BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18145_g1_i2 len=1509 path=[2777:0-653 2776:654-675 2489:676-923
649:924-1508]

Length=1509
                                                                      Score     E

ref|XP_006358064.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     434   2e-145   
ref|XP_004233007.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     434   2e-145   
ref|XP_009757862.1|  PREDICTED: uncharacterized protein LOC104210613    435   6e-140   
ref|XP_006358065.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     417   4e-139   
ref|XP_009598192.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     417   8e-139   
ref|XP_009623261.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     410   3e-136   
ref|XP_009796870.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     408   2e-135   
ref|XP_004234069.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     404   1e-133   
ref|XP_008349184.1|  PREDICTED: GDSL esterase/lipase At1g29660-like     401   1e-132   
ref|XP_009800182.1|  PREDICTED: GDSL esterase/lipase At1g29670-li...    400   1e-132   
ref|XP_009360797.1|  PREDICTED: GDSL esterase/lipase At1g29660-like     398   2e-131   
gb|EYU28138.1|  hypothetical protein MIMGU_mgv1a008735mg                397   6e-131   
ref|XP_009613021.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     389   1e-127   
ref|XP_009757859.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     388   1e-127   
ref|XP_011085626.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     386   3e-127   
ref|XP_009594105.1|  PREDICTED: GDSL esterase/lipase At5g45670-li...    387   4e-127   
emb|CDP21052.1|  unnamed protein product                                401   8e-127   
ref|XP_004232998.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     382   3e-125   
emb|CDO96912.1|  unnamed protein product                                380   2e-124   
ref|XP_006355554.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     378   9e-124   
ref|XP_010095104.1|  GDSL esterase/lipase                               377   3e-123   
ref|XP_002266915.1|  PREDICTED: GDSL esterase/lipase At1g29670          376   8e-123   Vitis vinifera
ref|XP_007213451.1|  hypothetical protein PRUPE_ppa024746mg             371   5e-121   
ref|XP_006389045.1|  hypothetical protein POPTR_0053s00200g             371   6e-121   
ref|XP_008366023.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     370   2e-120   
ref|XP_004233010.2|  PREDICTED: uncharacterized protein LOC101263269    382   3e-120   
ref|XP_006388931.1|  hypothetical protein POPTR_0073s00220g             367   1e-119   
ref|XP_007213100.1|  hypothetical protein PRUPE_ppa023347mg             366   2e-119   
ref|XP_010095107.1|  GDSL esterase/lipase                               367   5e-119   
ref|XP_011046352.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     364   3e-118   
ref|XP_009591549.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     364   3e-118   
emb|CBI30761.3|  unnamed protein product                                363   4e-118   
gb|ABK94705.1|  unknown                                                 363   4e-118   Populus trichocarpa [western balsam poplar]
gb|ABK95330.1|  unknown                                                 363   9e-118   Populus trichocarpa [western balsam poplar]
ref|XP_006388930.1|  hypothetical protein POPTR_0073s00220g             363   1e-117   
ref|XP_007212968.1|  hypothetical protein PRUPE_ppa021115mg             362   2e-117   
ref|XP_008225429.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     371   9e-117   
ref|XP_002266118.1|  PREDICTED: GDSL esterase/lipase At5g45670          360   2e-116   Vitis vinifera
gb|ABK94783.1|  unknown                                                 358   6e-116   Populus trichocarpa [western balsam poplar]
ref|XP_002522289.1|  zinc finger protein, putative                      357   4e-115   Ricinus communis
ref|XP_006355619.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     356   5e-115   
ref|XP_009360952.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     361   1e-114   
ref|XP_010046960.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     354   1e-114   
emb|CAN79113.1|  hypothetical protein VITISV_007009                     352   7e-114   Vitis vinifera
ref|XP_002316750.2|  hypothetical protein POPTR_0011s03110g             353   7e-114   Populus trichocarpa [western balsam poplar]
ref|XP_004295410.1|  PREDICTED: GDSL esterase/lipase At1g29660-like     353   1e-113   
ref|XP_006465152.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     352   2e-113   
ref|XP_006580187.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     351   4e-113   
gb|KHN06444.1|  GDSL esterase/lipase                                    350   5e-113   
ref|XP_006388165.1|  hypothetical protein POPTR_0306s00210g             350   7e-113   
ref|XP_006436361.1|  hypothetical protein CICLE_v10031897mg             350   1e-112   
ref|XP_006465155.1|  PREDICTED: GDSL esterase/lipase At1g29660-like     349   3e-112   
ref|XP_006449581.1|  hypothetical protein CICLE_v10018052mg             351   3e-112   
ref|XP_011045705.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     348   3e-112   
ref|XP_002262696.2|  PREDICTED: uncharacterized protein LOC100266969    374   4e-112   Vitis vinifera
ref|XP_006344120.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     348   6e-112   
ref|XP_006387682.1|  hypothetical protein POPTR_0679s00220g             348   6e-112   
ref|XP_007159508.1|  hypothetical protein PHAVU_002G243500g             347   1e-111   
ref|XP_010273430.1|  PREDICTED: GDSL esterase/lipase At4g18970-like     347   1e-111   
ref|XP_006388932.1|  hypothetical protein POPTR_0073s00230g             347   2e-111   
gb|KEH33152.1|  GDSL-like lipase/acylhydrolase                          347   2e-111   
ref|XP_006465154.1|  PREDICTED: GDSL esterase/lipase At1g29660-like     347   2e-111   
ref|XP_008439698.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     347   2e-111   
gb|AFK47139.1|  unknown                                                 345   3e-111   
ref|XP_010095106.1|  GDSL esterase/lipase                               345   3e-111   
ref|XP_006436372.1|  hypothetical protein CICLE_v10033655mg             345   4e-111   
ref|XP_004297889.1|  PREDICTED: GDSL esterase/lipase At1g29660-like     346   5e-111   
ref|XP_009351929.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     345   5e-111   
ref|XP_010273431.1|  PREDICTED: GDSL esterase/lipase At4g18970-like     346   6e-111   
gb|ACJ85846.1|  unknown                                                 346   6e-111   Medicago truncatula
ref|XP_004233002.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     345   1e-110   
gb|KHG24391.1|  hypothetical protein F383_02353                         344   1e-110   
emb|CDO96911.1|  unnamed protein product                                344   2e-110   
gb|KHN06446.1|  GDSL esterase/lipase                                    344   2e-110   
ref|XP_008225404.1|  PREDICTED: GDSL esterase/lipase At1g29660-like     344   2e-110   
dbj|BAB56037.1|  putative proline-rich protein                          344   2e-110   Oryza sativa Japonica Group [Japonica rice]
gb|KDO77976.1|  hypothetical protein CISIN_1g037608mg                   344   2e-110   
ref|XP_006355561.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     344   3e-110   
ref|XP_002522292.1|  zinc finger protein, putative                      343   5e-110   Ricinus communis
ref|XP_010540543.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     343   5e-110   
ref|XP_009769554.1|  PREDICTED: GDSL esterase/lipase At1g29670 is...    343   5e-110   
gb|KDP21165.1|  hypothetical protein JCGZ_21636                         343   6e-110   
ref|XP_010549442.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     342   8e-110   
ref|NP_001242366.1|  uncharacterized protein LOC100800635 precursor     342   9e-110   
gb|EYU28141.1|  hypothetical protein MIMGU_mgv1a008629mg                342   1e-109   
ref|XP_006436364.1|  hypothetical protein CICLE_v10033788mg             342   1e-109   
ref|XP_006436366.1|  hypothetical protein CICLE_v10033707mg             342   1e-109   
ref|XP_002267325.1|  PREDICTED: GDSL esterase/lipase At1g29670          342   2e-109   Vitis vinifera
ref|XP_011085304.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     341   2e-109   
ref|XP_009612510.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     341   3e-109   
ref|XP_010687164.1|  PREDICTED: GDSL esterase/lipase At4g18970-like     340   4e-109   
ref|XP_010046959.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     340   5e-109   
ref|XP_010460737.1|  PREDICTED: GDSL esterase/lipase At1g29660-like     340   6e-109   
gb|KDP21169.1|  hypothetical protein JCGZ_21640                         340   6e-109   
ref|XP_011102152.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     340   7e-109   
ref|XP_010655321.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     340   8e-109   
ref|XP_003629880.1|  GDSL esterase/lipase                               340   9e-109   
ref|XP_010549444.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     340   1e-108   
ref|XP_010924691.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     339   1e-108   
ref|XP_010272684.1|  PREDICTED: GDSL esterase/lipase At4g18970-like     339   1e-108   
gb|EYU43295.1|  hypothetical protein MIMGU_mgv1a008614mg                339   2e-108   
ref|XP_010478329.1|  PREDICTED: GDSL esterase/lipase At1g29660          339   2e-108   
gb|KHN48037.1|  GDSL esterase/lipase                                    338   2e-108   
gb|ABY59947.1|  nectar protein 1                                        338   2e-108   Jacaranda mimosifolia
ref|XP_006355559.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     338   3e-108   
ref|XP_006305157.1|  hypothetical protein CARUB_v10009525mg             338   4e-108   
gb|KFK44793.1|  hypothetical protein AALP_AA1G304100                    338   4e-108   
ref|XP_004497726.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     338   5e-108   
ref|XP_009102833.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     338   5e-108   
ref|XP_004504253.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     337   7e-108   
gb|AAZ23955.1|  GDSL-lipase 1                                           337   8e-108   Capsicum annuum
ref|XP_006415557.1|  hypothetical protein EUTSA_v10008016mg             337   9e-108   
emb|CDY35297.1|  BnaC03g59260D                                          337   9e-108   
ref|XP_002890825.1|  GDSL-motif lipase/hydrolase family protein         337   9e-108   
ref|XP_002522290.1|  zinc finger protein, putative                      337   1e-107   Ricinus communis
ref|XP_004232990.1|  PREDICTED: GDSL esterase/lipase At5g45670          337   1e-107   
ref|XP_006465150.1|  PREDICTED: GDSL esterase/lipase At1g29660-like     337   1e-107   
ref|NP_001242353.1|  uncharacterized protein LOC100777335 precursor     337   2e-107   
emb|CBI18440.3|  unnamed protein product                                336   3e-107   
ref|XP_011102202.1|  PREDICTED: uncharacterized protein LOC105180227    348   3e-107   
ref|XP_009769556.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     336   4e-107   
ref|XP_006467574.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     335   4e-107   
ref|XP_006449582.1|  hypothetical protein CICLE_v10015686mg             335   5e-107   
ref|XP_010499475.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    334   1e-106   
emb|CDX90201.1|  BnaA08g17830D                                          334   1e-106   
emb|CBI30762.3|  unnamed protein product                                335   1e-106   
ref|XP_009612511.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     334   1e-106   
ref|NP_174260.1|  GDSL esterase/lipase                                  334   1e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006471326.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     334   1e-106   
ref|XP_002263997.1|  PREDICTED: GDSL esterase/lipase At5g45670          334   2e-106   Vitis vinifera
gb|AAM65973.1|  lipase/hydrolase, putative                              334   2e-106   Arabidopsis thaliana [mouse-ear cress]
ref|NP_174259.1|  GDSL esterase/lipase                                  333   2e-106   Arabidopsis thaliana [mouse-ear cress]
gb|AAM64368.1|  lipase/hydrolase, putative                              333   3e-106   Arabidopsis thaliana [mouse-ear cress]
emb|CAN71483.1|  hypothetical protein VITISV_004374                     333   3e-106   Vitis vinifera
ref|XP_010499477.1|  PREDICTED: GDSL esterase/lipase At1g29670          333   3e-106   
ref|XP_010911116.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     333   4e-106   
emb|CDX90202.1|  BnaA08g17820D                                          333   4e-106   
gb|KCW78677.1|  hypothetical protein EUGRSUZ_C00134                     332   4e-106   
ref|XP_007025248.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    332   7e-106   
ref|XP_004134596.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     332   1e-105   
ref|XP_007225031.1|  hypothetical protein PRUPE_ppa019929mg             331   1e-105   
ref|XP_009109657.1|  PREDICTED: GDSL esterase/lipase At1g29660          332   1e-105   
ref|XP_010054297.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     332   2e-105   
ref|XP_002316749.2|  GDSL-motif lipase/hydrolase family protein         331   2e-105   Populus trichocarpa [western balsam poplar]
ref|XP_002890824.1|  GDSL-motif lipase/hydrolase family protein         331   3e-105   
emb|CDX94689.1|  BnaC07g09690D                                          330   4e-105   
ref|XP_010057187.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     330   4e-105   
ref|XP_008443704.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     330   5e-105   
ref|XP_008371536.1|  PREDICTED: GDSL esterase/lipase At5g45670          330   5e-105   
ref|XP_009102834.1|  PREDICTED: GDSL esterase/lipase At1g29660-like     330   5e-105   
ref|XP_007224226.1|  hypothetical protein PRUPE_ppa018058mg             328   8e-105   
emb|CDY35296.1|  BnaC03g59270D                                          329   9e-105   
ref|XP_010540541.1|  PREDICTED: GDSL esterase/lipase At1g29670-li...    330   9e-105   
ref|XP_002265963.1|  PREDICTED: GDSL esterase/lipase At1g29670 is...    329   1e-104   Vitis vinifera
gb|AAX20033.1|  GDSL-lipase protein                                     329   1e-104   Capsicum annuum
ref|XP_007147964.1|  hypothetical protein PHAVU_006G169100g             329   1e-104   
ref|XP_011010176.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     329   2e-104   
ref|XP_010095110.1|  GDSL esterase/lipase                               329   2e-104   
ref|XP_009351953.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    328   2e-104   
gb|KEH15769.1|  GDSL-like lipase/acylhydrolase                          328   2e-104   
ref|XP_010057371.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     328   3e-104   
ref|XP_002304022.1|  hypothetical protein POPTR_0003s21730g             328   3e-104   Populus trichocarpa [western balsam poplar]
ref|XP_004293650.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     328   5e-104   
ref|XP_004234068.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     328   5e-104   
ref|XP_009109655.1|  PREDICTED: GDSL esterase/lipase At1g29670          327   5e-104   
ref|XP_010655594.1|  PREDICTED: GDSL esterase/lipase At1g29670 is...    327   6e-104   
ref|XP_006305152.1|  hypothetical protein CARUB_v10009519mg             327   6e-104   
gb|KFK44794.1|  hypothetical protein AALP_AA1G304300                    327   6e-104   
ref|XP_004485963.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     327   8e-104   
ref|XP_008803727.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     327   8e-104   
ref|XP_010050223.1|  PREDICTED: uncharacterized protein LOC104438742    340   1e-103   
emb|CBI30764.3|  unnamed protein product                                329   1e-103   
ref|XP_011025221.1|  PREDICTED: GDSL esterase/lipase At4g18970-like     326   2e-103   
ref|XP_004147394.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     326   2e-103   
ref|XP_009406156.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     326   2e-103   
gb|KHG06516.1|  hypothetical protein F383_33590                         326   3e-103   
ref|XP_007147963.1|  hypothetical protein PHAVU_006G169000g             325   3e-103   
ref|XP_006356087.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     325   3e-103   
emb|CDO96913.1|  unnamed protein product                                325   6e-103   
gb|ABF72016.1|  GDSL-motif lipase/hydrolase family protein              324   7e-103   Musa acuminata [banana]
ref|XP_002324947.2|  hypothetical protein POPTR_0018s03490g             324   1e-102   Populus trichocarpa [western balsam poplar]
gb|KGN65589.1|  hypothetical protein Csa_1G467090                       325   1e-102   
ref|XP_008223778.1|  PREDICTED: uncharacterized protein LOC103323554    339   1e-102   
ref|XP_007014322.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    325   1e-102   
ref|XP_006852691.1|  hypothetical protein AMTR_s00021p00254410          326   2e-102   
ref|XP_008387170.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     324   2e-102   
ref|XP_003526254.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     323   2e-102   
gb|AGJ83937.1|  GLIP                                                    323   2e-102   
ref|XP_004969944.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     323   2e-102   
ref|XP_008366613.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     323   2e-102   
emb|CDO96914.1|  unnamed protein product                                323   3e-102   
ref|XP_008792294.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     323   4e-102   
ref|XP_008366024.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     323   5e-102   
ref|NP_001149080.1|  anther-specific proline-rich protein APG pre...    323   5e-102   Zea mays [maize]
ref|XP_006415558.1|  hypothetical protein EUTSA_v10007994mg             322   6e-102   
emb|CDO96915.1|  unnamed protein product                                322   6e-102   
ref|XP_003569805.1|  PREDICTED: GDSL esterase/lipase At1g29660-like     322   7e-102   
ref|XP_003629878.1|  GDSL esterase/lipase                               322   7e-102   
dbj|BAJ85694.1|  predicted protein                                      321   1e-101   
ref|XP_003546057.1|  PREDICTED: GDSL esterase/lipase At1g29670          321   2e-101   
ref|XP_008225405.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     321   2e-101   
gb|EYU28139.1|  hypothetical protein MIMGU_mgv1a008961mg                320   3e-101   
ref|XP_009392443.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     320   3e-101   
ref|XP_011035467.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     320   5e-101   
gb|EYU32864.1|  hypothetical protein MIMGU_mgv1a024394mg                319   5e-101   
ref|XP_007014320.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    320   5e-101   
ref|XP_009594106.1|  PREDICTED: GDSL esterase/lipase At1g29670-li...    318   6e-101   
emb|CDM83980.1|  unnamed protein product                                319   1e-100   
ref|XP_006858605.1|  hypothetical protein AMTR_s00071p00200630          319   1e-100   
ref|XP_011102156.1|  PREDICTED: GDSL esterase/lipase At4g18970-like     318   1e-100   
ref|XP_010687162.1|  PREDICTED: GDSL esterase/lipase At5g45670          319   1e-100   
ref|XP_004961487.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     318   3e-100   
ref|XP_011046354.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     318   3e-100   
ref|XP_002305046.1|  GDSL-motif lipase/hydrolase family protein         318   3e-100   Populus trichocarpa [western balsam poplar]
ref|XP_008441774.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     318   4e-100   
ref|XP_002456353.1|  hypothetical protein SORBIDRAFT_03g034560          318   4e-100   Sorghum bicolor [broomcorn]
ref|XP_010522212.1|  PREDICTED: GDSL esterase/lipase At1g29660-like     317   5e-100   
ref|XP_007211471.1|  hypothetical protein PRUPE_ppa007546mg             317   6e-100   
gb|KDP25050.1|  hypothetical protein JCGZ_22585                         316   2e-99    
ref|XP_003566036.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     314   7e-99    
ref|XP_010687168.1|  PREDICTED: GDSL esterase/lipase At4g18970-like     313   1e-98    
ref|XP_004504254.1|  PREDICTED: GDSL esterase/lipase At4g18970-like     311   6e-98    
ref|XP_002513318.1|  zinc finger protein, putative                      311   2e-97    Ricinus communis
ref|XP_002441391.1|  hypothetical protein SORBIDRAFT_09g025780          311   2e-97    Sorghum bicolor [broomcorn]
ref|XP_006655493.1|  PREDICTED: GDSL esterase/lipase At4g18970-like     310   2e-97    
ref|XP_011045057.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     309   4e-97    
ref|XP_010518837.1|  PREDICTED: GDSL esterase/lipase At5g45670-li...    310   7e-97    
ref|XP_011081388.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     316   7e-97    
gb|EPS68861.1|  hypothetical protein M569_05905                         309   7e-97    
emb|CDY59325.1|  BnaCnng34700D                                          308   9e-97    
ref|XP_009114398.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     309   9e-97    
emb|CDY13043.1|  BnaA09g17740D                                          309   9e-97    
ref|XP_006398248.1|  hypothetical protein EUTSA_v10000937mg             308   1e-96    
ref|XP_006468197.1|  PREDICTED: GDSL esterase/lipase At4g18970-like     308   1e-96    
ref|XP_010518836.1|  PREDICTED: GDSL esterase/lipase At5g45670-li...    310   1e-96    
ref|XP_009101579.1|  PREDICTED: GDSL esterase/lipase At5g45670          308   2e-96    
ref|XP_010481545.1|  PREDICTED: GDSL esterase/lipase At5g45670          308   2e-96    
ref|XP_010441685.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     308   2e-96    
ref|XP_008383578.1|  PREDICTED: GDSL esterase/lipase At1g29660-like     306   2e-96    
ref|XP_010494685.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     308   3e-96    
gb|KGN61305.1|  hypothetical protein Csa_2G078090                       307   4e-96    
ref|XP_002865231.1|  GDSL-motif lipase/hydrolase family protein         307   5e-96    
emb|CDY23109.1|  BnaC09g18630D                                          306   6e-96    
gb|ABF72017.1|  GDSL-motif lipase/hydrolase family protein              307   6e-96    Musa acuminata [banana]
gb|ABF70089.1|  GDSL-motif lipase/hydrolase family protein              307   8e-96    Musa balbisiana [starchy banana]
ref|XP_009770266.1|  PREDICTED: GDSL esterase/lipase At1g33811 is...    306   1e-95    
ref|XP_010540540.1|  PREDICTED: GDSL esterase/lipase At1g29660-like     306   1e-95    
ref|XP_006280692.1|  hypothetical protein CARUB_v10026655mg             305   2e-95    
gb|KEH36667.1|  GDSL-like lipase/acylhydrolase                          306   2e-95    
ref|XP_006372072.1|  hypothetical protein POPTR_0018s09660g             306   2e-95    
ref|XP_007212979.1|  hypothetical protein PRUPE_ppa022477mg             303   2e-95    
emb|CDY39440.1|  BnaAnng05710D                                          305   2e-95    
gb|ACN29259.1|  unknown                                                 305   2e-95    Zea mays [maize]
ref|XP_010062377.1|  PREDICTED: GDSL esterase/lipase At1g33811          306   3e-95    
ref|XP_010683187.1|  PREDICTED: GDSL esterase/lipase At1g33811          306   3e-95    
ref|NP_001149980.1|  anther-specific proline-rich protein APG pre...    305   4e-95    Zea mays [maize]
gb|KEH36671.1|  GDSL-like lipase/acylhydrolase                          305   4e-95    
ref|XP_002456282.1|  hypothetical protein SORBIDRAFT_03g033460          304   6e-95    Sorghum bicolor [broomcorn]
ref|XP_004152864.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     303   6e-95    
gb|KFK31532.1|  hypothetical protein AALP_AA6G124800                    304   7e-95    
ref|XP_009136981.1|  PREDICTED: GDSL esterase/lipase At4g18970          304   7e-95    
emb|CDX98598.1|  BnaA03g43830D                                          304   7e-95    
ref|NP_567570.1|  GDSL esterase/lipase                                  304   7e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002324528.2|  hypothetical protein POPTR_0018s09650g             304   8e-95    Populus trichocarpa [western balsam poplar]
ref|XP_009351941.1|  PREDICTED: GDSL esterase/lipase At1g29660-like     303   1e-94    
ref|XP_006381792.1|  hypothetical protein POPTR_0006s18240g             304   1e-94    
gb|KHN47367.1|  GDSL esterase/lipase                                    303   2e-94    
ref|XP_010538583.1|  PREDICTED: GDSL esterase/lipase At5g45670          303   2e-94    
ref|XP_011030197.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     303   2e-94    
ref|XP_006388671.1|  hypothetical protein POPTR_0124s00210g             303   2e-94    
ref|XP_010687163.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     302   3e-94    
ref|XP_006441609.1|  hypothetical protein CICLE_v10020729mg             302   3e-94    
emb|CDY01575.1|  BnaC07g35650D                                          302   4e-94    
ref|XP_003569720.1|  PREDICTED: GDSL esterase/lipase At5g45670          302   4e-94    
ref|XP_002325032.1|  hypothetical protein POPTR_0018s09580g             302   6e-94    Populus trichocarpa [western balsam poplar]
ref|NP_001190767.1|  GDSL esterase/lipase                               303   6e-94    
ref|NP_199379.1|  GDSL esterase/lipase                                  301   6e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867968.1|  GDSL-motif lipase/hydrolase family protein         301   7e-94    
ref|XP_002522288.1|  zinc finger protein, putative                      312   8e-94    Ricinus communis
gb|AFK45054.1|  unknown                                                 301   8e-94    
ref|XP_002325035.2|  hypothetical protein POPTR_0018s09590g             301   9e-94    
ref|XP_006494856.1|  PREDICTED: GDSL esterase/lipase At1g33811-like     301   1e-93    
gb|ABK94885.1|  unknown                                                 301   1e-93    
gb|AAM67249.1|  GDSL-motif lipase/hydrolase-like protein                300   1e-93    
ref|XP_009596154.1|  PREDICTED: GDSL esterase/lipase At1g33811 is...    300   2e-93    
ref|XP_007025249.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    301   2e-93    
gb|AAM63021.1|  GDSL-motif lipase/hydrolase-like protein                300   3e-93    
ref|XP_004969823.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     299   4e-93    
ref|XP_004486282.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     299   5e-93    
ref|XP_003598046.1|  GDSL esterase/lipase                               299   9e-93    
ref|XP_008786406.1|  PREDICTED: GDSL esterase/lipase At1g33811          298   9e-93    
ref|XP_002318829.2|  hypothetical protein POPTR_0012s13540g             299   1e-92    
ref|XP_008371524.1|  PREDICTED: GDSL esterase/lipase At1g29660-like     297   1e-92    
ref|XP_011014567.1|  PREDICTED: GDSL esterase/lipase At1g29660-like     299   1e-92    
ref|XP_011030064.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     299   1e-92    
gb|EAY75691.1|  hypothetical protein OsI_03598                          298   2e-92    
gb|KFK28567.1|  hypothetical protein AALP_AA7G013200                    297   2e-92    
ref|XP_006646284.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     297   3e-92    
ref|XP_002325034.2|  hypothetical protein POPTR_0018s09610g             298   3e-92    
emb|CAA16754.1|  putative protein                                       305   3e-92    
ref|XP_009416437.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     297   4e-92    
ref|XP_011008118.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     297   4e-92    
gb|KDP21164.1|  hypothetical protein JCGZ_21635                         296   4e-92    
ref|XP_006414032.1|  hypothetical protein EUTSA_v10025529mg             296   5e-92    
ref|XP_004485959.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     296   7e-92    
emb|CDM84214.1|  unnamed protein product                                296   8e-92    
dbj|BAJ85725.1|  predicted protein                                      296   8e-92    
ref|XP_006339350.1|  PREDICTED: GDSL esterase/lipase At1g33811-like     296   9e-92    
ref|XP_006415056.1|  hypothetical protein EUTSA_v10007976mg             296   1e-91    
ref|XP_011010333.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     296   1e-91    
ref|XP_010449440.1|  PREDICTED: GDSL esterase/lipase At4g18970-like     295   1e-91    
ref|XP_007226475.1|  hypothetical protein PRUPE_ppa027202mg             295   1e-91    
ref|XP_010054298.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     295   1e-91    
ref|XP_010434476.1|  PREDICTED: GDSL esterase/lipase At4g18970          295   1e-91    
ref|XP_010439787.1|  PREDICTED: GDSL esterase/lipase At4g18970-like     295   2e-91    
ref|XP_010930423.1|  PREDICTED: GDSL esterase/lipase At1g33811          295   2e-91    
gb|KDP45644.1|  hypothetical protein JCGZ_17251                         294   4e-91    
ref|XP_002278194.1|  PREDICTED: GDSL esterase/lipase At1g33811          294   5e-91    
gb|ABK95412.1|  unknown                                                 295   5e-91    
ref|XP_010669494.1|  PREDICTED: GDSL esterase/lipase At1g33811-like     294   7e-91    
ref|XP_010461207.1|  PREDICTED: GDSL esterase/lipase At1g33811          294   7e-91    
ref|XP_006381791.1|  hypothetical protein POPTR_0006s18230g             294   8e-91    
ref|XP_006597501.1|  PREDICTED: GDSL esterase/lipase At1g29660-like     293   8e-91    
ref|XP_010478804.1|  PREDICTED: GDSL esterase/lipase At1g33811-li...    293   8e-91    
ref|XP_011005306.1|  PREDICTED: GDSL esterase/lipase At1g29660-like     293   1e-90    
ref|XP_009770267.1|  PREDICTED: GDSL esterase/lipase At1g33811 is...    293   1e-90    
ref|XP_010499923.1|  PREDICTED: GDSL esterase/lipase At1g33811-like     294   2e-90    
ref|XP_006376146.1|  GDSL-motif lipase/hydrolase family protein         293   2e-90    
ref|XP_011102204.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     288   2e-90    
ref|XP_004135762.1|  PREDICTED: GDSL esterase/lipase At1g29660-like     292   3e-90    
ref|XP_008219130.1|  PREDICTED: GDSL esterase/lipase At1g33811          292   3e-90    
ref|XP_004485960.1|  PREDICTED: GDSL esterase/lipase At1g29660-li...    292   3e-90    
ref|XP_003542965.1|  PREDICTED: GDSL esterase/lipase At1g29670-li...    292   3e-90    
ref|XP_006597497.1|  PREDICTED: GDSL esterase/lipase At1g29670-li...    292   4e-90    
gb|KGN65999.1|  hypothetical protein Csa_1G560810                       292   4e-90    
ref|XP_011005438.1|  PREDICTED: GDSL esterase/lipase At1g33811          291   5e-90    
ref|XP_009407058.1|  PREDICTED: GDSL esterase/lipase At1g33811          294   6e-90    
ref|XP_004499571.1|  PREDICTED: GDSL esterase/lipase At1g33811-like     291   8e-90    
ref|NP_001056057.1|  Os05g0518300                                       291   8e-90    
ref|XP_002316752.2|  hypothetical protein POPTR_0011s03130g             290   1e-89    
ref|XP_006370938.1|  hypothetical protein POPTR_0019s01980g             291   1e-89    
gb|KEH36672.1|  GDSL-like lipase/acylhydrolase                          290   2e-89    
ref|NP_564430.1|  GDSL esterase/lipase                                  290   2e-89    
ref|XP_007159504.1|  hypothetical protein PHAVU_002G243300g             289   3e-89    
ref|XP_002526411.1|  zinc finger protein, putative                      288   5e-89    
ref|XP_011074971.1|  PREDICTED: GDSL esterase/lipase At1g33811-like     289   6e-89    
ref|XP_011095907.1|  PREDICTED: GDSL esterase/lipase At1g33811          289   8e-89    
gb|KCW74537.1|  hypothetical protein EUGRSUZ_E03249                     285   9e-89    
emb|CBI30763.3|  unnamed protein product                                289   1e-88    
ref|XP_010100103.1|  GDSL esterase/lipase                               288   1e-88    
ref|XP_002268991.2|  PREDICTED: GDSL esterase/lipase At1g29670          288   2e-88    
ref|XP_002891066.1|  GDSL-motif lipase/hydrolase family protein         287   2e-88    
ref|XP_007148614.1|  hypothetical protein PHAVU_005G001200g             287   2e-88    
ref|XP_009596155.1|  PREDICTED: GDSL esterase/lipase At1g33811 is...    286   3e-88    
ref|XP_009102234.1|  PREDICTED: GDSL esterase/lipase At2g19010-like     286   3e-88    
ref|XP_007147968.1|  hypothetical protein PHAVU_006G169400g             287   4e-88    
ref|XP_004250650.1|  PREDICTED: GDSL esterase/lipase At1g33811          286   4e-88    
ref|XP_004485961.1|  PREDICTED: GDSL esterase/lipase At1g29660-li...    286   5e-88    
ref|XP_009379054.1|  PREDICTED: GDSL esterase/lipase At1g33811          286   5e-88    
gb|KGN61342.1|  hypothetical protein Csa_2G093840                       286   7e-88    
ref|XP_008378723.1|  PREDICTED: GDSL esterase/lipase At1g33811          286   8e-88    
ref|XP_010433025.1|  PREDICTED: GDSL esterase/lipase At4g30140-like     285   8e-88    
ref|XP_010541145.1|  PREDICTED: GDSL esterase/lipase At4g30140-like     286   1e-87    
ref|XP_003526398.2|  PREDICTED: GDSL esterase/lipase At1g33811-like     286   1e-87    
gb|KHN06929.1|  GDSL esterase/lipase                                    285   1e-87    
gb|KHN06930.1|  GDSL esterase/lipase                                    285   2e-87    
gb|AFK40262.1|  unknown                                                 285   2e-87    
ref|XP_007019797.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    285   3e-87    
gb|KHN47079.1|  GDSL esterase/lipase                                    285   3e-87    
ref|XP_006597500.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     285   4e-87    
ref|XP_003522601.2|  PREDICTED: GDSL esterase/lipase At1g33811-like     284   4e-87    
ref|XP_010687192.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     283   5e-87    
emb|CDX73285.1|  BnaC05g28210D                                          283   6e-87    
ref|XP_007147969.1|  hypothetical protein PHAVU_006G169500g             283   7e-87    
gb|EYU28213.1|  hypothetical protein MIMGU_mgv1a008354mg                283   7e-87    
ref|XP_008441762.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     284   7e-87    
ref|XP_010930550.1|  PREDICTED: GDSL esterase/lipase At1g71250          283   7e-87    
ref|XP_010542848.1|  PREDICTED: GDSL esterase/lipase At1g33811          283   8e-87    
ref|XP_008459640.1|  PREDICTED: GDSL esterase/lipase At1g33811          283   1e-86    
emb|CDY39134.1|  BnaA07g01300D                                          282   1e-86    
ref|XP_010095103.1|  GDSL esterase/lipase                               280   2e-86    
emb|CDX82613.1|  BnaC07g02530D                                          282   2e-86    
ref|XP_009109003.1|  PREDICTED: GDSL esterase/lipase At4g30140-like     282   2e-86    
ref|XP_006305078.1|  hypothetical protein CARUB_v10009448mg             283   2e-86    
emb|CDY14189.1|  BnaA08g13200D                                          281   2e-86    
ref|XP_009145171.1|  PREDICTED: GDSL esterase/lipase At1g33811          282   2e-86    
gb|KHN20550.1|  GDSL esterase/lipase                                    282   2e-86    
gb|AFK49572.1|  unknown                                                 280   3e-86    
ref|XP_010252444.1|  PREDICTED: GDSL esterase/lipase At1g71250          282   3e-86    
ref|XP_006299667.1|  hypothetical protein CARUB_v10015855mg             281   3e-86    
ref|XP_008786569.1|  PREDICTED: GDSL esterase/lipase At1g71250          281   4e-86    
ref|XP_009109004.1|  PREDICTED: GDSL esterase/lipase At4g30140-like     281   4e-86    
ref|XP_010447763.1|  PREDICTED: GDSL esterase/lipase At4g30140-like     280   5e-86    
ref|XP_004141643.1|  PREDICTED: GDSL esterase/lipase At1g33811-like     281   6e-86    
ref|XP_006412746.1|  hypothetical protein EUTSA_v10025601mg             280   7e-86    
gb|KGN52691.1|  hypothetical protein Csa_5G650560                       281   7e-86    
ref|XP_010438214.1|  PREDICTED: GDSL esterase/lipase At4g30140          279   1e-85    
gb|AES69157.2|  GDSL-like lipase/acylhydrolase                          278   4e-85    
gb|AAF97292.1|AC010164_14  Hypothetical protein                         279   5e-85    
gb|AFK46568.1|  unknown                                                 278   6e-85    
ref|XP_010525717.1|  PREDICTED: GDSL esterase/lipase At4g30140-like     277   7e-85    
ref|XP_011005437.1|  PREDICTED: GDSL esterase/lipase At1g71691-li...    278   8e-85    
ref|XP_006285618.1|  hypothetical protein CARUB_v10007069mg             277   1e-84    
emb|CDY03548.1|  BnaC03g68070D                                          277   1e-84    
emb|CDY66505.1|  BnaAnng22350D                                          277   1e-84    
ref|XP_010541148.1|  PREDICTED: GDSL esterase/lipase At4g30140-like     276   1e-84    
ref|XP_004301465.1|  PREDICTED: GDSL esterase/lipase At1g33811-like     278   1e-84    
gb|KFK29568.1|  hypothetical protein AALP_AA7G151600                    276   2e-84    
ref|XP_010025680.1|  PREDICTED: GDSL esterase/lipase At5g08460-like     276   3e-84    
ref|XP_010265554.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     277   3e-84    
gb|ACC68159.1|  putative GDSL-motif lipase/hydrolase family protein     275   4e-84    
gb|KEH36666.1|  GDSL-like lipase/acylhydrolase                          276   5e-84    
gb|KFK45101.1|  hypothetical protein AALP_AA1G343700                    276   7e-84    
ref|XP_002886247.1|  GDSL-motif lipase/hydrolase family protein         274   1e-83    
ref|XP_010490405.1|  PREDICTED: GDSL esterase/lipase At2g19010          274   1e-83    
ref|XP_009112573.1|  PREDICTED: GDSL esterase/lipase At2g19010          274   1e-83    
gb|KFK25385.1|  hypothetical protein AALP_AA8G106800                    274   2e-83    
ref|XP_006388670.1|  hypothetical protein POPTR_0124s00200g             275   2e-83    
ref|XP_006409091.1|  hypothetical protein EUTSA_v10022766mg             274   2e-83    
gb|KEH36662.1|  GDSL-like lipase/acylhydrolase                          274   2e-83    
ref|XP_010112067.1|  GDSL esterase/lipase                               274   3e-83    
ref|XP_002867365.1|  GDSL-motif lipase/hydrolase family protein         273   3e-83    
ref|XP_006388935.1|  hypothetical protein POPTR_0073s00250g             271   3e-83    
gb|AFK46786.1|  unknown                                                 273   4e-83    
ref|XP_003598906.1|  GDSL esterase/lipase                               273   6e-83    
gb|AFK39208.1|  unknown                                                 273   6e-83    
gb|KFK40111.1|  hypothetical protein AALP_AA3G331800                    272   8e-83    
ref|XP_010541146.1|  PREDICTED: GDSL esterase/lipase At4g30140-like     272   9e-83    
gb|KHN47369.1|  GDSL esterase/lipase                                    273   1e-82    
ref|XP_011031552.1|  PREDICTED: GDSL esterase/lipase At1g71691-li...    272   1e-82    
ref|NP_179491.1|  GDSL esterase/lipase                                  271   1e-82    
ref|XP_010467741.1|  PREDICTED: GDSL esterase/lipase At2g19060          271   1e-82    
ref|XP_010414982.1|  PREDICTED: GDSL esterase/lipase At2g19010-like     271   1e-82    
gb|EPS64602.1|  hypothetical protein M569_10182                         270   2e-82    
ref|XP_006299421.1|  hypothetical protein CARUB_v10015581mg             271   3e-82    
ref|XP_010468750.1|  PREDICTED: GDSL esterase/lipase At2g19010-like     270   4e-82    
gb|KHG24758.1|  hypothetical protein F383_07589                         271   4e-82    
ref|XP_011005436.1|  PREDICTED: GDSL esterase/lipase At1g71691-li...    270   9e-82    
ref|XP_009105797.1|  PREDICTED: GDSL esterase/lipase At1g71250          270   9e-82    
ref|XP_010540542.1|  PREDICTED: GDSL esterase/lipase At1g29660-li...    268   1e-81    
ref|NP_194743.1|  GDSL esterase/lipase                                  269   1e-81    
emb|CDX68319.1|  BnaA07g23590D                                          270   1e-81    
ref|XP_010100104.1|  GDSL esterase/lipase                               272   1e-81    
gb|KFK40281.1|  hypothetical protein AALP_AA3G354600                    269   1e-81    
ref|XP_009104921.1|  PREDICTED: GDSL esterase/lipase At1g71250-like     269   2e-81    
ref|XP_010065073.1|  PREDICTED: GDSL esterase/lipase At1g71250          268   2e-81    
ref|XP_004301466.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     268   3e-81    
ref|XP_008237811.1|  PREDICTED: GDSL esterase/lipase At1g71250          269   3e-81    
ref|XP_006376145.1|  GDSL-motif lipase/hydrolase family protein         269   3e-81    
ref|XP_004141644.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     269   3e-81    
ref|XP_007019795.1|  Zinc finger protein, putative isoform 1            268   7e-81    
gb|EPS64557.1|  hypothetical protein M569_10224                         266   7e-81    
ref|XP_010683198.1|  PREDICTED: GDSL esterase/lipase At1g71691          268   8e-81    
ref|XP_006399344.1|  hypothetical protein EUTSA_v10016068mg             268   1e-80    
ref|XP_007148613.1|  hypothetical protein PHAVU_005G001100g             267   1e-80    
ref|XP_010471141.1|  PREDICTED: GDSL esterase/lipase At1g71250          267   1e-80    
gb|KHN06932.1|  GDSL esterase/lipase                                    267   2e-80    
gb|AAM63364.1|  putative GDSL-motif lipase/hydrolase                    266   2e-80    
ref|XP_010415834.1|  PREDICTED: GDSL esterase/lipase At1g71250-like     267   2e-80    
ref|XP_003547189.2|  PREDICTED: GDSL esterase/lipase At1g29670-like     267   2e-80    
ref|XP_010427953.1|  PREDICTED: GDSL esterase/lipase At1g71250-like     267   2e-80    
gb|ACC68162.1|  putative GDSL-motif lipase/hydrolase family protein     266   2e-80    
ref|XP_003598045.1|  GDSL esterase/lipase                               266   2e-80    
ref|XP_010489452.1|  PREDICTED: GDSL esterase/lipase At2g19060-like     266   2e-80    
ref|XP_010908040.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     267   3e-80    
ref|XP_011031551.1|  PREDICTED: GDSL esterase/lipase At1g71691-li...    266   3e-80    
ref|XP_006376755.1|  hypothetical protein POPTR_0012s05760g             263   4e-80    
ref|XP_008361601.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    266   4e-80    
gb|ACC68163.1|  putative GDSL-motif lipase/hydrolase family protein     265   4e-80    
ref|XP_009333996.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     266   5e-80    
ref|XP_008649890.1|  PREDICTED: GDSL esterase/lipase At4g18970-like     264   7e-80    
ref|XP_008459639.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     265   7e-80    
ref|XP_008440329.1|  PREDICTED: GDSL esterase/lipase At1g71250          265   8e-80    
gb|EYU31208.1|  hypothetical protein MIMGU_mgv1a026796mg                265   8e-80    
ref|XP_002886243.1|  GDSL-motif lipase/hydrolase family protein         264   9e-80    
ref|NP_179495.1|  GDSL esterase/lipase                                  264   1e-79    
ref|XP_008788334.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     265   1e-79    
ref|XP_006300432.1|  hypothetical protein CARUB_v10022173mg             265   1e-79    
ref|XP_008219080.1|  PREDICTED: GDSL esterase/lipase At1g71691          265   1e-79    
gb|EPS71849.1|  hypothetical protein M569_02907                         264   2e-79    
ref|XP_006362723.1|  PREDICTED: GDSL esterase/lipase At1g71250-like     263   3e-79    
emb|CDY72200.1|  BnaAnng40320D                                          261   3e-79    
ref|XP_006844094.1|  hypothetical protein AMTR_s00006p00253020          263   3e-79    
ref|XP_006415556.1|  hypothetical protein EUTSA_v10008016mg             261   3e-79    
ref|NP_179496.1|  SGNH hydrolase-type esterase family protein           263   3e-79    
gb|KFK41586.1|  hypothetical protein AALP_AA2G148200                    264   3e-79    
gb|KCW70983.1|  hypothetical protein EUGRSUZ_F04092                     262   4e-79    
ref|XP_002887358.1|  predicted protein                                  263   4e-79    
emb|CDP15726.1|  unnamed protein product                                263   4e-79    
ref|XP_004250819.1|  PREDICTED: GDSL esterase/lipase At1g71250          263   4e-79    
ref|XP_008339092.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    262   5e-79    
ref|XP_009357251.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     263   5e-79    
ref|XP_006299730.1|  hypothetical protein CARUB_v10015923mg             262   7e-79    
ref|XP_006286004.1|  hypothetical protein CARUB_v10007532mg             266   9e-79    
gb|KDP24218.1|  hypothetical protein JCGZ_25875                         262   9e-79    
ref|XP_006390789.1|  hypothetical protein EUTSA_v10019503mg             262   9e-79    
ref|XP_004154173.1|  PREDICTED: GDSL esterase/lipase At1g71250-like     261   9e-79    
ref|XP_004145208.1|  PREDICTED: GDSL esterase/lipase At1g71250-like     261   1e-78    
ref|NP_568318.1|  GDSL esterase/lipase 7                                262   1e-78    
emb|CDY49215.1|  BnaCnng17040D                                          262   1e-78    



