BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18160_g1_i1 len=1404 path=[1876:0-307 3061:308-308 20:309-682
394:683-764 476:765-834 2253:835-1403]

Length=1404
                                                                      Score     E

ref|XP_006341947.1|  PREDICTED: maf-like protein DDB_G0281937-lik...    194   2e-55   
ref|XP_006341946.1|  PREDICTED: maf-like protein DDB_G0281937-lik...    194   3e-55   
ref|XP_006341945.1|  PREDICTED: maf-like protein DDB_G0281937-lik...    194   5e-55   
ref|XP_004238281.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    192   2e-54   
ref|XP_009588767.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    192   2e-54   
ref|XP_009588765.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    192   2e-54   
ref|XP_004238280.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    192   3e-54   
ref|XP_009588764.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    192   3e-54   
ref|XP_004238279.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    192   4e-54   
ref|XP_010664699.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    190   8e-54   
ref|XP_010664695.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    191   1e-53   
ref|XP_010664696.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    191   1e-53   
ref|XP_009760259.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    189   2e-53   
ref|XP_009760257.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    189   2e-53   
ref|XP_010664698.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    189   2e-53   
ref|XP_009760260.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    189   2e-53   
ref|XP_009760256.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    190   2e-53   
ref|XP_009760254.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    189   4e-53   
ref|XP_008466562.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    188   6e-53   
ref|XP_008466560.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    189   8e-53   
ref|XP_008466561.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    187   8e-53   
gb|AEV89967.1|  Maf-like protein                                        187   1e-52   
ref|XP_007017548.1|  Maf-like protein isoform 2                         187   1e-52   
ref|XP_007017549.1|  Maf-like protein isoform 3                         187   2e-52   
ref|XP_007017547.1|  Maf-like protein isoform 1                         187   2e-52   
gb|KGN59963.1|  hypothetical protein Csa_3G857040                       186   3e-52   
ref|XP_002321311.1|  hypothetical protein POPTR_0014s18360g             185   2e-51   Populus trichocarpa [western balsam poplar]
ref|XP_011012328.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    184   2e-51   
ref|XP_011012325.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    184   3e-51   
gb|KHG17862.1|  Maf-like protein                                        183   9e-51   
gb|KHG01838.1|  Maf-like protein                                        182   9e-51   
ref|XP_006473506.1|  PREDICTED: maf-like protein DDB_G0281937-lik...    182   2e-50   
ref|XP_006473507.1|  PREDICTED: maf-like protein DDB_G0281937-lik...    181   4e-50   
ref|XP_011012327.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    180   5e-50   
ref|XP_006473505.1|  PREDICTED: maf-like protein DDB_G0281937-lik...    182   5e-50   
gb|KEH40147.1|  Maf DDB-G0281937-like protein                           178   9e-50   
ref|XP_004291875.1|  PREDICTED: maf-like protein DDB_G0281937-lik...    179   1e-49   
ref|XP_006435001.1|  hypothetical protein CICLE_v10002369mg             180   1e-49   
ref|XP_004291874.1|  PREDICTED: maf-like protein DDB_G0281937-lik...    180   2e-49   
gb|KDP38509.1|  hypothetical protein JCGZ_04434                         179   2e-49   
ref|XP_006435000.1|  hypothetical protein CICLE_v10002369mg             179   3e-49   
ref|XP_007223816.1|  hypothetical protein PRUPE_ppa010722mg             179   4e-49   
ref|XP_007223815.1|  hypothetical protein PRUPE_ppa010722mg             179   4e-49   
ref|XP_004147866.1|  PREDICTED: maf-like protein DDB_G0281937-like      178   7e-49   
ref|XP_010677775.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    178   8e-49   
gb|KEH40148.1|  Maf DDB-G0281937-like protein                           177   9e-49   
ref|XP_011074546.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    177   1e-48   
ref|XP_008220807.1|  PREDICTED: maf-like protein DDB_G0281937           177   1e-48   
gb|KCW68240.1|  hypothetical protein EUGRSUZ_F01889                     176   1e-48   
gb|AFY26891.1|  maf-like protein                                        177   2e-48   
ref|XP_011074545.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    177   2e-48   
ref|XP_011074542.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    177   2e-48   
ref|XP_010061308.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    176   2e-48   
ref|XP_010061309.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    176   2e-48   
ref|XP_010061307.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    177   3e-48   
ref|XP_010677774.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    177   3e-48   
gb|AFK47715.1|  unknown                                                 174   9e-48   
ref|XP_009365558.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    174   1e-47   
ref|XP_009365557.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    174   1e-47   
ref|XP_010552473.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    174   1e-47   
ref|XP_009365555.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    175   1e-47   
ref|XP_010552471.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    175   1e-47   
ref|XP_010552474.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    174   1e-47   
ref|XP_002510393.1|  maf protein, putative                              175   1e-47   Ricinus communis
ref|XP_010552472.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    174   1e-47   
ref|XP_010552470.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    175   1e-47   
ref|XP_008364995.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    173   3e-47   
ref|XP_008364994.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    173   3e-47   
ref|XP_006600188.1|  PREDICTED: uncharacterized protein LOC100792...    172   3e-47   
ref|XP_008364992.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    174   4e-47   
ref|NP_001242372.1|  uncharacterized protein LOC100792444               172   4e-47   
ref|XP_006600189.1|  PREDICTED: uncharacterized protein LOC100792...    173   5e-47   
gb|KHN12707.1|  Maf-like protein                                        173   6e-47   
ref|XP_010677777.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    172   8e-47   
ref|XP_004499160.1|  PREDICTED: maf-like protein DDB_G0281937-lik...    172   9e-47   
gb|AFK42859.1|  unknown                                                 171   1e-46   
ref|XP_010677776.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    172   1e-46   
ref|XP_006855997.1|  hypothetical protein AMTR_s00059p00024750          172   1e-46   
ref|XP_008388060.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    171   1e-46   
ref|XP_006281110.1|  hypothetical protein CARUB_v10027140mg             171   1e-46   
ref|XP_004499161.1|  PREDICTED: maf-like protein DDB_G0281937-lik...    171   1e-46   
ref|XP_008388059.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    172   2e-46   
ref|XP_004499159.1|  PREDICTED: maf-like protein DDB_G0281937-lik...    172   2e-46   
ref|XP_009395644.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    171   2e-46   
emb|CDP07509.1|  unnamed protein product                                171   3e-46   
ref|XP_010263652.1|  PREDICTED: maf-like protein DDB_G0281937           169   5e-46   
ref|XP_009395643.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    172   8e-46   
ref|XP_010936258.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    167   1e-45   
ref|XP_010254822.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    169   1e-45   
ref|XP_010936259.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    168   2e-45   
ref|XP_007160752.1|  hypothetical protein PHAVU_001G014200g             168   2e-45   
ref|XP_010494228.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    168   3e-45   
gb|AAM13078.1|  unknown protein                                         165   3e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010494226.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    169   3e-45   
ref|XP_010494227.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    167   3e-45   
ref|XP_008790384.1|  PREDICTED: maf-like protein DDB_G0281937           167   4e-45   
ref|XP_009364904.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    167   6e-45   
ref|XP_009364896.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    167   8e-45   
ref|XP_010481945.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    167   9e-45   
ref|XP_010481947.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    166   9e-45   
ref|XP_004289141.1|  PREDICTED: maf-like protein DDB_G0281937-like      166   1e-44   
ref|XP_010481946.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    166   1e-44   
ref|XP_006403352.1|  hypothetical protein EUTSA_v10003272mg             166   1e-44   
ref|XP_010442121.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    165   2e-44   
dbj|BAB10633.1|  unnamed protein product                                166   2e-44   Arabidopsis thaliana [mouse-ear cress]
gb|EYU32779.1|  hypothetical protein MIMGU_mgv1a013118mg                165   2e-44   
gb|EYU32778.1|  hypothetical protein MIMGU_mgv1a013118mg                166   3e-44   
gb|KFK31818.1|  hypothetical protein AALP_AA6G162400                    165   4e-44   
ref|NP_001190455.1|  Maf-like protein                                   166   4e-44   
ref|XP_010442120.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    165   4e-44   
gb|KFK31817.1|  hypothetical protein AALP_AA6G162400                    166   4e-44   
ref|NP_199091.3|  Maf-like protein                                      164   5e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002865485.1|  hypothetical protein ARALYDRAFT_331123             164   5e-44   
ref|XP_007202620.1|  hypothetical protein PRUPE_ppa011905mg             164   5e-44   
ref|XP_010550785.1|  PREDICTED: maf-like protein DDB_G0281937           162   6e-44   
ref|XP_009336226.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    164   6e-44   
ref|XP_008241678.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    164   9e-44   
ref|XP_009336218.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    164   1e-43   
ref|XP_009101837.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    162   2e-43   
ref|XP_009101835.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    162   4e-43   
ref|XP_008354663.1|  PREDICTED: maf-like protein DDB_G0281937           162   4e-43   
ref|XP_009101834.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    162   4e-43   
ref|XP_004985115.1|  PREDICTED: maf-like protein DDB_G0281937-lik...    161   6e-43   
ref|XP_009347538.1|  PREDICTED: maf-like protein DDB_G0281937           161   8e-43   
ref|XP_009340747.1|  PREDICTED: maf-like protein DDB_G0281937           161   8e-43   
ref|XP_002468218.1|  hypothetical protein SORBIDRAFT_01g041990          161   8e-43   Sorghum bicolor [broomcorn]
ref|XP_002527711.1|  maf protein, putative                              160   1e-42   Ricinus communis
ref|XP_009392957.1|  PREDICTED: maf-like protein DDB_G0281937           160   1e-42   
gb|ABF94775.1|  Maf family protein, putative, expressed                 157   2e-42   Oryza sativa Japonica Group [Japonica rice]
gb|ACF84159.1|  unknown                                                 158   2e-42   Zea mays [maize]
ref|NP_001150369.1|  LOC100283999                                       160   2e-42   Zea mays [maize]
ref|XP_008653072.1|  PREDICTED: maf-like protein DDB_G0281937           159   5e-42   
gb|ADE75962.1|  unknown                                                 159   5e-42   
ref|XP_008790383.1|  PREDICTED: maf-like protein DDB_G0281937           159   7e-42   
ref|XP_011025792.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    157   7e-42   
ref|XP_002880683.1|  maf family protein                                 158   9e-42   
gb|KFK28327.1|  hypothetical protein AALP_AA8G501600                    158   1e-41   
ref|XP_009607223.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    157   1e-41   
ref|XP_003558431.1|  PREDICTED: maf-like protein DDB_G0281937           158   1e-41   
ref|XP_010557922.1|  PREDICTED: maf-like protein DDB_G0281937           158   1e-41   
ref|XP_006466798.1|  PREDICTED: maf-like protein DDB_G0281937-lik...    157   1e-41   
ref|XP_009772915.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    158   2e-41   
ref|XP_006656251.1|  PREDICTED: maf-like protein DDB_G0281937-like      157   2e-41   
ref|XP_010484628.1|  PREDICTED: maf-like protein DDB_G0281937           158   2e-41   
ref|XP_006425670.1|  hypothetical protein CICLE_v10026398mg             158   2e-41   
ref|XP_002310234.2|  hypothetical protein POPTR_0007s12880g             157   2e-41   Populus trichocarpa [western balsam poplar]
ref|XP_009607221.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    157   2e-41   
ref|XP_007046933.1|  Maf-like protein isoform 2                         156   3e-41   
ref|XP_010444782.1|  PREDICTED: maf-like protein DDB_G0281937           158   3e-41   
gb|ABF94776.1|  Maf family protein, putative, expressed                 157   3e-41   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009772919.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    157   4e-41   
ref|XP_010465316.1|  PREDICTED: maf-like protein DDB_G0281937           157   4e-41   
dbj|BAJ91214.1|  predicted protein                                      157   4e-41   
ref|NP_201456.2|  Maf-like protein                                      156   5e-41   Arabidopsis thaliana [mouse-ear cress]
gb|EMT18880.1|  Maf-like protein                                        155   5e-41   
ref|XP_011025789.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    156   6e-41   
gb|EEC74808.1|  hypothetical protein OsI_10622                          157   6e-41   Oryza sativa Indica Group [Indian rice]
ref|XP_006393850.1|  hypothetical protein EUTSA_v10004849mg             157   7e-41   
ref|XP_009607222.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    155   9e-41   
ref|XP_010316365.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    155   9e-41   
ref|XP_006340618.1|  PREDICTED: maf-like protein DDB_G0281937-lik...    155   1e-40   
ref|XP_007046932.1|  Maf-like protein isoform 1                         156   1e-40   
ref|XP_010472549.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    155   1e-40   
ref|XP_004232406.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    155   1e-40   
ref|XP_009112309.1|  PREDICTED: maf-like protein DDB_G0281937           155   2e-40   
ref|XP_010089029.1|  Maf-like protein                                   154   2e-40   
gb|KHG09502.1|  Maf-like protein                                        155   4e-40   
ref|XP_010417317.1|  PREDICTED: maf-like protein DDB_G0281937           154   4e-40   
ref|XP_010429543.1|  PREDICTED: maf-like protein DDB_G0281937           154   4e-40   
gb|ABA94173.1|  Maf-like protein, expressed                             154   5e-40   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006301614.1|  hypothetical protein CARUB_v10022055mg             154   6e-40   
ref|XP_003631878.1|  PREDICTED: maf-like protein DDB_G0281937           153   9e-40   
ref|XP_006375639.1|  hypothetical protein POPTR_0014s18360g             152   2e-39   
gb|AAO00680.1|  Unknown protein                                         156   2e-39   Oryza sativa Japonica Group [Japonica rice]
emb|CDY18610.1|  BnaA09g07850D                                          152   3e-39   
gb|KDP38287.1|  hypothetical protein JCGZ_05173                         152   3e-39   
emb|CDP02020.1|  unnamed protein product                                151   4e-39   
ref|XP_004146552.1|  PREDICTED: maf-like protein DDB_G0281937-like      151   5e-39   
ref|XP_007156045.1|  hypothetical protein PHAVU_003G253800g             150   6e-39   
ref|XP_003548889.1|  PREDICTED: maf-like protein DDB_G0281937-lik...    150   7e-39   
ref|XP_004509262.1|  PREDICTED: maf-like protein DDB_G0281937-like      150   8e-39   
gb|KGN53301.1|  hypothetical protein Csa_4G046640                       151   9e-39   
ref|XP_009101836.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    150   9e-39   
emb|CDX81389.1|  BnaC09g08000D                                          150   1e-38   
ref|XP_010029803.1|  PREDICTED: maf-like protein DDB_G0281937           150   1e-38   
gb|KHN00541.1|  Maf-like protein                                        149   2e-38   
ref|XP_007223814.1|  hypothetical protein PRUPE_ppa010722mg             149   2e-38   
ref|XP_006294863.1|  hypothetical protein CARUB_v10023917mg             150   2e-38   
ref|XP_003520319.1|  PREDICTED: maf-like protein DDB_G0281937-lik...    149   3e-38   
ref|XP_006294864.1|  hypothetical protein CARUB_v10023917mg             150   4e-38   
ref|XP_008452089.1|  PREDICTED: maf-like protein DDB_G0281937           149   4e-38   
ref|XP_003629446.1|  Maf-like protein                                   148   6e-38   
emb|CDY45239.1|  BnaA07g12510D                                          148   7e-38   
ref|XP_010029802.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    147   7e-38   
ref|XP_010029801.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    148   8e-38   
ref|XP_009103516.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    148   8e-38   
ref|XP_011099609.1|  PREDICTED: maf-like protein DDB_G0281937           148   8e-38   
ref|XP_009103515.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    148   1e-37   
ref|XP_009365556.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    147   2e-37   
ref|XP_008364993.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    147   3e-37   
emb|CDY30767.1|  BnaC07g16670D                                          146   3e-37   
gb|EYU40161.1|  hypothetical protein MIMGU_mgv1a013798mg                146   3e-37   
ref|XP_010550780.1|  PREDICTED: maf-like protein DDB_G0281937           145   5e-37   
ref|XP_010097633.1|  Maf-like protein                                   146   1e-36   
ref|XP_006281109.1|  hypothetical protein CARUB_v10027139mg             143   4e-36   
ref|XP_002865059.1|  maf family protein                                 143   5e-36   
ref|XP_002450931.1|  hypothetical protein SORBIDRAFT_05g021370          142   8e-36   Sorghum bicolor [broomcorn]
tpg|DAA42109.2|  TPA: hypothetical protein ZEAMMB73_962619              140   1e-35   
emb|CDX71516.1|  BnaC04g17510D                                          141   1e-35   
gb|EPS58347.1|  hypothetical protein M569_16467                         137   2e-35   
ref|XP_001761267.1|  predicted protein                                  140   3e-35   
ref|XP_006662986.1|  PREDICTED: maf-like protein DDB_G0281937-like      140   3e-35   
ref|NP_001152030.1|  maf-like protein CV_0124                           140   5e-35   Zea mays [maize]
ref|XP_004979450.1|  PREDICTED: maf-like protein DDB_G0281937-like      139   8e-35   
dbj|BAJ90754.1|  predicted protein                                      141   1e-34   
ref|XP_010254823.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    138   1e-34   
emb|CDY22383.1|  BnaA06g37050D                                          137   3e-34   
ref|XP_003577472.1|  PREDICTED: maf-like protein DDB_G0281937           139   5e-34   
ref|XP_009588766.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    136   7e-34   
gb|EEC68337.1|  hypothetical protein OsI_36449                          135   2e-33   Oryza sativa Indica Group [Indian rice]
ref|XP_009760258.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    135   2e-33   
gb|AAR01628.1|  putative Maf-like protein                               134   6e-33   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001051124.1|  Os03g0724700                                       134   9e-33   Oryza sativa Japonica Group [Japonica rice]
gb|KCW56760.1|  hypothetical protein EUGRSUZ_I02441                     135   2e-32   
ref|NP_001068071.1|  Os11g0549600                                       132   3e-32   Oryza sativa Japonica Group [Japonica rice]
gb|KCW56761.1|  hypothetical protein EUGRSUZ_I02441                     135   3e-32   
ref|XP_004985114.1|  PREDICTED: maf-like protein DDB_G0281937-lik...    132   4e-32   
ref|XP_002969035.1|  hypothetical protein SELMODRAFT_90184              131   6e-32   
ref|XP_005535187.1|  probable nucleotide binding protein Maf            131   6e-32   
ref|XP_011025791.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    129   2e-31   
ref|XP_009371635.1|  PREDICTED: uncharacterized protein LOC103960867    126   1e-30   
gb|ACF74344.1|  Maf-like protein                                        123   2e-30   Arachis hypogaea [goober]
ref|XP_008345099.1|  PREDICTED: LOW QUALITY PROTEIN: maf-like pro...    126   4e-30   
gb|EAZ18696.1|  hypothetical protein OsJ_34216                          130   6e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002466540.1|  hypothetical protein SORBIDRAFT_01g009640          126   1e-29   Sorghum bicolor [broomcorn]
ref|XP_008643922.1|  PREDICTED: uncharacterized protein LOC100381...    125   1e-29   
ref|XP_001416332.1|  septum formation protein MAF-like protein          125   1e-29   Ostreococcus lucimarinus CCE9901
ref|XP_005839679.1|  hypothetical protein GUITHDRAFT_92283              124   2e-29   
ref|XP_008643921.1|  PREDICTED: uncharacterized protein LOC100381...    125   2e-29   
ref|XP_008643920.1|  PREDICTED: uncharacterized protein LOC100381...    125   3e-29   
ref|XP_009772925.1|  PREDICTED: uncharacterized protein LOC104223...    122   3e-29   
ref|XP_009772914.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    123   1e-28   
ref|XP_009772916.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    122   2e-28   
ref|XP_009772918.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    121   3e-28   
ref|NP_001167780.1|  uncharacterized protein LOC100381473               118   3e-28   Zea mays [maize]
ref|XP_009772917.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    120   5e-28   
emb|CBN74303.1|  conserved unknown protein                              120   6e-28   
ref|XP_003075217.1|  putative Maf-like protein (ISS)                    119   2e-27   
ref|XP_005702796.1|  septum formation protein / Maf family protein      126   2e-27   
ref|XP_001703013.1|  predicted protein                                  117   4e-27   Chlamydomonas reinhardtii
ref|XP_009103514.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    118   5e-27   
ref|XP_009103513.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    118   6e-27   
ref|XP_003560424.2|  PREDICTED: uncharacterized protein LOC100839260    120   1e-26   
ref|XP_007514161.1|  predicted protein                                  114   1e-25   
ref|XP_005844892.1|  hypothetical protein CHLNCDRAFT_26436              112   2e-25   
gb|KFM24175.1|  Maf-like protein                                        112   4e-25   
ref|XP_002503758.1|  MAF family protein                                 112   9e-25   Micromonas commoda
ref|XP_011012326.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    111   1e-24   
ref|XP_002947903.1|  hypothetical protein VOLCADRAFT_88280              109   2e-24   
ref|XP_004987145.1|  PREDICTED: uncharacterized protein LOC101772850    107   2e-24   
gb|AFW67759.1|  hypothetical protein ZEAMMB73_345019                    108   2e-24   
ref|XP_006595932.1|  PREDICTED: maf-like protein DDB_G0281937-lik...    107   3e-24   
ref|XP_006574700.1|  PREDICTED: maf-like protein DDB_G0281937-lik...    107   4e-24   
ref|XP_006574699.1|  PREDICTED: maf-like protein DDB_G0281937-lik...    107   5e-24   
ref|XP_001742758.1|  hypothetical protein                               105   2e-23   Monosiga brevicollis MX1
ref|XP_010550784.1|  PREDICTED: maf-like protein DDB_G0281937           105   3e-23   
ref|XP_006599381.1|  PREDICTED: maf-like protein DDB_G0281937-lik...    105   3e-23   
ref|XP_006599380.1|  PREDICTED: maf-like protein DDB_G0281937-lik...    105   3e-23   
gb|EAZ28427.1|  hypothetical protein OsJ_12410                          107   4e-23   Oryza sativa Japonica Group [Japonica rice]
gb|EPS66060.1|  hypothetical protein M569_08716                         103   5e-23   
gb|EAY91709.1|  hypothetical protein OsI_13351                          107   6e-23   Oryza sativa Indica Group [Indian rice]
gb|KEH20441.1|  Maf DDB-G0281937-like protein                           103   2e-22   
ref|XP_004981930.1|  PREDICTED: maf-like protein DDB_G0281937-lik...    105   2e-22   
gb|KEH20440.1|  Maf DDB-G0281937-like protein                           103   2e-22   
gb|KEH20438.1|  Maf DDB-G0281937-like protein                           102   3e-22   
ref|XP_004981929.1|  PREDICTED: maf-like protein DDB_G0281937-lik...    104   3e-22   
gb|ACJ85341.1|  unknown                                                 102   3e-22   Medicago truncatula
gb|KEH20439.1|  Maf DDB-G0281937-like protein                           102   4e-22   
ref|XP_007156046.1|  hypothetical protein PHAVU_003G253800g             102   6e-22   
ref|XP_005830568.1|  hypothetical protein GUITHDRAFT_163800             105   6e-22   
gb|EMT07311.1|  Maf-like protein                                        102   7e-22   
ref|XP_006677726.1|  hypothetical protein BATDEDRAFT_10473              102   9e-22   
ref|XP_006595934.1|  PREDICTED: maf-like protein DDB_G0281937-lik...  99.4    1e-21   
ref|XP_006595933.1|  PREDICTED: maf-like protein DDB_G0281937-lik...  99.4    2e-21   
ref|NP_565598.3|  Inosine triphosphate pyrophosphatase family pro...  99.0    2e-21   
gb|EFW41363.2|  maf-like protein                                        101   2e-21   
ref|XP_006434999.1|  hypothetical protein CICLE_v10002369mg             101   3e-21   
ref|XP_008241680.1|  PREDICTED: maf-like protein DDB_G0281937 iso...    100   3e-21   
ref|XP_002177640.1|  predicted protein                                  100   4e-21   
ref|NP_001176593.1|  Os11g0549655                                     99.4    5e-21   
gb|KDD74898.1|  hypothetical protein H632_c1003p1                       100   1e-20   
ref|XP_009607224.1|  PREDICTED: maf-like protein DDB_G0281937 iso...  99.4    1e-20   
dbj|BAF85812.1|  putative Maf-like protein                            96.3    1e-20   
ref|XP_009772927.1|  PREDICTED: maf-like protein DDB_G0281937 iso...  99.0    1e-20   
ref|XP_009772920.1|  PREDICTED: maf-like protein DDB_G0281937 iso...  98.6    3e-20   
gb|AAK96520.1|  AT5g66550/K1F13_22                                    97.1    5e-20   
tpg|DAA44215.1|  TPA: hypothetical protein ZEAMMB73_359637            95.5    5e-20   
ref|XP_004340607.1|  Maflike protein                                  97.8    5e-20   
ref|XP_009772924.1|  PREDICTED: maf-like protein DDB_G0281937 iso...  97.4    5e-20   
ref|XP_009772922.1|  PREDICTED: maf-like protein DDB_G0281937 iso...  97.4    5e-20   
dbj|BAB10931.1|  unnamed protein product                              96.3    6e-20   
ref|XP_009772923.1|  PREDICTED: maf-like protein DDB_G0281937 iso...  97.1    7e-20   
dbj|GAM21392.1|  hypothetical protein SAMD00019534_045670             97.8    7e-20   
gb|KDO35847.1|  hypothetical protein CISIN_1g033033mg                 94.7    1e-19   
gb|EFA79291.1|  maf family protein                                      101   1e-19   
gb|EMT10504.1|  Maf-like protein                                      97.1    2e-19   
emb|CAN79018.1|  hypothetical protein VITISV_040618                   97.8    3e-19   
gb|KDO35846.1|  hypothetical protein CISIN_1g033033mg                 93.2    5e-19   
ref|XP_003063333.1|  maf family protein                               95.5    8e-19   
ref|XP_008887864.1|  Maf family protein                               95.9    9e-19   
ref|XP_002366664.1|  maf-like protein, putative                       95.5    1e-18   
gb|KFH04365.1|  Maf family protein                                    95.5    1e-18   
gb|KDO79550.1|  hypothetical protein CISIN_1g042252mg                 90.1    2e-18   
ref|XP_006577626.1|  PREDICTED: maf-like protein DDB_G0281937-like    91.7    4e-18   
gb|EJK63038.1|  hypothetical protein THAOC_16326                      94.0    5e-18   
ref|XP_005783262.1|  hypothetical protein EMIHUDRAFT_72486            90.1    5e-18   
gb|ABF98623.1|  Maf-like protein, expressed                           93.6    9e-18   
ref|XP_006591805.1|  PREDICTED: maf-like protein DDB_G0281937-like    88.2    2e-17   
ref|XP_009035384.1|  hypothetical protein AURANDRAFT_6675             90.9    2e-17   
ref|XP_006595935.1|  PREDICTED: maf-like protein DDB_G0281937-lik...  87.0    3e-17   
ref|XP_004361255.1|  maf family protein                               89.0    4e-17   
gb|EKE01535.1|  hypothetical protein ACD_21C00107G0013                89.0    6e-17   
ref|XP_003881906.1|  putative Maf-like protein                        89.4    2e-16   
gb|ABF98624.1|  Maf-like protein, expressed                           86.3    3e-16   
ref|XP_007046934.1|  Maf-like protein isoform 3                       84.7    4e-16   
gb|ABF98625.1|  Maf-like protein, expressed                           84.0    7e-16   
ref|XP_007046935.1|  Maf-like protein isoform 4                       83.6    9e-16   
ref|XP_004993212.1|  hypothetical protein PTSG_12428                  85.1    2e-15   
ref|XP_640464.1|  maf family protein                                  85.1    2e-15   
ref|NP_001173329.1|  Os03g0229600                                     82.4    3e-15   
gb|EMT24588.1|  Maf-like protein                                      84.7    3e-15   
gb|KDO35848.1|  hypothetical protein CISIN_1g033033mg                 82.0    3e-15   
ref|XP_002297433.1|  predicted protein                                83.2    1e-14   
ref|XP_010103922.1|  15-cis-zeta-carotene isomerase                   85.1    2e-14   
emb|CBN74646.1|  conserved unknown protein                            81.6    3e-14   
gb|EPY29220.1|  septum formation protein                              78.6    3e-13   
ref|XP_739712.1|  hypothetical protein                                79.3    3e-13   
gb|KDP23807.1|  hypothetical protein JCGZ_00120                       76.6    3e-13   
ref|XP_002786711.1|  maf protein, putative                            77.8    7e-13   
ref|XP_009308774.1|  MAF-like septum formation protein                77.0    1e-12   
ref|XP_003291132.1|  hypothetical protein DICPUDRAFT_57163            76.6    1e-12   
gb|EUD70880.1|  hypothetical protein YYG_04004                        79.3    2e-12   
ref|XP_008350534.1|  PREDICTED: laccase-7-like                        76.6    2e-12   
gb|ACB59222.1|  Maf family protein                                    73.2    3e-12   
ref|XP_675471.1|  hypothetical protein                                78.6    3e-12   
gb|EPY42692.1|  septum formation protein                              75.5    3e-12   
ref|XP_008625904.1|  hypothetical protein YYE_04039                   78.2    4e-12   
emb|CDU16553.1|  Maf-like protein, putative                           78.2    4e-12   
emb|CDR11364.1|  Maf-like protein, putative                           78.2    4e-12   
gb|ETB59251.1|  hypothetical protein YYC_03487                        78.2    4e-12   
emb|CDS45088.1|  Maf-like protein, putative                           78.2    4e-12   
ref|XP_727956.1|  hypothetical protein                                77.8    5e-12   
gb|ESL08329.1|  septum formation protein                              73.6    2e-11   
ref|XP_001567470.1|  conserved hypothetical protein                   73.2    2e-11   
ref|XP_010701796.1|  hypothetical protein LPMP_321100                 73.6    3e-11   
ref|XP_002785530.1|  maf protein, putative                            72.0    6e-11   
gb|ACU24128.1|  unknown                                               68.9    7e-11   
ref|XP_001778833.1|  predicted protein                                69.3    9e-11   
ref|XP_004221587.1|  hypothetical protein PCYB_071420                 73.9    1e-10   
ref|XP_008815324.1|  hypothetical protein C922_01499                  73.6    1e-10   
emb|CCW62769.1|  unnamed protein product                              70.5    2e-10   
ref|XP_003877947.1|  conserved hypothetical protein                   70.1    2e-10   
ref|XP_001614602.1|  hypothetical protein                             71.6    4e-10   
ref|XP_001351937.1|  Maf-like protein, putative                       71.2    6e-10   
gb|ETW56935.1|  hypothetical protein PFUGPA_01136                     71.2    6e-10   
gb|EWC76924.1|  hypothetical protein C923_02431                       71.2    6e-10   
gb|ETW18450.1|  hypothetical protein PFFVO_02350                      71.2    6e-10   
emb|CCC95942.1|  unnamed protein product                              68.2    1e-09   
ref|XP_829484.1|  MAF-like septum formation protein                   68.2    1e-09   
gb|EPY25237.1|  septum formation protein                              68.2    1e-09   
pdb|2AMH|A  Chain A, Crystal Structure Of Maf-Like Protein Tbru21...  68.2    1e-09   
ref|XP_003863525.1|  hypothetical protein, conserved                  68.2    1e-09   
ref|XP_001467789.1|  conserved hypothetical protein                   68.2    1e-09   
ref|XP_818732.1|  hypothetical protein                                67.0    2e-09   
gb|AFK45900.1|  unknown                                               63.9    2e-09   
ref|XP_002142783.1|  maf-like protein                                 67.0    3e-09   
tpg|DAA42111.1|  TPA: hypothetical protein ZEAMMB73_962619            65.5    3e-09   
emb|CCW70600.1|  unnamed protein product                              66.6    3e-09   
ref|XP_002258335.1|  Maf-like protein                                 68.9    3e-09   
ref|XP_009492937.1|  maf-like protein                                 67.0    3e-09   
emb|CDO64123.1|  Maf-like protein, putative                           68.9    3e-09   
dbj|BAJ98964.1|  predicted protein                                    64.7    4e-09   
ref|XP_666574.1|  hypothetical protein                                65.5    8e-09   
ref|XP_001685419.1|  conserved hypothetical protein                   65.1    1e-08   
ref|XP_004345244.1|  conserved hypothetical protein                   63.5    2e-08   
ref|XP_626609.1|  Maf protein like, involved in RNA metabolism        62.4    7e-08   
gb|EZG50027.1|  Maf-like protein                                      60.1    5e-07   
ref|XP_725414.1|  hypothetical protein                                61.2    1e-06   
ref|WP_023846516.1|  MAF protein                                      57.0    4e-06   
ref|WP_022100152.1|  maf-like protein HMPREF0189_00281                56.6    5e-06   
emb|CBK25380.2|  unnamed protein product                              56.6    7e-06   
ref|WP_021867961.1|  maf-like protein HMPREF0189_00281                55.8    1e-05   
ref|WP_008810606.1|  septum formation protein Maf                     55.8    1e-05   
ref|WP_017051310.1|  hypothetical protein                             55.5    1e-05   
ref|WP_008863634.1|  septum formation protein Maf                     55.5    1e-05   
ref|XP_007046937.1|  Uncharacterized protein TCM_000383               54.7    1e-05   
ref|WP_026786539.1|  septum formation protein Maf                     55.5    2e-05   
ref|WP_011234592.1|  septum formation protein Maf                     55.1    2e-05   
ref|WP_034823118.1|  septum formation inhibitor Maf                   55.1    2e-05   
ref|WP_010964553.1|  septum formation protein Maf                     55.1    2e-05   
ref|WP_026797844.1|  septum formation protein Maf                     55.1    2e-05   
ref|WP_030328912.1|  septum formation inhibitor Maf                   55.1    2e-05   
gb|KEI65981.1|  Maf                                                   55.1    2e-05   
ref|WP_005956504.1|  septum formation protein Maf                     53.9    4e-05   
sp|Q1QDI9.2|Y481_PSYCK  RecName: Full=Maf-like protein Pcryo_0481     54.3    5e-05   
gb|KID50323.1|  septum formation protein Maf                          53.9    5e-05   
gb|KDE66787.1|  septum formation protein Maf                          54.3    5e-05   
ref|WP_011512849.1|  septum formation inhibitor Maf                   54.7    5e-05   
gb|EJU15853.1|  septum formation protein Maf                          53.9    5e-05   
gb|KDE63240.1|  septum formation protein Maf                          53.9    6e-05   
gb|KDO14777.1|  septum formation inhibitor Maf                        53.5    6e-05   
ref|WP_001181929.1|  septum formation inhibitor Maf                   53.5    6e-05   
ref|WP_026794110.1|  MULTISPECIES: septum formation protein Maf       53.5    7e-05   
ref|WP_015123430.1|  MAF protein                                      53.5    7e-05   
ref|WP_029627386.1|  septum formation inhibitor Maf                   53.1    7e-05   
ref|WP_007018983.1|  septum formation protein Maf                     53.1    8e-05   
ref|XP_001458804.1|  hypothetical protein                             53.5    8e-05   
ref|WP_015259276.1|  Septum formation protein Maf                     52.8    9e-05   
ref|WP_009106319.1|  septum formation protein Maf                     52.8    1e-04   
ref|WP_004746540.1|  septum formation inhibitor Maf                   52.8    1e-04   
ref|WP_006463512.1|  septum formation protein Maf                     53.1    1e-04   
ref|WP_012970835.1|  septum formation protein Maf                     52.8    1e-04   
ref|WP_015397141.1|  septum formation protein                         52.4    1e-04   
ref|WP_020442811.1|  septum formation inhibitor Maf                   53.1    1e-04   
ref|WP_006959291.1|  septum formation inhibitor Maf                   52.4    1e-04   
ref|WP_001181928.1|  septum formation inhibitor Maf                   52.4    2e-04   
ref|WP_038162035.1|  septum formation inhibitor Maf                   52.4    2e-04   
ref|WP_021455309.1|  septum formation inhibitor Maf                   52.4    2e-04   
ref|WP_001181927.1|  septum formation inhibitor Maf                   52.4    2e-04   
ref|WP_004737374.1|  septum formation inhibitor Maf                   52.0    2e-04   
ref|WP_006955321.1|  septum formation protein Maf                     52.4    2e-04   
ref|WP_021712416.1|  Maf-like protein                                 52.0    2e-04   
ref|WP_001247006.1|  septum formation inhibitor Maf                   52.0    2e-04   
ref|WP_001181920.1|  septum formation inhibitor Maf                   52.0    2e-04   
ref|WP_001181919.1|  MULTISPECIES: septum formation inhibitor Maf     52.0    2e-04   
ref|WP_022578295.1|  septum formation inhibitor Maf                   52.0    2e-04   
ref|WP_005523670.1|  Maf-like protein                                 52.0    2e-04   
ref|WP_017028839.1|  hypothetical protein                             52.0    2e-04   
ref|WP_001181926.1|  septum formation inhibitor Maf                   52.0    2e-04   
ref|WP_014263275.1|  septum formation protein Maf                     52.0    2e-04   
ref|WP_001181922.1|  septum formation inhibitor Maf                   52.0    2e-04   
ref|WP_001181925.1|  MULTISPECIES: septum formation inhibitor Maf     52.0    2e-04   
ref|WP_001181924.1|  septum formation inhibitor Maf                   52.0    2e-04   
ref|WP_038512788.1|  septum formation inhibitor Maf                   52.0    2e-04   
gb|AIW18295.1|  septum formation inhibitor Maf                        52.0    2e-04   
ref|WP_001181923.1|  septum formation inhibitor Maf                   51.6    2e-04   
ref|WP_001888737.1|  septum formation inhibitor Maf                   51.6    2e-04   
ref|WP_019808642.1|  maf-like protein                                 51.6    2e-04   
ref|WP_020335645.1|  septum formation inhibitor Maf                   51.6    2e-04   
ref|WP_009143178.1|  septum formation protein Maf                     51.6    2e-04   
ref|WP_037012597.1|  septum formation protein Maf                     51.6    3e-04   
ref|WP_011045286.1|  Maf                                              51.6    3e-04   
ref|WP_019170891.1|  septum formation protein Maf                     51.6    3e-04   
ref|WP_001181918.1|  septum formation inhibitor Maf                   51.2    3e-04   
emb|CEI85983.1|  Putative Maf-like protein                            51.6    3e-04   
ref|WP_024613304.1|  septum formation inhibitor Maf                   51.2    3e-04   
ref|WP_006878254.1|  septum formation inhibitor Maf                   51.2    4e-04   
ref|WP_036806207.1|  septum formation inhibitor Maf                   51.2    4e-04   
ref|WP_011785347.1|  MULTISPECIES: septum formation protein Maf       51.2    4e-04   
ref|WP_022991762.1|  septum formation protein Maf                     51.2    4e-04   
ref|WP_007074565.1|  septum formation protein Maf                     51.6    4e-04   
ref|WP_009186245.1|  septum formation protein Maf                     50.8    4e-04   
emb|CEI93476.1|  Putative Maf-like protein                            51.2    4e-04   
ref|WP_005330316.1|  septum formation inhibitor Maf                   50.8    4e-04   
ref|WP_027727515.1|  septum formation protein Maf                     50.8    4e-04   
ref|WP_026534886.1|  septum formation inhibitor Maf                   51.2    4e-04   
ref|WP_030486686.1|  septum formation inhibitor Maf                   51.2    5e-04   
ref|WP_021329900.1|  septum formation protein Maf                     50.8    5e-04   
ref|WP_017243814.1|  hypothetical protein                             50.8    5e-04   
gb|EDQ35255.2|  MAF protein                                           50.8    5e-04   
ref|WP_028783354.1|  septum formation protein Maf                     50.8    5e-04   
ref|WP_001965641.1|  septum formation inhibitor Maf                   50.8    5e-04   
ref|WP_013742775.1|  septum formation protein Maf                     50.4    5e-04   
ref|WP_023402560.1|  septum formation protein Maf                     50.4    5e-04   
ref|WP_011727924.1|  septum formation protein Maf                     50.8    6e-04   
ref|WP_007199486.1|  septum formation protein Maf                     50.8    6e-04   
gb|KGK09299.1|  septum formation inhibitor Maf                        50.4    6e-04   
ref|WP_039437430.1|  septum formation inhibitor Maf                   50.4    6e-04   
ref|WP_001181921.1|  septum formation inhibitor Maf                   50.4    6e-04   
ref|WP_017013873.1|  hypothetical protein                             50.4    6e-04   
ref|WP_039430578.1|  septum formation inhibitor Maf                   50.4    6e-04   
gb|KGK17274.1|  septum formation inhibitor Maf                        50.4    6e-04   
ref|WP_011794324.1|  septum formation protein Maf                     50.4    6e-04   
ref|WP_017010181.1|  hypothetical protein                             50.4    6e-04   
ref|WP_017740577.1|  septum formation protein Maf                     50.4    6e-04   
ref|WP_007098356.1|  septum formation protein Maf                     50.4    6e-04   
ref|WP_012326977.1|  Maf                                              50.4    7e-04   
ref|WP_002617248.1|  Maf                                              50.4    7e-04   
ref|WP_039786612.1|  septum formation inhibitor Maf                   50.4    7e-04   
ref|WP_017054982.1|  septum formation inhibitor Maf                   50.1    7e-04   
ref|WP_017076683.1|  septum formation inhibitor Maf                   50.1    8e-04   
ref|WP_014421132.1|  septum formation protein Maf                     50.1    9e-04   
ref|WP_017067204.1|  septum formation inhibitor Maf                   50.1    9e-04   
ref|WP_017062154.1|  MULTISPECIES: septum formation inhibitor Maf     50.1    9e-04   
ref|WP_007194828.1|  septum formation protein Maf                     50.1    9e-04   
ref|WP_004733995.1|  septum formation inhibitor Maf                   50.1    9e-04   
ref|WP_017091549.1|  septum formation inhibitor Maf                   50.1    9e-04   
ref|WP_034331683.1|  septum formation inhibitor Maf                   50.4    0.001   
gb|KHF24619.1|  MAF protein                                           50.1    0.001   
ref|WP_021813365.1|  Septum formation protein Maf                     50.4    0.001   



>ref|XP_006341947.1| PREDICTED: maf-like protein DDB_G0281937-like isoform X3 [Solanum 
tuberosum]
Length=203

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYEG++REKP ++ EAR+F+KDY+NG AAT+SSVLVTNL TG +RGE DKVEIYFH+
Sbjct  85    QVVVYEGVVREKPSSEAEARQFMKDYANGHAATVSSVLVTNLATGSRRGEWDKVEIYFHD  144

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP++VIDKLIEEGTVLY AGGL+IEHPL+ PYIK V G+TDSVMGLPKALT++LI EVL
Sbjct  145   IPDEVIDKLIEEGTVLYAAGGLIIEHPLVLPYIKEVVGSTDSVMGLPKALTERLIKEVL  203


 Score =   134 bits (336),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            ME N   FKLILGS+S  R+++L +MGYEF TMSADIDEKAIRKEKPEDLVMALAEAKAE
Sbjct  1    MEANAPQFKLILGSSSTARKKILGDMGYEFTTMSADIDEKAIRKEKPEDLVMALAEAKAE  60

Query  237  AIIPRLNIDESMEDAEPMLLITCDQV  314
            AIIPR++I ES  DA P LLITCDQV
Sbjct  61   AIIPRVSIGESEGDAGPTLLITCDQV  86



>ref|XP_006341946.1| PREDICTED: maf-like protein DDB_G0281937-like isoform X2 [Solanum 
tuberosum]
Length=204

 Score =   194 bits (493),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVVYEG++REKP ++ EAR+F+KDY+NG AAT+SSVLVTNL TG +RGE DKVEIYFH+I
Sbjct  87    VVVYEGVVREKPSSEAEARQFMKDYANGHAATVSSVLVTNLATGSRRGEWDKVEIYFHDI  146

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             P++VIDKLIEEGTVLY AGGL+IEHPL+ PYIK V G+TDSVMGLPKALT++LI EVL
Sbjct  147   PDEVIDKLIEEGTVLYAAGGLIIEHPLVLPYIKEVVGSTDSVMGLPKALTERLIKEVL  204


 Score =   111 bits (277),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            ME N   FKLILGS+S  R+++L +MGYEF TMSADIDEKAIRKEKPEDLVMALAEAKA+
Sbjct  1    MEANAPQFKLILGSSSTARKKILGDMGYEFTTMSADIDEKAIRKEKPEDLVMALAEAKAD  60

Query  237  AIIPRLNIDESME-DAEPMLLITCDQV  314
            AII +    E++E D  P +L+  D V
Sbjct  61   AIISKFRKIENLEKDVNPTILVAADTV  87



>ref|XP_006341945.1| PREDICTED: maf-like protein DDB_G0281937-like isoform X1 [Solanum 
tuberosum]
Length=231

 Score =   194 bits (494),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYEG++REKP ++ EAR+F+KDY+NG AAT+SSVLVTNL TG +RGE DKVEIYFH+
Sbjct  113   QVVVYEGVVREKPSSEAEARQFMKDYANGHAATVSSVLVTNLATGSRRGEWDKVEIYFHD  172

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP++VIDKLIEEGTVLY AGGL+IEHPL+ PYIK V G+TDSVMGLPKALT++LI EVL
Sbjct  173   IPDEVIDKLIEEGTVLYAAGGLIIEHPLVLPYIKEVVGSTDSVMGLPKALTERLIKEVL  231


 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 73/114 (64%), Gaps = 28/114 (25%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAK--  230
            ME N   FKLILGS+S  R+++L +MGYEF TMSADIDEKAIRKEKPEDLVMALAEAK  
Sbjct  1    MEANAPQFKLILGSSSTARKKILGDMGYEFTTMSADIDEKAIRKEKPEDLVMALAEAKAD  60

Query  231  --------------------------AEAIIPRLNIDESMEDAEPMLLITCDQV  314
                                      AEAIIPR++I ES  DA P LLITCDQV
Sbjct  61   AIISKFRKIENLEKDVNPTILVAADTAEAIIPRVSIGESEGDAGPTLLITCDQV  114



>ref|XP_004238281.1| PREDICTED: maf-like protein DDB_G0281937 isoform X3 [Solanum 
lycopersicum]
Length=203

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYEG+IREKP ++ EAR+F+KDY+NG AAT+SSVLVTNL TG +RGE DKVEIYFH+
Sbjct  85    QVVVYEGVIREKPSSEAEARQFMKDYANGHAATVSSVLVTNLTTGSRRGEWDKVEIYFHD  144

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP+ VIDKLIEEG VLY AGGL+IEHPL+ PYIK V G+TDSVMGLPKALT++LI EVL
Sbjct  145   IPDQVIDKLIEEGIVLYAAGGLIIEHPLVLPYIKEVVGSTDSVMGLPKALTERLIKEVL  203


 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            ME N   FKLILGS+S  R+++L +MGYEF TMSADIDEKAIRKEKPEDLVMALAEAKAE
Sbjct  1    MEANAPQFKLILGSSSTARKKILGDMGYEFTTMSADIDEKAIRKEKPEDLVMALAEAKAE  60

Query  237  AIIPRLNIDESMEDAEPMLLITCDQV  314
            AIIPR++I ES  DAEP LLITCDQV
Sbjct  61   AIIPRVSIGESEGDAEPTLLITCDQV  86



>ref|XP_009588767.1| PREDICTED: maf-like protein DDB_G0281937 isoform X4 [Nicotiana 
tomentosiformis]
Length=203

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYEGM+REKP ++ EAR+F+KDY+NG AAT+SSVLVTNL TG +RGE DKVEIYFH+
Sbjct  85    QVVVYEGMVREKPSSEAEARQFMKDYANGHAATVSSVLVTNLVTGCRRGEWDKVEIYFHD  144

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP+ VIDKLIEEG VLY AGGL+IEHPL+ PYIK V G+TDSVMGLPKALT++LI EVL
Sbjct  145   IPDQVIDKLIEEGIVLYAAGGLIIEHPLVLPYIKEVVGSTDSVMGLPKALTERLIKEVL  203


 Score =   136 bits (343),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            ME N   FKLILGS+S  RR++LA+MGY+F TMSADIDEKAIRKEKPEDLVMALAEAKAE
Sbjct  1    MEPNAPQFKLILGSSSTARRKILADMGYQFTTMSADIDEKAIRKEKPEDLVMALAEAKAE  60

