARWRFVNSDECLLTRMQEMSLDYHFTVEQEVG  254

Query  246  SSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNE  67
            S+T +FFGFNGTAG+WR+ A+++AGGWKDRTTVEDMDLAVRASLRGWKFLY+GDL+ K+E
Sbjct  255  SATHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGDLQAKSE  314

Query  66   LPSTFKAYRFQQHRWSCGPANL  1
            LPST +A+RFQQHRWSCGPANL
Sbjct  315  LPSTLRAFRFQQHRWSCGPANL  336



>ref|XP_003538146.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Glycine 
max]
Length=542

 Score =   466 bits (1199),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 204/322 (63%), Positives = 270/322 (84%), Gaps = 1/322 (0%)
 Frame = -1

Query  963  NGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGR  784
            NG+       +K  W+ ++ P++VP+L +A+   + M++MLF+ER+YM IVI++VK F +
Sbjct  15   NGVNFDVAAQIKMVWEVMKAPLIVPLLNLAVYISLAMALMLFMERVYMGIVIILVKLFWK  74

Query  783  KRYTRYKLDALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQIL  607
            K + RYK + L++D E  N NYP VLVQ+PMFNEKEVYK+SIGA C  +WP+DRL++Q+L
Sbjct  75   KPHQRYKFEPLQDDEELGNSNYPVVLVQIPMFNEKEVYKVSIGAACNLSWPADRLVIQVL  134

Query  606  DDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIF  427
            DDST+  ++++VE EC+ W  +G+N+ Y+ R  R GYKAGAL+EGLK+ YV  CE+VAIF
Sbjct  135  DDSTDPTVKQMVEMECQRWASKGINIVYQIRETRGGYKAGALKEGLKRNYVKHCEYVAIF  194

Query  426  DADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVG  247
            DADF+P+ DFL R+IP+L+ NP++ALVQARW+FVN+DEC++TR+QEMSLDYHFTVEQEVG
Sbjct  195  DADFRPEPDFLRRSIPFLVGNPDIALVQARWRFVNSDECLLTRMQEMSLDYHFTVEQEVG  254

Query  246  SSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNE  67
            S+T +FFGFNGTAG+WR+ A+++AGGWKDRTTVEDMDLAVRASLRGWKFLY+GDL+ K+E
Sbjct  255  SATHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGDLQAKSE  314

Query  66   LPSTFKAYRFQQHRWSCGPANL  1
            LPST +A+RFQQHRWSCGPANL
Sbjct  315  LPSTLRAFRFQQHRWSCGPANL  336



>ref|XP_009629011.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Nicotiana 
tomentosiformis]
Length=533

 Score =   466 bits (1198),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 206/308 (67%), Positives = 264/308 (86%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W+ I+ P++VP+L++A+  C+ M +MLF+ER+YM IVI++VK F +K   RYK +A++ED
Sbjct  29   WELIKAPLIVPLLRVAIYICLAMELMLFIERLYMGIVIILVKLFLKKPDKRYKWEAMRED  88

Query  741  LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            LE  N  +P VLVQ+PMFNEKEVYK+SIGA C  +WPSDRL++Q+LDDST+  ++ LVE 
Sbjct  89   LEIGNAGFPMVLVQIPMFNEKEVYKVSIGAACNLSWPSDRLVIQVLDDSTDPLIKDLVEK  148

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC  W  +G+N++Y+ R +R GYKAGAL+EGLK+ YV DCE+V IFDADF+P+ DFL R 
Sbjct  149  ECLRWASKGINIRYQIRESRGGYKAGALKEGLKRDYVKDCEYVVIFDADFRPEPDFLRRA  208

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            IP+L+ N E+ALVQ RW+FVN++EC++TR+QEMSLDYHFTVEQEVGSST +FFGFNGT G
Sbjct  209  IPFLVHNSEIALVQGRWRFVNSNECLLTRMQEMSLDYHFTVEQEVGSSTHAFFGFNGTGG  268

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ A+++AGGWKDRTTVEDMDLAVRASL+GWKFLY+GDL+VK+ELPSTFKA+RFQQHR
Sbjct  269  VWRIAAINEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGDLQVKSELPSTFKAFRFQQHR  328

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  329  WSCGPANL  336



>ref|XP_009403734.1| PREDICTED: probable mannan synthase 9 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=555

 Score =   466 bits (1200),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 206/315 (65%), Positives = 267/315 (85%), Gaps = 1/315 (0%)
 Frame = -1

Query  942  VESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYK  763
            V  L   W+ ++ P++VP+L+IA+  C+ MSVMLF+E++YMA VI+ VK   R+  TRYK
Sbjct  17   VTQLGMVWEQVKAPVIVPLLRIAVFLCLAMSVMLFVEKVYMATVILAVKLLRRRPETRYK  76

Query  762  LDALKEDLEQ-NQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDN  586
             + +++D+E+ +  YP VLVQ+PMFNEKEVY+LSIGA CG +WPSDRLI+Q+LDDST+  
Sbjct  77   WEPMEDDMERGSAAYPMVLVQIPMFNEKEVYQLSIGAACGLSWPSDRLIIQVLDDSTDPA  136

Query  585  LRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPD  406
            ++++V+ EC+ W  +GVN++YE R+NR GYKAGAL+ G+K +YV DC++V IFDADFQPD
Sbjct  137  IKEMVQVECRRWASKGVNIRYEIRDNRVGYKAGALKMGMKHRYVKDCDYVVIFDADFQPD  196

Query  405  HDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFF  226
             DFL RTIP+L+ NP++ LVQ RW+FVNADEC+MTR+QEMSLDYHF +EQEVGSST +FF
Sbjct  197  PDFLCRTIPFLIHNPQIGLVQGRWRFVNADECLMTRMQEMSLDYHFAIEQEVGSSTYAFF  256

Query  225  GFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKA  46
            GFNGTAGVWR+ A+++AGGWKDRTTVEDMDLAVRASL+GWKF+++ DL VK+ELPSTFKA
Sbjct  257  GFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLKGWKFIFLNDLGVKSELPSTFKA  316

Query  45   YRFQQHRWSCGPANL  1
            +R QQHRWSCGPANL
Sbjct  317  FRHQQHRWSCGPANL  331



>ref|XP_003539806.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Glycine 
max]
 gb|KHN21108.1| Glucomannan 4-beta-mannosyltransferase 2 [Glycine soja]
Length=543

 Score =   466 bits (1198),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 205/322 (64%), Positives = 268/322 (83%), Gaps = 1/322 (0%)
 Frame = -1

Query  963  NGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGR  784
            NG+       +K  W+ I+ P++VP+L +A+   + M++MLF+ER+YM IVI++VK F +
Sbjct  15   NGVNFDVAAQIKMVWEVIKAPLIVPLLNLAVYISLAMALMLFMERVYMGIVIILVKLFWK  74

Query  783  KRYTRYKLDALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQIL  607
            K + RYK + L++D E  N NYP VLVQ+PMFNEKEVYK+SIGA C  +WP DRL++Q+L
Sbjct  75   KPHQRYKFEPLQDDEELGNSNYPVVLVQIPMFNEKEVYKVSIGAACNLSWPVDRLVIQVL  134

Query  606  DDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIF  427
            DDST+  ++++VE EC  W  +G+N+ Y+ R  R GYKAGAL+EGLK+ YV  CE+VAIF
Sbjct  135  DDSTDPTIKQMVEMECNRWASKGINIVYQIRETRGGYKAGALKEGLKRNYVKHCEYVAIF  194

Query  426  DADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVG  247
            DADF+P+ DFL R+IP+L+ NP++ALVQARW+FVN+DEC++TR+QEMSLDYHFTVEQEVG
Sbjct  195  DADFRPEPDFLRRSIPFLVGNPDIALVQARWRFVNSDECLLTRMQEMSLDYHFTVEQEVG  254

Query  246  SSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNE  67
            S+T +FFGFNGTAG+WR+ A+++AGGWKDRTTVEDMDLAVRASLRGWKFLY+GDL+ K+E
Sbjct  255  SATHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGDLQAKSE  314

Query  66   LPSTFKAYRFQQHRWSCGPANL  1
            LPST +A+RFQQHRWSCGPANL
Sbjct  315  LPSTLRAFRFQQHRWSCGPANL  336



>ref|NP_001131007.1| uncharacterized protein LOC100192112 [Zea mays]
 gb|ACF79431.1| unknown [Zea mays]
 gb|ACG40011.1| CSLA1 - cellulose synthase-like family A; mannan synthase [Zea 
mays]
 gb|AFW66229.1| CSLA1-cellulose synthase-like family isoform 1 [Zea mays]
 gb|AFW66230.1| CSLA1-cellulose synthase-like family isoform 2 [Zea mays]
Length=514

 Score =   465 bits (1196),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 208/316 (66%), Positives = 270/316 (85%), Gaps = 2/316 (1%)
 Frame = -1

Query  942  VESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYK  763
            +++L  AW  +R P++VP+L++A++ C+ MSV+LFLER+YMA+VI  V+    +   RY+
Sbjct  1    MDALPEAWSQVRAPVIVPLLRLAVAVCLTMSVLLFLERVYMAVVISGVRLLRLRPDRRYR  60

Query  762  LDALKEDLEQ--NQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTND  589
             D L ED  +  +  +P VLVQ+PMFNE+EVY+LSIGAVCG +WP+DRL+VQ+LDDST++
Sbjct  61   CDPLPEDDPELGSSAFPVVLVQIPMFNEREVYQLSIGAVCGLSWPADRLVVQVLDDSTDE  120

Query  588  NLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQP  409
             ++++V  EC+ W R+G+N+ Y+ R +R GYKAGALR G++  YV DCE+VAIFDADFQP
Sbjct  121  VIKEMVRMECERWARKGINITYQIREDRKGYKAGALRAGMRHAYVRDCEYVAIFDADFQP  180

Query  408  DHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSF  229
            D D+L RTIPYL+ NPE+ALVQARW+FVNADEC+MTR+QEMSLDYHFTVEQEV SS C+F
Sbjct  181  DPDYLKRTIPYLVHNPEIALVQARWRFVNADECLMTRMQEMSLDYHFTVEQEVSSSVCAF  240

Query  228  FGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFK  49
            FGFNGTAGVWR+ A+++AGGWKDRTTVEDMDLA+RASL+GWKF+Y+GD++VK+ELPSTFK
Sbjct  241  FGFNGTAGVWRISAVNEAGGWKDRTTVEDMDLAIRASLKGWKFVYLGDVQVKSELPSTFK  300

Query  48   AYRFQQHRWSCGPANL  1
            A+RFQQHRWSCGPANL
Sbjct  301  AFRFQQHRWSCGPANL  316



>ref|XP_003551076.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Glycine 
max]
 gb|KHN21460.1| Glucomannan 4-beta-mannosyltransferase 2 [Glycine soja]
Length=533

 Score =   465 bits (1197),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 203/308 (66%), Positives = 264/308 (86%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W+ ++VP++VP+LK+ +  C+ MS+MLF+ER+YM IVI++VK F +K   RY    L++D
Sbjct  29   WELVKVPLIVPLLKLGVYICLAMSLMLFMERLYMGIVIILVKLFWKKPEQRYNYKPLQDD  88

Query  741  LEQNQN-YPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            +E     +P VL+Q+PMFNEKEVYK+SIGA CG +WPSDRL++Q+LDDST+  ++++VE 
Sbjct  89   VELGSFIFPTVLIQIPMFNEKEVYKVSIGAACGLSWPSDRLVIQVLDDSTDTVIKEMVEQ  148

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC  W  +G+N+ Y+ R NR GYKAGAL+EGLK+ YV+ CE+VAIFDADF+P+ DFL R 
Sbjct  149  ECLRWASKGINITYQIRENRTGYKAGALKEGLKRSYVEHCEYVAIFDADFRPEPDFLRRA  208

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            IP+L+ NPE+ALVQARW+FVNA+EC++TR+QEMSLDYHFTVEQEVGS+T +FFGFNGTAG
Sbjct  209  IPFLVGNPEIALVQARWRFVNANECLLTRMQEMSLDYHFTVEQEVGSATHAFFGFNGTAG  268

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            +WR+ A+++AGGWKDRTTVEDMDLAVRASLRGWKFLY+GDL+ K+ELPST +A+RFQQHR
Sbjct  269  IWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGDLQAKSELPSTLRAFRFQQHR  328

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  329  WSCGPANL  336



>gb|KEH42109.1| cellulose synthase-like protein A1 [Medicago truncatula]
Length=522

 Score =   465 bits (1196),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 208/312 (67%), Positives = 264/312 (85%), Gaps = 1/312 (0%)
 Frame = -1

Query  933  LKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDA  754
            L   W  IR P++VP+L+ A+  C+ MS+M+ +E +YM IVI +VK F R    RYK + 
Sbjct  15   LAFIWRKIREPLIVPMLRAAVFICLSMSLMILVEIVYMGIVICLVKLFKRTPEKRYKWET  74

Query  753  LKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRK  577
            +K+D+E +N NYP VLVQ+PM+NE+EVY+LSIGA C  +WPSDR+I+QILDDST+  +++
Sbjct  75   IKDDVELENSNYPIVLVQIPMYNEREVYQLSIGAACELSWPSDRIIIQILDDSTDPTIKE  134

Query  576  LVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDF  397
            LV++EC+ W  +GVN+KYE R+NRNGYKAGAL+EG+K  +V  CE+VAIFDADFQP+ DF
Sbjct  135  LVQEECRRWRNKGVNIKYEVRDNRNGYKAGALKEGMKHSHVLQCEYVAIFDADFQPEPDF  194

Query  396  LWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFN  217
            L +TIP+L+ NPE+ LVQARWKFVNA+EC+MTR+Q+MSLDYHFTVEQEVGSST +FFGFN
Sbjct  195  LCQTIPFLVNNPEIGLVQARWKFVNANECLMTRMQKMSLDYHFTVEQEVGSSTYAFFGFN  254

Query  216  GTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRF  37
            GTAGVWR+ AL++AGGWKDRTTVEDMDL+VRASL GWKFLY+ +++VKNELPST  AYR+
Sbjct  255  GTAGVWRISALNEAGGWKDRTTVEDMDLSVRASLEGWKFLYLSNIQVKNELPSTLNAYRY  314

Query  36   QQHRWSCGPANL  1
            QQHRWSCGPANL
Sbjct  315  QQHRWSCGPANL  326



>gb|AFZ78578.1| cellulose synthase-like protein [Populus tomentosa]
Length=530

 Score =   465 bits (1196),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 207/286 (72%), Positives = 253/286 (88%), Gaps = 1/286 (0%)
 Frame = -1

Query  855  MSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKEDLE-QNQNYPKVLVQVPMFNEKE  679
            MS+MLF+ER+YM +VIV VK FG+K   RYK + +K+D+E  N  YP VLVQVPM+NEKE
Sbjct  48   MSIMLFIERVYMGVVIVFVKLFGKKPNKRYKWEPIKDDIELGNSAYPMVLVQVPMYNEKE  107

Query  678  VYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNG  499
            VY+LSIGA CG +WPSDR+I+Q+LDDST+  ++ +VE EC+ W  +G+N+KYE R++RNG
Sbjct  108  VYQLSIGAACGLSWPSDRIIIQVLDDSTDPAIKSMVEVECQRWASKGINIKYEIRDSRNG  167

Query  498  YKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNA  319
            YKAGAL+EG+K  YV  C++VAIFDADFQP+ DFLWRTIP+L  NPE+ALVQARWKFVN+
Sbjct  168  YKAGALKEGMKHSYVKQCDYVAIFDADFQPEPDFLWRTIPFLAHNPEIALVQARWKFVNS  227

Query  318  DECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDM  139
            DEC+MTR+QEMSLDYHFTVEQEVGS+T +FFGFNGTAGVWR+ A+++AGGWK RTTVEDM
Sbjct  228  DECLMTRMQEMSLDYHFTVEQEVGSATYAFFGFNGTAGVWRISAVNEAGGWKARTTVEDM  287