>ref|XP_006358064.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Solanum tuberosum]
Length=380

 Score =   434 bits (1117),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 215/379 (57%), Positives = 270/379 (71%), Gaps = 10/379 (3%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLKPLVA----EPQVPCYFIFGDSLVDNGNNNNLSTEAKAN  225
             MASG+K+WF + T +LM ++ +P +     EPQVPC FI GDSL DNGNNNNL T AKAN
Sbjct  1     MASGLKLWFVLLTTILM-INFRPFLVMVKGEPQVPCLFILGDSLFDNGNNNNLITTAKAN  59

Query  226   YLPYGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGG  405
             Y PYGIDFPDGPTGRF+NGKN AD+LAE LGF+  I P+S V   + + +GVNYASGA G
Sbjct  60    YPPYGIDFPDGPTGRFTNGKNSADFLAELLGFDKFIEPFSTVKGVD-IFRGVNYASGAAG  118

Query  406   ILDESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINN  585
             I DESG H+G+ IS+++QL NH +T++ ++  +        YL+KC Y VGMGNNDYINN
Sbjct  119   IRDESGIHLGDRISLNRQLRNHKVTISHMSTLLGNKTLTMDYLSKCIYIVGMGNNDYINN  178

Query  586   YLMPQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHG  765
             YLMPQ YPSS LY P+++A +L +++  QLK L+  GARKVAVFG G LGCIP E+ ++G
Sbjct  179   YLMPQFYPSSHLYKPEKYATILMQQYSKQLKTLYRYGARKVAVFGVGSLGCIPAELASYG  238

Query  766   NGSLSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNK  945
                  CVD INSAVQ F D+ KP+IDD N +L  A FI IN+TS+A+GDP+ IG+ N+ +
Sbjct  239   TKDTICVDFINSAVQKFADKFKPMIDDFNNNLPNANFIYINLTSIAIGDPAQIGLTNLAE  298

Query  946   ACCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMD  1125
              CC++S   AKGQC  G   CS+R  + FWD FH TEI N  TA R+YTA LPTDAYP D
Sbjct  299   PCCEISSVIAKGQCSNGGGACSDRASHYFWDGFHPTEIPNKVTAIRAYTALLPTDAYPFD  358

Query  1126  ISSL----LQLNLQAKSDI  1170
             IS L    L LN   +S +
Sbjct  359   ISHLAASTLALNKLGQSGV  377



>ref|XP_004233007.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Solanum lycopersicum]
Length=380

 Score =   434 bits (1116),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 211/369 (57%), Positives = 266/369 (72%), Gaps = 6/369 (2%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLKPLVA----EPQVPCYFIFGDSLVDNGNNNNLSTEAKAN  225
             M SG+K+WF + T + + ++ +P +     EPQVPC FIFGDSL DNGNNN+L T AKAN
Sbjct  1     MGSGMKIWFVLLTTIFV-INFRPFLVMVKGEPQVPCLFIFGDSLFDNGNNNDLLTTAKAN  59

Query  226   YLPYGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGG  405
             Y PYGIDFPDGPTGRF+NGKN AD+LAE LGFN  I P++ V   + +++GVNYASGA G
Sbjct  60    YPPYGIDFPDGPTGRFTNGKNSADFLAELLGFNKFIEPFATVKGVD-IVRGVNYASGAAG  118

Query  406   ILDESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINN  585
             I DESG H+G+ IS+++QL NH +T++ ++  +        YL+KC Y VGMGNNDYINN
Sbjct  119   IRDESGIHLGDRISLNRQLRNHKVTISHMSTLLGNKTLTMDYLSKCIYIVGMGNNDYINN  178

Query  586   YLMPQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHG  765
             YLMPQ YPSS LY P++FA +L +++  QLK L+  GARKVAVFG G LGCIP E+  +G
Sbjct  179   YLMPQFYPSSHLYNPEKFATILMQQYSKQLKTLYHYGARKVAVFGVGSLGCIPAELAMYG  238

Query  766   NGSLSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNK  945
                  CVDSINSAVQ F D+ KP+IDD N +L  A FI IN+TS+A+GDP+ IG+ N+ +
Sbjct  239   TKDTICVDSINSAVQKFADKFKPMIDDFNNNLPSANFIYINLTSIAIGDPAQIGLTNLAE  298