Query  237  AIIPRLNIDESMEDAEPMLLITCDQV  314
            AIIPR++I ES  DAEP LLITCDQV
Sbjct  61   AIIPRVSIGESEGDAEPTLLITCDQV  86



>ref|XP_009588765.1| PREDICTED: maf-like protein DDB_G0281937 isoform X2 [Nicotiana 
tomentosiformis]
Length=204

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVVYEGM+REKP ++ EAR+F+KDY+NG AAT+SSVLVTNL TG +RGE DKVEIYFH+I
Sbjct  87    VVVYEGMVREKPSSEAEARQFMKDYANGHAATVSSVLVTNLVTGCRRGEWDKVEIYFHDI  146

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             P+ VIDKLIEEG VLY AGGL+IEHPL+ PYIK V G+TDSVMGLPKALT++LI EVL
Sbjct  147   PDQVIDKLIEEGIVLYAAGGLIIEHPLVLPYIKEVVGSTDSVMGLPKALTERLIKEVL  204


 Score =   114 bits (286),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 69/87 (79%), Gaps = 1/87 (1%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            ME N   FKLILGS+S  RR++LA+MGY+F TMSADIDEKAIRKEKPEDLVMALAEAKA+
Sbjct  1    MEPNAPQFKLILGSSSTARRKILADMGYQFTTMSADIDEKAIRKEKPEDLVMALAEAKAD  60

Query  237  AIIPRLNIDESME-DAEPMLLITCDQV  314
            AII +    E++E D+ P LL+  D V
Sbjct  61   AIISKFRNTENLEKDSNPTLLVAADTV  87



>ref|XP_004238280.1| PREDICTED: maf-like protein DDB_G0281937 isoform X2 [Solanum 
lycopersicum]
Length=204

 Score =   192 bits (487),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVVYEG+IREKP ++ EAR+F+KDY+NG AAT+SSVLVTNL TG +RGE DKVEIYFH+I
Sbjct  87    VVVYEGVIREKPSSEAEARQFMKDYANGHAATVSSVLVTNLTTGSRRGEWDKVEIYFHDI  146

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             P+ VIDKLIEEG VLY AGGL+IEHPL+ PYIK V G+TDSVMGLPKALT++LI EVL
Sbjct  147   PDQVIDKLIEEGIVLYAAGGLIIEHPLVLPYIKEVVGSTDSVMGLPKALTERLIKEVL  204


 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 65/87 (75%), Gaps = 1/87 (1%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            ME N   FKLILGS+S  R+++L +MGYEF TMSADIDEKAIRKEKPEDLVMALAEAKA+
Sbjct  1    MEANAPQFKLILGSSSTARKKILGDMGYEFTTMSADIDEKAIRKEKPEDLVMALAEAKAD  60

Query  237  AIIPRLNIDESMEDA-EPMLLITCDQV  314
            AII +    E+ E    P +L+  D V
Sbjct  61   AIISKFRKTENPEKVLNPTILVAADTV  87



>ref|XP_009588764.1| PREDICTED: maf-like protein DDB_G0281937 isoform X1 [Nicotiana 
tomentosiformis]
Length=231

 Score =   192 bits (489),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYEGM+REKP ++ EAR+F+KDY+NG AAT+SSVLVTNL TG +RGE DKVEIYFH+
Sbjct  113   QVVVYEGMVREKPSSEAEARQFMKDYANGHAATVSSVLVTNLVTGCRRGEWDKVEIYFHD  172

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP+ VIDKLIEEG VLY AGGL+IEHPL+ PYIK V G+TDSVMGLPKALT++LI EVL
Sbjct  173   IPDQVIDKLIEEGIVLYAAGGLIIEHPLVLPYIKEVVGSTDSVMGLPKALTERLIKEVL  231


 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 75/114 (66%), Gaps = 28/114 (25%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAK--  230
            ME N   FKLILGS+S  RR++LA+MGY+F TMSADIDEKAIRKEKPEDLVMALAEAK  
Sbjct  1    MEPNAPQFKLILGSSSTARRKILADMGYQFTTMSADIDEKAIRKEKPEDLVMALAEAKAD  60

Query  231  --------------------------AEAIIPRLNIDESMEDAEPMLLITCDQV  314
                                      AEAIIPR++I ES  DAEP LLITCDQV
Sbjct  61   AIISKFRNTENLEKDSNPTLLVAADTAEAIIPRVSIGESEGDAEPTLLITCDQV  114



>ref|XP_004238279.1| PREDICTED: maf-like protein DDB_G0281937 isoform X1 [Solanum 
lycopersicum]
Length=231

 Score =   192 bits (488),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYEG+IREKP ++ EAR+F+KDY+NG AAT+SSVLVTNL TG +RGE DKVEIYFH+
Sbjct  113   QVVVYEGVIREKPSSEAEARQFMKDYANGHAATVSSVLVTNLTTGSRRGEWDKVEIYFHD  172

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP+ VIDKLIEEG VLY AGGL+IEHPL+ PYIK V G+TDSVMGLPKALT++LI EVL
Sbjct  173   IPDQVIDKLIEEGIVLYAAGGLIIEHPLVLPYIKEVVGSTDSVMGLPKALTERLIKEVL  231


 Score =   121 bits (303),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 74/114 (65%), Gaps = 28/114 (25%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAK--  230
            ME N   FKLILGS+S  R+++L +MGYEF TMSADIDEKAIRKEKPEDLVMALAEAK  
Sbjct  1    MEANAPQFKLILGSSSTARKKILGDMGYEFTTMSADIDEKAIRKEKPEDLVMALAEAKAD  60

Query  231  --------------------------AEAIIPRLNIDESMEDAEPMLLITCDQV  314
                                      AEAIIPR++I ES  DAEP LLITCDQV
Sbjct  61   AIISKFRKTENPEKVLNPTILVAADTAEAIIPRVSIGESEGDAEPTLLITCDQV  114



>ref|XP_010664699.1| PREDICTED: maf-like protein DDB_G0281937 isoform X4 [Vitis vinifera]
Length=203

 Score =   190 bits (483),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 114/141 (81%), Gaps = 4/141 (3%)
 Frame = +3

Query  699   PPSQFR*DLSVLMFLTAKLKLLEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVL  878
             P   ++ D    + +T+     +VVVYEGM+REKP +KEEAR+FIKDYS G AAT+ SV+
Sbjct  67    PVGHYKMDAEPTLLITSD----QVVVYEGMVREKPSSKEEARQFIKDYSGGHAATVGSVI  122

Query  879   VTNLKTGKKRGELDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAG  1058
             +TNLKTG ++G  DKVEIYFHEIP+++I+KLIEEGTVLYVAGGL+IEHPLI P+IK V G
Sbjct  123   ITNLKTGFRKGGWDKVEIYFHEIPDEMINKLIEEGTVLYVAGGLIIEHPLILPFIKEVVG  182

Query  1059  ATDSVMGLPKALTQKLITEVL  1121
              TDSVMGLPKALT++LI E L
Sbjct  183   TTDSVMGLPKALTERLIKEAL  203


 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            M+ N   FK+ILGSAS  RR++LAEMGYEF  M+ADIDEK IRKEKPE+LVMA+AEAKAE
Sbjct  1    MDANASSFKIILGSASVARRKILAEMGYEFTVMTADIDEKGIRKEKPEELVMAIAEAKAE  60

Query  237  AIIPRLNIDESMEDAEPMLLITCDQV  314
            AI+P+L +     DAEP LLIT DQV
Sbjct  61   AILPKLPVGHYKMDAEPTLLITSDQV  86



>ref|XP_010664695.1| PREDICTED: maf-like protein DDB_G0281937 isoform X1 [Vitis vinifera]
Length=238

 Score =   191 bits (485),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 114/141 (81%), Gaps = 4/141 (3%)
 Frame = +3

Query  699   PPSQFR*DLSVLMFLTAKLKLLEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVL  878
             P   ++ D    + +T+     +VVVYEGM+REKP +KEEAR+FIKDYS G AAT+ SV+
Sbjct  102   PVGHYKMDAEPTLLITSD----QVVVYEGMVREKPSSKEEARQFIKDYSGGHAATVGSVI  157

Query  879   VTNLKTGKKRGELDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAG  1058
             +TNLKTG ++G  DKVEIYFHEIP+++I+KLIEEGTVLYVAGGL+IEHPLI P+IK V G
Sbjct  158   ITNLKTGFRKGGWDKVEIYFHEIPDEMINKLIEEGTVLYVAGGLIIEHPLILPFIKEVVG  217

Query  1059  ATDSVMGLPKALTQKLITEVL  1121
              TDSVMGLPKALT++LI E L
Sbjct  218   TTDSVMGLPKALTERLIKEAL  238


 Score =   110 bits (274),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 68/91 (75%), Gaps = 1/91 (1%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            M+ N   FK+ILGSAS  RR++LAEMGYEF  M+ADIDEK IRKEKPE+LVMA+AEAKA+
Sbjct  1    MDANASSFKIILGSASVARRKILAEMGYEFTVMTADIDEKGIRKEKPEELVMAIAEAKAD  60

Query  237  AIIPRLN-IDESMEDAEPMLLITCDQVHNIS  326
            AII +L  ID   +D +P +L+  D +   S
Sbjct  61   AIISKLQTIDNREKDTKPTILVAADTLMETS  91



>ref|XP_010664696.1| PREDICTED: maf-like protein DDB_G0281937 isoform X2 [Vitis vinifera]
 emb|CBI19702.3| unnamed protein product [Vitis vinifera]
Length=231

 Score =   191 bits (485),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 114/141 (81%), Gaps = 4/141 (3%)
 Frame = +3

Query  699   PPSQFR*DLSVLMFLTAKLKLLEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVL  878
             P   ++ D    + +T+     +VVVYEGM+REKP +KEEAR+FIKDYS G AAT+ SV+
Sbjct  95    PVGHYKMDAEPTLLITSD----QVVVYEGMVREKPSSKEEARQFIKDYSGGHAATVGSVI  150

Query  879   VTNLKTGKKRGELDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAG  1058
             +TNLKTG ++G  DKVEIYFHEIP+++I+KLIEEGTVLYVAGGL+IEHPLI P+IK V G
Sbjct  151   ITNLKTGFRKGGWDKVEIYFHEIPDEMINKLIEEGTVLYVAGGLIIEHPLILPFIKEVVG  210

Query  1059  ATDSVMGLPKALTQKLITEVL  1121
              TDSVMGLPKALT++LI E L
Sbjct  211   TTDSVMGLPKALTERLIKEAL  231


 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            M+ N   FK+ILGSAS  RR++LAEMGYEF  M+ADIDEK IRKEKPE+LVMA+AEAKA+
Sbjct  1    MDANASSFKIILGSASVARRKILAEMGYEFTVMTADIDEKGIRKEKPEELVMAIAEAKAD  60

Query  237  AIIPRLN-IDESMEDAEPMLLITCDQVHNI  323
            AII +L  ID   +D +P +L+  D    I
Sbjct  61   AIISKLQTIDNREKDTKPTILVAADTAEAI  90



>ref|XP_009760259.1| PREDICTED: maf-like protein DDB_G0281937 isoform X5 [Nicotiana 
sylvestris]
Length=204

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVVYEGM+REKP  + EAR+F+KDY+NG AAT+SSVLVTNL TG +RGE DKVEIYFH+I
Sbjct  87    VVVYEGMVREKPSTEAEARQFMKDYANGHAATVSSVLVTNLVTGCRRGEWDKVEIYFHDI  146

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             P+ VIDKLIEEG VLY AGGL+IEHPLI P IK V G+TDSVMGLPKALT++LI EVL
Sbjct  147   PDQVIDKLIEEGIVLYAAGGLIIEHPLILPCIKEVVGSTDSVMGLPKALTERLIKEVL  204


 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 69/87 (79%), Gaps = 1/87 (1%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            ME N   FKLILGS+S  RR++LA+MGY+F TMSADIDEKAIRKEKPEDLVMALAEAKA+
Sbjct  1    MEANVPQFKLILGSSSTARRKILADMGYQFTTMSADIDEKAIRKEKPEDLVMALAEAKAD  60

Query  237  AIIPRLNIDESME-DAEPMLLITCDQV  314
            AII +    E++E D+ P LL+  D V
Sbjct  61   AIISKFRNTENLEKDSNPTLLVAADTV  87



>ref|XP_009760257.1| PREDICTED: maf-like protein DDB_G0281937 isoform X3 [Nicotiana 
sylvestris]
Length=205

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVVYEGM+REKP  + EAR+F+KDY+NG AAT+SSVLVTNL TG +RGE DKVEIYFH+I
Sbjct  88    VVVYEGMVREKPSTEAEARQFMKDYANGHAATVSSVLVTNLVTGCRRGEWDKVEIYFHDI  147

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             P+ VIDKLIEEG VLY AGGL+IEHPLI P IK V G+TDSVMGLPKALT++LI EVL
Sbjct  148   PDQVIDKLIEEGIVLYAAGGLIIEHPLILPCIKEVVGSTDSVMGLPKALTERLIKEVL  205


 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 69/87 (79%), Gaps = 1/87 (1%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            ME N   FKLILGS+S  RR++LA+MGY+F TMSADIDEKAIRKEKPEDLVMALAEAKA+
Sbjct  1    MEANVPQFKLILGSSSTARRKILADMGYQFTTMSADIDEKAIRKEKPEDLVMALAEAKAD  60

Query  237  AIIPRLNIDESME-DAEPMLLITCDQV  314
            AII +    E++E D+ P LL+  D V
Sbjct  61   AIISKFRNTENLEKDSNPTLLVAADTV  87



>ref|XP_010664698.1| PREDICTED: maf-like protein DDB_G0281937 isoform X3 [Vitis vinifera]
Length=204

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVVYEGM+REKP +KEEAR+FIKDYS G AAT+ SV++TNLKTG ++G  DKVEIYFHEI
Sbjct  87    VVVYEGMVREKPSSKEEARQFIKDYSGGHAATVGSVIITNLKTGFRKGGWDKVEIYFHEI  146

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             P+++I+KLIEEGTVLYVAGGL+IEHPLI P+IK V G TDSVMGLPKALT++LI E L
Sbjct  147   PDEMINKLIEEGTVLYVAGGLIIEHPLILPFIKEVVGTTDSVMGLPKALTERLIKEAL  204


 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            M+ N   FK+ILGSAS  RR++LAEMGYEF  M+ADIDEK IRKEKPE+LVMA+AEAKA+
Sbjct  1    MDANASSFKIILGSASVARRKILAEMGYEFTVMTADIDEKGIRKEKPEELVMAIAEAKAD  60

Query  237  AIIPRL-NIDESMEDAEPMLLITCDQV  314
            AII +L  ID   +D +P +L+  D V
Sbjct  61   AIISKLQTIDNREKDTKPTILVAADTV  87



>ref|XP_009760260.1| PREDICTED: maf-like protein DDB_G0281937 isoform X6 [Nicotiana 
sylvestris]
Length=204

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVVYEGM+REKP  + EAR+F+KDY+NG AAT+SSVLVTNL TG +RGE DKVEIYFH+I
Sbjct  87    VVVYEGMVREKPSTEAEARQFMKDYANGHAATVSSVLVTNLVTGCRRGEWDKVEIYFHDI  146

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             P+ VIDKLIEEG VLY AGGL+IEHPLI P IK V G+TDSVMGLPKALT++LI EVL
Sbjct  147   PDQVIDKLIEEGIVLYAAGGLIIEHPLILPCIKEVVGSTDSVMGLPKALTERLIKEVL  204


 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            ME N   FKLILGS+S  RR++LA+MGY+F TMSADIDEKAIRKEKPEDLVMALAEAKAE
Sbjct  1    MEANVPQFKLILGSSSTARRKILADMGYQFTTMSADIDEKAIRKEKPEDLVMALAEAKAE  60

Query  237  AIIPRLNIDESMEDAEPMLLITCDQV  314
            AIIPR++I ES  DAEP LLITCDQV
Sbjct  61   AIIPRVSIGESEGDAEPTLLITCDQV  86



>ref|XP_009760256.1| PREDICTED: maf-like protein DDB_G0281937 isoform X2 [Nicotiana 
sylvestris]
Length=231

 Score =   190 bits (483),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYEGM+REKP  + EAR+F+KDY+NG AAT+SSVLVTNL TG +RGE DKVEIYFH+
Sbjct  113   QVVVYEGMVREKPSTEAEARQFMKDYANGHAATVSSVLVTNLVTGCRRGEWDKVEIYFHD  172

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP+ VIDKLIEEG VLY AGGL+IEHPLI P IK V G+TDSVMGLPKALT++LI EVL
Sbjct  173   IPDQVIDKLIEEGIVLYAAGGLIIEHPLILPCIKEVVGSTDSVMGLPKALTERLIKEVL  231


 Score =   123 bits (308),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 75/114 (66%), Gaps = 28/114 (25%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAK--  230
            ME N   FKLILGS+S  RR++LA+MGY+F TMSADIDEKAIRKEKPEDLVMALAEAK  
Sbjct  1    MEANVPQFKLILGSSSTARRKILADMGYQFTTMSADIDEKAIRKEKPEDLVMALAEAKAD  60

Query  231  --------------------------AEAIIPRLNIDESMEDAEPMLLITCDQV  314
                                      AEAIIPR++I ES  DAEP LLITCDQV
Sbjct  61   AIISKFRNTENLEKDSNPTLLVAADTAEAIIPRVSIGESEGDAEPTLLITCDQV  114



>ref|XP_009760254.1| PREDICTED: maf-like protein DDB_G0281937 isoform X1 [Nicotiana 
sylvestris]
Length=232

 Score =   189 bits (481),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVVYEGM+REKP  + EAR+F+KDY+NG AAT+SSVLVTNL TG +RGE DKVEIYFH+I
Sbjct  115   VVVYEGMVREKPSTEAEARQFMKDYANGHAATVSSVLVTNLVTGCRRGEWDKVEIYFHDI  174

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             P+ VIDKLIEEG VLY AGGL+IEHPLI P IK V G+TDSVMGLPKALT++LI EVL
Sbjct  175   PDQVIDKLIEEGIVLYAAGGLIIEHPLILPCIKEVVGSTDSVMGLPKALTERLIKEVL  232


 Score =   123 bits (308),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 75/114 (66%), Gaps = 28/114 (25%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAK--  230
            ME N   FKLILGS+S  RR++LA+MGY+F TMSADIDEKAIRKEKPEDLVMALAEAK  
Sbjct  1    MEANVPQFKLILGSSSTARRKILADMGYQFTTMSADIDEKAIRKEKPEDLVMALAEAKAD  60

Query  231  --------------------------AEAIIPRLNIDESMEDAEPMLLITCDQV  314
                                      AEAIIPR++I ES  DAEP LLITCDQV
Sbjct  61   AIISKFRNTENLEKDSNPTLLVAADTAEAIIPRVSIGESEGDAEPTLLITCDQV  114



>ref|XP_008466562.1| PREDICTED: maf-like protein DDB_G0281937 isoform X3 [Cucumis 
melo]
Length=203

 Score =   188 bits (477),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VV+YEG+IREKP +KEEAR+F+KDYS G AAT+ SVLVTNLKTG ++GE D+VEI+F+E
Sbjct  85    QVVIYEGVIREKPASKEEARQFLKDYSGGHAATLGSVLVTNLKTGFRKGEWDRVEIFFNE  144

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP++VIDKL+EEGTVLYVAGGL+IEHPLI PY+K V G TDSVMGLPKALT+KL+ E +
Sbjct  145   IPDEVIDKLVEEGTVLYVAGGLIIEHPLILPYVKEVVGTTDSVMGLPKALTEKLLKEAM  203


 Score =   123 bits (308),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            M+  +  FK+ILGS+S  RR++L+EMGYEF  MSADIDEKAIRKEKPE+LV+ALAEAKA+
Sbjct  1    MDATSSSFKIILGSSSVARRKILSEMGYEFTIMSADIDEKAIRKEKPEELVVALAEAKAD  60

Query  237  AIIPRLNIDESMEDAEPMLLITCDQV  314
            AI+ RL+ D+ M+DAEP LLIT DQV
Sbjct  61   AILGRLSTDDFMKDAEPTLLITSDQV  86



>ref|XP_008466560.1| PREDICTED: maf-like protein DDB_G0281937 isoform X1 [Cucumis 
melo]
Length=231

 Score =   189 bits (479),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VV+YEG+IREKP +KEEAR+F+KDYS G AAT+ SVLVTNLKTG ++GE D+VEI+F+E
Sbjct  113   QVVIYEGVIREKPASKEEARQFLKDYSGGHAATLGSVLVTNLKTGFRKGEWDRVEIFFNE  172

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP++VIDKL+EEGTVLYVAGGL+IEHPLI PY+K V G TDSVMGLPKALT+KL+ E +
Sbjct  173   IPDEVIDKLVEEGTVLYVAGGLIIEHPLILPYVKEVVGTTDSVMGLPKALTEKLLKEAM  231


 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 73/114 (64%), Gaps = 28/114 (25%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            M+  +  FK+ILGS+S  RR++L+EMGYEF  MSADIDEKAIRKEKPE+LV+ALAEAKA+
Sbjct  1    MDATSSSFKIILGSSSVARRKILSEMGYEFTIMSADIDEKAIRKEKPEELVVALAEAKAD  60

Query  237  AIIP----------------------------RLNIDESMEDAEPMLLITCDQV  314
            AII                             RL+ D+ M+DAEP LLIT DQV
Sbjct  61   AIISNLQNIDTHEKEAEQTVLIAADTADAILGRLSTDDFMKDAEPTLLITSDQV  114



>ref|XP_008466561.1| PREDICTED: maf-like protein DDB_G0281937 isoform X2 [Cucumis 
melo]
Length=204

 Score =   187 bits (476),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VV+YEG+IREKP +KEEAR+F+KDYS G AAT+ SVLVTNLKTG ++GE D+VEI+F+EI
Sbjct  87    VVIYEGVIREKPASKEEARQFLKDYSGGHAATLGSVLVTNLKTGFRKGEWDRVEIFFNEI  146

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             P++VIDKL+EEGTVLYVAGGL+IEHPLI PY+K V G TDSVMGLPKALT+KL+ E +
Sbjct  147   PDEVIDKLVEEGTVLYVAGGLIIEHPLILPYVKEVVGTTDSVMGLPKALTEKLLKEAM  204


 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 68/87 (78%), Gaps = 1/87 (1%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            M+  +  FK+ILGS+S  RR++L+EMGYEF  MSADIDEKAIRKEKPE+LV+ALAEAKA+
Sbjct  1    MDATSSSFKIILGSSSVARRKILSEMGYEFTIMSADIDEKAIRKEKPEELVVALAEAKAD  60

Query  237  AIIPRL-NIDESMEDAEPMLLITCDQV  314
            AII  L NID   ++AE  +LI  D V
Sbjct  61   AIISNLQNIDTHEKEAEQTVLIAADTV  87



>gb|AEV89967.1| Maf-like protein [Humulus lupulus]
Length=203

 Score =   187 bits (476),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYEG+IREKP +KEEAR+F+KDYS GQAAT+SSV V+NLKTG ++G+ D+VEI+FHE
Sbjct  85    QVVVYEGVIREKPSSKEEARKFMKDYSGGQAATVSSVFVSNLKTGFRKGDWDRVEIHFHE  144

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP+DVI+KLI+EGTVLYVAGGL+IEHPLI P +K+V G TDSVMGLPKALT++L+ E L
Sbjct  145   IPDDVIEKLIDEGTVLYVAGGLIIEHPLILPLVKKVVGTTDSVMGLPKALTERLLKEAL  203


 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            M  N+ PFK+ILGS+S  RR++LAEMGY+F  M+ADIDEK+IRKE PE+LV+ALAEAKA 
Sbjct  1    MAANSSPFKIILGSSSVARRKILAEMGYDFAIMTADIDEKSIRKEIPEELVVALAEAKAA  60

Query  237  AIIPRLNIDESMEDAEPMLLITCDQV  314
            AI+PR+   + +   EP LLIT DQV
Sbjct  61   AILPRIPTGDYINAVEPTLLITADQV  86



>ref|XP_007017548.1| Maf-like protein isoform 2 [Theobroma cacao]
 gb|EOY14773.1| Maf-like protein isoform 2 [Theobroma cacao]
Length=203

 Score =   187 bits (475),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYEG +REKP N++EARE+IK YS G AAT+ SVLVTNLKTG ++GE D+VEIYFHE
Sbjct  85    QVVVYEGAVREKPANEKEAREYIKGYSGGHAATVGSVLVTNLKTGFRKGEWDRVEIYFHE  144

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP++VI+KLIEEGTVL+VAGGL+IEHPLI+PY+K+V G TDSVMGLPKALT+KLI E L
Sbjct  145   IPDEVIEKLIEEGTVLHVAGGLIIEHPLIKPYVKQVVGTTDSVMGLPKALTEKLIKEAL  203


 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            M+  T PFK+ILGS+S  RR++LAEMGYEF  MSADIDEK IRKE PE+LV+ALAEAKAE
Sbjct  1    MQDKTSPFKVILGSSSIARRKILAEMGYEFTLMSADIDEKGIRKETPEELVIALAEAKAE  60

Query  237  AIIPRLNIDESMEDAEPMLLITCDQV  314
            AI+ RL + + +++AEP LLIT DQV
Sbjct  61   AILHRLPVGDYIKEAEPTLLITSDQV  86



>ref|XP_007017549.1| Maf-like protein isoform 3 [Theobroma cacao]
 gb|EOY14774.1| Maf-like protein isoform 3 [Theobroma cacao]
Length=204

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVVYEG +REKP N++EARE+IK YS G AAT+ SVLVTNLKTG ++GE D+VEIYFHEI
Sbjct  87    VVVYEGAVREKPANEKEAREYIKGYSGGHAATVGSVLVTNLKTGFRKGEWDRVEIYFHEI  146

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             P++VI+KLIEEGTVL+VAGGL+IEHPLI+PY+K+V G TDSVMGLPKALT+KLI E L
Sbjct  147   PDEVIEKLIEEGTVLHVAGGLIIEHPLIKPYVKQVVGTTDSVMGLPKALTEKLIKEAL  204


 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            M+  T PFK+ILGS+S  RR++LAEMGYEF  MSADIDEK IRKE PE+LV+ALAEAKA+
Sbjct  1    MQDKTSPFKVILGSSSIARRKILAEMGYEFTLMSADIDEKGIRKETPEELVIALAEAKAD  60

Query  237  AIIPRLN-IDESMEDAEPMLLITCDQV  314
            +I+ +L  I+   +D  P++LI  D V
Sbjct  61   SILSKLQTINNQEKDERPIILIAADTV  87



>ref|XP_007017547.1| Maf-like protein isoform 1 [Theobroma cacao]
 gb|EOY14772.1| Maf-like protein isoform 1 [Theobroma cacao]
Length=231

 Score =   187 bits (476),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYEG +REKP N++EARE+IK YS G AAT+ SVLVTNLKTG ++GE D+VEIYFHE
Sbjct  113   QVVVYEGAVREKPANEKEAREYIKGYSGGHAATVGSVLVTNLKTGFRKGEWDRVEIYFHE  172

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP++VI+KLIEEGTVL+VAGGL+IEHPLI+PY+K+V G TDSVMGLPKALT+KLI E L
Sbjct  173   IPDEVIEKLIEEGTVLHVAGGLIIEHPLIKPYVKQVVGTTDSVMGLPKALTEKLIKEAL  231


 Score =   103 bits (258),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            M+  T PFK+ILGS+S  RR++LAEMGYEF  MSADIDEK IRKE PE+LV+ALAEAKA+
Sbjct  1    MQDKTSPFKVILGSSSIARRKILAEMGYEFTLMSADIDEKGIRKETPEELVIALAEAKAD  60

Query  237  AIIPRLN-IDESMEDAEPMLLITCDQVHNI  323
            +I+ +L  I+   +D  P++LI  D    I
Sbjct  61   SILSKLQTINNQEKDERPIILIAADTAEAI  90



>gb|KGN59963.1| hypothetical protein Csa_3G857040 [Cucumis sativus]
Length=203

 Score =   186 bits (473),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/119 (72%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VV+YEG+IREKP +KEEAR+F+KDYS G AAT+ SVLVTNLKTG ++GE D+VEI+F+E
Sbjct  85    QVVIYEGVIREKPASKEEARQFLKDYSGGHAATLGSVLVTNLKTGFRKGEWDRVEIFFNE  144

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP++VI+KL+EEGTVLYVAGGL+IEHPLI PY+K V G TDSVMGLPKALT+KL+ E +
Sbjct  145   IPDEVINKLVEEGTVLYVAGGLIIEHPLILPYVKEVVGTTDSVMGLPKALTEKLLKEAM  203


 Score =   123 bits (308),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            M+  +  FK+ILGS+S  RR++L+EMGYEF  MSADIDEKAIRKEKPE+LV+ALAEAKA+
Sbjct  1    MDATSSSFKIILGSSSVARRKILSEMGYEFTIMSADIDEKAIRKEKPEELVVALAEAKAD  60

Query  237  AIIPRLNIDESMEDAEPMLLITCDQV  314
            AI+ RL+ D+ M+DAEP LLIT DQV
Sbjct  61   AILGRLSTDDFMKDAEPTLLITSDQV  86



>ref|XP_002321311.1| hypothetical protein POPTR_0014s18360g [Populus trichocarpa]
 gb|EEE99626.1| hypothetical protein POPTR_0014s18360g [Populus trichocarpa]
Length=233

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 110/141 (78%), Gaps = 4/141 (3%)
 Frame = +3

Query  699   PPSQFR*DLSVLMFLTAKLKLLEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVL  878
             P S +  D    + +TA     +VVVYEG IREKP +KEEA EFIK YS G AAT+ SVL
Sbjct  97    PISDYTKDAEPTLLITAD----QVVVYEGAIREKPASKEEAWEFIKGYSGGHAATVGSVL  152

Query  879   VTNLKTGKKRGELDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAG  1058
             VTNLKTG ++GE D+VEIYFHEIP++VI+KLIEEG VL VAGGL+IEHPL+ PYIK V G
Sbjct  153   VTNLKTGFRKGEWDRVEIYFHEIPDEVIEKLIEEGIVLRVAGGLIIEHPLLLPYIKEVVG  212

Query  1059  ATDSVMGLPKALTQKLITEVL  1121
              TDSVMGLPKALT+KLI E L
Sbjct  213   TTDSVMGLPKALTKKLIEEAL  233


 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 61/86 (71%), Gaps = 4/86 (5%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLN  257
            FKLILGSAS  RR++L EMGYEF   +ADIDEK+IR+EKPEDLVM LAEAKA+AII  L 
Sbjct  7    FKLILGSASFSRRKILEEMGYEFTISTADIDEKSIREEKPEDLVMTLAEAKADAIIANLR  66

Query  258  I----DESMEDAEPMLLITCDQVHNI  323
                 ++  +D EP +L+  D    I
Sbjct  67   TTTMNNQQDKDEEPTILVAADTADTI  92



>ref|XP_011012328.1| PREDICTED: maf-like protein DDB_G0281937 isoform X4 [Populus 
euphratica]
Length=202

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 111/141 (79%), Gaps = 4/141 (3%)
 Frame = +3

Query  699   PPSQFR*DLSVLMFLTAKLKLLEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVL  878
             P S +  D    + +TA     +VVVYEG+IREKP +KEEA EFIK YS G AAT+ SVL
Sbjct  66    PISDYTKDAEPTLLITAD----QVVVYEGVIREKPASKEEAWEFIKGYSGGHAATVGSVL  121

Query  879   VTNLKTGKKRGELDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAG  1058
             VTNLKTG ++GE D+VEIYFHEIP++VI+KLI+EG VL VAGGL+IEHPL+ PYIK V G
Sbjct  122   VTNLKTGFRKGEWDRVEIYFHEIPDEVIEKLIDEGIVLRVAGGLIIEHPLLLPYIKEVVG  181

Query  1059  ATDSVMGLPKALTQKLITEVL  1121
              TDSVMGLPKALT+KLI E L
Sbjct  182   TTDSVMGLPKALTKKLIEEAL  202


 Score =   108 bits (271),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLN  257
            FKLILGSAS  RR++L EMGYEF   +ADIDEK+IR+EKPEDLVM LAEAKA+ I+ +L 
Sbjct  7    FKLILGSASFSRRKILEEMGYEFTISTADIDEKSIREEKPEDLVMTLAEAKADTILQKLP  66

Query  258  IDESMEDAEPMLLITCDQV  314
            I +  +DAEP LLIT DQV
Sbjct  67   ISDYTKDAEPTLLITADQV  85



>ref|XP_011012325.1| PREDICTED: maf-like protein DDB_G0281937 isoform X1 [Populus 
euphratica]
Length=233

 Score =   184 bits (468),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 111/141 (79%), Gaps = 4/141 (3%)
 Frame = +3

Query  699   PPSQFR*DLSVLMFLTAKLKLLEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVL  878
             P S +  D    + +TA     +VVVYEG+IREKP +KEEA EFIK YS G AAT+ SVL
Sbjct  97    PISDYTKDAEPTLLITAD----QVVVYEGVIREKPASKEEAWEFIKGYSGGHAATVGSVL  152

Query  879   VTNLKTGKKRGELDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAG  1058
             VTNLKTG ++GE D+VEIYFHEIP++VI+KLI+EG VL VAGGL+IEHPL+ PYIK V G
Sbjct  153   VTNLKTGFRKGEWDRVEIYFHEIPDEVIEKLIDEGIVLRVAGGLIIEHPLLLPYIKEVVG  212

Query  1059  ATDSVMGLPKALTQKLITEVL  1121
              TDSVMGLPKALT+KLI E L
Sbjct  213   TTDSVMGLPKALTKKLIEEAL  233


 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 60/86 (70%), Gaps = 4/86 (5%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLN  257
            FKLILGSAS  RR++L EMGYEF   +ADIDEK+IR+EKPEDLVM LAEAKA+AII  L 
Sbjct  7    FKLILGSASFSRRKILEEMGYEFTISTADIDEKSIREEKPEDLVMTLAEAKADAIIANLR  66

Query  258  I----DESMEDAEPMLLITCDQVHNI  323
                 +   +D EP +L+  D    I
Sbjct  67   TTTMNNHQDKDEEPTILVAADTADTI  92



>gb|KHG17862.1| Maf-like protein [Gossypium arboreum]
Length=229

 Score =   183 bits (465),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVVYEG++REKP N++EAREFIK YS G AAT+ SV+VTNLKTG ++GE D+VEIYFHEI
Sbjct  112   VVVYEGVVREKPANEKEAREFIKGYSGGHAATVGSVIVTNLKTGFRKGEWDRVEIYFHEI  171

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             P+++I KLIEEG VL+VAGGL+IEHPLI PY+K V G TDSVMGLPKALT+KLI E L
Sbjct  172   PDEIIKKLIEEGAVLHVAGGLIIEHPLIMPYVKEVVGTTDSVMGLPKALTEKLIKEAL  229


 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 71/96 (74%), Gaps = 1/96 (1%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            ME  T PFK+ILGS+S  RR +LAEMGYEF  MSADIDEK IRKEKPE+LVMALAEAKA+
Sbjct  1    MEDKTCPFKIILGSSSIARRNILAEMGYEFSLMSADIDEKGIRKEKPEELVMALAEAKAD  60

Query  237  AIIPRL-NIDESMEDAEPMLLITCDQVHNISVAVIF  341
            +I+ +L  ++   +D +P +LI  D +  +S   I+
Sbjct  61   SIVSKLQTMNNQDKDEKPTILIAADTLPIVSPIAIY  96



>gb|KHG01838.1| Maf-like protein [Gossypium arboreum]
Length=203

 Score =   182 bits (462),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYEG+IREKP N+EEA +FIK YS G AAT+ SVLVTNLKTG ++GE D+VEI+FHE
Sbjct  85    QVVVYEGVIREKPANEEEAHQFIKGYSGGHAATVGSVLVTNLKTGFRKGEWDRVEIHFHE  144

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP++VI+KLIEEG VL+VAGGLLIEHPLI+PYIK+V G  DSVMGLPKALT+KLI E +
Sbjct  145   IPDEVIEKLIEEGNVLHVAGGLLIEHPLIKPYIKQVVGTIDSVMGLPKALTEKLIREAV  203


 Score =   120 bits (301),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            ME  T  FK+ILGS+S PRR++LAEMGYEF  MSADIDEK IRKEKPE+LVMALAEAKA+
Sbjct  1    MEDKTSQFKIILGSSSLPRRKILAEMGYEFTLMSADIDEKGIRKEKPEELVMALAEAKAD  60

Query  237  AIIPRLNIDESMEDAEPMLLITCDQV  314
            AI+ RL + + +++AEP LLI+ DQV
Sbjct  61   AILHRLPVGDYVKEAEPTLLISSDQV  86



>ref|XP_006473506.1| PREDICTED: maf-like protein DDB_G0281937-like isoform X2 [Citrus 
sinensis]
 gb|KDO84577.1| hypothetical protein CISIN_1g025297mg [Citrus sinensis]
Length=228

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVVYEG+IREKP ++EEAR FIKDYS GQ AT+SSVLVTNLKTG ++GE D+VEI FHEI
Sbjct  111   VVVYEGVIREKPSSREEARRFIKDYSGGQCATVSSVLVTNLKTGFRKGEWDRVEIQFHEI  170

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             P++VI+KLIEEG VL VAGGL+IEH LI PY+K+V GA DSVMGLPKA+T+KLI E L
Sbjct  171   PDEVIEKLIEEGIVLNVAGGLIIEHSLILPYVKQVVGAMDSVMGLPKAVTEKLIKEAL  228


 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            ME +  P K+ILGS+S PRR++LAEMGYEF  M+ADIDEK+IRKEKPEDLVMA+AEAKA 
Sbjct  25   MEASATPVKIILGSSSMPRRKILAEMGYEFSVMAADIDEKSIRKEKPEDLVMAIAEAKAA  84

Query  237  AIIPRLNI-DESMEDAEPMLLITCDQV  314
            AII +L I D  + + +  +LI  D V
Sbjct  85   AIISKLQITDSQLGNVKQTILIVADTV  111



>ref|XP_006473507.1| PREDICTED: maf-like protein DDB_G0281937-like isoform X3 [Citrus 
sinensis]
 gb|KDO84578.1| hypothetical protein CISIN_1g025297mg [Citrus sinensis]
Length=227

 Score =   181 bits (460),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYEG+IREKP ++EEAR FIKDYS GQ AT+SSVLVTNLKTG ++GE D+VEI FHE
Sbjct  109   QVVVYEGVIREKPSSREEARRFIKDYSGGQCATVSSVLVTNLKTGFRKGEWDRVEIQFHE  168

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP++VI+KLIEEG VL VAGGL+IEH LI PY+K+V GA DSVMGLPKA+T+KLI E L
Sbjct  169   IPDEVIEKLIEEGIVLNVAGGLIIEHSLILPYVKQVVGAMDSVMGLPKAVTEKLIKEAL  227


 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            ME +  P K+ILGS+S PRR++LAEMGYEF  M+ADIDEK+IRKEKPEDLVMA+AEAKAE
Sbjct  25   MEASATPVKIILGSSSMPRRKILAEMGYEFSVMAADIDEKSIRKEKPEDLVMAIAEAKAE  84

Query  237  AIIPRLNIDESMEDAEPMLLITCDQV  314
            AI+ RL I + +++AEP +LIT DQV
Sbjct  85   AILNRLPIGDYIKEAEPTILITGDQV  110



>ref|XP_011012327.1| PREDICTED: maf-like protein DDB_G0281937 isoform X3 [Populus 
euphratica]
Length=206

 Score =   180 bits (457),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVVYEG+IREKP +KEEA EFIK YS G AAT+ SVLVTNLKTG ++GE D+VEIYFHEI
Sbjct  89    VVVYEGVIREKPASKEEAWEFIKGYSGGHAATVGSVLVTNLKTGFRKGEWDRVEIYFHEI  148

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             P++VI+KLI+EG VL VAGGL+IEHPL+ PYIK V G TDSVMGLPKALT+KLI E L
Sbjct  149   PDEVIEKLIDEGIVLRVAGGLIIEHPLLLPYIKEVVGTTDSVMGLPKALTKKLIEEAL  206


 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 60/83 (72%), Gaps = 4/83 (5%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLN  257
            FKLILGSAS  RR++L EMGYEF   +ADIDEK+IR+EKPEDLVM LAEAKA+AII  L 
Sbjct  7    FKLILGSASFSRRKILEEMGYEFTISTADIDEKSIREEKPEDLVMTLAEAKADAIIANLR  66

Query  258  I----DESMEDAEPMLLITCDQV  314
                 +   +D EP +L+  D V
Sbjct  67   TTTMNNHQDKDEEPTILVAADTV  89



>ref|XP_006473505.1| PREDICTED: maf-like protein DDB_G0281937-like isoform X1 [Citrus 
sinensis]
 gb|KDO84576.1| hypothetical protein CISIN_1g025297mg [Citrus sinensis]
Length=255

 Score =   182 bits (461),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYEG+IREKP ++EEAR FIKDYS GQ AT+SSVLVTNLKTG ++GE D+VEI FHE
Sbjct  137   QVVVYEGVIREKPSSREEARRFIKDYSGGQCATVSSVLVTNLKTGFRKGEWDRVEIQFHE  196

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP++VI+KLIEEG VL VAGGL+IEH LI PY+K+V GA DSVMGLPKA+T+KLI E L
Sbjct  197   IPDEVIEKLIEEGIVLNVAGGLIIEHSLILPYVKQVVGAMDSVMGLPKAVTEKLIKEAL  255


 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 69/114 (61%), Gaps = 28/114 (25%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMA-------  215
            ME +  P K+ILGS+S PRR++LAEMGYEF  M+ADIDEK+IRKEKPEDLVMA       
Sbjct  25   MEASATPVKIILGSSSMPRRKILAEMGYEFSVMAADIDEKSIRKEKPEDLVMAIAEAKAA  84

Query  216  ---------------------LAEAKAEAIIPRLNIDESMEDAEPMLLITCDQV  314
                                 +    AEAI+ RL I + +++AEP +LIT DQV
Sbjct  85   AIISKLQITDSQLGNVKQTILIVADTAEAILNRLPIGDYIKEAEPTILITGDQV  138



>gb|KEH40147.1| Maf DDB-G0281937-like protein [Medicago truncatula]
Length=152

 Score =   178 bits (451),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = +3

Query  762   LEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFH  941
              EVVVYEG+IREKP +K+EAR+F+KDYS  QAAT+ SVLVTNLKTG ++G+ D+VEI+F+
Sbjct  33    FEVVVYEGVIREKPSSKQEARQFLKDYSGKQAATVGSVLVTNLKTGLRKGDSDRVEIHFN  92

Query  942   EIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             EIP++VI+KL++EGT LYVAGGL+IEHPLI PY+K V G TDSVMGLPK LT+KL+  VL
Sbjct  93    EIPDEVIEKLVDEGTTLYVAGGLIIEHPLIFPYVKEVVGTTDSVMGLPKDLTEKLLKAVL  152



>ref|XP_004291875.1| PREDICTED: maf-like protein DDB_G0281937-like isoform 2 [Fragaria 
vesca subsp. vesca]
Length=204

 Score =   179 bits (455),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYEG++REKP +KEEAR+F+KDYS G AAT+ SVLVTNLKTG  +GE D+VEIYFHE
Sbjct  86    QVVVYEGVVREKPSSKEEARQFLKDYSGGHAATVGSVLVTNLKTGFSKGEWDRVEIYFHE  145

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP++ I+KLIEEGTVL VAGGL+IEHPLI P++K V G TDSVMGLPK +T++L+ E L
Sbjct  146   IPDEAIEKLIEEGTVLKVAGGLIIEHPLILPFVKEVVGTTDSVMGLPKDITERLLKEAL  204


 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 73/87 (84%), Gaps = 1/87 (1%)
 Frame = +3

Query  57   MEGNTWP-FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKA  233
            ME N+ P FKLILGS+S  RR++L++MGYEF  M+ADIDEK+IRK+KPE+LVM LA+AKA
Sbjct  1    METNSSPPFKLILGSSSIARRKILSDMGYEFTLMTADIDEKSIRKDKPEELVMVLAQAKA  60

Query  234  EAIIPRLNIDESMEDAEPMLLITCDQV  314
            EAI P+L + + ++DAEP LLIT DQV
Sbjct  61   EAIRPKLPVGDYVKDAEPTLLITSDQV  87



>ref|XP_006435001.1| hypothetical protein CICLE_v10002369mg [Citrus clementina]
 gb|ESR48241.1| hypothetical protein CICLE_v10002369mg [Citrus clementina]
Length=228

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVVYEG+IREKP ++EEAR FIKDYS GQ AT+ SVLVTNLKTG ++GE D+VEI FHEI
Sbjct  111   VVVYEGVIREKPSSREEARRFIKDYSGGQCATVGSVLVTNLKTGFRKGEWDRVEIQFHEI  170

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             P++VI+KLIEEG VL VAGGL+IEH LI PY+K+V GA DSVMGLPKA+T+KLI E L
Sbjct  171   PDEVIEKLIEEGIVLNVAGGLIIEHSLILPYVKQVVGAMDSVMGLPKAVTEKLIKEAL  228


 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 68/87 (78%), Gaps = 1/87 (1%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            ME +  P K+ILGS+S PRR++LAEMGYEF  M+ADIDEK+IRKEKPEDLVMA+AEAKA+
Sbjct  25   MEASATPVKIILGSSSMPRRKILAEMGYEFSVMAADIDEKSIRKEKPEDLVMAIAEAKAD  84

Query  237  AIIPRLNI-DESMEDAEPMLLITCDQV  314
            AII +L I D  + + E  +LI  D V
Sbjct  85   AIISKLQITDSQLGNVEQTILIVADTV  111



>ref|XP_004291874.1| PREDICTED: maf-like protein DDB_G0281937-like isoform 1 [Fragaria 
vesca subsp. vesca]
Length=232

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYEG++REKP +KEEAR+F+KDYS G AAT+ SVLVTNLKTG  +GE D+VEIYFHE
Sbjct  114   QVVVYEGVVREKPSSKEEARQFLKDYSGGHAATVGSVLVTNLKTGFSKGEWDRVEIYFHE  173

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP++ I+KLIEEGTVL VAGGL+IEHPLI P++K V G TDSVMGLPK +T++L+ E L
Sbjct  174   IPDEAIEKLIEEGTVLKVAGGLIIEHPLILPFVKEVVGTTDSVMGLPKDITERLLKEAL  232


 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 74/115 (64%), Gaps = 29/115 (25%)
 Frame = +3

Query  57   MEGNTWP-FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKA  233
            ME N+ P FKLILGS+S  RR++L++MGYEF  M+ADIDEK+IRK+KPE+LVM LA+AKA
Sbjct  1    METNSSPPFKLILGSSSIARRKILSDMGYEFTLMTADIDEKSIRKDKPEELVMVLAQAKA  60

Query  234  EAII----------------------------PRLNIDESMEDAEPMLLITCDQV  314
            +AII                            P+L + + ++DAEP LLIT DQV
Sbjct  61   DAIISKIQSIHSKEKDAEPTIVIAADTAEAIRPKLPVGDYVKDAEPTLLITSDQV  115



>gb|KDP38509.1| hypothetical protein JCGZ_04434 [Jatropha curcas]
Length=233

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYEG IREKP ++EEAR+F+K YS G AAT+SSVLVTNLKTG ++ E D+VEIYFHE
Sbjct  115   QVVVYEGSIREKPSSEEEARQFLKGYSGGHAATVSSVLVTNLKTGFRKVEWDRVEIYFHE  174

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP++VI+KLIEEG VL VAGGL+IEHPLI PY+K V G TDSVMGLPKALT+KL+ E L
Sbjct  175   IPDEVIEKLIEEGLVLRVAGGLIIEHPLILPYVKEVVGTTDSVMGLPKALTEKLMKEAL  233


 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 69/108 (64%), Gaps = 28/108 (26%)
 Frame = +3

Query  75   PFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAK--------  230
            PFK+ILGS+S  RR++LAEMGYEF   +ADIDEK IRKEKPE+LVMALAEAK        
Sbjct  9    PFKIILGSSSIARRKILAEMGYEFTVTTADIDEKCIRKEKPEELVMALAEAKADAILSKL  68