Query  138  DLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHRWSCGPANL  1
            DLAVRASL+GWKF+Y+GDL+VKNELPSTFKAYR+QQHRWSCGPANL
Sbjct  288  DLAVRASLQGWKFVYVGDLKVKNELPSTFKAYRYQQHRWSCGPANL  333



>ref|XP_008385455.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2 [Malus domestica]
Length=549

 Score =   466 bits (1198),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 202/308 (66%), Positives = 265/308 (86%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W+ I+ P++VP+L + +   + MS+MLF ER+YM +VIV+VK F +K   RYK + +++D
Sbjct  29   WELIKAPLIVPLLTVGVYVSLAMSLMLFFERVYMGVVIVLVKLFWKKPEERYKYEPIQDD  88

Query  741  LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            LE  + N+P VL+Q+PMFNE+EVYK+SIGA CG +WPSDRL++Q+LDDST+  ++++VE 
Sbjct  89   LEVGSSNFPVVLIQIPMFNEREVYKVSIGAACGLSWPSDRLVIQVLDDSTDPTIKQMVEL  148

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC+ W  +G+N++Y+ R  R GYKAGAL+EGLK+ YV  CE+VAIFDADF+P+ D+L R 
Sbjct  149  ECQRWASKGINIRYQIRETRGGYKAGALKEGLKRSYVKHCEYVAIFDADFRPEPDYLRRA  208

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            IP+L+ NP++ALVQARW+FVN+DEC++TR+QEMSLDYHFTVEQEVGS+T +FFGFNGTAG
Sbjct  209  IPFLVHNPDIALVQARWRFVNSDECLLTRMQEMSLDYHFTVEQEVGSATHAFFGFNGTAG  268

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ A+++AGGWKDRTTVEDMDLAVRASLRGWKFLY+GDL+VK+ELPSTF A+RFQQHR
Sbjct  269  VWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGDLQVKSELPSTFNAFRFQQHR  328

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  329  WSCGPANL  336



>ref|XP_011010406.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X1 [Populus euphratica]
Length=546

 Score =   465 bits (1197),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 208/286 (73%), Positives = 252/286 (88%), Gaps = 1/286 (0%)
 Frame = -1

Query  855  MSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKEDLE-QNQNYPKVLVQVPMFNEKE  679
            MS+M+F+ER+YM +VIV VK FG+K   RYK + +K+D+E  N  YP VLVQVPM+NEKE
Sbjct  48   MSIMIFIERVYMGVVIVFVKLFGKKPNKRYKWEPIKDDIELGNSAYPMVLVQVPMYNEKE  107

Query  678  VYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNG  499
            VY+LSIGA CG +WPSDR+I+Q+LDDST+  ++ LVE EC+ W  +G+ +KYE R+NRNG
Sbjct  108  VYQLSIGAACGLSWPSDRIIIQVLDDSTDPAIKSLVEVECQRWASKGITIKYEMRDNRNG  167

Query  498  YKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNA  319
            YKAGAL+EG+K  YV  C F+AIFDADFQP+ DFLWRTIP+L  NPE+ALVQARWKFVN+
Sbjct  168  YKAGALKEGMKHSYVKQCFFLAIFDADFQPEPDFLWRTIPFLAHNPEIALVQARWKFVNS  227

Query  318  DECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDM  139
            DEC+MTR+QEMSLDYHFTVEQEVGS+T +FFGFNGTAGVWR+ A+++AGGWKDRTTVEDM
Sbjct  228  DECLMTRMQEMSLDYHFTVEQEVGSATYAFFGFNGTAGVWRISAVNEAGGWKDRTTVEDM  287

Query  138  DLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHRWSCGPANL  1
            DLAVRASL+GWKF+Y+GDL+VKNELPSTFKAYR+QQHRWSCGPANL
Sbjct  288  DLAVRASLKGWKFVYVGDLKVKNELPSTFKAYRYQQHRWSCGPANL  333



>ref|XP_009337395.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Pyrus 
x bretschneideri]
Length=549

 Score =   465 bits (1197),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 205/329 (62%), Positives = 270/329 (82%), Gaps = 1/329 (0%)
 Frame = -1

Query  984  IVFSEPGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIV  805
            ++  E   G        L   W+ I+ P++VP+L + +   + MS+MLF ER+YM +VIV
Sbjct  8    VLIPETFQGTTNDIAGQLGLIWELIKAPLIVPLLTVGVYVSLAMSLMLFFERVYMGVVIV  67

Query  804  VVKCFGRKRYTRYKLDALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSD  628
            +VK F +K   RYK + +++DLE  + N+P VL+Q+PMFNE+EVYK+SIGA CG +WPSD
Sbjct  68   LVKLFWKKPEERYKYEPIQDDLEVGSSNFPVVLIQIPMFNEREVYKVSIGAACGLSWPSD  127

Query  627  RLIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDD  448
            RL++Q+LDDST+  ++++VE EC+ W  +G+N++Y+ R  R GYKAGAL+EGLK+ YV  
Sbjct  128  RLVIQVLDDSTDPTIKQMVELECQRWASKGINIRYQIRETRGGYKAGALKEGLKRSYVKH  187

Query  447  CEFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHF  268
            CE+VAIFDADF+P+ D+L R IP+L+ NP++ALVQARW+FVN+DEC++TR+QEMSLDYHF
Sbjct  188  CEYVAIFDADFRPEPDYLRRAIPFLVHNPDIALVQARWRFVNSDECLLTRMQEMSLDYHF  247

Query  267  TVEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIG  88
            TVEQEVGS+T +FFGFNGTAGVWR+ A+++AGGWKDRTTVEDMDLAVRASLRGWKFLY+G
Sbjct  248  TVEQEVGSATHAFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLG  307

Query  87   DLEVKNELPSTFKAYRFQQHRWSCGPANL  1
            DL+VK+ELPSTF A+RFQQHRWSCGPANL
Sbjct  308  DLQVKSELPSTFNAFRFQQHRWSCGPANL  336



>ref|XP_008360269.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Malus 
domestica]
Length=549

 Score =   465 bits (1197),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 203/308 (66%), Positives = 264/308 (86%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W+ I+ P++VP+L + +     MS+MLF ER+YM +VIV+VK F +K   RYK + +++D
Sbjct  29   WELIKAPLIVPLLTVGVYVSXAMSLMLFFERVYMGVVIVLVKLFWKKPEQRYKYEPIQDD  88

Query  741  LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            LE  + N+P VL+Q+PMFNE+EVYK+SIGA CG +WPSDRL++Q+LDDST+  ++++VE 
Sbjct  89   LELGSSNFPVVLIQIPMFNEREVYKVSIGAACGLSWPSDRLVIQVLDDSTDPTIKQMVEL  148

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC+ W  +G+N++Y+ R  R GYKAGAL+EGLK+ YV  CE+VAIFDADF+P+ D+L R 
Sbjct  149  ECQRWASKGINIRYQIRETRGGYKAGALKEGLKRSYVKHCEYVAIFDADFRPEPDYLRRA  208

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            IP+L+ NP++ALVQARW+FVNADEC++TR+QEMSLDYHFTVEQEVGS+T +FFGFNGTAG
Sbjct  209  IPFLVHNPDIALVQARWRFVNADECLLTRMQEMSLDYHFTVEQEVGSATHAFFGFNGTAG  268

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ A+++AGGWKDRTTVEDMDLAVRASLRGWKFLY+GDL+VK+ELPSTF A+RFQQHR
Sbjct  269  VWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGDLQVKSELPSTFNAFRFQQHR  328

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  329  WSCGPANL  336



>ref|XP_006484970.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Citrus 
sinensis]
Length=537

 Score =   464 bits (1195),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 201/308 (65%), Positives = 267/308 (87%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W+ ++ P++VP+LK+ +  C+ MS+MLF+ER+YM IVI++VK F +K   RY    +++D
Sbjct  29   WELLKAPLIVPLLKLGVYICLAMSLMLFMERVYMGIVIILVKLFWQKPEKRYNWQPIEDD  88

Query  741  LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            +E  + N+P VL+Q+PMFNEKEVYK+SIGA CG +WPSDRL++Q+LDDST+  ++++VE 
Sbjct  89   VELGSSNFPVVLIQIPMFNEKEVYKISIGAACGLSWPSDRLVIQVLDDSTDPAIKQMVEQ  148

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC+ W  +G+N++Y+ R NR GYKAGAL+EGLK+ YV  CE+VAIFDADF+P+ D+L R 
Sbjct  149  ECQRWAAKGINIRYQIRENRTGYKAGALKEGLKRSYVKHCEYVAIFDADFRPEPDYLRRA  208

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            IPYL++N ++ALVQARW+FVN+DEC++TR+QEMSLDYHF VEQEVGS+T +FFGFNGTAG
Sbjct  209  IPYLVQNSDIALVQARWRFVNSDECLLTRMQEMSLDYHFKVEQEVGSATHAFFGFNGTAG  268

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ A+++AGGWKDRTTVEDMDLAVRASL+GWKF+Y+GDL+VK+ELPSTFKA+RFQQHR
Sbjct  269  VWRIAAINEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGDLQVKSELPSTFKAFRFQQHR  328

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  329  WSCGPANL  336



>ref|XP_004170553.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
sativus]
Length=537

 Score =   464 bits (1195),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 210/317 (66%), Positives = 268/317 (85%), Gaps = 1/317 (0%)
 Frame = -1

Query  948  TPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTR  769
            T  + ++   ++I+  I+VP+L+ A+  C+ MS+ML +ER+YM IVI +VK F RK   R
Sbjct  22   TSFQVIRLICEAIKSVIVVPLLRGAVYICLTMSLMLLIERVYMGIVIGLVKLFKRKPEKR  81

Query  768  YKLDALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTN  592
            YK + +++DLE  N  YP VLVQ+PM+NEKEVY+LSIGA C  +WPSDR+I+Q+LDDST+
Sbjct  82   YKWEPMEDDLELGNSVYPMVLVQIPMYNEKEVYQLSIGAACDLSWPSDRIIIQVLDDSTD  141

Query  591  DNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQ  412
              ++ LVE EC+ W  +G+ +KYE R+NRNGYKAGAL+EGLK+ YV  C++V IFDADFQ
Sbjct  142  PTVKGLVEKECERWASKGITIKYEIRDNRNGYKAGALKEGLKRSYVKLCDYVVIFDADFQ  201

Query  411  PDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCS  232
            P+ DFL RT+P+L+ NP++ALVQARWKFVNA+EC+MTR+QEMSLDYHFTVEQEVGSST +
Sbjct  202  PEPDFLRRTVPFLIHNPKIALVQARWKFVNANECLMTRMQEMSLDYHFTVEQEVGSSTYA  261

Query  231  FFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTF  52
            FFGFNGTAGVWR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKFLY+G+++VKNELPST 
Sbjct  262  FFGFNGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGNIQVKNELPSTL  321

Query  51   KAYRFQQHRWSCGPANL  1
            KA+R+QQHRWSCGPANL
Sbjct  322  KAFRYQQHRWSCGPANL  338



>ref|XP_004143299.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
sativus]
 gb|KGN48230.1| hypothetical protein Csa_6G450350 [Cucumis sativus]
Length=537

 Score =   464 bits (1195),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 210/317 (66%), Positives = 268/317 (85%), Gaps = 1/317 (0%)
 Frame = -1

Query  948  TPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTR  769
            T  + ++   ++I+  I+VP+L+ A+  C+ MS+ML +ER+YM IVI +VK F RK   R
Sbjct  22   TSFQVIRLICEAIKSVIVVPLLRGAVYICLTMSLMLLIERVYMGIVIGLVKLFKRKPEKR  81

Query  768  YKLDALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTN  592
            YK + +++DLE  N  YP VLVQ+PM+NEKEVY+LSIGA C  +WPSDR+I+Q+LDDST+
Sbjct  82   YKWEPMEDDLELGNSVYPMVLVQIPMYNEKEVYQLSIGAACDLSWPSDRIIIQVLDDSTD  141

Query  591  DNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQ  412
              ++ LVE EC+ W  +G+ +KYE R+NRNGYKAGAL+EGLK+ YV  C++V IFDADFQ
Sbjct  142  PTVKGLVEKECERWASKGITIKYEIRDNRNGYKAGALKEGLKRSYVKLCDYVVIFDADFQ  201

Query  411  PDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCS  232
            P+ DFL RT+P+L+ NP++ALVQARWKFVNA+EC+MTR+QEMSLDYHFTVEQEVGSST +
Sbjct  202  PEPDFLRRTVPFLIHNPKIALVQARWKFVNANECLMTRMQEMSLDYHFTVEQEVGSSTYA  261

Query  231  FFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTF  52
            FFGFNGTAGVWR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKFLY+G+++VKNELPST 
Sbjct  262  FFGFNGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGNIQVKNELPSTL  321

Query  51   KAYRFQQHRWSCGPANL  1
            KA+R+QQHRWSCGPANL
Sbjct  322  KAFRYQQHRWSCGPANL  338



>ref|XP_008458630.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2 [Cucumis 
melo]
Length=539

 Score =   464 bits (1195),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 206/323 (64%), Positives = 271/323 (84%), Gaps = 4/323 (1%)
 Frame = -1

Query  966  GNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFG  787
            G G +T   E +   W+ I+ P++VP+L++ +   + MS+MLF ER+YM IVI++VK F 
Sbjct  16   GRGDFT---EQIWLIWELIKAPLIVPVLRLMVYISLAMSLMLFFERLYMGIVIILVKLFW  72

Query  786  RKRYTRYKLDALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQI  610
            +K   RYK + +++DLE  + N+P VL+Q+PMFNE+EVYK+SIGA CG +WP+DRL++Q+
Sbjct  73   KKPEKRYKYEPIQDDLELGSSNFPHVLIQIPMFNEREVYKISIGAACGLSWPADRLVIQV  132

Query  609  LDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAI  430
            LDDST+  ++++VE EC  W  +G+N+ Y+ R  R GYKAGAL+EGLK+ YV  CE+VAI
Sbjct  133  LDDSTDPVIKQMVEQECLRWASKGINITYQIRETRGGYKAGALKEGLKRSYVKHCEYVAI  192

Query  429  FDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEV  250
            FDADF+P+ D+L R IP+L+ NP++ALVQARW+FVNADEC++TR+QEMSLDYHFTVEQEV
Sbjct  193  FDADFRPEPDYLRRAIPFLVHNPDIALVQARWRFVNADECLLTRMQEMSLDYHFTVEQEV  252

Query  249  GSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKN  70
            GS+T +FFGFNGTAGVWR+ A+++AGGWKDRTTVEDMDLAVRASLRGWKF+Y+GDL+VK+
Sbjct  253  GSATHAFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFVYLGDLQVKS  312

Query  69   ELPSTFKAYRFQQHRWSCGPANL  1
            ELPSTFKA+RFQQHRWSCGPANL
Sbjct  313  ELPSTFKAFRFQQHRWSCGPANL  335



>gb|KEH42113.1| cellulose synthase-like protein A1 [Medicago truncatula]
Length=523

 Score =   464 bits (1194),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 210/315 (67%), Positives = 266/315 (84%), Gaps = 1/315 (0%)
 Frame = -1

Query  942  VESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYK  763
            V  L+  W +IR P++VP+L+  +  C+ +S+++ +E++YMAIVI  VK F R    RYK
Sbjct  12   VMQLEFIWKNIREPLIVPMLRWTVYLCLGLSLIMLVEKVYMAIVICYVKLFKRTPEKRYK  71

Query  762  LDALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDN  586
             +A+++D+E  N  YP VLVQ+PM+NE+EVY+LSIGA C  +WPSDR+I+QILDDST+  
Sbjct  72   FEAIEDDVELGNSYYPMVLVQIPMYNEREVYQLSIGAACELSWPSDRIIIQILDDSTDPT  131

Query  585  LRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPD  406
            +++LV++EC+ W  +GVN+KYE R+NRNGYKAGAL+EG+K  +V  CE+VAIFDADFQP+
Sbjct  132  IKELVQEECRRWRNKGVNIKYEVRDNRNGYKAGALKEGMKHSHVLQCEYVAIFDADFQPE  191