Query  946   ACCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMD  1125
              CC++S   AKGQC +G   CS+R  + FWD FH TEI N  TA R+YTA LPTDAYP D
Sbjct  299   PCCEISSVIAKGQCLKGGGACSDRASHYFWDGFHPTEIPNKVTAIRAYTALLPTDAYPFD  358

Query  1126  ISSLLQLNL  1152
             IS L    L
Sbjct  359   ISHLAATTL  367



>ref|XP_009757862.1| PREDICTED: uncharacterized protein LOC104210613 [Nicotiana sylvestris]
Length=806

 Score =   435 bits (1118),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 211/372 (57%), Positives = 271/372 (73%), Gaps = 4/372 (1%)
 Frame = +1

Query  40    YTSITLMASGVKVWFAIATLLLMFLSLKPLVA--EPQVPCYFIFGDSLVDNGNNNNLSTE  213
             +  I  MAS +K+WF + T+LL+F++L PL+   E QVPC FI GDSL DNGNNNNL T 
Sbjct  436   FVEIAQMASEMKIWFVLLTVLLVFINLSPLLVKGEQQVPCLFIMGDSLFDNGNNNNLFTT  495

Query  214   AKANYLPYGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYAS  393
             AKANY PYGIDFPDGPTGRF+NGKN AD++A+ LGF+  I P++ V   E + +GVNYAS
Sbjct  496   AKANYPPYGIDFPDGPTGRFTNGKNTADFIADLLGFDKYIEPFATVKGVE-MFRGVNYAS  554

Query  394   GAGGILDESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRA-ARYYLNKCFYSVGMGNN  570
             GA GI DESG H+G+ IS+++QL NH  T++ ++  ++  +   + YL+KC Y VGMGNN
Sbjct  555   GAAGIRDESGIHLGDRISLNRQLRNHKETISHMSTLLENNKTLTKEYLSKCIYIVGMGNN  614

Query  571   DYINNYLMPQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEE  750
             DYINNYLMPQ YPSS LY P+++A +LA+++  QLK L++ GARKVAVFG G +GCIP E
Sbjct  615   DYINNYLMPQFYPSSLLYKPEKYATILAQQYEKQLKTLYSYGARKVAVFGLGSIGCIPAE  674

Query  751   METHGNGSLSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGI  930
             ++ +G     CVDSINSAV  F D++KP+IDD N +L  A FI IN+TS+A+GDP+ IGI
Sbjct  675   LDLYGTKDSPCVDSINSAVLKFVDKLKPMIDDFNSNLPNANFIYINVTSIAIGDPAAIGI  734

Query  931   NNVNKACCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTD  1110
              N+   CC++S   AKGQC  G   C++R  + FWD FH TE  N  TA R+YTA LPTD
Sbjct  735   TNLADPCCEISSFIAKGQCSYGGSACNDRASHYFWDGFHPTEAPNKATAERAYTALLPTD  794

Query  1111  AYPMDISSLLQL  1146
             AYP DIS L  L
Sbjct  795   AYPFDISHLALL  806


 Score =   390 bits (1002),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 186/352 (53%), Positives = 257/352 (73%), Gaps = 6/352 (2%)
 Frame = +1

Query  94    TLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRF  273
             T++ +FL LK +   PQVPCYFIFGDSL+DNGNNN+++T A+ANYLPYG+DFPDGPTGRF
Sbjct  6     TIITVFLVLKLVEGAPQVPCYFIFGDSLLDNGNNNDINTAARANYLPYGVDFPDGPTGRF  65

Query  274   SNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMD  453
             +NG+N+AD LAE LGF++ IPPY+A  T + +L+GVNYASG+ GI +++G H+G  I + 
Sbjct  66    TNGRNMADLLAEHLGFDNYIPPYAAGATGDEILQGVNYASGSAGIRNDTGNHLGYRIYLG  125

Query  454   QQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPD  633
             +QL NH +T++RIA  +    +A+ +LNKC + VG+G+NDYINN+LMP  YP+S  YTP 
Sbjct  126   RQLENHKVTISRIADLLGNTTSAKNHLNKCLFIVGIGSNDYINNFLMPDIYPTSHFYTPS  185

Query  634   QFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQM  813
             Q+A +L +++  QLK L+  GARK+ +FG   +GCIP+E++ H   +L CVDS N AVQ+
Sbjct  186   QYATVLIEQYSQQLKDLYEDGARKITLFGLPQIGCIPDELKKH--STLLCVDSTNEAVQL  243

Query  814   FNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACCQVSKTKAKGQCEE  993
             FN  +K ++DDLN +L  A+FI INM S++    S I +  +N  CCQV+K   +GQC  
Sbjct  244   FNKNLKALVDDLNTNLPDAQFIYINMYSIS----SAIALTLLNYPCCQVTKIMPEGQCIP  299

Query  994   GQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQLN  1149
             G+ PC  R+ ++F+DNFH TEI N     R+Y A LP+DAYPMDI  L+  N
Sbjct  300   GKAPCLIRSTHLFFDNFHPTEIANSIATHRAYNALLPSDAYPMDIRHLVTGN  351



>ref|XP_006358065.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Solanum tuberosum]
Length=365

 Score =   417 bits (1073),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 200/363 (55%), Positives = 263/363 (72%), Gaps = 3/363 (1%)
 Frame = +1

Query  64    SGVKVWFAIATLLLMFLSLKPLVA--EPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPY  237
             SG  VWFA    LL+ ++LKPL+   E QVPC F+ GDSL DNGNNNNL T AKANY PY
Sbjct  4     SGFIVWFAKVITLLICMNLKPLLVKGEQQVPCLFVMGDSLFDNGNNNNLLTAAKANYPPY  63

Query  238   GIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDE  417
             GIDFPDGPTGRF+NG+N+AD+LAE LGF+  I P++ V   + + +GVNYASGA GILDE
Sbjct  64    GIDFPDGPTGRFTNGRNVADFLAELLGFDKYIEPFATVKGVD-MFRGVNYASGAAGILDE  122

Query  418   SGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMP  597
             +  H+G+ IS+++QL NH +T++R++  +      + YL+KC Y VGMGNNDYINNYL+P
Sbjct  123   TAIHVGDRISLNRQLRNHNVTISRMSTLLGNKTLTKEYLSKCIYIVGMGNNDYINNYLLP  182

Query  598   QKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSL  777
             Q Y SS +Y P+QFA +L +++  QLK L+  GARKV VFG G +GC+P E++ +G G  
Sbjct  183   QLYSSSHMYNPEQFASILIQQYSEQLKTLYLYGARKVVVFGLGGIGCVPSELDLYGTGDS  242

Query  778   SCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACCQ  957
              C++SI+SAV+ F+D+++P+IDDLN SL  AKF  IN TS+A+ DPS IGI  + + CC+
Sbjct  243   VCINSIDSAVRKFSDKLEPMIDDLNSSLPNAKFSYINSTSIAVPDPSSIGITKLREPCCE  302

Query  958   VSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSL  1137
             +S T  +GQC+ G   CS+R  + FWD FH +E  N  TA R+YTA L TD YP DIS L
Sbjct  303   ISGTIGEGQCKHGGGVCSDRAAHYFWDGFHPSEAPNKVTAERAYTALLSTDVYPFDISQL  362

Query  1138  LQL  1146
              QL
Sbjct  363   AQL  365



>ref|XP_009598192.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Nicotiana tomentosiformis]
Length=361

 Score =   417 bits (1071),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 205/366 (56%), Positives = 263/366 (72%), Gaps = 8/366 (2%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLKPLVA--EPQVPCYFIFGDSLVDNGNNNNLSTEAKANYL  231
             MASG+ VWF    L++  L L PL+   E QVPC FI GDS  DNGNNNNL T AKANY 
Sbjct  1     MASGIIVWF----LMMTTLKLNPLLVKGEQQVPCLFIIGDSTYDNGNNNNLLTAAKANYP  56

Query  232   PYGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGIL  411
             PYGIDFPDGPTGRF+NG+N+AD++AE LGF+  I P++ V   E + +GVNYASGA GIL
Sbjct  57    PYGIDFPDGPTGRFTNGRNIADFIAELLGFDKYIEPFATVKGVE-MFRGVNYASGAAGIL  115

Query  412   DESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRA-ARYYLNKCFYSVGMGNNDYINNY  588
             DESG H+G+ IS+++QL NH +T++ ++  +   +   + YL+KC Y VGMGNNDYINNY
Sbjct  116   DESGIHLGDRISLNRQLRNHKVTISHMSTLLGNNKTLTKEYLSKCIYIVGMGNNDYINNY  175

Query  589   LMPQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGN  768
             L+PQ YPSS LY P+++A +L +++  QLK L+  GARKVAVFG G +GCIP E++ +G 
Sbjct  176   LLPQFYPSSHLYKPEKYATILVQQYEKQLKTLYRYGARKVAVFGLGGIGCIPAELDLYGT  235

Query  769   GSLSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKA  948
                 CVDSIN AVQ F+D++ P+I+DLN +L   KFI +N TS+ +GDPS IGI N+   
Sbjct  236   KDSGCVDSINKAVQYFDDKLIPMINDLNSNLPNTKFIYVNSTSIGIGDPSSIGITNLLDP  295

Query  949   CCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDI  1128
             CC++S T A GQC+ G   CS+R  + FWD FH TE  N  TATR+Y+  LPTDAYP DI
Sbjct  296   CCEMSSTIANGQCKYGGGACSDRASHYFWDGFHPTETPNKVTATRAYSTLLPTDAYPFDI  355

Query  1129  SSLLQL  1146
             S L  L
Sbjct  356   SHLALL  361



>ref|XP_009623261.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Nicotiana tomentosiformis]
Length=361

 Score =   410 bits (1054),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 207/362 (57%), Positives = 265/362 (73%), Gaps = 4/362 (1%)
 Frame = +1

Query  70    VKVWFAIATLLLMFLSLKPLVA--EPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGI  243
             +K+WF + T+LL+F+++  L+   E QVPC FI GDSL DNGNNNNL T AKANY PYGI
Sbjct  1     MKIWFVLLTVLLIFINISSLLVKGEQQVPCLFIMGDSLFDNGNNNNLLTTAKANYPPYGI  60

Query  244   DFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESG  423
             DFPDGPTGRF+NGKN AD++AE LGF+  I P++ V   E + +GVNYASGA GI DESG
Sbjct  61    DFPDGPTGRFTNGKNTADFIAELLGFDKYIEPFATVKGVE-MFRGVNYASGAAGIRDESG  119

Query  424   THMGEVISMDQQLVNHGLTLARIALYMKG-YRAARYYLNKCFYSVGMGNNDYINNYLMPQ  600
              H+G+ IS+++QL NH +T++ ++  ++      + YL+KC Y VGMGNNDYINNYL+PQ
Sbjct  120   IHLGDRISLNRQLRNHKVTISHMSTLLENNMTLIQEYLSKCIYIVGMGNNDYINNYLLPQ  179

Query  601   KYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLS  780
              YPSS LY P+++A +LA+++  QLK L+  GARKVAVFG G +GCIP E++ +G     
Sbjct  180   FYPSSLLYKPEKYATILAQQYEKQLKTLYRYGARKVAVFGLGSIGCIPAELDLYGTKDSV  239

Query  781   CVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACCQV  960
             CVDSINSAV  F D++KP+IDD N +L  A FI IN+TS+A+GDPS IGI N+ + CC++
Sbjct  240   CVDSINSAVLKFVDKLKPMIDDFNSNLPNANFIYINVTSIAIGDPSSIGITNLAEPCCEI  299

Query  961   SKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLL  1140
             S   AKGQC  G   CS+R  + FWD FH TE  N  TA R+YTA LPTDAYP DIS L 
Sbjct  300   SSFIAKGQCSYGGSACSDRASHYFWDGFHPTEAPNKATAERAYTALLPTDAYPFDISHLA  359

Query  1141  QL  1146
              L
Sbjct  360   LL  361



>ref|XP_009796870.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Nicotiana sylvestris]
Length=361

 Score =   408 bits (1049),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 201/366 (55%), Positives = 263/366 (72%), Gaps = 8/366 (2%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLKPLVA--EPQVPCYFIFGDSLVDNGNNNNLSTEAKANYL  231
             MASG+ VW     L++  L L PL+   E QVPC FI GDS  DNGNNNNL T AKANY 
Sbjct  1     MASGIIVWL----LVMATLKLNPLLVKGEQQVPCLFIMGDSTYDNGNNNNLLTAAKANYP  56

Query  232   PYGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGIL  411
             PYGIDFPDGPTGRF+NG+N+AD++AE LGF+  I P++ V   E + +GVNYASGA GIL
Sbjct  57    PYGIDFPDGPTGRFTNGRNIADFIAELLGFDKYIEPFATVKGVE-MFRGVNYASGAAGIL  115

Query  412   DESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRA-ARYYLNKCFYSVGMGNNDYINNY  588
             DESG H+G+ IS+++QL NH +T++ ++  ++  +   + YL+KC Y VGMGNNDYINNY
Sbjct  116   DESGIHLGDRISLNRQLRNHKVTISHMSTLLENNKTLTKEYLSKCIYIVGMGNNDYINNY  175

Query  589   LMPQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGN  768
             L+PQ YPSS LY P+++A +L +++  QLK L+  GARKVAVFG G +GCIP E++ +G 
Sbjct  176   LLPQFYPSSLLYKPEKYATILIQQYEKQLKTLYRYGARKVAVFGLGGIGCIPAELDLYGT  235

Query  769   GSLSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKA  948
                +CVDSIN AVQ F+D++ P+IDDLN +L   +FI +N TS+ + DPS IGI N+ + 
Sbjct  236   KDSACVDSINKAVQYFDDKLIPMIDDLNSNLPNTEFIYVNSTSIEIRDPSSIGITNLLEP  295

Query  949   CCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDI  1128
             CC+++ T A GQC+ G   CS+R  + FWD FH  EI N  TATR+Y+A L TD YP DI
Sbjct  296   CCEMTSTIANGQCKYGGGACSDRASHYFWDGFHPAEIPNKVTATRAYSALLRTDVYPFDI  355

Query  1129  SSLLQL  1146
             S L  L
Sbjct  356   SHLALL  361



>ref|XP_004234069.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Solanum lycopersicum]
Length=360

 Score =   404 bits (1037),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 198/354 (56%), Positives = 253/354 (71%), Gaps = 4/354 (1%)
 Frame = +1

Query  88    IATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGP-T  264
             I  ++ MF+    +  +PQVPCYFIFGDS+VDNGNNNNL T AKANY PYGIDFP+GP  
Sbjct  8     IVLMISMFVMFSMVKGQPQVPCYFIFGDSIVDNGNNNNLITTAKANYFPYGIDFPNGPQN  67

Query  265   GRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVI  444
             GRF+NG+N AD++AEF+GFNSSIPP+ A      +L+GVNY SG  GI DE+G   G+ I
Sbjct  68    GRFTNGRNKADFIAEFIGFNSSIPPH-ATARGNTILRGVNYGSGVAGIRDETGIRWGDRI  126

Query  445   SMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLY  624
             SM++QL+NH +T++RI L ++   A R  LNKC Y+V MGNNDY+NNYL  + Y SS LY
Sbjct  127   SMNRQLLNHQVTISRINLILRNITATRSLLNKCLYTVDMGNNDYLNNYLDSRFYLSSLLY  186

Query  625   TPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSA  804
             +PD FA  L ++   QL++L+  GARKVAV   G+LGC+PEE  T+G  +  CVD IN+ 
Sbjct  187   SPDMFATSLVQQFEGQLRRLYRFGARKVAVSNIGLLGCLPEETRTYGRNASGCVDFINNY  246

Query  805   VQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACCQVSKTKAKGQ  984
             VQ+FN ++K  ID+LN +L  A+FI+ N TS++ G P  IG    +  CC +S T AKGQ
Sbjct  247   VQLFNQKLKVSIDNLNTNLPNARFIISNQTSISQGGPP-IGFTVFDSPCCIISNTTAKGQ  305

Query  985   C-EEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQ  1143
             C   GQ PCSNRN+Y+F+DNFH TE  N   ATRSYTA LPTD+YP DI  L+Q
Sbjct  306   CINNGQTPCSNRNQYVFFDNFHPTEAANKAIATRSYTALLPTDSYPTDIKGLVQ  359



>ref|XP_008349184.1| PREDICTED: GDSL esterase/lipase At1g29660-like [Malus domestica]
Length=362

 Score =   401 bits (1030),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 191/366 (52%), Positives = 249/366 (68%), Gaps = 5/366 (1%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLKPLV-AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLP  234
             MA+   +WF +  ++++ LS   LV   PQVPC+FIFGDSL DNGNNNN  T AK NY P
Sbjct  1     MANEANIWFTMIVVMVILLSQSSLVYGAPQVPCFFIFGDSLADNGNNNNRRTSAKVNYHP  60

Query  235   YGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILD  414
             YGID+P GPTGRF NG+   D LA+ LGF + IPPY+     E +LKG+NYASG GGI  
Sbjct  61    YGIDYPAGPTGRFCNGRTTVDILAQLLGFENPIPPYATARGPE-ILKGLNYASGGGGIRA  119

Query  415   ESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLM  594
             E+    G+VIS+DQQL+NH  T +RIA  ++  R+A  YLNKC YSVGMG+NDYINNY +
Sbjct  120   ETSYQQGDVISLDQQLLNHKFTASRIASILRSKRSAGQYLNKCLYSVGMGSNDYINNYFL  179

Query  595   PQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGS  774
             P+ YP+SRLYTP+Q+A +L +++  Q+  L+  GARKVA+ G G++GC P  +   G   
Sbjct  180   PELYPTSRLYTPEQYATVLVQQYSRQIMSLYESGARKVALIGIGLIGCTPSAISAFGTNG  239

Query  775   LSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACC  954
              +CVD +NSA QMFN  +  ++D LN  L  AKFI +N   +  GDP+  G   VN  CC
Sbjct  240   SACVDKLNSAAQMFNQNLVSLVDQLNTDLTDAKFIYVNSFGMGSGDPAAAGFKVVNVGCC  299

Query  955   QVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISS  1134
              ++   + G C EGQ PC NR+EY+FWD FH TE  N+ TA R+Y+   P+D YPMDIS 
Sbjct  300   PIN---SFGLCAEGQTPCQNRSEYVFWDGFHPTEALNVITAARTYSEFDPSDTYPMDISH  356

Query  1135  LLQLNL  1152
             L+QL+L
Sbjct  357   LVQLSL  362



>ref|XP_009800182.1| PREDICTED: GDSL esterase/lipase At1g29670-like isoform X1 [Nicotiana 
sylvestris]
Length=358

 Score =   400 bits (1029),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 205/357 (57%), Positives = 265/357 (74%), Gaps = 4/357 (1%)
 Frame = +1

Query  76    VWFAIATLLLMFLSLKPLV-AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFP  252
             +WF I  +L++ +S KP+V  EP VPCYFIFGDS+VDNGNNNNL+T AKANY PYGIDF 
Sbjct  4     IWF-ILMILILIVSSKPMVKGEPLVPCYFIFGDSVVDNGNNNNLTTTAKANYPPYGIDFH  62

Query  253   DGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHM  432
              G  GRF+NG+N AD+ AE LGF+S IPP+ +    E +LKGVNYASG  GI DE+G   
Sbjct  63    TGVNGRFTNGRNKADFFAELLGFDSFIPPFVSARGKE-ILKGVNYASGVSGIRDETGYRW  121

Query  433   GEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPS  612
             G+  SM++QL NH  T++RI   +    +A+  L KC Y+V MGNNDY+NNYL PQ YPS
Sbjct  122   GDRWSMNRQLQNHLFTISRIISILGNITSAKDLLRKCLYTVDMGNNDYLNNYLQPQFYPS  181

Query  613   SRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDS  792
             S LYTP+QFA +L ++   QL+ L++ GARKVAV   G+LGC+PEE+E  G  +  CVD 
Sbjct  182   SLLYTPNQFATVLTQQFSQQLRTLYSYGARKVAVSNIGLLGCLPEELEVFGRNASGCVDF  241

Query  793   INSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACCQVSKTK  972
             IN+ VQ+FND++K +IDDLN +L  A+FI IN TS++ G P+ +GI  V+ +CC  S T 
Sbjct  242   INNYVQLFNDKLKLLIDDLNTNLPNARFIYINQTSISSGGPTPVGI-TVDSSCCITSDTI  300

Query  973   AKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQ  1143
             AKGQC +G+VPCSNRN+Y+F+DNFH TE+ N+ TA RS+TA LP+DAYP DIS L+Q
Sbjct  301   AKGQCRKGEVPCSNRNQYIFFDNFHPTEVANMATARRSFTALLPSDAYPTDISQLVQ  357



>ref|XP_009360797.1| PREDICTED: GDSL esterase/lipase At1g29660-like [Pyrus x bretschneideri]
Length=362

 Score =   398 bits (1022),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 191/366 (52%), Positives = 247/366 (67%), Gaps = 5/366 (1%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLKPLV-AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLP  234
             MA+   +WF +  ++++ LS   LV   PQVPC+FIFGDSL DNGNNNN  T AK NY P
Sbjct  1     MANEANMWFTMIVVMVILLSQSSLVYGAPQVPCFFIFGDSLADNGNNNNRQTSAKVNYHP  60

Query  235   YGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILD  414
             YGID+P GPTGRF NG+   D LA+ LGF + IPPY+     E +LKG+NYASG GGI  
Sbjct  61    YGIDYPAGPTGRFCNGRTTVDILAQLLGFENPIPPYATARGPE-ILKGLNYASGGGGIRA  119

Query  415   ESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLM  594
             E+    G VIS+DQQL+NH  T +RIA  ++  R+A  YLNKC YSVGMG+NDYINNY +
Sbjct  120   ETSYQQGAVISLDQQLLNHKFTASRIASILRSKRSAGQYLNKCLYSVGMGSNDYINNYFL  179

Query  595   PQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGS  774
             P+ YP+SRLYTP+Q+A +L +++  Q+  L+  GARKVA+ G G++GC P  +   G   
Sbjct  180   PELYPTSRLYTPEQYATVLVQQYSRQIMSLYESGARKVALIGIGLIGCTPSAISAFGTNG  239

Query  775   LSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACC  954
              +CVD +NSA Q+FN  +  ++D LN  L  AKFI +N   +  GDP+  G   VN  CC
Sbjct  240   SACVDKLNSAAQIFNQNLVSLVDQLNTDLTDAKFIYVNSFGMGSGDPTAAGFKVVNVGCC  299

Query  955   QVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISS  1134
              V+   + G C EGQ PC NR +Y+FWD FH TE  N+ TA R+YT   P+D YPMDIS 
Sbjct  300   PVN---SFGLCAEGQTPCQNRRKYVFWDGFHPTEALNVITAARTYTEFDPSDTYPMDISH  356

Query  1135  LLQLNL  1152
             L+QL+L
Sbjct  357   LVQLSL  362



>gb|EYU28138.1| hypothetical protein MIMGU_mgv1a008735mg [Erythranthe guttata]
Length=364

 Score =   397 bits (1019),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 199/367 (54%), Positives = 250/367 (68%), Gaps = 11/367 (3%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLKP----LVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKAN  225
             MA  +  W  IA  +L  L +KP    +  + QVPC F FGDS  DNGNNN L T AK N
Sbjct  1     MAPTITKWILIA--ILSILVMKPGIILIQGQQQVPCLFFFGDSQFDNGNNNQLITTAKVN  58

Query  226   YLPYGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGG  405
             Y PYGIDFPDGPTGRF+NGKN+AD+LA+FLGF + IPP++    ++ +LKGVNYASG  G
Sbjct  59    YPPYGIDFPDGPTGRFTNGKNIADFLAQFLGFANPIPPFTTARGSD-VLKGVNYASGGAG  117

Query  406   ILDESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRA--ARYYLNKCFYSVGMGNNDYI  579
             ILDESG  +G  I ++QQL+NH  T+ RI L +   R      YLNKC Y V MG+NDY+
Sbjct  118   ILDESGILLGGRIPLNQQLINHRTTIGRIRLLLIRNRTITPESYLNKCLYVVNMGSNDYL  177