Query  231  --------------------AEAIIPRLNIDESMEDAEPMLLITCDQV  314
                                AEAI+ RL++ + ++DA P LLITCDQV
Sbjct  69   RADNNQENDGELSILIAADTAEAILQRLSVHDYIKDAVPALLITCDQV  116



>ref|XP_006435000.1| hypothetical protein CICLE_v10002369mg [Citrus clementina]
 gb|ESR48240.1| hypothetical protein CICLE_v10002369mg [Citrus clementina]
Length=227

 Score =   179 bits (454),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYEG+IREKP ++EEAR FIKDYS GQ AT+ SVLVTNLKTG ++GE D+VEI FHE
Sbjct  109   QVVVYEGVIREKPSSREEARRFIKDYSGGQCATVGSVLVTNLKTGFRKGEWDRVEIQFHE  168

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP++VI+KLIEEG VL VAGGL+IEH LI PY+K+V GA DSVMGLPKA+T+KLI E L
Sbjct  169   IPDEVIEKLIEEGIVLNVAGGLIIEHSLILPYVKQVVGAMDSVMGLPKAVTEKLIKEAL  227


 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            ME +  P K+ILGS+S PRR++LAEMGYEF  M+ADIDEK+IRKEKPEDLVMA+AEAKAE
Sbjct  25   MEASATPVKIILGSSSMPRRKILAEMGYEFSVMAADIDEKSIRKEKPEDLVMAIAEAKAE  84

Query  237  AIIPRLNIDESMEDAEPMLLITCDQV  314
            AI+ RL I + +++AEP +LIT DQV
Sbjct  85   AILNRLPIGDYIKEAEPTILITGDQV  110



>ref|XP_007223816.1| hypothetical protein PRUPE_ppa010722mg [Prunus persica]
 gb|EMJ25015.1| hypothetical protein PRUPE_ppa010722mg [Prunus persica]
Length=238

 Score =   179 bits (454),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYEG+IREKP +KEEAR+F+KDYS G AAT+ SV VTNLKTG  +GE D+VEIYFHE
Sbjct  120   QVVVYEGVIREKPSSKEEARQFLKDYSGGHAATVGSVHVTNLKTGFSKGEWDRVEIYFHE  179

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP+++I+KLIEEGTVL VAGGL+IEHPLI P++K V G TDSVMGLPK LT++L+ E +
Sbjct  180   IPDEIIEKLIEEGTVLKVAGGLIIEHPLILPFVKEVVGTTDSVMGLPKDLTRRLLKEAI  238


 Score =   107 bits (267),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 71/94 (76%), Gaps = 2/94 (2%)
 Frame = +3

Query  57   MEGNTWP-FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKA  233
            ME N+   FK+ILGSAS  RR++LAEMGYEFI M+ADIDEK IRKEKPE+LV+ LA+AKA
Sbjct  1    MEANSSSSFKIILGSASVARRKILAEMGYEFIVMTADIDEKCIRKEKPEELVLVLAQAKA  60

Query  234  EAIIPRLN-IDESMEDAEPMLLITCDQVHNISVA  332
            +AII +L  I+   +DAEP ++I  D +   S A
Sbjct  61   DAIISKLQTINNQEKDAEPTIVIAADTLMETSQA  94



>ref|XP_007223815.1| hypothetical protein PRUPE_ppa010722mg [Prunus persica]
 gb|EMJ25014.1| hypothetical protein PRUPE_ppa010722mg [Prunus persica]
Length=232

 Score =   179 bits (453),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYEG+IREKP +KEEAR+F+KDYS G AAT+ SV VTNLKTG  +GE D+VEIYFHE
Sbjct  114   QVVVYEGVIREKPSSKEEARQFLKDYSGGHAATVGSVHVTNLKTGFSKGEWDRVEIYFHE  173

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP+++I+KLIEEGTVL VAGGL+IEHPLI P++K V G TDSVMGLPK LT++L+ E +
Sbjct  174   IPDEIIEKLIEEGTVLKVAGGLIIEHPLILPFVKEVVGTTDSVMGLPKDLTRRLLKEAI  232


 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 68/86 (79%), Gaps = 2/86 (2%)
 Frame = +3

Query  57   MEGNTWP-FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKA  233
            ME N+   FK+ILGSAS  RR++LAEMGYEFI M+ADIDEK IRKEKPE+LV+ LA+AKA
Sbjct  1    MEANSSSSFKIILGSASVARRKILAEMGYEFIVMTADIDEKCIRKEKPEELVLVLAQAKA  60

Query  234  EAIIPRLN-IDESMEDAEPMLLITCD  308
            +AII +L  I+   +DAEP ++I  D
Sbjct  61   DAIISKLQTINNQEKDAEPTIVIAAD  86



>ref|XP_004147866.1| PREDICTED: maf-like protein DDB_G0281937-like [Cucumis sativus]
 ref|XP_004154841.1| PREDICTED: maf-like protein DDB_G0281937-like [Cucumis sativus]
Length=241

 Score =   178 bits (452),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 107/129 (83%), Gaps = 10/129 (8%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VV+YEG+IREKP +KEEAR+F+KDYS G AAT+ SVLVTNLKTG ++GE D+VEI+F+E
Sbjct  113   QVVIYEGVIREKPASKEEARQFLKDYSGGHAATLGSVLVTNLKTGFRKGEWDRVEIFFNE  172

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRV----------AGATDSVMGLPKAL  1094
             IP++VI+KL+EEGTVLYVAGGL+IEHPLI PY+K V           G TDSVMGLPKAL
Sbjct  173   IPDEVINKLVEEGTVLYVAGGLIIEHPLILPYVKEVVSNPNFGSLQVGTTDSVMGLPKAL  232

Query  1095  TQKLITEVL  1121
             T+KL+ E +
Sbjct  233   TEKLLKEAM  241


 Score =   110 bits (274),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 73/114 (64%), Gaps = 28/114 (25%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            M+  +  FK+ILGS+S  RR++L+EMGYEF  MSADIDEKAIRKEKPE+LV+ALAEAKA+
Sbjct  1    MDATSSSFKIILGSSSVARRKILSEMGYEFTIMSADIDEKAIRKEKPEELVVALAEAKAD  60

Query  237  AIIP----------------------------RLNIDESMEDAEPMLLITCDQV  314
            AII                             RL+ D+ M+DAEP LLIT DQV
Sbjct  61   AIISNLQNIHTHEKEAEPTVLIAADTADAILGRLSTDDFMKDAEPTLLITSDQV  114



>ref|XP_010677775.1| PREDICTED: maf-like protein DDB_G0281937 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=231

 Score =   178 bits (451),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 111/155 (72%), Gaps = 4/155 (3%)
 Frame = +3

Query  657   FISSSLCPQQTHTPPPSQFR*DLSVLMFLTAKLKLLEVVVYEGMIREKPENKEEAREFIK  836
              IS+         PP    R D    + +T      +VVVYEGM+REKP +KEEAR ++K
Sbjct  81    LISADTAEATLPKPPNGDLRTDAGPTILITGD----QVVVYEGMVREKPSSKEEARRYMK  136

Query  837   DYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLI  1016
             DYS  +A+T+SSVLVTNL+TG ++GE DKVEI F EIP++ IDKLIEEG VL VAGGL+I
Sbjct  137   DYSGSKASTVSSVLVTNLQTGFRKGEWDKVEILFDEIPDETIDKLIEEGAVLGVAGGLII  196

Query  1017  EHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             EHPLI P +K V G TDSVMGLPKA+ ++LI+E L
Sbjct  197   EHPLILPLVKEVVGTTDSVMGLPKAVAERLISESL  231


 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 67/85 (79%), Gaps = 1/85 (1%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            M    +PFK+ILGS S  RR++L +MGYEF  M+ADIDEKAIRKEKPEDLVMALAEAKA+
Sbjct  1    MASTAYPFKIILGSKSKARREILEQMGYEFTIMTADIDEKAIRKEKPEDLVMALAEAKAD  60

Query  237  AIIPRLNI-DESMEDAEPMLLITCD  308
            AII +L I D  + D+EP LLI+ D
Sbjct  61   AIISKLQIADIQVNDSEPTLLISAD  85



>gb|KEH40148.1| Maf DDB-G0281937-like protein [Medicago truncatula]
Length=203

 Score =   177 bits (449),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYEG+IREKP +K+EAR+F+KDYS  QAAT+ SVLVTNLKTG ++G+ D+VEI+F+E
Sbjct  85    QVVVYEGVIREKPSSKQEARQFLKDYSGKQAATVGSVLVTNLKTGLRKGDSDRVEIHFNE  144

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP++VI+KL++EGT LYVAGGL+IEHPLI PY+K V G TDSVMGLPK LT+KL+  VL
Sbjct  145   IPDEVIEKLVDEGTTLYVAGGLIIEHPLIFPYVKEVVGTTDSVMGLPKDLTEKLLKAVL  203


 Score =   116 bits (291),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            ME  T  +++ILGS+S  RR++L++MGY+F  M+ADIDEK+IRK+ PE+LVMALAEAKAE
Sbjct  1    MEPATSSYRIILGSSSVARRKILSQMGYQFTLMTADIDEKSIRKDTPEELVMALAEAKAE  60

Query  237  AIIPRLNIDESMEDAEPMLLITCDQV  314
            AI+ RL +D+ ++DAEP LLIT DQV
Sbjct  61   AILQRLPVDDYLKDAEPTLLITSDQV  86



>ref|XP_011074546.1| PREDICTED: maf-like protein DDB_G0281937 isoform X3 [Sesamum 
indicum]
Length=206

 Score =   177 bits (448),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVVYEGMIREKP ++EEAREFIK YS   AAT+SSVLVTNL TG ++G+ DKVEI+FH+I
Sbjct  89    VVVYEGMIREKPSSEEEAREFIKGYSGSHAATLSSVLVTNLSTGLRKGDWDKVEIHFHDI  148

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             PE +ID LI+EG VL VAGGL+IEHPL+ PY+K V G TDSVMGLPK LT++L+ EVL
Sbjct  149   PEQIIDNLIKEGNVLNVAGGLIIEHPLVLPYVKEVVGGTDSVMGLPKELTRRLMKEVL  206


 Score =   102 bits (255),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 65/80 (81%), Gaps = 1/80 (1%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRL-  254
             ++ILGS+S  R+++LA+MG+EF TMSADIDEKAIRKEKPEDLV ALAEAKA AI+ +L 
Sbjct  10   LQIILGSSSVARKKILADMGFEFTTMSADIDEKAIRKEKPEDLVTALAEAKANAIVGKLK  69

Query  255  NIDESMEDAEPMLLITCDQV  314
            N++   +DA+P L+I  D V
Sbjct  70   NVENQEKDAKPTLVIAADTV  89



>ref|XP_008220807.1| PREDICTED: maf-like protein DDB_G0281937 [Prunus mume]
Length=204

 Score =   177 bits (448),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYEG+IREKP +KEEA++F+KDYS G AAT+ SV VTNLKTG  +GE D+VEIYFHE
Sbjct  86    QVVVYEGVIREKPSSKEEAQQFLKDYSGGHAATVGSVHVTNLKTGFSKGEWDRVEIYFHE  145

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP+++I+KLIEEGTVL VAGGL+IEHPLI P++K V G TDSVMGLPK LT++L+ E +
Sbjct  146   IPDEIIEKLIEEGTVLKVAGGLIIEHPLILPFVKEVVGTTDSVMGLPKDLTRRLLKEAI  204


 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 68/87 (78%), Gaps = 1/87 (1%)
 Frame = +3

Query  57   MEGNTWP-FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKA  233
            ME N+   FK+ILGSAS  RR++LAEMGYEF  M+ADIDEK IRKEKPE+LV+ LA+AKA
Sbjct  1    MEANSSSSFKIILGSASVARRKILAEMGYEFTVMTADIDEKCIRKEKPEELVLVLAQAKA  60

Query  234  EAIIPRLNIDESMEDAEPMLLITCDQV  314
            EA   RL + + ++D EP LLIT DQV
Sbjct  61   EANSQRLPVGDYIKDDEPTLLITSDQV  87



>gb|KCW68240.1| hypothetical protein EUGRSUZ_F01889 [Eucalyptus grandis]
Length=179

 Score =   176 bits (445),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVVY   +REKP +KEEAREF+K YS G AAT+ SVLV NLKTG ++GE D+VEI+FHEI
Sbjct  62    VVVYGDAVREKPSSKEEAREFLKGYSGGHAATVGSVLVLNLKTGSRKGEWDRVEIFFHEI  121

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             P+++I+K++EEG VL VAGGL+IEHPLI PY+K+V G TDSVMGLPKALT+KLI EVL
Sbjct  122   PDEIIEKMVEEGIVLNVAGGLIIEHPLILPYVKQVVGTTDSVMGLPKALTEKLIKEVL  179


 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 49/62 (79%), Gaps = 1/62 (2%)
 Frame = +3

Query  132  MGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLN-IDESMEDAEPMLLITCD  308
            MGYEF  M+ADIDEK+IRK+KPE+LVMALAEAKA AI  ++  I+   +D+EP++LI  D
Sbjct  1    MGYEFTIMTADIDEKSIRKDKPEELVMALAEAKANAITSKVQRINSQEKDSEPIILIAAD  60

Query  309  QV  314
             V
Sbjct  61   TV  62



>gb|AFY26891.1| maf-like protein [Morella rubra]
Length=234

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = +3

Query  744   TAKLKLLEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDK  923
             T  L   +VVVYEG +REKP +KEEAR+F+KDYS G AAT+ SVLVTNLKTG ++GE D+
Sbjct  106   TLLLTCDQVVVYEGSVREKPSSKEEARQFLKDYSGGHAATVGSVLVTNLKTGFRKGEWDR  165

Query  924   VEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQK  1103
             VEIYF EIP+++I+K++EEG VL VAGGL+IEHPLI P++K+V G TDSVMGLPKALT+K
Sbjct  166   VEIYFQEIPDEIIEKVVEEGIVLNVAGGLIIEHPLILPFVKQVVGTTDSVMGLPKALTEK  225

Query  1104  LITE  1115
             L+ E
Sbjct  226   LMRE  229


 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 72/114 (63%), Gaps = 28/114 (25%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAK--  230
            ME NT PFK+ILGS+S  RR +LAEMGYE   ++ADIDEK IRKEKPEDLVMALAEAK  
Sbjct  1    MEPNTSPFKIILGSSSKSRRTILAEMGYELTILTADIDEKGIRKEKPEDLVMALAEAKAD  60

Query  231  --------------------------AEAIIPRLNIDESMEDAEPMLLITCDQV  314
                                      AEAI+ RL I + ++DAEP LL+TCDQV
Sbjct  61   AVISKLHTVNNQVSGDEQTILISADTAEAILQRLPIGDYVKDAEPTLLLTCDQV  114



>ref|XP_011074545.1| PREDICTED: maf-like protein DDB_G0281937 isoform X2 [Sesamum 
indicum]
Length=229

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYEGMIREKP ++EEAREFIK YS   AAT+SSVLVTNL TG ++G+ DKVEI+FH+
Sbjct  111   QVVVYEGMIREKPSSEEEAREFIKGYSGSHAATLSSVLVTNLSTGLRKGDWDKVEIHFHD  170

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IPE +ID LI+EG VL VAGGL+IEHPL+ PY+K V G TDSVMGLPK LT++L+ EVL
Sbjct  171   IPEQIIDNLIKEGNVLNVAGGLIIEHPLVLPYVKEVVGGTDSVMGLPKELTRRLMKEVL  229


 Score =   109 bits (272),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 68/83 (82%), Gaps = 1/83 (1%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRL-  254
            FK+ILGS+S  R+++LA+MG+EF TMSADIDEKAIRKEKPEDLV ALAEAKA AI+ +L 
Sbjct  9    FKIILGSSSVARKKILADMGFEFTTMSADIDEKAIRKEKPEDLVTALAEAKANAIVGKLK  68

Query  255  NIDESMEDAEPMLLITCDQVHNI  323
            N++   +DA+P L+I  D V N+
Sbjct  69   NVENQEKDAKPTLVIAADTVENV  91



>ref|XP_011074542.1| PREDICTED: maf-like protein DDB_G0281937 isoform X1 [Sesamum 
indicum]
 ref|XP_011074543.1| PREDICTED: maf-like protein DDB_G0281937 isoform X1 [Sesamum 
indicum]
 ref|XP_011074544.1| PREDICTED: maf-like protein DDB_G0281937 isoform X1 [Sesamum 
indicum]
Length=230

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYEGMIREKP ++EEAREFIK YS   AAT+SSVLVTNL TG ++G+ DKVEI+FH+
Sbjct  112   QVVVYEGMIREKPSSEEEAREFIKGYSGSHAATLSSVLVTNLSTGLRKGDWDKVEIHFHD  171

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IPE +ID LI+EG VL VAGGL+IEHPL+ PY+K V G TDSVMGLPK LT++L+ EVL
Sbjct  172   IPEQIIDNLIKEGNVLNVAGGLIIEHPLVLPYVKEVVGGTDSVMGLPKELTRRLMKEVL  230


 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 67/83 (81%), Gaps = 1/83 (1%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRL-  254
             ++ILGS+S  R+++LA+MG+EF TMSADIDEKAIRKEKPEDLV ALAEAKA AI+ +L 
Sbjct  10   LQIILGSSSVARKKILADMGFEFTTMSADIDEKAIRKEKPEDLVTALAEAKANAIVGKLK  69

Query  255  NIDESMEDAEPMLLITCDQVHNI  323
            N++   +DA+P L+I  D V N+
Sbjct  70   NVENQEKDAKPTLVIAADTVENV  92



>ref|XP_010061308.1| PREDICTED: maf-like protein DDB_G0281937 isoform X2 [Eucalyptus 
grandis]
Length=204

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVVY   +REKP +KEEAREF+K YS G AAT+ SVLV NLKTG ++GE D+VEI+FHEI
Sbjct  87    VVVYGDAVREKPSSKEEAREFLKGYSGGHAATVGSVLVLNLKTGSRKGEWDRVEIFFHEI  146

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             P+++I+K++EEG VL VAGGL+IEHPLI PY+K+V G TDSVMGLPKALT+KLI EVL
Sbjct  147   PDEIIEKMVEEGIVLNVAGGLIIEHPLILPYVKQVVGTTDSVMGLPKALTEKLIKEVL  204


 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 68/87 (78%), Gaps = 1/87 (1%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            ME    PFK+ILGS+S  RR++LAEMGYEF  M+ADIDEK+IRK+KPE+LVMALAEAKA 
Sbjct  1    MEAACSPFKIILGSSSIARRKILAEMGYEFTIMTADIDEKSIRKDKPEELVMALAEAKAN  60

Query  237  AIIPRLN-IDESMEDAEPMLLITCDQV  314
            AI  ++  I+   +D+EP++LI  D V
Sbjct  61   AITSKVQRINSQEKDSEPIILIAADTV  87



>ref|XP_010061309.1| PREDICTED: maf-like protein DDB_G0281937 isoform X3 [Eucalyptus 
grandis]
Length=203

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVY   +REKP +KEEAREF+K YS G AAT+ SVLV NLKTG ++GE D+VEI+FHE
Sbjct  85    QVVVYGDAVREKPSSKEEAREFLKGYSGGHAATVGSVLVLNLKTGSRKGEWDRVEIFFHE  144

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP+++I+K++EEG VL VAGGL+IEHPLI PY+K+V G TDSVMGLPKALT+KLI EVL
Sbjct  145   IPDEIIEKMVEEGIVLNVAGGLIIEHPLILPYVKQVVGTTDSVMGLPKALTEKLIKEVL  203


 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            ME    PFK+ILGS+S  RR++LAEMGYEF  M+ADIDEK+IRK+KPE+LVMALAEAKAE
Sbjct  1    MEAACSPFKIILGSSSIARRKILAEMGYEFTIMTADIDEKSIRKDKPEELVMALAEAKAE  60

Query  237  AIIPRLNIDESMEDAEPMLLITCDQV  314
            AI  ++ + + ++DA+P LLIT DQV
Sbjct  61   AISQKIPLGDYIKDADPTLLITSDQV  86



>ref|XP_010061307.1| PREDICTED: maf-like protein DDB_G0281937 isoform X1 [Eucalyptus 
grandis]
 gb|KCW68239.1| hypothetical protein EUGRSUZ_F01889 [Eucalyptus grandis]
Length=231

 Score =   177 bits (448),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVY   +REKP +KEEAREF+K YS G AAT+ SVLV NLKTG ++GE D+VEI+FHE
Sbjct  113   QVVVYGDAVREKPSSKEEAREFLKGYSGGHAATVGSVLVLNLKTGSRKGEWDRVEIFFHE  172

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP+++I+K++EEG VL VAGGL+IEHPLI PY+K+V G TDSVMGLPKALT+KLI EVL
Sbjct  173   IPDEIIEKMVEEGIVLNVAGGLIIEHPLILPYVKQVVGTTDSVMGLPKALTEKLIKEVL  231


 Score =   108 bits (271),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 69/91 (76%), Gaps = 1/91 (1%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            ME    PFK+ILGS+S  RR++LAEMGYEF  M+ADIDEK+IRK+KPE+LVMALAEAKA 
Sbjct  1    MEAACSPFKIILGSSSIARRKILAEMGYEFTIMTADIDEKSIRKDKPEELVMALAEAKAN  60

Query  237  AIIPRLN-IDESMEDAEPMLLITCDQVHNIS  326
            AI  ++  I+   +D+EP++LI  D    IS
Sbjct  61   AITSKVQRINSQEKDSEPIILIAADTAEAIS  91



>ref|XP_010677774.1| PREDICTED: maf-like protein DDB_G0281937 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=239

 Score =   177 bits (448),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 116/166 (70%), Gaps = 8/166 (5%)
 Frame = +3

Query  624   FSCSGVFIIFHFISSSLCPQQTHTPPPSQFR*DLSVLMFLTAKLKLLEVVVYEGMIREKP  803
              S   V I F   + +  P+    PP    R D    + +T      +VVVYEGM+REKP
Sbjct  82    ISADTVCIPFFKPAEATLPK----PPNGDLRTDAGPTILITGD----QVVVYEGMVREKP  133

Query  804   ENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEIPEDVIDKLIEEG  983
              +KEEAR ++KDYS  +A+T+SSVLVTNL+TG ++GE DKVEI F EIP++ IDKLIEEG
Sbjct  134   SSKEEARRYMKDYSGSKASTVSSVLVTNLQTGFRKGEWDKVEILFDEIPDETIDKLIEEG  193

Query  984   TVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
              VL VAGGL+IEHPLI P +K V G TDSVMGLPKA+ ++LI+E L
Sbjct  194   AVLGVAGGLIIEHPLILPLVKEVVGTTDSVMGLPKAVAERLISESL  239


 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 68/87 (78%), Gaps = 1/87 (1%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            M    +PFK+ILGS S  RR++L +MGYEF  M+ADIDEKAIRKEKPEDLVMALAEAKA+
Sbjct  1    MASTAYPFKIILGSKSKARREILEQMGYEFTIMTADIDEKAIRKEKPEDLVMALAEAKAD  60

Query  237  AIIPRLNI-DESMEDAEPMLLITCDQV  314
            AII +L I D  + D+EP LLI+ D V
Sbjct  61   AIISKLQIADIQVNDSEPTLLISADTV  87



>gb|AFK47715.1| unknown [Lotus japonicus]
Length=202

 Score =   174 bits (441),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYEG++REKP +KEEAR+F+KDYS   AAT+ SVLVTNLKTG ++G+ D+VEIYF+E
Sbjct  84    QVVVYEGVVREKPSSKEEARQFLKDYSGRHAATVGSVLVTNLKTGLRKGDSDRVEIYFNE  143

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP+++ID+L++EG  L VAGGLLIEHPLI P++K V G TDSVMGLPK+LT+KL+ E L
Sbjct  144   IPDEIIDRLVDEGITLNVAGGLLIEHPLILPFVKEVVGTTDSVMGLPKSLTEKLLKEAL  202


 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLN  257
            +K+ILGS+S  RR++L+EMGY+F  M+ADIDEK+IRKE PE+LVMALAEAKAEAII RL 
Sbjct  7    YKIILGSSSVARRKILSEMGYQFTLMTADIDEKSIRKETPEELVMALAEAKAEAIIQRLP  66

Query  258  IDESMEDAEPMLLITCDQV  314
            +D+ ++DA+P LLIT DQV
Sbjct  67   VDDYLKDAQPTLLITSDQV  85



>ref|XP_009365558.1| PREDICTED: maf-like protein DDB_G0281937 isoform X4 [Pyrus x 
bretschneideri]
Length=204

 Score =   174 bits (441),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVVYEG+IREKP +KEEAR+F+KDYS G AAT+ SV VTNLKTG  +GE D+VEIYFH+I
Sbjct  87    VVVYEGVIREKPSSKEEARQFLKDYSGGHAATVGSVHVTNLKTGFSKGEWDRVEIYFHKI  146

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             P++VI+KLIEEG VL VAGGL+IEHPLI PY+K V G TDSVMGLP  LT++L+ E L
Sbjct  147   PDEVIEKLIEEGIVLKVAGGLIIEHPLILPYVKEVVGTTDSVMGLPIDLTRRLLKEAL  204


 Score =   102 bits (255),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 69/87 (79%), Gaps = 1/87 (1%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            ME ++  FK+ILGSAS  RR++LAEMGYEF  ++ADIDEK+IR EKPE+LV+ LA+AKA+
Sbjct  1    MEADSSSFKIILGSASIARRKILAEMGYEFTVVTADIDEKSIRTEKPEELVLVLAKAKAD  60

Query  237  AIIPRL-NIDESMEDAEPMLLITCDQV  314
            AII +L +I+   +DA+P ++I  D V
Sbjct  61   AIISKLQSINNQEKDADPTIVIAADTV  87



>ref|XP_009365557.1| PREDICTED: maf-like protein DDB_G0281937 isoform X3 [Pyrus x 
bretschneideri]
Length=206

 Score =   174 bits (441),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYEG+IREKP +KEEAR+F+KDYS G AAT+ SV VTNLKTG  +GE D+VEIYFH+
Sbjct  88    QVVVYEGVIREKPSSKEEARQFLKDYSGGHAATVGSVHVTNLKTGFSKGEWDRVEIYFHK  147

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP++VI+KLIEEG VL VAGGL+IEHPLI PY+K V G TDSVMGLP  LT++L+ E L
Sbjct  148   IPDEVIEKLIEEGIVLKVAGGLIIEHPLILPYVKEVVGTTDSVMGLPIDLTRRLLKEAL  206


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 50/66 (76%), Gaps = 1/66 (2%)
 Frame = +3

Query  132  MGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRL-NIDESMEDAEPMLLITCD  308
            MGYEF  ++ADIDEK+IR EKPE+LV+ LA+AKA+AII +L +I+   +DA+P ++I  D
Sbjct  1    MGYEFTVVTADIDEKSIRTEKPEELVLVLAKAKADAIISKLQSINNQEKDADPTIVIAAD  60

Query  309  QVHNIS  326
                IS
Sbjct  61   TAEAIS  66



>ref|XP_010552473.1| PREDICTED: maf-like protein DDB_G0281937 isoform X4 [Tarenaya 
hassleriana]
Length=206

 Score =   174 bits (441),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVVYE  +REKP + EEARE+I+ YS G AAT+SSVLVTNLKTG ++G++D+VEIYFHEI
Sbjct  86    VVVYEDAVREKPSHVEEAREYIRGYSKGHAATVSSVLVTNLKTGFRKGDVDRVEIYFHEI  145

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             PE+VI+KLIEEG VL VAG L+IEHPL+ PY+K V G TDSVMGLPK LT+KL+ E L
Sbjct  146   PEEVIEKLIEEGMVLKVAGALIIEHPLVLPYVKEVVGTTDSVMGLPKTLTEKLLKEAL  203


 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            ME N   FKLILGS+S  RR++LA+MGYEF  +SADIDEK+IRKEKPE+LVMALAEAKA+
Sbjct  1    MEANLGQFKLILGSSSIARRKILADMGYEFTLVSADIDEKSIRKEKPEELVMALAEAKAD  60

Query  237  AIIPRLNIDESMEDAEPMLLITCDQV  314
            AI+ +L I +  ++A+P +LI  D V
Sbjct  61   AIVSKLRITQVQQEAQPTVLIAADTV  86



>ref|XP_009365555.1| PREDICTED: maf-like protein DDB_G0281937 isoform X1 [Pyrus x 
bretschneideri]
Length=231

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYEG+IREKP +KEEAR+F+KDYS G AAT+ SV VTNLKTG  +GE D+VEIYFH+
Sbjct  113   QVVVYEGVIREKPSSKEEARQFLKDYSGGHAATVGSVHVTNLKTGFSKGEWDRVEIYFHK  172

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP++VI+KLIEEG VL VAGGL+IEHPLI PY+K V G TDSVMGLP  LT++L+ E L
Sbjct  173   IPDEVIEKLIEEGIVLKVAGGLIIEHPLILPYVKEVVGTTDSVMGLPIDLTRRLLKEAL  231


 Score =   103 bits (258),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 70/91 (77%), Gaps = 1/91 (1%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            ME ++  FK+ILGSAS  RR++LAEMGYEF  ++ADIDEK+IR EKPE+LV+ LA+AKA+
Sbjct  1    MEADSSSFKIILGSASIARRKILAEMGYEFTVVTADIDEKSIRTEKPEELVLVLAKAKAD  60

Query  237  AIIPRL-NIDESMEDAEPMLLITCDQVHNIS  326
            AII +L +I+   +DA+P ++I  D    IS
Sbjct  61   AIISKLQSINNQEKDADPTIVIAADTAEAIS  91



>ref|XP_010552471.1| PREDICTED: maf-like protein DDB_G0281937 isoform X2 [Tarenaya 
hassleriana]
Length=232

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYE  +REKP + EEARE+I+ YS G AAT+SSVLVTNLKTG ++G++D+VEIYFHE
Sbjct  111   QVVVYEDAVREKPSHVEEAREYIRGYSKGHAATVSSVLVTNLKTGFRKGDVDRVEIYFHE  170

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IPE+VI+KLIEEG VL VAG L+IEHPL+ PY+K V G TDSVMGLPK LT+KL+ E L
Sbjct  171   IPEEVIEKLIEEGMVLKVAGALIIEHPLVLPYVKEVVGTTDSVMGLPKTLTEKLLKEAL  229


 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            ME N   FKLILGS+S  RR++LA+MGYEF T+SADIDEK+IRKEKPE+LVMALAEAKA+
Sbjct  1    MEANLGQFKLILGSSSIARRKILADMGYEF-TLSADIDEKSIRKEKPEELVMALAEAKAD  59

Query  237  AIIPRLNIDESMEDAEPMLLITCDQVHNI  323
            AI+ +L I +  ++A+P +LI  D    I
Sbjct  60   AIVSKLRITQVQQEAQPTVLIAADTAKAI  88



>ref|XP_010552474.1| PREDICTED: maf-like protein DDB_G0281937 isoform X5 [Tarenaya 
hassleriana]
Length=205

 Score =   174 bits (441),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYE  +REKP + EEARE+I+ YS G AAT+SSVLVTNLKTG ++G++D+VEIYFHE
Sbjct  84    QVVVYEDAVREKPSHVEEAREYIRGYSKGHAATVSSVLVTNLKTGFRKGDVDRVEIYFHE  143

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IPE+VI+KLIEEG VL VAG L+IEHPL+ PY+K V G TDSVMGLPK LT+KL+ E L
Sbjct  144   IPEEVIEKLIEEGMVLKVAGALIIEHPLVLPYVKEVVGTTDSVMGLPKTLTEKLLKEAL  202


 Score =   120 bits (300),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 73/86 (85%), Gaps = 1/86 (1%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            ME N   FKLILGS+S  RR++LA+MGYEF T+SADIDEK+IRKEKPE+LVMALAEAKA+
Sbjct  1    MEANLGQFKLILGSSSIARRKILADMGYEF-TLSADIDEKSIRKEKPEELVMALAEAKAK  59

Query  237  AIIPRLNIDESMEDAEPMLLITCDQV  314
            AI+ R+  D++ E+AE  LLITCDQV
Sbjct  60   AIVQRIPGDDNTEEAESTLLITCDQV  85



>ref|XP_002510393.1| maf protein, putative [Ricinus communis]
 gb|EEF52580.1| maf protein, putative [Ricinus communis]
Length=242

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 105/129 (81%), Gaps = 10/129 (8%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYEG IREKP ++EEAR+F+KDYS G AAT+SSVLVTNLKTG ++ E D+VEI+FHE
Sbjct  114   QVVVYEGAIREKPSSEEEARQFMKDYSGGHAATVSSVLVTNLKTGFRKVEFDRVEIFFHE  173

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVA----------GATDSVMGLPKAL  1094
             IP++VI+KLIEEG VL VAGGL+IEHPLI PY+K V+          G TDSVMGLPK+L
Sbjct  174   IPDEVIEKLIEEGLVLRVAGGLIIEHPLILPYVKEVSSTETLSSVQVGTTDSVMGLPKSL  233

Query  1095  TQKLITEVL  1121
             T+KL+ E L
Sbjct  234   TEKLMKEAL  242


 Score =   103 bits (258),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 67/111 (60%), Gaps = 27/111 (24%)
 Frame = +3

Query  63   GNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAI  242
             ++   K+ILGS+S  RR++LAEMGYEF   SADIDEK IRKEKPE+LVMALAEAKA+AI
Sbjct  5    ASSSSVKIILGSSSVARRKILAEMGYEFTVTSADIDEKCIRKEKPEELVMALAEAKADAI  64

Query  243  IPRLNIDESME---------------------------DAEPMLLITCDQV  314
            I +L  D + E                           DA P LLITCDQV
Sbjct  65   IAKLQADNNQEKDAELILAAADTAEAILQRLPVHDYIKDAVPALLITCDQV  115



>ref|XP_010552472.1| PREDICTED: maf-like protein DDB_G0281937 isoform X3 [Tarenaya 
hassleriana]
Length=206

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYE  +REKP + EEARE+I+ YS G AAT+SSVLVTNLKTG ++G++D+VEIYFHE
Sbjct  85    QVVVYEDAVREKPSHVEEAREYIRGYSKGHAATVSSVLVTNLKTGFRKGDVDRVEIYFHE  144

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IPE+VI+KLIEEG VL VAG L+IEHPL+ PY+K V G TDSVMGLPK LT+KL+ E L
Sbjct  145   IPEEVIEKLIEEGMVLKVAGALIIEHPLVLPYVKEVVGTTDSVMGLPKTLTEKLLKEAL  203


 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            ME N   FKLILGS+S  RR++LA+MGYEF  +SADIDEK+IRKEKPE+LVMALAEAKA+
Sbjct  1    MEANLGQFKLILGSSSIARRKILADMGYEFTLVSADIDEKSIRKEKPEELVMALAEAKAK  60

Query  237  AIIPRLNIDESMEDAEPMLLITCDQV  314
            AI+ R+  D++ E+AE  LLITCDQV
Sbjct  61   AIVQRIPGDDNTEEAESTLLITCDQV  86



>ref|XP_010552470.1| PREDICTED: maf-like protein DDB_G0281937 isoform X1 [Tarenaya 
hassleriana]
Length=233

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYE  +REKP + EEARE+I+ YS G AAT+SSVLVTNLKTG ++G++D+VEIYFHE
Sbjct  112   QVVVYEDAVREKPSHVEEAREYIRGYSKGHAATVSSVLVTNLKTGFRKGDVDRVEIYFHE  171

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IPE+VI+KLIEEG VL VAG L+IEHPL+ PY+K V G TDSVMGLPK LT+KL+ E L
Sbjct  172   IPEEVIEKLIEEGMVLKVAGALIIEHPLVLPYVKEVVGTTDSVMGLPKTLTEKLLKEAL  230


 Score =   112 bits (280),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 69/89 (78%), Gaps = 0/89 (0%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            ME N   FKLILGS+S  RR++LA+MGYEF  +SADIDEK+IRKEKPE+LVMALAEAKA+
Sbjct  1    MEANLGQFKLILGSSSIARRKILADMGYEFTLVSADIDEKSIRKEKPEELVMALAEAKAD  60

Query  237  AIIPRLNIDESMEDAEPMLLITCDQVHNI  323
            AI+ +L I +  ++A+P +LI  D    I
Sbjct  61   AIVSKLRITQVQQEAQPTVLIAADTAKAI  89



>ref|XP_008364995.1| PREDICTED: maf-like protein DDB_G0281937 isoform X4 [Malus domestica]
Length=204

 Score =   173 bits (439),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVVYEG+IREKP +KEEAR+F+KDYS G AAT+ SV VTNLKTG  +GE D+VEIYFH+I
Sbjct  87    VVVYEGVIREKPSSKEEARQFLKDYSGGHAATVGSVHVTNLKTGFSKGEWDRVEIYFHKI  146

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             P++VI+KLIEEG VL VAGGL+IEHPLI PY+K V G TDSVMGLP  LT+ L+ E L
Sbjct  147   PDEVIEKLIEEGIVLKVAGGLIIEHPLILPYVKEVVGTTDSVMGLPIDLTRTLLKEAL  204


 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 68/87 (78%), Gaps = 1/87 (1%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            ME ++  FK+ILGSAS  RR++LAEMGYEF  ++ADIDEK+IR EKPE+LV+ LA+AKA+
Sbjct  1    MEADSSSFKIILGSASIARRKILAEMGYEFTVVTADIDEKSIRTEKPEELVLVLAKAKAD  60

Query  237  AIIPRL-NIDESMEDAEPMLLITCDQV  314
            AII +L +I+   +D EP ++I  D V
Sbjct  61   AIISKLQSINXQEKDXEPTIVIAADTV  87



>ref|XP_008364994.1| PREDICTED: maf-like protein DDB_G0281937 isoform X3 [Malus domestica]
Length=206

 Score =   173 bits (438),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 100/119 (84%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYEG+IREKP +KEEAR+F+KDYS G AAT+ SV VTNLKTG  +GE D+VEIYFH+
Sbjct  88    QVVVYEGVIREKPSSKEEARQFLKDYSGGHAATVGSVHVTNLKTGFSKGEWDRVEIYFHK  147

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP++VI+KLIEEG VL VAGGL+IEHPLI PY+K V G TDSVMGLP  LT+ L+ E L
Sbjct  148   IPDEVIEKLIEEGIVLKVAGGLIIEHPLILPYVKEVVGTTDSVMGLPIDLTRTLLKEAL  206


 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 49/66 (74%), Gaps = 1/66 (2%)
 Frame = +3

Query  132  MGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRL-NIDESMEDAEPMLLITCD  308
            MGYEF  ++ADIDEK+IR EKPE+LV+ LA+AKA+AII +L +I+   +D EP ++I  D
Sbjct  1    MGYEFTVVTADIDEKSIRTEKPEELVLVLAKAKADAIISKLQSINXQEKDXEPTIVIAAD  60

Query  309  QVHNIS  326
                IS
Sbjct  61   TAEAIS  66



>ref|XP_006600188.1| PREDICTED: uncharacterized protein LOC100792444 isoform X1 [Glycine 
max]
Length=202

 Score =   172 bits (437),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVVYEG+IREKP +KEEAR+F+KDYS   AAT+ SVLVTNLKTG ++G+ D+VEIYF+EI
Sbjct  85    VVVYEGVIREKPTSKEEARQFLKDYSGRHAATVGSVLVTNLKTGLRKGDSDRVEIYFNEI  144

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             P+++I+KL++EG  L VAGGL+IEHPL+ P++K V G TDSVMGLPKALT+KL+ E L
Sbjct  145   PDEIIEKLVDEGITLNVAGGLIIEHPLVLPFVKEVVGTTDSVMGLPKALTEKLLKEAL  202


 Score = 97.4 bits (241),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 61/84 (73%), Gaps = 1/84 (1%)
 Frame = +3

Query  66   NTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAII  245
            +   FK+ILGS+S  RR++L+EMGY F  M+ADIDEK+IRKE PEDLVMALAEAKA AII
Sbjct  2    DASSFKIILGSSSVARRKILSEMGYLFTIMTADIDEKSIRKETPEDLVMALAEAKANAII  61

Query  246  PRLNIDESMEDA-EPMLLITCDQV  314
             +L    + +   EP +LI  D V
Sbjct  62   SKLQTTTNQQRVDEPTILIAADTV  85



>ref|XP_008364992.1| PREDICTED: maf-like protein DDB_G0281937 isoform X1 [Malus domestica]
Length=231

 Score =   174 bits (440),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 100/119 (84%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYEG+IREKP +KEEAR+F+KDYS G AAT+ SV VTNLKTG  +GE D+VEIYFH+
Sbjct  113   QVVVYEGVIREKPSSKEEARQFLKDYSGGHAATVGSVHVTNLKTGFSKGEWDRVEIYFHK  172

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP++VI+KLIEEG VL VAGGL+IEHPLI PY+K V G TDSVMGLP  LT+ L+ E L
Sbjct  173   IPDEVIEKLIEEGIVLKVAGGLIIEHPLILPYVKEVVGTTDSVMGLPIDLTRTLLKEAL  231


 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 69/91 (76%), Gaps = 1/91 (1%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            ME ++  FK+ILGSAS  RR++LAEMGYEF  ++ADIDEK+IR EKPE+LV+ LA+AKA+
Sbjct  1    MEADSSSFKIILGSASIARRKILAEMGYEFTVVTADIDEKSIRTEKPEELVLVLAKAKAD  60

Query  237  AIIPRL-NIDESMEDAEPMLLITCDQVHNIS  326
            AII +L +I+   +D EP ++I  D    IS
Sbjct  61   AIISKLQSINXQEKDXEPTIVIAADTAEAIS  91



>ref|NP_001242372.1| uncharacterized protein LOC100792444 [Glycine max]
 gb|ACU21322.1| unknown [Glycine max]
Length=201

 Score =   172 bits (437),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYEG+IREKP +KEEAR+F+KDYS   AAT+ SVLVTNLKTG ++G+ D+VEIYF+E
Sbjct  83    QVVVYEGVIREKPTSKEEARQFLKDYSGRHAATVGSVLVTNLKTGLRKGDSDRVEIYFNE  142

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP+++I+KL++EG  L VAGGL+IEHPL+ P++K V G TDSVMGLPKALT+KL+ E L
Sbjct  143   IPDEIIEKLVDEGITLNVAGGLIIEHPLVLPFVKEVVGTTDSVMGLPKALTEKLLKEAL  201


 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +3

Query  66   NTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAII  245
            +   FK+ILGS+S  RR++L+EMGY F  M+ADIDEK+IRKE PEDLVMALAEAKAEAI+
Sbjct  2    DASSFKIILGSSSVARRKILSEMGYLFTIMTADIDEKSIRKETPEDLVMALAEAKAEAIL  61

Query  246  PRLNIDESMEDAEPMLLITCDQV  314
             RL +D+ +++AEP LLIT DQV
Sbjct  62   RRLPVDDYLKEAEPTLLITSDQV  84



>ref|XP_006600189.1| PREDICTED: uncharacterized protein LOC100792444 isoform X2 [Glycine 
max]
Length=229

 Score =   173 bits (439),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYEG+IREKP +KEEAR+F+KDYS   AAT+ SVLVTNLKTG ++G+ D+VEIYF+E
Sbjct  111   QVVVYEGVIREKPTSKEEARQFLKDYSGRHAATVGSVLVTNLKTGLRKGDSDRVEIYFNE  170

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP+++I+KL++EG  L VAGGL+IEHPL+ P++K V G TDSVMGLPKALT+KL+ E L
Sbjct  171   IPDEIIEKLVDEGITLNVAGGLIIEHPLVLPFVKEVVGTTDSVMGLPKALTEKLLKEAL  229


 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 69/111 (62%), Gaps = 28/111 (25%)
 Frame = +3

Query  66   NTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAK-----  230
            +   FK+ILGS+S  RR++L+EMGY F  M+ADIDEK+IRKE PEDLVMALAEAK     
Sbjct  2    DASSFKIILGSSSVARRKILSEMGYLFTIMTADIDEKSIRKETPEDLVMALAEAKANAII  61

Query  231  -----------------------AEAIIPRLNIDESMEDAEPMLLITCDQV  314
                                   AEAI+ RL +D+ +++AEP LLIT DQV
Sbjct  62   SKLQTTTNQQRVDEPTILIAADTAEAILQRLPVDDYLKEAEPTLLITSDQV  112



>gb|KHN12707.1| Maf-like protein [Glycine soja]
Length=224

 Score =   173 bits (438),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVVYEG+IREKP +KEEAR+F+KDYS   AAT+ SVLVTNLKTG ++G+ D+VEIYF+EI
Sbjct  107   VVVYEGVIREKPTSKEEARQFLKDYSGRHAATVGSVLVTNLKTGLRKGDSDRVEIYFNEI  166

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             P+++I+KL++EG  L VAGGL+IEHPL+ P++K V G TDSVMGLPKALT+KL+ E L
Sbjct  167   PDEIIEKLVDEGITLNVAGGLIIEHPLVLPFVKEVVGTTDSVMGLPKALTEKLLKEAL  224


 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 59/79 (75%), Gaps = 1/79 (1%)
 Frame = +3

Query  81   KLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLNI  260
            ++ILGS+S  RR++L+EMGY F  M+ADIDEK+IRKE PEDLVMALAEAKA AII +L  
Sbjct  29   QIILGSSSVARRKILSEMGYLFTIMTADIDEKSIRKETPEDLVMALAEAKANAIISKLQT  88

Query  261  DESMEDA-EPMLLITCDQV  314
              + +   EP +LI  D V
Sbjct  89   TTNQQRVDEPTILIAADTV  107



>ref|XP_010677777.1| PREDICTED: maf-like protein DDB_G0281937 isoform X4 [Beta vulgaris 
subsp. vulgaris]
Length=204

 Score =   172 bits (435),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVVYEGM+REKP +KEEAR ++KDYS  +A+T+SSVLVTNL+TG ++GE DKVEI F EI
Sbjct  87    VVVYEGMVREKPSSKEEARRYMKDYSGSKASTVSSVLVTNLQTGFRKGEWDKVEILFDEI  146

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             P++ IDKLIEEG VL VAGGL+IEHPLI P +K V G TDSVMGLPKA+ ++LI+E L
Sbjct  147   PDETIDKLIEEGAVLGVAGGLIIEHPLILPLVKEVVGTTDSVMGLPKAVAERLISESL  204


 Score =   114 bits (286),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 68/87 (78%), Gaps = 1/87 (1%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            M    +PFK+ILGS S  RR++L +MGYEF  M+ADIDEKAIRKEKPEDLVMALAEAKA+
Sbjct  1    MASTAYPFKIILGSKSKARREILEQMGYEFTIMTADIDEKAIRKEKPEDLVMALAEAKAD  60

Query  237  AIIPRLNI-DESMEDAEPMLLITCDQV  314
            AII +L I D  + D+EP LLI+ D V
Sbjct  61   AIISKLQIADIQVNDSEPTLLISADTV  87



>ref|XP_004499160.1| PREDICTED: maf-like protein DDB_G0281937-like isoform X2 [Cicer 
arietinum]
Length=204

 Score =   172 bits (435),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVVYEG+IREKP +K+EAR+F+KDYS  +AAT+ SVLVTNLKTG ++GE D+VEIYF+E+
Sbjct  87    VVVYEGVIREKPSSKQEARQFLKDYSGRKAATVGSVLVTNLKTGLRKGESDRVEIYFNEM  146

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             P+++I+KL++EG  L VAGGL+IEHPLI PY++ V G TDSVMGLPK LT+KL+ EVL
Sbjct  147   PDEIIEKLVDEGITLNVAGGLIIEHPLIFPYVREVVGTTDSVMGLPKDLTEKLLKEVL  204


 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 62/87 (71%), Gaps = 1/87 (1%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            ME     +K+ILGS+S  RR +L+EMG++F  M+ADIDEK+IRKE PEDLV+ALAEAKA 
Sbjct  1    MEAGNSSYKIILGSSSVARRNILSEMGHQFTIMTADIDEKSIRKETPEDLVLALAEAKAN  60

Query  237  AIIPRLNIDESMEDA-EPMLLITCDQV  314
            AII +L    + E   EP LLI  D V
Sbjct  61   AIISKLQTTGNQERVDEPTLLIAADTV  87