Query  405  HDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFF  226
             DFL RTIP+L+ NPE+ LVQARWKFVNA+EC+MTR+Q+MSLDYHF VEQEVGSS  +FF
Sbjct  192  PDFLRRTIPFLVNNPEIGLVQARWKFVNANECLMTRMQQMSLDYHFKVEQEVGSSAYAFF  251

Query  225  GFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKA  46
            GFNGTAGVWR+ AL++AGGWKDRTTVEDMDLAVRASL GWKFLY+ +LEVKNELPSTFKA
Sbjct  252  GFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLEGWKFLYLCNLEVKNELPSTFKA  311

Query  45   YRFQQHRWSCGPANL  1
            YR+QQHRWSCGPANL
Sbjct  312  YRYQQHRWSCGPANL  326



>ref|XP_004303037.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Fragaria 
vesca subsp. vesca]
Length=533

 Score =   464 bits (1193),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 203/309 (66%), Positives = 264/309 (85%), Gaps = 1/309 (0%)
 Frame = -1

Query  924  AWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKE  745
             W+ I+ P+++P+L++A++ C++MSVM+F ER+YM +VI++V  FGRK   RYK + +K+
Sbjct  28   VWNMIKEPLIIPLLRMAVAMCLVMSVMIFAERLYMGVVIILVHVFGRKPEKRYKWEPIKD  87

Query  744  DLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVE  568
            D+E  + NYP VLVQ+PMFNE+EVY+LSIGA C  TWPSDRLI+Q+LDDST+   + +VE
Sbjct  88   DVELGSSNYPMVLVQIPMFNEREVYQLSIGACCSLTWPSDRLIIQVLDDSTDPTCKAMVE  147

Query  567  DECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWR  388
             EC+ W  +G+N+KYE R+NR GYK+GAL+EGLK+ Y  +C++VAIFDADFQP+ DFL R
Sbjct  148  RECQRWAGKGINIKYEIRDNRTGYKSGALKEGLKRSYAKNCDYVAIFDADFQPEPDFLSR  207

Query  387  TIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTA  208
            +IP+ + NP +ALVQARW+FVN +EC+MTR QEMSLDYHF +EQEVGSST +FFGFNGTA
Sbjct  208  SIPFFVHNPNVALVQARWRFVNNNECLMTRFQEMSLDYHFKIEQEVGSSTHAFFGFNGTA  267

Query  207  GVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQH  28
            GVWR+ A+++AGGWKDRTTVEDMDLAVRASL+GWKF+Y+G L+VK+ELPSTFKA+R QQH
Sbjct  268  GVWRIAAINEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGTLQVKSELPSTFKAFRHQQH  327

Query  27   RWSCGPANL  1
            RWSCGPANL
Sbjct  328  RWSCGPANL  336



>ref|XP_004145779.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Cucumis 
sativus]
Length=539

 Score =   464 bits (1194),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 206/323 (64%), Positives = 271/323 (84%), Gaps = 4/323 (1%)
 Frame = -1

Query  966  GNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFG  787
            G G +T   E +   W+ I+ P++VP+L++ +   + MS+MLF ER+YM IVI++VK F 
Sbjct  16   GRGDFT---EQIWLIWELIKAPLIVPVLRLMVYISLAMSLMLFFERLYMGIVIILVKLFW  72

Query  786  RKRYTRYKLDALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQI  610
            +K   RYK + +++DLE  + N+P VL+Q+PMFNE+EVYK+SIGA CG +WP+DRL++Q+
Sbjct  73   KKPEKRYKYEPIQDDLELGSSNFPHVLIQIPMFNEREVYKISIGAACGLSWPADRLVIQV  132

Query  609  LDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAI  430
            LDDST+  ++++VE EC  W  +G+N+ Y+ R  R GYKAGAL+EGLK+ YV  CE+VAI
Sbjct  133  LDDSTDPVIKQMVEQECLRWASKGINITYQIRETRGGYKAGALKEGLKRSYVKHCEYVAI  192

Query  429  FDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEV  250
            FDADF+P+ D+L R IP+L+ NP++ALVQARW+FVNADEC++TR+QEMSLDYHFTVEQEV
Sbjct  193  FDADFRPEPDYLRRAIPFLVNNPDIALVQARWRFVNADECLLTRMQEMSLDYHFTVEQEV  252

Query  249  GSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKN  70
            GS+T +FFGFNGTAGVWR+ A+++AGGWKDRTTVEDMDLAVRASLRGWKF+Y+GDL+VK+
Sbjct  253  GSATHAFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFVYLGDLQVKS  312

Query  69   ELPSTFKAYRFQQHRWSCGPANL  1
            ELPSTFKA+RFQQHRWSCGPANL
Sbjct  313  ELPSTFKAFRFQQHRWSCGPANL  335



>gb|AFZ78579.1| cellulose synthase-like protein [Populus tomentosa]
Length=540

 Score =   464 bits (1194),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 205/314 (65%), Positives = 267/314 (85%), Gaps = 1/314 (0%)
 Frame = -1

Query  939  ESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKL  760
            + LK  W+ I+ P++VP+L + +   + MS+MLF+ER+YM IVI++VK F +K   RYK 
Sbjct  25   DQLKLIWELIKAPLIVPLLTLGVYISLAMSLMLFMERVYMGIVIILVKLFWKKPEKRYKW  84

Query  759  DALKEDLEQ-NQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNL  583
            + +++D+E  N N+P VLVQ+PMFNEKEVYKLSIGA    +WP+DRL++Q+LDDST+  +
Sbjct  85   EPMQDDIESGNLNFPVVLVQIPMFNEKEVYKLSIGAASNLSWPADRLVIQVLDDSTDPAI  144

Query  582  RKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDH  403
            +++VE EC+ W  +G++++Y+ R NR GYKAGAL+EGLK+ YV  CE+V IFDADFQP+ 
Sbjct  145  KQMVELECQRWASKGIDIRYQIRENRTGYKAGALKEGLKRSYVKHCEYVCIFDADFQPEP  204

Query  402  DFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFG  223
            DFL R IP+L+ NP++ALVQARW+FVNADEC++TR+QEMSLDYHFTVEQEVGS+T +FFG
Sbjct  205  DFLRRAIPFLVHNPDVALVQARWRFVNADECLLTRMQEMSLDYHFTVEQEVGSATHAFFG  264

Query  222  FNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAY  43
            FNGTAGVWR+ A+++AGGWKDRTTVEDMDLAVRASLRGWKF+Y+GDL VK+ELPSTF+A+
Sbjct  265  FNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFVYLGDLHVKSELPSTFQAF  324

Query  42   RFQQHRWSCGPANL  1
            RFQQHRWSCGPANL
Sbjct  325  RFQQHRWSCGPANL  338



>sp|Q67VS7.1|CSLA9_ORYSJ RecName: Full=Probable mannan synthase 9; AltName: Full=Cellulose 
synthase-like protein A9; AltName: Full=OsCslA9 [Oryza 
sativa Japonica Group]
 gb|AAL25128.1|AF432499_1 cellulose synthase-like protein OsCslA9 [Oryza sativa]
 dbj|BAD37742.1| putative glycosyltransferase 1 [Oryza sativa Japonica Group]
 gb|EEC81007.1| hypothetical protein OsI_23768 [Oryza sativa Indica Group]
 gb|EEE66045.1| hypothetical protein OsJ_22033 [Oryza sativa Japonica Group]
Length=527

 Score =   463 bits (1192),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 207/322 (64%), Positives = 268/322 (83%), Gaps = 9/322 (3%)
 Frame = -1

Query  939  ESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKL  760
            E +   W+ ++ P++VP+L+++++ C+ MSVMLF+E++YM++V+V V  FGR+   RY+ 
Sbjct  10   EQIAAMWEQVKAPVVVPLLRLSVAACLAMSVMLFVEKVYMSVVLVGVHLFGRRPDRRYRC  69

Query  759  DAL---------KEDLEQNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQIL  607
            D +          E  + N  +P VL+Q+PM+NE+EVYKLSIGA CG +WPSDR+IVQ+L
Sbjct  70   DPIVAAGADNDDPELADANAAFPMVLIQIPMYNEREVYKLSIGAACGLSWPSDRVIVQVL  129

Query  606  DDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIF  427
            DDST+  ++++V+ ECK W  +GV +KYE R+NR GYKAGALREG+K  YV DC++VAIF
Sbjct  130  DDSTDPVIKEMVQVECKRWESKGVRIKYEIRDNRVGYKAGALREGMKHGYVRDCDYVAIF  189

Query  426  DADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVG  247
            DADFQPD DFL RTIP+L+ NP++ALVQARWKFVNA+EC+MTR+QEMSLDYHF VEQEVG
Sbjct  190  DADFQPDPDFLARTIPFLVHNPDIALVQARWKFVNANECLMTRMQEMSLDYHFKVEQEVG  249

Query  246  SSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNE  67
            SST +FFGFNGTAGVWR+ A+++AGGWKDRTTVEDMDLAVRA L+GWKF+Y+GDL VK+E
Sbjct  250  SSTHAFFGFNGTAGVWRISAMNEAGGWKDRTTVEDMDLAVRAGLKGWKFVYLGDLMVKSE  309

Query  66   LPSTFKAYRFQQHRWSCGPANL  1
            LPSTFKA+R+QQHRWSCGPANL
Sbjct  310  LPSTFKAFRYQQHRWSCGPANL  331



>ref|XP_004241301.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Solanum 
lycopersicum]
Length=533

 Score =   463 bits (1192),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 208/328 (63%), Positives = 267/328 (81%), Gaps = 1/328 (0%)
 Frame = -1

Query  981  VFSEPGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVV  802
            +F E   G        +   W+ I+ P++VP+L+ A+  C+ M +MLF+ER+YM IVIV+
Sbjct  9    LFPETFQGTAADIAGQIGLMWELIKAPLIVPLLRAAVYICLAMELMLFIERLYMGIVIVL  68

Query  801  VKCFGRKRYTRYKLDALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDR  625
            VK F +K   RY  + +++DLE  N+ +P VLVQ+PMFNEKEVYK+SIGA C  +WP+DR
Sbjct  69   VKLFMKKPDKRYNWEPMRDDLEIGNEGFPMVLVQIPMFNEKEVYKISIGAACNLSWPADR  128

Query  624  LIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDC  445
            L++Q+LDDST+  ++ LVE EC  W  +G+N++Y+ R NR GYKAGAL+EGLK+ YV DC
Sbjct  129  LVIQVLDDSTDPLIKDLVEKECLRWANKGINIRYQIRENRGGYKAGALKEGLKRDYVKDC  188

Query  444  EFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFT  265
            E+V IFDADF+P+ DFL R IP+L+ N E+ALVQ RW+FVNA+EC++TR+QEMSLDYHFT
Sbjct  189  EYVVIFDADFRPEPDFLRRAIPFLVHNSEIALVQGRWRFVNANECLLTRMQEMSLDYHFT  248

Query  264  VEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGD  85
            VEQEVGSST +FFGFNGT GVWR+ A+++AGGWKDRTTVEDMDLAVRASL+GWKFLY+GD
Sbjct  249  VEQEVGSSTHAFFGFNGTGGVWRIAAINEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGD  308

Query  84   LEVKNELPSTFKAYRFQQHRWSCGPANL  1
            L+VK+ELPSTFKA+RFQQHRWSCGPANL
Sbjct  309  LQVKSELPSTFKAFRFQQHRWSCGPANL  336



>ref|XP_004294040.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Fragaria 
vesca subsp. vesca]
Length=540

 Score =   464 bits (1193),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 203/308 (66%), Positives = 264/308 (86%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W+ I+ P++VP+L++ +   + M++MLF+ER+YM IVIV+VK F +K   RY  + ++ED
Sbjct  29   WELIKAPLIVPLLRVGVYVSLAMALMLFVERVYMGIVIVLVKMFWKKPEKRYNYEPIQED  88

Query  741  LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            LE  + N+P VLVQ+PMFNE+EVYK+SIGA CG +WPSDRL++Q+LDDST+  ++K+VE 
Sbjct  89   LELGSSNFPVVLVQIPMFNEREVYKISIGAACGLSWPSDRLVIQVLDDSTDPTIKKMVEA  148

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC+ W  +G+N+ Y+ R +R GYKAGAL+EGLK+ YV  CE+VAI DADF+P+ D+L R 
Sbjct  149  ECQRWASKGINIVYQIRESRGGYKAGALKEGLKRSYVKHCEYVAIMDADFRPEPDYLRRA  208

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            IP+L+ NPE+ALVQARW+FVN+DEC++TR+QEMSLDYHFTVEQEVGS+T +FFGFNGTAG
Sbjct  209  IPFLVHNPEIALVQARWRFVNSDECLLTRMQEMSLDYHFTVEQEVGSATHAFFGFNGTAG  268

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ A+++AGGWKDRTTVEDMDLAVRA LRGWKFLY+GDL+VK+ELPSTF A+RFQQHR
Sbjct  269  VWRIAAINEAGGWKDRTTVEDMDLAVRAGLRGWKFLYLGDLQVKSELPSTFNAFRFQQHR  328

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  329  WSCGPANL  336



>ref|XP_011024272.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Populus 
euphratica]
Length=530

 Score =   463 bits (1192),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 206/286 (72%), Positives = 252/286 (88%), Gaps = 1/286 (0%)
 Frame = -1

Query  855  MSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKEDLE-QNQNYPKVLVQVPMFNEKE  679
            MS+MLF+ER+YM IVIV VK FGRK    YK + +K+D+E  N  YP VLVQ+PM+NEKE
Sbjct  48   MSIMLFIERVYMGIVIVFVKLFGRKPNKMYKWEPMKDDIEVGNSAYPMVLVQIPMYNEKE  107

Query  678  VYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNG  499
            VY+LSIGA CG +WP DR+I+Q+LDDST+  ++ LVE EC+ W  +G+N+KYE R+NR G
Sbjct  108  VYQLSIGAACGLSWPPDRIIIQVLDDSTDPAIKSLVELECQRWASKGINIKYEIRDNRKG  167

Query  498  YKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNA  319
            YKAGAL+EG+K  YV  C++VAIFDADFQP+ ++LWRTIP+L+ NPE+ALVQARWKFVN+
Sbjct  168  YKAGALKEGMKHSYVKQCDYVAIFDADFQPEPNYLWRTIPFLVHNPEIALVQARWKFVNS  227

Query  318  DECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDM  139
            DEC+MTR+QEMSLDYHFTVEQEVGS+T +FFGFNGTAGVWR+ A+++AGGWKDRTTVEDM
Sbjct  228  DECLMTRMQEMSLDYHFTVEQEVGSATYAFFGFNGTAGVWRISAVNEAGGWKDRTTVEDM  287

Query  138  DLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHRWSCGPANL  1
            DLAVRASL+GWKF+Y+GDL+VKNELPSTFKAYR+QQHRWSCGPANL
Sbjct  288  DLAVRASLKGWKFVYVGDLKVKNELPSTFKAYRYQQHRWSCGPANL  333



>ref|XP_010112526.1| hypothetical protein L484_012804 [Morus notabilis]
 gb|EXC33914.1| hypothetical protein L484_012804 [Morus notabilis]
Length=574

 Score =   465 bits (1196),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 217/350 (62%), Positives = 268/350 (77%), Gaps = 43/350 (12%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W  I+ P++VP+L++A+  C++MS+MLFLER+YM IVIV+VK FGRK   RY  + +K+D
Sbjct  29   WGQIKAPLIVPLLQLAVVLCLIMSLMLFLERVYMGIVIVLVKLFGRKPEKRYNWEPIKDD  88

Query  741  LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            LE  N  YP VLVQ+PM+NE EVY+LSIGA CG +WPSDR+ +Q+LDDST+  ++ LVE 
Sbjct  89   LELGNLAYPMVLVQIPMYNEGEVYQLSIGAACGLSWPSDRITIQVLDDSTDPTIKDLVEL  148