Query  580   NNYLMPQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMET  759
             NNY +    PS  L+TPD+FA  L ++   QL+ L+  GARKVAVFG G+LGC P+E+  
Sbjct  178   NNYFLQPISPSRILFTPDRFAANLIQRLTQQLRTLYNSGARKVAVFGLGLLGCTPQELSM  237

Query  760   HGNGSLSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNV  939
                 +  CVD IN A Q+FN+R+KP+IDD N +  GA+FI +N+TS++LGDP+ IGI  V
Sbjct  238   FPANASGCVDFINEAAQLFNNRLKPVIDDFNTNSPGAQFIYVNITSISLGDPASIGITVV  297

Query  940   NKACCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYP  1119
             N ACC V      GQC    +PCSNRNEY FWDNFH TE+ NL TA+RS+   LP DAYP
Sbjct  298   NAACCVVEAR--SGQCVRNGIPCSNRNEYAFWDNFHPTELLNLVTASRSFNVLLPEDAYP  355

Query  1120  MDISSLL  1140
             +DI  L+
Sbjct  356   VDIQRLV  362



>ref|XP_009613021.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Nicotiana tomentosiformis]
Length=364

 Score =   389 bits (998),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 188/366 (51%), Positives = 260/366 (71%), Gaps = 9/366 (2%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLKPLV-AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLP  234
             MAS VK+W     +     SLK LV   PQVPCYFIFGDSL+DNGNNN+L T AKANY P
Sbjct  1     MASCVKIWLITIAITFFVFSLKILVEGAPQVPCYFIFGDSLLDNGNNNDLDTAAKANYAP  60

Query  235   YGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILD  414
             YG+DF DGPTGRF+NG+N AD+LAE L F+  IPP+++   +E +L+GVNYASG+ GI +
Sbjct  61    YGVDFRDGPTGRFTNGRNTADFLAELLDFDHYIPPFASAEGSE-ILEGVNYASGSAGIRN  119

Query  415   ESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLM  594
             +SG+H+G+ I + +QL NH +T++R+A  +    +A+ +LNKC + VG+G+NDYINNYLM
Sbjct  120   DSGSHLGDRIYLGRQLENHQVTISRLADLLGNTTSAKKHLNKCLFIVGIGSNDYINNYLM  179

Query  595   PQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGS  774
             P+ YPSS LYTP ++A  L +++   L+ L+  GARKVA+FG G +GCIP+E++ H   +
Sbjct  180   PETYPSSHLYTPSEYATALIEQYSQHLRTLYEDGARKVALFGLGRIGCIPDELQKH--NT  237

Query  775   LSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNV-NKAC  951
               CV S N A+Q+FN  +K ++D+LN +   AKF  INM S++    S+I I +V N+ C
Sbjct  238   RRCVGSTNDAIQLFNSNLKSLVDNLNTNFPDAKFTYINMYSIS----SLIDIFSVLNRPC  293

Query  952   CQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDIS  1131
             C+VS++  +GQC  G+ PC  R  Y F+DNFH TEI N+    R+Y + LP+DAYPMDI 
Sbjct  294   CEVSESMPEGQCVAGETPCLLRGIYFFYDNFHPTEIANMIATNRAYNSVLPSDAYPMDIR  353

Query  1132  SLLQLN  1149
              L++ N
Sbjct  354   HLVRNN  359



>ref|XP_009757859.1| PREDICTED: GDSL esterase/lipase At5g45670-like [Nicotiana sylvestris]
Length=363

 Score =   388 bits (996),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 191/364 (52%), Positives = 260/364 (71%), Gaps = 10/364 (3%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLKPLV-AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLP  234
             MA  VK+WF IA   L+ L+LK LV   PQVPCYFIFGDSL+DNGNNN+L T AKANY P
Sbjct  1     MAYCVKIWFTIAITFLV-LNLKTLVEGAPQVPCYFIFGDSLLDNGNNNDLDTAAKANYAP  59

Query  235   YGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILD  414
             YG+DF DGPTGRF+NG+N AD+LAE L F+  IPP+++   +E +L+GVNYASG+ GI +
Sbjct  60    YGVDFRDGPTGRFTNGRNTADFLAELLDFDHYIPPFASAEGSE-ILEGVNYASGSAGIRN  118

Query  415   ESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLM  594
             +SG+H+G+ I + +QL NH +T++R+A  +    AA+ +LNKC + VG+G+NDYINNYLM
Sbjct  119   DSGSHLGDRIYLGRQLENHKVTISRVADLLGNTAAAKKHLNKCLFIVGIGSNDYINNYLM  178

Query  595   PQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGS  774
             P+ YPSS LYTP Q+A  L +++   L+ L+  GARKVA+FG G +GCIP+E++ H   +
Sbjct  179   PETYPSSHLYTPSQYATALIEQYSQHLRTLYEDGARKVALFGLGRIGCIPDELQKH--NT  236

Query  775   LSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNV-NKAC  951
               CV S N A+Q+FN  +K ++D+LN +   AKF  INM S++    SII   +V N+ C
Sbjct  237   RRCVSSTNDAIQLFNSNLKSLVDNLNTNFPDAKFTYINMYSIS----SIIDTFSVLNRPC  292

Query  952   CQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDIS  1131
             C+VS+T  +GQC  G+ PC  R  Y F+DNFH TE  N+    R+Y + L +DAYPMDI 
Sbjct  293   CEVSETMPEGQCVPGETPCLLRGIYFFYDNFHPTETANMIATNRAYNSLLSSDAYPMDIR  352

Query  1132  SLLQ  1143
              L++
Sbjct  353   HLVR  356



>ref|XP_011085626.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Sesamum indicum]
Length=344

 Score =   386 bits (992),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 195/341 (57%), Positives = 248/341 (73%), Gaps = 13/341 (4%)
 Frame = +1

Query  136   EPQV-PCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNLADYLAEF  312
             E QV PC F  GDSL DNGNNN L T AK+NY PYGID+PDG TGRFSN +N+ D+LAEF
Sbjct  13    EQQVLPCLFFMGDSLTDNGNNNFLFTIAKSNYFPYGIDYPDGATGRFSNARNVPDFLAEF  72

Query  313   LGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNHGLTLARI  492
             LGF   IPP++    T+ +L+G+NY SG  GILD +G  +G+ IS+++QL NHG T++  
Sbjct  73    LGFEKPIPPFATANHTD-ILRGLNYGSGGAGILDRTGAQLGDEISLNRQLQNHGGTVSTT  131

Query  493   ALYMKGYRA--ARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAKKHY  666
              L + G+ A  AR +LNKC Y V MG+NDYINNYLMP  YP+SRL+TPDQFAE+L +++ 
Sbjct  132   TLLL-GFNATRAREHLNKCLYIVNMGSNDYINNYLMPHVYPTSRLHTPDQFAEILIQQYS  190

Query  667   VQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMFNDRMKPIIDD  846
              QL+ LH  GARK+A+FG G+LGCIPE    + NG+ +CVDSINS V+ FN R++P++D 
Sbjct  191   QQLRTLHGYGARKIAIFGLGMLGCIPE----YANGT-ACVDSINSVVRPFNSRLRPLVDT  245

Query  847   LNGSLKGAKFILINMTSLALG-DPSIIGINNVNKACCQVSKTKAKGQCEEGQVPCSNRNE  1023
             LN  L  A+FILI+ +S++ G D S +GI   N  CCQVS++   G C  G+VPCSNR+E
Sbjct  246   LNTDLPDAQFILIDTSSISAGIDLSALGIRVSNAPCCQVSES--VGLCIAGKVPCSNRDE  303

Query  1024  YMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             Y FWDNFH TEI N   A R+YTA LP+DAYP DI  L QL
Sbjct  304   YSFWDNFHPTEILNRAVAQRAYTAVLPSDAYPFDIRCLAQL  344



>ref|XP_009594105.1| PREDICTED: GDSL esterase/lipase At5g45670-like isoform X1 [Nicotiana 
tomentosiformis]
Length=363

 Score =   387 bits (993),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 200/344 (58%), Positives = 254/344 (74%), Gaps = 3/344 (1%)
 Frame = +1

Query  115   SLKPLV-AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNL  291
             S KP+V  E  VPCYFIFGDS+VDNGNNNNL+T AKANY PYGIDFP G  GRF+NG N 
Sbjct  19    SSKPMVKGEQLVPCYFIFGDSVVDNGNNNNLTTTAKANYPPYGIDFPTGVNGRFTNGHNK  78

Query  292   ADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNH  471
             AD+ AE LGF+S IPP+      E +LKGVNYASG  GI DE+G   G+  SM++QLVNH
Sbjct  79    ADFFAELLGFDSFIPPFVTARGKE-ILKGVNYASGVAGIRDETGYRWGDRWSMNRQLVNH  137

Query  472   GLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELL  651
              +T++RI   +    +A+  L+KC Y+V MGNNDY+NNYL PQ YP+S LYTPDQFA +L
Sbjct  138   FVTVSRIISILGNVTSAKGLLSKCLYTVDMGNNDYLNNYLQPQFYPTSLLYTPDQFATVL  197

Query  652   AKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMFNDRMK  831
              ++   QL+ L++ GARKVAV   G+LGC+PEE+E  G  +  CVD IN+ VQ+FND++K
Sbjct  198   VQQFSQQLRTLYSYGARKVAVSNIGLLGCLPEELEVFGRNASGCVDFINNYVQLFNDKLK  257

Query  832   PIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQVPCS  1011
              +IDDLN +L  A+FI IN TS++ G PS +G   V+ +CC    T AKGQC +G+VPC+
Sbjct  258   LLIDDLNINLPNARFIYINQTSISSGGPSPVGF-TVDSSCCITLDTIAKGQCRKGEVPCN  316

Query  1012  NRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQ  1143
             NRN+Y+F+DNFH TEI N+ TA RS+ A LP+DAYP DIS L+Q
Sbjct  317   NRNQYIFFDNFHPTEIANIATARRSFNAFLPSDAYPTDISQLVQ  360



>emb|CDP21052.1| unnamed protein product [Coffea canephora]
Length=817

 Score =   401 bits (1030),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 191/350 (55%), Positives = 258/350 (74%), Gaps = 6/350 (2%)
 Frame = +1

Query  103   LMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNG  282
             L+F +++P+   PQVPCYF FGDSLVDNGNNNNLST AK NY PYGIDFPDGPTGRF+NG
Sbjct  375   LVFCNIEPIWGAPQVPCYFSFGDSLVDNGNNNNLSTLAKVNYPPYGIDFPDGPTGRFTNG  434

Query  283   KNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQL  462
             + + D L + +GF + IPP+ A  T++ ++KGVNY SGA GI DE+   MG+ IS ++QL
Sbjct  435   RTILDILGQLVGFENYIPPF-ATATSQDIIKGVNYGSGAAGIRDETSRQMGDRISFNKQL  493

Query  463   VNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFA  642
             +NH   +++IA  +    AA  YL +C Y+V +G+NDYINNYLMPQ YP+S+LYTP Q+A
Sbjct  494   LNHQKVVSKIASLLGSQAAANEYLGRCLYTVVIGSNDYINNYLMPQIYPTSKLYTPAQYA  553

Query  643   ELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMFND  822
             E+L +++  QL  L+  GARK+A+FG G +GC P E+ T+   + +CVDS+N+AVQ+FND
Sbjct  554   EVLVQQYSQQLMTLYNNGARKIALFGLGPIGCTPAEISTY--RTTTCVDSVNAAVQLFND  611

Query  823   RMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQV  1002
             ++K ++DD N  L  AKFI IN+TS+  GDP+ IG+  +N+ CC+VS+T   G C+ G  
Sbjct  612   KLKFLVDDFNRQLTDAKFIYINITSIQSGDPATIGLQILNQPCCKVSET---GLCKPGVR  668

Query  1003  PCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQLNL  1152
             PC+ R  Y+FWD+FH TE  N+ TATR+Y A LPTDAYPMDI  L  ++L
Sbjct  669   PCTFRAIYLFWDSFHPTETVNVLTATRAYNALLPTDAYPMDIRHLFYIHL  718


 Score =   384 bits (987),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 184/357 (52%), Positives = 250/357 (70%), Gaps = 6/357 (2%)
 Frame = +1

Query  76    VWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPD  255
             +W  +   L+ F  ++ ++  PQVPCYF FGDS+ DNGNNNNL T AKANY PYGIDFPD
Sbjct  7     IWIFVFMGLVRF-DMQFVLGAPQVPCYFSFGDSIADNGNNNNLPTIAKANYPPYGIDFPD  65

Query  256   GPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMG  435
             G TGR++NG+N+ D++A+ LGF++ IPPY A    +G++KGVNY SG  GI DE+    G
Sbjct  66    GSTGRYTNGRNIPDFIAQLLGFDNFIPPY-ATARGQGIIKGVNYGSGGAGIRDETSFQQG  124

Query  436   EVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSS  615
               IS +QQL NHG T++RI+L   G  +A+ YL+KC Y+V +G+NDY+NNY +PQ Y +S
Sbjct  125   ARISFNQQLQNHGRTISRISLLHGGPTSAKDYLSKCLYTVLIGSNDYLNNYFLPQIYSTS  184

Query  616   RLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSI  795
             R YTPDQ+AE+L ++   QLK L+  GARK+A+FG G LGCIP  +++  +G  +CVDS+
Sbjct  185   RTYTPDQYAEVLIRQFSQQLKTLYNYGARKIALFGLGALGCIPAVIDS--SGGTTCVDSV  242

Query  796   NSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACCQVSKTKA  975
             N+AVQ+FN R+KP++DDLN  L GAKFI +N +S+  GDP+ +GI    + CCQV    +
Sbjct  243   NAAVQIFNGRLKPLVDDLNSQLVGAKFIYLNTSSIQSGDPTSLGIQFFTEPCCQVD--SS  300

Query  976   KGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
              G C  G  PC NR +Y F+D  H TE      + R++ + LP+DAYPMDI  L QL
Sbjct  301   TGLCISGSTPCCNRTQYAFYDAIHPTETVYQAYSVRAFDSVLPSDAYPMDIRHLAQL  357


 Score = 84.0 bits (206),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 61/83 (73%), Gaps = 5/83 (6%)
 Frame = +1

Query  64   SGVKVWFAIATLLLMFLSL-----KPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANY  228
            S V + F ++T  L+F+       +  + E ++PC+F FGDSLVDNGNNNNL+T +KANY
Sbjct  719  SPVPMSFKVSTCFLVFIGFIIFNPQTTLGEQEIPCFFSFGDSLVDNGNNNNLNTTSKANY  778

Query  229  LPYGIDFPDGPTGRFSNGKNLAD  297
             PYGIDFPDGPTGRF+NG+ + D
Sbjct  779  RPYGIDFPDGPTGRFTNGRTIID  801



>ref|XP_004232998.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Solanum lycopersicum]
Length=365

 Score =   382 bits (982),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 193/359 (54%), Positives = 253/359 (70%), Gaps = 3/359 (1%)
 Frame = +1

Query  76    VWFAIATLLLMFLSLKP--LVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDF  249
             VWF   T LL+ +S KP  +  E QVPC F+ GDSL DNGNNNNL T AKANY PYGIDF
Sbjct  8     VWFVRMTALLICMSSKPWFVKGEQQVPCLFVLGDSLFDNGNNNNLLTTAKANYPPYGIDF  67

Query  250   PDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTH  429
             PDGPTGRF+NG+N+AD+LAE LGF+  I P++ V   + + KGVNYASGA GILDE+  H
Sbjct  68    PDGPTGRFTNGRNVADFLAELLGFDKYIEPFATVKGVD-MFKGVNYASGAAGILDETAIH  126

Query  430   MGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYP  609
             MG+ IS+++QL NH  T++ ++  +        YL+KC Y V MGNNDYINNYL+PQ Y 
Sbjct  127   MGDRISLNRQLHNHNETISHMSTLLGNKTLTMEYLSKCIYIVQMGNNDYINNYLLPQLYL  186

Query  610   SSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVD  789
             SS +Y P+QFA +L +++  QLK L+  GARKV VFG G +GC+P E++ +G G   C++
Sbjct  187   SSHMYNPEQFASILIQQYSEQLKTLYLYGARKVVVFGLGGIGCVPSELDMYGTGDSVCIN  246

Query  790   SINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACCQVSKT  969
             SI+SAV+ F+D++KP+IDDLN +L  AKFI IN +S+ + DPS IGI  +++ CC++S T
Sbjct  247   SIDSAVRKFSDKLKPMIDDLNSNLPNAKFIYINSSSIEVPDPSSIGITKLSEPCCEISGT  306

Query  970   KAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
               +G C+ G   CS+R  + FWD FH +E  N  TA R+YTA   T  YP DIS L QL
Sbjct  307   IGEGLCKHGGGACSDRAAHYFWDGFHPSEAPNKVTAERAYTALQSTHVYPFDISQLAQL  365



>emb|CDO96912.1| unnamed protein product [Coffea canephora]
Length=366

 Score =   380 bits (975),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 184/365 (50%), Positives = 255/365 (70%), Gaps = 12/365 (3%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLKPL-VAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLP  234
             MA   + WF ++ ++++   LKP  + E QVPCYFIFGDS  DNGNNN+L+T A+ANY P
Sbjct  1     MAFAARQWFLLSIIVVVVCFLKPFALGEQQVPCYFIFGDSQDDNGNNNHLNTTARANYPP  60

Query  235   YGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILD  414
             YGIDFP+GPTGRF+NG+N AD++ E LGF+S IPP+ A T    + KG+NYASGA GILD
Sbjct  61    YGIDFPEGPTGRFTNGRNPADFIGELLGFDSYIPPF-ANTEGRDITKGINYASGASGILD  119

Query  415   ESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLM  594
             ++G H+G++ S ++QL NH   ++RI   +    A + YL KC Y+  +GNNDYINNYL+
Sbjct  120   QTGRHLGDLFSFNEQLHNHERVISRIVRLIGNRSATKEYLAKCLYTAALGNNDYINNYLL  179

Query  595   PQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGS  774
             P+ YP+S LYTP +FA LL + +  QL+ L+ LGARK+AVFG G+LGCIP E+   GN  
Sbjct  180   PEYYPTSHLYTPTEFASLLIRHYSQQLRTLYRLGARKIAVFGLGLLGCIPAELSADGN--  237

Query  775   LSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNK  945
               CVDSIN  V +FND++KP++++LN  L  A+F+ +++ ++   +L  P+ I I N   
Sbjct  238   --CVDSINDEVLLFNDKLKPLVEELNTELSDAQFLYVDVRAINLNSLSTPAEITIGNA--  293

Query  946   ACCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTA-TLPTDAYPM  1122
              CC VS T A+GQC  GQ+PCSNRN+Y FWD+FH +E+ N   +  +Y+A +   DA P+
Sbjct  294   PCCNVSATVARGQCIPGQIPCSNRNQYYFWDDFHPSEVVNEAYSRLAYSALSSLLDADPL  353

Query  1123  DISSL  1137
              I  L
Sbjct  354   AIGGL  358



>ref|XP_006355554.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Solanum tuberosum]
Length=360

 Score =   378 bits (971),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 182/357 (51%), Positives = 255/357 (71%), Gaps = 7/357 (2%)
 Frame = +1

Query  79    WFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDG  258
             +  I   ++++L L  +   P+VPCYFIFGDSL+DNGNNN+L T A+ANY PYG+DFPDG
Sbjct  4     YVTIILSIVLYLVLNLVEGAPEVPCYFIFGDSLLDNGNNNDLDTAARANYPPYGVDFPDG  63

Query  259   PTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGE  438
             PTGRF+NG+N+AD+LAE L F+  IP +++ T  E +L+GVNYASG+ GI +++G+H+G 
Sbjct  64    PTGRFTNGRNIADFLAEHLDFDHYIPSFASATGDE-ILEGVNYASGSAGIRNDTGSHLGY  122

Query  439   VISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSR  618
              I + +QL NH +T++RIA  +     A+ +LNKC + VG+G+NDYINN+LMP  Y SS 
Sbjct  123   RIYLGKQLENHKVTISRIADLLGNTTLAKNHLNKCLFIVGIGSNDYINNFLMPDVYQSSH  182

Query  619   LYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSIN  798
             LY+P Q+A LL +++  QLK+L++ GARK+A+FG   +GCIP+++  H   +  CVDS N
Sbjct  183   LYSPTQYATLLIQQYSQQLKELYSDGARKIALFGLPQIGCIPDQLNQH--STFFCVDSTN  240

Query  799   SAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACCQVSKTKAK  978
              AVQ+FN  +K ++DDLN +   AKFI INM S++    S I I  +N  CCQ+SKT  +
Sbjct  241   KAVQLFNKNLKALVDDLNTNFSDAKFIYINMYSIS----SAIAITLLNNPCCQISKTMPE  296

Query  979   GQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQLN  1149
             GQC  G+ PC  R  + F+DNFH TEIGN    +R+Y A LP+D+YPMDI  L++ N
Sbjct  297   GQCIPGKSPCLIRATHFFYDNFHPTEIGNNIATSRAYRALLPSDSYPMDIRHLVRAN  353



>ref|XP_010095104.1| GDSL esterase/lipase [Morus notabilis]
 gb|EXB58270.1| GDSL esterase/lipase [Morus notabilis]
Length=363

 Score =   377 bits (967),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 188/369 (51%), Positives = 244/369 (66%), Gaps = 10/369 (3%)
 Frame = +1

Query  58    MASGVKVWFAI--ATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYL  231
             MA   KV   +   +L+   L +  +  +PQVPC+FIFGDSLVDNGNNN L TEAK NY 
Sbjct  1     MAGQTKVLVVLFAMSLVAYILQINGVNGDPQVPCFFIFGDSLVDNGNNNPLLTEAKVNYK  60

Query  232   PYGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEG--LLKGVNYASGAGG  405
             PYGIDF   PTGRF+NG+  AD L + LGF+  IPPY   TT  G  +LKGVNYASGA G
Sbjct  61    PYGIDFGGTPTGRFNNGRTQADILGQLLGFDDFIPPY---TTARGNVILKGVNYASGAAG  117

Query  406   ILDESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINN  585
             I DE+G  +G++I +++QL NH +T+ RI   ++   AA+ YLNKC Y VGMGNNDY+NN
Sbjct  118   IRDETGYQLGDIIPLNEQLRNHQITVLRITAMLRNRTAAQKYLNKCLYYVGMGNNDYLNN  177

Query  586   YLMPQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHG  765
             Y +PQ Y ++ +YTP Q+A+ L  ++  Q+ +L+ LGARKVA+FG GV+GCIP  + T G
Sbjct  178   YFLPQFYTTALIYTPQQYAQQLIDQYRKQITRLYNLGARKVAIFGVGVIGCIPYAISTFG  237

Query  766   NGSLSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNK  945
                 +CVD  N A Q+FN  +  ++D+LN     AKFI +N   +  GDP+ +G   +N 
Sbjct  238   TNGSACVDRFNEAAQIFNTMLISLVDELNSRYTYAKFIYVNSFGIGSGDPTSVGFTVLNV  297

Query  946   ACCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMD  1125
              CC V+     GQC     PC NR  Y+FWD+FH TE  NL TA+RSYTA LP+D YP+D
Sbjct  298   GCCPVNNI---GQCIPFLTPCQNRTTYVFWDSFHPTEAVNLLTASRSYTAFLPSDTYPID  354

Query  1126  ISSLLQLNL  1152
             I  L QL L
Sbjct  355   IKRLAQLQL  363



>ref|XP_002266915.1| PREDICTED: GDSL esterase/lipase At1g29670 [Vitis vinifera]
 emb|CBI18441.3| unnamed protein product [Vitis vinifera]
Length=362

 Score =   376 bits (965),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 186/351 (53%), Positives = 241/351 (69%), Gaps = 2/351 (1%)
 Frame = +1

Query  97    LLLMFLSLKPLV-AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRF  273
             ++++ L+L P V  E QVPC FIFGDS+ DNGNNN L T+AKANY PYGIDFP G TGRF
Sbjct  13    VMVLGLNLPPRVYGEQQVPCIFIFGDSMADNGNNNGLVTKAKANYQPYGIDFPTGATGRF  72

Query  274   SNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMD  453
             SNG+N  D +AEFLGFN SI P+ A+     +LKGVNYASGA GI +E+G   G+ ISMD
Sbjct  73    SNGRNTVDIIAEFLGFNDSIKPF-AIANGRDILKGVNYASGAAGIREETGQQQGDRISMD  131