>gb|AFK42859.1| unknown [Lotus japonicus]
Length=202

 Score =   171 bits (434),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYEG++REKP +KEEA +F+KDYS   AAT+ SVLVTNLKTG ++G+ D+VEIYF+E
Sbjct  84    QVVVYEGVVREKPSSKEEAWQFLKDYSGRHAATVGSVLVTNLKTGLRKGDSDRVEIYFNE  143

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP+++ID+L++EG  L VAGGLLIEHPLI P++K V G TDSVMGLPK+LT+KL+ E L
Sbjct  144   IPDEIIDRLVDEGITLNVAGGLLIEHPLILPFVKEVVGTTDSVMGLPKSLTEKLLKEAL  202


 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLN  257
            +K+ILGS+S  RR++L+EMGY+F  M+ADIDEK+IRKE PE+LVMALAEAKAEAII RL 
Sbjct  7    YKIILGSSSVARRKILSEMGYQFTLMTADIDEKSIRKETPEELVMALAEAKAEAIIQRLP  66

Query  258  IDESMEDAEPMLLITCDQV  314
            +D+ ++DA+P LLIT DQV
Sbjct  67   VDDYLKDAQPTLLITSDQV  85



>ref|XP_010677776.1| PREDICTED: maf-like protein DDB_G0281937 isoform X3 [Beta vulgaris 
subsp. vulgaris]
Length=212

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVVYEGM+REKP +KEEAR ++KDYS  +A+T+SSVLVTNL+TG ++GE DKVEI F EI
Sbjct  95    VVVYEGMVREKPSSKEEARRYMKDYSGSKASTVSSVLVTNLQTGFRKGEWDKVEILFDEI  154

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             P++ IDKLIEEG VL VAGGL+IEHPLI P +K V G TDSVMGLPKA+ ++LI+E L
Sbjct  155   PDETIDKLIEEGAVLGVAGGLIIEHPLILPLVKEVVGTTDSVMGLPKAVAERLISESL  212


 Score =   114 bits (284),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 68/87 (78%), Gaps = 1/87 (1%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            M    +PFK+ILGS S  RR++L +MGYEF  M+ADIDEKAIRKEKPEDLVMALAEAKA+
Sbjct  1    MASTAYPFKIILGSKSKARREILEQMGYEFTIMTADIDEKAIRKEKPEDLVMALAEAKAD  60

Query  237  AIIPRLNI-DESMEDAEPMLLITCDQV  314
            AII +L I D  + D+EP LLI+ D V
Sbjct  61   AIISKLQIADIQVNDSEPTLLISADTV  87



>ref|XP_006855997.1| hypothetical protein AMTR_s00059p00024750 [Amborella trichopoda]
 gb|ERN17464.1| hypothetical protein AMTR_s00059p00024750 [Amborella trichopoda]
Length=206

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 108/140 (77%), Gaps = 4/140 (3%)
 Frame = +3

Query  714   R*DLSVLMFLTAKLKLL----EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLV  881
             R DLSV    +A+  LL    +VVV+EG+IREKP +KEEAR FIK YS G AATI SVLV
Sbjct  66    RLDLSVYKEPSAEPTLLITADQVVVHEGVIREKPLSKEEARAFIKGYSKGHAATIGSVLV  125

Query  882   TNLKTGKKRGELDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGA  1061
             TNLKTG ++GE+DK EIYFH+IP+++I+ LIEEG VL VAGGL++EHPL  P ++ + G 
Sbjct  126   TNLKTGIRKGEVDKAEIYFHDIPDEIIESLIEEGKVLNVAGGLIVEHPLTSPLVEAMVGT  185

Query  1062  TDSVMGLPKALTQKLITEVL  1121
             TDSVMGLPK LTQ LI E L
Sbjct  186   TDSVMGLPKVLTQTLIREAL  205


 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 64/84 (76%), Gaps = 1/84 (1%)
 Frame = +3

Query  66   NTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAII  245
            N+   ++ILGS+S  RR +L+EMGY F  MSADIDEK+IR E PEDLVMALAEAKA+AII
Sbjct  5    NSAFKQIILGSSSIARRNILSEMGYAFTVMSADIDEKSIRIENPEDLVMALAEAKADAII  64

Query  246  PRLNIDESME-DAEPMLLITCDQV  314
             RL++    E  AEP LLIT DQV
Sbjct  65   SRLDLSVYKEPSAEPTLLITADQV  88



>ref|XP_008388060.1| PREDICTED: maf-like protein DDB_G0281937 isoform X2 [Malus domestica]
Length=204

 Score =   171 bits (434),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVVYEG+IREKP  KEEAR+F+KDYS G AAT+ SV VTNLKTG  +GE D+VEIYFH+I
Sbjct  87    VVVYEGVIREKPSGKEEARQFLKDYSGGHAATVGSVHVTNLKTGFSKGEWDRVEIYFHKI  146

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             P++VI+KLIEEG VL VAGGL+IEHPLI P++K V G TDSVMGLP  LT++L+ E +
Sbjct  147   PDEVIEKLIEEGIVLKVAGGLIIEHPLILPFVKEVVGTTDSVMGLPIDLTRRLLKEAV  204


 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 68/87 (78%), Gaps = 1/87 (1%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            ME ++  FK+ILGSAS  RR++LAEMGYEF  M+ADIDEK+IR EKPE+LV+ LA+AKA+
Sbjct  1    MEADSSSFKIILGSASIARRKILAEMGYEFTVMTADIDEKSIRTEKPEELVLVLAKAKAD  60

Query  237  AIIPRL-NIDESMEDAEPMLLITCDQV  314
            AI+ +L +I+   +DAE  ++I  D V
Sbjct  61   AIVSKLQSINNQEKDAETTIVIAADTV  87



>ref|XP_006281110.1| hypothetical protein CARUB_v10027140mg [Capsella rubella]
 gb|EOA14008.1| hypothetical protein CARUB_v10027140mg [Capsella rubella]
Length=206

 Score =   171 bits (434),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYE  +REKP N EEARE+I+ YSNG  AT+SSV VTNLKTG ++  +D+VEIYF+E
Sbjct  85    QVVVYEDAVREKPSNPEEAREYIRGYSNGHTATVSSVAVTNLKTGFRQAGVDRVEIYFNE  144

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IPE+ I+KLIEEGTVL VAG LLIEHPLI P +K VAG TDSVMGLPK LT+KLI EVL
Sbjct  145   IPEETIEKLIEEGTVLKVAGALLIEHPLILPCVKEVAGTTDSVMGLPKDLTEKLIKEVL  203


 Score = 94.7 bits (234),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            ME N   FK+ILGS+S  RR +L EMGY+F  MSADIDEK+IRKEKPEDLV+ALAEAKAE
Sbjct  1    MESNHPHFKIILGSSSIARRTILTEMGYQFTLMSADIDEKSIRKEKPEDLVLALAEAKAE  60

Query  237  AIIPRLNIDESMEDAEPMLLITCDQV  314
            AI+ R+   +++E+ +  LLITCDQV
Sbjct  61   AIMERIPDGDNIEEDKSTLLITCDQV  86



>ref|XP_004499161.1| PREDICTED: maf-like protein DDB_G0281937-like isoform X3 [Cicer 
arietinum]
Length=203

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYEG+IREKP +K+EAR+F+KDYS  +AAT+ SVLVTNLKTG ++GE D+VEIYF+E
Sbjct  85    QVVVYEGVIREKPSSKQEARQFLKDYSGRKAATVGSVLVTNLKTGLRKGESDRVEIYFNE  144

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             +P+++I+KL++EG  L VAGGL+IEHPLI PY++ V G TDSVMGLPK LT+KL+ EVL
Sbjct  145   MPDEIIEKLVDEGITLNVAGGLIIEHPLIFPYVREVVGTTDSVMGLPKDLTEKLLKEVL  203


 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            ME     +K+ILGS+S  RR +L+EMG++F  M+ADIDEK+IRKE PEDLV+ALAEAKAE
Sbjct  1    MEAGNSSYKIILGSSSVARRNILSEMGHQFTIMTADIDEKSIRKETPEDLVLALAEAKAE  60

Query  237  AIIPRLNIDESMEDAEPMLLITCDQV  314
            AI+ +L + + ++ AEP LLITCDQV
Sbjct  61   AILQKLPVGDYLKHAEPTLLITCDQV  86



>ref|XP_008388059.1| PREDICTED: maf-like protein DDB_G0281937 isoform X1 [Malus domestica]
Length=231

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 100/119 (84%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYEG+IREKP  KEEAR+F+KDYS G AAT+ SV VTNLKTG  +GE D+VEIYFH+
Sbjct  113   QVVVYEGVIREKPSGKEEARQFLKDYSGGHAATVGSVHVTNLKTGFSKGEWDRVEIYFHK  172

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP++VI+KLIEEG VL VAGGL+IEHPLI P++K V G TDSVMGLP  LT++L+ E +
Sbjct  173   IPDEVIEKLIEEGIVLKVAGGLIIEHPLILPFVKEVVGTTDSVMGLPIDLTRRLLKEAV  231


 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 69/91 (76%), Gaps = 1/91 (1%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            ME ++  FK+ILGSAS  RR++LAEMGYEF  M+ADIDEK+IR EKPE+LV+ LA+AKA+
Sbjct  1    MEADSSSFKIILGSASIARRKILAEMGYEFTVMTADIDEKSIRTEKPEELVLVLAKAKAD  60

Query  237  AIIPRL-NIDESMEDAEPMLLITCDQVHNIS  326
            AI+ +L +I+   +DAE  ++I  D    IS
Sbjct  61   AIVSKLQSINNQEKDAETTIVIAADTAEAIS  91



>ref|XP_004499159.1| PREDICTED: maf-like protein DDB_G0281937-like isoform X1 [Cicer 
arietinum]
Length=231

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYEG+IREKP +K+EAR+F+KDYS  +AAT+ SVLVTNLKTG ++GE D+VEIYF+E
Sbjct  113   QVVVYEGVIREKPSSKQEARQFLKDYSGRKAATVGSVLVTNLKTGLRKGESDRVEIYFNE  172

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             +P+++I+KL++EG  L VAGGL+IEHPLI PY++ V G TDSVMGLPK LT+KL+ EVL
Sbjct  173   MPDEIIEKLVDEGITLNVAGGLIIEHPLIFPYVREVVGTTDSVMGLPKDLTEKLLKEVL  231


 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 69/114 (61%), Gaps = 28/114 (25%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            ME     +K+ILGS+S  RR +L+EMG++F  M+ADIDEK+IRKE PEDLV+ALAEAKA 
Sbjct  1    MEAGNSSYKIILGSSSVARRNILSEMGHQFTIMTADIDEKSIRKETPEDLVLALAEAKAN  60

Query  237  AIIPRLN-------IDES---------------------MEDAEPMLLITCDQV  314
            AII +L        +DE                      ++ AEP LLITCDQV
Sbjct  61   AIISKLQTTGNQERVDEPTLLIAADTAEAILQKLPVGDYLKHAEPTLLITCDQV  114



>ref|XP_009395644.1| PREDICTED: maf-like protein DDB_G0281937 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=208

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVV+ G+IREKP + EEAREFIK YS G A+T+ SVLVTNLKTG ++G  DK EIYFH+
Sbjct  86    QVVVHGGLIREKPSSTEEAREFIKGYSAGHASTVGSVLVTNLKTGVRKGGCDKAEIYFHK  145

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP++VID LIEEG VLYVAGGL++EHPL  P+++ + G  D VMGLPKALTQ+LI E L
Sbjct  146   IPDEVIDSLIEEGDVLYVAGGLMVEHPLTSPFVEAIVGTIDGVMGLPKALTQRLIQEAL  204


 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 65/87 (75%), Gaps = 1/87 (1%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            M  +   FK+ILGS+S  RRQ+L+EMGY+FI +SADIDEK IR+  PE+LVM LAEAKA+
Sbjct  1    MSPSDSSFKMILGSSSRSRRQILSEMGYDFIVLSADIDEKEIRRHTPEELVMVLAEAKAD  60

Query  237  AIIPRLNIDE-SMEDAEPMLLITCDQV  314
            AII +L       EDAEP LLIT DQV
Sbjct  61   AIISKLRSSGFKEEDAEPTLLITADQV  87



>emb|CDP07509.1| unnamed protein product [Coffea canephora]
Length=232

 Score =   171 bits (433),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYEG IREKP +K+EAR +IK YS G AAT+SSV++TNLK+G ++GE DKVEI F +
Sbjct  114   QVVVYEGNIREKPSSKDEARHYIKGYSGGCAATVSSVVITNLKSGIRKGEWDKVEIRFQD  173

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP+ VID LIEEG VL VAG L+IEHPLI PY+K V GATDSVMGLPK LT++LI EVL
Sbjct  174   IPDQVIDSLIEEGNVLNVAGALIIEHPLILPYVKEVVGATDSVMGLPKTLTERLIKEVL  232


 Score =   112 bits (279),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 71/107 (66%), Gaps = 28/107 (26%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAK---------  230
            FK+ILGS+S  R+++LA+MGY+F TMSADIDEKAIRKEKPE+LVMALAEAK         
Sbjct  9    FKVILGSSSVARKEILADMGYQFTTMSADIDEKAIRKEKPEELVMALAEAKADAIISKFQ  68

Query  231  -------------------AEAIIPRLNIDESMEDAEPMLLITCDQV  314
                               AEAIIP+L I+E   DAEP LLITCDQV
Sbjct  69   NIQNEGKDVKPTILIAADTAEAIIPKLQIEEYNMDAEPALLITCDQV  115



>ref|XP_010263652.1| PREDICTED: maf-like protein DDB_G0281937 [Nelumbo nucifera]
Length=204

 Score =   169 bits (429),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVV EG IREKP NKEEAR+FI+ YS G A T+ SVLVTNLKTG +RG  DK E+YF +
Sbjct  86    QVVVIEGKIREKPSNKEEARQFIRGYSGGNAVTVGSVLVTNLKTGTRRGAWDKAEVYFRD  145

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP ++I+ LIEEG VL VAGGL++EHPL QP+++ V G TDSVMGLPK+LT+KLI EV 
Sbjct  146   IPNEIIENLIEEGLVLNVAGGLIVEHPLTQPFVEAVVGTTDSVMGLPKSLTEKLIKEVF  204


 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 65/87 (75%), Gaps = 1/87 (1%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            M  +T  FK+ILGS S  R+ +L EMGY+F  M+ADIDEKAIRKE PEDLVMALAEAKA+
Sbjct  1    MATDTASFKIILGSKSMTRQNILTEMGYKFTIMTADIDEKAIRKEHPEDLVMALAEAKAD  60

Query  237  AIIPRL-NIDESMEDAEPMLLITCDQV  314
            AII  L N D   +DA P LLIT DQV
Sbjct  61   AIISTLQNTDCKDKDAVPTLLITADQV  87



>ref|XP_009395643.1| PREDICTED: maf-like protein DDB_G0281937 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=281

 Score =   172 bits (435),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVV+ G+IREKP + EEAREFIK YS G A+T+ SVLVTNLKTG ++G  DK EIYFH+
Sbjct  159   QVVVHGGLIREKPSSTEEAREFIKGYSAGHASTVGSVLVTNLKTGVRKGGCDKAEIYFHK  218

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP++VID LIEEG VLYVAGGL++EHPL  P+++ + G  D VMGLPKALTQ+LI E L
Sbjct  219   IPDEVIDSLIEEGDVLYVAGGLMVEHPLTSPFVEAIVGTIDGVMGLPKALTQRLIQEAL  277



>ref|XP_010936258.1| PREDICTED: maf-like protein DDB_G0281937 isoform X1 [Elaeis guineensis]
Length=162

 Score =   167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVV+ GMIREKP   E+AREF+K YS G A+T+ SVLVTNLKTG ++G  DK E+YFH+
Sbjct  43    QVVVHGGMIREKPSGAEQAREFLKGYSGGHASTVGSVLVTNLKTGTRKGGWDKAEVYFHK  102

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IPE+VI+ LI+EG VLYVAGGL++EHPL  P+++ + G  DS+MGLPKALT+KLI E L
Sbjct  103   IPEEVIENLIKEGDVLYVAGGLMVEHPLTSPFVEAIVGTIDSIMGLPKALTEKLIQEAL  161


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 33/43 (77%), Gaps = 1/43 (2%)
 Frame = +3

Query  189  EKPEDLVMALAEAKAEAIIPRLNIDESMED-AEPMLLITCDQV  314
            EKPE+LVMALAEAKA+AI+ +L  +   ED  +P LLIT DQV
Sbjct  2    EKPEELVMALAEAKADAIVTKLRSNGFKEDHTQPTLLITADQV  44



>ref|XP_010254822.1| PREDICTED: maf-like protein DDB_G0281937 isoform X1 [Nelumbo 
nucifera]
Length=204

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 98/118 (83%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVV+EG +REKP +KEEAR FIK YS G AAT+ SV+VTNLKTG ++G  DK E+YFH+I
Sbjct  87    VVVFEGKVREKPSSKEEARRFIKGYSGGNAATVGSVIVTNLKTGTRKGAWDKAEVYFHDI  146

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             P++VID LIEEG VL VAGGL++EHPL  P+++ V G+ DSVMGLPK+LT++LI EVL
Sbjct  147   PDEVIDNLIEEGLVLNVAGGLILEHPLTLPFVEAVVGSADSVMGLPKSLTEELIKEVL  204


 Score =   108 bits (270),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 63/87 (72%), Gaps = 1/87 (1%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            M   T  FK+ILGS S  RR +L EMGYEF  M+ADIDEK IRKEKPE+LVMALAEAKA+
Sbjct  1    MATGTASFKIILGSKSLARRNILTEMGYEFTIMTADIDEKGIRKEKPEELVMALAEAKAD  60

Query  237  AIIPRLNIDESME-DAEPMLLITCDQV  314
            AII RL      E DAEP LLIT D V
Sbjct  61   AIIARLQTAGYQEKDAEPTLLITADTV  87



>ref|XP_010936259.1| PREDICTED: maf-like protein DDB_G0281937 isoform X2 [Elaeis guineensis]
Length=205

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVV+ GMIREKP   E+AREF+K YS G A+T+ SVLVTNLKTG ++G  DK E+YFH+
Sbjct  86    QVVVHGGMIREKPSGAEQAREFLKGYSGGHASTVGSVLVTNLKTGTRKGGWDKAEVYFHK  145

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IPE+VI+ LI+EG VLYVAGGL++EHPL  P+++ + G  DS+MGLPKALT+KLI E L
Sbjct  146   IPEEVIENLIKEGDVLYVAGGLMVEHPLTSPFVEAIVGTIDSIMGLPKALTEKLIQEAL  204


 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 65/80 (81%), Gaps = 1/80 (1%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLN  257
            FK+ILGS+SA RRQ+LAEMGY+F  MSADIDEK IR EKPE+LVMALAEAKA+AI+ +L 
Sbjct  8    FKVILGSSSASRRQILAEMGYKFTIMSADIDEKEIRMEKPEELVMALAEAKADAIVTKLR  67

Query  258  IDESMED-AEPMLLITCDQV  314
             +   ED  +P LLIT DQV
Sbjct  68   SNGFKEDHTQPTLLITADQV  87



>ref|XP_007160752.1| hypothetical protein PHAVU_001G014200g [Phaseolus vulgaris]
 gb|ESW32746.1| hypothetical protein PHAVU_001G014200g [Phaseolus vulgaris]
Length=203

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYEG+IREKP +KEEAR+F+KDYS   AAT+ SVLVTN+KTG ++G+ D+VEIYF+E
Sbjct  85    QVVVYEGVIREKPTSKEEARQFLKDYSGKCAATVGSVLVTNIKTGFRKGDSDRVEIYFNE  144

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP+++I+KL++EG  L VAGGL+IEHP I P++K V G TDSVMGLPK+LT+KL+ E L
Sbjct  145   IPDEIIEKLVDEGITLNVAGGLIIEHPSILPFVKEVVGTTDSVMGLPKSLTEKLLKEAL  203


 Score =   117 bits (292),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            ME ++  +K+ILGS+S  RR++L+EMG+ F  M+ADIDEK+IRKE PE+LVMALAEAKAE
Sbjct  1    MEASSSSYKIILGSSSVARRKILSEMGFLFTLMTADIDEKSIRKETPEELVMALAEAKAE  60

Query  237  AIIPRLNIDESMEDAEPMLLITCDQV  314
            AI+ RL +D+ ++DAEP LLIT DQV
Sbjct  61   AILQRLPVDDYLKDAEPTLLITSDQV  86



>ref|XP_010494228.1| PREDICTED: maf-like protein DDB_G0281937 isoform X3 [Camelina 
sativa]
 ref|XP_010494233.1| PREDICTED: maf-like protein DDB_G0281937 isoform X3 [Camelina 
sativa]
Length=208

 Score =   168 bits (425),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVVYE  +REKP + EEARE+I+ YS G  AT+SSV VTNLKTG ++  +DKVEIYF+EI
Sbjct  86    VVVYEDTVREKPSSVEEAREYIRGYSKGHTATVSSVAVTNLKTGLRKSGVDKVEIYFNEI  145

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             PE+ I+KLIEEGTVL VAG LLIEHPLI P +K VAG TDSVMGLPK LT+KLI EVL
Sbjct  146   PEETIEKLIEEGTVLKVAGALLIEHPLILPCVKEVAGTTDSVMGLPKELTEKLIKEVL  203


 Score =   100 bits (250),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            ME     FKLILGS+S  RR++L +MGY+F  MSADIDEK+IRK+KPE+LV+ALAEAKA+
Sbjct  1    MESIHPHFKLILGSSSIARRKILTDMGYQFTLMSADIDEKSIRKDKPEELVLALAEAKAD  60

Query  237  AIIPRLNIDESMEDAEPMLLITCDQV  314
            AI+ +L+ +   E+ +P +LI  D V
Sbjct  61   AIVSKLHTECEDEEQQPTILIASDTV  86



>gb|AAM13078.1| unknown protein [Arabidopsis thaliana]
 gb|AAM91161.1| unknown protein [Arabidopsis thaliana]
Length=123

 Score =   165 bits (417),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +3

Query  762   LEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFH  941
             ++VVVYE  +REKP + EEARE+I+ YS G  AT+SSV VTNLKTG ++G +D+VEIYF+
Sbjct  1     MKVVVYEDAVREKPSSVEEAREYIRGYSKGHTATVSSVAVTNLKTGVRKGGVDRVEIYFN  60

Query  942   EIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             EIPE+ I+KLIEEG VL VAG LLIEHPLI P +K V G TDSVMGLPK LT+KLI EVL
Sbjct  61    EIPEETIEKLIEEGMVLKVAGALLIEHPLILPCVKEVVGTTDSVMGLPKELTEKLIKEVL  120



>ref|XP_010494226.1| PREDICTED: maf-like protein DDB_G0281937 isoform X1 [Camelina 
sativa]
 ref|XP_010494230.1| PREDICTED: maf-like protein DDB_G0281937 isoform X1 [Camelina 
sativa]
Length=235

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYE  +REKP + EEARE+I+ YS G  AT+SSV VTNLKTG ++  +DKVEIYF+E
Sbjct  112   QVVVYEDTVREKPSSVEEAREYIRGYSKGHTATVSSVAVTNLKTGLRKSGVDKVEIYFNE  171

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IPE+ I+KLIEEGTVL VAG LLIEHPLI P +K VAG TDSVMGLPK LT+KLI EVL
Sbjct  172   IPEETIEKLIEEGTVLKVAGALLIEHPLILPCVKEVAGTTDSVMGLPKELTEKLIKEVL  230


 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            ME     FKLILGS+S  RR++L +MGY+F  MSADIDEK+IRK+KPE+LV+ALAEAKA+
Sbjct  1    MESIHPHFKLILGSSSIARRKILTDMGYQFTLMSADIDEKSIRKDKPEELVLALAEAKAD  60

Query  237  AIIPRLNIDESMEDAEPMLLITCDQVHNI  323
            AI+ +L+ +   E+ +P +LI  D    I
Sbjct  61   AIVSKLHTECEDEEQQPTILIASDTAEAI  89



>ref|XP_010494227.1| PREDICTED: maf-like protein DDB_G0281937 isoform X2 [Camelina 
sativa]
 ref|XP_010494231.1| PREDICTED: maf-like protein DDB_G0281937 isoform X2 [Camelina 
sativa]
Length=208

 Score =   167 bits (424),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYE  +REKP + EEARE+I+ YS G  AT+SSV VTNLKTG ++  +DKVEIYF+E
Sbjct  85    QVVVYEDTVREKPSSVEEAREYIRGYSKGHTATVSSVAVTNLKTGLRKSGVDKVEIYFNE  144

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IPE+ I+KLIEEGTVL VAG LLIEHPLI P +K VAG TDSVMGLPK LT+KLI EVL
Sbjct  145   IPEETIEKLIEEGTVLKVAGALLIEHPLILPCVKEVAGTTDSVMGLPKELTEKLIKEVL  203


 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            ME     FKLILGS+S  RR++L +MGY+F  MSADIDEK+IRK+KPE+LV+ALAEAKAE
Sbjct  1    MESIHPHFKLILGSSSIARRKILTDMGYQFTLMSADIDEKSIRKDKPEELVLALAEAKAE  60

Query  237  AIIPRLNIDESMEDAEPMLLITCDQV  314
            AI+ R+   +++E+ +  LLITCDQV
Sbjct  61   AIMQRIPDGDNIEEDKSTLLITCDQV  86



>ref|XP_008790384.1| PREDICTED: maf-like protein DDB_G0281937 [Phoenix dactylifera]
Length=205

 Score =   167 bits (424),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVV+ GMIREKP   EEAREFIK YS G A+T+ SVLVTNLKTG ++G  DK E+YFH+
Sbjct  86    QVVVHGGMIREKPSGAEEAREFIKGYSGGHASTVGSVLVTNLKTGARKGGWDKAEVYFHK  145

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IPE+VI+ LI+EG VLYVAGGL++E+PL  P+++ + G  DS+MGLPKALT+KLI E L
Sbjct  146   IPEEVIESLIKEGDVLYVAGGLMVENPLTSPFVEAIVGTIDSIMGLPKALTEKLIQEAL  204


 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 65/80 (81%), Gaps = 1/80 (1%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLN  257
            FK+ILGS+SA RR++LAEMGY+F  M ADIDEK IR+EKPE+LVMALAEAKA+AI+ RL 
Sbjct  8    FKVILGSSSASRRRILAEMGYKFTVMGADIDEKEIRREKPEELVMALAEAKADAIVTRLR  67

Query  258  IDESMED-AEPMLLITCDQV  314
             +   ED  +P LLIT DQV
Sbjct  68   SNGFKEDHTDPTLLITADQV  87



>ref|XP_009364904.1| PREDICTED: maf-like protein DDB_G0281937 isoform X2 [Pyrus x 
bretschneideri]
Length=204

 Score =   167 bits (422),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 98/118 (83%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVVYEG+IREKP +KEEAR+F+KDYS G AAT+ SV VTNLKTG  +GE D+ E+YFH+I
Sbjct  87    VVVYEGVIREKPSSKEEARQFLKDYSGGHAATVGSVHVTNLKTGFSKGEWDRAEVYFHKI  146

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             P++VI+KLIEEG VL VAGGL+ EHPL+ P++K V G TDSVMGLP  LT++L+ E +
Sbjct  147   PDEVIEKLIEEGIVLEVAGGLITEHPLLLPFVKEVVGTTDSVMGLPIDLTRRLLKEAV  204


 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 69/87 (79%), Gaps = 1/87 (1%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            ME ++  FK+ILGSAS  RR++LAEMGYEF  M+ADIDEK+IR EKPE+LV+ LA+AKA+
Sbjct  1    MEADSSSFKIILGSASIARRKILAEMGYEFTVMTADIDEKSIRAEKPEELVLVLAKAKAD  60

Query  237  AIIPRL-NIDESMEDAEPMLLITCDQV  314
            AI+ +L +I+   +DAEP ++I  D V
Sbjct  61   AIVSKLQSINNHEKDAEPTIVIAADTV  87



>ref|XP_009364896.1| PREDICTED: maf-like protein DDB_G0281937 isoform X1 [Pyrus x 
bretschneideri]
Length=231

 Score =   167 bits (424),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYEG+IREKP +KEEAR+F+KDYS G AAT+ SV VTNLKTG  +GE D+ E+YFH+
Sbjct  113   QVVVYEGVIREKPSSKEEARQFLKDYSGGHAATVGSVHVTNLKTGFSKGEWDRAEVYFHK  172

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP++VI+KLIEEG VL VAGGL+ EHPL+ P++K V G TDSVMGLP  LT++L+ E +
Sbjct  173   IPDEVIEKLIEEGIVLEVAGGLITEHPLLLPFVKEVVGTTDSVMGLPIDLTRRLLKEAV  231


 Score =   106 bits (264),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 70/91 (77%), Gaps = 1/91 (1%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            ME ++  FK+ILGSAS  RR++LAEMGYEF  M+ADIDEK+IR EKPE+LV+ LA+AKA+
Sbjct  1    MEADSSSFKIILGSASIARRKILAEMGYEFTVMTADIDEKSIRAEKPEELVLVLAKAKAD  60

Query  237  AIIPRL-NIDESMEDAEPMLLITCDQVHNIS  326
            AI+ +L +I+   +DAEP ++I  D    IS
Sbjct  61   AIVSKLQSINNHEKDAEPTIVIAADTAEAIS  91



>ref|XP_010481945.1| PREDICTED: maf-like protein DDB_G0281937 isoform X1 [Camelina 
sativa]
Length=235

 Score =   167 bits (424),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYE  +REKP + EEARE+I+ YS G  AT+SSV VTNLKTG ++  +D+VEIYF+E
Sbjct  112   QVVVYEDAVREKPSSVEEAREYIRGYSKGHTATVSSVAVTNLKTGLRKSGVDRVEIYFNE  171

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IPE+ I+KLIEEGTVL VAG LLIEHPLI P +K VAG TDSVMGLPK LT+KLI EVL
Sbjct  172   IPEETIEKLIEEGTVLKVAGALLIEHPLILPCVKEVAGTTDSVMGLPKELTEKLIKEVL  230


 Score = 98.6 bits (244),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 65/89 (73%), Gaps = 0/89 (0%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            ME     FKLILGS+S  RR++L +MGY+F  MSADIDEK IRK+KPE+LV+ALAEAKA+
Sbjct  1    MESIHPHFKLILGSSSIARRKILTDMGYQFTLMSADIDEKNIRKDKPEELVLALAEAKAD  60

Query  237  AIIPRLNIDESMEDAEPMLLITCDQVHNI  323
            AI+ +L+ +   E+ +P +LI  D    I
Sbjct  61   AIVSKLHTECEDEEQQPTILIASDTAEAI  89



>ref|XP_010481947.1| PREDICTED: maf-like protein DDB_G0281937 isoform X3 [Camelina 
sativa]
Length=208

 Score =   166 bits (421),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVVYE  +REKP + EEARE+I+ YS G  AT+SSV VTNLKTG ++  +D+VEIYF+EI
Sbjct  86    VVVYEDAVREKPSSVEEAREYIRGYSKGHTATVSSVAVTNLKTGLRKSGVDRVEIYFNEI  145

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             PE+ I+KLIEEGTVL VAG LLIEHPLI P +K VAG TDSVMGLPK LT+KLI EVL
Sbjct  146   PEETIEKLIEEGTVLKVAGALLIEHPLILPCVKEVAGTTDSVMGLPKELTEKLIKEVL  203


 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            ME     FKLILGS+S  RR++L +MGY+F  MSADIDEK IRK+KPE+LV+ALAEAKA+
Sbjct  1    MESIHPHFKLILGSSSIARRKILTDMGYQFTLMSADIDEKNIRKDKPEELVLALAEAKAD  60

Query  237  AIIPRLNIDESMEDAEPMLLITCDQV  314
            AI+ +L+ +   E+ +P +LI  D V
Sbjct  61   AIVSKLHTECEDEEQQPTILIASDTV  86



>ref|XP_004289141.1| PREDICTED: maf-like protein DDB_G0281937-like [Fragaria vesca 
subsp. vesca]
Length=199

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 94/118 (80%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVVYEG+IREKP +KEEA EFIK YS GQA  I SVLVTNLKTGK+RG     E+YFH I
Sbjct  82    VVVYEGIIREKPSSKEEAWEFIKGYSGGQAGVIGSVLVTNLKTGKRRGGWRSAEVYFHVI  141

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             P+++I  LIEEGT L VAGGL++EHP+I P+++ V G TD+VMGLPK LT+KLI E L
Sbjct  142   PDEIIGNLIEEGTTLNVAGGLMLEHPMISPFVEAVLGTTDTVMGLPKELTEKLIHEAL  199


 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 60/80 (75%), Gaps = 1/80 (1%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLN  257
            F++ILGSAS  RRQ+LA++GYEF  M+ADIDEK+IR +KPE+LVM LAEAKA+AII R+ 
Sbjct  3    FQIILGSASMARRQILADLGYEFTIMTADIDEKSIRMDKPEELVMVLAEAKADAIISRMQ  62

Query  258  IDE-SMEDAEPMLLITCDQV  314
              E      +  LLIT D V
Sbjct  63   SSELDGGGDQATLLITADTV  82



>ref|XP_010481946.1| PREDICTED: maf-like protein DDB_G0281937 isoform X2 [Camelina 
sativa]
Length=208

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYE  +REKP + EEARE+I+ YS G  AT+SSV VTNLKTG ++  +D+VEIYF+E
Sbjct  85    QVVVYEDAVREKPSSVEEAREYIRGYSKGHTATVSSVAVTNLKTGLRKSGVDRVEIYFNE  144

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IPE+ I+KLIEEGTVL VAG LLIEHPLI P +K VAG TDSVMGLPK LT+KLI EVL
Sbjct  145   IPEETIEKLIEEGTVLKVAGALLIEHPLILPCVKEVAGTTDSVMGLPKELTEKLIKEVL  203


 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            ME     FKLILGS+S  RR++L +MGY+F  MSADIDEK IRK+KPE+LV+ALAEAKAE
Sbjct  1    MESIHPHFKLILGSSSIARRKILTDMGYQFTLMSADIDEKNIRKDKPEELVLALAEAKAE  60

Query  237  AIIPRLNIDESMEDAEPMLLITCDQV  314
            AI+ R+    S+E+ +  LLITCDQV
Sbjct  61   AIMQRIPDGGSLEEDKSTLLITCDQV  86



>ref|XP_006403352.1| hypothetical protein EUTSA_v10003272mg [Eutrema salsugineum]
 gb|ESQ44805.1| hypothetical protein EUTSA_v10003272mg [Eutrema salsugineum]
Length=207

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYE  IREKP + EEARE+I+ YS G  AT+SSV+VTNLKTG ++G +D+VEIYF+E
Sbjct  86    QVVVYEDTIREKPSSVEEAREYIRGYSKGHTATVSSVVVTNLKTGFRKGGVDRVEIYFNE  145

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IPE++IDKLIE+G VL VAG L+IEHPLI P +K V G TDSVMGLPK LT+KL+ EVL
Sbjct  146   IPEEIIDKLIEDGMVLKVAGALVIEHPLILPCVKEVVGTTDSVMGLPKELTEKLLKEVL  204


 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 72/87 (83%), Gaps = 1/87 (1%)
 Frame = +3

Query  57   MEGNTWP-FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKA  233
            ME N  P FKLILGSAS  RR+VL++MGY+F  MSADIDEK+IR EKPEDLV+ALAEAKA
Sbjct  1    MESNLLPHFKLILGSASIARRKVLSDMGYQFTLMSADIDEKSIRMEKPEDLVLALAEAKA  60

Query  234  EAIIPRLNIDESMEDAEPMLLITCDQV  314
            EAI+ R+  D+S+++ +  LL+TCDQV
Sbjct  61   EAIMQRIPDDDSIQEDKSTLLVTCDQV  87



>ref|XP_010442121.1| PREDICTED: maf-like protein DDB_G0281937 isoform X2 [Camelina 
sativa]
Length=183

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYE  +REKP + EEARE+I+ YS G  AT+SSV VTNLKTG ++  +D+VE YF+E
Sbjct  60    QVVVYEDAVREKPSSVEEAREYIRGYSKGHTATVSSVAVTNLKTGLRKSGVDRVETYFNE  119

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IPE+ I+KLIEEGTVL VAG LLIEHPLI P +K VAG TDSVMGLPK LT+KLI EVL
Sbjct  120   IPEETIEKLIEEGTVLKVAGALLIEHPLILPCVKEVAGTTDSVMGLPKELTEKLIKEVL  178


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +3

Query  132  MGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLNIDESMEDAEPMLLITCDQ  311
            MGY+F  MSADIDEK+IRK+KPE+LV+ALAEAKAEAI+ R+   +++E+ +  LLITCDQ
Sbjct  1    MGYQFTLMSADIDEKSIRKDKPEELVLALAEAKAEAIMRRIPDGDNIEEDKSTLLITCDQ  60

Query  312  V  314
            V
Sbjct  61   V  61



>dbj|BAB10633.1| unnamed protein product [Arabidopsis thaliana]
Length=208

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYE  +REKP + EEARE+I+ YS G  AT+SSV VTNLKTG ++G +D+VEIYF+E
Sbjct  87    QVVVYEDAVREKPSSVEEAREYIRGYSKGHTATVSSVAVTNLKTGVRKGGVDRVEIYFNE  146

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IPE+ I+KLIEEG VL VAG LLIEHPLI P +K V G TDSVMGLPK LT+KLI EVL
Sbjct  147   IPEETIEKLIEEGMVLKVAGALLIEHPLILPCVKEVVGTTDSVMGLPKELTEKLIKEVL  205


 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = +3

Query  132  MGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLNIDESMEDAEPMLLITCDQ  311
            MGY+F  MSADIDEK+IRKEKPE+LV+ALAEAKA+AI+ +L I E  ++ +P +LI  D 
Sbjct  1    MGYQFTLMSADIDEKSIRKEKPEELVLALAEAKADAIVSKLQISECEDEEQPRVLIASDT  60

Query  312  VHNI  323
               I
Sbjct  61   AEAI  64



>gb|EYU32779.1| hypothetical protein MIMGU_mgv1a013118mg [Erythranthe guttata]
Length=206

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVVYEG+IREKP NKEEAR+F+KDYS G AAT+SSVLVTNLKTG K+GE DKVEI+FH+I
Sbjct  89    VVVYEGVIREKPSNKEEARQFLKDYSGGHAATVSSVLVTNLKTGLKKGEWDKVEIHFHDI  148

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             PE++I+ LIEEG VL VAGGL+IEHPL+ PY+K+V G TDSVMGLPKALT++L+ EVL
Sbjct  149   PEEIIESLIEEGIVLNVAGGLIIEHPLVLPYVKQVVGGTDSVMGLPKALTRRLMNEVL  206


 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 62/80 (78%), Gaps = 1/80 (1%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRL-  254
            FK+ILGS+S  R+Q+L+ MG++F TM ADIDEKAIRKEKPEDLVMALAEAKA+AI+ +L 
Sbjct  10   FKIILGSSSIARKQILSHMGFQFTTMYADIDEKAIRKEKPEDLVMALAEAKADAIVGKLQ  69

Query  255  NIDESMEDAEPMLLITCDQV  314
            NI     D +  L+I  D V
Sbjct  70   NIKNQETDGKSTLVIAADTV  89



>gb|EYU32778.1| hypothetical protein MIMGU_mgv1a013118mg [Erythranthe guttata]
Length=230

 Score =   166 bits (419),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYEG+IREKP NKEEAR+F+KDYS G AAT+SSVLVTNLKTG K+GE DKVEI+FH+
Sbjct  112   QVVVYEGVIREKPSNKEEARQFLKDYSGGHAATVSSVLVTNLKTGLKKGEWDKVEIHFHD  171

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IPE++I+ LIEEG VL VAGGL+IEHPL+ PY+K+V G TDSVMGLPKALT++L+ EVL
Sbjct  172   IPEEIIESLIEEGIVLNVAGGLIIEHPLVLPYVKQVVGGTDSVMGLPKALTRRLMNEVL  230


 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 70/104 (67%), Gaps = 25/104 (24%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRL-  254
            FK+ILGS+S  R+Q+L+ MG++F TM ADIDEKAIRKEKPEDLVMALAEAKA+AI+ +L 
Sbjct  10   FKIILGSSSIARKQILSHMGFQFTTMYADIDEKAIRKEKPEDLVMALAEAKADAIVGKLQ  69

Query  255  ---------------------NIDESM---EDAEPMLLITCDQV  314
                                 N++  +   EDAEP LLITCDQV
Sbjct  70   NIKNQETDGKSTLVIAADTVENVEPKLHGSEDAEPTLLITCDQV  113



>gb|KFK31818.1| hypothetical protein AALP_AA6G162400 [Arabis alpina]
Length=206

 Score =   165 bits (417),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVV+E  +REKP + EEARE+I+ YS G  AT+SSV+VTNLKTG ++G +D+VEIYFHE
Sbjct  85    QVVVFEDAVREKPSSVEEAREYIRGYSKGHTATVSSVVVTNLKTGFRKGGVDRVEIYFHE  144

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP+++I+KLIEEG VL VAG L+IEHPLI P +K V G TDSVMGLPK LT+KLI EVL
Sbjct  145   IPDEIIEKLIEEGMVLKVAGALVIEHPLILPLVKEVIGTTDSVMGLPKELTEKLIKEVL  203


 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            ME N   FKLILGS+S  RR++L +MGY+F  MSADIDEK+IRKEKPE+LV+ALAEAKAE
Sbjct  1    MESNRSHFKLILGSSSIARRKILGDMGYQFTLMSADIDEKSIRKEKPEELVLALAEAKAE  60

Query  237  AIIPRLNIDESMEDAEPMLLITCDQV  314
            AI+ R+ +D+++E+ +  LL+TCDQV
Sbjct  61   AIMKRIPVDDNIEEDKSTLLVTCDQV  86



>ref|NP_001190455.1| Maf-like protein [Arabidopsis thaliana]
 gb|AED94861.1| Maf-like protein [Arabidopsis thaliana]
Length=233

 Score =   166 bits (419),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYE  +REKP + EEARE+I+ YS G  AT+SSV VTNLKTG ++G +D+VEIYF+E
Sbjct  112   QVVVYEDAVREKPSSVEEAREYIRGYSKGHTATVSSVAVTNLKTGVRKGGVDRVEIYFNE  171

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IPE+ I+KLIEEG VL VAG LLIEHPLI P +K V G TDSVMGLPK LT+KLI EVL
Sbjct  172   IPEETIEKLIEEGMVLKVAGALLIEHPLILPCVKEVVGTTDSVMGLPKELTEKLIKEVL  230


 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 67/89 (75%), Gaps = 0/89 (0%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            ME N   FKLILGS+S  RR++L +MGY+F  MSADIDEK+IRKEKPE+LV+ALAEAKA+
Sbjct  1    MESNHPHFKLILGSSSIARRKILTDMGYQFTLMSADIDEKSIRKEKPEELVLALAEAKAD  60

Query  237  AIIPRLNIDESMEDAEPMLLITCDQVHNI  323
            AI+ +L I E  ++ +P +LI  D    I
Sbjct  61   AIVSKLQISECEDEEQPRVLIASDTAEAI  89



>ref|XP_010442120.1| PREDICTED: maf-like protein DDB_G0281937 isoform X1 [Camelina 
sativa]
Length=208

 Score =   165 bits (417),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYE  +REKP + EEARE+I+ YS G  AT+SSV VTNLKTG ++  +D+VE YF+E
Sbjct  85    QVVVYEDAVREKPSSVEEAREYIRGYSKGHTATVSSVAVTNLKTGLRKSGVDRVETYFNE  144

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IPE+ I+KLIEEGTVL VAG LLIEHPLI P +K VAG TDSVMGLPK LT+KLI EVL
Sbjct  145   IPEETIEKLIEEGTVLKVAGALLIEHPLILPCVKEVAGTTDSVMGLPKELTEKLIKEVL  203


 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            ME     FKLILGS+S  RR++L +MGY+F  MSADIDEK+IRK+KPE+LV+ALAEAKAE
Sbjct  1    MESIHPHFKLILGSSSIARRKILTDMGYQFTLMSADIDEKSIRKDKPEELVLALAEAKAE  60

Query  237  AIIPRLNIDESMEDAEPMLLITCDQV  314
            AI+ R+   +++E+ +  LLITCDQV
Sbjct  61   AIMRRIPDGDNIEEDKSTLLITCDQV  86



>gb|KFK31817.1| hypothetical protein AALP_AA6G162400 [Arabis alpina]
Length=233

 Score =   166 bits (419),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVV+E  +REKP + EEARE+I+ YS G  AT+SSV+VTNLKTG ++G +D+VEIYFHE
Sbjct  112   QVVVFEDAVREKPSSVEEAREYIRGYSKGHTATVSSVVVTNLKTGFRKGGVDRVEIYFHE  171

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP+++I+KLIEEG VL VAG L+IEHPLI P +K V G TDSVMGLPK LT+KLI EVL
Sbjct  172   IPDEIIEKLIEEGMVLKVAGALVIEHPLILPLVKEVIGTTDSVMGLPKELTEKLIKEVL  230


 Score =   104 bits (260),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 72/113 (64%), Gaps = 27/113 (24%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            ME N   FKLILGS+S  RR++L +MGY+F  MSADIDEK+IRKEKPE+LV+ALAEAKA+
Sbjct  1    MESNRSHFKLILGSSSIARRKILGDMGYQFTLMSADIDEKSIRKEKPEELVLALAEAKAD  60

Query  237  AIIPRLN---------------------------IDESMEDAEPMLLITCDQV  314
            AI+ +L                            +D+++E+ +  LL+TCDQV
Sbjct  61   AIVSKLQTTDYEDEEESTVLIASDTAEAIMKRIPVDDNIEEDKSTLLVTCDQV  113



>ref|NP_199091.3| Maf-like protein [Arabidopsis thaliana]
 gb|AED94860.1| Maf-like protein [Arabidopsis thaliana]
Length=206

 Score =   164 bits (416),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYE  +REKP + EEARE+I+ YS G  AT+SSV VTNLKTG ++G +D+VEIYF+E
Sbjct  85    QVVVYEDAVREKPSSVEEAREYIRGYSKGHTATVSSVAVTNLKTGVRKGGVDRVEIYFNE  144

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IPE+ I+KLIEEG VL VAG LLIEHPLI P +K V G TDSVMGLPK LT+KLI EVL
Sbjct  145   IPEETIEKLIEEGMVLKVAGALLIEHPLILPCVKEVVGTTDSVMGLPKELTEKLIKEVL  203


 Score = 95.1 bits (235),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            ME N   FKLILGS+S  RR++L +MGY+F  MSADIDEK+IRKEKPE+LV+ALAEAKAE
Sbjct  1    MESNHPHFKLILGSSSIARRKILTDMGYQFTLMSADIDEKSIRKEKPEELVLALAEAKAE  60

Query  237  AIIPRLNIDESMEDAEPMLLITCDQV  314
            AI+ R+   E++E+ +  LLITCDQV
Sbjct  61   AIMQRIPDGENIEEDKSTLLITCDQV  86



>ref|XP_002865485.1| hypothetical protein ARALYDRAFT_331123 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41744.1| hypothetical protein ARALYDRAFT_331123 [Arabidopsis lyrata subsp. 
lyrata]
Length=206

 Score =   164 bits (416),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYE  +REKP + EEARE+I+ YS G  AT+SSV VTNLKTG ++G +D+VEIYF+E
Sbjct  85    QVVVYEDAVREKPSSVEEAREYIRGYSKGHTATVSSVAVTNLKTGVRKGGVDRVEIYFNE  144

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IPE+ I+KLIEEG VL VAG LLIEHPLI P +K V G TDSVMGLPK LT+KL+ EVL
Sbjct  145   IPEETIEKLIEEGMVLKVAGALLIEHPLILPCVKEVVGTTDSVMGLPKELTEKLLKEVL  203


 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            ME N   FKLILGS+S  RRQ+L +MGY+F  MSADIDEK+IRKEKPE+LV+ALA AKAE
Sbjct  1    MESNQPHFKLILGSSSIARRQILTDMGYQFTLMSADIDEKSIRKEKPEELVLALAVAKAE  60