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC+ W  +GVN+KYE R+NRNGYKAGAL+EG+K+ YV  C++VAIFDADFQP+ DFLWRT
Sbjct  149  ECQRWASKGVNIKYEIRDNRNGYKAGALKEGMKRSYVKHCDYVAIFDADFQPEPDFLWRT  208

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNG---  214
            +P+L+ NPE+ LVQARWKFVNADEC+MTR+QEMSLDYHFTVEQEVGSST +FFGFNG   
Sbjct  209  VPFLVHNPEIGLVQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAG  268

Query  213  ---------------------------------------TAGVWRLQALHDAGGWKDRTT  151
                                                   TAGVWR+ AL++AGGWKDRTT
Sbjct  269  VWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWKFVYLWTAGVWRIAALNEAGGWKDRTT  328

Query  150  VEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHRWSCGPANL  1
            VEDMDLAVRASL+GWKF+Y+ +L+VKNELPST KAYR+QQHRWSCGPANL
Sbjct  329  VEDMDLAVRASLKGWKFVYLCNLKVKNELPSTLKAYRYQQHRWSCGPANL  378



>gb|KEH42110.1| cellulose synthase-like protein A1 [Medicago truncatula]
Length=523

 Score =   463 bits (1191),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 212/332 (64%), Positives = 269/332 (81%), Gaps = 7/332 (2%)
 Frame = -1

Query  993  MRGIVFSEPGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAI  814
            M     +  G GM       L+  W +IR P++VP+L+  +  C+ +S+++ +E++YMAI
Sbjct  1    MEAFKVASEGVGM------QLEFIWKNIREPLIVPMLRWTVYLCLGLSLIMLVEKVYMAI  54

Query  813  VIVVVKCFGRKRYTRYKLDALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTW  637
            VI  VK F R     YK  A+++D+E  N NYP VLVQVPM+NE+EVY+LSIGA C  +W
Sbjct  55   VICYVKLFKRTPEKCYKFKAIEDDVELGNSNYPMVLVQVPMYNEREVYQLSIGAACELSW  114

Query  636  PSDRLIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQY  457
            PSDR+I+QILDDST+  +++ V++EC+ W  +GVN+KYE R+NRNGYKAGAL+EG+K  +
Sbjct  115  PSDRIIIQILDDSTDPTIKEFVQEECRRWRNKGVNIKYEVRDNRNGYKAGALKEGMKHSH  174

Query  456  VDDCEFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLD  277
            V  CE+VAIFDADFQP+ DFL RTIP+L+ NPE+ LVQARWKFVNA+EC+MTR+Q+MSLD
Sbjct  175  VLQCEYVAIFDADFQPEPDFLLRTIPFLVNNPEIGLVQARWKFVNANECLMTRMQQMSLD  234

Query  276  YHFTVEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFL  97
            YHF VEQEVGSST +FFGFNGTAGVWR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKFL
Sbjct  235  YHFKVEQEVGSSTYAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFL  294

Query  96   YIGDLEVKNELPSTFKAYRFQQHRWSCGPANL  1
            Y+ +L+VKNELPST KAYR+QQHRWSCGPANL
Sbjct  295  YLSNLQVKNELPSTLKAYRYQQHRWSCGPANL  326



>ref|XP_006424348.1| hypothetical protein CICLE_v10028164mg [Citrus clementina]
 gb|ESR37588.1| hypothetical protein CICLE_v10028164mg [Citrus clementina]
Length=537

 Score =   463 bits (1191),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 201/308 (65%), Positives = 266/308 (86%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W+ ++ P++VP+LK+ +  C+ MS+MLF+ER+YM IVI++VK F  K   RY    +++D
Sbjct  29   WELLKAPLIVPLLKLGVYICLAMSLMLFMERVYMGIVIILVKLFWPKPEKRYNWQPIEDD  88

Query  741  LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            +E  + N+P VL+Q+PMFNEKEVYK+SIGA CG +WPSDRL++Q+LDDST+  ++++VE 
Sbjct  89   VELGSSNFPVVLIQIPMFNEKEVYKISIGAACGLSWPSDRLVIQVLDDSTDPAIKQMVEQ  148

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC+ W  +G+N++Y+ R NR GYKAGAL+EGLK+ YV  CE+VAIFDADF+P+ D+L R 
Sbjct  149  ECQRWAAKGINIRYQIRENRTGYKAGALKEGLKRSYVKHCEYVAIFDADFRPEPDYLRRA  208

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            IPYL++N ++ALVQARW+FVNA+EC++TR+QEMSLDYHF VEQEVGS+T +FFGFNGTAG
Sbjct  209  IPYLVQNSDIALVQARWRFVNANECLLTRMQEMSLDYHFKVEQEVGSATHAFFGFNGTAG  268

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ A+++AGGWKDRTTVEDMDLAVRASL+GWKF+Y+GDL+VK+ELPSTFKA+RFQQHR
Sbjct  269  VWRIAAINEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGDLQVKSELPSTFKAFRFQQHR  328

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  329  WSCGPANL  336



>ref|XP_004506130.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Cicer 
arietinum]
Length=538

 Score =   463 bits (1191),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 207/315 (66%), Positives = 263/315 (83%), Gaps = 1/315 (0%)
 Frame = -1

Query  942  VESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYK  763
            V  +K  WD ++ P++VP L   +   + M++MLF+ER+YM IVIV++K F +K   RY 
Sbjct  21   VTQMKMIWDVMKAPLIVPFLNACVYISLAMALMLFMERVYMGIVIVLIKLFWKKPEQRYN  80

Query  762  LDALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDN  586
             + L+ED E  N N+P VL+Q+PMFNEKEVYK+SIGA CG +WPSDRL++Q+LDDST+  
Sbjct  81   YEPLREDEELGNSNFPVVLIQIPMFNEKEVYKVSIGAACGLSWPSDRLVIQVLDDSTDPV  140

Query  585  LRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPD  406
            +++LVE EC+ W  +G+N+ Y+ R +R GYKAGAL+EGLK+ YV  CE+VAIFDADF+P+
Sbjct  141  VKQLVEMECQRWASKGLNITYQIRESRGGYKAGALKEGLKRNYVKHCEYVAIFDADFRPE  200

Query  405  HDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFF  226
             DFL R IP+L+ NPELALVQARW+FVN++EC++TR+QEMSLDYHFTVEQEVGS+T +FF
Sbjct  201  PDFLRRAIPFLVGNPELALVQARWRFVNSNECLLTRMQEMSLDYHFTVEQEVGSATHAFF  260

Query  225  GFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKA  46
            GFNGTAGVWR+ A+ +AGGWKDRTTVEDMDLAVRASLRGWKFLY+GDLE K+ELPST +A
Sbjct  261  GFNGTAGVWRIAAIDEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGDLEAKSELPSTLRA  320

Query  45   YRFQQHRWSCGPANL  1
            +RFQQHRWSCGPANL
Sbjct  321  FRFQQHRWSCGPANL  335



>ref|XP_011088835.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Sesamum 
indicum]
Length=536

 Score =   461 bits (1186),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 202/308 (66%), Positives = 262/308 (85%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W+ I+ P++VP+L +A+  C+ MSVM+F+ER+YM IVI++VK F +K   RYK + + +D
Sbjct  29   WELIKAPLIVPLLNLAVYICLAMSVMVFVERLYMGIVIILVKLFWKKPEKRYKWEPMNDD  88

Query  741  LEQ-NQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            LE  ++ +PKVLVQ+PMFNEKEVYK+SIGA C   WPSDRL++Q+LDDST+  ++ +VE 
Sbjct  89   LEMGSETFPKVLVQIPMFNEKEVYKISIGAACNLAWPSDRLVIQVLDDSTDLLVKDMVER  148

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC  W  +G+N++Y+ R +R GYKAGAL+EGL   YV +CE+V IFDADF+P+ DFL R 
Sbjct  149  ECIRWASKGINIRYQIRESRGGYKAGALKEGLTHDYVKECEYVVIFDADFRPEPDFLRRA  208

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            +P+L+ NP++ALVQARW+FVNADEC++TR+QEMSLDYHFTVEQEVGS+T +FFGFNGT G
Sbjct  209  VPFLIHNPDIALVQARWRFVNADECLLTRMQEMSLDYHFTVEQEVGSATHAFFGFNGTGG  268

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            +WR+ A++DAGGWKDRTTVEDMDLAVRA L+GWKFLY+GDL+VK+ELPSTFKA+RFQQHR
Sbjct  269  IWRIAAINDAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLQVKSELPSTFKAFRFQQHR  328

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  329  WSCGPANL  336



>ref|XP_004151323.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
sativus]
 ref|XP_004165881.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
sativus]
Length=483

 Score =   458 bits (1179),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 206/286 (72%), Positives = 252/286 (88%), Gaps = 1/286 (0%)
 Frame = -1

Query  855  MSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKEDLEQNQ-NYPKVLVQVPMFNEKE  679
            MS+MLF+ER+YM IVI+ VK F +  +  YK + +K+DLE     YP VLVQ+PM+NEKE
Sbjct  1    MSLMLFVERVYMGIVILFVKLFRKNPHKTYKWEPIKDDLELAHFAYPMVLVQIPMYNEKE  60

Query  678  VYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNG  499
            VY+LSIGA CG +WP+DR+I+Q+LDDST+ +++ LVE ECK W  +G+N+KYE R+NRNG
Sbjct  61   VYQLSIGAACGLSWPTDRIIIQVLDDSTDPSIKDLVELECKRWANKGINIKYEIRDNRNG  120

Query  498  YKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNA  319
            YKAGAL+EG+K  YV  C++VAIFDADFQP+ DFLWRTIP+L+ NPE+ALVQARWKFVN+
Sbjct  121  YKAGALKEGMKHNYVKLCDYVAIFDADFQPEPDFLWRTIPFLINNPEIALVQARWKFVNS  180

Query  318  DECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDM  139
            DEC+MTR+QEMSLDYHF VEQEVGS+T +FFGFNGTAGVWR+ AL++AGGWKDRTTVEDM
Sbjct  181  DECLMTRMQEMSLDYHFKVEQEVGSATYAFFGFNGTAGVWRIAALNEAGGWKDRTTVEDM  240

Query  138  DLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHRWSCGPANL  1
            DLAVRASL+GWKF+Y+GDL+VKNELPSTFKAYR+QQHRWSCGPANL
Sbjct  241  DLAVRASLKGWKFVYVGDLKVKNELPSTFKAYRYQQHRWSCGPANL  286



>ref|XP_009769755.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like isoform 
X1 [Nicotiana sylvestris]
Length=533

 Score =   460 bits (1183),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 204/308 (66%), Positives = 263/308 (85%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W+ I+ P++VP+L++A+  C+ M +MLF+ER+YM IVI++VK F +K   RYK + ++ED
Sbjct  29   WELIKAPLIVPLLRVAIYICLPMELMLFIERLYMGIVIILVKLFLKKPDKRYKWEPMRED  88

Query  741  LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            LE  N  +P VLVQ+PMFNEKEVYK+SIGA C  +WPSDRL++Q+LDDST+  ++ LVE 
Sbjct  89   LEIGNSGFPMVLVQIPMFNEKEVYKVSIGAACNLSWPSDRLVIQVLDDSTDLLIKDLVEK  148

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC  W  +G++++Y+ R +R GYKAGAL+EGLK+ YV DCE+V IFDADF+P+ DFL R 
Sbjct  149  ECLRWAGKGIDIRYQIRESRGGYKAGALKEGLKRDYVKDCEYVVIFDADFRPEPDFLRRA  208

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            IP+L+ N E+ALVQ RW+FVN++EC++TR+QEMSLDYHFTVEQEVGSST +FFGFNGT G
Sbjct  209  IPFLVHNSEIALVQGRWRFVNSNECLLTRMQEMSLDYHFTVEQEVGSSTHAFFGFNGTGG  268

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ A+++AGGWKDRTTVEDMDLAVRASL+GWKFLY+GDL+VK+ELPSTFKA+RFQQHR
Sbjct  269  VWRIAAINEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGDLQVKSELPSTFKAFRFQQHR  328

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  329  WSCGPANL  336



>ref|XP_004307031.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Fragaria 
vesca subsp. vesca]
Length=483

 Score =   458 bits (1178),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 207/286 (72%), Positives = 253/286 (88%), Gaps = 1/286 (0%)
 Frame = -1

Query  855  MSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKEDLE-QNQNYPKVLVQVPMFNEKE  679
            MSV+LF+E++YM IVI++VK F R+   R+K +A+K+D+E  N  YP VLVQ+PM+NEKE
Sbjct  1    MSVLLFVEKVYMGIVIMLVKVFRRRPEKRWKWEAIKDDVELGNSAYPMVLVQIPMYNEKE  60

Query  678  VYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNG  499
            VY+LSIGA CG +WPSDR+IVQ+LDDST+  ++ LVE E + W  +G+N+KYE R+NR+G
Sbjct  61   VYQLSIGAACGLSWPSDRIIVQVLDDSTDPLIKDLVEVEVQRWASKGINIKYEIRDNRHG  120

Query  498  YKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNA  319
            YKAGAL+EG+K  YV  C++VAIFDADFQP+ DFLWRTIP+LL NP++ALVQ RWKFVNA
Sbjct  121  YKAGALKEGMKHSYVKQCDYVAIFDADFQPEPDFLWRTIPFLLHNPDIALVQTRWKFVNA  180

Query  318  DECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDM  139
            DEC+MTR+QEMSLDYHFTVEQEVGS+T +FFGFNGTAGVWR+ AL++AGGWKDRTTVEDM
Sbjct  181  DECLMTRMQEMSLDYHFTVEQEVGSATHAFFGFNGTAGVWRITALNEAGGWKDRTTVEDM  240

Query  138  DLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHRWSCGPANL  1
            DLAVRASLRGWKF+YI D++VKNELPSTFKAYR+QQHRWSCGPANL
Sbjct  241  DLAVRASLRGWKFVYISDIKVKNELPSTFKAYRYQQHRWSCGPANL  286



>ref|XP_009769757.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like isoform 
X2 [Nicotiana sylvestris]
Length=519

 Score =   459 bits (1182),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 204/308 (66%), Positives = 263/308 (85%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W+ I+ P++VP+L++A+  C+ M +MLF+ER+YM IVI++VK F +K   RYK + ++ED
Sbjct  29   WELIKAPLIVPLLRVAIYICLPMELMLFIERLYMGIVIILVKLFLKKPDKRYKWEPMRED  88

Query  741  LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            LE  N  +P VLVQ+PMFNEKEVYK+SIGA C  +WPSDRL++Q+LDDST+  ++ LVE 
Sbjct  89   LEIGNSGFPMVLVQIPMFNEKEVYKVSIGAACNLSWPSDRLVIQVLDDSTDLLIKDLVEK  148

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC  W  +G++++Y+ R +R GYKAGAL+EGLK+ YV DCE+V IFDADF+P+ DFL R 
Sbjct  149  ECLRWAGKGIDIRYQIRESRGGYKAGALKEGLKRDYVKDCEYVVIFDADFRPEPDFLRRA  208

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            IP+L+ N E+ALVQ RW+FVN++EC++TR+QEMSLDYHFTVEQEVGSST +FFGFNGT G
Sbjct  209  IPFLVHNSEIALVQGRWRFVNSNECLLTRMQEMSLDYHFTVEQEVGSSTHAFFGFNGTGG  268

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            VWR+ A+++AGGWKDRTTVEDMDLAVRASL+GWKFLY+GDL+VK+ELPSTFKA+RFQQHR
Sbjct  269  VWRIAAINEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGDLQVKSELPSTFKAFRFQQHR  328

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  329  WSCGPANL  336



>emb|CDP06989.1| unnamed protein product [Coffea canephora]
Length=537

 Score =   459 bits (1180),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 201/308 (65%), Positives = 262/308 (85%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W+ IR P++VP+L++A+  C+ MS+MLF+ER+YM IVI++VK F +K   RYK + +++D
Sbjct  31   WELIRAPLIVPLLRLAVYICLAMSLMLFIERLYMGIVIILVKIFWKKPEKRYKWEPMRDD  90