Query  454   QQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPD  633
             +QL NH   ++RIA  +    A + YL KC Y VGMG+NDY+NNY MP+ Y +S  Y P+
Sbjct  132   RQLQNHQTIVSRIANMLGNDSATKSYLVKCIYLVGMGSNDYVNNYYMPKFYTTSLEYAPE  191

Query  634   QFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQM  813
             Q+A +L ++  +QL+ L+ LGARKVA+ G G+LGC P+E+ T+G    SCV  IN  VQ+
Sbjct  192   QYAIVLIQQFSLQLRTLYGLGARKVALDGLGLLGCTPKELATYGTNGSSCVQFINDEVQI  251

Query  814   FNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACCQVSKTKAKGQCEE  993
             FNDR++ ++D+LN +L  A FI +N + +   DP++ G   V   CC+V  +   G C  
Sbjct  252   FNDRLRLLVDELNSNLTNANFIYVNTSGILATDPALAGFRVVGAPCCEVGSSDGLGTCLP  311

Query  994   GQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
              + PC NR EY+FWD FH TE  N+ TATRSY A  P DAYP+DI SL QL
Sbjct  312   LKAPCLNRAEYVFWDAFHPTEAVNIITATRSYNARSPFDAYPVDIYSLAQL  362



>ref|XP_007213451.1| hypothetical protein PRUPE_ppa024746mg, partial [Prunus persica]
 gb|EMJ14650.1| hypothetical protein PRUPE_ppa024746mg, partial [Prunus persica]
Length=358

 Score =   371 bits (953),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 185/360 (51%), Positives = 245/360 (68%), Gaps = 5/360 (1%)
 Frame = +1

Query  82    FAIATLLLMFLSLKPLV-AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDG  258
             F +  +L++ +S   LV   PQVPC+FIFGDSL DNGNNNNL + A ANY PYGIDFP G
Sbjct  1     FILIVVLVVSISQSRLVNGAPQVPCFFIFGDSLADNGNNNNLLSFANANYQPYGIDFPIG  60

Query  259   PTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGE  438
             PTGRF NG+   D LA+ LGF + IP ++A T  + +LKG+NYASG+ GI  E+G  +G 
Sbjct  61    PTGRFCNGRTTVDILAQLLGFENPIPSFAA-TRGQDILKGLNYASGSAGIRAETGFQVGA  119

Query  439   VISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSR  618
              IS+DQQL NH +T++RIA  +   ++A  YLNKC YSVGMG+NDYINNY +PQ Y +SR
Sbjct  120   RISLDQQLQNHQVTVSRIASTLGHNQSALQYLNKCLYSVGMGSNDYINNYFLPQFYDTSR  179

Query  619   LYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSIN  798
             +Y  +Q+A +L  ++  Q+  L+  GARKVA+ G G +GC P  + T G    +CVD++N
Sbjct  180   IYNHEQYATVLIHQYSRQIASLYKNGARKVALIGLGAIGCTPNAISTFGTEGSACVDNMN  239

Query  799   SAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACCQVSKTKAK  978
             SAVQ+FN ++  +++ LN +L  AKFI +N   +A GDP+  G   VN  CC V+K    
Sbjct  240   SAVQLFNQKLLALVNQLNTNLTDAKFIYVNSFGMASGDPAAAGFKVVNVGCCPVNKF---  296

Query  979   GQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQLNLQA  1158
             GQC   Q PC NR+EY FWD FH TE  N  TA R+YT   P+D YP+DIS L+QL+L +
Sbjct  297   GQCAADQTPCQNRSEYAFWDGFHPTEALNQITARRTYTEFDPSDTYPLDISHLVQLSLSS  356



>ref|XP_006389045.1| hypothetical protein POPTR_0053s00200g [Populus trichocarpa]
 gb|ERP47959.1| hypothetical protein POPTR_0053s00200g [Populus trichocarpa]
Length=359

 Score =   371 bits (952),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 185/362 (51%), Positives = 239/362 (66%), Gaps = 5/362 (1%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLKPLV-AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLP  234
             M   +KVW  +  LL +  +L+    A PQVPC+FIFGDSL D+GNNNNL T AKANY P
Sbjct  1     MTDKIKVWCFLLFLLKLVSNLQNCAHAAPQVPCFFIFGDSLADSGNNNNLVTAAKANYRP  60

Query  235   YGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILD  414
             YGIDFP+G TGRF+NG+   D + E LGFN  IPP+ A      +L GVNYASGA GI D
Sbjct  61    YGIDFPNGTTGRFTNGRTTVDIIGELLGFNQFIPPF-ATARGRDILVGVNYASGAAGIRD  119

Query  415   ESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLM  594
             ESG  +G+ IS+++QL NH  TL+R+   +   +AA  YLNKC Y V +G+NDY+NNY M
Sbjct  120   ESGRQLGDRISLNEQLQNHAATLSRLTQLLGTKQAAENYLNKCLYYVSLGSNDYLNNYFM  179

Query  595   PQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGS  774
             P  Y +SRLYTPDQ+A++L  ++  Q+K L+ LGARK+A+ G G +G IP    T    +
Sbjct  180   PSNYTTSRLYTPDQYAKVLIDQYSQQIKLLYLLGARKIALPGLGAIGSIPYSFSTLCRNN  239

Query  775   LSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACC  954
             +SCV +IN+AV  FN  +  ++D LN  L  A+FI +N T ++ GDPS++G   VN  CC
Sbjct  240   ISCVTNINNAVLPFNAGLVSLVDQLNRELNDARFIYLNSTGMSSGDPSVLGFRVVNVGCC  299

Query  955   QVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISS  1134
                  +  GQC +   PC NR EY+FWD  H TE  N  TA RSY A LP+DAYP DIS 
Sbjct  300   ---PARGDGQCIQDSTPCQNRTEYVFWDAIHPTEALNQFTARRSYNAFLPSDAYPTDISH  356

Query  1135  LL  1140
             L+
Sbjct  357   LI  358



>ref|XP_008366023.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Malus domestica]
Length=368

 Score =   370 bits (949),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 181/366 (49%), Positives = 251/366 (69%), Gaps = 6/366 (2%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLKPLV-AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLP  234
             MA G K+  A+   L    +++ LV  +PQVPC+FIFGDS+ D GNNN L T AK NY P
Sbjct  1     MAGGTKL-LAVVIALSWLSNMQQLVQGKPQVPCFFIFGDSVADPGNNNKLPTLAKVNYKP  59

Query  235   YGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILD  414
             YGIDFP GPTGRF NG+N+ D+LAE LGF + IP +++   TE +L+GVNYASGA GI  
Sbjct  60    YGIDFPAGPTGRFCNGRNIVDFLAELLGFENYIPAFASANGTE-ILQGVNYASGAAGIRK  118

Query  415   ESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLM  594
             ESG  +G  ISM +QL NH  T++RI         A+  LN+C YSVGMG+NDYINNY M
Sbjct  119   ESGKQLGARISMGEQLKNHRTTVSRIIDIFGKKSLAKNQLNQCIYSVGMGSNDYINNYFM  178

Query  595   PQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGS  774
             PQ Y +S+ YT +++A++L K++  Q+ +LH  GARKVA+ G G++GC P+ ++T+G   
Sbjct  179   PQYYTTSQKYTLEEYADVLIKQYTRQILRLHQYGARKVALVGLGLIGCTPDAIKTYGTNG  238

Query  775   LSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACC  954
              +CVD +N+A Q+FN ++  ++D+LN +L  ++FI IN   +  GD ++ G   +N  CC
Sbjct  239   SACVDIMNNASQIFNGKLVSLVDELNTNLTDSQFIYINSYGMGSGDLTLAGFKVLNAGCC  298

Query  955   QVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISS  1134
             +  +    GQC     PC NR+EY+FWD+FH TE GNL TA+R+YTA+ P+D YPMD+S 
Sbjct  299   EADEV---GQCIPDLTPCQNRSEYVFWDSFHPTEAGNLITASRTYTASEPSDTYPMDMSH  355

Query  1135  LLQLNL  1152
             L +L +
Sbjct  356   LAELQI  361



>ref|XP_004233010.2| PREDICTED: uncharacterized protein LOC101263269 [Solanum lycopersicum]
Length=741

 Score =   382 bits (980),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 186/364 (51%), Positives = 261/364 (72%), Gaps = 11/364 (3%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPY  237
             MA  V + F+I    +++L L  +   P+VPCYFIFGDSL+DNGNNN+L T A+ANY PY
Sbjct  382   MACYVTIIFSI----VLYLVLNLVEGAPEVPCYFIFGDSLLDNGNNNDLDTAARANYPPY  437

Query  238   GIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDE  417
             G+DFPDGPTGRF+NG+N+AD+LAE L F+  IP +++ T  E +L+GVNYASG+ GI ++
Sbjct  438   GVDFPDGPTGRFTNGRNIADFLAEHLDFDHYIPSFASATGDE-ILEGVNYASGSAGIRND  496

Query  418   SGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMP  597
             +G+H+G  I + +QL NH +T++RIA  +    +A+ +LNKC + VG+G+NDYINN+LMP
Sbjct  497   TGSHLGYRIYLGKQLENHKVTISRIADLLGNATSAKNHLNKCLFIVGIGSNDYINNFLMP  556

Query  598   QKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSL  777
               Y SS LY+P Q+A LL +++  QLK+L++ GARK+A+FG   +GCIP+++  H   ++
Sbjct  557   DVYQSSHLYSPSQYATLLIQQYSQQLKELYSDGARKIALFGLPQIGCIPDQLNQH--STI  614

Query  778   SCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACCQ  957
              CVDS N AVQ+FN  +K ++DDLN +   AKFI INM S++    S I I  +N  CCQ
Sbjct  615   FCVDSTNKAVQLFNKNLKALVDDLNTNFPDAKFIYINMYSIS----SAIAITLLNNPCCQ  670

Query  958   VSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSL  1137
             +SKT  +GQC  G+ PC  R  + F+DNFH TEIGN    +R+Y A LP+D+YPMDI  L
Sbjct  671   ISKTMPEGQCIPGKSPCLFRATHFFYDNFHPTEIGNNIATSRAYRALLPSDSYPMDIRHL  730

Query  1138  LQLN  1149
             ++ N
Sbjct  731   VRAN  734


 Score =   366 bits (939),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 183/357 (51%), Positives = 251/357 (70%), Gaps = 10/357 (3%)
 Frame = +1

Query  88    IATLLLMFLSLKPLV-AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDG-P  261
             I   + + L+LK  V   PQVPCYFIFGDSL+DNGNNN L+T AKANY PYG+DF  G P
Sbjct  7     IFATIFIVLNLKTFVEGAPQVPCYFIFGDSLLDNGNNNELNTTAKANYPPYGVDFQGGRP  66

Query  262   TGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEV  441
             TGRF+NG+N AD+LAE+LGF+  IPP+++V  +E +L+GVNYASG+ GI ++SG+H+G+ 
Sbjct  67    TGRFTNGRNTADFLAEYLGFDHYIPPFASVKDSE-ILEGVNYASGSAGIRNDSGSHLGDR  125

Query  442   ISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRL  621
             I + +QL NH  T++RIA  +    +A+ +LNKC + VG+G+NDYINNYLMP+ YPSS L
Sbjct  126   IYLGRQLENHQTTISRIANLVGNTTSAQKHLNKCLFIVGIGSNDYINNYLMPEIYPSSHL  185

Query  622   YTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINS  801
             YTP Q+A  L  ++   L+ L+  GARKVA+FG G +GCIP E++ H   +  CV S N+
Sbjct  186   YTPTQYATALIDQYSQHLRTLYEDGARKVALFGLGQIGCIPAELQKH--DTRRCVSSTNN  243

Query  802   AVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL-ALGDPSIIGINNVNKACCQVSKTKAK  978
             A+Q FN ++K ++ DLN +   AKF  INM S+ ++ DP    ++   + CC V +T  +
Sbjct  244   AIQQFNSKLKSLVGDLNTNFPDAKFTYINMYSISSIIDP----LSVFTRPCCNVLETMPE  299

Query  979   GQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQLN  1149
             GQC  G+ PC  R  Y+F+DNFH TEI N    +R+Y A LP+DAYPMDI  L++ N
Sbjct  300   GQCVPGETPCFLRGIYLFYDNFHPTEIANRIATSRAYNALLPSDAYPMDIHHLIRTN  356



>ref|XP_006388931.1| hypothetical protein POPTR_0073s00220g [Populus trichocarpa]
 gb|ERP47845.1| hypothetical protein POPTR_0073s00220g [Populus trichocarpa]
Length=359

 Score =   367 bits (943),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 186/362 (51%), Positives = 243/362 (67%), Gaps = 5/362 (1%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLKPLV-AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLP  234
             MA  +KVW  +  LL +  +L+    A PQVPC+FIFGDSL D+GNNNNL T AKANY P
Sbjct  1     MAYKIKVWCLLLVLLKLVSNLQNCAHAAPQVPCFFIFGDSLADSGNNNNLVTAAKANYRP  60

Query  235   YGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILD  414
             YGIDFP+G TGRF+NG+ + D + E LGFN  IPP+ A      +L GVNYASGA GI D
Sbjct  61    YGIDFPNGTTGRFTNGRTVVDVIGELLGFNQFIPPF-ATARGRDILVGVNYASGAAGIRD  119

Query  415   ESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLM  594
             ESG  +G+ IS+++QL+NH  TL+R+   +   +AA  YLNKC Y V +G+NDY+NNY M
Sbjct  120   ESGRQLGDRISLNEQLLNHVTTLSRLIQLLGTKQAAENYLNKCLYYVSLGSNDYLNNYFM  179

Query  595   PQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGS  774
             P  Y +SRLYTPDQ+A++L  ++  Q+K L+ LGARK+A+ G G +G IP    T    +
Sbjct  180   PSNYTTSRLYTPDQYAKVLIDQYSQQIKLLYLLGARKIALPGLGAIGSIPYSFSTLCRNN  239

Query  775   LSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACC  954
             LSCV +IN+AV  FN  +  ++D LN  L  A+FI +N T ++ GDPS++G   V+  CC
Sbjct  240   LSCVTNINNAVLPFNAGLVSLVDQLNRELNDARFIYLNSTGMSSGDPSVLGFRVVDVGCC  299

Query  955   QVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISS  1134
                  ++ GQC +   PC NR EY+FWD  H TE  N  TA RSY A LP+DAYP DIS 
Sbjct  300   ---PARSDGQCIQDSTPCQNRTEYVFWDAIHPTEALNQFTARRSYNAFLPSDAYPTDISH  356

Query  1135  LL  1140
             L+
Sbjct  357   LI  358



>ref|XP_007213100.1| hypothetical protein PRUPE_ppa023347mg, partial [Prunus persica]
 gb|EMJ14299.1| hypothetical protein PRUPE_ppa023347mg, partial [Prunus persica]
Length=344

 Score =   366 bits (940),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 171/344 (50%), Positives = 239/344 (69%), Gaps = 4/344 (1%)
 Frame = +1

Query  130   VAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNLADYLAE  309
             V EPQVPC+FIFGDS+ DNGNNN L T AK NY PYG+DFP GPTGRF NG+N+ D LAE
Sbjct  1     VREPQVPCFFIFGDSVSDNGNNNLLPTFAKVNYSPYGVDFPQGPTGRFCNGRNIVDVLAE  60

Query  310   FLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNHGLTLAR  489
              LGF + IPP++    +E ++KGVNYASGA GI  ESG  +G  ISM +QL NH  T+ R
Sbjct  61    LLGFENYIPPFAYANGSE-IVKGVNYASGAAGIRKESGRQLGARISMGEQLKNHRTTVLR  119

Query  490   IALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAKKHYV  669
             I   +     A+ +LNKC YSVGMG+NDYINNY +PQ Y +S+ YT +++AE+L K++  
Sbjct  120   IIDILGKRSLAKKHLNKCLYSVGMGSNDYINNYFLPQYYQTSKKYTLEEYAEVLIKQYTQ  179

Query  670   QLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMFNDRMKPIIDDL  849
             Q+ +L   GARKV++ G G++GC P+ ++T+G    SCV+ +N+A Q FN ++  ++D+L
Sbjct  180   QILRLRKYGARKVSLVGLGLIGCTPDAIKTYGTNGSSCVEKLNNASQQFNQKLVALVDEL  239

Query  850   NGSLKGAKFILINMTSLALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQVPCSNRNEYM  1029
             N +   +KFI +N   +  GDP+++G   ++  CC+V +    GQC   + PC NR +Y+
Sbjct  240   NTNFTDSKFIYVNSYEMGSGDPTLVGFKVLDAGCCEVDQY---GQCAPNKTPCQNRTDYV  296

Query  1030  FWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQLNLQAK  1161
             FWD FH +E  NL +A+R+Y+A   +D YPMDIS L+QL L+ +
Sbjct  297   FWDGFHPSEASNLISASRTYSAYNASDTYPMDISHLVQLQLEPQ  340



>ref|XP_010095107.1| GDSL esterase/lipase [Morus notabilis]
 gb|EXB58273.1| GDSL esterase/lipase [Morus notabilis]
Length=386

 Score =   367 bits (942),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 185/363 (51%), Positives = 232/363 (64%), Gaps = 7/363 (2%)
 Frame = +1

Query  73    KVWFAIATLLLMFLSLK----PLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYG  240
             K W  +  L L+  +++     + A+PQVPC+FIFGDSL DNGNNN LST  KANY+PYG
Sbjct  9     KTWLLVFALSLVVSTMQLHDFCVCAKPQVPCFFIFGDSLADNGNNNQLSTLTKANYIPYG  68

Query  241   IDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPY-SAVTTTEGLLKGVNYASGAGGILDE  417
             IDF DGPTGRF+NG+   D LAE LGF + IP + SA   +  LL GVNYASGA GIL  
Sbjct  69    IDFSDGPTGRFTNGRTTVDILAELLGFENPIPSFASATANSSNLLGGVNYASGAAGILRA  128

Query  418   SGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMP  597
             +G H G  IS+ +QL NH +T++RIA  +   R A+  L KC Y V MGNNDYINNY +P
Sbjct  129   TGKHAGNNISLRRQLNNHRITVSRIADVLGSKRLAKERLEKCLYWVEMGNNDYINNYYIP  188

Query  598   QKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSL  777
               YPSS LY P Q+A LL + +   + KL++ GAR  A+ G G +GC P  +  +G    
Sbjct  189   SIYPSSSLYNPKQYAALLIQNYQRHVMKLYSHGARMFALVGVGQIGCTPNSISVYGTNGS  248

Query  778   SCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACCQ  957
             +CVD +N A Q FN R+  ++D LN  L   KFI +N   +  GDP+I G    N  CC 
Sbjct  249   ACVDYMNDAAQFFNQRLIALVDQLNTDLLDVKFIYVNSYGMGSGDPTIAGFKVWNVGCCA  308

Query  958   VSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSL  1137
             V+     GQC   + PC NRNEY+FWD+FH TE  NL TA R Y A  P+D YPMDISSL
Sbjct  309   VNNN--TGQCVPNKTPCENRNEYVFWDSFHPTEALNLITAKRVYNAYDPSDCYPMDISSL  366

Query  1138  LQL  1146
             +QL
Sbjct  367   VQL  369



>ref|XP_011046352.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Populus euphratica]
 ref|XP_011016101.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Populus euphratica]
Length=359

 Score =   364 bits (934),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 184/362 (51%), Positives = 244/362 (67%), Gaps = 5/362 (1%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLKPLV-AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLP  234
             MA  ++VW  +  LL +  +L+    A PQVPC+FIFGDSL D+GNNNNL T AKANY P
Sbjct  1     MAYKIEVWCLLLVLLKLVSNLQNCAHAAPQVPCFFIFGDSLADSGNNNNLVTAAKANYRP  60

Query  235   YGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILD  414
             YGIDFP+G TGRF+NG+ + D + E LGFN  IPP++     E +L GVNYASGA GI D
Sbjct  61    YGIDFPNGTTGRFTNGRTVVDIIGELLGFNQFIPPFATARGRE-ILVGVNYASGAAGIRD  119

Query  415   ESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLM  594
             ESG  +G+ IS+++QL+NH  TL+R+   +   +AA  YLNKC Y V +G+NDY+NNY M
Sbjct  120   ESGRQLGDRISLNEQLLNHVTTLSRLIQLLGTKQAAENYLNKCLYYVSLGSNDYLNNYFM  179

Query  595   PQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGS  774
             P  Y +SRLYTPDQ+A++L  ++  Q+K L+ LGARK+A+ G G +G IP    T  + +
Sbjct  180   PSNYTTSRLYTPDQYAKVLIDQYSQQIKLLYLLGARKLALPGLGPIGSIPYSFSTLCHNN  239

Query  775   LSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACC  954
             +SCV +IN+AV  FN  +  ++D LN  L  A+FI +N T ++ GDPS++G    N  CC
Sbjct  240   VSCVTNINNAVLPFNAGLVSLVDQLNRELNDARFIYLNSTGMSSGDPSVLGFRVTNVGCC  299

Query  955   QVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISS  1134
                  ++ GQC +   PC NR EY+FWD  H TE  N  TA RSY A LP+DAYP DIS 
Sbjct  300   ---PARSDGQCIQDSTPCQNRTEYVFWDAIHPTEALNQFTARRSYNAFLPSDAYPTDISH  356

Query  1135  LL  1140
             L+
Sbjct  357   LI  358



>ref|XP_009591549.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Nicotiana tomentosiformis]
Length=356

 Score =   364 bits (934),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 187/353 (53%), Positives = 255/353 (72%), Gaps = 7/353 (2%)
 Frame = +1

Query  91    ATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGR  270
              T++ +FL L  +   PQVPCYFIFGDSL+DNGNNN+L+T A+ANYLPYG+DFPDGPTGR
Sbjct  5     TTIITVFLVLNLVQGAPQVPCYFIFGDSLLDNGNNNDLNTAARANYLPYGVDFPDGPTGR  64

Query  271   FSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISM  450
             F+NG+N+AD+L E LGF++ IPPY++ T  E +L+GVNYASG+ GI +++G H+G  I +
Sbjct  65    FTNGRNMADFLGEHLGFDNYIPPYASATGDE-ILQGVNYASGSAGIRNDTGNHLGYRIYL  123

Query  451   DQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTP  630
              +QL NH +T++RIA  +    +A+ +LNKC + VG+G+NDYINN+LMP  YP+S LYTP
Sbjct  124   GRQLENHKVTISRIADLLGNTTSAKNHLNKCLFIVGIGSNDYINNFLMPDIYPTSHLYTP  183

Query  631   DQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQ  810
              Q+A +L +++  QLK L+  GARK+ +FG   +GCIP+E++ H   +L CVDS N AVQ
Sbjct  184   SQYATVLIEQYSQQLKDLYEDGARKITLFGLPQIGCIPDELKKH--STLLCVDSTNEAVQ  241

Query  811   MFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACCQVSKTKAKGQCE  990
             +FN  +K ++DDLN +L  A+FI INM S++    S I I  +N  CCQVSK   +GQC 
Sbjct  242   LFNQNLKALVDDLNTNLPDAQFIYINMYSIS----SAIAITLLNYPCCQVSKIMPEGQCI  297

Query  991   EGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQLN  1149
              G+ PC  R  ++F+DNFH TEI N     R+Y A L +DAYPMDI  L+  N
Sbjct  298   PGKAPCLIRPTHLFFDNFHPTEIANSIATNRAYNALLSSDAYPMDIRHLVTGN  350



>emb|CBI30761.3| unnamed protein product [Vitis vinifera]
Length=359

 Score =   363 bits (933),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 181/359 (50%), Positives = 237/359 (66%), Gaps = 7/359 (2%)
 Frame = +1

Query  73    KVWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFP  252
             K+W++   L L+       + +PQV CYFI GDSL D+GNNN LST AK NYLPYGIDFP
Sbjct  7     KIWWSTVLLFLLSNLQHGTLGDPQVSCYFILGDSLSDSGNNNALSTLAKVNYLPYGIDFP  66

Query  253   DGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHM  432
              GPTGRF NG+ + D +AE LGFNS +PP+ A    E +LKGVNYASG  GI DESG ++
Sbjct  67    QGPTGRFCNGRTVVDVIAELLGFNSFVPPF-ATAEGEVILKGVNYASGGSGIRDESGQNL  125