Query  237  AIIPRLNIDESMEDAEPMLLITCDQV  314
            AI+ ++   +++E+ +  LLITCDQV
Sbjct  61   AIMQQIADGDNIEEDKSTLLITCDQV  86



>ref|XP_007202620.1| hypothetical protein PRUPE_ppa011905mg [Prunus persica]
 gb|EMJ03819.1| hypothetical protein PRUPE_ppa011905mg [Prunus persica]
Length=191

 Score =   164 bits (414),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVVYEG+IREKP +KEEA  FIK YS GQAA I SV VTNLKTGK++G   + E+YFH I
Sbjct  71    VVVYEGIIREKPSSKEEAWNFIKGYSGGQAAVIGSVFVTNLKTGKRKGGCCRAEVYFHVI  130

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             PE++ID LIEEG  L VAGGL++EHPLI P+++ V G TD+VMGLPK  T+KLI E L
Sbjct  131   PEEIIDSLIEEGITLDVAGGLMLEHPLISPFVEAVVGTTDTVMGLPKEFTEKLIHEAL  188


 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 54/69 (78%), Gaps = 1/69 (1%)
 Frame = +3

Query  111  RRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRL-NIDESMEDAEP  287
            RR++LAEMGYEF  ++ADIDEK+IR +KPE+LVM LAEAKA+AII RL +  +  EDA  
Sbjct  3    RRKILAEMGYEFTILTADIDEKSIRMDKPEELVMVLAEAKADAIISRLQSTSQPDEDAHA  62

Query  288  MLLITCDQV  314
             LLIT D V
Sbjct  63   TLLITADTV  71



>ref|XP_010550785.1| PREDICTED: maf-like protein DDB_G0281937 [Tarenaya hassleriana]
Length=135

 Score =   162 bits (409),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 100/128 (78%), Gaps = 1/128 (1%)
 Frame = +3

Query  738   FLTAKLKLLEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGEL  917
             F+ +++ L+ VVVY+G+IREKP +KEEAREFIK YS    + + SVLVTNLKTG ++G  
Sbjct  9     FVHSRVSLM-VVVYKGVIREKPSSKEEAREFIKGYSGSHGSVVGSVLVTNLKTGVRKGGW  67

Query  918   DKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALT  1097
             DK E+YFHEIP+ VID LIEEG  L VAGGL++EHPL  P+++ V GA D+VMGLPK LT
Sbjct  68    DKAEVYFHEIPDKVIDDLIEEGITLNVAGGLMLEHPLTLPFVETVVGAADTVMGLPKTLT  127

Query  1098  QKLITEVL  1121
             ++ I +VL
Sbjct  128   EEFIKDVL  135



>ref|XP_009336226.1| PREDICTED: maf-like protein DDB_G0281937 isoform X2 [Pyrus x 
bretschneideri]
Length=204

 Score =   164 bits (415),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVVYE +IREKP +KEEAR+F+KDYS G AAT+ SV VTNLKTG  +GE D+ E+YFH+I
Sbjct  87    VVVYEDVIREKPSSKEEARQFLKDYSGGHAATVGSVHVTNLKTGFSKGEWDRAEVYFHKI  146

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             P++VI+KLIEEG VL VAGGL+ EHPL+ P++K V G TDSVMGLP  LT++L+ E +
Sbjct  147   PDEVIEKLIEEGIVLEVAGGLITEHPLLLPFVKEVVGTTDSVMGLPIDLTRRLLKEAV  204


 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 69/87 (79%), Gaps = 1/87 (1%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            ME ++  FK+ILGSAS  RR++LAEMGYEF  M+ADIDEK+IR EKPE+LV+ LA+AKA+
Sbjct  1    MEADSSSFKIILGSASIARRKILAEMGYEFTVMTADIDEKSIRTEKPEELVLVLAKAKAD  60

Query  237  AIIPRL-NIDESMEDAEPMLLITCDQV  314
            AI+ +L +I+   +DAEP ++I  D V
Sbjct  61   AIVSKLQSINNHEKDAEPTIVIAADTV  87



>ref|XP_008241678.1| PREDICTED: maf-like protein DDB_G0281937 isoform X1 [Prunus mume]
Length=202

 Score =   164 bits (414),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVVYEG+ REKP +KEEA  FIK YS GQAA I SV VTNLKTGK++G   + E+YFH I
Sbjct  82    VVVYEGITREKPSSKEEAWNFIKGYSGGQAAVIGSVFVTNLKTGKRKGGCCRAEVYFHII  141

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             PE++ID LIEEG  L VAGGL++EHPLI P+++ V G TD+VMGLPK LT+KLI E L
Sbjct  142   PEEIIDSLIEEGITLDVAGGLMLEHPLISPFVEAVVGTTDTVMGLPKELTEKLIHEAL  199


 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 63/80 (79%), Gaps = 1/80 (1%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRL-  254
            F++ILGSAS  RR++LAEMGYEF  M+ADIDEK+IR +KPE+LVM LAEAKA+AII RL 
Sbjct  3    FQIILGSASMARRKILAEMGYEFTIMTADIDEKSIRMDKPEELVMVLAEAKADAIISRLQ  62

Query  255  NIDESMEDAEPMLLITCDQV  314
            +  +  EDA   LLIT D V
Sbjct  63   STSQPDEDAHATLLITADTV  82



>ref|XP_009336218.1| PREDICTED: maf-like protein DDB_G0281937 isoform X1 [Pyrus x 
bretschneideri]
Length=231

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYE +IREKP +KEEAR+F+KDYS G AAT+ SV VTNLKTG  +GE D+ E+YFH+
Sbjct  113   QVVVYEDVIREKPSSKEEARQFLKDYSGGHAATVGSVHVTNLKTGFSKGEWDRAEVYFHK  172

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP++VI+KLIEEG VL VAGGL+ EHPL+ P++K V G TDSVMGLP  LT++L+ E +
Sbjct  173   IPDEVIEKLIEEGIVLEVAGGLITEHPLLLPFVKEVVGTTDSVMGLPIDLTRRLLKEAV  231


 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 70/91 (77%), Gaps = 1/91 (1%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            ME ++  FK+ILGSAS  RR++LAEMGYEF  M+ADIDEK+IR EKPE+LV+ LA+AKA+
Sbjct  1    MEADSSSFKIILGSASIARRKILAEMGYEFTVMTADIDEKSIRTEKPEELVLVLAKAKAD  60

Query  237  AIIPRL-NIDESMEDAEPMLLITCDQVHNIS  326
            AI+ +L +I+   +DAEP ++I  D    IS
Sbjct  61   AIVSKLQSINNHEKDAEPTIVIAADTAEAIS  91



>ref|XP_009101837.1| PREDICTED: maf-like protein DDB_G0281937 isoform X4 [Brassica 
rapa]
Length=179

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYE  +REKP +  EARE+I+ YS G  AT+SSV+VTNL TG ++G +D+VEIYF+E
Sbjct  58    QVVVYEDAVREKPSSVVEAREYIRSYSKGHTATVSSVVVTNLNTGFRKGGVDRVEIYFNE  117

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             I E++IDKLIEEG VL VAG LLIEHPLI P IK+V G TDSVMGLPK LT+KL+ EVL
Sbjct  118   ISEEIIDKLIEEGMVLRVAGALLIEHPLILPCIKQVVGTTDSVMGLPKELTEKLLKEVL  176



>ref|XP_009101835.1| PREDICTED: maf-like protein DDB_G0281937 isoform X2 [Brassica 
rapa]
Length=202

 Score =   162 bits (410),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYE  +REKP +  EARE+I+ YS G  AT+SSV+VTNL TG ++G +D+VEIYF+E
Sbjct  81    QVVVYEDAVREKPSSVVEAREYIRSYSKGHTATVSSVVVTNLNTGFRKGGVDRVEIYFNE  140

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             I E++IDKLIEEG VL VAG LLIEHPLI P IK+V G TDSVMGLPK LT+KL+ EVL
Sbjct  141   ISEEIIDKLIEEGMVLRVAGALLIEHPLILPCIKQVVGTTDSVMGLPKELTEKLLKEVL  199


 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 68/87 (78%), Gaps = 6/87 (7%)
 Frame = +3

Query  57   MEGNTWP-FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKA  233
            ME +  P FK+ILGS+S  RR +L +MGY+F  MSADIDEK+IRKEKPE+LV+ALAE  A
Sbjct  1    MESDRPPHFKVILGSSSIARRSILTDMGYQFTLMSADIDEKSIRKEKPEELVLALAE--A  58

Query  234  EAIIPRLNIDESMEDAEPMLLITCDQV  314
            EAI+ R  I + +ED +P LL+TCDQV
Sbjct  59   EAIVQR--IPDDVED-KPTLLVTCDQV  82



>ref|XP_008354663.1| PREDICTED: maf-like protein DDB_G0281937 [Malus domestica]
Length=199

 Score =   162 bits (409),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVVYEG++REKP +KEEA  FIK YS GQA  I SVLVTNLKTGK++G   + E+YFH I
Sbjct  82    VVVYEGIVREKPSSKEEAWNFIKGYSGGQAEVIGSVLVTNLKTGKRKGSWRRAEVYFHVI  141

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             PE+VI  LIEEG  L VAGGL++EHPLI P+++ V G TD+VMGLPK LT+KLI E +
Sbjct  142   PEEVIHSLIEEGITLNVAGGLMLEHPLISPFVEAVIGTTDTVMGLPKELTEKLIQEAV  199


 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 64/80 (80%), Gaps = 1/80 (1%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLN  257
            F++ILGSASA RRQ+LAEMGY F  M+ADIDEK+IR +KPE+LVM LAEAKA+AII RL 
Sbjct  3    FQIILGSASAARRQILAEMGYRFTVMTADIDEKSIRMDKPEELVMVLAEAKADAIISRLQ  62

Query  258  IDESME-DAEPMLLITCDQV  314
             D+ ++ DA   LL+T D V
Sbjct  63   SDKQLDGDAPATLLVTADTV  82



>ref|XP_009101834.1| PREDICTED: maf-like protein DDB_G0281937 isoform X1 [Brassica 
rapa]
Length=204

 Score =   162 bits (409),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYE  +REKP +  EARE+I+ YS G  AT+SSV+VTNL TG ++G +D+VEIYF+E
Sbjct  83    QVVVYEDAVREKPSSVVEAREYIRSYSKGHTATVSSVVVTNLNTGFRKGGVDRVEIYFNE  142

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             I E++IDKLIEEG VL VAG LLIEHPLI P IK+V G TDSVMGLPK LT+KL+ EVL
Sbjct  143   ISEEIIDKLIEEGMVLRVAGALLIEHPLILPCIKQVVGTTDSVMGLPKELTEKLLKEVL  201


 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 70/87 (80%), Gaps = 4/87 (5%)
 Frame = +3

Query  57   MEGNTWP-FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKA  233
            ME +  P FK+ILGS+S  RR +L +MGY+F  MSADIDEK+IRKEKPE+LV+ALAEAKA
Sbjct  1    MESDRPPHFKVILGSSSIARRSILTDMGYQFTLMSADIDEKSIRKEKPEELVLALAEAKA  60

Query  234  EAIIPRLNIDESMEDAEPMLLITCDQV  314
            EAI+ R  I + +ED +P LL+TCDQV
Sbjct  61   EAIVQR--IPDDVED-KPTLLVTCDQV  84



>ref|XP_004985115.1| PREDICTED: maf-like protein DDB_G0281937-like isoform X2 [Setaria 
italica]
Length=209

 Score =   161 bits (408),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 94/119 (79%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVV++G+IREKP   EEAR+FIK YS   AATI SVLVTN+KTG +R   DK E+YFH+
Sbjct  88    QVVVHDGVIREKPSTPEEARKFIKGYSESHAATIGSVLVTNVKTGARREGWDKAEVYFHK  147

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP++V++ LIEEG V YVAGGLL+EHPL  P ++ + G  DSVMGLPKALT+KLI E L
Sbjct  148   IPDEVVESLIEEGNVFYVAGGLLVEHPLTSPLVEAIVGTIDSVMGLPKALTEKLIKESL  206


 Score = 94.7 bits (234),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 64/83 (77%), Gaps = 4/83 (5%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLN  257
             +LILGS+SA RRQ+L+EMGY+F  +SADIDEK IRKEKPE+LV+ALA AKA+AI+ ++ 
Sbjct  7    LRLILGSSSASRRQILSEMGYKFTLLSADIDEKEIRKEKPEELVVALAHAKADAILEKMK  66

Query  258  ----IDESMEDAEPMLLITCDQV  314
                + E ++  E  L+IT DQV
Sbjct  67   NNGMMKEIVDSQETTLMITADQV  89



>ref|XP_009347538.1| PREDICTED: maf-like protein DDB_G0281937 [Pyrus x bretschneideri]
Length=204

 Score =   161 bits (407),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVVYEG++REKP +KEEA  FIK YS GQA  I SVLVTNLKTGK++G   + E+YFH I
Sbjct  87    VVVYEGIVREKPSSKEEAWNFIKGYSGGQAEVIGSVLVTNLKTGKRKGGWRRAEVYFHVI  146

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             PE+VI  LIEEG  L VAGGL++EHPLI P+++ V G TD+VMGLPK LT+KLI E +
Sbjct  147   PEEVIHSLIEEGITLNVAGGLMLEHPLISPFVEAVIGTTDTVMGLPKELTEKLIQEAV  204


 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 65/87 (75%), Gaps = 1/87 (1%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            M+     F++ILGSASA RRQ+LAEMG+ F  M+ADIDEK+IR +KPE+LVM LAEAKA+
Sbjct  1    MQTTNMSFQIILGSASAARRQILAEMGHRFTVMTADIDEKSIRMDKPEELVMVLAEAKAD  60

Query  237  AIIPRLNIDESME-DAEPMLLITCDQV  314
            AII RL  D  ++ DA   LL+T D V
Sbjct  61   AIISRLQSDRQLDGDAPATLLVTADTV  87



>ref|XP_009340747.1| PREDICTED: maf-like protein DDB_G0281937 [Pyrus x bretschneideri]
Length=199

 Score =   161 bits (407),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVVYEG++REKP +KEEA  FIK YS GQA  I SVLVTNLKTGK++G   + E+YFH I
Sbjct  82    VVVYEGIVREKPSSKEEAWNFIKGYSGGQAEVIGSVLVTNLKTGKRKGGWRRAEVYFHVI  141

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             PE+VI  LIEEG  L VAGGL++EHPLI P+++ V G TD+VMGLPK LT+KLI E +
Sbjct  142   PEEVIHSLIEEGITLNVAGGLMLEHPLISPFVEAVIGTTDTVMGLPKELTEKLIQEAV  199


 Score =   102 bits (255),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 63/80 (79%), Gaps = 1/80 (1%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLN  257
            F++ILGSASA RRQ+LAEMG+ F  M+ADIDEK+IR +KPE+LVM LAEAKA+AII RL 
Sbjct  3    FQIILGSASAARRQILAEMGHRFTVMTADIDEKSIRMDKPEELVMVLAEAKADAIISRLQ  62

Query  258  IDESME-DAEPMLLITCDQV  314
             D  ++ DA   LL+T D V
Sbjct  63   SDRQLDGDAPATLLVTADTV  82



>ref|XP_002468218.1| hypothetical protein SORBIDRAFT_01g041990 [Sorghum bicolor]
 gb|EER95216.1| hypothetical protein SORBIDRAFT_01g041990 [Sorghum bicolor]
Length=211

 Score =   161 bits (408),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 94/119 (79%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VV+++G+IREKP   EEAR+FIK YS   AATI SVLVTN+KTG +R   DK E+YFH+
Sbjct  90    QVVIHDGVIREKPSTPEEARKFIKGYSESHAATIGSVLVTNVKTGARREGWDKAEVYFHK  149

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP++V++ LIEEG V YVAGGLL+EHPL  P ++ + G  DSVMGLPKALT+KLI E L
Sbjct  150   IPDEVVESLIEEGNVFYVAGGLLVEHPLTSPLVEAIVGTIDSVMGLPKALTEKLIKESL  208


 Score = 97.4 bits (241),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 65/83 (78%), Gaps = 4/83 (5%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLN  257
             +LILGS+SA RRQ+L+EMGY+F  +SADIDEKAIRKEKPE+LV+ALA AKA+AI+ ++ 
Sbjct  9    LRLILGSSSASRRQILSEMGYKFTLLSADIDEKAIRKEKPEELVVALAHAKADAILEKMQ  68

Query  258  ----IDESMEDAEPMLLITCDQV  314
                + E ++  E  L+IT DQV
Sbjct  69   NNGMMKEIVDSQETTLMITADQV  91



>ref|XP_002527711.1| maf protein, putative [Ricinus communis]
 gb|EEF34670.1| maf protein, putative [Ricinus communis]
Length=203

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVVY+GM+REKP +KEEAR FIK YS   AA + SVLVTNL TGK++G  ++ E+YFH+I
Sbjct  86    VVVYKGMVREKPTSKEEARYFIKGYSGSHAAVVGSVLVTNLATGKRKGAWERAEVYFHDI  145

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             P+++ID LIEE     VAGGL++EHPL  PY++ V G+ D+VMGL KALT+KLI EVL
Sbjct  146   PDEIIDNLIEERVTFNVAGGLMLEHPLTSPYVEAVVGSADTVMGLSKALTEKLIAEVL  203


 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 59/79 (75%), Gaps = 0/79 (0%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLN  257
            FK+ILGS+S  R+++L+EMGYEF  M+ADIDEK+IRK  PE+LVMALA+AKA+A     N
Sbjct  8    FKIILGSSSMARKRILSEMGYEFSIMTADIDEKSIRKATPEELVMALAQAKADAXSRLRN  67

Query  258  IDESMEDAEPMLLITCDQV  314
            + +  ED    LLIT D V
Sbjct  68   MGKLEEDTHATLLITADTV  86



>ref|XP_009392957.1| PREDICTED: maf-like protein DDB_G0281937 [Musa acuminata subsp. 
malaccensis]
Length=211

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVV+EG+IREKP + EEAR+F+K YS G  +T+ SVLVTNLKTG++ G LDK E+YFH+I
Sbjct  90    VVVHEGIIREKPSSTEEARQFLKGYSGGHVSTVGSVLVTNLKTGRRYGGLDKAEVYFHDI  149

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             P+++++ LI+EG V  VAGGLL+EHPL  P+++ V G TDSVMGL KALT+KLI E L
Sbjct  150   PDEIVENLIDEGVVFNVAGGLLLEHPLTLPFVEAVVGTTDSVMGLAKALTEKLIREAL  207


 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 65/90 (72%), Gaps = 4/90 (4%)
 Frame = +3

Query  57   MEGNTWP---FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEA  227
            M  N  P   FK+ILGS+S  RR +L+EMGY+F  M+ADIDEK+IR++ P++LVM LAEA
Sbjct  1    MAANPSPLPSFKIILGSSSVARRHILSEMGYQFEVMTADIDEKSIRRDNPDELVMVLAEA  60

Query  228  KAEAIIPRLNIDESMEDA-EPMLLITCDQV  314
            KA+AII R+  +  +E   EP LLIT D V
Sbjct  61   KADAIISRIMSEGYVERIDEPTLLITSDIV  90



>gb|ABF94775.1| Maf family protein, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAG92971.1| unnamed protein product [Oryza sativa Japonica Group]
Length=123

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = +3

Query  762   LEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFH  941
             +EVVV++G+IREKP   EEAR+FIK YS   AATI SVLVTN+K+G ++   DK E+YFH
Sbjct  1     MEVVVHDGVIREKPSTPEEARKFIKGYSESHAATIGSVLVTNVKSGARKEGWDKAEVYFH  60

Query  942   EIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             +IP++V++ LIEEG V YVAGGLL+EHPL  P ++ + G  DSVMGLPK+LT+KLI E L
Sbjct  61    KIPDEVVESLIEEGDVFYVAGGLLVEHPLTSPLVEAIVGTIDSVMGLPKSLTEKLIKESL  120



>gb|ACF84159.1| unknown [Zea mays]
Length=145

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 93/119 (78%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VV+++G+IREKP   EEAR+FIK YS   AATI SVLVTN+KTG +R   DK E+YFH+
Sbjct  24    QVVLHDGVIREKPSTPEEARKFIKGYSESHAATIGSVLVTNVKTGARREGWDKAEVYFHK  83

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP+ V++ LIEEG V YVAGGLL+EHPL  P ++ + G  DSVMGLPKALT+KLI E L
Sbjct  84    IPDKVVESLIEEGDVFYVAGGLLVEHPLTSPLVEAIVGTIDSVMGLPKALTEKLIKESL  142



>ref|NP_001150369.1| LOC100283999 [Zea mays]
 gb|ACG38826.1| maf-like protein CV_0124 [Zea mays]
Length=209

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 94/119 (79%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VV+++G+IREKP   EEAR+FIK YS   AATI SVLVTN+KTG +R   DK E+YFH+
Sbjct  88    QVVLHDGVIREKPSTPEEARKFIKGYSESHAATIGSVLVTNVKTGARREGWDKAEVYFHK  147

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP++V++ LIEEG V YVAGGLL+EHPL  P ++ + G  DSVMGLPKALT+KLI E L
Sbjct  148   IPDEVVESLIEEGDVFYVAGGLLVEHPLTSPLVEAIVGTIDSVMGLPKALTEKLIKESL  206


 Score = 95.1 bits (235),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 64/83 (77%), Gaps = 4/83 (5%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLN  257
             +LILGS+SA RRQ+L+EMGY+F  +SADIDEKAIRKE PE+LV+ALA AKA+AI+ ++ 
Sbjct  7    LRLILGSSSASRRQILSEMGYKFTLLSADIDEKAIRKENPEELVVALAHAKADAILEKMQ  66

Query  258  ----IDESMEDAEPMLLITCDQV  314
                + E ++  +  L+IT DQV
Sbjct  67   NNGMMKEILDSQDTTLMITADQV  89



>ref|XP_008653072.1| PREDICTED: maf-like protein DDB_G0281937 [Zea mays]
Length=209

 Score =   159 bits (402),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 93/119 (78%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VV+++G+IREKP   EEAR+FIK YS   AATI SVLVTN+KTG +R   DK E+YFH+
Sbjct  88    QVVLHDGVIREKPSTPEEARKFIKGYSESHAATIGSVLVTNVKTGARREGWDKAEVYFHK  147

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP+ V++ LIEEG V YVAGGLL+EHPL  P ++ + G  DSVMGLPKALT+KLI E L
Sbjct  148   IPDKVVESLIEEGDVFYVAGGLLVEHPLTSPLVEAIVGTIDSVMGLPKALTEKLIKESL  206


 Score = 94.7 bits (234),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 64/83 (77%), Gaps = 4/83 (5%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLN  257
             +LILGS+SA RRQ+L+EMGY+F  +SADIDEKAIRKE PE+LV+ALA AKA+AI+ ++ 
Sbjct  7    LRLILGSSSASRRQILSEMGYKFTLISADIDEKAIRKENPEELVVALAHAKADAILEKMQ  66

Query  258  ----IDESMEDAEPMLLITCDQV  314
                + E ++  +  L+IT DQV
Sbjct  67   NNGMMKEILDSQDTTLMITADQV  89



>gb|ADE75962.1| unknown [Picea sitchensis]
Length=203

 Score =   159 bits (402),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 99/130 (76%), Gaps = 4/130 (3%)
 Frame = +3

Query  732   LMFLTAKLKLLEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRG  911
             L+ +TA     +VVV+EG+IREKP ++EEAR FIK YS   A T+ SV+VTNLKTG K+G
Sbjct  78    LLLITAD----QVVVHEGVIREKPSSEEEARLFIKGYSRAPACTVGSVMVTNLKTGLKKG  133

Query  912   ELDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKA  1091
               DK E+YFH IP DV++ LI+EGTVL VAGGLL+EHPL  P ++ + G+ DS+MGLPK 
Sbjct  134   GWDKAEVYFHPIPGDVVESLIKEGTVLKVAGGLLVEHPLTSPLVEAMVGSIDSIMGLPKD  193

Query  1092  LTQKLITEVL  1121
             LT+ LI EVL
Sbjct  194   LTRALINEVL  203


 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 69/84 (82%), Gaps = 1/84 (1%)
 Frame = +3

Query  66   NTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAII  245
            ++  FK+ILGSASA R+ +L EMG+ F  M+ADIDE+AIR+EKPEDLVMALAEAKAEAII
Sbjct  3    SSSSFKIILGSASAARQFILREMGFNFTVMTADIDERAIRREKPEDLVMALAEAKAEAII  62

Query  246  PRL-NIDESMEDAEPMLLITCDQV  314
             ++ N+ +S   +EP+LLIT DQV
Sbjct  63   SKIANLKDSEISSEPLLLITADQV  86



>ref|XP_008790383.1| PREDICTED: maf-like protein DDB_G0281937 [Phoenix dactylifera]
Length=210

 Score =   159 bits (401),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVV+EG+IREKP +KEEAR+F+K YS    +T+ SV++TNLKTG++   LDK E+YFH+I
Sbjct  89    VVVHEGIIREKPTSKEEARQFLKGYSGDHVSTVGSVVITNLKTGRRYEGLDKAEVYFHDI  148

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             P+++I+ LI+EG V  VAGGLL+EHPL  P+++ V GATDSVMGLPKALT+KLI E L
Sbjct  149   PDEIIEGLIDEGVVFRVAGGLLLEHPLTLPFVEAVVGATDSVMGLPKALTEKLIREAL  206


 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 65/80 (81%), Gaps = 1/80 (1%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLN  257
            FK+ILGS+S  RR +LAEMGYEF  M+ADIDEK+IR+EKPE+LVM LAEAKA+AII R+ 
Sbjct  10   FKIILGSSSVARRHILAEMGYEFEVMTADIDEKSIRREKPEELVMVLAEAKADAIISRIK  69

Query  258  I-DESMEDAEPMLLITCDQV  314
            I D S +DA P LL+T D V
Sbjct  70   ITDYSEKDAVPTLLLTSDIV  89



>ref|XP_011025792.1| PREDICTED: maf-like protein DDB_G0281937 isoform X3 [Populus 
euphratica]
Length=157

 Score =   157 bits (397),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 99/134 (74%), Gaps = 4/134 (3%)
 Frame = +3

Query  720   DLSVLMFLTAKLKLLEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTG  899
             D    + +TA      VVV  GM+REKP +KEEAREFIK YS G AA I SV+V+NL TG
Sbjct  24    DAQATLLITADT----VVVSNGMVREKPNSKEEAREFIKGYSGGHAAVIGSVVVSNLTTG  79

Query  900   KKRGELDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMG  1079
              ++G  +K E+YFHEIP+++ID +I+EG+ L+VAGGL +EHPL  P+++ V G+TD+V G
Sbjct  80    IRKGAWEKAEVYFHEIPDEIIDSVIDEGSTLHVAGGLTLEHPLTSPFVEAVVGSTDTVWG  139

Query  1080  LPKALTQKLITEVL  1121
             L KALT+KLI + L
Sbjct  140   LSKALTEKLIKDNL  153



>ref|XP_002880683.1| maf family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56942.1| maf family protein [Arabidopsis lyrata subsp. lyrata]
Length=206

 Score =   158 bits (400),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 96/139 (69%), Gaps = 4/139 (3%)
 Frame = +3

Query  705   SQFR*DLSVLMFLTAKLKLLEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVT  884
             SQF  D    + +T+      VVVY+G+IREKP +KEEAREFIK YS      + SVLV 
Sbjct  72    SQFAQDCQPTLLITSDT----VVVYKGVIREKPTSKEEAREFIKGYSGSHGGVVGSVLVR  127

Query  885   NLKTGKKRGELDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGAT  1064
             NLKTG +RG  DK E+YFHEIPE VID LI++     VAGGL++EHPLI P+I  V G  
Sbjct  128   NLKTGVRRGGWDKAEVYFHEIPEHVIDDLIDDSITFKVAGGLMLEHPLISPFIDSVVGGV  187

Query  1065  DSVMGLPKALTQKLITEVL  1121
             D+VMGLPK LT+K I +VL
Sbjct  188   DTVMGLPKELTEKFINDVL  206


 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 62/80 (78%), Gaps = 1/80 (1%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLN  257
            FKLILGS S  R+Q+LAEMGY+F  ++ADIDEKAIRKEKPEDLV+A+AEAKA  II +L 
Sbjct  10   FKLILGSQSMARKQILAEMGYDFTIVTADIDEKAIRKEKPEDLVVAIAEAKANEIILKLG  69

Query  258  IDESM-EDAEPMLLITCDQV  314
             +    +D +P LLIT D V
Sbjct  70   GESQFAQDCQPTLLITSDTV  89



>gb|KFK28327.1| hypothetical protein AALP_AA8G501600 [Arabis alpina]
Length=206

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 97/139 (70%), Gaps = 4/139 (3%)
 Frame = +3

Query  705   SQFR*DLSVLMFLTAKLKLLEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVT  884
             SQF  D    + +TA      VVVY+G+IREKP +KEEAREFIK YS      + SV+V 
Sbjct  72    SQFAQDPEPTILITADT----VVVYKGVIREKPTSKEEAREFIKGYSGSHGGVVGSVIVR  127

Query  885   NLKTGKKRGELDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGAT  1064
             NLKTG +RG  DK E+YFHEIPE+VID LI++     VAGGL +EHPLI P+I  V G  
Sbjct  128   NLKTGVRRGGWDKAEVYFHEIPENVIDDLIDDAITFKVAGGLTLEHPLISPFIDTVVGGV  187

Query  1065  DSVMGLPKALTQKLITEVL  1121
             D+VMGLPK LT+K I++VL
Sbjct  188   DTVMGLPKELTEKFISDVL  206


 Score = 97.4 bits (241),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 60/80 (75%), Gaps = 1/80 (1%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLN  257
            FKLILGS S  R+++LAEMGY F  ++ADIDEKAIR EKPEDLV+A+AEAKAE II +L 
Sbjct  10   FKLILGSQSMARKRILAEMGYNFTIVTADIDEKAIRTEKPEDLVVAIAEAKAEEIISKLG  69

Query  258  IDESM-EDAEPMLLITCDQV  314
                  +D EP +LIT D V
Sbjct  70   GQSQFAQDPEPTILITADTV  89



>ref|XP_009607223.1| PREDICTED: maf-like protein DDB_G0281937 isoform X3 [Nicotiana 
tomentosiformis]
Length=190

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 94/120 (78%), Gaps = 0/120 (0%)
 Frame = +3

Query  762   LEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFH  941
             +EV VY+G+IREKP +K+EAR+FIK YS GQA  + SV+VTNL  G ++G  ++ E+YFH
Sbjct  71    IEVAVYQGIIREKPSSKDEARQFIKSYSGGQATVVGSVVVTNLTKGIRKGAWERSEVYFH  130

Query  942   EIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             EIP++VID LIEEG +L VAGGL++EHPL  P++  V G  D VMGLP++LT+KLI E L
Sbjct  131   EIPDEVIDSLIEEGIILNVAGGLMLEHPLTLPFVDTVIGTADHVMGLPRSLTEKLIQEAL  190


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAK  230
            M      FK+ILGS+S  RR++LA+MGY+F  M+ADIDEK+IRKE  E+LV+ALAEAK
Sbjct  1    MAPKNLSFKIILGSSSMARRKILADMGYDFTVMTADIDEKSIRKENAEELVVALAEAK  58



>ref|XP_003558431.1| PREDICTED: maf-like protein DDB_G0281937 [Brachypodium distachyon]
Length=209

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 94/119 (79%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVV++G+IREKP   EEAR+FIK YS   AATI SVLVTN+K+G +R   DK E+YFH+
Sbjct  88    QVVVHDGVIREKPSTPEEARKFIKGYSESHAATIGSVLVTNVKSGTRREGWDKSEVYFHK  147

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP++V++ LIEEG V YVAGGLL+EHPL  P ++ + G  DSVMGLPKALT+KLI + L
Sbjct  148   IPDEVVESLIEEGDVFYVAGGLLVEHPLTSPLVEAIVGTIDSVMGLPKALTEKLIKDSL  206


 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 64/83 (77%), Gaps = 4/83 (5%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLN  257
             +LILGS+SA RRQ+L+EMGY+F  +SADIDEK IRKEKPE+LV+ALA AKA+AI+ ++ 
Sbjct  7    LRLILGSSSASRRQILSEMGYQFTLLSADIDEKEIRKEKPEELVVALAHAKADAILEKMQ  66

Query  258  ----IDESMEDAEPMLLITCDQV  314
                + E ++  E  LLIT DQV
Sbjct  67   NSGLMKEIVDSQETALLITADQV  89



>ref|XP_010557922.1| PREDICTED: maf-like protein DDB_G0281937 [Tarenaya hassleriana]
Length=206

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 99/139 (71%), Gaps = 4/139 (3%)
 Frame = +3

Query  705   SQFR*DLSVLMFLTAKLKLLEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVT  884
             S+F  D    + +TA      VVVY G+IREKP +KEEAREFI+ YS    A + SVLVT
Sbjct  72    SKFMNDTQPTLLITADT----VVVYNGVIREKPTSKEEAREFIRGYSGSHGAVVGSVLVT  127

Query  885   NLKTGKKRGELDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGAT  1064
             NLKTG ++G  DK E+YFHEIP+ VID +IEEG  + VAGGL++EHPL  P++  V GA 
Sbjct  128   NLKTGVRKGGWDKAEVYFHEIPDKVIDDMIEEGITINVAGGLMLEHPLTLPFVDTVVGAV  187

Query  1065  DSVMGLPKALTQKLITEVL  1121
             D+VMGL KALT++ I +V+
Sbjct  188   DTVMGLSKALTEQFIKDVI  206


 Score =   102 bits (255),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 64/81 (79%), Gaps = 3/81 (4%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLN  257
            FK+ILGS S  R+++LAEMGY+F  M+AD+DEK+IRKEKPEDLV+ALAE KA+AII R  
Sbjct  10   FKVILGSQSMARKRILAEMGYDFSIMTADVDEKSIRKEKPEDLVVALAEVKADAIISRFG  69

Query  258  IDES--MEDAEPMLLITCDQV  314
             D+S  M D +P LLIT D V
Sbjct  70   -DKSKFMNDTQPTLLITADTV  89



>ref|XP_006466798.1| PREDICTED: maf-like protein DDB_G0281937-like isoform X2 [Citrus 
sinensis]
Length=187

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 92/116 (79%), Gaps = 0/116 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVVY+G IREKP +KEEAREFIK YS   A  + SVL++NLKTG ++G  D+ E+YFH+I
Sbjct  68    VVVYKGSIREKPSSKEEAREFIKGYSGSHAEVVGSVLISNLKTGIRKGGWDRAEVYFHDI  127

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITE  1115
             P++VID LIEEG    VAGGL++EHPL  P+++ V GATD+VMGL KALT+KLI E
Sbjct  128   PDEVIDNLIEEGITFNVAGGLMLEHPLTLPFVEAVVGATDTVMGLSKALTEKLIWE  183


 Score = 80.1 bits (196),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 53/69 (77%), Gaps = 4/69 (6%)
 Frame = +3

Query  111  RRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLNIDESMEDAEP-  287
            R+++LAEMGYEF  ++A+IDEK+IRK+KPEDLVMALAEAKAEAI  RL   +S     P 
Sbjct  3    RKEILAEMGYEFTVVTAEIDEKSIRKDKPEDLVMALAEAKAEAIRSRL---QSAGQLNPT  59

Query  288  MLLITCDQV  314
             LLIT D V
Sbjct  60   TLLITADTV  68



>ref|XP_009772915.1| PREDICTED: maf-like protein DDB_G0281937 isoform X2 [Nicotiana 
sylvestris]
Length=233

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 94/120 (78%), Gaps = 0/120 (0%)
 Frame = +3

Query  762   LEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFH  941
             +EV VY+G+IREKP +KEEAR+FIK YS GQA  + SV+VTNL  G ++G  ++ E+YFH
Sbjct  114   IEVAVYQGIIREKPSSKEEARQFIKSYSGGQATVVGSVVVTNLTKGIRKGAWERSEVYFH  173

Query  942   EIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             EIP++VID LIEEG +L VAGGL++EHPL  P++  V G  D VMGLP++LT+KLI E L
Sbjct  174   EIPDEVIDSLIEEGIILNVAGGLMLEHPLTLPFVDTVIGTADHVMGLPRSLTEKLIQEAL  233


 Score = 97.8 bits (242),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 64/87 (74%), Gaps = 1/87 (1%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            M      FK+ILGS+S  RR++LA+MGY+F  M+ADIDEK+IRKE  E+LV+ALAEAKA+
Sbjct  1    MAPKNLSFKIILGSSSMARRKILADMGYDFTVMTADIDEKSIRKENAEELVVALAEAKAD  60

Query  237  AIIPRLNIDESM-EDAEPMLLITCDQV  314
            AI+ RL   + + E+  P LLIT D V
Sbjct  61   AIMSRLETTDHLEENTHPTLLITADTV  87



>ref|XP_006656251.1| PREDICTED: maf-like protein DDB_G0281937-like [Oryza brachyantha]
Length=209

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 94/119 (79%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVV++G+IREKP   EEAR+FIK YS   AATI SVLVTN+K+G ++   DK E+YFH+
Sbjct  88    QVVVHDGVIREKPSTPEEARKFIKGYSESHAATIGSVLVTNVKSGARKEGWDKAEVYFHK  147

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP++V++ LIEEG V YVAGGLL+EHPL  P ++ + G  DSVMGLPK+LT+KLI E L
Sbjct  148   IPDEVVESLIEEGNVFYVAGGLLVEHPLTSPLVEAIVGTIDSVMGLPKSLTEKLIKESL  206


 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 64/83 (77%), Gaps = 4/83 (5%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLN  257
             +LILGS+S+ RRQ+L+EMGY+F  +SADIDEK IRKEKPE+LV+ALA AKA+AI+ +L 
Sbjct  7    LRLILGSSSSSRRQILSEMGYKFTLLSADIDEKEIRKEKPEELVVALAHAKADAIMEKLQ  66

Query  258  ----IDESMEDAEPMLLITCDQV  314
                + E ++  E  LLIT DQV
Sbjct  67   NNGMMKEILDSQESTLLITADQV  89



>ref|XP_010484628.1| PREDICTED: maf-like protein DDB_G0281937 [Camelina sativa]
Length=233

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 95/139 (68%), Gaps = 4/139 (3%)
 Frame = +3

Query  705   SQFR*DLSVLMFLTAKLKLLEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVT  884
             SQF  D    + +TA      VVVY+G+IREKP  KEEAREFIK YS      + SVLV+
Sbjct  99    SQFAQDPQPTLLITADT----VVVYKGVIREKPTTKEEAREFIKGYSGSHGGVVGSVLVS  154

Query  885   NLKTGKKRGELDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGAT  1064
             NLKTG +RG  DK E+YFHEIPE VID LI++     VAGGL +EHPLI P++  V G  
Sbjct  155   NLKTGVRRGGWDKAEVYFHEIPEQVIDNLIDDAITYKVAGGLTLEHPLISPFVDSVVGGV  214

Query  1065  DSVMGLPKALTQKLITEVL  1121
             D+VMGLPK LT+K I +VL
Sbjct  215   DTVMGLPKELTEKFINDVL  233


 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 61/80 (76%), Gaps = 1/80 (1%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLN  257
            FKLILGS S  R+++LAEMGY++  ++ADIDEKAIR +KPEDLV+ALAEAKA  II +L 
Sbjct  37   FKLILGSQSMARKRILAEMGYDYTIVTADIDEKAIRTDKPEDLVVALAEAKANEIISKLG  96

Query  258  IDESM-EDAEPMLLITCDQV  314
             +    +D +P LLIT D V
Sbjct  97   GESQFAQDPQPTLLITADTV  116



>ref|XP_006425670.1| hypothetical protein CICLE_v10026398mg [Citrus clementina]
 ref|XP_006466797.1| PREDICTED: maf-like protein DDB_G0281937-like isoform X1 [Citrus 
sinensis]
 gb|ESR38910.1| hypothetical protein CICLE_v10026398mg [Citrus clementina]
Length=233

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 92/117 (79%), Gaps = 0/117 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVVY+G IREKP +KEEAREFIK YS   A  + SVL++NLKTG ++G  D+ E+YFH+I
Sbjct  114   VVVYKGSIREKPSSKEEAREFIKGYSGSHAEVVGSVLISNLKTGIRKGGWDRAEVYFHDI  173

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEV  1118
             P++VID LIEEG    VAGGL++EHPL  P+++ V GATD+VMGL KALT+KLI E 
Sbjct  174   PDEVIDNLIEEGITFNVAGGLMLEHPLTLPFVEAVVGATDTVMGLSKALTEKLIWEA  230


 Score = 95.1 bits (235),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 62/81 (77%), Gaps = 4/81 (5%)
 Frame = +3

Query  75   PFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRL  254
            P K+ILGS+S  R+++LAEMGYEF  ++A+IDEK+IRK+KPEDLVMALAEAKAEAI  RL
Sbjct  37   PIKIILGSSSMARKEILAEMGYEFTVVTAEIDEKSIRKDKPEDLVMALAEAKAEAIRSRL  96

Query  255  NIDESMEDAEP-MLLITCDQV  314
               +S     P  LLIT D V
Sbjct  97   ---QSAGQLNPTTLLITADTV  114



>ref|XP_002310234.2| hypothetical protein POPTR_0007s12880g [Populus trichocarpa]
 gb|EEE90684.2| hypothetical protein POPTR_0007s12880g [Populus trichocarpa]
Length=218

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 99/134 (74%), Gaps = 4/134 (3%)
 Frame = +3

Query  720   DLSVLMFLTAKLKLLEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTG  899
             D    + +TA      VVV  GM+REKP +KEEAREFIK YS G AA I SV+V+NL TG
Sbjct  85    DAQATLLITADT----VVVSNGMVREKPNSKEEAREFIKGYSGGHAAVIGSVVVSNLTTG  140

Query  900   KKRGELDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMG  1079
              ++G  +K E+YFHEIP+++ID +IEEG+ L+VAGGL +EHPL  P+++ V G+TD+V G
Sbjct  141   IRKGAWEKAEVYFHEIPDEIIDSVIEEGSTLHVAGGLTLEHPLTSPFVEAVVGSTDTVWG  200

Query  1080  LPKALTQKLITEVL  1121
             L KALT+KLI + L
Sbjct  201   LSKALTEKLIKDNL  214


 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 67/88 (76%), Gaps = 1/88 (1%)
 Frame = +3

Query  54   KMEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKA  233
            KM      FK+ILGS+S  RRQ+L EMGYEF  ++ADIDEK+IRK+KPE+LVMALAEAKA
Sbjct  10   KMTTCNSSFKIILGSSSLARRQILNEMGYEFTVVTADIDEKSIRKDKPEELVMALAEAKA  69

Query  234  EAIIPRLNIDESM-EDAEPMLLITCDQV  314
             AII RL I+  + EDA+  LLIT D V
Sbjct  70   NAIIERLRIEGHVEEDAQATLLITADTV  97



>ref|XP_009607221.1| PREDICTED: maf-like protein DDB_G0281937 isoform X1 [Nicotiana 
tomentosiformis]
Length=218

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 94/120 (78%), Gaps = 0/120 (0%)
 Frame = +3

Query  762   LEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFH  941
             +EV VY+G+IREKP +K+EAR+FIK YS GQA  + SV+VTNL  G ++G  ++ E+YFH
Sbjct  99    IEVAVYQGIIREKPSSKDEARQFIKSYSGGQATVVGSVVVTNLTKGIRKGAWERSEVYFH  158

Query  942   EIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             EIP++VID LIEEG +L VAGGL++EHPL  P++  V G  D VMGLP++LT+KLI E L
Sbjct  159   EIPDEVIDSLIEEGIILNVAGGLMLEHPLTLPFVDTVIGTADHVMGLPRSLTEKLIQEAL  218


 Score = 98.6 bits (244),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 64/87 (74%), Gaps = 1/87 (1%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            M      FK+ILGS+S  RR++LA+MGY+F  M+ADIDEK+IRKE  E+LV+ALAEAKA+
Sbjct  1    MAPKNLSFKIILGSSSMARRKILADMGYDFTVMTADIDEKSIRKENAEELVVALAEAKAD  60

Query  237  AIIPRLNIDESM-EDAEPMLLITCDQV  314
            AI+ RL   E + E+  P LLIT D +
Sbjct  61   AIMSRLETTEQLEENTHPTLLITADTI  87



>ref|XP_007046933.1| Maf-like protein isoform 2 [Theobroma cacao]
 gb|EOX91090.1| Maf-like protein isoform 2 [Theobroma cacao]
Length=189

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 97/127 (76%), Gaps = 0/127 (0%)
 Frame = +3

Query  741   LTAKLKLLEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELD  920
             L   L   +VVVY+GMIREKP ++EEARE+IK YS G AA + SVLVTNL+TG  +G  +
Sbjct  50    LVTALAEAKVVVYKGMIREKPSSEEEAREYIKGYSGGHAAVVGSVLVTNLRTGASKGGWE  109

Query  921   KVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQ  1100
               E+YFH+IP++VI+ LI+EG    VAGGL++EHPL  P+++ V GATD+VMGL K+LT+
Sbjct  110   SAEVYFHDIPDEVINNLIDEGIPFKVAGGLMLEHPLTLPFVEAVIGATDTVMGLSKSLTE  169

Query  1101  KLITEVL  1121
             KLI E L
Sbjct  170   KLIQEAL  176


 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAK  230
            FKLILGS+S  R+++LAEMGYEF  M+ADIDEK+IRKEKPEDLV ALAEAK
Sbjct  8    FKLILGSSSMARQRILAEMGYEFTIMTADIDEKSIRKEKPEDLVTALAEAK  58



>ref|XP_010444782.1| PREDICTED: maf-like protein DDB_G0281937 [Camelina sativa]
Length=233

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 94/139 (68%), Gaps = 4/139 (3%)
 Frame = +3

Query  705   SQFR*DLSVLMFLTAKLKLLEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVT  884
             SQF  D    + +TA      VVVY+G+IREKP  KEEAREFIK YS      + SVLV 
Sbjct  99    SQFAHDPQPTLLVTADT----VVVYKGVIREKPTTKEEAREFIKGYSGSHGGVVGSVLVR  154

Query  885   NLKTGKKRGELDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGAT  1064
             NLKTG KRG  DK E+YFHEIPE VID LI++     VAGGL +EHPLI P++  V G  
Sbjct  155   NLKTGVKRGGWDKAEVYFHEIPEQVIDDLIDDAVTYKVAGGLTLEHPLISPFVDSVVGGV  214

Query  1065  DSVMGLPKALTQKLITEVL  1121
             D+VMGLPK LT+K I +VL
Sbjct  215   DTVMGLPKELTEKFINDVL  233


 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 60/80 (75%), Gaps = 1/80 (1%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLN  257
            FKLILGS S  R+++LAEMGY++  ++ADIDEKAIR +KPEDLV+ALAEAKA  II +L 
Sbjct  37   FKLILGSQSMARKRILAEMGYDYTIVTADIDEKAIRTDKPEDLVVALAEAKANEIISKLG  96

Query  258  IDESM-EDAEPMLLITCDQV  314
             +     D +P LL+T D V
Sbjct  97   GESQFAHDPQPTLLVTADTV  116



>gb|ABF94776.1| Maf family protein, putative, expressed [Oryza sativa Japonica 
Group]
Length=209

 Score =   157 bits (397),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 94/119 (79%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVV++G+IREKP   EEAR+FIK YS   AATI SVLVTN+K+G ++   DK E+YFH+
Sbjct  88    QVVVHDGVIREKPSTPEEARKFIKGYSESHAATIGSVLVTNVKSGARKEGWDKAEVYFHK  147

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP++V++ LIEEG V YVAGGLL+EHPL  P ++ + G  DSVMGLPK+LT+KLI E L
Sbjct  148   IPDEVVESLIEEGDVFYVAGGLLVEHPLTSPLVEAIVGTIDSVMGLPKSLTEKLIKESL  206


 Score = 97.8 bits (242),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 63/83 (76%), Gaps = 4/83 (5%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLN  257
             +LILGS+SA RRQ+LAEMGY F  +SADIDEK IRKEKPE+LV+ALA AKA+AI+ +L 
Sbjct  7    LRLILGSSSASRRQILAEMGYSFTLLSADIDEKEIRKEKPEELVVALAHAKADAIMEKLR  66