Query  741  LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            LE  N  +P VLVQ+PMFNEKEVYK+SIGA C  +WPSDR+++Q+LDDST+  ++ +VE 
Sbjct  91   LEIGNAAFPMVLVQIPMFNEKEVYKISIGAACNLSWPSDRIVIQVLDDSTDPIIKDMVEK  150

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC+ W  +G++ +Y+ R  R GYKAGAL+EGLK  YV DCE+V IFDADF+P+ DFL R 
Sbjct  151  ECQRWASKGIHCRYQIRETRGGYKAGALKEGLKHDYVKDCEYVVIFDADFRPEPDFLRRA  210

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            IP+L+ N ++ALVQARW+FVN+DEC++TR+QEMSLDYHFTVEQEVGSST +FFGFNGT G
Sbjct  211  IPFLMHNSDIALVQARWRFVNSDECLLTRMQEMSLDYHFTVEQEVGSSTHAFFGFNGTGG  270

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            +WR+ A+++AGGWKDRTTVEDMDLAVRA L+GWKF+Y+GDL+VK+ELPSTFKA+RFQQHR
Sbjct  271  IWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFVYLGDLQVKSELPSTFKAFRFQQHR  330

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  331  WSCGPANL  338



>ref|XP_009794211.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Nicotiana 
sylvestris]
Length=526

 Score =   458 bits (1178),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 203/309 (66%), Positives = 264/309 (85%), Gaps = 2/309 (1%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W+ ++ P+LVP+L+ A+  C++M +MLF+ER+YM IVIV+VK F +K   RYK + + +D
Sbjct  21   WEVLKAPLLVPLLRAAVYICLVMELMLFIERLYMGIVIVIVKLFMKKPDKRYKWEPMADD  80

Query  741  -LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVE  568
             LE  + ++PKVLVQ+PMFNE+EVYK+SIGA C  +WPSDRL++Q+LDDST+  ++ +VE
Sbjct  81   DLEIGSADFPKVLVQIPMFNEREVYKISIGAACNLSWPSDRLVIQVLDDSTDPIIKDMVE  140

Query  567  DECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWR  388
             EC  W  +G+N+ Y+ R +R GYKAGAL+EGLK  YV DCE+V IFDADF+P+ DFL R
Sbjct  141  TECLRWASKGLNITYQIRESRGGYKAGALKEGLKHNYVKDCEYVVIFDADFRPEPDFLRR  200

Query  387  TIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTA  208
            +IP+L+ NPE+ALVQ RW+FVNA+EC++TR+QEMSLDYHFTVEQEVGSST +FFGFNGT 
Sbjct  201  SIPFLVHNPEIALVQGRWRFVNANECLLTRMQEMSLDYHFTVEQEVGSSTHAFFGFNGTG  260

Query  207  GVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQH  28
            G+WR+ A+++AGGWKDRTTVEDMDLAVRASL+GWKF+Y+GDL+VK+ELPSTFKA+RFQQH
Sbjct  261  GIWRIAAINEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGDLQVKSELPSTFKAFRFQQH  320

Query  27   RWSCGPANL  1
            RWSCGPANL
Sbjct  321  RWSCGPANL  329



>ref|NP_001046164.1| Os02g0192500 [Oryza sativa Japonica Group]
 sp|Q7PC76.1|CSLA1_ORYSJ RecName: Full=Glucomannan 4-beta-mannosyltransferase 1; AltName: 
Full=Cellulose synthase-like protein A1; AltName: Full=Glucomannan-synthase 
1; Short=Mannan synthase 1; AltName: Full=OsCslA1; 
AltName: Full=OsCslA9 [Oryza sativa Japonica Group]
 tpg|DAA01743.1| TPA_exp: cellulose synthase-like A1 [Oryza sativa (japonica cultivar-group)]
 dbj|BAD15390.1| putative cellulose synthase-like protein OsCslA9 [Oryza sativa 
Japonica Group]
 dbj|BAD34025.1| putative cellulose synthase-like protein OsCslA9 [Oryza sativa 
Japonica Group]
 dbj|BAF08078.1| Os02g0192500 [Oryza sativa Japonica Group]
 dbj|BAG95675.1| unnamed protein product [Oryza sativa Japonica Group]
Length=521

 Score =   457 bits (1177),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 207/314 (66%), Positives = 265/314 (84%), Gaps = 2/314 (1%)
 Frame = -1

Query  936  SLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLD  757
             L  AW  +R P++VP+L++A++ C+ MSV+LFLER+YMA+VI  VK   R+   RY+ D
Sbjct  10   GLPEAWSQVRAPVIVPLLRLAVAVCLTMSVLLFLERMYMAVVISGVKILRRRPDRRYRCD  69

Query  756  ALKEDLEQ--NQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNL  583
             + +D  +     +P VL+Q+PMFNE+EVY+LSIGAVCG +WPSDRL+VQ+LDDST+  +
Sbjct  70   PIPDDDPELGTSAFPVVLIQIPMFNEREVYQLSIGAVCGLSWPSDRLVVQVLDDSTDPVI  129

Query  582  RKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDH  403
            +++V  EC+ W  +GVN+ Y+ R NR GYKAGAL+EG+K  YV +CE+VAIFDADFQPD 
Sbjct  130  KEMVRIECERWAHKGVNITYQIRENRKGYKAGALKEGMKHGYVRECEYVAIFDADFQPDP  189

Query  402  DFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFG  223
            DFL RTIP+L+ N ++ALVQARW+FVNADEC+MTR+QEMSLDYHFTVEQEV SS C+FFG
Sbjct  190  DFLRRTIPFLVHNSDIALVQARWRFVNADECLMTRMQEMSLDYHFTVEQEVSSSVCAFFG  249

Query  222  FNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAY  43
            FNGTAGVWR+ A+++AGGWKDRTTVEDMDLA+RASL+GWKF+Y+GD++VK+ELPSTFKA+
Sbjct  250  FNGTAGVWRVSAVNEAGGWKDRTTVEDMDLAIRASLKGWKFVYLGDVQVKSELPSTFKAF  309

Query  42   RFQQHRWSCGPANL  1
            RFQQHRWSCGPANL
Sbjct  310  RFQQHRWSCGPANL  323



>gb|EAY84833.1| hypothetical protein OsI_06199 [Oryza sativa Indica Group]
Length=517

 Score =   457 bits (1176),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 207/314 (66%), Positives = 265/314 (84%), Gaps = 2/314 (1%)
 Frame = -1

Query  936  SLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLD  757
             L  AW  +R P++VP+L++A++ C+ MSV+LFLER+YMA+VI  VK   R+   RY+ D
Sbjct  10   GLPEAWSQVRAPVIVPLLRLAVAVCLTMSVLLFLERMYMAVVISGVKILRRRPDRRYRCD  69

Query  756  ALKEDLEQ--NQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNL  583
             + +D  +     +P VL+Q+PMFNE+EVY+LSIGAVCG +WPSDRL+VQ+LDDST+  +
Sbjct  70   PIPDDDPELGTSAFPVVLIQIPMFNEREVYQLSIGAVCGLSWPSDRLVVQVLDDSTDPVI  129

Query  582  RKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDH  403
            +++V  EC+ W  +GVN+ Y+ R NR GYKAGAL+EG+K  YV +CE+VAIFDADFQPD 
Sbjct  130  KEMVRIECERWAHKGVNITYQIRENRKGYKAGALKEGMKHGYVRECEYVAIFDADFQPDP  189

Query  402  DFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFG  223
            DFL RTIP+L+ N ++ALVQARW+FVNADEC+MTR+QEMSLDYHFTVEQEV SS C+FFG
Sbjct  190  DFLRRTIPFLVHNSDIALVQARWRFVNADECLMTRMQEMSLDYHFTVEQEVSSSVCAFFG  249

Query  222  FNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAY  43
            FNGTAGVWR+ A+++AGGWKDRTTVEDMDLA+RASL+GWKF+Y+GD++VK+ELPSTFKA+
Sbjct  250  FNGTAGVWRVSAVNEAGGWKDRTTVEDMDLAIRASLKGWKFVYLGDVQVKSELPSTFKAF  309

Query  42   RFQQHRWSCGPANL  1
            RFQQHRWSCGPANL
Sbjct  310  RFQQHRWSCGPANL  323



>gb|ACV71015.1| UPA15 [Capsicum annuum]
Length=528

 Score =   457 bits (1176),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 204/309 (66%), Positives = 262/309 (85%), Gaps = 2/309 (1%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W+ ++ P+LVP+LK+A+  CI+M +MLF+ER+YM IVI++VK F +K   RYK + + +D
Sbjct  22   WEVLKAPLLVPMLKVAVYICIVMELMLFIERLYMGIVIILVKVFMKKPDKRYKWEPMDDD  81

Query  741  -LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVE  568
             LE  +  +PKVLVQ+PMFNEKEVYK+SIGA C  +WPSDRL++Q+LDDST+  ++ +VE
Sbjct  82   DLEIGSGGFPKVLVQIPMFNEKEVYKISIGAACNLSWPSDRLVIQVLDDSTDPIVKDMVE  141

Query  567  DECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWR  388
             EC  W  +G+N+ Y+ R  R GYKAGAL+EGLK  YV DCE+V IFDADF+P+ DFL R
Sbjct  142  TECLRWASKGLNITYQIRETRGGYKAGALKEGLKHNYVKDCEYVVIFDADFRPEPDFLRR  201

Query  387  TIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTA  208
            +IP+L+ NP++ALVQ RW+FVNA+EC++TR+QEMSLDYHFTVEQEVGSST +FFGFNGT 
Sbjct  202  SIPFLIHNPKIALVQGRWRFVNANECLLTRMQEMSLDYHFTVEQEVGSSTHAFFGFNGTG  261

Query  207  GVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQH  28
            G+WR+ A+ +AGGWKDRTTVEDMDLAVRASL+GWKF+Y+GDL+VK+ELPSTFKA+RFQQH
Sbjct  262  GIWRIAAIDEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGDLQVKSELPSTFKAFRFQQH  321

Query  27   RWSCGPANL  1
            RWSCGPANL
Sbjct  322  RWSCGPANL  330



>ref|XP_009603535.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X1 [Nicotiana tomentosiformis]
Length=531

 Score =   457 bits (1176),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 204/309 (66%), Positives = 257/309 (83%), Gaps = 2/309 (1%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALK-E  745
            W   R P++VP+++I +  C+ +S MLF+ER+YM IVI  +K   RK   +YK + +K +
Sbjct  26   WQQTRAPLIVPLIRIVLFVCLALSFMLFVERLYMGIVIAFIKLVRRKPEKKYKWEPMKKD  85

Query  744  DLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVE  568
            DLE  N +YP VLVQ+PM+NEKEVY+LSIGA C  +WP++R+ +Q+LDDST+  ++ LVE
Sbjct  86   DLELGNSSYPVVLVQIPMYNEKEVYQLSIGAACSLSWPANRIFIQVLDDSTDPAIKALVE  145

Query  567  DECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWR  388
             EC++W  +G+N+KYE R+NR GYKAGALREG+K  YV+ C  VAIFDADFQP+ DFL R
Sbjct  146  QECRIWASKGINIKYEIRDNRKGYKAGALREGMKHSYVNLCSHVAIFDADFQPEPDFLER  205

Query  387  TIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTA  208
            TIP+L+ NP++ LVQARW+FVNADEC+MTR+QEMSL YHFTVEQEVGS+  +FFGFNGTA
Sbjct  206  TIPFLVHNPDIGLVQARWEFVNADECLMTRMQEMSLGYHFTVEQEVGSAIHAFFGFNGTA  265

Query  207  GVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQH  28
            GVWR+ AL++AGGWKDRTTVEDMDLAVRA L GWKF+Y+GDL+VKNELPSTFKAYR+QQH
Sbjct  266  GVWRMSALNEAGGWKDRTTVEDMDLAVRAGLNGWKFVYVGDLKVKNELPSTFKAYRYQQH  325

Query  27   RWSCGPANL  1
            RWSCGPANL
Sbjct  326  RWSCGPANL  334



>ref|XP_007219015.1| hypothetical protein PRUPE_ppa004315mg [Prunus persica]
 gb|EMJ20214.1| hypothetical protein PRUPE_ppa004315mg [Prunus persica]
Length=517

 Score =   456 bits (1174),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 201/304 (66%), Positives = 263/304 (87%), Gaps = 1/304 (0%)
 Frame = -1

Query  909  RVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKEDLE-Q  733
            +  ++VP+LK  +  C+ MS+MLF+E++YM I+I+++K F R+    +K +A+K+D+E  
Sbjct  17   KATLIVPLLKFLVVVCLGMSLMLFVEKVYMGIMIILIKLFRRRPVKHWKWEAIKDDVELG  76

Query  732  NQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVEDECKM  553
            N  YP VLVQ+PM+NE+EVY+LSIGA CG +WPSDR+I+Q+LDDST+  ++ LVE EC+ 
Sbjct  77   NSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIIIQVLDDSTDPTIKDLVELECQR  136

Query  552  WMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRTIPYL  373
            W  +G+N+KYE R++RNG+KAG+L+EG+K  YV  C++VAIFDADFQP+ DFL+RTIP+L
Sbjct  137  WASKGINIKYEIRDDRNGFKAGSLKEGMKHSYVKQCDYVAIFDADFQPEPDFLYRTIPFL  196

Query  372  LENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAGVWRL  193
            + N ++ALVQARWKFVN+DEC+MTR+QEM+LDYHFTVEQEVGS+T +FFGFNGTAGVWR+
Sbjct  197  VHNSDIALVQARWKFVNSDECLMTRMQEMTLDYHFTVEQEVGSATYAFFGFNGTAGVWRI  256

Query  192  QALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHRWSCG  13
             AL+DAGGWKD TTVEDMDLAVRASL+GWKF+Y+ DL+VKNELPSTFKAYR+QQHRWSCG
Sbjct  257  AALNDAGGWKDCTTVEDMDLAVRASLKGWKFVYLSDLKVKNELPSTFKAYRYQQHRWSCG  316

Query  12   PANL  1
            PANL
Sbjct  317  PANL  320



>ref|XP_006656269.1| PREDICTED: probable mannan synthase 9-like [Oryza brachyantha]
Length=520

 Score =   456 bits (1174),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 205/314 (65%), Positives = 263/314 (84%), Gaps = 7/314 (2%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKE-  745
            W+ ++ P++VP+L+++++ C+ MSVMLF+E++Y+  V+V V  FGR+   RY+ D +   
Sbjct  11   WEQVKAPVVVPLLRLSVAACLAMSVMLFVEKVYLTAVLVAVHLFGRRPERRYRCDPIVAG  70

Query  744  ------DLEQNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNL  583
                  D + +  +P VLVQ+PM+NE+EVYKLSIGA CG +WPSDR+IVQ+LDDST+  +
Sbjct  71   DDPELGDADADAAFPMVLVQIPMYNEREVYKLSIGAACGLSWPSDRVIVQVLDDSTDPVI  130

Query  582  RKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDH  403
            +++V+ EC+ W  +GV +KYE R+NR GYKAGALREG+K  YV DC+FVAIFDADFQPD 
Sbjct  131  KEMVQVECRRWESKGVRIKYEIRDNRVGYKAGALREGMKHGYVRDCDFVAIFDADFQPDP  190

Query  402  DFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFG  223
            DFL RTIP+LL NP++ALVQARWKFVNA+EC+MTR+QEMSLDYHF VEQEVGSST +FFG
Sbjct  191  DFLARTIPFLLHNPDVALVQARWKFVNANECLMTRMQEMSLDYHFKVEQEVGSSTHAFFG  250

Query  222  FNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAY  43
            FNGTAGVWR+ A+++AGGWKDRTTVEDMDLAVRA L+GWKF+Y+GDL VK+ELPSTFKA+
Sbjct  251  FNGTAGVWRISAMNEAGGWKDRTTVEDMDLAVRAGLKGWKFVYLGDLMVKSELPSTFKAF  310

Query  42   RFQQHRWSCGPANL  1
            R+QQHRWSCG ANL
Sbjct  311  RYQQHRWSCGRANL  324



>ref|XP_004251009.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2 [Solanum 
lycopersicum]
Length=524