Query  433   GEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPS  612
             G+ ISM++QL N+  T+++I   +    AA  +LNKC ++VG+G+NDYINNYLMP  YP+
Sbjct  126   GDRISMNEQLENYQTTVSQINDILGSDSAAATHLNKCLFTVGIGSNDYINNYLMPDLYPT  185

Query  613   SRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLS-CVD  789
             SRLYTPDQ+AE L +++  QLK L+  GARK+A+FG G++GC P E+ + G    S CVD
Sbjct  186   SRLYTPDQYAEALIEQYSQQLKTLYGYGARKLALFGLGLIGCAPTELASFGPSPGSNCVD  245

Query  790   SINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACCQVSKT  969
             +IN AV++FN  +  +IDDLN +   AKF  IN   +   + +  G    N  CC     
Sbjct  246   TINDAVRLFNTGLVSLIDDLNKNFSDAKFTYINFYEIGSTNLTAFGFKVTNMGCC-----  300

Query  970   KAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
               +  C     PC NR+EY FWD FH TE  NL    R+Y +  P+DAYP+DIS+L QL
Sbjct  301   GGQNACLRSSTPCQNRSEYAFWDQFHSTEAVNLIFGQRAYKSQTPSDAYPIDISTLAQL  359



>gb|ABK94705.1| unknown [Populus trichocarpa]
Length=357

 Score =   363 bits (933),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 185/362 (51%), Positives = 239/362 (66%), Gaps = 7/362 (2%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLKPLV-AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLP  234
             MA  +KVW  +  LL +  +L+    A PQVPC+FIFGDSL D+GNNNNL T AKANY P
Sbjct  1     MADKIKVWCFLLFLLRLVSNLQNCAHAAPQVPCFFIFGDSLADSGNNNNLVTAAKANYRP  60

Query  235   YGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILD  414
             YGIDFP+G TGRF+NG+ + D + E LGFN  IPP+ A      +L GVNYASGA GI D
Sbjct  61    YGIDFPNGTTGRFTNGRTVVDIIGELLGFNQFIPPF-ATARGRDILVGVNYASGASGIRD  119

Query  415   ESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLM  594
             ESG  +G+ IS+++QL NH  TL+R+   +   +AA  YLNKC Y V +G+NDY+NNY M
Sbjct  120   ESGRQLGDRISLNEQLQNHAATLSRLTQLLGTKQAAENYLNKCLYYVSLGSNDYLNNYFM  179

Query  595   PQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGS  774
             P  Y +SRLYTPDQ+A++L  ++  Q+K L+ LGARK+A+ G   +G IP    T    +
Sbjct  180   PSNYTTSRLYTPDQYAKVLIDQYSQQIKLLYHLGARKIALPGLRPIGSIPYSFSTLCRNN  239

Query  775   LSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACC  954
             +SCV +IN+AV  FN  +  ++D LN  L  A+FI +N T ++ GDPS++G    N  CC
Sbjct  240   VSCVTNINNAVLPFNAGLVSLVDQLNRELNDARFIYLNSTGMSSGDPSVLGFRVTNVGCC  299

Query  955   QVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISS  1134
                  ++ GQC   Q PC NR EY FWD  H TE  N  TA RSY A LP+DAYP DIS 
Sbjct  300   ---PARSDGQCI--QDPCQNRTEYAFWDAIHPTEALNQFTARRSYNAILPSDAYPTDISH  354

Query  1135  LL  1140
             L+
Sbjct  355   LI  356



>gb|ABK95330.1| unknown [Populus trichocarpa]
Length=359

 Score =   363 bits (931),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 177/336 (53%), Positives = 228/336 (68%), Gaps = 4/336 (1%)
 Frame = +1

Query  133   AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNLADYLAEF  312
             A PQVPC+FIFGDSL D+GNNNNL T AKANY PYGIDFP+G TGRF+NG+ + D + E 
Sbjct  27    AAPQVPCFFIFGDSLADSGNNNNLVTAAKANYRPYGIDFPNGTTGRFTNGRTVVDIIGEL  86

Query  313   LGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNHGLTLARI  492
             LGFN  IPP+ A      +L GVNY SGA GI DESG  +G+ IS+++QL NH  TL+R+
Sbjct  87    LGFNQFIPPF-ATARGRDILVGVNYGSGAAGIRDESGRQLGDRISLNEQLQNHAATLSRL  145

Query  493   ALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAKKHYVQ  672
                +   +AA  YLNKC Y V +G+NDY+NNY MP  Y +SRLYTPDQ+A++L  ++  Q
Sbjct  146   TQLLGTKQAAENYLNKCLYYVSLGSNDYLNNYFMPSNYTTSRLYTPDQYAKVLIDQYSQQ  205

Query  673   LKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMFNDRMKPIIDDLN  852
             +K L+ LGARK+A+ G G +G IP    T    +LSCV +IN+AV  FN  +  ++D LN
Sbjct  206   IKLLYLLGARKIALPGLGAIGSIPYSFSTLCRNNLSCVTNINNAVLPFNAGLVSLVDQLN  265

Query  853   GSLKGAKFILINMTSLALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQVPCSNRNEYMF  1032
               L  A+FI +N T ++ GDPS++G   V+  CC     ++ GQC +   PC NR EY+F
Sbjct  266   RELNDARFIYLNSTGMSSGDPSVLGFRVVDVGCC---PARSDGQCIQDSTPCQNRTEYVF  322

Query  1033  WDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLL  1140
             WD  H TE  N  TA RSY A LP+DAYP DIS L+
Sbjct  323   WDAIHPTEALNQFTARRSYNAFLPSDAYPTDISHLI  358



>ref|XP_006388930.1| hypothetical protein POPTR_0073s00220g [Populus trichocarpa]
 gb|ERP47844.1| hypothetical protein POPTR_0073s00220g [Populus trichocarpa]
Length=362

 Score =   363 bits (931),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 186/365 (51%), Positives = 245/365 (67%), Gaps = 8/365 (2%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLKPLV-AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLP  234
             MA  +KVW  +  LL +  +L+    A PQVPC+FIFGDSL D+GNNNNL T AKANY P
Sbjct  1     MAYKIKVWCLLLVLLKLVSNLQNCAHAAPQVPCFFIFGDSLADSGNNNNLVTAAKANYRP  60

Query  235   YGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILD  414
             YGIDFP+G TGRF+NG+ + D + E LGFN  IPP+ A      +L GVNYASGA GI D
Sbjct  61    YGIDFPNGTTGRFTNGRTVVDVIGELLGFNQFIPPF-ATARGRDILVGVNYASGAAGIRD  119

Query  415   ESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLM  594
             ESG  +G+ IS+++QL+NH  TL+R+   +   +AA  YLNKC Y V +G+NDY+NNY M
Sbjct  120   ESGRQLGDRISLNEQLLNHVTTLSRLIQLLGTKQAAENYLNKCLYYVSLGSNDYLNNYFM  179

Query  595   PQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGS  774
             P  Y +SRLYTPDQ+A++L  ++  Q+K L+ LGARK+A+ G G +G IP    T    +
Sbjct  180   PSNYTTSRLYTPDQYAKVLIDQYSQQIKLLYLLGARKIALPGLGAIGSIPYSFSTLCRNN  239

Query  775   LSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINN---VNK  945
             LSCV +IN+AV  FN  +  ++D LN  L  A+FI +N T ++ GDPS++G ++   V+ 
Sbjct  240   LSCVTNINNAVLPFNAGLVSLVDQLNRELNDARFIYLNSTGMSSGDPSVLGKSSNLVVDV  299

Query  946   ACCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMD  1125
              CC     ++ GQC +   PC NR EY+FWD  H TE  N  TA RSY A LP+DAYP D
Sbjct  300   GCC---PARSDGQCIQDSTPCQNRTEYVFWDAIHPTEALNQFTARRSYNAFLPSDAYPTD  356

Query  1126  ISSLL  1140
             IS L+
Sbjct  357   ISHLI  361



>ref|XP_007212968.1| hypothetical protein PRUPE_ppa021115mg [Prunus persica]
 gb|EMJ14167.1| hypothetical protein PRUPE_ppa021115mg [Prunus persica]
Length=357

 Score =   362 bits (928),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 175/360 (49%), Positives = 248/360 (69%), Gaps = 11/360 (3%)
 Frame = +1

Query  76    VWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPD  255
             +W  +  +L++F+S   +  E +VPC+FIFGDSL DNGNNN+L T AKANYLPYGIDFP 
Sbjct  8     IWTLMIVVLVVFISQSCVHGESRVPCFFIFGDSLADNGNNNHLKTPAKANYLPYGIDFPK  67

Query  256   GPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMG  435
             GPTGRF+NG+   D +AE LGF + IP ++     + +++G+NYASG+ G+ DE+GTHMG
Sbjct  68    GPTGRFTNGRTFVDIVAELLGFENPIPCFATTRRPKDMVRGLNYASGSAGLRDETGTHMG  127

Query  436   EVISMDQQLVNHGLTLARIALYMKGYRAA-RYYLNKCFYSVGMGNNDYINNYLMPQKYPS  612
               +++++QL+NH  T+  IA  M   +++ ++YLNKC YSVGMG+NDY+NNY  P+ YP+
Sbjct  128   ANVNLNKQLLNHKATVKHIASVMGHKQSSNKHYLNKCLYSVGMGSNDYMNNYFQPKFYPT  187

Query  613   SRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDS  792
             S  Y P+Q+A LL K++  Q+K L+  GARKVA+ G G +GC P  + T  NGS +CVD 
Sbjct  188   STKYNPEQYATLLIKQYSRQIKTLYMYGARKVALVGLGQVGCAPYSISTGTNGS-ACVDK  246

Query  793   INSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACCQVSKTK  972
             +N AVQ FN+++K ++D LN +L  AKFI +N      G    + +++VN  CC V++  
Sbjct  247   MNDAVQFFNEKLKSLVDQLNTNLTDAKFIYVN----TYGMSGRLKVSDVN--CCPVNEI-  299

Query  973   AKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQLNL  1152
               GQC     PC NR+E+MFWD FH TE+ NL TA R+Y ++  +D YPM+I  L +L L
Sbjct  300   --GQCVPSAAPCKNRSEHMFWDLFHPTEMANLVTARRAYNSSNQSDTYPMNIGHLAKLRL  357



>ref|XP_008225429.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Prunus mume]
Length=675

 Score =   371 bits (952),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 177/365 (48%), Positives = 251/365 (69%), Gaps = 7/365 (2%)
 Frame = +1

Query  76    VWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPD  255
             +W  +  +L++F+S   +  E QVPC+FIFGDSL DNGNNN+L T AKANYLPYGIDFP 
Sbjct  8     IWTLMIVVLVVFISQSCVHGESQVPCFFIFGDSLADNGNNNHLKTPAKANYLPYGIDFPK  67

Query  256   GPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMG  435
             GPTGRF+NG+   D +AE LGF + IP ++     + +++G+NYASG+ G+ DE+GTHMG
Sbjct  68    GPTGRFTNGRTFVDIIAELLGFENPIPCFATTRRPKDMVRGLNYASGSAGLRDETGTHMG  127

Query  436   EVISMDQQLVNHGLTLARIALYMKGYRAA-RYYLNKCFYSVGMGNNDYINNYLMPQKYPS  612
               +++++QL+NH  T+  IA  M   +++ ++YLNKC YSVGMG+NDY+NNY  P+ YP+
Sbjct  128   ANVNLNKQLLNHKATVKHIASVMGHKQSSNKHYLNKCLYSVGMGSNDYMNNYFQPKFYPT  187

Query  613   SRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDS  792
             S  YTP+Q+A LL K++  Q+K L+  GARKVA+ G G +GC P  + T  NGS +CVD 
Sbjct  188   STKYTPEQYATLLIKQYSRQIKTLYMYGARKVALVGLGQVGCAPYSISTGTNGS-ACVDK  246

Query  793   INSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL--ALGDPSIIGINNVNKACCQVSK  966
             +N AVQ FN+++K ++D LN +L  AKFI +N   +  +  D +  G+   +  CC V++
Sbjct  247   MNDAVQFFNEKLKSLVDQLNTNLTDAKFIYVNTYGMSGSSADRTTTGLKVSDVNCCPVNE  306

Query  967   TKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
                 GQC     PC NR+E+MFWD FH TE+ NL TA R+Y ++ P+D YPM+I  L +L
Sbjct  307   I---GQCVPSAAPCKNRSEHMFWDLFHPTEMANLVTARRAYNSSNPSDTYPMNIGHLAKL  363

Query  1147  NLQAK  1161
              L  +
Sbjct  364   RLSPQ  368


 Score =   307 bits (787),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 163/347 (47%), Positives = 222/347 (64%), Gaps = 33/347 (10%)
 Frame = +1

Query  118   LKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNLAD  297
             L  L   PQVPC+FIFGDSLVD+GNNN L T AK NYLPYG+DFP G TGRF NG+   D
Sbjct  360   LAKLRLSPQVPCFFIFGDSLVDSGNNNYLPTLAKVNYLPYGVDFPIGATGRFCNGRTSVD  419

Query  298   YLAEFLGFNSSIPPYSAVTTTEGL--LKGVNYASGAGGILDESGTHMGEVISMDQQLVNH  471
              LAE LGF   IPP++   TT GL  L+G+NYASGA GI  ESGT MG  +++DQQL NH
Sbjct  420   ILAELLGFKKPIPPFA---TTWGLVILRGLNYASGAAGIRAESGTEMGVNVNLDQQLRNH  476

Query  472   GLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELL  651
              +T+ RIA  ++    A  YLNKCFY +G+GNNDYINNY   Q + +SR+YT +Q+A +L
Sbjct  477   HVTVLRIASILRHKALALKYLNKCFYFMGIGNNDYINNYFQTQYFNTSRIYTLEQYASVL  536

Query  652   AKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMFNDRMK  831
              +++  Q+  L+  GARKVA+ G                     V  I +A + FN++++
Sbjct  537   IEQYSQQIMTLYRYGARKVALVG---------------------VAPIGNATEPFNEKLR  575

Query  832   PIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQVPCS  1011
              ++D LN  L+ A+FI +N +S++   P+   + N+  +CC V++    G C   Q  C 
Sbjct  576   ALVDKLNADLQDAQFIYVNASSVS--RPADFKVPNI--SCCAVNEL---GLCNPFQPVCQ  628

Query  1012  NRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQLNL  1152
             NR++Y  WD+FH TE  N+ +A R+Y +  P+D YPMDIS L+QL+L
Sbjct  629   NRSDYALWDSFHPTEAANIASAGRAYRSQDPSDTYPMDISHLVQLSL  675



>ref|XP_002266118.1| PREDICTED: GDSL esterase/lipase At5g45670 [Vitis vinifera]
 emb|CBI30765.3| unnamed protein product [Vitis vinifera]
Length=365

 Score =   360 bits (923),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 174/366 (48%), Positives = 239/366 (65%), Gaps = 4/366 (1%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPY  237
             MAS +K W  +  +++       + A+PQVPCYFIFGDSLVDNGNNN +++ A+ANYLPY
Sbjct  1     MASELKQWCMVCAVVVALSWGCWVEADPQVPCYFIFGDSLVDNGNNNGIASLARANYLPY  60

Query  238   GIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDE  417
             GIDFP GPTGRFSNGK   D +AE LGF++ IPPYS+    E +LKGVNYAS A GI DE
Sbjct  61    GIDFPQGPTGRFSNGKTTVDVIAELLGFDNYIPPYSSARG-EDILKGVNYASAAAGIRDE  119

Query  418   SGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMP  597
             +G  +G  ISM+ QL N+  T++++   +     A  YL+KC YS+G+G+NDY+NNY MP
Sbjct  120   TGQQLGGRISMNGQLRNYQTTVSQVVSILGDEDTAANYLSKCIYSLGLGSNDYLNNYFMP  179

Query  598   QKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSL  777
             Q Y +SR YTP+Q+A++L +++  Q++ L+  GARKV + G G +GC P E+  +     
Sbjct  180   QYYSTSRQYTPEQYADVLIQQYAQQIRTLYNYGARKVVLIGVGQIGCSPNELAQNSPDGT  239

Query  778   SCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKA  948
             +C++ IN A ++FNDR+K ++ +LN +    +FI IN   +    +  PS  G    N  
Sbjct  240   TCIERINYANRLFNDRLKSLVGELNNNFPDGRFIYINAYGIFQDLISSPSSYGFRVTNAG  299

Query  949   CCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDI  1128
             CC V +   +  C   Q PC NRNEY+FWD FH  E  N+    RSY+A   +DAYP+DI
Sbjct  300   CCGVGRNNGQITCLPFQTPCQNRNEYLFWDAFHPGEAANVVIGRRSYSAQSSSDAYPIDI  359

Query  1129  SSLLQL  1146
              SL QL
Sbjct  360   RSLAQL  365



>gb|ABK94783.1| unknown [Populus trichocarpa]
Length=360

 Score =   358 bits (919),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 182/363 (50%), Positives = 234/363 (64%), Gaps = 6/363 (2%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLKPLV-AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLP  234
             M   +KVW  +  LL +  +L+    A PQVPC+FIFGDSL D+GNNNNL T AKANY P
Sbjct  1     MTDKIKVWCFLLFLLKLVSNLQNCAHAAPQVPCFFIFGDSLADSGNNNNLVTAAKANYRP  60

Query  235   YGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILD  414
             YGIDFP+G TGRF+NG+   D + E LGFN  IPP+ A      +L GVNYASG+ GI D
Sbjct  61    YGIDFPNGTTGRFTNGRTTVDIIGELLGFNQFIPPF-ATARGRDILVGVNYASGSAGIRD  119

Query  415   ESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLM  594
             ESG  +G+ IS+++QL NH  T  R    +   +AA  YLNKC Y V +G NDY+NNY M
Sbjct  120   ESGRQLGDRISLNEQLQNHAATFNRSIQLLGTKQAAENYLNKCLYYVSLGRNDYLNNYFM  179

Query  595   PQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGS  774
             P  Y +SRLYTPDQ+A++L  ++  Q+K L+ LGARK+A+ G G +G IP    T    +
Sbjct  180   PSNYTTSRLYTPDQYAKVLIDQYSQQIKLLYHLGARKIALHGLGAIGSIPYSFSTLCRNN  239

Query  775   LSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTS-LALGDPSIIGINNVNKAC  951
             LSCV + N+AV  FN  +  ++D LN  L  A+FI +N T  L+ GDPS++G    N  C
Sbjct  240   LSCVTNKNNAVLPFNAGLVSLVDQLNRELNDARFIYLNSTGILSSGDPSVLGFRVTNVEC  299

Query  952   CQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDIS  1131
             C     ++ G+C +   PC NR EY+FWD  H TE  N  TA RSY A LP+DAYP DIS
Sbjct  300   C---PARSDGRCIQDSTPCQNRTEYVFWDAVHPTEAMNQVTARRSYNAFLPSDAYPTDIS  356

Query  1132  SLL  1140
              L+
Sbjct  357   HLI  359



>ref|XP_002522289.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF40147.1| zinc finger protein, putative [Ricinus communis]
Length=381

 Score =   357 bits (915),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 175/366 (48%), Positives = 243/366 (66%), Gaps = 5/366 (1%)
 Frame = +1

Query  73    KVWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFP  252
             K+W+ +  ++L  L +       QVPCYFIFGDSL DNGNNN L T AK NY PYGIDFP
Sbjct  12    KLWWVVVVVVLPALFIMGAEGHGQVPCYFIFGDSLADNGNNNLLETLAKVNYPPYGIDFP  71

Query  253   DGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHM  432
              GPTGRFSNG+   D +AE LGF++ IPP+++V  T+ +L GVNYASG+ GIL+E+G  +
Sbjct  72    FGPTGRFSNGRTTVDVIAEVLGFDNFIPPFASVNGTD-ILFGVNYASGSAGILNETGQQL  130

Query  433   GEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPS  612
             GE I +D QL NH   + R+   +    AA +YL+KC Y+VG+GNNDYINNY +PQ Y +
Sbjct  131   GERIPLDMQLENHRTIVLRLVEILGTELAASWYLSKCLYTVGLGNNDYINNYFLPQYYNT  190

Query  613   SRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDS  792
             SR YT  Q+ ELL +++  Q+K LH  GARK+A+FG G +GC P+ + T+G    +CV+ 
Sbjct  191   SRDYTLLQYTELLIEQYTQQIKTLHKYGARKIALFGLGQIGCTPDAISTYGTNGSTCVEI  250

Query  793   INSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACCQVSKTK  972
             +  A  +FN ++K +++ LN ++  AKFI IN  ++   D S++G  N +  CC V+   
Sbjct  251   MEEASLLFNSKLKLVVEQLNANITDAKFIYINYYTIG-ADSSVLGFTNASAGCCPVA---  306

Query  973   AKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQLNL  1152
             + GQC   QVPC NR  Y FWD+FH TE  N+    RSY++  P+DAYP DI +L+ LN 
Sbjct  307   SDGQCIPDQVPCQNRTAYAFWDSFHPTEAVNVYIGLRSYSSLHPSDAYPFDIRNLVMLNQ  366

Query  1153  QAKSDI  1170
             +  + +
Sbjct  367   ETGAAV  372



>ref|XP_006355619.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Solanum tuberosum]
Length=362

 Score =   356 bits (913),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 189/357 (53%), Positives = 254/357 (71%), Gaps = 10/357 (3%)
 Frame = +1

Query  88    IATLLLMFLSLKPLV-AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDG-P  261
             I   + + L+LK  V   PQVPCYFIFGDSL+DNGNNN+L+T AKANY PYG+DF DG P
Sbjct  7     IFATIFVVLNLKTFVEGAPQVPCYFIFGDSLLDNGNNNDLNTTAKANYPPYGVDFQDGRP  66

Query  262   TGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEV  441
             TGRF+NG+N AD+LAE+LGF+  IPPY++V  +E +LKGVNYASG+ GI ++SG+H+G+ 
Sbjct  67    TGRFTNGRNTADFLAEYLGFDHYIPPYASVKDSE-MLKGVNYASGSAGIRNDSGSHLGDR  125

Query  442   ISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRL  621
             I + +QL NH  T++RIA  +    +A+ +LNKC + VG+G+NDYINNYLMP+ YPSS L
Sbjct  126   IYLGRQLENHQATISRIANLVGNTTSAKKHLNKCLFIVGIGSNDYINNYLMPEIYPSSHL  185

Query  622   YTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINS  801
             YTP Q+A  L  ++   L+ L+  GARKVA+FG G +GCIP E++ H   +  CV S N+
Sbjct  186   YTPTQYATALIDQYSQHLRTLYEDGARKVALFGLGKIGCIPAELQKH--DTRRCVSSTNN  243

Query  802   AVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIG-INNVNKACCQVSKTKAK  978
             A+Q FN ++K ++DDLN +   AKF  INM S++    SIIG ++   + CC V +T  +
Sbjct  244   AIQQFNSKLKSLVDDLNTNFPDAKFTYINMYSIS----SIIGPLSVFTRPCCNVLETMPE  299

Query  979   GQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQLN  1149
             GQC  G+ PC  R  Y+F+DNFH TEI N     R+Y A LP+DAYPMDI  L++ N
Sbjct  300   GQCVPGETPCFLRGIYLFYDNFHPTEIANRIATNRAYNALLPSDAYPMDIHHLIRTN  356



>ref|XP_009360952.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Pyrus x bretschneideri]
Length=552

 Score =   361 bits (927),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 174/353 (49%), Positives = 243/353 (69%), Gaps = 6/353 (2%)
 Frame = +1

Query  100   LLMFLSLKP--LVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRF  273
             L   +  KP  ++ +PQVPC+FIFGDS+ D GNNN L T AK NY PYGIDFP GPTGRF
Sbjct  197   LTQLVQGKPQAVLGKPQVPCFFIFGDSVADPGNNNKLPTLAKVNYKPYGIDFPAGPTGRF  256

Query  274   SNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMD  453
              NG+N+ D LAE LGF + IP +++   T+ +L+GVNYASGA GI  ESG  +G  ISM 
Sbjct  257   CNGRNIVDILAELLGFENYIPAFASANGTD-ILQGVNYASGAAGIRKESGKQLGARISMG  315