Query  258  ----IDESMEDAEPMLLITCDQV  314
                + E ++  E  LLIT DQV
Sbjct  67   DNGMMKEILDSQETTLLITADQV  89



>ref|XP_009772919.1| PREDICTED: maf-like protein DDB_G0281937 isoform X6 [Nicotiana 
sylvestris]
Length=204

 Score =   157 bits (396),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 92/118 (78%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             V VY+G+IREKP +KEEAR+FIK YS GQA  + SV+VTNL  G ++G  ++ E+YFHEI
Sbjct  87    VAVYQGIIREKPSSKEEARQFIKSYSGGQATVVGSVVVTNLTKGIRKGAWERSEVYFHEI  146

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             P++VID LIEEG +L VAGGL++EHPL  P++  V G  D VMGLP++LT+KLI E L
Sbjct  147   PDEVIDSLIEEGIILNVAGGLMLEHPLTLPFVDTVIGTADHVMGLPRSLTEKLIQEAL  204


 Score = 97.8 bits (242),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 64/87 (74%), Gaps = 1/87 (1%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            M      FK+ILGS+S  RR++LA+MGY+F  M+ADIDEK+IRKE  E+LV+ALAEAKA+
Sbjct  1    MAPKNLSFKIILGSSSMARRKILADMGYDFTVMTADIDEKSIRKENAEELVVALAEAKAD  60

Query  237  AIIPRLNIDESM-EDAEPMLLITCDQV  314
            AI+ RL   + + E+  P LLIT D V
Sbjct  61   AIMSRLETTDHLEENTHPTLLITADTV  87



>ref|XP_010465316.1| PREDICTED: maf-like protein DDB_G0281937 [Camelina sativa]
Length=236

 Score =   157 bits (398),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 94/139 (68%), Gaps = 4/139 (3%)
 Frame = +3

Query  705   SQFR*DLSVLMFLTAKLKLLEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVT  884
             SQF  D    + +TA      VVVY+G+IREKP  KEEAREFIK YS      + SVLV 
Sbjct  102   SQFAQDPQPTLLITADT----VVVYKGVIREKPTTKEEAREFIKGYSGSHGGVVGSVLVR  157

Query  885   NLKTGKKRGELDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGAT  1064
             NLKTG KRG  DK E+YFHEIPE VID LI++     VAGGL +EHPLI P++  V G  
Sbjct  158   NLKTGVKRGGWDKAEVYFHEIPEQVIDDLIDDAITYKVAGGLTLEHPLISPFVDSVVGGV  217

Query  1065  DSVMGLPKALTQKLITEVL  1121
             D+VMGLPK LT+K I +VL
Sbjct  218   DTVMGLPKELTEKFINDVL  236


 Score = 95.5 bits (236),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 66/92 (72%), Gaps = 4/92 (4%)
 Frame = +3

Query  42   ISPRKMEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALA  221
            I+ + ME     FKLILGS S  R+++LAEMGY++  ++ADIDEKAIR +KPEDLV+ALA
Sbjct  31   ITTKAMERG---FKLILGSQSMARKRILAEMGYDYTIVTADIDEKAIRTDKPEDLVVALA  87

Query  222  EAKAEAIIPRLNIDESM-EDAEPMLLITCDQV  314
            EAKA  II +L  +    +D +P LLIT D V
Sbjct  88   EAKANEIISKLGGESQFAQDPQPTLLITADTV  119



>dbj|BAJ91214.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=209

 Score =   157 bits (396),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 93/119 (78%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VV+++G+IREKP   EEAR+FI+ YS   AATI SVLVTN+KTG +R   DK E+YFH+
Sbjct  88    QVVIHDGVIREKPTTPEEARKFIQGYSQSHAATIGSVLVTNVKTGTRREGWDKSEVYFHK  147

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP +V++ LIEEG V YVAGGLL+EHPL  P ++ + G  DSVMGLPKALT++LI + L
Sbjct  148   IPNEVVESLIEEGNVFYVAGGLLVEHPLTSPLVEAIVGTIDSVMGLPKALTEQLINDSL  206


 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 64/83 (77%), Gaps = 4/83 (5%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLN  257
             +LILGS+SA RRQ+LAEMGY+F  +SADIDEK IRKEKPE+LV+ALA AKA+AI+ ++ 
Sbjct  7    LRLILGSSSASRRQILAEMGYQFKLLSADIDEKEIRKEKPEELVVALAHAKADAILDKMQ  66

Query  258  ----IDESMEDAEPMLLITCDQV  314
                + E ++  E  LLIT DQV
Sbjct  67   NNGMMKEIVDSQETTLLITADQV  89



>ref|NP_201456.2| Maf-like protein [Arabidopsis thaliana]
 gb|AED98228.1| Maf-like protein [Arabidopsis thaliana]
Length=207

 Score =   156 bits (395),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 94/139 (68%), Gaps = 4/139 (3%)
 Frame = +3

Query  705   SQFR*DLSVLMFLTAKLKLLEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVT  884
             SQF  D    + +TA      VVVY+G+IREKP  KEEAREFIK YS      + SVLV 
Sbjct  72    SQFAKDPQPTLLITADT----VVVYKGVIREKPTTKEEAREFIKGYSGSHGGVVGSVLVR  127

Query  885   NLKTGKKRGELDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGAT  1064
             NLKTG K+G  DK E+YFHEIPE VID LI++     VAGGL +EHPLI P+I  V G  
Sbjct  128   NLKTGVKKGGWDKAEVYFHEIPEQVIDGLIDDAITYKVAGGLTLEHPLISPFIDSVVGGV  187

Query  1065  DSVMGLPKALTQKLITEVL  1121
             D+VMGLPK LT+K I +VL
Sbjct  188   DTVMGLPKELTEKFINDVL  206


 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 61/80 (76%), Gaps = 1/80 (1%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLN  257
            FKLILGS S  R+++LAEMGY++  ++ADIDEKAIR EKPEDLV+ALAEAKA  II +L 
Sbjct  10   FKLILGSQSMARKRILAEMGYDYTIVTADIDEKAIRTEKPEDLVVALAEAKANEIISKLG  69

Query  258  IDESM-EDAEPMLLITCDQV  314
             +    +D +P LLIT D V
Sbjct  70   GESQFAKDPQPTLLITADTV  89



>gb|EMT18880.1| Maf-like protein [Aegilops tauschii]
Length=185

 Score =   155 bits (393),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 93/119 (78%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VV+++G+IREKP   EEAR+FI+ YS   AATI SVLVTN+KTG +R   DK E+YFH+
Sbjct  64    QVVIHDGVIREKPTTPEEARKFIQGYSQSHAATIGSVLVTNVKTGTRREGWDKSEVYFHK  123

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP +V++ LIEEG V YVAGGLL+EHPL  P ++ + G  DSVMGLPKALT++LI + L
Sbjct  124   IPNEVVESLIEEGNVFYVAGGLLVEHPLTSPLVEAIVGTIDSVMGLPKALTEQLIKDSL  182


 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 42/57 (74%), Gaps = 4/57 (7%)
 Frame = +3

Query  156  SADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLN----IDESMEDAEPMLLITCDQV  314
            SADIDEK IRKEKPE+LV+ALA AKA+AI+ ++     + E ++  E  LLIT DQV
Sbjct  9    SADIDEKEIRKEKPEELVVALAHAKADAILDKMRNNGMMKEIVDSQETTLLITADQV  65



>ref|XP_011025789.1| PREDICTED: maf-like protein DDB_G0281937 isoform X1 [Populus 
euphratica]
 ref|XP_011025790.1| PREDICTED: maf-like protein DDB_G0281937 isoform X1 [Populus 
euphratica]
Length=218

 Score =   156 bits (395),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 99/134 (74%), Gaps = 4/134 (3%)
 Frame = +3

Query  720   DLSVLMFLTAKLKLLEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTG  899
             D    + +TA      VVV  GM+REKP +KEEAREFIK YS G AA I SV+V+NL TG
Sbjct  85    DAQATLLITADT----VVVSNGMVREKPNSKEEAREFIKGYSGGHAAVIGSVVVSNLTTG  140

Query  900   KKRGELDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMG  1079
              ++G  +K E+YFHEIP+++ID +I+EG+ L+VAGGL +EHPL  P+++ V G+TD+V G
Sbjct  141   IRKGAWEKAEVYFHEIPDEIIDSVIDEGSTLHVAGGLTLEHPLTSPFVEAVVGSTDTVWG  200

Query  1080  LPKALTQKLITEVL  1121
             L KALT+KLI + L
Sbjct  201   LSKALTEKLIKDNL  214


 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 67/88 (76%), Gaps = 1/88 (1%)
 Frame = +3

Query  54   KMEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKA  233
            KM      FK+ILGS+S  RRQ+L EMGYEF  ++ADIDEK+IRK+KPE+LVMALAEAKA
Sbjct  10   KMTSCNSSFKIILGSSSLARRQILNEMGYEFTVVTADIDEKSIRKDKPEELVMALAEAKA  69

Query  234  EAIIPRLNIDESM-EDAEPMLLITCDQV  314
             AII RL I+  + EDA+  LLIT D V
Sbjct  70   NAIIERLRIEGHVEEDAQATLLITADTV  97



>gb|EEC74808.1| hypothetical protein OsI_10622 [Oryza sativa Indica Group]
 gb|EEE58641.1| hypothetical protein OsJ_10016 [Oryza sativa Japonica Group]
Length=238

 Score =   157 bits (397),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 94/119 (79%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVV++G+IREKP   EEAR+FIK YS   AATI SVLVTN+K+G ++   DK E+YFH+
Sbjct  117   QVVVHDGVIREKPSTPEEARKFIKGYSESHAATIGSVLVTNVKSGARKEGWDKAEVYFHK  176

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP++V++ LIEEG V YVAGGLL+EHPL  P ++ + G  DSVMGLPK+LT+KLI E L
Sbjct  177   IPDEVVESLIEEGDVFYVAGGLLVEHPLTSPLVEAIVGTIDSVMGLPKSLTEKLIKESL  235


 Score = 97.8 bits (242),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 75/110 (68%), Gaps = 9/110 (8%)
 Frame = +3

Query  12   LLRSPPA---YTGISPRKM--EGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEK  176
            ++ +PP    ++ ++ R +   G     +LILGS+SA RRQ+LAEMGY F  +SADIDEK
Sbjct  9    VITAPPKSLLFSFVTSRSLIRVGGWLTMQLILGSSSASRRQILAEMGYSFTLLSADIDEK  68

Query  177  AIRKEKPEDLVMALAEAKAEAIIPRLN----IDESMEDAEPMLLITCDQV  314
             IRKEKPE+LV+ALA AKA+AI+ +L     + E ++  E  LLIT DQV
Sbjct  69   EIRKEKPEELVVALAHAKADAIMEKLRDNGMMKEILDSQETTLLITADQV  118



>ref|XP_006393850.1| hypothetical protein EUTSA_v10004849mg [Eutrema salsugineum]
 gb|ESQ31136.1| hypothetical protein EUTSA_v10004849mg [Eutrema salsugineum]
Length=236

 Score =   157 bits (396),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 78/139 (56%), Positives = 97/139 (70%), Gaps = 4/139 (3%)
 Frame = +3

Query  705   SQFR*DLSVLMFLTAKLKLLEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVT  884
             SQF  D    + +TA      VVVY+G+IREKP +KEEAR+FIK YS      + SV+V+
Sbjct  102   SQFAEDPQPTILITADT----VVVYKGVIREKPTSKEEARQFIKGYSGSHGGVVGSVIVS  157

Query  885   NLKTGKKRGELDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGAT  1064
             NLKTG +RG  DK E+YFHEIP  VID LI++     VAGGL +EHPLI P+I  V G T
Sbjct  158   NLKTGVRRGGWDKAEVYFHEIPAKVIDDLIDDAITFKVAGGLTLEHPLISPFIDTVVGGT  217

Query  1065  DSVMGLPKALTQKLITEVL  1121
             D+VMGLPK LT+K I++VL
Sbjct  218   DTVMGLPKELTEKFISDVL  236


 Score = 98.2 bits (243),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 62/80 (78%), Gaps = 1/80 (1%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLN  257
            FKLILGS S  R+++LAEMGY+F  ++ADIDEKAIR+EKPEDLV+A+AEAKA+ II +L 
Sbjct  40   FKLILGSQSMARKRILAEMGYDFTIVTADIDEKAIRREKPEDLVVAIAEAKADEIISKLG  99

Query  258  IDESM-EDAEPMLLITCDQV  314
                  ED +P +LIT D V
Sbjct  100  GQSQFAEDPQPTILITADTV  119



>ref|XP_009607222.1| PREDICTED: maf-like protein DDB_G0281937 isoform X2 [Nicotiana 
tomentosiformis]
Length=204

 Score =   155 bits (393),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 92/118 (78%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             V VY+G+IREKP +K+EAR+FIK YS GQA  + SV+VTNL  G ++G  ++ E+YFHEI
Sbjct  87    VAVYQGIIREKPSSKDEARQFIKSYSGGQATVVGSVVVTNLTKGIRKGAWERSEVYFHEI  146

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             P++VID LIEEG +L VAGGL++EHPL  P++  V G  D VMGLP++LT+KLI E L
Sbjct  147   PDEVIDSLIEEGIILNVAGGLMLEHPLTLPFVDTVIGTADHVMGLPRSLTEKLIQEAL  204


 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 64/87 (74%), Gaps = 1/87 (1%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            M      FK+ILGS+S  RR++LA+MGY+F  M+ADIDEK+IRKE  E+LV+ALAEAKA+
Sbjct  1    MAPKNLSFKIILGSSSMARRKILADMGYDFTVMTADIDEKSIRKENAEELVVALAEAKAD  60

Query  237  AIIPRLNIDESM-EDAEPMLLITCDQV  314
            AI+ RL   E + E+  P LLIT D V
Sbjct  61   AIMSRLETTEQLEENTHPTLLITADTV  87



>ref|XP_010316365.1| PREDICTED: maf-like protein DDB_G0281937 isoform X2 [Solanum 
lycopersicum]
Length=180

 Score =   155 bits (391),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 92/118 (78%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             V VYEG++REKP +KEEAR+FIK YS GQA  + SV+VTNL  G ++G  ++ E+YFH+I
Sbjct  63    VAVYEGIVREKPSSKEEARQFIKSYSGGQATVVGSVVVTNLTKGIRKGAWERSEVYFHDI  122

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             P+++ID LIEEG +L VAGGL++EHPL  P++  + G  DSVMGLP+ LT+KLI E L
Sbjct  123   PDEIIDSLIEEGIILNVAGGLMLEHPLTLPFVDTLIGTADSVMGLPRNLTEKLIEEAL  180


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = +3

Query  159  ADIDEKAIRKEKPEDLVMALAEAKAEAIIPRL-NIDESMEDAEPMLLITCDQV  314
            ADIDEK+IRK+  E+LV+ALAEAKA+AI+ RL   D+  E+    LLIT D V
Sbjct  11   ADIDEKSIRKDNAEELVIALAEAKADAIMSRLKTTDQLDENTHSTLLITADTV  63



>ref|XP_006340618.1| PREDICTED: maf-like protein DDB_G0281937-like isoform X1 [Solanum 
tuberosum]
Length=204

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             V VY+G+IREKP +KEEAR+FIK YS GQA  + SV+VTNL  G ++G  ++ E+YFH+I
Sbjct  87    VAVYDGIIREKPSSKEEARQFIKSYSGGQATVVGSVVVTNLTKGIRKGAWERSEVYFHDI  146

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             P+++ID LIEEG +L VAGGL++EHPL  P++  + G  DSVMGLP++LT+KLI E L
Sbjct  147   PDEIIDSLIEEGIILNVAGGLMLEHPLTLPFVDTLIGTADSVMGLPRSLTEKLIEETL  204


 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 61/87 (70%), Gaps = 1/87 (1%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            M      FK+ILGS+S  RR++LA+MGYEF  M ADIDEK IRK+  E+LV+ALAEAKA+
Sbjct  1    MAPKNLSFKIILGSSSMARRKILADMGYEFTVMGADIDEKRIRKDNAEELVVALAEAKAD  60

Query  237  AIIPRLNIDESM-EDAEPMLLITCDQV  314
            AI+ RL   + + E+    LLIT D V
Sbjct  61   AIMSRLKTTDHLEENTHSTLLITADTV  87



>ref|XP_007046932.1| Maf-like protein isoform 1 [Theobroma cacao]
 gb|EOX91089.1| Maf-like protein isoform 1 [Theobroma cacao]
Length=217

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 94/118 (80%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVVY+GMIREKP ++EEARE+IK YS G AA + SVLVTNL+TG  +G  +  E+YFH+I
Sbjct  87    VVVYKGMIREKPSSEEEAREYIKGYSGGHAAVVGSVLVTNLRTGASKGGWESAEVYFHDI  146

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             P++VI+ LI+EG    VAGGL++EHPL  P+++ V GATD+VMGL K+LT+KLI E L
Sbjct  147   PDEVINNLIDEGIPFKVAGGLMLEHPLTLPFVEAVIGATDTVMGLSKSLTEKLIQEAL  204


 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 63/87 (72%), Gaps = 1/87 (1%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            M      FKLILGS+S  R+++LAEMGYEF  M+ADIDEK+IRKEKPEDLV ALAEAKA+
Sbjct  1    MAAGESSFKLILGSSSMARQRILAEMGYEFTIMTADIDEKSIRKEKPEDLVTALAEAKAD  60

Query  237  AIIPRL-NIDESMEDAEPMLLITCDQV  314
            AII  L N     EDA   LLIT D V
Sbjct  61   AIISMLQNTGIIEEDAHTTLLITADTV  87



>ref|XP_010472549.1| PREDICTED: maf-like protein DDB_G0281937 isoform X1 [Camelina 
sativa]
 ref|XP_010472550.1| PREDICTED: maf-like protein DDB_G0281937 isoform X2 [Camelina 
sativa]
Length=206

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 96/139 (69%), Gaps = 4/139 (3%)
 Frame = +3

Query  705   SQFR*DLSVLMFLTAKLKLLEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVT  884
             SQF  D    + +TA      VVVY+G+IREKP +KEEAREFIK YS      + SV+V 
Sbjct  72    SQFAQDHQPTLLITADT----VVVYKGVIREKPTSKEEAREFIKGYSGSHGGVVGSVIVR  127

Query  885   NLKTGKKRGELDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGAT  1064
             NL+TG +RG  +K E+YFHEIPE VID LI++     VAGGL++EHPLI P+I  V G  
Sbjct  128   NLQTGVRRGGWEKAEVYFHEIPEQVIDDLIDDAITFKVAGGLMLEHPLISPFIDSVMGGV  187

Query  1065  DSVMGLPKALTQKLITEVL  1121
             D+VMGLPK LT+K I +VL
Sbjct  188   DTVMGLPKELTEKFINDVL  206


 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 61/80 (76%), Gaps = 1/80 (1%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLN  257
            FKLILGS S  R++++AEMGY+F  ++ADIDEKAIRK KPEDLV+A+AEAKA  II +L 
Sbjct  10   FKLILGSQSMARKRIIAEMGYDFTIVTADIDEKAIRKHKPEDLVVAVAEAKANEIISKLG  69

Query  258  IDESM-EDAEPMLLITCDQV  314
             +    +D +P LLIT D V
Sbjct  70   GESQFAQDHQPTLLITADTV  89



>ref|XP_004232406.1| PREDICTED: maf-like protein DDB_G0281937 isoform X1 [Solanum 
lycopersicum]
Length=204

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 92/118 (78%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             V VYEG++REKP +KEEAR+FIK YS GQA  + SV+VTNL  G ++G  ++ E+YFH+I
Sbjct  87    VAVYEGIVREKPSSKEEARQFIKSYSGGQATVVGSVVVTNLTKGIRKGAWERSEVYFHDI  146

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             P+++ID LIEEG +L VAGGL++EHPL  P++  + G  DSVMGLP+ LT+KLI E L
Sbjct  147   PDEIIDSLIEEGIILNVAGGLMLEHPLTLPFVDTLIGTADSVMGLPRNLTEKLIEEAL  204


 Score = 94.4 bits (233),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 62/87 (71%), Gaps = 1/87 (1%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            M      FK+ILGS+S  RR++LA+MGYEF  M ADIDEK+IRK+  E+LV+ALAEAKA+
Sbjct  1    MAPKNLSFKIILGSSSMARRKILADMGYEFTVMGADIDEKSIRKDNAEELVIALAEAKAD  60

Query  237  AIIPRL-NIDESMEDAEPMLLITCDQV  314
            AI+ RL   D+  E+    LLIT D V
Sbjct  61   AIMSRLKTTDQLDENTHSTLLITADTV  87



>ref|XP_009112309.1| PREDICTED: maf-like protein DDB_G0281937 [Brassica rapa]
Length=201

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 95/139 (68%), Gaps = 4/139 (3%)
 Frame = +3

Query  705   SQFR*DLSVLMFLTAKLKLLEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVT  884
             SQF  DL   + +TA      VVVY+G+IREKP  K+EAR FIK YS      + SVLV 
Sbjct  67    SQFAQDLQPTLLITAD----TVVVYKGVIREKPTTKDEARLFIKGYSGSHGGVVGSVLVR  122

Query  885   NLKTGKKRGELDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGAT  1064
             NLKTG +R   DK E+YFHEIPE VID LI++     VAGGL++EHPLI P+I  V G  
Sbjct  123   NLKTGVQRIGWDKAEVYFHEIPEKVIDDLIDDAVTFKVAGGLMLEHPLIAPFIDTVVGGV  182

Query  1065  DSVMGLPKALTQKLITEVL  1121
             D+VMGLPK LT+K IT+VL
Sbjct  183   DTVMGLPKDLTEKFITDVL  201


 Score = 94.7 bits (234),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 61/80 (76%), Gaps = 1/80 (1%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLN  257
            FK+ILGS S  R+++LAEMGYEF  ++ADIDEKAIR++ PEDLV+A+A+AKA+ II +L 
Sbjct  5    FKMILGSQSMARKRILAEMGYEFTVVTADIDEKAIRRDNPEDLVVAIAQAKADEIISKLG  64

Query  258  IDESM-EDAEPMLLITCDQV  314
                  +D +P LLIT D V
Sbjct  65   GQSQFAQDLQPTLLITADTV  84



>ref|XP_010089029.1| Maf-like protein [Morus notabilis]
 gb|EXB37256.1| Maf-like protein [Morus notabilis]
Length=199

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 94/118 (80%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVV +GMIREKP +KEEAR+FIK YS  QAA + SVLVTNLKTGK++G  ++ E+YFH+I
Sbjct  82    VVVSKGMIREKPSSKEEARDFIKGYSGSQAAVVGSVLVTNLKTGKRKGGWERAEVYFHDI  141

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             P++VID L+EE   L VAGGL +E+PLI  +++ V G  D+VMGLPKALT++LI E L
Sbjct  142   PDEVIDTLVEEAITLNVAGGLTLENPLILRFVEAVIGTGDAVMGLPKALTERLIQEAL  199


 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 64/80 (80%), Gaps = 1/80 (1%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLN  257
            F++ILGSAS  RRQ+L EMGYEF  M+ADIDE++IRKEKPE+LVMALAEAKA+AII RL 
Sbjct  3    FQIILGSASMARRQLLKEMGYEFSLMTADIDERSIRKEKPEELVMALAEAKADAIISRLK  62

Query  258  IDESMEDA-EPMLLITCDQV  314
                +E++ E  LLIT D V
Sbjct  63   SRGQLEESTEEKLLITADTV  82



>gb|KHG09502.1| Maf-like protein [Gossypium arboreum]
Length=244

 Score =   155 bits (392),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 92/121 (76%), Gaps = 0/121 (0%)
 Frame = +3

Query  759   LLEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYF  938
              ++VVVY+G IREKP N++EAREFIK YS G AA + SVLVTNL +G  +G  +  E+YF
Sbjct  111   FMQVVVYKGTIREKPCNEDEAREFIKGYSGGHAAVVGSVLVTNLNSGASKGGWESAEVYF  170

Query  939   HEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEV  1118
             H+IP +VID LI+EG    VAGGL++EHPL  P++  V GATD+VMGL K+LT+KLI E 
Sbjct  171   HDIPNEVIDSLIDEGIPFKVAGGLMLEHPLTLPFVDAVIGATDTVMGLSKSLTEKLIEEA  230

Query  1119  L  1121
             L
Sbjct  231   L  231


 Score = 77.8 bits (190),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 57/81 (70%), Gaps = 11/81 (14%)
 Frame = +3

Query  111  RRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAK----------AEAIIPRLNI  260
            R+++LAEMGYEF  M+ADIDEK+IRKEKPEDLV ALAEAK          A AI+ RL  
Sbjct  3    RQRILAEMGYEFTIMTADIDEKSIRKEKPEDLVTALAEAKLKFGPVPQHEANAIMARLQH  62

Query  261  DESMED-AEPMLLITCDQVHN  320
             + +++ A P LLIT D +++
Sbjct  63   TDILKNVACPTLLITADTLNS  83



>ref|XP_010417317.1| PREDICTED: maf-like protein DDB_G0281937 [Camelina sativa]
Length=206

 Score =   154 bits (388),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 95/139 (68%), Gaps = 4/139 (3%)
 Frame = +3

Query  705   SQFR*DLSVLMFLTAKLKLLEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVT  884
             SQF  D    + +TA       VVY+G+IREKP +KEEAREFIK YS      + SV+V 
Sbjct  72    SQFAQDHQPTLLITADT----AVVYKGVIREKPTSKEEAREFIKGYSGSHGGVVGSVIVR  127

Query  885   NLKTGKKRGELDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGAT  1064
             NL+TG +RG  +K E+YFHEIPE VID LI++     VAGGL++EHPLI P+I  V G  
Sbjct  128   NLQTGVRRGGWEKAEVYFHEIPEQVIDDLIDDAITFKVAGGLMLEHPLISPFIDSVMGGV  187

Query  1065  DSVMGLPKALTQKLITEVL  1121
             D+VMGLPK LT+K I +VL
Sbjct  188   DTVMGLPKELTEKFINDVL  206


 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 61/78 (78%), Gaps = 1/78 (1%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLN  257
            FKLILGS S  R+++LAEMGY+F  ++ADIDEKAIRK+KPEDLV+A+AEAKA  II +L 
Sbjct  10   FKLILGSQSMARKRILAEMGYDFTIVTADIDEKAIRKDKPEDLVVAVAEAKANEIISKLG  69

Query  258  IDESM-EDAEPMLLITCD  308
             +    +D +P LLIT D
Sbjct  70   GESQFAQDHQPTLLITAD  87



>ref|XP_010429543.1| PREDICTED: maf-like protein DDB_G0281937 [Camelina sativa]
Length=208

 Score =   154 bits (388),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 88/118 (75%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVVY+G+IREKP +KEEAREFIK YS      + SV+V NL+TG +RG  +K E+YFHEI
Sbjct  91    VVVYKGVIREKPTSKEEAREFIKGYSGSHGGVVGSVIVRNLQTGVRRGGWEKAEVYFHEI  150

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             PE VID LI++     VAGGL++EHPLI P+I  V G  D+VMGLPK LTQK I +VL
Sbjct  151   PEQVIDDLIDDAITFKVAGGLMLEHPLISPFIDSVMGGVDTVMGLPKELTQKFINDVL  208


 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 60/82 (73%), Gaps = 3/82 (4%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLN  257
            FKLILGS S  R+++LAEMGY+F  ++ADIDEKAIRK+KPEDLV+A+AEAKA  II +L 
Sbjct  10   FKLILGSQSMARKRILAEMGYDFTIVTADIDEKAIRKDKPEDLVVAVAEAKANEIISKLG  69

Query  258  IDESM---EDAEPMLLITCDQV  314
             +         +P LLIT D V
Sbjct  70   GESQFAQDHHHQPTLLITADTV  91



>gb|ABA94173.1| Maf-like protein, expressed [Oryza sativa Japonica Group]
 dbj|BAH01012.1| unnamed protein product [Oryza sativa Japonica Group]
Length=209

 Score =   154 bits (388),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 92/118 (78%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVV+EG+IREKP  KEEAR+F+K YS    AT+ SV+VTNL TGK+ G LDK E+YFH+I
Sbjct  92    VVVHEGIIREKPTTKEEARQFLKGYSGSHVATVGSVVVTNLTTGKRLGSLDKAEVYFHDI  151

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             P++VI+ LI+EG V  VAGGLL+EHPL  P+++ V G++DSVMG+ K L  KLI + L
Sbjct  152   PDEVIENLIDEGVVFRVAGGLLLEHPLTLPFVEAVVGSSDSVMGISKDLANKLIQDAL  209


 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 63/85 (74%), Gaps = 1/85 (1%)
 Frame = +3

Query  63   GNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAI  242
             ++ PFKLILGS+S  R+ +LAEMG EF  M+ADIDEK+IR+E P++LV  LAEAKA+AI
Sbjct  8    ASSQPFKLILGSSSVARKHILAEMGLEFEVMTADIDEKSIRRENPDELVTILAEAKADAI  67

Query  243  IPRLNI-DESMEDAEPMLLITCDQV  314
            + RLNI D   E   P LLIT D V
Sbjct  68   MSRLNISDYQKEGDRPTLLITSDIV  92



>ref|XP_006301614.1| hypothetical protein CARUB_v10022055mg [Capsella rubella]
 gb|EOA34512.1| hypothetical protein CARUB_v10022055mg [Capsella rubella]
Length=207

 Score =   154 bits (388),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 95/139 (68%), Gaps = 4/139 (3%)
 Frame = +3

Query  705   SQFR*DLSVLMFLTAKLKLLEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVT  884
             SQF  D    + +TA      VVVY+G+IREKP +KEEAREFIK YS      + SVLV 
Sbjct  72    SQFAQDPQPTLLITADT----VVVYKGVIREKPTSKEEAREFIKGYSGSHGGVVGSVLVW  127

Query  885   NLKTGKKRGELDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGAT  1064
             NLKTG +RG  DK E+YFHEIPE VID+LI++     VAGG ++EHPLI P++  V G  
Sbjct  128   NLKTGVRRGGWDKAEVYFHEIPERVIDELIDDAITYTVAGGAMLEHPLISPFVDSVVGGV  187

Query  1065  DSVMGLPKALTQKLITEVL  1121
             D+VMGL K LT+K I +VL
Sbjct  188   DTVMGLSKELTEKFINDVL  206


 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 60/80 (75%), Gaps = 1/80 (1%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLN  257
            FKLILGS S  R+++LA+MGYE+  ++ADIDEKAIR +KPEDLV+ALA AKA  II +L 
Sbjct  10   FKLILGSQSMARKRILAKMGYEYTIVTADIDEKAIRTDKPEDLVVALAGAKAMEIISKLG  69

Query  258  IDESM-EDAEPMLLITCDQV  314
             +    +D +P LLIT D V
Sbjct  70   GESQFAQDPQPTLLITADTV  89



>ref|XP_003631878.1| PREDICTED: maf-like protein DDB_G0281937 [Vitis vinifera]
 emb|CBI17516.3| unnamed protein product [Vitis vinifera]
Length=204

 Score =   153 bits (386),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 97/134 (72%), Gaps = 4/134 (3%)
 Frame = +3

Query  720   DLSVLMFLTAKLKLLEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTG  899
             DL   + +TA      VV Y+G IREKP ++EEAREF+K YS      + SVLVTNLKTG
Sbjct  75    DLPPTLLITADT----VVEYKGTIREKPSSEEEAREFVKGYSGSHGGVVGSVLVTNLKTG  130

Query  900   KKRGELDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMG  1079
              ++G  ++ E+YF++IP++VID +IEEG  L VAGGL++EHPL  P+++ V G+TD VMG
Sbjct  131   TRKGGWERAEVYFYDIPDEVIDNMIEEGISLNVAGGLMLEHPLTLPFVESVVGSTDCVMG  190

Query  1080  LPKALTQKLITEVL  1121
             LPKALT+ LI E L
Sbjct  191   LPKALTESLIQEAL  204


 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 64/80 (80%), Gaps = 1/80 (1%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLN  257
            FK+ILGS+S  RR++LAEMGYEF  ++ADIDEK IRKE PE+LVMALAEAKA+AI+ +L 
Sbjct  8    FKIILGSSSVARRRILAEMGYEFTIVTADIDEKGIRKETPEELVMALAEAKADAILSKLQ  67

Query  258  IDESM-EDAEPMLLITCDQV  314
            I + + ED  P LLIT D V
Sbjct  68   IKDYLAEDLPPTLLITADTV  87



>ref|XP_006375639.1| hypothetical protein POPTR_0014s18360g [Populus trichocarpa]
 gb|ABK92653.1| unknown [Populus trichocarpa]
 gb|ERP53436.1| hypothetical protein POPTR_0014s18360g [Populus trichocarpa]
Length=198

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 92/120 (77%), Gaps = 4/120 (3%)
 Frame = +3

Query  699   PPSQFR*DLSVLMFLTAKLKLLEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVL  878
             P S +  D    + +TA     +VVVYEG IREKP +KEEA EFIK YS G AAT+ SVL
Sbjct  66    PISDYTKDAEPTLLITAD----QVVVYEGAIREKPASKEEAWEFIKGYSGGHAATVGSVL  121

Query  879   VTNLKTGKKRGELDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAG  1058
             VTNLKTG ++GE D+VEIYFHEIP++VI+KLIEEG VL VAGGL+IEHPL+ PYIK V G
Sbjct  122   VTNLKTGFRKGEWDRVEIYFHEIPDEVIEKLIEEGIVLRVAGGLIIEHPLLLPYIKEVVG  181


 Score =   108 bits (271),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLN  257
            FKLILGSAS  RR++L EMGYEF   +ADIDEK+IR+EKPEDLVM LAEAKA+ I+ +L 
Sbjct  7    FKLILGSASFSRRKILEEMGYEFTISTADIDEKSIREEKPEDLVMTLAEAKADTILQKLP  66

Query  258  IDESMEDAEPMLLITCDQV  314
            I +  +DAEP LLIT DQV
Sbjct  67   ISDYTKDAEPTLLITADQV  85



>gb|AAO00680.1| Unknown protein [Oryza sativa Japonica Group]
 gb|AAO06956.1| Unknown protein [Oryza sativa Japonica Group]
Length=359

 Score =   156 bits (395),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 94/119 (79%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVV++G+IREKP   EEAR+FIK YS   AATI SVLVTN+K+G ++   DK E+YFH+
Sbjct  238   QVVVHDGVIREKPSTPEEARKFIKGYSESHAATIGSVLVTNVKSGARKEGWDKAEVYFHK  297

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP++V++ LIEEG V YVAGGLL+EHPL  P ++ + G  DSVMGLPK+LT+KLI E L
Sbjct  298   IPDEVVESLIEEGDVFYVAGGLLVEHPLTSPLVEAIVGTIDSVMGLPKSLTEKLIKESL  356


 Score = 58.9 bits (141),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 42/57 (74%), Gaps = 4/57 (7%)
 Frame = +3

Query  156  SADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLN----IDESMEDAEPMLLITCDQV  314
            SADIDEK IRKEKPE+LV+ALA AKA+AI+ +L     + E ++  E  LLIT DQV
Sbjct  183  SADIDEKEIRKEKPEELVVALAHAKADAIMEKLRDNGMMKEILDSQETTLLITADQV  239



>emb|CDY18610.1| BnaA09g07850D [Brassica napus]
Length=215

 Score =   152 bits (383),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 94/138 (68%), Gaps = 4/138 (3%)
 Frame = +3

Query  705   SQFR*DLSVLMFLTAKLKLLEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVT  884
             SQF  DL   + +TA      VVVY+G+IREKP  K+EAR FIK YS      + SVLV 
Sbjct  69    SQFAQDLQPTLLITAD----TVVVYKGVIREKPTTKDEARLFIKGYSGSHGGVVGSVLVR  124

Query  885   NLKTGKKRGELDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGAT  1064
             NLKTG +R   DK E+YFHEIPE VID LI++     VAGGL++EHPLI P+I  V G  
Sbjct  125   NLKTGVQRIGWDKAEVYFHEIPEKVIDDLIDDAVTFKVAGGLMLEHPLIAPFIDTVVGGV  184

Query  1065  DSVMGLPKALTQKLITEV  1118
             D+VMGLPK LT+K IT++
Sbjct  185   DTVMGLPKDLTEKFITDL  202


 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 61/80 (76%), Gaps = 1/80 (1%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLN  257
            FK+ILGS S  R+++LAEMGY+F  ++ADIDEKAIR++ PEDLV+A+A+AKA+ II +L 
Sbjct  7    FKMILGSQSMARKRILAEMGYDFTVVTADIDEKAIRRDNPEDLVVAIAQAKADEIISKLG  66

Query  258  IDESM-EDAEPMLLITCDQV  314
                  +D +P LLIT D V
Sbjct  67   GQSQFAQDLQPTLLITADTV  86



>gb|KDP38287.1| hypothetical protein JCGZ_05173 [Jatropha curcas]
Length=249

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/138 (53%), Positives = 98/138 (71%), Gaps = 4/138 (3%)
 Frame = +3

Query  708   QFR*DLSVLMFLTAKLKLLEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTN  887
             Q   D    + +TA      VVVY+G++REKP ++EEAR FIK YS+   A + SVLV N
Sbjct  116   QLEEDARATLLITAD----TVVVYKGIVREKPTSREEARNFIKGYSSDSGAVVGSVLVIN  171

Query  888   LKTGKKRGELDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATD  1067
             LKTG ++G  ++ E+YFHEIP+ VI+ LIE+G    VAGGL++EHPLI P+++ V G+TD
Sbjct  172   LKTGIRKGAWERAEVYFHEIPDGVINSLIEDGVTFKVAGGLMLEHPLISPFVEAVIGSTD  231

Query  1068  SVMGLPKALTQKLITEVL  1121
             +VMGL K LT+KLI E L
Sbjct  232   TVMGLSKTLTEKLIAEAL  249


 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 67/89 (75%), Gaps = 1/89 (1%)
 Frame = +3

Query  51   RKMEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAK  230
            ++M+     FK+ILGS+S  RR++LAEMGYEF  ++ADIDEK+IRK+KPE+LVM+LA AK
Sbjct  44   KQMDVCKSSFKIILGSSSMARRRILAEMGYEFSIVTADIDEKSIRKDKPEELVMSLAHAK  103

Query  231  AEAIIPRLNIDESM-EDAEPMLLITCDQV  314
            A+AII RL     + EDA   LLIT D V
Sbjct  104  ADAIIARLQTTGQLEEDARATLLITADTV  132



>emb|CDP02020.1| unnamed protein product [Coffea canephora]
Length=204

 Score =   151 bits (381),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 90/118 (76%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             V V+EG +REKP +KEEAR++++DYS G  + + SV+V+NL +G ++G  D+ E+YFHEI
Sbjct  87    VAVFEGTVREKPSSKEEARKYLRDYSRGHTSVLGSVVVSNLTSGNRKGGWDRAEVYFHEI  146

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             P+DVID LIEEG +L V+G L++EHPL  P++  V G  D VMGL KALT+KLI E L
Sbjct  147   PDDVIDNLIEEGIILNVSGALMLEHPLTLPFVDTVIGTADHVMGLSKALTEKLIQEAL  204


 Score =   108 bits (271),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 66/80 (83%), Gaps = 1/80 (1%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRL-  254
            FK+ILGS+S  RRQ+L+EMG+EF  M+ADIDEK++RKEKPEDLVMALAEAKA+AII RL 
Sbjct  8    FKIILGSSSVARRQILSEMGFEFTVMTADIDEKSVRKEKPEDLVMALAEAKADAIISRLK  67

Query  255  NIDESMEDAEPMLLITCDQV  314
            N     E+ +P+LLIT D V
Sbjct  68   NTSYLGENEQPVLLITADTV  87



>ref|XP_004146552.1| PREDICTED: maf-like protein DDB_G0281937-like [Cucumis sativus]
 ref|XP_004160986.1| PREDICTED: maf-like protein DDB_G0281937-like [Cucumis sativus]
Length=205

 Score =   151 bits (381),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 92/118 (78%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVVYEG IREKP NK+EAR+FIK YS   A+ + SVLVTNL TG ++G  ++ E+YF++I
Sbjct  88    VVVYEGTIREKPSNKDEARKFIKGYSGSHASVVGSVLVTNLMTGTRKGGWEEAEVYFYDI  147

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             PE++ID LIE+     VAGGL++EHPL  P ++ V G+TD+VMGLPKALT+KL+ + L
Sbjct  148   PEEIIDTLIEDDVTFKVAGGLMLEHPLTLPLVEAVVGSTDTVMGLPKALTEKLMNDAL  205


 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 65/82 (79%), Gaps = 2/82 (2%)
 Frame = +3

Query  75   PFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRL  254
            PF++ILGS+S  RR++L+EMGYEF  M+ADIDEKAIRKE+PE+LV+ALAEAKA+AI+ R+
Sbjct  7    PFQIILGSSSMARRRILSEMGYEFTIMTADIDEKAIRKERPEELVVALAEAKADAIMSRI  66

Query  255  NID--ESMEDAEPMLLITCDQV  314
                 +   DA P LLIT D V
Sbjct  67   LATGVQLNNDAHPTLLITADTV  88



>ref|XP_007156045.1| hypothetical protein PHAVU_003G253800g [Phaseolus vulgaris]
 gb|ESW28039.1| hypothetical protein PHAVU_003G253800g [Phaseolus vulgaris]
Length=204

 Score =   150 bits (380),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 75/140 (54%), Positives = 98/140 (70%), Gaps = 4/140 (3%)
 Frame = +3

Query  696   PPPSQFR*DLSVLMFLTAKLKLLEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSV  875
             P   +   D S  + +TA      VVVY+G+IREKP +++EAREFIK YS   AA + SV
Sbjct  67    PAGGRLEEDDSTTLLITADT----VVVYQGIIREKPTSEKEAREFIKGYSGSHAAVVGSV  122

Query  876   LVTNLKTGKKRGELDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVA  1055
             +VTNL TGK+ G  D  E+YF EIP++VID LI+EG    VAGGL++EHPL  P++  V 
Sbjct  123   VVTNLATGKRVGGWDSAEVYFLEIPDEVIDSLIDEGITFNVAGGLMLEHPLTLPFVDAVV  182

Query  1056  GATDSVMGLPKALTQKLITE  1115
             G+TD+VMGL KALT+KL+ E
Sbjct  183   GSTDTVMGLSKALTEKLLLE  202


 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 63/81 (78%), Gaps = 1/81 (1%)
 Frame = +3

Query  75   PFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRL  254
            PFK+ILGS+S  RR++L+EMGYEF  M+ADIDEK+IR+EKPEDLVM LAEAKA+AI+ RL
Sbjct  7    PFKIILGSSSNARREILSEMGYEFTIMTADIDEKSIRREKPEDLVMVLAEAKADAIVQRL  66

Query  255  NIDESM-EDAEPMLLITCDQV  314
                 + ED    LLIT D V
Sbjct  67   PAGGRLEEDDSTTLLITADTV  87



>ref|XP_003548889.1| PREDICTED: maf-like protein DDB_G0281937-like isoform X1 [Glycine 
max]
 gb|KHN11097.1| Maf-like protein [Glycine soja]
Length=204

 Score =   150 bits (380),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 96/134 (72%), Gaps = 4/134 (3%)
 Frame = +3

Query  720   DLSVLMFLTAKLKLLEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTG  899
             D S  + +TA      VVVY G+IREKP +++EAR+FIK YS   AA + SV+VTNL TG
Sbjct  75    DASTTLLITADT----VVVYRGVIREKPTSEKEARDFIKGYSGSHAAVVGSVVVTNLATG  130

Query  900   KKRGELDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMG  1079
             K+ G  D  E+YF EIP++VID LI+EG    VAGGL++EHPL  P++  V G+TD+VMG
Sbjct  131   KRCGGWDSAEVYFLEIPDEVIDNLIDEGITFNVAGGLMLEHPLTLPFVDAVVGSTDTVMG  190

Query  1080  LPKALTQKLITEVL  1121
             L KALT+KL+ E L
Sbjct  191   LSKALTEKLLLEAL  204


 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 64/81 (79%), Gaps = 1/81 (1%)
 Frame = +3

Query  75   PFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRL  254
            PFK+ILGS+S  RR++L+EMGYEF  M+ADIDEK IR+EKPEDLVMALAEAKA+AI+ RL
Sbjct  7    PFKIILGSSSKARREILSEMGYEFTVMTADIDEKCIRREKPEDLVMALAEAKADAIVQRL  66

Query  255  NIDESM-EDAEPMLLITCDQV  314
                 + EDA   LLIT D V
Sbjct  67   PTGGPLEEDASTTLLITADTV  87



>ref|XP_004509262.1| PREDICTED: maf-like protein DDB_G0281937-like [Cicer arietinum]
Length=205

 Score =   150 bits (379),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 95/134 (71%), Gaps = 4/134 (3%)
 Frame = +3

Query  720   DLSVLMFLTAKLKLLEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTG  899
             D S  + +TA      VVVY G IREKP +++EAREFIK YS   AA + SV+VTNL TG
Sbjct  75    DASSTLLITADT----VVVYRGTIREKPTSEKEAREFIKGYSGSHAAVVGSVVVTNLATG  130

Query  900   KKRGELDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMG  1079
             K+ G  +  E+YF EIP++VID LI+EG    VAGGL++EHPL  P++  V G+TD+VMG
Sbjct  131   KRYGGWESAEVYFLEIPDEVIDNLIDEGVTFNVAGGLMLEHPLTLPFVDAVIGSTDTVMG  190

Query  1080  LPKALTQKLITEVL  1121
             L KALT+KLI E L
Sbjct  191   LSKALTEKLIMEAL  204


 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 65/87 (75%), Gaps = 1/87 (1%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            M      FK+ILGS+S  R+Q+LAEMGYEF  M+ADIDEK+IR+EKP+DLV+ LAEAKA+
Sbjct  1    MASKNPSFKIILGSSSKARKQILAEMGYEFTIMTADIDEKSIRREKPQDLVVTLAEAKAD  60

Query  237  AIIPRLNIDESME-DAEPMLLITCDQV  314
            AI+ RL  D  +E DA   LLIT D V
Sbjct  61   AIVQRLLTDGPLETDASSTLLITADTV  87



>gb|KGN53301.1| hypothetical protein Csa_4G046640 [Cucumis sativus]
Length=232

 Score =   151 bits (381),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 92/118 (78%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVVYEG IREKP NK+EAR+FIK YS   A+ + SVLVTNL TG ++G  ++ E+YF++I
Sbjct  115   VVVYEGTIREKPSNKDEARKFIKGYSGSHASVVGSVLVTNLMTGTRKGGWEEAEVYFYDI  174

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             PE++ID LIE+     VAGGL++EHPL  P ++ V G+TD+VMGLPKALT+KL+ + L
Sbjct  175   PEEIIDTLIEDDVTFKVAGGLMLEHPLTLPLVEAVVGSTDTVMGLPKALTEKLMNDAL  232


 Score =   103 bits (258),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 77/110 (70%), Gaps = 7/110 (6%)
 Frame = +3

Query  6    TLLLRSPPAYTGISP-----RKMEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADID  170
            +L++++P     IS      R+M     PF++ILGS+S  RR++L+EMGYEF  M+ADID
Sbjct  6    SLMVQTPNLIRRISTKIRDCREMAAPKSPFQIILGSSSMARRRILSEMGYEFTIMTADID  65

Query  171  EKAIRKEKPEDLVMALAEAKAEAIIPRLNID--ESMEDAEPMLLITCDQV  314
            EKAIRKE+PE+LV+ALAEAKA+AI+ R+     +   DA P LLIT D V
Sbjct  66   EKAIRKERPEELVVALAEAKADAIMSRILATGVQLNNDAHPTLLITADTV  115



>ref|XP_009101836.1| PREDICTED: maf-like protein DDB_G0281937 isoform X3 [Brassica 
rapa]
Length=200

 Score =   150 bits (378),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 96/119 (81%), Gaps = 4/119 (3%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYE  +REKP +  EARE+I+ ++    AT+SSV+VTNL TG ++G +D+VEIYF+E
Sbjct  83    QVVVYEDAVREKPSSVVEAREYIRRHT----ATVSSVVVTNLNTGFRKGGVDRVEIYFNE  138