 Score =   456 bits (1173),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 205/309 (66%), Positives = 261/309 (84%), Gaps = 2/309 (1%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYK-LDALKE  745
            W+ ++ P+LVP+LK A+  CI+M +MLF+ER+YM IVIV+VK F +K   RYK +    +
Sbjct  19   WEVLKAPLLVPLLKSAVYICIVMELMLFVERLYMGIVIVLVKIFMKKPDKRYKWIPMADD  78

Query  744  DLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVE  568
            DLE  + ++PKVLVQ+PMFNEKEVYK+SIGA C  +WPSDRL++Q+LDDST+  ++ +VE
Sbjct  79   DLEIGSADFPKVLVQIPMFNEKEVYKISIGAACNLSWPSDRLVIQVLDDSTDPIVKDMVE  138

Query  567  DECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWR  388
             EC  W  +G+N+ Y+ R  R GYKAGAL+EGLK  YV DCE+V IFDADF+P+ DFL R
Sbjct  139  TECLRWASKGLNITYQIRETRGGYKAGALKEGLKHNYVKDCEYVVIFDADFRPEPDFLRR  198

Query  387  TIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTA  208
            +IP+L+ NPE+ALVQ RW+FVN++EC++TR+QEMSLDYHFTVEQEVGSST +FFGFNGT 
Sbjct  199  SIPFLIHNPEIALVQGRWRFVNSNECLLTRMQEMSLDYHFTVEQEVGSSTHAFFGFNGTG  258

Query  207  GVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQH  28
            G+WR+ A+ +AGGWKDRTTVEDMDLAVRASL+GWKF+Y+GDL+VK+ELPSTFKA+RFQQH
Sbjct  259  GIWRIAAIDEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGDLQVKSELPSTFKAFRFQQH  318

Query  27   RWSCGPANL  1
            RWSCGPANL
Sbjct  319  RWSCGPANL  327



>emb|CAN82595.1| hypothetical protein VITISV_013708 [Vitis vinifera]
Length=534

 Score =   456 bits (1174),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 203/309 (66%), Positives = 263/309 (85%), Gaps = 2/309 (1%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W+ ++ P++VP+L++A+  C+ MS+MLF+ER+YM IVI++VK F +K   RYK + L+ED
Sbjct  29   WELVKAPLIVPLLRVAVYICLTMSLMLFVERLYMGIVIILVKIFWKKPDKRYKWEPLRED  88

Query  741  LEQ-NQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            LE  N N+P V+VQ+PM+NEKEVYKLSIGA CG +WP+DRL++Q+LDDST+  ++ LVE 
Sbjct  89   LESGNSNFPHVVVQIPMYNEKEVYKLSIGAACGLSWPADRLVIQVLDDSTDPTIKNLVET  148

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGAL-REGLKKQYVDDCEFVAIFDADFQPDHDFLWR  388
            EC+ W  +G+N++Y+ R NR GYKAG   R    ++YV  CE+VAIFDADFQP+ D+L R
Sbjct  149  ECQRWAAKGINIRYQIRENRVGYKAGGSERRPEAERYVKHCEYVAIFDADFQPEPDYLKR  208

Query  387  TIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTA  208
             IP+L+ N ++ALVQ RW+FVNADEC+MTR+QEMSLDYHFTVEQEVGS+T +FFGFNGTA
Sbjct  209  AIPFLVYNSDIALVQGRWRFVNADECLMTRMQEMSLDYHFTVEQEVGSATHAFFGFNGTA  268

Query  207  GVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQH  28
            GVWR+ A+++AGGWKDRTTVEDMDLAVRASL+GWKF+Y+GDL+VK+ELPSTFKA+RFQQH
Sbjct  269  GVWRIAAINEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGDLQVKSELPSTFKAFRFQQH  328

Query  27   RWSCGPANL  1
            RWSCGPANL
Sbjct  329  RWSCGPANL  337



>ref|XP_008363208.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X2 [Malus domestica]
Length=483

 Score =   454 bits (1168),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 205/286 (72%), Positives = 250/286 (87%), Gaps = 1/286 (0%)
 Frame = -1

Query  855  MSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKEDLE-QNQNYPKVLVQVPMFNEKE  679
            MSVMLF+E++YM IVI ++K F RK   ++K +A+K+D+E  N  YP VL+Q+PM+NEKE
Sbjct  1    MSVMLFVEKVYMGIVITLIKLFRRKPEKKWKWEAVKDDVELGNSAYPMVLLQIPMYNEKE  60

Query  678  VYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNG  499
            VY+LSIGA CG +WPSDR+I+Q+LDDST+  ++ LVE E K W  +G+N+KYE R+NRNG
Sbjct  61   VYQLSIGAACGLSWPSDRVIIQVLDDSTDPAIKDLVELEVKRWAGKGINIKYEIRDNRNG  120

Query  498  YKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNA  319
            YKAGAL+EG+K  YV  C+FVAIFDADFQPD DFLWRTIP+L+ N ++ALVQ RWKFVN+
Sbjct  121  YKAGALKEGMKHSYVKQCDFVAIFDADFQPDPDFLWRTIPFLIHNSDVALVQTRWKFVNS  180

Query  318  DECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDM  139
            DEC+MTR+QEMSLDYHFTVEQEVGS+T +FFGFNG AGVWR+ AL++AGGWKDRTTVEDM
Sbjct  181  DECLMTRMQEMSLDYHFTVEQEVGSATHAFFGFNGMAGVWRIAALNEAGGWKDRTTVEDM  240

Query  138  DLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHRWSCGPANL  1
            DLAVRASLRGWKF+Y+ DL+VKNELPSTFKAYR+QQHRWSCGPANL
Sbjct  241  DLAVRASLRGWKFIYLSDLKVKNELPSTFKAYRYQQHRWSCGPANL  286



>ref|XP_006349077.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Solanum 
tuberosum]
Length=524

 Score =   456 bits (1172),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 205/309 (66%), Positives = 260/309 (84%), Gaps = 2/309 (1%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYK-LDALKE  745
            W+ ++ P+LVP+LK A+  CI M +MLF+ER+YM IVIV+VK F +K   RYK +    +
Sbjct  19   WEVLKAPLLVPLLKAAVYICIAMELMLFVERLYMGIVIVLVKIFMKKPDKRYKWIPMADD  78

Query  744  DLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVE  568
            DLE  + ++PKVLVQ+PMFNEKEVYK+SIGA C  +WPSDRL++Q+LDDST+  ++ +VE
Sbjct  79   DLEIGSADFPKVLVQIPMFNEKEVYKISIGAACNLSWPSDRLVIQVLDDSTDPIVKDMVE  138

Query  567  DECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWR  388
             EC  W  +G+N+ Y+ R  R GYKAGAL+EGLK  YV DCE+V IFDADF+P+ DFL R
Sbjct  139  TECLRWESKGLNITYQIRETRGGYKAGALKEGLKHNYVKDCEYVVIFDADFRPEPDFLRR  198

Query  387  TIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTA  208
            +IP+L+ NPE+ALVQ RW+FVN++EC++TR+QEMSLDYHFTVEQEVGSST +FFGFNGT 
Sbjct  199  SIPFLIHNPEIALVQGRWRFVNSNECLLTRMQEMSLDYHFTVEQEVGSSTHAFFGFNGTG  258

Query  207  GVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQH  28
            G+WR+ A+ +AGGWKDRTTVEDMDLAVRASL+GWKF+Y+GDL+VK+ELPSTFKA+RFQQH
Sbjct  259  GIWRIAAIEEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGDLQVKSELPSTFKAFRFQQH  318

Query  27   RWSCGPANL  1
            RWSCGPANL
Sbjct  319  RWSCGPANL  327



>ref|XP_011089999.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Sesamum 
indicum]
Length=536

 Score =   456 bits (1172),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 204/327 (62%), Positives = 267/327 (82%), Gaps = 5/327 (2%)
 Frame = -1

Query  975  SEPGNGMYTTPVES-LKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVV  799
            S PG   YT  +   L   W+ IRVP++ P+L++ +  C+ MS+M+F+ER+YM +VIV+V
Sbjct  13   SLPG---YTADIAGQLGLLWELIRVPLIAPLLRVCVYICLAMSIMVFMERLYMGVVIVLV  69

Query  798  KCFGRKRYTRYKLDALKEDLEQNQN-YPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRL  622
            K F +K   RYK + +K+DLE     +P VLVQ+PMFNEKEVYK+SIGA C  +WP+DRL
Sbjct  70   KLFWKKPEKRYKWEPMKDDLEMGSAAFPMVLVQIPMFNEKEVYKISIGAACNLSWPADRL  129

Query  621  IVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCE  442
            ++Q+LDDST+  ++ +VE EC  W  +G+N++Y+ R  R GYKAGAL+EGLK  YV +CE
Sbjct  130  VIQVLDDSTDLVIKDMVEKECIRWASKGINIRYQIRETRGGYKAGALKEGLKHDYVKECE  189

Query  441  FVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTV  262
            +V IFDADF+P+ DFL R +P+L+ N ++ALVQARW+FVNADEC++TR+QEMSLDYHFTV
Sbjct  190  YVVIFDADFRPEPDFLRRAVPFLIHNRDIALVQARWRFVNADECLLTRMQEMSLDYHFTV  249

Query  261  EQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDL  82
            EQEVGS+T +FFGFNGT G+WR+ A+++AGGWKDRTTVEDMDLAVRA L+GWKF+Y+GDL
Sbjct  250  EQEVGSATHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFVYLGDL  309

Query  81   EVKNELPSTFKAYRFQQHRWSCGPANL  1
            +VK+ELPSTFKA+RFQQHRWSCGPANL
Sbjct  310  QVKSELPSTFKAFRFQQHRWSCGPANL  336



>ref|XP_009120642.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Brassica 
rapa]
Length=534

 Score =   455 bits (1171),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 209/328 (64%), Positives = 274/328 (84%), Gaps = 1/328 (0%)
 Frame = -1

Query  981  VFSEPGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVV  802
            V  E  +G+       L   W+ ++ P++VP+L++A+  C++MS+ML  ER+YM IVIV+
Sbjct  9    VLPETFDGVKMEITGQLGMIWELVKAPVIVPLLQLAVDICLLMSLMLLCERVYMGIVIVL  68

Query  801  VKCFGRKRYTRYKLDALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDR  625
            VK F +K + RYK + +++D E  + N+P VLVQ+PMFNE+EVYKLSIGA  G +WPSDR
Sbjct  69   VKLFWKKPHKRYKFEPIQDDEELGSSNFPVVLVQIPMFNEREVYKLSIGAASGLSWPSDR  128

Query  624  LIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDC  445
            L++Q+LDDST+  ++++VE EC+ W  +G+N++Y+ R NR GYKAGAL+EGLK+ YV  C
Sbjct  129  LVIQVLDDSTDPTVKQMVEMECQRWASKGINIRYQIRENRVGYKAGALKEGLKRSYVKHC  188

Query  444  EFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFT  265
            E+V IFDADFQP+ DFL R+IP+L+ NP +ALVQARW+FVN+DEC++TR+QEMSLDYHFT
Sbjct  189  EYVVIFDADFQPEPDFLRRSIPFLVHNPNIALVQARWRFVNSDECLLTRMQEMSLDYHFT  248

Query  264  VEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGD  85
            VEQEVGSST +FFGFNGTAG+WR+ A+++AGGWKDRTTVEDMDLAVRASLRGWKFLY+GD
Sbjct  249  VEQEVGSSTHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGD  308

Query  84   LEVKNELPSTFKAYRFQQHRWSCGPANL  1
            L+VK+ELPSTF+A+RFQQHRWSCGPANL
Sbjct  309  LQVKSELPSTFRAFRFQQHRWSCGPANL  336



>gb|KGN63048.1| hypothetical protein Csa_2G386160 [Cucumis sativus]
Length=706

 Score =   460 bits (1184),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 206/286 (72%), Positives = 252/286 (88%), Gaps = 1/286 (0%)
 Frame = -1

Query  855  MSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKEDLEQNQ-NYPKVLVQVPMFNEKE  679
            MS+MLF+ER+YM IVI+ VK F +  +  YK + +K+DLE     YP VLVQ+PM+NEKE
Sbjct  1    MSLMLFVERVYMGIVILFVKLFRKNPHKTYKWEPIKDDLELAHFAYPMVLVQIPMYNEKE  60

Query  678  VYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNG  499
            VY+LSIGA CG +WP+DR+I+Q+LDDST+ +++ LVE ECK W  +G+N+KYE R+NRNG
Sbjct  61   VYQLSIGAACGLSWPTDRIIIQVLDDSTDPSIKDLVELECKRWANKGINIKYEIRDNRNG  120

Query  498  YKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNA  319
            YKAGAL+EG+K  YV  C++VAIFDADFQP+ DFLWRTIP+L+ NPE+ALVQARWKFVN+
Sbjct  121  YKAGALKEGMKHNYVKLCDYVAIFDADFQPEPDFLWRTIPFLINNPEIALVQARWKFVNS  180

Query  318  DECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDM  139
            DEC+MTR+QEMSLDYHF VEQEVGS+T +FFGFNGTAGVWR+ AL++AGGWKDRTTVEDM
Sbjct  181  DECLMTRMQEMSLDYHFKVEQEVGSATYAFFGFNGTAGVWRIAALNEAGGWKDRTTVEDM  240

Query  138  DLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHRWSCGPANL  1
            DLAVRASL+GWKF+Y+GDL+VKNELPSTFKAYR+QQHRWSCGPANL
Sbjct  241  DLAVRASLKGWKFVYVGDLKVKNELPSTFKAYRYQQHRWSCGPANL  286



>ref|XP_009335111.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Pyrus 
x bretschneideri]
 ref|XP_009335114.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Pyrus 
x bretschneideri]
Length=517

 Score =   454 bits (1167),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 203/286 (71%), Positives = 249/286 (87%), Gaps = 1/286 (0%)
 Frame = -1

Query  855  MSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKEDLE-QNQNYPKVLVQVPMFNEKE  679
            MSVMLF+E++YM IVI ++K F RK   ++K +A+K+D+E  N  YP VLVQ+PM+NEKE
Sbjct  35   MSVMLFVEKVYMGIVITLIKLFRRKPEKKWKWEAVKDDVELGNSAYPMVLVQIPMYNEKE  94

Query  678  VYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNG  499
            VY+LSIGA CG +WPSDR+I+Q+LDDST+  ++ LVE E + W  +G+N+KYE R NRNG
Sbjct  95   VYQLSIGAACGLSWPSDRIIIQVLDDSTDPAIKDLVELEVQRWASKGINIKYEIRGNRNG  154

Query  498  YKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNA  319
            YKAGAL+EG+K  YV  C++VAIFDADFQP+ DFLWRTIP+L+ NPE+ LVQ RWKFVN+
Sbjct  155  YKAGALKEGMKHSYVKHCDYVAIFDADFQPEPDFLWRTIPFLIHNPEVGLVQTRWKFVNS  214

Query  318  DECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDM  139
            DEC+MTR+QEMSLDYHFTVEQEVGS+T +FFGFNGTAGVWR+ AL++AGGWKDRTTVEDM
Sbjct  215  DECLMTRMQEMSLDYHFTVEQEVGSATHAFFGFNGTAGVWRIAALNEAGGWKDRTTVEDM  274

Query  138  DLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHRWSCGPANL  1
            DLAVRASL GWKF+Y+ D++VKNELPSTFKAYR+QQHRWSCGPANL
Sbjct  275  DLAVRASLGGWKFVYLSDVKVKNELPSTFKAYRYQQHRWSCGPANL  320



>ref|XP_010690012.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Beta 
vulgaris subsp. vulgaris]
Length=537

 Score =   454 bits (1168),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 204/316 (65%), Positives = 262/316 (83%), Gaps = 5/316 (2%)
 Frame = -1

Query  933  LKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDA  754
            L+  WD I+ P++VP+LK+ +  C+ MS+MLF+ER+YM IVI +VK F +K   RY  +A
Sbjct  20   LELMWDMIKAPLIVPLLKLGVIVCLTMSLMLFMERLYMGIVISLVKMFWKKPDKRYNWEA  79