Query  454   QQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPD  633
             +QL NH  T++RI         A+  LN+C YSVGMG+NDYINNY MPQ Y +S+ YT +
Sbjct  316   EQLKNHRTTVSRIIDIFGKKSLAKNQLNQCLYSVGMGSNDYINNYFMPQYYTTSQKYTLE  375

Query  634   QFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQM  813
             ++A++L K++  Q+ KLH  GARKVA+ G G++GC P+ ++T+G    +CVD +N+A Q+
Sbjct  376   EYADVLIKQYTRQILKLHQYGARKVALVGLGLIGCTPDAIKTYGTNGSACVDIMNNASQI  435

Query  814   FNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACCQVSKTKAKGQCEE  993
             FN ++  ++D+LN +L  ++FI IN   +  GD ++ G   ++  CC+  +    GQC  
Sbjct  436   FNGKLVSLVDELNTNLTDSQFIYINTYGMGSGDATLAGFKVLDAGCCEADEV---GQCVP  492

Query  994   GQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQLNL  1152
                PC NR+EY+FWD+FH TE GNL +A+R+YTA+ P+D YPMD+S L +L +
Sbjct  493   DLTPCQNRSEYVFWDSFHPTEAGNLISASRTYTASEPSDTYPMDMSQLAELQI  545


 Score =   197 bits (502),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 102/208 (49%), Positives = 138/208 (66%), Gaps = 4/208 (2%)
 Frame = +1

Query  118  LKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNLAD  297
            L  L  EPQVPCYFIFGDSLVDNGNNN L + A+A+YLPYG+DF  GPTGRFSNGK   D
Sbjct  14   LGTLWFEPQVPCYFIFGDSLVDNGNNNQLQSLARADYLPYGVDF-GGPTGRFSNGKTTVD  72

Query  298  YLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNHGL  477
             +AE LGF+  IPPY A    + +LKGVN+AS A GI +E+G  +G+ I+   Q+ N+  
Sbjct  73   VVAELLGFDDFIPPY-ATARGQDVLKGVNFASAAAGIREETGRQLGDRITFSGQVKNYQN  131

Query  478  TLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAK  657
            T++++   +     A  YL+KC YSVG+G+NDY+NNY MPQ Y +   +TP+++A+ L  
Sbjct  132  TVSQVVNLLGDEDQAANYLSKCIYSVGLGSNDYLNNYFMPQFYSTGNQFTPEEYADSLIH  191

Query  658  KHYVQLKKLHALGARKVAVFGPGVLGCI  741
             +  QL +L  +  +  AV G   + C 
Sbjct  192  DYGQQLTQL--VQGKPQAVLGKPQVPCF  217



>ref|XP_010046960.1| PREDICTED: GDSL esterase/lipase At5g45670-like [Eucalyptus grandis]
 gb|KCW78679.1| hypothetical protein EUGRSUZ_C00136 [Eucalyptus grandis]
Length=350

 Score =   354 bits (909),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 175/359 (49%), Positives = 244/359 (68%), Gaps = 9/359 (3%)
 Frame = +1

Query  70    VKVWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDF  249
             + +W     L+ + LS + ++  PQVPCYFIFGDSL D+GNNNNL T AK+NY PYGIDF
Sbjct  1     MAIWLF---LVALNLSGRLVLGAPQVPCYFIFGDSLADDGNNNNLLTLAKSNYPPYGIDF  57

Query  250   PDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTH  429
              DG TGRF+NG+ + D +A+ LGF+  IPP++     +  L+GVNYASGA GI DESG  
Sbjct  58    SDGATGRFTNGRTIVDIIAQLLGFDQYIPPFATARGND-TLQGVNYASGAAGIRDESGQQ  116

Query  430   MGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYP  609
              G+ IS+++QL NH +T++R+   + G  +A  YLNKC Y+VGMG+NDY+NNY MP  YP
Sbjct  117   QGDRISLNRQLGNHLITVSRVREILGGNESA--YLNKCIYTVGMGSNDYLNNYFMPNIYP  174

Query  610   SSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVD  789
             +S +YTP+Q+A++L K++  QLK L+  GARKVAV G G+LGC P E+   G    +CVD
Sbjct  175   TSSMYTPEQYADVLIKQYKEQLKTLYGYGARKVAVIGLGLLGCTPAEISRFGTNGSACVD  234

Query  790   SINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACCQVSKT  969
             +IN+A  +FN++++P++++ N +   AKF  IN  +++   P   G+ + N  CC+V   
Sbjct  235   NINNAAVLFNNQLQPLVNEFNSNFSDAKFTYINTFAISTTGPGTAGLIS-NATCCKVD--  291

Query  970   KAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             K  G C   + PCSNR  Y+F+D FH TE  NLG A R+Y A LP+DA P DI +L  +
Sbjct  292   KELGTCIPYETPCSNRTIYVFYDGFHPTETVNLGFAARAYNALLPSDASPYDIRTLAMI  350



>emb|CAN79113.1| hypothetical protein VITISV_007009 [Vitis vinifera]
Length=342

 Score =   352 bits (903),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 179/350 (51%), Positives = 230/350 (66%), Gaps = 9/350 (3%)
 Frame = +1

Query  100   LLMFLSLKPLV-AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFS  276
             +++ L L P V  E QVPC FIFGDS+ DNGNNN L T+AKANY PYGIDFP G TGR  
Sbjct  1     MVLGLDLPPRVYGEQQVPCIFIFGDSMADNGNNNGLVTKAKANYQPYGIDFPTGATGRMI  60

Query  277   NGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQ  456
                      AEFLGFN SI P+ A+     +L+GVNYASGA GI +E+G   G+ ISMD+
Sbjct  61    -------ITAEFLGFNDSIKPF-AIANGRDILEGVNYASGAAGIREETGQQQGDRISMDR  112

Query  457   QLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQ  636
             QL NH   ++RIA  +    A + YL KC Y VGMG+NDY+NNY MP+ Y +S  Y P+Q
Sbjct  113   QLQNHQTIVSRIANMLGNDSATKSYLAKCIYLVGMGSNDYVNNYYMPKFYTTSLEYAPEQ  172

Query  637   FAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMF  816
             +A +L ++  +QL+ L+ LGARKVA+ G G+LGC P+E+ T+G    SCV  IN  VQ F
Sbjct  173   YAIVLIQQFSLQLRTLYGLGARKVALDGLGLLGCTPKELATYGTNGSSCVQFINDEVQFF  232

Query  817   NDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACCQVSKTKAKGQCEEG  996
             NDR++ ++D+LN +L  A FI +N + +   DP++ G   V   CC+V  +   G C   
Sbjct  233   NDRLRLLVDELNSNLTNANFIYVNTSGILSTDPALAGFRVVGAPCCEVGSSDGLGTCLSL  292

Query  997   QVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             + PC NR EY+FWD FH TE  N+ TATRSY A  P DAYP+DI SL QL
Sbjct  293   KAPCLNRAEYVFWDAFHPTEAVNIITATRSYNARSPFDAYPVDIYSLAQL  342



>ref|XP_002316750.2| hypothetical protein POPTR_0011s03110g [Populus trichocarpa]
 gb|EEE97362.2| hypothetical protein POPTR_0011s03110g [Populus trichocarpa]
Length=369

 Score =   353 bits (906),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 177/368 (48%), Positives = 245/368 (67%), Gaps = 7/368 (2%)
 Frame = +1

Query  49    ITLMASGVK-VWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKAN  225
             +T++A  +K +W  +   ++  +       +P VPCYFIFGDSL DNGNNN L T AK +
Sbjct  1     MTMLAHEMKRLWMVLVLFMVFSMWQHCATGDPLVPCYFIFGDSLADNGNNNMLQTLAKVD  60

Query  226   YLPYGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGG  405
             Y PYG+DFP+GP+GRF NG  + D +AE LGF+S IPP++A    + +L GVNYASGA G
Sbjct  61    YAPYGVDFPNGPSGRFCNGLTVVDVIAEILGFHSYIPPFAAAKEAD-ILHGVNYASGAAG  119

Query  406   ILDESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINN  585
             I DE+G  +GE ISM+ QL NH  T+  + + M G  +A   LNKC YSVGMGNNDY+NN
Sbjct  120   IRDETGQELGERISMNMQLQNHHKTVQNL-IGMLGNESALRNLNKCLYSVGMGNNDYLNN  178

Query  586   YLMPQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHG  765
             Y +PQ +P+S  YT +++ +LL +++  QL+ L+ LGARK+ VFG G +GC+P  ++T+G
Sbjct  179   YFLPQYFPTSHEYTLEKYTQLLIEQYSQQLRSLYELGARKLVVFGLGKIGCVPGAIDTYG  238

Query  766   NGSLSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNK  945
                 +CV+ +N+A Q+FN ++ P+ID+LN  L  AK I IN   +   D +++     N 
Sbjct  239   TNGSACVELLNNASQIFNSKLLPVIDELNDDLPDAKIIYINNYKIG-EDSTVLDFKVNNT  297

Query  946   ACCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMD  1125
             ACC  S   A GQC   +VPC NR +YMFWD+FH TEI N+  A RSY+A  P+ AYP D
Sbjct  298   ACCPSS---AIGQCIPDKVPCQNRTQYMFWDSFHPTEIFNIFYAERSYSALDPSYAYPYD  354

Query  1126  ISSLLQLN  1149
             I  L+ L+
Sbjct  355   IRHLISLD  362



>ref|XP_004295410.1| PREDICTED: GDSL esterase/lipase At1g29660-like [Fragaria vesca 
subsp. vesca]
Length=368

 Score =   353 bits (905),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 182/371 (49%), Positives = 241/371 (65%), Gaps = 10/371 (3%)
 Frame = +1

Query  55    LMASGVKVWFAIATLLLMFLSLKPLVA----EPQVPCYFIFGDSLVDNGNNNNLSTEAKA  222
             + ASG+K   A A  L  FLS++   +    +PQVPC+FIFGDSL DNGNNN L T AK 
Sbjct  1     MAASGMKPLVA-AIALSWFLSMQQHSSSANGKPQVPCFFIFGDSLADNGNNNVLDTLAKV  59

Query  223   NYLPYGIDFPDGP-TGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGA  399
             NY PYGIDFP G  TGRFSNG+   D L+E LGF++ IPP++ V  ++ +LKGVNYA GA
Sbjct  60    NYQPYGIDFPGGAATGRFSNGRTTVDVLSELLGFDNYIPPFAFVNGSD-ILKGVNYACGA  118

Query  400   GGILDESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYI  579
              GI  E+G  +G  ISM +QL NH + ++RIA  +   R A  +L+KC YSVG+G+NDYI
Sbjct  119   AGIRKETGKQLGARISMGRQLKNHKIIISRIADILGNKRLAHKHLHKCLYSVGLGSNDYI  178

Query  580   NNYLMPQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMET  759
             NNY +PQ Y +S+ YT  ++AE+L  ++  ++ +L+  GARKVA+ G G++GC P  + +
Sbjct  179   NNYFVPQYYHTSKKYTTAKYAEVLINQYSWEILRLYKYGARKVALVGVGLIGCTPSAISS  238

Query  760   HGNGSLSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNV  939
              G    +CVD++N A Q FN R+  ++D LN +L  AKFI IN   +  GDP+  G    
Sbjct  239   FGTNGSACVDTLNIAAQQFNQRLVSLVDKLNNNLTDAKFIYINSFEMGSGDPAAAGFTVS  298

Query  940   NKACCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYP  1119
             N  CC V++    GQC+    PC NR EY+FWD FH TE  N  TA RSY A    D YP
Sbjct  299   NVGCCAVNEV---GQCKVDHTPCKNRTEYVFWDGFHPTETLNRITAIRSYNAFNFADTYP  355

Query  1120  MDISSLLQLNL  1152
             MDIS L+QL +
Sbjct  356   MDISHLVQLQI  366



>ref|XP_006465152.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Citrus sinensis]
Length=364

 Score =   352 bits (902),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 182/369 (49%), Positives = 249/369 (67%), Gaps = 11/369 (3%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPY  237
             M  G K W  +  ++++    + +    QVPCYFIFGDSL D+GNNN L T+AKANY PY
Sbjct  1     MTRGRKQWHLM--VMILNFHFRWVNGAEQVPCYFIFGDSLFDSGNNNALPTKAKANYPPY  58

Query  238   GIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDE  417
             GIDFP GPTGRFSNG N+AD +A+ LGF+  IP Y A    E +LKGVNYASG GGIL+E
Sbjct  59    GIDFPGGPTGRFSNGLNMADVIAQLLGFDGFIPSY-ASARGEDILKGVNYASGGGGILNE  117

Query  418   SG-THMGEVISMDQQLVNHGLTLARIALYMKGYR-AARYYLNKCFYSVGMGNNDYINNYL  591
             +   ++G V SM+ QL+NH  T++RI   +K  R +   YL+KC Y+VGMGNNDYINNYL
Sbjct  118   TARNNLGFVWSMNHQLLNHQRTVSRIRRVLKRDRKSTAKYLSKCIYTVGMGNNDYINNYL  177

Query  592   MPQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNG  771
             +PQ Y +S +YTP+Q+A +L +++  QLK L+ LGARK+AVFG G++GC P  +  +G  
Sbjct  178   LPQFYTTSHVYTPEQYATVLVRQYSRQLKILYKLGARKIAVFGLGLVGCTPGSVAMYGTS  237

Query  772   SLS-CVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKA  948
             + S CVDSIN AVQ+FN ++ P++D+LN +L+ AKFI +++ +++       G + +N  
Sbjct  238   NSSMCVDSINMAVQIFNKKLIPLVDELNNNLQDAKFIYVDIFNIS--STPTPGNSAINTP  295

Query  949   CCQV---SKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYP  1119
             CC+V   +  +    C      C NR E++FWD  H TE+ N   A RSY+A LP+D YP
Sbjct  296   CCEVGNLTMNEGVSTCTPFGTSCPNRGEHVFWDTTHPTEVANAVLAGRSYSAQLPSDTYP  355

Query  1120  MDISSLLQL  1146
             +DI  L QL
Sbjct  356   IDIRRLAQL  364



>ref|XP_006580187.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Glycine max]
Length=366

 Score =   351 bits (901),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 178/365 (49%), Positives = 241/365 (66%), Gaps = 15/365 (4%)
 Frame = +1

Query  70    VKVWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDF  249
             V ++F  AT +  +     +V +PQVPC FIFGDSL D+GNNNNL T+AK N LPYGIDF
Sbjct  10    VMIFFFSATYMQYYC----VVGKPQVPCLFIFGDSLSDSGNNNNLHTDAKVNNLPYGIDF  65

Query  250   PDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTH  429
             P GPTGRF+NG+   D + E LG  + IPP+ A T    +LKGVNYASGA GI +E+GTH
Sbjct  66    PLGPTGRFTNGRTSVDIITELLGLENFIPPF-ANTGVSDILKGVNYASGAAGIRNETGTH  124

Query  430   MGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYP  609
             +GE IS+  QL NH + +++I   + G   A+++LNKC Y V +G+NDY+NNY +P+ YP
Sbjct  125   LGEDISLGLQLQNHKVIVSQITQKLGGPDQAQHHLNKCLYYVNIGSNDYLNNYFLPEHYP  184

Query  610   SSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVD  789
             SSR Y+P+Q+A  L +++   LK LHALGAR+ A+ G G++GCIP E+  HG     CVD
Sbjct  185   SSRTYSPEQYAVALVQEYARNLKDLHALGARRFALIGLGLIGCIPHEISIHGENGSICVD  244

Query  790   SINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGD------PSIIGINNVNKAC  951
               N A  MFND++KP++D  N  L  AKFI IN   ++L D        + GI+ V   C
Sbjct  245   EENRAALMFNDKLKPVVDRFNKELPDAKFIFINSAVISLRDSKDFNTSKLQGISEV-AVC  303

Query  952   CQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDIS  1131
             C+V      GQC   + PC NRN ++F+D FH +E+ N  +A  +Y A +PT A+PMDIS
Sbjct  304   CKVG---PNGQCIPNEEPCKNRNLHVFFDAFHPSEMTNQLSARSAYNAPIPTLAHPMDIS  360

Query  1132  SLLQL  1146
              L++L
Sbjct  361   HLVKL  365



>gb|KHN06444.1| GDSL esterase/lipase [Glycine soja]
Length=356

 Score =   350 bits (899),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 177/363 (49%), Positives = 240/363 (66%), Gaps = 15/363 (4%)
 Frame = +1

Query  76    VWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPD  255
             ++F  AT +  +     +V +PQVPC FIFGDSL D+GNNNNL T+AK N LPYGIDFP 
Sbjct  2     IFFFSATYMQYYC----VVGKPQVPCLFIFGDSLSDSGNNNNLHTDAKVNNLPYGIDFPL  57

Query  256   GPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMG  435
             GPTGRF+NG+   D + E LG  + IPP+ A T    +LKGVNYASGA GI +E+GTH+G
Sbjct  58    GPTGRFTNGRTSVDIITELLGLENFIPPF-ANTGVSDILKGVNYASGAAGIRNETGTHLG  116

Query  436   EVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSS  615
             E IS+  QL NH + +++I   + G   A+++LNKC Y V +G+NDY+NNY +P+ YPSS
Sbjct  117   EDISLGLQLQNHKVIVSQITQKLGGPDQAQHHLNKCLYYVNIGSNDYLNNYFLPEHYPSS  176

Query  616   RLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSI  795
             R Y+P+Q+A  L +++   LK LHALGAR+ A+ G G++GCIP E+  HG     CVD  
Sbjct  177   RTYSPEQYAVALVQEYARNLKDLHALGARRFALIGLGLIGCIPHEISIHGENGSICVDEE  236

Query  796   NSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGD------PSIIGINNVNKACCQ  957
             N A  MFND++KP++D  N  L  AKFI IN   ++L D        + GI+ V   CC+
Sbjct  237   NRAALMFNDKLKPVVDRFNKELPDAKFIFINSAVISLRDSKDFNTSKLQGISEV-AVCCK  295

Query  958   VSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSL  1137
             V      GQC   + PC NRN ++F+D FH +E+ N  +A  +Y A +PT A+PMDIS L
Sbjct  296   VG---PNGQCIPNEEPCKNRNLHVFFDAFHPSEMTNQLSARSAYNAPIPTLAHPMDISHL  352

Query  1138  LQL  1146
             ++L
Sbjct  353   VKL  355



>ref|XP_006388165.1| hypothetical protein POPTR_0306s00210g [Populus trichocarpa]
 gb|ERP47079.1| hypothetical protein POPTR_0306s00210g [Populus trichocarpa]
Length=362

 Score =   350 bits (898),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 173/359 (48%), Positives = 237/359 (66%), Gaps = 6/359 (2%)
 Frame = +1

Query  73    KVWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFP  252
             ++W  +   ++  +       +P VPCYFIFGDSL DNGNNN L T AK +Y PYG+DFP
Sbjct  3     RLWMVLVLFMVFSMWQHCATGDPLVPCYFIFGDSLADNGNNNMLQTLAKVDYAPYGVDFP  62

Query  253   DGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHM  432
             +GP+GRF NG  + D +AE LGF+S IPP++A    + +L GVNYASGA GI DE+G  +
Sbjct  63    NGPSGRFCNGLTVVDVIAEILGFHSYIPPFAAAKEAD-ILHGVNYASGAAGIRDETGQEL  121

Query  433   GEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPS  612
             GE I M+ QL NH  T+  + + M G  +A   LNKC YSVGMGNNDY+NNY +PQ +P+
Sbjct  122   GERICMNMQLQNHHKTVQNL-IGMLGNESALRNLNKCLYSVGMGNNDYLNNYFLPQYFPT  180

Query  613   SRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDS  792
             S  YT +++ +LL +++  QL+ L+ LGARK+ VFG G +GC+P  ++T+G    +CV+ 
Sbjct  181   SHEYTLEKYTQLLIEQYSQQLRSLYELGARKLVVFGLGKIGCVPGAIDTYGTNGSACVEL  240

Query  793   INSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACCQVSKTK  972
             +N+A Q+FN ++ P+ID+LN  L  AK I IN   +   D +++     N ACC  S   
Sbjct  241   LNNASQLFNSKLLPVIDELNDDLPDAKIIYINNYKIG-EDSTVLDFKVNNTACCPSSTI-  298

Query  973   AKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQLN  1149
               GQC   QVPC NR +YMFWD+FH TEI N+  A RSY+A  P+ AYP DI  L+ L+
Sbjct  299   --GQCIPDQVPCQNRTQYMFWDSFHPTEIFNIFYAERSYSALDPSYAYPYDIRHLISLD  355



>ref|XP_006436361.1| hypothetical protein CICLE_v10031897mg [Citrus clementina]
 gb|ESR49601.1| hypothetical protein CICLE_v10031897mg [Citrus clementina]
Length=364

 Score =   350 bits (897),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 180/369 (49%), Positives = 249/369 (67%), Gaps = 11/369 (3%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPY  237
             M  G K W  +  ++++    + +    QVPCYFIFGDSL D+GNNN L T+AKANY PY
Sbjct  1     MTRGRKQWHLM--VMILNFHFRWVNGAEQVPCYFIFGDSLFDSGNNNALPTKAKANYPPY  58

Query  238   GIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDE  417
             GIDFP GPTGRFSNG N+AD +A+ LGF   IP Y++    + +LKGVNYASG GGIL+E
Sbjct  59    GIDFPGGPTGRFSNGLNMADVIAQLLGFGGFIPSYASARGDD-ILKGVNYASGGGGILNE  117

Query  418   SG-THMGEVISMDQQLVNHGLTLARIALYMKGYR-AARYYLNKCFYSVGMGNNDYINNYL  591
             +   ++G V SM+ QL+NH  T++RI   +K  R +   YL+KC Y+VGMGNNDYINNYL
Sbjct  118   TARNNLGFVWSMNHQLLNHQRTVSRIRRVLKRDRKSTAKYLSKCIYTVGMGNNDYINNYL  177

Query  592   MPQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNG  771
             +PQ Y +S +YTP+Q+A +L +++  QLK L+ LGARK+AVFG G++GC P  +  +G  
Sbjct  178   LPQFYTTSHVYTPEQYATVLVRQYSRQLKILYKLGARKIAVFGLGLVGCTPGSVAIYGTS  237

Query  772   SLS-CVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKA  948
             + S CVDSIN AVQ+FN ++ P++D+LN +L+ AKFI +++ +++       G + +N  
Sbjct  238   NSSMCVDSINMAVQIFNKKLIPLVDELNNNLQDAKFIYVDIFNIS--STPTPGNSAINTP  295

Query  949   CCQV---SKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYP  1119
             CC+V   +  +    C      C NR E++FWD  H TE+ N   A RSY+A LP+D YP
Sbjct  296   CCEVGNLTMNEGVSTCTPFGTSCPNRGEHVFWDTTHPTEVANAVLAGRSYSAQLPSDTYP  355

Query  1120  MDISSLLQL  1146
             +DI  L QL
Sbjct  356   IDIRRLAQL  364



>ref|XP_006465155.1| PREDICTED: GDSL esterase/lipase At1g29660-like [Citrus sinensis]
Length=364

 Score =   349 bits (895),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 186/368 (51%), Positives = 245/368 (67%), Gaps = 13/368 (4%)
 Frame = +1

Query  67    GVKVW-FAIATLLLMFLSLKPLV---AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLP  234
             G K W  A+  +L+M L+L  +     E QVPCYFIFGDSL+DNGNNN L ++ KANYLP
Sbjct  2     GTKTWHLALVIVLMMILNLSTISRVDGEQQVPCYFIFGDSLLDNGNNNALQSKVKANYLP  61

Query  235   YGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILD  414
             YGIDFP GPTGRFSNG+N+AD  AE LGF   IP ++     E +LKGVNYASG  GI D
Sbjct  62    YGIDFPAGPTGRFSNGRNIADITAELLGFVEYIPSFATARGRE-ILKGVNYASGGAGIRD  120

Query  415   ESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLM  594
             E+G ++G VIS  +QL+NH  T++RI   +   ++    L+KC Y+VG+G+NDYINNYLM
Sbjct  121   ETGQNLGTVISFSKQLLNHKTTVSRIVSLLGDEKSTEKNLSKCIYTVGIGSNDYINNYLM  180

Query  595   PQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHG-NG  771
             PQ YP+SRL+ PDQ+A LL +++  QLK L++ GARKVA+FG G +GC P  + T+  NG
Sbjct  181   PQFYPTSRLHMPDQYAALLIEQYSQQLKTLYSYGARKVALFGIGPIGCTPGNIATYDTNG  240