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             I E++IDKLIEEG VL VAG LLIEHPLI P IK+V G TDSVMGLPK LT+KL+ EVL
Sbjct  139   ISEEIIDKLIEEGMVLRVAGALLIEHPLILPCIKQVVGTTDSVMGLPKELTEKLLKEVL  197


 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 70/87 (80%), Gaps = 4/87 (5%)
 Frame = +3

Query  57   MEGNTWP-FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKA  233
            ME +  P FK+ILGS+S  RR +L +MGY+F  MSADIDEK+IRKEKPE+LV+ALAEAKA
Sbjct  1    MESDRPPHFKVILGSSSIARRSILTDMGYQFTLMSADIDEKSIRKEKPEELVLALAEAKA  60

Query  234  EAIIPRLNIDESMEDAEPMLLITCDQV  314
            EAI+ R  I + +ED +P LL+TCDQV
Sbjct  61   EAIVQR--IPDDVED-KPTLLVTCDQV  84



>emb|CDX81389.1| BnaC09g08000D [Brassica napus]
 emb|CDX81390.1| BnaC09g08010D [Brassica napus]
Length=218

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 94/139 (68%), Gaps = 4/139 (3%)
 Frame = +3

Query  705   SQFR*DLSVLMFLTAKLKLLEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVT  884
             +QF  D    + +TA      VVVY+G+IREKP  K+EAR FIK YS      + SVLV 
Sbjct  69    TQFAQDPQPTLLITAD----TVVVYKGVIREKPTTKDEARLFIKGYSGSHGGVVGSVLVR  124

Query  885   NLKTGKKRGELDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGAT  1064
             NLKTG +R   DK E+YFHEIPE VID LI++     VAGGL++EHPLI P+I  V G  
Sbjct  125   NLKTGVQRIGWDKAEVYFHEIPEKVIDDLIDDAVTFKVAGGLMLEHPLIAPFIDTVVGGV  184

Query  1065  DSVMGLPKALTQKLITEVL  1121
             D+VMGLPK LT+K IT+VL
Sbjct  185   DTVMGLPKDLTEKFITDVL  203


 Score = 95.1 bits (235),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 63/80 (79%), Gaps = 1/80 (1%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRL-  254
            FK+ILGS S  R+++LAEMGYEF  ++ADIDEKAIR++ PEDLV+A+A+AKA+ II +L 
Sbjct  7    FKMILGSQSMARKRILAEMGYEFTVVTADIDEKAIRRDNPEDLVVAIAQAKADEIISKLG  66

Query  255  NIDESMEDAEPMLLITCDQV  314
             + +  +D +P LLIT D V
Sbjct  67   GLTQFAQDPQPTLLITADTV  86



>ref|XP_010029803.1| PREDICTED: maf-like protein DDB_G0281937 [Eucalyptus grandis]
Length=232

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 97/134 (72%), Gaps = 4/134 (3%)
 Frame = +3

Query  720   DLSVLMFLTAKLKLLEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTG  899
             D+   + +TA      VVVYEG IREKP +K+EAR FI++YS G+A  + SVLVTNLKTG
Sbjct  102   DVHTTLLITAD----TVVVYEGRIREKPSSKDEARHFIEEYSGGRADVVGSVLVTNLKTG  157

Query  900   KKRGELDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMG  1079
             ++    ++ E+YF++IP  V+  LI+EG  L VAGGL++EHPL  P++K V G  D+VMG
Sbjct  158   RREAGWERAEVYFYDIPAQVVQSLIDEGITLNVAGGLMLEHPLTLPFVKEVIGTDDTVMG  217

Query  1080  LPKALTQKLITEVL  1121
             LPK+LT++LI E L
Sbjct  218   LPKSLTERLIQEAL  231


 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 65/81 (80%), Gaps = 1/81 (1%)
 Frame = +3

Query  75   PFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRL  254
            PFK+ILGS+S  RR +LAEMGY+F  M+ADIDEKAIRKEKPEDLV ALAEAKA+AI+ RL
Sbjct  34   PFKIILGSSSMARRHILAEMGYDFTVMTADIDEKAIRKEKPEDLVTALAEAKADAILSRL  93

Query  255  -NIDESMEDAEPMLLITCDQV  314
             N+D  +ED    LLIT D V
Sbjct  94   QNVDSFVEDVHTTLLITADTV  114



>gb|KHN00541.1| Maf-like protein [Glycine soja]
Length=179

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 95/134 (71%), Gaps = 4/134 (3%)
 Frame = +3

Query  720   DLSVLMFLTAKLKLLEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTG  899
             D S  + +TA      VVVY G+IREKP +++EA EFIK YS   AA + S++VTNL TG
Sbjct  50    DASTTLLITADT----VVVYRGVIREKPTSEKEAHEFIKGYSGSHAAVVGSIVVTNLATG  105

Query  900   KKRGELDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMG  1079
             K+ G  D  E+YF EIP++VID LI+EG    VAGGL++EHPL  P++  V G+TD+VMG
Sbjct  106   KRCGGWDSAEVYFLEIPDEVIDSLIDEGITFNVAGGLMLEHPLTLPFVDAVVGSTDTVMG  165

Query  1080  LPKALTQKLITEVL  1121
             L KALT+KL+ E L
Sbjct  166   LSKALTEKLLLEAL  179


 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = +3

Query  132  MGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLNIDESM-EDAEPMLLITCD  308
            MGYEF  M+ADIDEK IR+EKPEDLVMALAEAKA+AI+ RL +   + EDA   LLIT D
Sbjct  1    MGYEFAIMTADIDEKGIRREKPEDLVMALAEAKADAIVQRLPVGGPLEEDASTTLLITAD  60

Query  309  QV  314
             V
Sbjct  61   TV  62



>ref|XP_007223814.1| hypothetical protein PRUPE_ppa010722mg [Prunus persica]
 gb|EMJ25013.1| hypothetical protein PRUPE_ppa010722mg [Prunus persica]
Length=187

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVVYEG+IREKP +KEEAR+F+KDYS G AAT+ SV VTNLKTG  +GE D+VEIYFHEI
Sbjct  88    VVVYEGVIREKPSSKEEARQFLKDYSGGHAATVGSVHVTNLKTGFSKGEWDRVEIYFHEI  147

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRV  1052
             P+++I+KLIEEGTVL VAGGL+IEHPLI P++K V
Sbjct  148   PDEIIEKLIEEGTVLKVAGGLIIEHPLILPFVKEV  182


 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 69/88 (78%), Gaps = 2/88 (2%)
 Frame = +3

Query  57   MEGNTWP-FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKA  233
            ME N+   FK+ILGSAS  RR++LAEMGYEFI M+ADIDEK IRKEKPE+LV+ LA+AKA
Sbjct  1    MEANSSSSFKIILGSASVARRKILAEMGYEFIVMTADIDEKCIRKEKPEELVLVLAQAKA  60

Query  234  EAIIPRL-NIDESMEDAEPMLLITCDQV  314
            +AII +L  I+   +DAEP ++I  D V
Sbjct  61   DAIISKLQTINNQEKDAEPTIVIAADTV  88



>ref|XP_006294863.1| hypothetical protein CARUB_v10023917mg [Capsella rubella]
 gb|EOA27761.1| hypothetical protein CARUB_v10023917mg [Capsella rubella]
Length=235

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 94/139 (68%), Gaps = 4/139 (3%)
 Frame = +3

Query  705   SQFR*DLSVLMFLTAKLKLLEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVT  884
             SQF  D    + +TA      VVVY+G+IREKP +KEEA EFI+ YS      +SSV+V 
Sbjct  101   SQFAKDPKPTLLITADT----VVVYKGVIREKPTSKEEALEFIRGYSGSHGGVVSSVIVR  156

Query  885   NLKTGKKRGELDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGAT  1064
             NLKTG +RG  +K E+YFHEIP+ VID LI +     VAGGL +EHPLI P+I  V G  
Sbjct  157   NLKTGVRRGGWEKAEVYFHEIPKQVIDDLINDAITYKVAGGLTLEHPLISPFIDSVMGGV  216

Query  1065  DSVMGLPKALTQKLITEVL  1121
             D+VMGLPK LT+K I EVL
Sbjct  217   DTVMGLPKELTEKFINEVL  235


 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 61/80 (76%), Gaps = 1/80 (1%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLN  257
            FKLILGS S  R+++LAEMGY+F  ++ADIDEKAIRK+KPEDLV+A+AEAK   II +L 
Sbjct  39   FKLILGSQSMARKRILAEMGYDFTIVTADIDEKAIRKDKPEDLVVAIAEAKENEIISKLG  98

Query  258  IDESM-EDAEPMLLITCDQV  314
             +    +D +P LLIT D V
Sbjct  99   GESQFAKDPKPTLLITADTV  118



>ref|XP_003520319.1| PREDICTED: maf-like protein DDB_G0281937-like isoform X1 [Glycine 
max]
Length=204

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 95/134 (71%), Gaps = 4/134 (3%)
 Frame = +3

Query  720   DLSVLMFLTAKLKLLEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTG  899
             D S  + +TA      VVVY G+IREKP +++EA EFIK YS   AA + S++VTNL TG
Sbjct  75    DASTTLLITADT----VVVYRGVIREKPTSEKEAHEFIKGYSGSHAAVVGSIVVTNLATG  130

Query  900   KKRGELDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMG  1079
             K+ G  D  E+YF EIP++VID LI+EG    VAGGL++EHPL  P++  V G+TD+VMG
Sbjct  131   KRCGGWDSAEVYFLEIPDEVIDSLIDEGITFNVAGGLMLEHPLTLPFVDAVVGSTDTVMG  190

Query  1080  LPKALTQKLITEVL  1121
             L KALT+KL+ E L
Sbjct  191   LSKALTEKLLLEAL  204


 Score =   109 bits (272),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 65/81 (80%), Gaps = 1/81 (1%)
 Frame = +3

Query  75   PFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRL  254
            PFK+ILGS+S  RR++LAEMGYEF  M+ADIDEK IR+EKPEDLVMALAEAKA+AI+ RL
Sbjct  7    PFKIILGSSSKARREILAEMGYEFAIMTADIDEKGIRREKPEDLVMALAEAKADAIVQRL  66

Query  255  NIDESM-EDAEPMLLITCDQV  314
             +   + EDA   LLIT D V
Sbjct  67   PVGGPLEEDASTTLLITADTV  87



>ref|XP_006294864.1| hypothetical protein CARUB_v10023917mg, partial [Capsella rubella]
 gb|EOA27762.1| hypothetical protein CARUB_v10023917mg, partial [Capsella rubella]
Length=250

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 94/139 (68%), Gaps = 4/139 (3%)
 Frame = +3

Query  705   SQFR*DLSVLMFLTAKLKLLEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVT  884
             SQF  D    + +TA      VVVY+G+IREKP +KEEA EFI+ YS      +SSV+V 
Sbjct  116   SQFAKDPKPTLLITADT----VVVYKGVIREKPTSKEEALEFIRGYSGSHGGVVSSVIVR  171

Query  885   NLKTGKKRGELDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGAT  1064
             NLKTG +RG  +K E+YFHEIP+ VID LI +     VAGGL +EHPLI P+I  V G  
Sbjct  172   NLKTGVRRGGWEKAEVYFHEIPKQVIDDLINDAITYKVAGGLTLEHPLISPFIDSVMGGV  231

Query  1065  DSVMGLPKALTQKLITEVL  1121
             D+VMGLPK LT+K I EVL
Sbjct  232   DTVMGLPKELTEKFINEVL  250


 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 61/80 (76%), Gaps = 1/80 (1%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLN  257
            FKLILGS S  R+++LAEMGY+F  ++ADIDEKAIRK+KPEDLV+A+AEAK   II +L 
Sbjct  54   FKLILGSQSMARKRILAEMGYDFTIVTADIDEKAIRKDKPEDLVVAIAEAKENEIISKLG  113

Query  258  IDESM-EDAEPMLLITCDQV  314
             +    +D +P LLIT D V
Sbjct  114  GESQFAKDPKPTLLITADTV  133



>ref|XP_008452089.1| PREDICTED: maf-like protein DDB_G0281937 [Cucumis melo]
 ref|XP_008452090.1| PREDICTED: maf-like protein DDB_G0281937 [Cucumis melo]
Length=232

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 92/118 (78%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVVYEG IREKP +K+EAR+FIK YS   A+ + SVLVTNL TG ++G  ++ E+YF++I
Sbjct  115   VVVYEGTIREKPSDKDEARKFIKGYSGSHASVVGSVLVTNLMTGTRKGGWEEAEVYFYDI  174

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             PE++ID LIE+     VAGGL++EHPL  P ++ V G+TD+VMGLPKALT+KL+ + L
Sbjct  175   PEEIIDTLIEDDVTFKVAGGLMLEHPLTLPLVEAVVGSTDTVMGLPKALTEKLMNDAL  232


 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 77/110 (70%), Gaps = 7/110 (6%)
 Frame = +3

Query  6    TLLLRSPPAYTGISP-----RKMEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADID  170
            +L++++P     IS      R+M     PF++ILGS+S  RR++L+EMGYEF  M+ADID
Sbjct  6    SLMVQTPNLIRRISTKIRDCREMVAPKSPFQIILGSSSMARRRILSEMGYEFTIMTADID  65

Query  171  EKAIRKEKPEDLVMALAEAKAEAIIPRLNID--ESMEDAEPMLLITCDQV  314
            EKAIRKE+PE+LV+ALAEAKA+AI+ R+     +   DA P LLIT D V
Sbjct  66   EKAIRKERPEELVVALAEAKADAIMSRILATGVQLNNDAHPTLLITADTV  115



>ref|XP_003629446.1| Maf-like protein [Medicago truncatula]
 gb|AET03922.1| Maf DDB-G0281937-like protein [Medicago truncatula]
Length=204

 Score =   148 bits (373),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 73/138 (53%), Positives = 96/138 (70%), Gaps = 4/138 (3%)
 Frame = +3

Query  708   QFR*DLSVLMFLTAKLKLLEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTN  887
             Q   D S  + +TA      VVVY G+IREKP +++EAREF+K YS   AA + SV+VTN
Sbjct  71    QLEADASTTLLITADT----VVVYRGIIREKPTSEKEAREFVKGYSGSHAAVVGSVVVTN  126

Query  888   LKTGKKRGELDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATD  1067
             L TGK+ G  +  E+YF EIP++VID LI++G    VAGGL++EHPL  P++  V G+ D
Sbjct  127   LVTGKRYGGWEGAEVYFLEIPDEVIDNLIDDGVTFNVAGGLMLEHPLTLPFVDAVVGSAD  186

Query  1068  SVMGLPKALTQKLITEVL  1121
             +VMGL KALT+KLI E L
Sbjct  187   TVMGLSKALTEKLIMEAL  204


 Score =   103 bits (256),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 64/80 (80%), Gaps = 1/80 (1%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLN  257
            +++ILGS+S  R+Q+LAEMGYEF  M+ADIDEK+IR+EKPEDLV+ LAEAKA+AI+ RL 
Sbjct  8    YRIILGSSSKARKQILAEMGYEFTIMTADIDEKSIRREKPEDLVVTLAEAKADAIVQRLL  67

Query  258  IDESME-DAEPMLLITCDQV  314
             D  +E DA   LLIT D V
Sbjct  68   NDGQLEADASTTLLITADTV  87



>emb|CDY45239.1| BnaA07g12510D [Brassica napus]
Length=227

 Score =   148 bits (374),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 94/139 (68%), Gaps = 4/139 (3%)
 Frame = +3

Query  705   SQFR*DLSVLMFLTAKLKLLEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVT  884
             SQF  D    + +TA      VVVY+G+IREKP +KEEAR+FIK YS      + SV+V+
Sbjct  93    SQFAQDPLPTLLITAD----TVVVYKGVIREKPTSKEEARQFIKGYSGSHGGVVGSVIVS  148

Query  885   NLKTGKKRGELDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGAT  1064
             NLKTG +R   DK E+YF EIP  VID LI++     VAGGL +EHPLI P+I  V G  
Sbjct  149   NLKTGVQRAGWDKAEVYFREIPAKVIDDLIDDSITFKVAGGLTLEHPLISPFIDTVVGGV  208

Query  1065  DSVMGLPKALTQKLITEVL  1121
             D+VMGLPK LT+K IT+VL
Sbjct  209   DTVMGLPKELTEKFITDVL  227


 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +3

Query  93   GSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLNIDESM  272
            G  S  R+++L EMGY+F  ++ADIDEKAIR++ P+DLV+ALA+AKA+ II +L      
Sbjct  36   GFKSMARKKILGEMGYDFTIVTADIDEKAIRRDNPQDLVVALAQAKADEIISKLGGQSQF  95

Query  273  -EDAEPMLLITCDQV  314
             +D  P LLIT D V
Sbjct  96   AQDPLPTLLITADTV  110



>ref|XP_010029802.1| PREDICTED: maf-like protein DDB_G0281937 isoform X2 [Eucalyptus 
grandis]
Length=188

 Score =   147 bits (371),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 93/127 (73%), Gaps = 0/127 (0%)
 Frame = +3

Query  741   LTAKLKLLEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELD  920
             L   L   +VVV+EG IREKP +K+EAR FI+ YS G+A  + SVLVTNLKTG++    +
Sbjct  50    LVTALAEAKVVVHEGRIREKPSSKDEARNFIEGYSGGRAEVVGSVLVTNLKTGRREAGWE  109

Query  921   KVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQ  1100
             + E+YF++IP +V+  LI+EG  L VAGGL++EHPL  P IK V G  D++MGLPK+LT+
Sbjct  110   RAEVYFYDIPAEVVQSLIDEGITLNVAGGLMLEHPLTSPIIKEVIGTADTIMGLPKSLTE  169

Query  1101  KLITEVL  1121
             +LI E L
Sbjct  170   RLIQEAL  176


 Score = 86.3 bits (212),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +3

Query  75   PFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAK  230
            PFK+ILGS+S PR+ +LAEMGY+F  M+ADIDEKAIRK+KPE+LV ALAEAK
Sbjct  7    PFKIILGSSSMPRQHILAEMGYDFTVMTADIDEKAIRKDKPEELVTALAEAK  58



>ref|XP_010029801.1| PREDICTED: maf-like protein DDB_G0281937 isoform X1 [Eucalyptus 
grandis]
Length=216

 Score =   148 bits (373),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 97/138 (70%), Gaps = 4/138 (3%)
 Frame = +3

Query  708   QFR*DLSVLMFLTAKLKLLEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTN  887
              F  D+   + +TA      VVV+EG IREKP +K+EAR FI+ YS G+A  + SVLVTN
Sbjct  71    SFVEDVHTTLLITADT----VVVHEGRIREKPSSKDEARNFIEGYSGGRAEVVGSVLVTN  126

Query  888   LKTGKKRGELDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATD  1067
             LKTG++    ++ E+YF++IP +V+  LI+EG  L VAGGL++EHPL  P IK V G  D
Sbjct  127   LKTGRREAGWERAEVYFYDIPAEVVQSLIDEGITLNVAGGLMLEHPLTSPIIKEVIGTAD  186

Query  1068  SVMGLPKALTQKLITEVL  1121
             ++MGLPK+LT++LI E L
Sbjct  187   TIMGLPKSLTERLIQEAL  204


 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 65/81 (80%), Gaps = 1/81 (1%)
 Frame = +3

Query  75   PFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRL  254
            PFK+ILGS+S PR+ +LAEMGY+F  M+ADIDEKAIRK+KPE+LV ALAEAKA+AI+  L
Sbjct  7    PFKIILGSSSMPRQHILAEMGYDFTVMTADIDEKAIRKDKPEELVTALAEAKADAILSSL  66

Query  255  -NIDESMEDAEPMLLITCDQV  314
             N+D  +ED    LLIT D V
Sbjct  67   QNVDSFVEDVHTTLLITADTV  87



>ref|XP_009103516.1| PREDICTED: maf-like protein DDB_G0281937 isoform X4 [Brassica 
rapa]
Length=233

 Score =   148 bits (374),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 75/139 (54%), Positives = 94/139 (68%), Gaps = 4/139 (3%)
 Frame = +3

Query  705   SQFR*DLSVLMFLTAKLKLLEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVT  884
             SQF  D    + +TA      VVVY+G+IREKP +KEEAR+FIK YS      + SV+++
Sbjct  99    SQFAQDPLPTLLITAD----TVVVYKGVIREKPTSKEEARQFIKGYSGSHGGVVGSVIIS  154

Query  885   NLKTGKKRGELDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGAT  1064
             NLKTG +R   DK E+YF EIP  VID LI++     VAGGL +EHPLI P+I  V G  
Sbjct  155   NLKTGVQRAGWDKAEVYFREIPAKVIDDLIDDSITFKVAGGLTLEHPLISPFIDTVVGGV  214

Query  1065  DSVMGLPKALTQKLITEVL  1121
             D+VMGLPK LT+K IT+VL
Sbjct  215   DTVMGLPKELTEKFITDVL  233


 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 59/80 (74%), Gaps = 1/80 (1%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLN  257
            FKLILGS S  R+++L EMGY+F  ++ADIDEKAIR++ P+DLV+ALA+AKA+ II +L 
Sbjct  37   FKLILGSQSMARKKILGEMGYDFTIVTADIDEKAIRRDNPQDLVVALAQAKADEIISKLG  96

Query  258  IDESM-EDAEPMLLITCDQV  314
                  +D  P LLIT D V
Sbjct  97   GQSQFAQDPLPTLLITADTV  116



>ref|XP_011099609.1| PREDICTED: maf-like protein DDB_G0281937 [Sesamum indicum]
Length=216

 Score =   148 bits (373),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 87/118 (74%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVVY+G IREKP ++EEAR+FI+DYS G A  + SVLVTNL TG ++G  +  E+YF +I
Sbjct  99    VVVYQGTIREKPSSEEEARQFIRDYSGGSAQVVGSVLVTNLVTGSRKGGWESAEVYFLDI  158

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             P++VID LIEEG +  VAGGL++EHPL  P +  V G  D VMGL K LT+KLI E L
Sbjct  159   PDEVIDSLIEEGIIFNVAGGLMLEHPLTWPLVDTVIGTADCVMGLSKTLTEKLIQEAL  216


 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 70/96 (73%), Gaps = 6/96 (6%)
 Frame = +3

Query  30   AYTGISPRKMEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLV  209
            A  G++P+        F++ILGS+S  RR++L EMGYEF  M+ADIDEK+IRKEKPEDLV
Sbjct  9    AGRGVAPKNQ-----TFEIILGSSSMARREILDEMGYEFTIMTADIDEKSIRKEKPEDLV  63

Query  210  MALAEAKAEAIIPRLNIDESMED-AEPMLLITCDQV  314
            MALAEAKA+AI+ RL     +E+ + P LLIT D V
Sbjct  64   MALAEAKADAIVTRLQSSYQLEEISRPTLLITADTV  99



>ref|XP_009103515.1| PREDICTED: maf-like protein DDB_G0281937 isoform X3 [Brassica 
rapa]
Length=235

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/139 (54%), Positives = 94/139 (68%), Gaps = 4/139 (3%)
 Frame = +3

Query  705   SQFR*DLSVLMFLTAKLKLLEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVT  884
             SQF  D    + +TA      VVVY+G+IREKP +KEEAR+FIK YS      + SV+++
Sbjct  101   SQFAQDPLPTLLITAD----TVVVYKGVIREKPTSKEEARQFIKGYSGSHGGVVGSVIIS  156

Query  885   NLKTGKKRGELDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGAT  1064
             NLKTG +R   DK E+YF EIP  VID LI++     VAGGL +EHPLI P+I  V G  
Sbjct  157   NLKTGVQRAGWDKAEVYFREIPAKVIDDLIDDSITFKVAGGLTLEHPLISPFIDTVVGGV  216

Query  1065  DSVMGLPKALTQKLITEVL  1121
             D+VMGLPK LT+K IT+VL
Sbjct  217   DTVMGLPKELTEKFITDVL  235


 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 58/79 (73%), Gaps = 1/79 (1%)
 Frame = +3

Query  81   KLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLNI  260
            +LILGS S  R+++L EMGY+F  ++ADIDEKAIR++ P+DLV+ALA+AKA+ II +L  
Sbjct  40   QLILGSQSMARKKILGEMGYDFTIVTADIDEKAIRRDNPQDLVVALAQAKADEIISKLGG  99

Query  261  DESM-EDAEPMLLITCDQV  314
                 +D  P LLIT D V
Sbjct  100  QSQFAQDPLPTLLITADTV  118



>ref|XP_009365556.1| PREDICTED: maf-like protein DDB_G0281937 isoform X2 [Pyrus x 
bretschneideri]
Length=221

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 84/96 (88%), Gaps = 0/96 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYEG+IREKP +KEEAR+F+KDYS G AAT+ SV VTNLKTG  +GE D+VEIYFH+
Sbjct  113   QVVVYEGVIREKPSSKEEARQFLKDYSGGHAATVGSVHVTNLKTGFSKGEWDRVEIYFHK  172

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRV  1052
             IP++VI+KLIEEG VL VAGGL+IEHPLI PY+K V
Sbjct  173   IPDEVIEKLIEEGIVLKVAGGLIIEHPLILPYVKEV  208


 Score =   103 bits (257),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 70/91 (77%), Gaps = 1/91 (1%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            ME ++  FK+ILGSAS  RR++LAEMGYEF  ++ADIDEK+IR EKPE+LV+ LA+AKA+
Sbjct  1    MEADSSSFKIILGSASIARRKILAEMGYEFTVVTADIDEKSIRTEKPEELVLVLAKAKAD  60

Query  237  AIIPRL-NIDESMEDAEPMLLITCDQVHNIS  326
            AII +L +I+   +DA+P ++I  D    IS
Sbjct  61   AIISKLQSINNQEKDADPTIVIAADTAEAIS  91



>ref|XP_008364993.1| PREDICTED: maf-like protein DDB_G0281937 isoform X2 [Malus domestica]
Length=225

 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 84/96 (88%), Gaps = 0/96 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYEG+IREKP +KEEAR+F+KDYS G AAT+ SV VTNLKTG  +GE D+VEIYFH+
Sbjct  113   QVVVYEGVIREKPSSKEEARQFLKDYSGGHAATVGSVHVTNLKTGFSKGEWDRVEIYFHK  172

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRV  1052
             IP++VI+KLIEEG VL VAGGL+IEHPLI PY+K V
Sbjct  173   IPDEVIEKLIEEGIVLKVAGGLIIEHPLILPYVKEV  208


 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 69/91 (76%), Gaps = 1/91 (1%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            ME ++  FK+ILGSAS  RR++LAEMGYEF  ++ADIDEK+IR EKPE+LV+ LA+AKA+
Sbjct  1    MEADSSSFKIILGSASIARRKILAEMGYEFTVVTADIDEKSIRTEKPEELVLVLAKAKAD  60

Query  237  AIIPRL-NIDESMEDAEPMLLITCDQVHNIS  326
            AII +L +I+   +D EP ++I  D    IS
Sbjct  61   AIISKLQSINXQEKDXEPTIVIAADTAEAIS  91



>emb|CDY30767.1| BnaC07g16670D [Brassica napus]
Length=199

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 95/139 (68%), Gaps = 4/139 (3%)
 Frame = +3

Query  705   SQFR*DLSVLMFLTAKLKLLEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVT  884
             SQF  D    + +TA      V+VY+G+IREK  +KEEAR+FIK YS    + + SV+V+
Sbjct  65    SQFAQDPLPTLLITAD----TVIVYKGVIREKLISKEEARQFIKGYSGSHGSVVGSVIVS  120

Query  885   NLKTGKKRGELDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGAT  1064
             NLKTG +R   DK E+YFHEIP  VID LI++     VAGGL +EHPLI P+I  V G  
Sbjct  121   NLKTGVQRAGWDKAEVYFHEIPAKVIDDLIDDSITFKVAGGLTLEHPLISPFIDTVVGGV  180

Query  1065  DSVMGLPKALTQKLITEVL  1121
             D+VMGLPK LT+K+IT+ L
Sbjct  181   DTVMGLPKELTEKIITDAL  199


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 51/69 (74%), Gaps = 1/69 (1%)
 Frame = +3

Query  111  RRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLNIDESM-EDAEP  287
            R+++L EMGY+F  ++ADIDEKAIR++ P+DLV+ALA+AKA+ II +L       +D  P
Sbjct  14   RKKILGEMGYDFTIVTADIDEKAIRRDNPQDLVVALAQAKADEIISKLGGQSQFAQDPLP  73

Query  288  MLLITCDQV  314
             LLIT D V
Sbjct  74   TLLITADTV  82



>gb|EYU40161.1| hypothetical protein MIMGU_mgv1a013798mg [Erythranthe guttata]
Length=210

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 89/118 (75%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVVY+G+IREKP +++EAR+FI+DYS G A+ + S+LVTNL TG ++G  +  E+YF +I
Sbjct  93    VVVYQGVIREKPTSEKEARQFIRDYSGGSASVVGSILVTNLVTGSRKGGWESAEVYFLDI  152

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             P++VID LIEEG    VAGGL++EHPLI P +  + G  D VMGL K L +KLI EVL
Sbjct  153   PDEVIDSLIEEGITFNVAGGLMLEHPLILPLVDTLVGTVDCVMGLSKTLAEKLINEVL  210


 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 68/89 (76%), Gaps = 5/89 (6%)
 Frame = +3

Query  63   GNTWP----FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAK  230
            GN  P    F++ILGS+S  RR++LAEMGYEF  ++ADIDEK+IRKEKPEDLVM LAEAK
Sbjct  5    GNFSPKNKDFEIILGSSSKARREILAEMGYEFTIVTADIDEKSIRKEKPEDLVMTLAEAK  64

Query  231  AEAIIPRLNIDESMED-AEPMLLITCDQV  314
            A+AI+ +L  +  +E+ + P LLIT D V
Sbjct  65   ADAIMMKLGSNNQLEEISRPTLLITADTV  93



>ref|XP_010550780.1| PREDICTED: maf-like protein DDB_G0281937 [Tarenaya hassleriana]
Length=196

 Score =   145 bits (365),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 95/139 (68%), Gaps = 14/139 (10%)
 Frame = +3

Query  705   SQFR*DLSVLMFLTAKLKLLEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVT  884
             S+F  D    + +TA      VVVY+G+IREKP +KEEAREFIK YS    + + SVLVT
Sbjct  72    SKFLQDTQPTLLITAD----TVVVYKGVIREKPSSKEEAREFIKGYSGSHGSVVGSVLVT  127

Query  885   NLKTGKKRGELDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGAT  1064
             NLKTG          +YFHEIP+ VID LIEEG  L VAGGL++EHPL  P+++ V GA 
Sbjct  128   NLKTG----------VYFHEIPDKVIDDLIEEGITLNVAGGLMLEHPLTLPFVETVVGAA  177

Query  1065  DSVMGLPKALTQKLITEVL  1121
             D+VMGLPK LT++ I +VL
Sbjct  178   DTVMGLPKTLTEEFIKDVL  196


 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 65/80 (81%), Gaps = 1/80 (1%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRL-  254
            FK+ILGS S  R+++LAEMGY+F  M+ADIDEK+IR+EKPEDLVMALAEAKA+AI  R  
Sbjct  10   FKVILGSQSMARKRILAEMGYDFSIMTADIDEKSIRREKPEDLVMALAEAKADAITKRFG  69

Query  255  NIDESMEDAEPMLLITCDQV  314
            +I + ++D +P LLIT D V
Sbjct  70   DISKFLQDTQPTLLITADTV  89



>ref|XP_010097633.1| Maf-like protein [Morus notabilis]
 gb|EXB70259.1| Maf-like protein [Morus notabilis]
Length=271

 Score =   146 bits (369),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 84/96 (88%), Gaps = 0/96 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYEG++REKP +KEEAR+F+KDYS G AAT+ SVLVTNLKTG ++G+ D VEIYFHE
Sbjct  162   QVVVYEGVVREKPSSKEEARKFMKDYSGGHAATVGSVLVTNLKTGFRKGDWDCVEIYFHE  221

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRV  1052
             IP+ VI+ LIEEGTVL VAGGL+IEHPLI P +K+V
Sbjct  222   IPDGVIESLIEEGTVLNVAGGLIIEHPLILPLVKQV  257


 Score =   113 bits (283),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 75/107 (70%), Gaps = 5/107 (5%)
 Frame = +3

Query  6    TLLLRSPPAYTGISPRKMEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIR  185
            TL   S P Y     R M  N+ PFK+ILGS+S  RR++LAEMGY+F  M+ADIDEK+IR
Sbjct  37   TLFATSLPGYW----RVMAANSSPFKIILGSSSVARRKILAEMGYDFTIMTADIDEKSIR  92

Query  186  KEKPEDLVMALAEAKAEAIIPRL-NIDESMEDAEPMLLITCDQVHNI  323
            KEKPEDLVMALA+AKA+AI+ ++  +D   +D EP +L+  D    I
Sbjct  93   KEKPEDLVMALADAKADAILSKIRTLDSQKKDDEPTILVAADTAEAI  139



>ref|XP_006281109.1| hypothetical protein CARUB_v10027139mg [Capsella rubella]
 gb|EOA14007.1| hypothetical protein CARUB_v10027139mg [Capsella rubella]
Length=207

 Score =   143 bits (360),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 90/139 (65%), Gaps = 4/139 (3%)
 Frame = +3

Query  705   SQFR*DLSVLMFLTAKLKLLEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVT  884
             S F  D    + +TA      VVVY+ +IREKP NKEEAREFIK YS      + SV V 
Sbjct  72    SHFAQDPQPTILITADT----VVVYKSVIREKPINKEEAREFIKGYSGSHEGVVGSVFVW  127

Query  885   NLKTGKKRGELDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGAT  1064
             NLKTG K G  DK E+YFHEIPE VI+ LI++     VAGG  +EHPL+ P++  V G  
Sbjct  128   NLKTGVKIGGWDKAEVYFHEIPEHVIEDLIDDAITYTVAGGATLEHPLVSPFVDYVVGGV  187

Query  1065  DSVMGLPKALTQKLITEVL  1121
             D+VMGLPK LT+K I +VL
Sbjct  188   DTVMGLPKELTKKFINDVL  206


 Score = 95.5 bits (236),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 61/80 (76%), Gaps = 1/80 (1%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLN  257
            FKLILGS S  R+++LAEMGYE+  ++ADIDEKAIR +KPEDLV+ALAEAKA  II +L 
Sbjct  10   FKLILGSQSMARKRILAEMGYEYTIVTADIDEKAIRTDKPEDLVVALAEAKANEIISKLG  69

Query  258  IDESM-EDAEPMLLITCDQV  314
             +    +D +P +LIT D V
Sbjct  70   GESHFAQDPQPTILITADTV  89



>ref|XP_002865059.1| maf family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41318.1| maf family protein [Arabidopsis lyrata subsp. lyrata]
Length=214

 Score =   143 bits (360),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 94/139 (68%), Gaps = 4/139 (3%)
 Frame = +3

Query  705   SQFR*DLSVLMFLTAKLKLLEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVT  884
             SQF  D    + +TA      VVVY+G+IREKP  KEEAREFIK YS      + SVLV 
Sbjct  72    SQFAQDPQPTLLITADT----VVVYKGVIREKPTTKEEAREFIKGYSGSHGGVVGSVLVR  127

Query  885   NLKTGKKRGELDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGAT  1064
             NLKTG +RG  DK E+YFHEIPE +ID LI++     VAGGL +EHPLI P+I  V G  
Sbjct  128   NLKTGVRRGGWDKAEVYFHEIPEQIIDDLIDDAITYKVAGGLTLEHPLISPFIDAVVGGV  187

Query  1065  DSVMGLPKALTQKLITEVL  1121
             D+VMGLPK LT+K I +VL
Sbjct  188   DTVMGLPKELTEKCINDVL  206


 Score = 95.1 bits (235),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 61/80 (76%), Gaps = 1/80 (1%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLN  257
            FKLILGS S  R+++LA+MGY++  ++ADIDEKAIR EKPEDLV+ALAEAKA  II +L 
Sbjct  10   FKLILGSQSMARKRILADMGYDYTIVTADIDEKAIRTEKPEDLVVALAEAKANEIISKLG  69

Query  258  IDESM-EDAEPMLLITCDQV  314
             +    +D +P LLIT D V
Sbjct  70   GESQFAQDPQPTLLITADTV  89



>ref|XP_002450931.1| hypothetical protein SORBIDRAFT_05g021370 [Sorghum bicolor]
 gb|EES09919.1| hypothetical protein SORBIDRAFT_05g021370 [Sorghum bicolor]
Length=212

 Score =   142 bits (358),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVV+EG+IREKP  KEEAR+F+K YS G  +T+ SV+VTNL TGK+ G LDK E+YFH+I
Sbjct  93    VVVHEGIIREKPTTKEEARQFLKGYSGGHVSTVGSVVVTNLTTGKRLGSLDKAEVYFHDI  152

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             PE+VI+ LI+EG V  VAGGLL+EHPL  P+++ V G++DSVMGL K +  KLI + L
Sbjct  153   PEEVIESLIDEGVVFRVAGGLLLEHPLTLPFVEAVVGSSDSVMGLSKEIANKLIHDAL  210


 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 66/94 (70%), Gaps = 4/94 (4%)
 Frame = +3

Query  36   TGISPRKMEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMA  215
            TG SP        PFKLILGS+S  R+ +L EMG EF  M+ADIDEK+IR+E P+DLVM 
Sbjct  3    TGSSP---PARQQPFKLILGSSSVARKHILEEMGLEFQVMTADIDEKSIRRENPDDLVMV  59

Query  216  LAEAKAEAIIPRLNI-DESMEDAEPMLLITCDQV  314
            LAEAKA+AI+ RLN+ D   E  +P LLIT D V
Sbjct  60   LAEAKADAIMSRLNLADYQKEGNQPTLLITSDIV  93



>tpg|DAA42109.2| TPA: hypothetical protein ZEAMMB73_962619 [Zea mays]
Length=155

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 92/118 (78%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVV+EG+IREKP  KEEAR+F+K YS G  +T+ SV+VTNL TGK+ G LDK E+YFH+I
Sbjct  36    VVVHEGIIREKPTTKEEARQFLKGYSGGHVSTVGSVVVTNLTTGKRLGSLDKAEVYFHDI  95

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             P++VI  LI+EG V  VAGGLL+EHPL  P+++ V G++DSVMGL K +  KLI + L
Sbjct  96    PDEVIKSLIDEGVVFRVAGGLLLEHPLTLPFVEAVVGSSDSVMGLSKEVANKLIHDAL  153



>emb|CDX71516.1| BnaC04g17510D [Brassica napus]
Length=204

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYE  +REKP + EEARE+I+ YS G+ AT+SSV+VTNLKTG ++G +D+VEIYF+E
Sbjct  83    QVVVYEDAVREKPSSVEEAREYIRSYSKGRTATVSSVVVTNLKTGFRKGGVDRVEIYFNE  142

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             I E++I+KLIEEG VL VAG LLIEHPLI P +K V G TDSVMGLPK LT+KL+ EVL
Sbjct  143   ISEEIIEKLIEEGMVLRVAGALLIEHPLILPCVKEVVGTTDSVMGLPKPLTEKLLKEVL  201


 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 69/87 (79%), Gaps = 4/87 (5%)
 Frame = +3

Query  57   MEGNTWP-FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKA  233
            ME +  P FK+ILGS+S  RR +L +MGY+F  MSADIDEK+IRKEKPE+LV+ALAEAKA
Sbjct  1    MESDRPPHFKVILGSSSIARRSILTDMGYQFTLMSADIDEKSIRKEKPEELVLALAEAKA  60

Query  234  EAIIPRLNIDESMEDAEPMLLITCDQV  314
            EAI  R  I + +ED +P LL+TCDQV
Sbjct  61   EAITQR--IPDDVED-KPTLLVTCDQV  84



>gb|EPS58347.1| hypothetical protein M569_16467 [Genlisea aurea]
Length=100

 Score =   137 bits (345),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 80/95 (84%), Gaps = 0/95 (0%)
 Frame = +3

Query  837   DYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLI  1016
             DYS GQAAT+SSV+V+NL  G ++G  D+VEI+F++IPE++ID LI+EG VL VAGGLLI
Sbjct  6     DYSGGQAATVSSVIVSNLSNGLRKGNWDRVEIHFNDIPEEIIDSLIDEGIVLNVAGGLLI  65

Query  1017  EHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             EHPLI PY+K V G TDSVMGLP A+T+KLI EVL
Sbjct  66    EHPLILPYVKEVVGETDSVMGLPVAVTRKLIEEVL  100



>ref|XP_001761267.1| predicted protein [Physcomitrella patens]
 gb|EDQ73989.1| predicted protein [Physcomitrella patens]
Length=209

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 88/119 (74%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVV+EG+I EKP++ EEAR  I  YS   A T+ +VLVTNL TG + G +DK E++F+E
Sbjct  87    QVVVHEGVILEKPKSAEEARRVIPGYSRAPAVTVGAVLVTNLDTGVRAGGVDKAEVHFNE  146

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             I ++V+D LIEEG V Y AGGLL+EHPL+ P++K + G  DSVMGL K LTQ LI + L
Sbjct  147   ISDEVVDALIEEGEVFYSAGGLLVEHPLMSPFVKSMVGGLDSVMGLSKELTQSLIEQAL  205


 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 57/88 (65%), Gaps = 2/88 (2%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGY-EFITMSADIDEKAIRKEKPEDLVMALAEAKA  233
            M  +    ++ILGS S  R  +L +MGY +F  ++A+IDE AIR    EDLV+ LA AKA
Sbjct  1    MASSPAAARIILGSQSQDRHAILRDMGYTDFEVVTANIDESAIRAPAAEDLVVKLAHAKA  60

Query  234  EAIIPRLNIDESMEDAE-PMLLITCDQV  314
            EAI+ +L   E +  A+ P+LLIT DQV
Sbjct  61   EAILSKLEGTELLRKADVPVLLITADQV  88



>ref|XP_006662986.1| PREDICTED: maf-like protein DDB_G0281937-like [Oryza brachyantha]
Length=181

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 92/118 (78%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVV+EG+IREKP  KEEAR+F+K YS    +T+ SV+VTNL TGK+ G LDK E+YFH+I
Sbjct  62    VVVHEGIIREKPTTKEEARQFLKGYSGSHVSTVGSVVVTNLTTGKRLGSLDKAEVYFHDI  121

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             P++VI+ LI+EG V  VAGGLL+EHPL  P+++ V G++DSVMG+ K L  KLI E L
Sbjct  122   PDEVIENLIDEGVVFRVAGGLLLEHPLTLPFVEAVVGSSDSVMGISKDLANKLIQEAL  179


 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +3

Query  132  MGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLNI-DESMEDAEPMLLITCD  308
            MG EF   +ADIDEK+IR+E P++LV  LAEAKA+AI+ RLNI D   E   P LLIT D
Sbjct  1    MGLEFEVRTADIDEKSIRRENPDELVTVLAEAKADAIMSRLNISDYQKEGDRPTLLITSD  60

Query  309  QV  314
             V
Sbjct  61   IV  62



>ref|NP_001152030.1| maf-like protein CV_0124 [Zea mays]
 gb|ACG45454.1| maf-like protein CV_0124 [Zea mays]
Length=213

 Score =   140 bits (353),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 92/118 (78%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVV+EG+IREKP  KEEAR+F+K YS G  +T+ SV+VTNL TGK+ G LDK E+YFH+I
Sbjct  94    VVVHEGIIREKPTTKEEARQFLKGYSGGHVSTVGSVVVTNLTTGKRLGSLDKAEVYFHDI  153

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             P++VI  LI+EG V  VAGGLL+EHPL  P+++ V G++DSVMGL K +  KLI + L
Sbjct  154   PDEVIKSLIDEGVVFRVAGGLLLEHPLTLPFVEAVVGSSDSVMGLSKEVANKLIHDAL  211


 Score =   103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 68/96 (71%), Gaps = 4/96 (4%)
 Frame = +3

Query  30   AYTGISPRKMEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLV  209
            A  G SP     +  PFKLILGS+S  R+ +L EMG EF  M+ADIDEK+IR+E P+DLV
Sbjct  2    ATAGSSP---PASQQPFKLILGSSSVARKHILEEMGLEFQVMTADIDEKSIRRENPDDLV  58

Query  210  MALAEAKAEAIIPRLNIDE-SMEDAEPMLLITCDQV  314
              LAEAKA+AI+ RLNID+   E ++P LLIT D V
Sbjct  59   TVLAEAKADAIMSRLNIDDYQKEGSQPTLLITSDIV  94



>ref|XP_004979450.1| PREDICTED: maf-like protein DDB_G0281937-like [Setaria italica]
Length=211

 Score =   139 bits (351),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 91/114 (80%), Gaps = 0/114 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVV+EG+IREKP  KEEAR+F+K YS G  +T+ SV+VTNL TGK+ G LDK E+YFH+I
Sbjct  93    VVVHEGIIREKPTTKEEARQFLKGYSGGHVSTVGSVVVTNLTTGKRLGSLDKAEVYFHDI  152

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLI  1109
             P++VI+ LI+EG V  VAGGLL+EHPL  P+++ V G++DSVMGL K +  KLI
Sbjct  153   PDEVIENLIDEGVVFRVAGGLLLEHPLTLPFVEAVVGSSDSVMGLSKEIASKLI  206


 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 63/81 (78%), Gaps = 1/81 (1%)
 Frame = +3

Query  75   PFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRL  254
            PFKLILGS+S  R+ +L EMG EF  M+ADIDEK+IR+E P+DLVM LAEAKA+AI+ RL
Sbjct  13   PFKLILGSSSVARKHILEEMGLEFQVMTADIDEKSIRREDPDDLVMVLAEAKADAIMSRL  72

Query  255  NI-DESMEDAEPMLLITCDQV  314
            NI D   ED +P LLIT D V
Sbjct  73   NIADYQKEDNQPTLLITSDIV  93



>dbj|BAJ90754.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=269

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVV+EG+IREKP +KEEAR+F+K YS G  +T+  V+VTNL TGKK G LDK E+YFH+I
Sbjct  150   VVVHEGIIREKPSSKEEARQFLKGYSGGHVSTVGGVVVTNLTTGKKLGSLDKAEVYFHDI  209

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             P+++I+ LI+EG V  VAGGLL+EHPL  P+++ V G++DSVMGL K L  KLI E L
Sbjct  210   PDEIIENLIDEGVVFRVAGGLLLEHPLTLPFVEAVVGSSDSVMGLSKDLANKLIHEAL  267


 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 69/103 (67%), Gaps = 4/103 (4%)
 Frame = +3

Query  9    LLLRSPPAYTGISPRKMEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRK  188
            LL    P  T  SP     N  PFKLILGS S  R+ +L EMG+EF  M+ADIDE++IR+
Sbjct  51   LLSSMAPMATSSSP---TANPQPFKLILGSMSVARKNILNEMGFEFQVMTADIDERSIRR  107

Query  189  EKPEDLVMALAEAKAEAIIPRLNI-DESMEDAEPMLLITCDQV  314
            E P++LVM LAEAKA+AI+ R+NI D   E  +P LLIT D V
Sbjct  108  EDPDELVMLLAEAKADAIMSRMNISDYQKEGDQPTLLITSDIV  150



>ref|XP_010254823.1| PREDICTED: maf-like protein DDB_G0281937 isoform X2 [Nelumbo 
nucifera]
Length=189

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/97 (65%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVV+EG +REKP +KEEAR FIK YS G AAT+ SV+VTNLKTG ++G  DK E+YFH+I
Sbjct  87    VVVFEGKVREKPSSKEEARRFIKGYSGGNAATVGSVIVTNLKTGTRKGAWDKAEVYFHDI  146

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAG  1058
             P++VID LIEEG VL VAGGL++EHPL  P+++ V G
Sbjct  147   PDEVIDNLIEEGLVLNVAGGLILEHPLTLPFVEAVVG  183


 Score =   108 bits (270),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 63/87 (72%), Gaps = 1/87 (1%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            M   T  FK+ILGS S  RR +L EMGYEF  M+ADIDEK IRKEKPE+LVMALAEAKA+
Sbjct  1    MATGTASFKIILGSKSLARRNILTEMGYEFTIMTADIDEKGIRKEKPEELVMALAEAKAD  60