Query  753  LKEDLEQ-----NQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTND  589
            L + ++      +  +P VL+Q+PMFNE+EVYK+SIGA C  +WP+DR+++Q+LDDST+ 
Sbjct  80   LPDSIDDIETGGSNKFPHVLIQIPMFNEREVYKVSIGAACNLSWPADRMVIQVLDDSTDP  139

Query  588  NLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQP  409
             ++ +VE EC+ W  +G+N+ Y+ R NR GYKAGAL+EGLK+ YV  CE+VAIFDADF+P
Sbjct  140  IVKDMVELECQRWASKGLNIVYQIRENRVGYKAGALKEGLKRDYVKHCEYVAIFDADFRP  199

Query  408  DHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSF  229
            + D+L R IP+L+ NPELALVQ RW+FVNADEC+MTR+QEMSLDYHF VEQEVGSST +F
Sbjct  200  EPDYLRRAIPFLMYNPELALVQGRWRFVNADECLMTRMQEMSLDYHFKVEQEVGSSTHAF  259

Query  228  FGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFK  49
            FGFNGTAGVWR+ A+ +AGGWKDRTTVEDMDLAVRASLRGWKF+Y+GDL+VK+ELPSTFK
Sbjct  260  FGFNGTAGVWRIAAIDEAGGWKDRTTVEDMDLAVRASLRGWKFVYLGDLQVKSELPSTFK  319

Query  48   AYRFQQHRWSCGPANL  1
            A+RFQQHRWSCGPANL
Sbjct  320  AFRFQQHRWSCGPANL  335



>ref|XP_001759209.1| cellulose synthase-like A3, glycosyltransferase family 2 protein; 
mannan synthase [Physcomitrella patens]
 gb|EDQ75893.1| cellulose synthase-like A3, glycosyltransferase family 2 protein; 
mannan synthase [Physcomitrella patens]
Length=538

 Score =   454 bits (1168),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 207/327 (63%), Positives = 266/327 (81%), Gaps = 4/327 (1%)
 Frame = -1

Query  978  FSEPGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVV  799
            FSE   G +   V+ L + W S+R PI+ PIL+ A++ C++M  MLF+ERI+M  V++ V
Sbjct  5    FSE---GTFPVLVDQLINLWLSVRGPIVAPILQFAINVCLVMVTMLFIERIFMCGVMIFV  61

Query  798  KCFGRKRYTRYKLDALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRL  622
            K  GR   T++K + + +DLE  N  +P VLVQ+PMFNE+EVY+LSI A CG +WP DR+
Sbjct  62   KLLGRTPETQFKFEPIGDDLELANTAFPMVLVQIPMFNEREVYQLSIQAACGLSWPGDRM  121

Query  621  IVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCE  442
            I+Q+LDDST+  +R+LV+ EC+ W  +G+N+KYETR NR GYKAGALR+G+K  YV  C+
Sbjct  122  IIQVLDDSTDQTIRELVQMECQRWASKGINIKYETRPNRKGYKAGALRQGMKHPYVSMCD  181

Query  441  FVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTV  262
            +VAIFDADFQP+ +FL RT+P+L+ N  LALVQARWKFVNA+EC+MT++QE+SL+YHF+V
Sbjct  182  YVAIFDADFQPEPEFLHRTVPFLVHNSNLALVQARWKFVNANECLMTKMQEVSLNYHFSV  241

Query  261  EQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDL  82
            EQ VGS+T  FFGFNGTAGVWR++A+ +AGGW DRTTVEDMDLAVRAS+ GWKF+YI DL
Sbjct  242  EQRVGSATYGFFGFNGTAGVWRIRAMEEAGGWNDRTTVEDMDLAVRASMCGWKFVYIHDL  301

Query  81   EVKNELPSTFKAYRFQQHRWSCGPANL  1
            EVKNELPSTFKA+RFQQHRWSCGPANL
Sbjct  302  EVKNELPSTFKAFRFQQHRWSCGPANL  328



>emb|CDY26949.1| BnaC09g36340D [Brassica napus]
Length=510

 Score =   453 bits (1165),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 208/328 (63%), Positives = 274/328 (84%), Gaps = 1/328 (0%)
 Frame = -1

Query  981  VFSEPGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVV  802
            V  E  +G+       L   W+ ++ P++VP+L++A+  C++MS+ML  ER+YM IVIV+
Sbjct  9    VLPETFDGVKMEITGQLGMIWELVKAPVIVPLLQLAVYICLLMSLMLLCERVYMGIVIVL  68

Query  801  VKCFGRKRYTRYKLDALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDR  625
            VK F +K + RYK + +++D E  + N+P VLVQ+PMFNE+EVYKLSIG+  G +WPSDR
Sbjct  69   VKLFWKKPHKRYKFEPIQDDEELGSSNFPVVLVQIPMFNEREVYKLSIGSASGLSWPSDR  128

Query  624  LIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDC  445
            L++Q+LDDST+  ++++VE EC+ W  +G+N++Y+ R NR GYKAGAL+EGLK+ YV  C
Sbjct  129  LVIQVLDDSTDPTVKQMVEMECQRWASKGINIRYQIRENRVGYKAGALKEGLKRSYVKHC  188

Query  444  EFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFT  265
            E+V IFDADFQP+ DFL R+IP+L+ NP +ALVQARW+FVN+DEC++TR+QEMSLDYHFT
Sbjct  189  EYVVIFDADFQPEPDFLRRSIPFLVHNPNIALVQARWRFVNSDECLLTRMQEMSLDYHFT  248

Query  264  VEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGD  85
            VEQEVGSST +FFGFNGTAG+WR+ A+++AGGWKDRTTVEDMDLAVRASLRGWKFLY+GD
Sbjct  249  VEQEVGSSTHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGD  308

Query  84   LEVKNELPSTFKAYRFQQHRWSCGPANL  1
            L+VK+ELPSTF+A+RFQQHRWSCGPANL
Sbjct  309  LQVKSELPSTFRAFRFQQHRWSCGPANL  336



>ref|XP_009590983.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Nicotiana 
tomentosiformis]
Length=526

 Score =   453 bits (1166),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 201/309 (65%), Positives = 263/309 (85%), Gaps = 2/309 (1%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W+ ++ P+LVP+L+ A+  C++M +MLF+ER+YM IVI++VK F +K   RYK + + +D
Sbjct  21   WEVLKAPLLVPLLRAAVYICLVMELMLFIERLYMGIVIIIVKLFMKKPDKRYKWEPMADD  80

Query  741  -LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVE  568
             LE  + ++PKVLVQ+PMFNE+EVYK+SIGA C  +WPSDRL++Q+LDDST+  ++ +VE
Sbjct  81   DLEIGSADFPKVLVQIPMFNEREVYKISIGAACNLSWPSDRLVIQVLDDSTDPIIKDMVE  140

Query  567  DECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWR  388
             EC  W  +G+N+ Y+ R +R GYKAGAL+EGLK  YV DCE+V IFDADF+P+ DFL R
Sbjct  141  TECLRWASKGLNITYQIRESRGGYKAGALKEGLKHNYVKDCEYVVIFDADFRPEPDFLRR  200

Query  387  TIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTA  208
            +IP+L+ N E+ALVQ RW+FVNA+EC++TR+QEMSLDYHFTVEQEVGSST +FFGFNGT 
Sbjct  201  SIPFLVHNREIALVQGRWRFVNANECLLTRMQEMSLDYHFTVEQEVGSSTHAFFGFNGTG  260

Query  207  GVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQH  28
            G+WR+ A+++AGGWKDRTTVEDMDLAVRASL+GWKF+Y+GDL+VK+ELPSTFKA+RFQQH
Sbjct  261  GIWRIAAINEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGDLQVKSELPSTFKAFRFQQH  320

Query  27   RWSCGPANL  1
            RWSCGPANL
Sbjct  321  RWSCGPANL  329



>gb|ACF33171.1| mannan synthase [Coffea canephora]
Length=537

 Score =   454 bits (1167),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 200/308 (65%), Positives = 259/308 (84%), Gaps = 1/308 (0%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W+ IR P++VP+L++A+  C+ MS+MLF+ER YM IVI++VK F +K   RYK + +++D
Sbjct  31   WELIRAPLIVPLLRLAVYICLAMSLMLFIERPYMGIVIILVKIFWKKPEKRYKWEPMRDD  90

Query  741  LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            LE  N  +P VLVQ+PMFNEKEVYK+SIGA C  +WPSDR+++Q+LDDST+  ++ +VE 
Sbjct  91   LEIGNAAFPMVLVQIPMFNEKEVYKISIGAACNLSWPSDRIVIQVLDDSTDPIIKDMVEK  150

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC+ W  +G + +Y+ R  R GYKAGAL+EGLK  YV DCE+V IFDADF+P+ DFL R 
Sbjct  151  ECQRWASKGTHCRYQIRETRGGYKAGALKEGLKHDYVKDCEYVVIFDADFRPEPDFLRRA  210

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            IP+L+ N ++ALVQARW+FVN+DEC++TR+QEMSLDYHFTVEQEVGSST +FFGFNGT G
Sbjct  211  IPFLMHNSDIALVQARWRFVNSDECLLTRMQEMSLDYHFTVEQEVGSSTHAFFGFNGTGG  270

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHR  25
            +WR+ A+++AGGWKDRTTVEDMDLAVRA L+GWKF+Y+GD +VK+ELPSTFKA+RFQQHR
Sbjct  271  IWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFVYLGDPQVKSELPSTFKAFRFQQHR  330

Query  24   WSCGPANL  1
            WSCGPANL
Sbjct  331  WSCGPANL  338



>ref|XP_009361452.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Pyrus 
x bretschneideri]
Length=483

 Score =   451 bits (1161),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 202/286 (71%), Positives = 249/286 (87%), Gaps = 1/286 (0%)
 Frame = -1

Query  855  MSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKEDLE-QNQNYPKVLVQVPMFNEKE  679
            MSVMLF+E++YM IVI ++K F RK   ++K +A+K+D+E  N  YP VLVQ+PM+NEKE
Sbjct  1    MSVMLFVEKVYMGIVITLIKLFRRKPEKKWKWEAVKDDVELGNSAYPMVLVQIPMYNEKE  60

Query  678  VYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNG  499
            VY+LSIGA CG +WPSDR+I+Q+LDDST+  ++ LVE E + W  +G+++KYE R NRNG
Sbjct  61   VYQLSIGAACGLSWPSDRIIIQVLDDSTDPAIKDLVELEVQRWASKGISIKYEIRGNRNG  120

Query  498  YKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNA  319
            YKAGAL+EG+K  YV  C++VAIFDADFQP+ DFLWRTIP+L+ NPE+ LVQ RWKFVN+
Sbjct  121  YKAGALKEGMKHSYVKHCDYVAIFDADFQPEPDFLWRTIPFLIHNPEVGLVQTRWKFVNS  180

Query  318  DECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDM  139
            DEC+MTR+QEMSLDYHFTVEQEVGS+T +FFGFNGTAGVWR+ AL++AGGWKDRTTVEDM
Sbjct  181  DECLMTRMQEMSLDYHFTVEQEVGSATHAFFGFNGTAGVWRIAALNEAGGWKDRTTVEDM  240

Query  138  DLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHRWSCGPANL  1
            DLAVRASL GWKF+Y+ D++VKNELPSTFKAYR+QQHRWSCGPANL
Sbjct  241  DLAVRASLGGWKFVYLSDVKVKNELPSTFKAYRYQQHRWSCGPANL  286



>ref|XP_010110184.1| hypothetical protein L484_016805 [Morus notabilis]
 gb|EXC25422.1| hypothetical protein L484_016805 [Morus notabilis]
Length=541

 Score =   453 bits (1166),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 210/316 (66%), Positives = 264/316 (84%), Gaps = 9/316 (3%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W+  + P++VP+L++ +  C+ MSVMLF+E++YM + I  VK F ++   RYK + +K+D
Sbjct  29   WEQAKAPVIVPVLRLLVVVCLAMSVMLFIEKVYMGVFITFVKLFRKRPEKRYKWEPIKDD  88

Query  741  LE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVED  565
            +E  N  YP VLVQ+PM+NEKEVY+LSIGA CG +WPSDR+I+Q+LDDST+  ++ LVE 
Sbjct  89   VELGNSAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRIIIQVLDDSTDPTIKSLVEL  148

Query  564  ECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRT  385
            EC+ W  +G+N+KYE R+NRNGYKAGAL+EG+K  YV  C++VAIFDADFQP+ DFLWRT
Sbjct  149  ECQRWASKGINIKYEIRDNRNGYKAGALKEGMKHSYVKHCDYVAIFDADFQPEPDFLWRT  208

Query  384  IPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAG  205
            IP+L+ NPE+ LVQARWKFVN+DEC+MTR+QEMSLDYHFTVEQEVGS+  SFFGFNGTAG
Sbjct  209  IPFLVHNPEIGLVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVGSTAYSFFGFNGTAG  268

Query  204  VWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDL--------EVKNELPSTFK  49
            VWRL AL++AGGWKDRTTVEDMDLAVRASLRGWKF+Y+ DL        +VK+ELPSTFK
Sbjct  269  VWRLSALNEAGGWKDRTTVEDMDLAVRASLRGWKFVYLSDLKYQIFNETQVKSELPSTFK  328

Query  48   AYRFQQHRWSCGPANL  1
            A+R+QQHRWSCGPANL
Sbjct  329  AFRYQQHRWSCGPANL  344



>ref|XP_004965827.1| PREDICTED: probable mannan synthase 9-like [Setaria italica]
Length=538

 Score =   453 bits (1166),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 202/315 (64%), Positives = 261/315 (83%), Gaps = 8/315 (3%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKE-  745
            W  ++ P++VP+L++A++ C+ MSVMLF E++Y+A V++  +  GR+   RY+ + ++  
Sbjct  27   WQQLKSPVVVPLLRLAVALCLAMSVMLFAEKVYLAAVVLATRLLGRRPELRYRWEPIRGG  86

Query  744  ---DLEQ----NQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDN  586
               DLE     +  YP VLVQ+PM+NE+EVY +SIGA CG +WP+DR+IVQ+LDDST+  
Sbjct  87   EDGDLEAAAGGSAAYPMVLVQIPMYNEREVYGVSIGAACGLSWPADRIIVQVLDDSTDPA  146

Query  585  LRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPD  406
            +R+LV  EC+ W  +GVN++YE R++R GYKAGALREG+K+ Y   C+ VAIFDADFQP+
Sbjct  147  IRELVRAECERWASKGVNIRYEVRDSRRGYKAGALREGMKRGYARGCDMVAIFDADFQPE  206

Query  405  HDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFF  226
             DFL R +P+L+ NP+LALVQARWKFVNADEC+MTR+QE+SLDYHFTVEQEVGSST +FF
Sbjct  207  PDFLQRAVPFLVHNPDLALVQARWKFVNADECLMTRMQEISLDYHFTVEQEVGSSTYAFF  266

Query  225  GFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKA  46
            GFNGTAGVWR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKF+++GDL VKNELPST KA
Sbjct  267  GFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFVFLGDLMVKNELPSTLKA  326

Query  45   YRFQQHRWSCGPANL  1
            YR+QQHRWSCGPANL
Sbjct  327  YRYQQHRWSCGPANL  341



>ref|XP_003606274.1| Glucomannan 4-beta-mannosyltransferase [Medicago truncatula]
 gb|AES88471.1| cellulose synthase-like protein A1 [Medicago truncatula]
Length=500

 Score =   451 bits (1161),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 198/312 (63%), Positives = 257/312 (82%), Gaps = 1/312 (0%)
 Frame = -1

Query  933  LKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDA  754
            +K  WD ++ P++VP L   +   + M++MLF+ER+YM  VI++VK F +K   RYK + 
Sbjct  24   IKMIWDVMKAPLIVPFLNACVYISLAMALMLFMERVYMGFVIILVKLFWKKPEQRYKYEP  83