Query  237  AIIPRLNIDESME-DAEPMLLITCDQV  314
            AII RL      E DAEP LLIT D V
Sbjct  61   AIIARLQTAGYQEKDAEPTLLITADTV  87



>emb|CDY22383.1| BnaA06g37050D [Brassica napus]
Length=204

 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYE  +REKP +  EARE+I+ YS G  AT+SSV+VTNL TG ++G +D+VEIYF+E
Sbjct  83    QVVVYEDAVREKPSSVVEAREYIRSYSKGHTATVSSVVVTNLNTGFRKGGVDRVEIYFNE  142

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             I E++I+KLIEEG VL VAG LLIEHPLI P IK+V G TDSVMGLPK LT+KL+ EVL
Sbjct  143   ISEEIIEKLIEEGMVLRVAGALLIEHPLILPCIKQVVGTTDSVMGLPKELTEKLMKEVL  201


 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 70/87 (80%), Gaps = 4/87 (5%)
 Frame = +3

Query  57   MEGNTWP-FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKA  233
            ME +  P FK+ILGS+S  RR +L +MGY+F  MSADIDEK+IRKEKPE+LV+ALAEAKA
Sbjct  1    MESDRPPHFKVILGSSSIARRSILTDMGYQFTLMSADIDEKSIRKEKPEELVLALAEAKA  60

Query  234  EAIIPRLNIDESMEDAEPMLLITCDQV  314
            EAI+ R  I + +ED +P LL+TCDQV
Sbjct  61   EAIVQR--IPDDVED-KPTLLVTCDQV  84



>ref|XP_003577472.1| PREDICTED: maf-like protein DDB_G0281937 [Brachypodium distachyon]
Length=271

 Score =   139 bits (350),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVV+EG+IREKP  KEEAR+F+K YS G  +T+  V+VTNL TGKK G LDK E+YFH+I
Sbjct  152   VVVHEGIIREKPITKEEARQFLKGYSGGHVSTVGGVVVTNLTTGKKLGSLDKAEVYFHDI  211

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             P++VI+ LI+EG V  VAGGLL+EHPL  P+++ V G++DSVMGL K L +KLI E L
Sbjct  212   PDEVIENLIDEGVVFRVAGGLLLEHPLTLPFVEAVVGSSDSVMGLSKDLAKKLIHEAL  269


 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 68/100 (68%), Gaps = 4/100 (4%)
 Frame = +3

Query  18   RSPPAYTGISPRKMEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKP  197
            + P A TG  P     N   FKLILGS+S  R+ +L  MG+EF  M+ADIDE++IR+E P
Sbjct  56   KPPMASTGSPP---AANPQQFKLILGSSSVARKHILTGMGFEFQVMTADIDERSIRREDP  112

Query  198  EDLVMALAEAKAEAIIPRLNI-DESMEDAEPMLLITCDQV  314
            ++LVM LAEAKA+AI+ R++I D   E  +P LLIT D V
Sbjct  113  DELVMVLAEAKADAIMSRMSISDYQKEGDQPTLLITSDIV  152



>ref|XP_009588766.1| PREDICTED: maf-like protein DDB_G0281937 isoform X3 [Nicotiana 
tomentosiformis]
Length=204

 Score =   136 bits (343),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 84/119 (71%), Gaps = 27/119 (23%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVVYEGM+REKP ++ EAR+F+KDY+NG AAT+SSVLVTNL TG +RGE DKVEIYFH+
Sbjct  113   QVVVYEGMVREKPSSEAEARQFMKDYANGHAATVSSVLVTNLVTGCRRGEWDKVEIYFHD  172

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP+ VIDKL+                           G+TDSVMGLPKALT++LI EVL
Sbjct  173   IPDQVIDKLV---------------------------GSTDSVMGLPKALTERLIKEVL  204


 Score =   122 bits (306),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 75/114 (66%), Gaps = 28/114 (25%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAK--  230
            ME N   FKLILGS+S  RR++LA+MGY+F TMSADIDEKAIRKEKPEDLVMALAEAK  
Sbjct  1    MEPNAPQFKLILGSSSTARRKILADMGYQFTTMSADIDEKAIRKEKPEDLVMALAEAKAD  60

Query  231  --------------------------AEAIIPRLNIDESMEDAEPMLLITCDQV  314
                                      AEAIIPR++I ES  DAEP LLITCDQV
Sbjct  61   AIISKFRNTENLEKDSNPTLLVAADTAEAIIPRVSIGESEGDAEPTLLITCDQV  114



>gb|EEC68337.1| hypothetical protein OsI_36449 [Oryza sativa Indica Group]
Length=211

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 91/118 (77%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVV+EG+IREKP  KEEAR+F+K YS    +T+ SV+VTNL TGK+   LDK E+YFH+I
Sbjct  92    VVVHEGIIREKPTTKEEARQFLKGYSGSHVSTVGSVVVTNLTTGKRLESLDKAEVYFHDI  151

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             P+++I+ LI+EG V  VAGGLL+EHPL  P+++ V G++DSVMG+ K L  KLI + L
Sbjct  152   PDEIIENLIDEGVVFRVAGGLLLEHPLTLPFVEAVVGSSDSVMGISKDLANKLIQDAL  209


 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 61/85 (72%), Gaps = 1/85 (1%)
 Frame = +3

Query  63   GNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAI  242
             ++ PFKLILGS+S  R+ +L EMG EF  M+ADIDEK+IR+E P+ LV  LAEAKA+AI
Sbjct  8    ASSQPFKLILGSSSVARKHILTEMGLEFEVMTADIDEKSIRRENPDALVTVLAEAKADAI  67

Query  243  IPRLNI-DESMEDAEPMLLITCDQV  314
            + RLNI D   E   P LLIT D V
Sbjct  68   MSRLNISDYQKEGDRPTLLITSDIV  92



>ref|XP_009760258.1| PREDICTED: maf-like protein DDB_G0281937 isoform X4 [Nicotiana 
sylvestris]
Length=205

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 82/118 (69%), Gaps = 27/118 (23%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVVYEGM+REKP  + EAR+F+KDY+NG AAT+SSVLVTNL TG +RGE DKVEIYFH+I
Sbjct  115   VVVYEGMVREKPSTEAEARQFMKDYANGHAATVSSVLVTNLVTGCRRGEWDKVEIYFHDI  174

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             P+ VIDKL+                           G+TDSVMGLPKALT++LI EVL
Sbjct  175   PDQVIDKLV---------------------------GSTDSVMGLPKALTERLIKEVL  205


 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 75/114 (66%), Gaps = 28/114 (25%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAK--  230
            ME N   FKLILGS+S  RR++LA+MGY+F TMSADIDEKAIRKEKPEDLVMALAEAK  
Sbjct  1    MEANVPQFKLILGSSSTARRKILADMGYQFTTMSADIDEKAIRKEKPEDLVMALAEAKAD  60

Query  231  --------------------------AEAIIPRLNIDESMEDAEPMLLITCDQV  314
                                      AEAIIPR++I ES  DAEP LLITCDQV
Sbjct  61   AIISKFRNTENLEKDSNPTLLVAADTAEAIIPRVSIGESEGDAEPTLLITCDQV  114



>gb|AAR01628.1| putative Maf-like protein [Oryza sativa Japonica Group]
Length=211

 Score =   134 bits (337),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 86/119 (72%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +V+V +GMIRE+P+ +EEAREFIK YS  +A  ++ VLVTNL  G  +G  D  EIYFH 
Sbjct  90    QVMVSKGMIRERPKGQEEAREFIKGYSGDKAFAVNYVLVTNLSNGASKGGWDIPEIYFHH  149

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IPED I  +++EG +  VAGGL + HP + P+IK++ G  DSV GLP+ LT++LI EVL
Sbjct  150   IPEDFIQSVVKEGHMTCVAGGLKLTHPSVLPFIKQLIGTMDSVRGLPRELTERLIQEVL  208


 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 68/87 (78%), Gaps = 1/87 (1%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            M  N+ PFK++LGS+S  RR++LA+MGYEF  M ADIDE+AIR+EKPE+LV ALAEAKAE
Sbjct  5    MAKNSSPFKVVLGSSSPARREILADMGYEFTVMCADIDERAIRREKPEELVKALAEAKAE  64

Query  237  AIIPRLNI-DESMEDAEPMLLITCDQV  314
            AI  +L+  D + E  +P +LIT DQV
Sbjct  65   AIKLKLHGEDSAQERDQPTILITSDQV  91



>ref|NP_001051124.1| Os03g0724700 [Oryza sativa Japonica Group]
 gb|ABF98622.1| Maf-like protein, expressed [Oryza sativa Japonica Group]
 dbj|BAF13038.1| Os03g0724700 [Oryza sativa Japonica Group]
 dbj|BAG89095.1| unnamed protein product [Oryza sativa Japonica Group]
Length=215

 Score =   134 bits (336),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 86/119 (72%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +V+V +GMIRE+P+ +EEAREFIK YS  +A  ++ VLVTNL  G  +G  D  EIYFH 
Sbjct  94    QVMVSKGMIRERPKGQEEAREFIKGYSGDKAFAVNYVLVTNLSNGASKGGWDIPEIYFHH  153

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IPED I  +++EG +  VAGGL + HP + P+IK++ G  DSV GLP+ LT++LI EVL
Sbjct  154   IPEDFIQSVVKEGHMTCVAGGLKLTHPSVLPFIKQLIGTMDSVRGLPRELTERLIQEVL  212


 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 67/84 (80%), Gaps = 1/84 (1%)
 Frame = +3

Query  66   NTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAII  245
            N+ PFK++LGS+S  RR++LA+MGYEF  M ADIDE+AIR+EKPE+LV ALAEAKAEAI 
Sbjct  12   NSSPFKVVLGSSSPARREILADMGYEFTVMCADIDERAIRREKPEELVKALAEAKAEAIK  71

Query  246  PRLNI-DESMEDAEPMLLITCDQV  314
             +L+  D + E  +P +LIT DQV
Sbjct  72   LKLHGEDSAQERDQPTILITSDQV  95



>gb|KCW56760.1| hypothetical protein EUGRSUZ_I02441 [Eucalyptus grandis]
Length=326

 Score =   135 bits (341),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/147 (47%), Positives = 92/147 (63%), Gaps = 27/147 (18%)
 Frame = +3

Query  762   LEVVVYEGMIREKPENKEEAREFIKD---------------------------YSNGQAA  860
             LEVVV+EG IREKP +K+EAR FI+                            YS G+A 
Sbjct  179   LEVVVHEGRIREKPSSKDEARNFIEGLLDTTSPHITFRKKKFSWILIVVYFPGYSGGRAE  238

Query  861   TISSVLVTNLKTGKKRGELDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPY  1040
              + SVLVTNLKTG++    ++ E+YF++IP  V+  LI+EG  L VAGGL++EHPL  P+
Sbjct  239   VVGSVLVTNLKTGRREAGWERAEVYFYDIPAQVVQSLIDEGITLNVAGGLMLEHPLTLPF  298

Query  1041  IKRVAGATDSVMGLPKALTQKLITEVL  1121
             +K V G  D+VMGLPK+LT++LI E L
Sbjct  299   VKEVIGTDDTVMGLPKSLTERLIQEAL  325


 Score = 91.3 bits (225),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 63/96 (66%), Gaps = 18/96 (19%)
 Frame = +3

Query  81   KLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAK----------  230
            ++ILGS+S PR+ +LAEMGY+F  M+ADIDEKAIRK+KPE+LV ALAEAK          
Sbjct  76   QIILGSSSMPRQHILAEMGYDFTVMTADIDEKAIRKDKPEELVTALAEAKHFRQLSTTAL  135

Query  231  -------AEAIIPRL-NIDESMEDAEPMLLITCDQV  314
                   A+AI+  L N+D  +ED    LLIT D +
Sbjct  136  EDSGSVHADAILSSLQNVDSFVEDVHTTLLITADTL  171



>ref|NP_001068071.1| Os11g0549600 [Oryza sativa Japonica Group]
 gb|ABA94182.1| Maf family protein, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF28434.1| Os11g0549600 [Oryza sativa Japonica Group]
 gb|EAZ18702.1| hypothetical protein OsJ_34224 [Oryza sativa Japonica Group]
Length=211

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 90/118 (76%), Gaps = 0/118 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVV+EG+IREKP  KEEAR+F+K YS    +T+ SV+VTNL TGK+   LDK E+YFH+I
Sbjct  92    VVVHEGIIREKPTTKEEARQFLKGYSGSHVSTVGSVVVTNLTTGKRLESLDKAEVYFHDI  151

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             P+++I+ LI+E  V  VAGGLL+EHPL  P+++ V G++DSVMG+ K L  KLI + L
Sbjct  152   PDEIIENLIDERVVFRVAGGLLLEHPLTLPFVEAVVGSSDSVMGISKDLANKLIQDAL  209


 Score = 97.4 bits (241),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 62/85 (73%), Gaps = 1/85 (1%)
 Frame = +3

Query  63   GNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAI  242
             ++ PFKLILGS+S  R+ +L EMG EF  M+ADIDEK+IR+E P++LV  LAEAKA+AI
Sbjct  8    ASSQPFKLILGSSSVARKHILTEMGLEFEVMTADIDEKSIRRENPDELVTVLAEAKADAI  67

Query  243  IPRLNI-DESMEDAEPMLLITCDQV  314
            + RLNI D   E   P LLIT D V
Sbjct  68   MSRLNISDYQKEGDRPTLLITSDIV  92



>gb|KCW56761.1| hypothetical protein EUGRSUZ_I02441 [Eucalyptus grandis]
Length=337

 Score =   135 bits (341),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 69/147 (47%), Positives = 92/147 (63%), Gaps = 27/147 (18%)
 Frame = +3

Query  762   LEVVVYEGMIREKPENKEEAREFIKD---------------------------YSNGQAA  860
             LEVVV+EG IREKP +K+EAR FI+                            YS G+A 
Sbjct  179   LEVVVHEGRIREKPSSKDEARNFIEGLLDTTSPHITFRKKKFSWILIVVYFPGYSGGRAE  238

Query  861   TISSVLVTNLKTGKKRGELDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPY  1040
              + SVLVTNLKTG++    ++ E+YF++IP +V+  LI+EG  L VAGGL++EHPL  P 
Sbjct  239   VVGSVLVTNLKTGRREAGWERAEVYFYDIPAEVVQSLIDEGITLNVAGGLMLEHPLTSPI  298

Query  1041  IKRVAGATDSVMGLPKALTQKLITEVL  1121
             IK V G  D++MGLPK+LT++LI E L
Sbjct  299   IKEVIGTADTIMGLPKSLTERLIQEAL  325


 Score = 90.5 bits (223),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 63/96 (66%), Gaps = 18/96 (19%)
 Frame = +3

Query  81   KLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAK----------  230
            ++ILGS+S PR+ +LAEMGY+F  M+ADIDEKAIRK+KPE+LV ALAEAK          
Sbjct  76   QIILGSSSMPRQHILAEMGYDFTVMTADIDEKAIRKDKPEELVTALAEAKHFRQLSTTAL  135

Query  231  -------AEAIIPRL-NIDESMEDAEPMLLITCDQV  314
                   A+AI+  L N+D  +ED    LLIT D +
Sbjct  136  EDSGSVHADAILSSLQNVDSFVEDVHTTLLITADTL  171



>ref|XP_004985114.1| PREDICTED: maf-like protein DDB_G0281937-like isoform X1 [Setaria 
italica]
Length=219

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 78/102 (76%), Gaps = 0/102 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVV++G+IREKP   EEAR+FIK YS   AATI SVLVTN+KTG +R   DK E+YFH+
Sbjct  88    QVVVHDGVIREKPSTPEEARKFIKGYSESHAATIGSVLVTNVKTGARREGWDKAEVYFHK  147

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDS  1070
             IP++V++ LIEEG V YVAGGLL+EHPL  P ++ +   + S
Sbjct  148   IPDEVVESLIEEGNVFYVAGGLLVEHPLTSPLVEAIVSCSCS  189


 Score = 95.1 bits (235),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 64/83 (77%), Gaps = 4/83 (5%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLN  257
             +LILGS+SA RRQ+L+EMGY+F  +SADIDEK IRKEKPE+LV+ALA AKA+AI+ ++ 
Sbjct  7    LRLILGSSSASRRQILSEMGYKFTLLSADIDEKEIRKEKPEELVVALAHAKADAILEKMK  66

Query  258  ----IDESMEDAEPMLLITCDQV  314
                + E ++  E  L+IT DQV
Sbjct  67   NNGMMKEIVDSQETTLMITADQV  89



>ref|XP_002969035.1| hypothetical protein SELMODRAFT_90184, partial [Selaginella moellendorffii]
 ref|XP_002990701.1| hypothetical protein SELMODRAFT_132111, partial [Selaginella 
moellendorffii]
 gb|EFJ08333.1| hypothetical protein SELMODRAFT_132111, partial [Selaginella 
moellendorffii]
 gb|EFJ30151.1| hypothetical protein SELMODRAFT_90184, partial [Selaginella moellendorffii]
Length=209

 Score =   131 bits (330),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 84/128 (66%), Gaps = 9/128 (7%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKV------  926
             +V  Y  ++REKP N +EAR FI  Y+   A T+S+VLVTN+ TGK +            
Sbjct  74    QVSSYSCVVREKPLNGDEARTFIAGYARDPAITVSAVLVTNVTTGKTKASFFFWSFSSLV  133

Query  927   ---EIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALT  1097
                +IYFH IPE VID LI+EG+VLY AGGLL+EHPL+ P+++ + G  DSVMGLPK LT
Sbjct  134   SSSQIYFHPIPEQVIDDLIKEGSVLYAAGGLLVEHPLVSPFVQSMIGTLDSVMGLPKELT  193

Query  1098  QKLITEVL  1121
               LI + L
Sbjct  194   HTLIRDSL  201


 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 63/84 (75%), Gaps = 2/84 (2%)
 Frame = +3

Query  84   LILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLNID  263
            +ILGS+S  R+ VL EMGY F  MSADIDE+AIR+E PE+LVMALA AKA+AI+PR+   
Sbjct  1    IILGSSSQTRQAVLREMGYNFTVMSADIDERAIRRETPEELVMALAHAKAQAILPRITSL  60

Query  264  ESMEDAEPMLLITCDQVHNISVAV  335
            E+ +  E +LLIT DQV + S  V
Sbjct  61   ETSD--EEVLLITADQVSSYSCVV  82



>ref|XP_005535187.1| probable nucleotide binding protein Maf [Cyanidioschyzon merolae 
strain 10D]
 dbj|BAM78901.1| probable nucleotide binding protein Maf [Cyanidioschyzon merolae 
strain 10D]
Length=207

 Score =   131 bits (330),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 88/130 (68%), Gaps = 4/130 (3%)
 Frame = +3

Query  732   LMFLTAKLKLLEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRG  911
             L+ LT      +VVV++G I EKP++  EAR+FI  Y+N  A T+ S++V+NL TGK+  
Sbjct  80    LLLLTGD----QVVVHQGRILEKPQDPAEARQFIASYANAPAITVGSIVVSNLSTGKRYE  135

Query  912   ELDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKA  1091
              +D+ E+YFH IPE V+++LI EG V   +GGL++EHPL+  ++  + G  DSVMGL K 
Sbjct  136   AIDRAEVYFHPIPESVVERLIAEGAVFACSGGLMVEHPLLTKFVHHIVGTVDSVMGLNKD  195

Query  1092  LTQKLITEVL  1121
             LT+ LI   L
Sbjct  196   LTRALIERAL  205


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 58/88 (66%), Gaps = 2/88 (2%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            M  +  PF+LILGS+S  R+Q+L E+GYEF  +   IDE+AIR  + E LV  L  AKA+
Sbjct  1    MNQHPRPFRLILGSSSRSRQQLLKELGYEFSILKPGIDEEAIRHPEAEQLVRLLGNAKAD  60

Query  237  AIIPRLNIDE--SMEDAEPMLLITCDQV  314
            A++  L  ++  S   AEP+LL+T DQV
Sbjct  61   ALVKMLKNEKGSSRTTAEPLLLLTGDQV  88



>ref|XP_011025791.1| PREDICTED: maf-like protein DDB_G0281937 isoform X2 [Populus 
euphratica]
Length=191

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 81/111 (73%), Gaps = 4/111 (4%)
 Frame = +3

Query  720   DLSVLMFLTAKLKLLEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTG  899
             D    + +TA      VVV  GM+REKP +KEEAREFIK YS G AA I SV+V+NL TG
Sbjct  85    DAQATLLITADT----VVVSNGMVREKPNSKEEAREFIKGYSGGHAAVIGSVVVSNLTTG  140

Query  900   KKRGELDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRV  1052
              ++G  +K E+YFHEIP+++ID +I+EG+ L+VAGGL +EHPL  P+++ V
Sbjct  141   IRKGAWEKAEVYFHEIPDEIIDSVIDEGSTLHVAGGLTLEHPLTSPFVEAV  191


 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 67/88 (76%), Gaps = 1/88 (1%)
 Frame = +3

Query  54   KMEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKA  233
            KM      FK+ILGS+S  RRQ+L EMGYEF  ++ADIDEK+IRK+KPE+LVMALAEAKA
Sbjct  10   KMTSCNSSFKIILGSSSLARRQILNEMGYEFTVVTADIDEKSIRKDKPEELVMALAEAKA  69

Query  234  EAIIPRLNIDESM-EDAEPMLLITCDQV  314
             AII RL I+  + EDA+  LLIT D V
Sbjct  70   NAIIERLRIEGHVEEDAQATLLITADTV  97



>ref|XP_009371635.1| PREDICTED: uncharacterized protein LOC103960867 [Pyrus x bretschneideri]
Length=161

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 87/128 (68%), Gaps = 4/128 (3%)
 Frame = +3

Query  735   MFLTAK-LKLLEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRG  911
             ++LTAK L +L +   +  I  K  +      +I  YS GQAA I SVL TNLKTGK++G
Sbjct  35    LYLTAKSLLILRLWCVKHGILSKWSS---VYGWIAGYSGGQAAVIGSVLETNLKTGKRKG  91

Query  912   ELDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKA  1091
                + E+YFH IPE+VID L+EEG  L VAGGL++EHPLI P+++ V G  D+VMGLP  
Sbjct  92    VWRRAEVYFHVIPEEVIDSLMEEGITLNVAGGLMLEHPLISPFVEAVIGTIDTVMGLPTE  151

Query  1092  LTQKLITE  1115
             LT+KLI E
Sbjct  152   LTEKLIQE  159



>gb|ACF74344.1| Maf-like protein [Arachis hypogaea]
Length=99

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +3

Query  57   MEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAE  236
            ME +T  +K+ILGS+S  RR++L+EMGYEF  M+ADIDEK+IRKE PE+LVMALAEAKAE
Sbjct  1    MEASTSSYKIILGSSSVARRKILSEMGYEFTKMTADIDEKSIRKETPEELVMALAEAKAE  60

Query  237  AIIPRLNIDESMEDAEPMLLITCDQ  311
            AI+ +L +D+ ++DAEP LLITCDQ
Sbjct  61   AILQKLPVDDYLKDAEPTLLITCDQ  85



>ref|XP_008345099.1| PREDICTED: LOW QUALITY PROTEIN: maf-like protein DDB_G0281937 
[Malus domestica]
Length=201

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 80/111 (72%), Gaps = 0/111 (0%)
 Frame = +3

Query  771   VVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEIP  950
             VV+EG+IREKP  KEEA EF + Y  GQAA I SVLVTNLKTGK+ G+  + E+  + IP
Sbjct  91    VVHEGIIREKPSCKEEAXEFYQGYYGGQAAVIGSVLVTNLKTGKRNGDWRRAEVCLYVIP  150

Query  951   EDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQK  1103
             E+VID LIEE   L VA GL+++HPLI P+++      D+VMGLPK +T+ 
Sbjct  151   EEVIDSLIEEEITLNVAXGLMLQHPLIFPFVETXIDRVDTVMGLPKEVTKN  201


 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 55/85 (65%), Gaps = 13/85 (15%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAII----  245
            F++ILGSA   RR +L EMGY F  ++ADIDEK+IR +KP++LVM LAEAKA+ II    
Sbjct  9    FQIILGSALGARRTILVEMGYHFTVVTADIDEKSIRMDKPKELVMVLAEAKADTIIFXRG  68

Query  246  ----PRLNIDESMEDAEPMLLITCD  308
                 +LN      DA   LLIT D
Sbjct  69   SKVRXQLN-----GDAPATLLITAD  88



>gb|EAZ18696.1| hypothetical protein OsJ_34216 [Oryza sativa Japonica Group]
Length=415

 Score =   130 bits (327),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 76/95 (80%), Gaps = 0/95 (0%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEI  947
             VVV+EG+IREKP  KEEAR+F+K YS    AT+ SV+VTNL TGK+ G LDK E+YFH+I
Sbjct  92    VVVHEGIIREKPTTKEEARQFLKGYSGSHVATVGSVVVTNLTTGKRLGSLDKAEVYFHDI  151

Query  948   PEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRV  1052
             P++VI+ LI+EG V  VAGGLL+EHPL  P+++ V
Sbjct  152   PDEVIENLIDEGVVFRVAGGLLLEHPLTLPFVEAV  186


 Score = 97.4 bits (241),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query  75   PFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRL  254
            PFKLILGS+S  R+ +LAEMG EF  M+ADIDEK+IR+E P++LV  LAEAKA+AI+ RL
Sbjct  12   PFKLILGSSSVARKHILAEMGLEFEVMTADIDEKSIRRENPDELVTILAEAKADAIMSRL  71

Query  255  NI-DESMEDAEPMLLITCDQV  314
            NI D   E   P LLIT D V
Sbjct  72   NISDYQKEGDRPTLLITSDIV  92



>ref|XP_002466540.1| hypothetical protein SORBIDRAFT_01g009640 [Sorghum bicolor]
 gb|EER93538.1| hypothetical protein SORBIDRAFT_01g009640 [Sorghum bicolor]
Length=244

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 84/119 (71%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +V+V +G+IRE+P + E AREFIK YS+ +A  ++ VLVTNL TG  +G  D  EI F  
Sbjct  123   QVMVSKGIIRERPRSAEAAREFIKGYSDDRAFAVNFVLVTNLSTGATKGGWDIPEIKFQH  182

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP++ ID ++ +G +  VAGGL + HP +QP+IK + G  DSV GLP+ LT+KLI E+L
Sbjct  183   IPDEFIDTVVNQGDMTCVAGGLKLTHPSVQPFIKELVGTVDSVRGLPRELTEKLIGELL  241


 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 68/99 (69%), Gaps = 7/99 (7%)
 Frame = +3

Query  18   RSPPAYTGISPRKMEGNTWPFKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKP  197
            RS       SPR++       K+ILGS+S  RR++LA+MGYEF  MSADIDE+AIR E+P
Sbjct  33   RSTKFLACASPRRL-------KIILGSSSPARREILADMGYEFTVMSADIDERAIRMEEP  85

Query  198  EDLVMALAEAKAEAIIPRLNIDESMEDAEPMLLITCDQV  314
            E LV ALAEAKAEAI  +L  D + +  +P L+IT DQV
Sbjct  86   EQLVKALAEAKAEAIKQKLQGDSAPDSDQPALMITSDQV  124



>ref|XP_008643922.1| PREDICTED: uncharacterized protein LOC100381473 isoform X4 [Zea 
mays]
Length=224

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 83/119 (70%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +V+V +G+IRE+P + EEAREFI  YS  +A  ++ VLVT+L TG  RG  D  EI F  
Sbjct  103   QVMVSKGVIRERPRSAEEAREFINGYSGDRAFAVNFVLVTDLSTGTTRGGWDVPEIRFQH  162

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP++ ID+++ +G +  VAGGL + HP +QP++K + G  DSV GLP+ LT+KLI E L
Sbjct  163   IPDEFIDQVVNQGDMTCVAGGLKLTHPSVQPFVKELVGTVDSVRGLPRELTEKLIRESL  221


 Score = 72.0 bits (175),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 66/101 (65%), Gaps = 14/101 (14%)
 Frame = +3

Query  54   KMEGNTWPFKLILGSASAPRRQVLAEMGYEF-----------ITMSADIDEKAIRKEKPE  200
             + GN   FK+ILGS+S  RR++LA+MGYEF           +T+SADIDE+AIR+E+PE
Sbjct  4    SVSGNYPRFKVILGSSSPARREILADMGYEFTVMVGWLYWNPVTLSADIDERAIRREEPE  63

Query  201  DLVMALAEAKAEAIIPRLNIDESM---EDAEPMLLITCDQV  314
             LV ALAEAKAEAI  +L  D +     D    LLIT DQV
Sbjct  64   QLVKALAEAKAEAIKQKLQGDSAPVTDGDQPARLLITSDQV  104



>ref|XP_001416332.1| septum formation protein MAF-like protein [Ostreococcus lucimarinus 
CCE9901]
 gb|ABO94625.1| septum formation protein MAF-like protein [Ostreococcus lucimarinus 
CCE9901]
Length=236

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 83/119 (70%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVV+ G+IREKP +  EAREFI+ Y     +T+ S +VT+L +GK    +D   + F E
Sbjct  118   QVVVHRGIIREKPTSASEAREFIRGYGLDPPSTVGSTMVTDLSSGKSASAVDVNTVVFDE  177

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP+DV++ +++EG  ++ AGGL++EHPL+QPY+KR+ G+ D VMGL     ++L+ E +
Sbjct  178   IPDDVVNAIVDEGECMFCAGGLMVEHPLLQPYLKRIEGSMDGVMGLDAQTVERLLNEFV  236


 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 50/77 (65%), Gaps = 3/77 (4%)
 Frame = +3

Query  84   LILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLNID  263
            +ILGS SA RR +L+ M  E++    DIDEKAIR + PE LV ALA AKA A+  R  + 
Sbjct  46   VILGSGSATRRAILSGMNIEYVIEKPDIDEKAIRFDDPEVLVRALASAKATAV--REKLA  103

Query  264  ESMEDAEPMLLITCDQV  314
            E  E A   LLITCDQV
Sbjct  104  ERGEGAR-RLLITCDQV  119



>ref|XP_005839679.1| hypothetical protein GUITHDRAFT_92283 [Guillardia theta CCMP2712]
 gb|EKX52699.1| hypothetical protein GUITHDRAFT_92283 [Guillardia theta CCMP2712]
Length=179

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 87/131 (66%), Gaps = 4/131 (3%)
 Frame = +3

Query  729   VLMFLTAKLKLLEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKR  908
             V + LT+     +VVV+EG I EKPE++EEAR FI  Y     +T+ ++ VTN+ TGK+ 
Sbjct  52    VTLLLTSD----QVVVHEGRILEKPEDQEEARSFISGYGRSPPSTVGAIAVTNVATGKRV  107

Query  909   GELDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPK  1088
               LDK  I F+ IP DVI++++++   L+ AGGL++E P IQPY+ R+ G  DSVMGL K
Sbjct  108   TSLDKATIVFNSIPSDVIEEIVKDDMTLHCAGGLMVEDPRIQPYLVRIEGGMDSVMGLGK  167

Query  1089  ALTQKLITEVL  1121
               T+ L+  VL
Sbjct  168   RTTRSLLESVL  178


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 41/60 (68%), Gaps = 6/60 (10%)
 Frame = +3

Query  153  MSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLNID------ESMEDAEPMLLITCDQV  314
            + A+IDEKAIR E PE LV+ALA AKA+A++ R   D      E +++++  LL+T DQV
Sbjct  2    LPANIDEKAIRSEDPEKLVLALANAKADALLQRHCKDGKWTGSEQVDESKVTLLLTSDQV  61



>ref|XP_008643921.1| PREDICTED: uncharacterized protein LOC100381473 isoform X3 [Zea 
mays]
Length=248

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 83/119 (70%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +V+V +G+IRE+P + EEAREFI  YS  +A  ++ VLVT+L TG  RG  D  EI F  
Sbjct  127   QVMVSKGVIRERPRSAEEAREFINGYSGDRAFAVNFVLVTDLSTGTTRGGWDVPEIRFQH  186

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP++ ID+++ +G +  VAGGL + HP +QP++K + G  DSV GLP+ LT+KLI E L
Sbjct  187   IPDEFIDQVVNQGDMTCVAGGLKLTHPSVQPFVKELVGTVDSVRGLPRELTEKLIRESL  245


 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 60/82 (73%), Gaps = 3/82 (4%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLN  257
             K+ILGS+S  RR++LA+MGYEF  MSADIDE+AIR+E+PE LV ALAEAKAEAI  +L 
Sbjct  47   LKVILGSSSPARREILADMGYEFTVMSADIDERAIRREEPEQLVKALAEAKAEAIKQKLQ  106

Query  258  IDESM---EDAEPMLLITCDQV  314
             D +     D    LLIT DQV
Sbjct  107  GDSAPVTDGDQPARLLITSDQV  128



>ref|XP_008643920.1| PREDICTED: uncharacterized protein LOC100381473 isoform X2 [Zea 
mays]
Length=259

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 83/119 (70%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +V+V +G+IRE+P + EEAREFI  YS  +A  ++ VLVT+L TG  RG  D  EI F  
Sbjct  138   QVMVSKGVIRERPRSAEEAREFINGYSGDRAFAVNFVLVTDLSTGTTRGGWDVPEIRFQH  197

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP++ ID+++ +G +  VAGGL + HP +QP++K + G  DSV GLP+ LT+KLI E L
Sbjct  198   IPDEFIDQVVNQGDMTCVAGGLKLTHPSVQPFVKELVGTVDSVRGLPRELTEKLIRESL  256


 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 62/93 (67%), Gaps = 14/93 (15%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEF-----------ITMSADIDEKAIRKEKPEDLVMALAE  224
             K+ILGS+S  RR++LA+MGYEF           +T+SADIDE+AIR+E+PE LV ALAE
Sbjct  47   LKVILGSSSPARREILADMGYEFTVMVGWLYWNPVTLSADIDERAIRREEPEQLVKALAE  106

Query  225  AKAEAIIPRLNIDESM---EDAEPMLLITCDQV  314
            AKAEAI  +L  D +     D    LLIT DQV
Sbjct  107  AKAEAIKQKLQGDSAPVTDGDQPARLLITSDQV  139



>ref|XP_009772925.1| PREDICTED: uncharacterized protein LOC104223229 isoform X11 [Nicotiana 
sylvestris]
 ref|XP_009772926.1| PREDICTED: uncharacterized protein LOC104223229 isoform X11 [Nicotiana 
sylvestris]
Length=180

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 85/131 (65%), Gaps = 13/131 (10%)
 Frame = +3

Query  762   LEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLK-----------TGKKR  908
             +EV VY+G+IREKP +KEEAR+FIK       +T + +L  +              G K+
Sbjct  52    IEVAVYQGIIREKPSSKEEARQFIKRSIGNNLSTCTRLLWWSSHGCGICCGDQPHKGDKK  111

Query  909   GELDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPK  1088
               L KV  YFHEIP++VID LIEEG +L VAGGL++EHPL  P++  V G  D VMGLP+
Sbjct  112   RSLGKV--YFHEIPDEVIDSLIEEGIILNVAGGLMLEHPLTLPFVDTVIGTADHVMGLPR  169

Query  1089  ALTQKLITEVL  1121
             +LT+KLI E L
Sbjct  170   SLTEKLIQEAL  180



>ref|XP_009772914.1| PREDICTED: maf-like protein DDB_G0281937 isoform X1 [Nicotiana 
sylvestris]
Length=242

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 85/131 (65%), Gaps = 13/131 (10%)
 Frame = +3

Query  762   LEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLK-----------TGKKR  908
             +EV VY+G+IREKP +KEEAR+FIK       +T + +L  +              G K+
Sbjct  114   IEVAVYQGIIREKPSSKEEARQFIKRSIGNNLSTCTRLLWWSSHGCGICCGDQPHKGDKK  173

Query  909   GELDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPK  1088
               L KV  YFHEIP++VID LIEEG +L VAGGL++EHPL  P++  V G  D VMGLP+
Sbjct  174   RSLGKV--YFHEIPDEVIDSLIEEGIILNVAGGLMLEHPLTLPFVDTVIGTADHVMGLPR  231

Query  1089  ALTQKLITEVL  1121
             +LT+KLI E L
Sbjct  232   SLTEKLIQEAL  242


 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 63/80 (79%), Gaps = 1/80 (1%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLN  257
            FK+ILGS+S  RR++LA+MGY+F  M+ADIDEK+IRKE  E+LV+ALAEAKA+AI+ RL 
Sbjct  8    FKIILGSSSMARRKILADMGYDFTVMTADIDEKSIRKENAEELVVALAEAKADAIMSRLE  67

Query  258  IDESM-EDAEPMLLITCDQV  314
              + + E+  P LLIT D V
Sbjct  68   TTDHLEENTHPTLLITADTV  87



>ref|XP_009772916.1| PREDICTED: maf-like protein DDB_G0281937 isoform X3 [Nicotiana 
sylvestris]
Length=231

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = +3

Query  834   KDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLL  1013
             K YS GQA  + SV+VTNL  G ++G  ++ E+YFHEIP++VID LIEEG +L VAGGL+
Sbjct  136   KGYSGGQATVVGSVVVTNLTKGIRKGAWERSEVYFHEIPDEVIDSLIEEGIILNVAGGLM  195

Query  1014  IEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             +EHPL  P++  V G  D VMGLP++LT+KLI E L
Sbjct  196   LEHPLTLPFVDTVIGTADHVMGLPRSLTEKLIQEAL  231


 Score = 98.6 bits (244),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 68/98 (69%), Gaps = 8/98 (8%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLN  257
            FK+ILGS+S  RR++LA+MGY+F  M+ADIDEK+IRKE  E+LV+ALAEAKA+AI+ RL 
Sbjct  8    FKIILGSSSMARRKILADMGYDFTVMTADIDEKSIRKENAEELVVALAEAKADAIMSRLE  67

Query  258  IDESM-EDAEPMLLITCDQVHNISVAVIFIVKYLQFII  368
              + + E+  P LLIT D        +   + YL  ++
Sbjct  68   TTDHLEENTHPTLLITAD-------TIFLAISYLHLLV  98



>ref|XP_009772918.1| PREDICTED: maf-like protein DDB_G0281937 isoform X5 [Nicotiana 
sylvestris]
Length=213

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 83/129 (64%), Gaps = 13/129 (10%)
 Frame = +3

Query  768   VVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLK-----------TGKKRGE  914
             V VY+G+IREKP +KEEAR+FIK       +T + +L  +              G K+  
Sbjct  87    VAVYQGIIREKPSSKEEARQFIKRSIGNNLSTCTRLLWWSSHGCGICCGDQPHKGDKKRS  146

Query  915   LDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKAL  1094
             L KV  YFHEIP++VID LIEEG +L VAGGL++EHPL  P++  V G  D VMGLP++L
Sbjct  147   LGKV--YFHEIPDEVIDSLIEEGIILNVAGGLMLEHPLTLPFVDTVIGTADHVMGLPRSL  204

Query  1095  TQKLITEVL  1121
             T+KLI E L
Sbjct  205   TEKLIQEAL  213


 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 63/80 (79%), Gaps = 1/80 (1%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLN  257
            FK+ILGS+S  RR++LA+MGY+F  M+ADIDEK+IRKE  E+LV+ALAEAKA+AI+ RL 
Sbjct  8    FKIILGSSSMARRKILADMGYDFTVMTADIDEKSIRKENAEELVVALAEAKADAIMSRLE  67

Query  258  IDESM-EDAEPMLLITCDQV  314
              + + E+  P LLIT D V
Sbjct  68   TTDHLEENTHPTLLITADTV  87



>ref|NP_001167780.1| uncharacterized protein LOC100381473 [Zea mays]
 ref|XP_008643923.1| PREDICTED: uncharacterized protein LOC100381473 isoform X1 [Zea 
mays]
 gb|ACN26044.1| unknown [Zea mays]
Length=120

 Score =   118 bits (295),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 58/117 (50%), Positives = 81/117 (69%), Gaps = 0/117 (0%)
 Frame = +3

Query  771   VVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEIP  950
             +V +G+IRE+P + EEAREFI  YS  +A  ++ VLVT+L TG  RG  D  EI F  IP
Sbjct  1     MVSKGVIRERPRSAEEAREFINGYSGDRAFAVNFVLVTDLSTGTTRGGWDVPEIRFQHIP  60

Query  951   EDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             ++ ID+++ +G +  VAGGL + HP +QP++K + G  DSV GLP+ LT+KLI E L
Sbjct  61    DEFIDQVVNQGDMTCVAGGLKLTHPSVQPFVKELVGTVDSVRGLPRELTEKLIRESL  117



>ref|XP_009772917.1| PREDICTED: maf-like protein DDB_G0281937 isoform X4 [Nicotiana 
sylvestris]
Length=229

 Score =   120 bits (302),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 71/94 (76%), Gaps = 0/94 (0%)
 Frame = +3

Query  840   YSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIE  1019
             YS GQA  + SV+VTNL  G ++G  ++ E+YFHEIP++VID LIEEG +L VAGGL++E
Sbjct  136   YSGGQATVVGSVVVTNLTKGIRKGAWERSEVYFHEIPDEVIDSLIEEGIILNVAGGLMLE  195

Query  1020  HPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             HPL  P++  V G  D VMGLP++LT+KLI E L
Sbjct  196   HPLTLPFVDTVIGTADHVMGLPRSLTEKLIQEAL  229


 Score = 98.6 bits (244),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 68/98 (69%), Gaps = 8/98 (8%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLN  257
            FK+ILGS+S  RR++LA+MGY+F  M+ADIDEK+IRKE  E+LV+ALAEAKA+AI+ RL 
Sbjct  8    FKIILGSSSMARRKILADMGYDFTVMTADIDEKSIRKENAEELVVALAEAKADAIMSRLE  67

Query  258  IDESM-EDAEPMLLITCDQVHNISVAVIFIVKYLQFII  368
              + + E+  P LLIT D        +   + YL  ++
Sbjct  68   TTDHLEENTHPTLLITAD-------TIFLAISYLHLLV  98



>emb|CBN74303.1| conserved unknown protein [Ectocarpus siliculosus]
Length=211

 Score =   120 bits (301),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 59/132 (45%), Positives = 87/132 (66%), Gaps = 4/132 (3%)
 Frame = +3

Query  714   R*DLSVLMFLTAKLKLLEVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLK  893
             R +LS    LT      +VVV++G I EKP +++E R  I  Y+     T+ S ++T++ 
Sbjct  78    RGELSTSWLLTGD----QVVVHDGRILEKPADEDEVRRNIASYARSPCRTVGSAVLTDIS  133

Query  894   TGKKRGELDKVEIYFHEIPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSV  1073
             TG++   +D  EI+F E+PE V+ KL  EGTVL  AGGL++EHPL++P+I R+ G+ DSV
Sbjct  134   TGQQFSGVDTAEIFFKEVPESVVTKLCGEGTVLQCAGGLMVEHPLVEPFIARIDGSMDSV  193

Query  1074  MGLPKALTQKLI  1109
             MGL KAL  +L+
Sbjct  194   MGLSKALVLELL  205


 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 48/80 (60%), Gaps = 2/80 (3%)
 Frame = +3

Query  81   KLILGSASAPRRQVLAEMGYEFITMSADIDEKAI--RKEKPEDLVMALAEAKAEAIIPRL  254
            ++ILGS S  R+ ++ EMG+  I  SADI+E AI  R   P DLV+ L  AKAEA++P L
Sbjct  13   QIILGSKSFTRKMIIEEMGFVPIVRSADINEAAIGDRTADPADLVLQLGLAKAEALLPAL  72

Query  255  NIDESMEDAEPMLLITCDQV  314
              +    +     L+T DQV
Sbjct  73   KAEADRGELSTSWLLTGDQV  92



>ref|XP_003075217.1| putative Maf-like protein (ISS) [Ostreococcus tauri]
 emb|CAL52489.1| Maf-like protein [Ostreococcus tauri]
Length=211

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 82/119 (69%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVV+ G IREKP +++EAR FI+ Y     +T+ S +VT+L TGK    +D   + F  
Sbjct  93    QVVVHRGEIREKPSSEDEARAFIRGYGVDPPSTVGSTMVTDLSTGKSALAVDVNTVVFDA  152

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP+DV+D ++EEG  ++ AGGL++EH L+QPY++R+ G+ D VMGL     ++L+ E++
Sbjct  153   IPDDVVDAIVEEGECMHCAGGLMVEHELVQPYLRRIDGSLDGVMGLDAKTVERLLDELI  211


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 51/79 (65%), Gaps = 3/79 (4%)
 Frame = +3

Query  78   FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLN  257
             ++ILGS S+ RR VL+ MG + + +  DIDEKAIR++ P+ LV ALA AKA+A   +L 
Sbjct  19   CEVILGSGSSTRRAVLSSMGIDHVVVKPDIDEKAIRRDDPKALVRALAIAKADAAKEKLG  78

Query  258  IDESMEDAEPMLLITCDQV  314
              +        LLITCDQV
Sbjct  79   TSDF---GTRRLLITCDQV  94



>ref|XP_005702796.1| septum formation protein / Maf family protein [Galdieria sulphuraria]
 gb|EME26276.1| septum formation protein / Maf family protein [Galdieria sulphuraria]
Length=1353

 Score =   126 bits (316),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 85/119 (71%), Gaps = 0/119 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVV+EG I EKP++  EAREFI  YS   A T+ +++VTN ++ ++   LD+ E+YFH 
Sbjct  1235  QVVVHEGRILEKPKDANEAREFISGYSCSPAVTVGAIVVTNCQSYQRECGLDRSEVYFHP  1294

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITEVL  1121
             IP+ VI +L+EEG+V Y AGGL +E+PL+  ++  + G  DSVMGL + + +KLI ++L
Sbjct  1295  IPDSVIQQLVEEGSVYYCAGGLQVENPLVSKFVDHIVGTLDSVMGLSRQVLEKLIEKIL  1353


 Score = 73.2 bits (178),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 53/79 (67%), Gaps = 2/79 (3%)
 Frame = +3

Query  78    FKLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLN  257
             F LILGS+S  R+ +L + GYEF T SA+IDEK+IR E  E+LV  LA AK++AI+ R  
Sbjct  1160  FHLILGSSSPSRQALLKQWGYEFETESANIDEKSIRAETAEELVQKLAVAKSDAILARRT  1219

Query  258   IDESMEDAEPMLLITCDQV  314
                  E+ +  LL+T DQV
Sbjct  1220  TQ--FENQKTTLLVTADQV  1236



>ref|XP_001703013.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDO96751.1| predicted protein [Chlamydomonas reinhardtii]
Length=210

 Score =   117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 81/117 (69%), Gaps = 0/117 (0%)
 Frame = +3

Query  765   EVVVYEGMIREKPENKEEAREFIKDYSNGQAATISSVLVTNLKTGKKRGELDKVEIYFHE  944
             +VVV+E  I EKP + +EA E+I  Y    A+T+ +VL T+L +G+   +++   I+F  
Sbjct  90    QVVVHEDRILEKPSSVDEAHEYIDGYGRSPASTVGAVLATDLASGRAAEDVETSYIHFRP  149

Query  945   IPEDVIDKLIEEGTVLYVAGGLLIEHPLIQPYIKRVAGATDSVMGLPKALTQKLITE  1115
             IPEDV  +LIEEG V Y AGGL+IEHPL++P+I+R+ G   SVMGLPK L  +L+ E
Sbjct  150   IPEDVRARLIEEGEVFYCAGGLMIEHPLVEPHIERMDGTQCSVMGLPKHLVLRLMLE  206


 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 52/80 (65%), Gaps = 7/80 (9%)
 Frame = +3

Query  81   KLILGSASAPRRQVLAEMGYEFITMSADIDEKAIRKEKPEDLVMALAEAKAEAIIPRLNI  260
            +++LGSAS  R+Q++ E G+ +   +ADIDEKAIR   PE LV  LA AK EAII ++  
Sbjct  17   RILLGSASFARKQIMTEHGFTYEVRTADIDEKAIRDPSPEMLVRLLARAKREAIIAKMK-  75

Query  261  DESMEDAEPM--LLITCDQV  314
                   EP+  LLITCDQV
Sbjct  76   ----AAGEPLQGLLITCDQV  91



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3744971002710