Query  753  LKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRK  577
            L++D E   +N+P VLVQ+PMFNE+EVYK+SIGA CG +WP+DRL++Q+LDDST+  +++
Sbjct  84   LQDDEELGGENFPVVLVQIPMFNEREVYKVSIGAACGLSWPTDRLVIQVLDDSTDPVVKQ  143

Query  576  LVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDF  397
            LVE EC+ W  +G+N+ Y+ R  R GYKAGAL+EGLK+ YV  CE+V IFDADF P  DF
Sbjct  144  LVEMECQRWASKGINITYQIRETRGGYKAGALKEGLKRSYVKHCEYVVIFDADFSPPPDF  203

Query  396  LWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFN  217
            L R IP+L+ NPE+ALVQ RW+FVNA+EC++TR+QEMSLDYHFTVEQEVGS+T +FFGFN
Sbjct  204  LRRAIPFLVGNPEIALVQGRWRFVNANECLLTRMQEMSLDYHFTVEQEVGSATHAFFGFN  263

Query  216  GTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRF  37
            GTAG+WR+ A+++AGGWKDRTTVEDMDLAVRASLRGWKFLY+GDL+  +ELPST +A+RF
Sbjct  264  GTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGDLQANSELPSTLRAFRF  323

Query  36   QQHRWSCGPANL  1
            QQHRWSCGPANL
Sbjct  324  QQHRWSCGPANL  335



>gb|KEH43412.1| cellulose synthase-like protein A1 [Medicago truncatula]
Length=530

 Score =   452 bits (1163),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 213/316 (67%), Positives = 266/316 (84%), Gaps = 2/316 (1%)
 Frame = -1

Query  942  VESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYK  763
            V  +   W   RVP++VP+LK+ +  C+ MSVMLF+ER+YM IVIV +K FG K    YK
Sbjct  18   VNQMNFIWQQARVPLIVPVLKLLVVLCLTMSVMLFVERVYMGIVIVFLKLFGHKPEKHYK  77

Query  762  LDALKEDLEQ--NQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTND  589
             +ALK+D  +  N  +P VLVQ+PM+NEKEVY+LSIGA CG +WPSDR+I+Q+LDDST+ 
Sbjct  78   WEALKDDDIELGNSAFPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRIIIQVLDDSTDP  137

Query  588  NLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQP  409
             ++ +VE EC+ W R+G+N+KYE R NRNGYKAGAL+EG+K  YV  C++VAIFDADFQP
Sbjct  138  IIKNMVEIECERWRRKGINIKYEIRENRNGYKAGALKEGMKHSYVKLCDYVAIFDADFQP  197

Query  408  DHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSF  229
            + +FL+RTIP+L +NP++ LVQARW+FVNADEC+MTR+QEMSLDYHF VEQEVGS T +F
Sbjct  198  ESNFLYRTIPFLDQNPQVGLVQARWQFVNADECLMTRMQEMSLDYHFLVEQEVGSITHAF  257

Query  228  FGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFK  49
            FGFNGTAGVWR+ AL++AGGWKDRTTVEDMDLAVRASL+GWKF+Y+ DL+VK+ELPSTFK
Sbjct  258  FGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFVYLSDLKVKSELPSTFK  317

Query  48   AYRFQQHRWSCGPANL  1
            AYR+QQHRWSCGPANL
Sbjct  318  AYRYQQHRWSCGPANL  333



>ref|XP_009793131.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X2 [Nicotiana sylvestris]
Length=531

 Score =   451 bits (1160),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 203/309 (66%), Positives = 253/309 (82%), Gaps = 2/309 (1%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALK-E  745
            W   + P++ P+L+I +  C+ +S MLF+ER+YM IVI  +K   RK   +YK +++K +
Sbjct  26   WQQTKAPLIAPLLRIVLFVCLALSFMLFVERLYMGIVIAFIKLLRRKPEKKYKWESMKKD  85

Query  744  DLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVE  568
            DLE  N +YP VLVQ+PM+NEKEVY+LSIGA C  +WP++R+ +Q+LDDST+  ++ LVE
Sbjct  86   DLELGNSSYPMVLVQIPMYNEKEVYQLSIGAACNLSWPANRIFIQVLDDSTDPAIKALVE  145

Query  567  DECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWR  388
             EC+ W  +GVN+KYE R+NR GYKAGALREG+K  YV  C  VAIFDADFQP+ DFL R
Sbjct  146  QECRRWASKGVNIKYEIRDNRKGYKAGALREGMKHSYVKLCSHVAIFDADFQPEPDFLER  205

Query  387  TIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTA  208
             IP+L+ NPE+ LVQARW+FVNADEC+MTR+QEMSL YHFTVEQEVGS+  +FFGFNGTA
Sbjct  206  AIPFLVHNPEIGLVQARWEFVNADECLMTRMQEMSLGYHFTVEQEVGSAIHAFFGFNGTA  265

Query  207  GVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQH  28
            GVWR+ AL++AGGWKDRTTVEDMDLAVRA L GWKF+Y+ DL+VKNELPSTFKAYR+QQH
Sbjct  266  GVWRMSALNEAGGWKDRTTVEDMDLAVRAGLNGWKFVYVCDLKVKNELPSTFKAYRYQQH  325

Query  27   RWSCGPANL  1
            RWSCGPANL
Sbjct  326  RWSCGPANL  334



>ref|XP_010067160.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Eucalyptus 
grandis]
 gb|KCW65234.1| hypothetical protein EUGRSUZ_G02715 [Eucalyptus grandis]
Length=482

 Score =   449 bits (1155),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 199/286 (70%), Positives = 248/286 (87%), Gaps = 1/286 (0%)
 Frame = -1

Query  855  MSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKEDLEQNQN-YPKVLVQVPMFNEKE  679
            MS MLF+ER+YM IVI  +K   R+   +YK +A+ ED+E   + YP VLVQ+PM+NEKE
Sbjct  1    MSTMLFVERVYMGIVIFFIKLLRRRPEKQYKWEAMGEDIEAGSSAYPMVLVQIPMYNEKE  60

Query  678  VYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNG  499
            VY+LSIGA CG +WP+DR+I+Q+LDDST+  +++L + EC+ W  +G+N+KYE R+NR G
Sbjct  61   VYQLSIGAACGLSWPADRIIIQVLDDSTDPTIKELKKLECQRWASKGINIKYEIRDNRKG  120

Query  498  YKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNA  319
            YKAGAL+EG+K  YV  C++VAIFDADFQP+ DFLWRTIP+L+ NPE+ LVQARWKFVN+
Sbjct  121  YKAGALKEGMKHSYVKQCDYVAIFDADFQPEPDFLWRTIPFLVHNPEIGLVQARWKFVNS  180

Query  318  DECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDM  139
            DEC+MTR+QEMSLDYHFTVEQEVGS+T +FFGFNGTAGVWR+ AL++AGGWKDRTTVEDM
Sbjct  181  DECLMTRMQEMSLDYHFTVEQEVGSATYAFFGFNGTAGVWRISALNEAGGWKDRTTVEDM  240

Query  138  DLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQQHRWSCGPANL  1
            DLAVRASL+GWKF+Y+ DL+VK+ELPSTFKAYR+QQHRWSCGPANL
Sbjct  241  DLAVRASLKGWKFVYVSDLKVKSELPSTFKAYRYQQHRWSCGPANL  286



>emb|CDY09164.1| BnaA02g05900D [Brassica napus]
Length=510

 Score =   450 bits (1157),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 209/328 (64%), Positives = 271/328 (83%), Gaps = 1/328 (0%)
 Frame = -1

Query  981  VFSEPGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVV  802
            V  E  +G+       L   W+ ++ P++VP+L++A+  C++MS+ML  ER+YM IVIV+
Sbjct  9    VLPETFDGVKMEITGQLGMIWELVKGPVIVPLLQLAVYICLLMSLMLLCERVYMGIVIVL  68

Query  801  VKCFGRKRYTRYKLDALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDR  625
            VK F +K   RYK + + +D E  + N+P VLVQ+PMFNE+EVYKLSIGA  G +WPSDR
Sbjct  69   VKLFWKKPEKRYKFEPIHDDEELGSSNFPVVLVQIPMFNEREVYKLSIGAASGLSWPSDR  128

Query  624  LIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDC  445
            L++Q+LDDST+  ++++VE EC+ W  +G+N+ Y+ R NR GYKAGAL+EGLK+ YV  C
Sbjct  129  LVIQVLDDSTDPTVKQMVEMECQRWASKGINITYQIRENRVGYKAGALKEGLKRSYVKHC  188

Query  444  EFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFT  265
            E+V IFDADFQP+ DFL R+IP+L+ NP +ALVQARW+FVN+DEC++TR+QEMSLDYHFT
Sbjct  189  EYVVIFDADFQPEPDFLRRSIPFLVHNPNIALVQARWRFVNSDECLLTRMQEMSLDYHFT  248

Query  264  VEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGD  85
            VEQEVGSST +FFGFNGTAG+WR+ A+++AGGWKDRTTVEDMDLAVRASLRGWKFLY+GD
Sbjct  249  VEQEVGSSTHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGD  308

Query  84   LEVKNELPSTFKAYRFQQHRWSCGPANL  1
            L+VK+ELPSTF+A+RFQQHRWSCGPANL
Sbjct  309  LQVKSELPSTFRAFRFQQHRWSCGPANL  336



>emb|CDY35710.1| BnaC02g09760D [Brassica napus]
Length=511

 Score =   449 bits (1156),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 208/328 (63%), Positives = 270/328 (82%), Gaps = 1/328 (0%)
 Frame = -1

Query  981  VFSEPGNGMYTTPVESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVV  802
            V  E  +G+       L   W+ ++ P++VP+L++A+  C++MS+ML  ER+YM  VIV+
Sbjct  9    VLPETFDGVKMEITGQLGMIWELVKAPVIVPLLQLAVYICLLMSLMLLCERVYMGTVIVL  68

Query  801  VKCFGRKRYTRYKLDALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDR  625
            VK F +K   RYK + + +D E  + N+P VLVQ+PMFNE+EVYKLSIGA  G +WPSDR
Sbjct  69   VKLFWKKPEKRYKFEPIHDDEELGSSNFPVVLVQIPMFNEREVYKLSIGAASGLSWPSDR  128

Query  624  LIVQILDDSTNDNLRKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDC  445
            L++Q+LDDST+  ++++VE EC+ W  +G+N+ Y+ R NR GYKAGAL+EGLK+ YV  C
Sbjct  129  LVIQVLDDSTDPTVKQMVEMECQRWASKGINITYQIRENRVGYKAGALKEGLKRSYVKHC  188

Query  444  EFVAIFDADFQPDHDFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFT  265
            E+V IFDADFQP+ DFL R+IP+L+ NP +ALVQARW+FVN+DEC++TR+QEMSLDYHFT
Sbjct  189  EYVVIFDADFQPEPDFLRRSIPFLVHNPNIALVQARWRFVNSDECLLTRMQEMSLDYHFT  248

Query  264  VEQEVGSSTCSFFGFNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGD  85
            VEQEVGSST +FFGFNGTAG+WR+ A+++AGGWKDRTTVEDMDLAVRASLRGWKFLY+GD
Sbjct  249  VEQEVGSSTHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGD  308

Query  84   LEVKNELPSTFKAYRFQQHRWSCGPANL  1
            L+VK+ELPSTF+A+RFQQHRWSCGPANL
Sbjct  309  LQVKSELPSTFRAFRFQQHRWSCGPANL  336



>ref|XP_003606273.1| Glucomannan 4-beta-mannosyltransferase [Medicago truncatula]
 gb|AES88470.1| cellulose synthase-like protein A1 [Medicago truncatula]
Length=542

 Score =   450 bits (1158),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 198/314 (63%), Positives = 257/314 (82%), Gaps = 1/314 (0%)
 Frame = -1

Query  939  ESLKHAWDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKL  760
              +K  WD ++ P++VP L   +   + M++MLF+ER+YM  VI++VK F +K   RYK 
Sbjct  22   SQIKMIWDVMKAPLIVPFLNACVYISLAMALMLFMERVYMGFVIILVKLFWKKPEQRYKY  81

Query  759  DALKEDLE-QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNL  583
            + L++D E   +N+P VLVQ+PMFNE+EVYK+SIGA CG +WP+DRL++Q+LDDST+  +
Sbjct  82   EPLQDDEELGGENFPVVLVQIPMFNEREVYKVSIGAACGLSWPTDRLVIQVLDDSTDPVV  141

Query  582  RKLVEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDH  403
            ++LVE EC+ W  +G+N+ Y+ R  R GYKAGAL+EGLK+ YV  CE+V IFDADF P  
Sbjct  142  KQLVEMECQRWASKGINITYQIRETRGGYKAGALKEGLKRSYVKHCEYVVIFDADFSPPP  201

Query  402  DFLWRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFG  223
            DFL R IP+L+ NPE+ALVQ RW+FVNA+EC++TR+QEMSLDYHFTVEQEVGS+T +FFG
Sbjct  202  DFLRRAIPFLVGNPEIALVQGRWRFVNANECLLTRMQEMSLDYHFTVEQEVGSATHAFFG  261

Query  222  FNGTAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAY  43
            FNGTAG+WR+ A+++AGGWKDRTTVEDMDLAVRASLRGWKFLY+GDL+  +ELPST +A+
Sbjct  262  FNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGDLQANSELPSTLRAF  321

Query  42   RFQQHRWSCGPANL  1
            RFQQHRWSCGPANL
Sbjct  322  RFQQHRWSCGPANL  335



>gb|EYU36982.1| hypothetical protein MIMGU_mgv1a004240mg [Erythranthe guttata]
Length=538

 Score =   450 bits (1158),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 197/311 (63%), Positives = 259/311 (83%), Gaps = 4/311 (1%)
 Frame = -1

Query  921  WDSIRVPILVPILKIAMSFCIMMSVMLFLERIYMAIVIVVVKCFGRKRYTRYKLDALKED  742
            W+ I+ P++VP+L + +  C+ MS+M+F+ER+YM +VIV+VK F RK   RYK + ++ED
Sbjct  29   WELIKAPLIVPVLTVCVYICLAMSIMVFMERLYMGVVIVLVKLFWRKPEKRYKWEPMEED  88

Query  741  LE----QNQNYPKVLVQVPMFNEKEVYKLSIGAVCGFTWPSDRLIVQILDDSTNDNLRKL  574
             +       N+P VLVQ+PMFNEKEVYK+SIGA C  +WP+DRL++Q+LDDST+  ++ +
Sbjct  89   ADDLEAAGANFPIVLVQIPMFNEKEVYKISIGAACNLSWPADRLVIQVLDDSTDFVVKDM  148

Query  573  VEDECKMWMRRGVNVKYETRNNRNGYKAGALREGLKKQYVDDCEFVAIFDADFQPDHDFL  394
            VE EC  W  +GVN+KY+ R +R GYKAGAL+EGLK  Y+  CE+V IFDADF+P+ DFL
Sbjct  149  VERECLRWASKGVNIKYQIRESRGGYKAGALKEGLKHDYIKQCEYVVIFDADFRPEPDFL  208

Query  393  WRTIPYLLENPELALVQARWKFVNADECIMTRLQEMSLDYHFTVEQEVGSSTCSFFGFNG  214
             R +P+L+ NP++ALVQARW+FVN++EC++TR+QEMSLDYHF VEQEVGS+T +FFGFNG
Sbjct  209  KRAVPFLIHNPDIALVQARWRFVNSNECMLTRMQEMSLDYHFKVEQEVGSATHAFFGFNG  268

Query  213  TAGVWRLQALHDAGGWKDRTTVEDMDLAVRASLRGWKFLYIGDLEVKNELPSTFKAYRFQ  34
            T G+WR+ A+++AGGWKDRTTVEDMDLAVRA L+GWKFLY+GDL+VK+ELPSTFKA+RFQ
Sbjct  269  TGGIWRIGAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLQVKSELPSTFKAFRFQ  328

Query  33   QHRWSCGPANL  1
            QHRWSCGPANL
Sbjct  329  QHRWSCGPANL  339



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2727717223662