Query  772   SLSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKAC  951
             SL CVD IN AVQ FN R+K ++D+LN +L+ AKFI +N+  ++ G   + G+   N  C
Sbjct  241   SL-CVDFINKAVQEFNIRLKTLVDNLNHNLQDAKFIYVNVYGISSG--PLAGLQGPNP-C  296

Query  952   CQVSKTKAKG---QCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPM  1122
             C V+     G    C     PC  R   +F+D  H TE  NL  A RSY + LP+D +P+
Sbjct  297   CSVANIANNGGILTCIPFSPPCPVRALEVFYDATHPTEAANLVVAGRSYVSLLPSDTHPI  356

Query  1123  DISSLLQL  1146
             DI  L +L
Sbjct  357   DIRQLARL  364



>ref|XP_006449581.1| hypothetical protein CICLE_v10018052mg, partial [Citrus clementina]
 gb|ESR62821.1| hypothetical protein CICLE_v10018052mg, partial [Citrus clementina]
Length=416

 Score =   351 bits (900),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 175/369 (47%), Positives = 239/369 (65%), Gaps = 9/369 (2%)
 Frame = +1

Query  64    SGVKVWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGI  243
             SG   W      + +F    P+  +P VPCYF+FGDSLVD+GNNNNL+T+AK NY PYGI
Sbjct  52    SGCWNWVMAFVFISVFNLQSPVWGKPAVPCYFVFGDSLVDSGNNNNLATDAKVNYWPYGI  111

Query  244   DFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESG  423
             DFP GPTGRF NG+ +AD  AE LGF+  IPP++    +E +LKGVNYASG+ GI DE+G
Sbjct  112   DFPKGPTGRFCNGRTIADVTAERLGFDDYIPPFATANGSE-ILKGVNYASGSAGIRDETG  170

Query  424   THMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQK  603
             +H G  IS+++QL NH +T++RIA ++    +A  +L KC YS  +G+NDYINNY +PQ 
Sbjct  171   SHQGVCISLNKQLKNHKITISRIAGFLGSSHSAHEHLKKCLYSFTIGSNDYINNYFLPQF  230

Query  604   YPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHG-NGSLS  780
             Y SS+LYTP  +A +L++++  QLK LH  GARKV + G G +GC P     +G NGSL 
Sbjct  231   YNSSQLYTPSAYARILSQQYSRQLKTLHRYGARKVTLAGIGAIGCTPNATSYYGTNGSL-  289

Query  781   CVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILIN-MTSLALGDPSIIGINNVNKACCQ  957
             CVD +NSAVQ+FN R+  ++D LN   + +KFI +N +     G P   G N     CC 
Sbjct  290   CVDKMNSAVQLFNKRLVTLVDQLNAKHQDSKFIALNTLVQTPPGFPP--GFNMSTLRCCD  347

Query  958   VSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSL  1137
             V+     G     + PCS R  ++FWD+FH  E+ N+  A +++ +  P+DAYP DI  L
Sbjct  348   VNDF---GLSIRAKSPCSQRATHIFWDSFHPAEVANIIAANKAFHSEAPSDAYPTDIQRL  404

Query  1138  LQLNLQAKS  1164
             +  N +A S
Sbjct  405   VHFNPEAHS  413



>ref|XP_011045705.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Populus euphratica]
Length=365

 Score =   348 bits (894),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 182/369 (49%), Positives = 242/369 (66%), Gaps = 8/369 (2%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLKPLVAE--PQVPCYFIFGDSLVDNGNNNNLSTEAKANYL  231
             MA  +K W+AI  LL +   L+   A   PQ PC+FIFGDSL DNGNNNNL+T AKANY 
Sbjct  1     MACKIKPWYAILVLLNLVSQLQDYCAHAAPQAPCFFIFGDSLADNGNNNNLATVAKANYH  60

Query  232   PYGIDFPD-GPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGI  408
             P+GIDF +   TGRF+NG+   D + E LG +  IP + A      +L GVNYASG  GI
Sbjct  61    PFGIDFLNQTTTGRFTNGRTTVDIIGELLGLDKLIPSF-ATAGGRDILIGVNYASGGAGI  119

Query  409   LDESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNY  588
              DE+G  +G  IS+++QL NH +TL+ +   +    +A  +LNKC Y V MG+NDY+NNY
Sbjct  120   RDETGKQLGGRISLNRQLQNHKVTLSSLIKLLGTRESAANHLNKCLYYVAMGSNDYLNNY  179

Query  589   LMPQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMET-HG  765
              +P  Y +SRLYTP+QFA++L  ++Y QLK+L+ LGARK+A+ G G +G IP        
Sbjct  180   FVPGYYNTSRLYTPEQFAKVLIVQYYKQLKRLYHLGARKIALPGLGPVGSIPYAFSNLCR  239

Query  766   NGSLSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNK  945
             N   +CV +INSA Q+F+ R+  ++D LN  L+ A FI +N + ++ GDPS++G N V+ 
Sbjct  240   NNVATCVANINSAAQVFDARLVLLVDRLNRDLEDAHFIYLNSSGMSSGDPSVLGFNVVDV  299

Query  946   ACCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMD  1125
              CC V   ++ GQC     PC NR EY+FWD FH TE  N  TA RSYTA LP+DAYP D
Sbjct  300   GCCPV---RSDGQCIPNSNPCKNRTEYVFWDAFHPTEALNQFTARRSYTAFLPSDAYPYD  356

Query  1126  ISSLLQLNL  1152
             IS L+Q+ L
Sbjct  357   ISHLVQIKL  365



>ref|XP_002262696.2| PREDICTED: uncharacterized protein LOC100266969 [Vitis vinifera]
Length=1519

 Score =   374 bits (961),  Expect = 4e-112, Method: Composition-based stats.
 Identities = 181/359 (50%), Positives = 237/359 (66%), Gaps = 7/359 (2%)
 Frame = +1

Query  73    KVWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFP  252
             K+W++   L L+       + +PQV CYFI GDSL D+GNNN LST AK NYLPYGIDFP
Sbjct  1167  KIWWSTVLLFLLSNLQHGTLGDPQVSCYFILGDSLSDSGNNNALSTLAKVNYLPYGIDFP  1226

Query  253   DGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHM  432
              GPTGRF NG+ + D +AE LGFNS +PP+ A    E +LKGVNYASG  GI DESG ++
Sbjct  1227  QGPTGRFCNGRTVVDVIAELLGFNSFVPPF-ATAEGEVILKGVNYASGGSGIRDESGQNL  1285

Query  433   GEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPS  612
             G+ ISM++QL N+  T+++I   +    AA  +LNKC ++VG+G+NDYINNYLMP  YP+
Sbjct  1286  GDRISMNEQLENYQTTVSQINDILGSDSAAATHLNKCLFTVGIGSNDYINNYLMPDLYPT  1345

Query  613   SRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLS-CVD  789
             SRLYTPDQ+AE L +++  QLK L+  GARK+A+FG G++GC P E+ + G    S CVD
Sbjct  1346  SRLYTPDQYAEALIEQYSQQLKTLYGYGARKLALFGLGLIGCAPTELASFGPSPGSNCVD  1405

Query  790   SINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACCQVSKT  969
             +IN AV++FN  +  +IDDLN +   AKF  IN   +   + +  G    N  CC     
Sbjct  1406  TINDAVRLFNTGLVSLIDDLNKNFSDAKFTYINFYEIGSTNLTAFGFKVTNMGCC-----  1460

Query  970   KAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
               +  C     PC NR+EY FWD FH TE  NL    R+Y +  P+DAYP+DIS+L QL
Sbjct  1461  GGQNACLRSSTPCQNRSEYAFWDQFHSTEAVNLIFGQRAYKSQTPSDAYPIDISTLAQL  1519



>ref|XP_006344120.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Solanum tuberosum]
Length=354

 Score =   348 bits (892),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 181/350 (52%), Positives = 250/350 (71%), Gaps = 9/350 (3%)
 Frame = +1

Query  100   LLMFLSLKPLV-AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFS  276
             +L+ L+   LV    +VPCYFIFGDSL+DNGNNNNL+TEAKANY PYGIDFP+GPTGRF+
Sbjct  10    ILIILNFITLVHGASKVPCYFIFGDSLLDNGNNNNLNTEAKANYPPYGIDFPNGPTGRFT  69

Query  277   NGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQ  456
             NG+N+AD L + LGF+  IPP+++ T  E +L+GVNYASG+ GI +E+G+H+G  I +D 
Sbjct  70    NGRNMADILGQLLGFDDYIPPFASATGRE-ILQGVNYASGSAGIRNETGSHLGNRIFLDL  128

Query  457   QLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQ  636
             QL NH  T+ R+   +    A   +LN C Y VG+G+NDYINNYL+P+ Y ++ +YTP Q
Sbjct  129   QLQNHHNTILRMVDLVGNRVATNAHLNTCLYIVGIGSNDYINNYLVPKHYSTNSMYTPSQ  188

Query  637   FAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMF  816
             +A LL +++  QLK L+  GARK+A+FG   +GCIP+E++ H   +  CVDS N A+Q+F
Sbjct  189   YATLLVQQYAQQLKTLYEDGARKIALFGLPQIGCIPQELQKH--NTRKCVDSTNEAIQLF  246

Query  817   NDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIG-INNVNKACCQVSKTKAKGQCEE  993
             N+++K ++ DLN +   AKF  INM S++    SI+  ++ +N  CC VS T A+GQC  
Sbjct  247   NEKLKSLVTDLNTNFPQAKFTYINMYSIS----SIMSTLSFLNYPCCNVSTTTAEGQCVS  302

Query  994   GQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQ  1143
             GQ PC  R  ++FWDNFH TE GN+    R+Y + LP+D+YPMDIS L+Q
Sbjct  303   GQAPCHLRAAHVFWDNFHPTENGNVIAIMRAYNSFLPSDSYPMDISHLIQ  352



>ref|XP_006387682.1| hypothetical protein POPTR_0679s00220g [Populus trichocarpa]
 gb|ERP46596.1| hypothetical protein POPTR_0679s00220g [Populus trichocarpa]
Length=369

 Score =   348 bits (893),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 177/368 (48%), Positives = 241/368 (65%), Gaps = 7/368 (2%)
 Frame = +1

Query  49    ITLMASGVK-VWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKAN  225
             +T++A  +K  W A+   L+          +P VPCYFIFGDSL DNGNNN L T AK +
Sbjct  1     MTMLAHEMKRQWMALVLFLVFSKWQHCATGDPLVPCYFIFGDSLADNGNNNMLQTLAKVD  60

Query  226   YLPYGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGG  405
             Y PYG+DFP+GP+GRF NG  + D +AE LGF+S IPP++A    + +L GVNYASGA G
Sbjct  61    YAPYGVDFPNGPSGRFCNGLTVVDVIAEILGFHSYIPPFAAANEAD-ILHGVNYASGAAG  119

Query  406   ILDESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINN  585
             I DE+G  +GE ISM+ QL NH  T+  + + M G  +A   LNKC YSVGMGNNDY+NN
Sbjct  120   IRDETGQELGERISMNVQLQNHHKTVQNL-IGMLGNDSALRNLNKCLYSVGMGNNDYLNN  178

Query  586   YLMPQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHG  765
             Y +PQ +P+S  YT +++ +LL +++  QL+ L+ LGARK+ VFG G +GC+P  ++T+G
Sbjct  179   YFLPQYFPTSHEYTLEKYTQLLIEQYSQQLRSLYELGARKLVVFGLGKIGCVPGAIDTYG  238

Query  766   NGSLSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNK  945
                 +CV+ +N+A Q+FN ++  +ID LN  L  AK I IN   +   D +++     N 
Sbjct  239   TNGSACVELLNNASQLFNSKLVSVIDQLNDGLPDAKIIYINNYKIG-EDSTVLDFKVNNT  297

Query  946   ACCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMD  1125
              CC    + A GQC   QVPC NR +YMFWD+FH TEI N+  A RSY+A  P+ AYP D
Sbjct  298   GCC---PSSAIGQCIPDQVPCQNRTQYMFWDSFHPTEIFNIFCAERSYSALDPSYAYPYD  354

Query  1126  ISSLLQLN  1149
             I  L+ L+
Sbjct  355   IRHLISLD  362



>ref|XP_007159508.1| hypothetical protein PHAVU_002G243500g [Phaseolus vulgaris]
 gb|AGV54372.1| GDSL esterase/lipase [Phaseolus vulgaris]
 gb|AHA84183.1| GDSL esterase/lipase [Phaseolus vulgaris]
 gb|ESW31502.1| hypothetical protein PHAVU_002G243500g [Phaseolus vulgaris]
Length=365

 Score =   347 bits (891),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 173/357 (48%), Positives = 231/357 (65%), Gaps = 4/357 (1%)
 Frame = +1

Query  85    AIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPT  264
             ++  L+L+      + A PQVPCYFIFGDSLVDNGNNN L + A+A+YLPYGIDFP GP+
Sbjct  10    SMLALVLVLGLWNGVHAAPQVPCYFIFGDSLVDNGNNNQLQSLARADYLPYGIDFPGGPS  69

Query  265   GRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVI  444
             GRFSNGK   D +AE LGF+  IPPY A  + + +LKGVNYAS A GI +E+G  +G  I
Sbjct  70    GRFSNGKTTVDGIAELLGFDDFIPPY-AEASGDAVLKGVNYASAAAGIREETGQQLGGRI  128

Query  445   SMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLY  624
             S   Q+ N+  T++++   +    +A  YL+KC YS+G+G+NDY+NNY MPQ Y SSR Y
Sbjct  129   SFSGQVQNYQNTVSQVVNLLGDEDSAANYLSKCIYSIGLGSNDYLNNYFMPQFYTSSREY  188

Query  625   TPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSA  804
             TPDQFA++L   +  QLK L+  GARK+ +FG G +GC P E+  +     +CVD IN+A
Sbjct  189   TPDQFADVLIGAYTDQLKTLYNYGARKMVLFGLGQIGCSPNELARNSPDGNTCVDRINNA  248

Query  805   VQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKA  975
              QMFN R+K + D  N  +  A+ I IN   +    + +P+  G + +N  CC V +   
Sbjct  249   NQMFNTRLKTLTDQFNNQMPDARVIYINSFGIFQDVISNPAAYGFSVINAGCCGVGRNNG  308

Query  976   KGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             +  C   Q PC NR EY+FWD FH TE GNL  A R+Y+A   +DAYP DI  L Q+
Sbjct  309   QITCLPMQTPCPNRREYLFWDAFHPTEAGNLIVAQRAYSAQSASDAYPFDIQHLAQI  365



>ref|XP_010273430.1| PREDICTED: GDSL esterase/lipase At4g18970-like [Nelumbo nucifera]
Length=365

 Score =   347 bits (891),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 171/369 (46%), Positives = 237/369 (64%), Gaps = 15/369 (4%)
 Frame = +1

Query  49    ITLMASGVKVWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANY  228
             + L A GV +W             + + AE +VPCYFIFGDSLVD+GNNN LS+ A+A+Y
Sbjct  9     LVLAAGGVNLWGG-----------RVVQAEAEVPCYFIFGDSLVDDGNNNQLSSLARADY  57

Query  229   LPYGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGI  408
             +PYGIDF  GPTGRF NGK   D +A+ LGF+  IPPY A T  + LLKGVN+AS A GI
Sbjct  58    MPYGIDFDGGPTGRFRNGKTTTDVIAQLLGFDDYIPPY-ATTGGQDLLKGVNFASAAAGI  116

Query  409   LDESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNY  588
              DE+G H G+ ISM++Q+ N+    ++I   +    +A+ +L+KC ++VGMG+NDY+NNY
Sbjct  117   RDETGRHFGDRISMNRQVRNYQSVFSQIVEILGDEASAKDHLSKCIFTVGMGSNDYLNNY  176

Query  589   LMPQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGN  768
              MP  Y +S+ YTP+Q+A+ L +++  QLK L+  GARKV++FG G +GC P E+  +  
Sbjct  177   FMPLYYTTSQEYTPEQYADALIQEYTGQLKTLYNYGARKVSLFGVGQIGCTPNELAKNSP  236

Query  769   GSLSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNV  939
               ++CVD IN A QMFN+++K +++D N +L G KF  IN   +    L +PS  G    
Sbjct  237   NGVTCVDRINVANQMFNNKLKALVNDFNNNLVGTKFTYINANGIFEDMLKNPSAYGFTVT  296

Query  940   NKACCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYP  1119
             N  CC + +   +  C   Q PC NRN+Y+FWD FH TE  N+    RSY A   +DAYP
Sbjct  297   NTGCCGMGQNNGQITCLPLQTPCQNRNQYLFWDAFHPTEAANVIVGGRSYRAQSSSDAYP  356

Query  1120  MDISSLLQL  1146
             +DI  L +L
Sbjct  357   VDIQHLARL  365



>ref|XP_006388932.1| hypothetical protein POPTR_0073s00230g [Populus trichocarpa]
 gb|ERP47846.1| hypothetical protein POPTR_0073s00230g [Populus trichocarpa]
Length=353

 Score =   347 bits (889),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 181/363 (50%), Positives = 236/363 (65%), Gaps = 13/363 (4%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLKPLV-AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLP  234
             MA  +KVW  +  LL +  +L+    A PQVPC+FIFGDSL D+GNNNNL T AKANY P
Sbjct  1     MADKIKVWCFLLVLLKLVSNLQNCAHAAPQVPCFFIFGDSLADSGNNNNLVTAAKANYRP  60

Query  235   YGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILD  414
             YGIDFP+G TGRF+NG++  D + E LGFN  IPP+ A      +L GVNYASG+ GI D
Sbjct  61    YGIDFPNGTTGRFTNGRSTVDIIGELLGFNQFIPPF-ATARGRDILVGVNYASGSAGIRD  119

Query  415   ESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLM  594
             E+G+ +GE IS+++QL NH  T  R    +   +AA  YLNKC Y V +G+NDY+NNY M
Sbjct  120   ETGSQLGERISLNEQLQNHAATFNRSIQLLGTKQAAENYLNKCLYYVSLGSNDYLNNYFM  179

Query  595   PQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGS  774
             P  Y +SRLYTPDQ+A++L  ++  Q+K L+ LGARK+A+ G G +G +P    T    +
Sbjct  180   PSNYTTSRLYTPDQYAKVLIDQYSQQIKLLYHLGARKIALPGLGPMGSLPYASSTLCPNN  239

Query  775   LSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTS-LALGDPSIIGINNVNKAC  951
             LSCV +IN+AV  FN  +  ++D LN  L  A+FI +N T  L+ GDPS++G    N  C
Sbjct  240   LSCVTNINNAVLPFNAGLVSLVDQLNRELNDARFIYLNSTGILSSGDPSVLGFRVTNVGC  299

Query  952   CQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDIS  1131
             C     ++ G+C+       NR EYMFWD  H TE     TA RSY A LP+DAYP DIS
Sbjct  300   C---PARSDGRCQ-------NRTEYMFWDAIHCTEALYQLTARRSYNAFLPSDAYPTDIS  349

Query  1132  SLL  1140
              L+
Sbjct  350   HLI  352



>gb|KEH33152.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=370

 Score =   347 bits (890),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 172/364 (47%), Positives = 238/364 (65%), Gaps = 7/364 (2%)
 Frame = +1

Query  70    VKVWFAIATLLLMFLSL--KPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGI  243
             VK    +  ++++ L L    + A+PQVPCYFIFGDSLVD+GNNNNL++ AKANYLPYGI
Sbjct  9     VKWIMNLCVMMVVVLGLWSSKVEADPQVPCYFIFGDSLVDDGNNNNLNSLAKANYLPYGI  68

Query  244   DFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESG  423
             DF  GPTGRFSNGK   D +AE LGF   I PYS     E +L+GVNYAS A GI +E+G
Sbjct  69    DFNGGPTGRFSNGKTTVDVIAELLGFEGYISPYSTARDQE-ILQGVNYASAAAGIREETG  127

Query  424   THMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQK  603
               +G+ IS   Q+ N+  T++++   +     A  YL+KC YS+G+G+NDY+NNY MP  
Sbjct  128   QQLGDRISFSGQVQNYQKTVSQVVNLLGDEDTASNYLSKCIYSIGLGSNDYLNNYFMP-A  186

Query  604   YPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSC  783
             YPS R +TP Q+A++L + +  QL+ L+  GARK+A+FG G +GC P E+  +     +C
Sbjct  187   YPSGRQFTPQQYADVLIQAYAQQLRILYNYGARKMALFGIGQIGCSPNELAQNSPDGTTC  246

Query  784   VDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKACC  954
             V+ INSA Q+FN+ +K +++ LN  L  A+FI +N   +    + +PS  GI   N+ CC
Sbjct  247   VERINSANQLFNNGLKSLVNQLNNELTDARFIYVNTYGIFQDIINNPSSFGIRVTNEGCC  306

Query  955   QVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISS  1134
              + +   +  C   Q PCSNRNEY+FWD FH TE+GN     R+Y A   +DAYP+DI+ 
Sbjct  307   GIGRNNGQITCLPLQTPCSNRNEYLFWDAFHPTEVGNTIIGRRAYNAQSESDAYPIDINR  366

Query  1135  LLQL  1146
             L Q+
Sbjct  367   LAQI  370



>ref|XP_006465154.1| PREDICTED: GDSL esterase/lipase At1g29660-like [Citrus sinensis]
Length=367

 Score =   347 bits (889),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 183/369 (50%), Positives = 248/369 (67%), Gaps = 12/369 (3%)
 Frame = +1

Query  67    GVKVWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGID  246
             G+KV   + +L+LM LS K +    QVPCYFIFGDSL DNGNNN LST+AKANY PYGID
Sbjct  2     GLKVCHLVLSLILMDLS-KWVNGAEQVPCYFIFGDSLWDNGNNNALSTKAKANYPPYGID  60

Query  247   FPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTT--EGLLKGVNYASGAGGILDES  420
             FP+G TGRF+NG+N+ D LA+ LGF + IP ++  +    + +L+GVNYASG  GI +E+
Sbjct  61    FPEGATGRFTNGRNMGDILAQLLGFENFIPSFAHASNAKDQEILRGVNYASGGAGIRNET  120

Query  421   G-THMGEVISMDQQLVNHGLTLARIALYM-KGYRAARYYLNKCFYSVGMGNNDYINNYLM  594
                ++G VISMD QL NH  T +RIA  +    ++A  +L+KC YSVG+GNNDYINNYL+
Sbjct  121   ARNNLGPVISMDMQLQNHQNTASRIAKILGNSKKSAAKHLSKCIYSVGIGNNDYINNYLL  180

Query  595   PQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGS  774
             PQ YP++  YTPDQ+A +L +++  QLK L+  GARKVA+FG G++GC P  +  +GNG+
Sbjct  181   PQFYPTNSSYTPDQYATVLIQQYSRQLKTLYNFGARKVALFGLGLIGCTPGSIAMYGNGT  240

Query  775   LSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACC  954
              SCV+ IN+ VQMFN ++  ++D+LN + +  KFI +N +S++   P+ + IN     CC
Sbjct  241   -SCVEYINNEVQMFNTKLVSLVDELNNNFQDTKFIYVNTSSVSSSIPATV-IN--TSPCC  296

Query  955   QVSKTKAKG---QCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMD  1125
             +V    A      C      C NR E++ WD  H TE   +  A RSY A LP+D YP+D
Sbjct  297   EVGNLTANNGVLTCIPSGTACPNRAEHIMWDAAHPTEAAYVMMAERSYKAQLPSDTYPID  356

Query  1126  ISSLLQLNL  1152
             I  L QLNL
Sbjct  357   IHHLAQLNL  365



>ref|XP_008439698.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Cucumis melo]
Length=375

 Score =   347 bits (889),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 176/352 (50%), Positives = 223/352 (63%), Gaps = 5/352 (1%)
 Frame = +1

Query  100   LLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSN  279
             +  F S      +PQVPCYFIFGDSLVDNGNNN LS+ A+A+YLPYGIDFP GPTGRFSN
Sbjct  26    VTAFSSSSNAQQQPQVPCYFIFGDSLVDNGNNNRLSSLARADYLPYGIDFPRGPTGRFSN  85

Query  280   GKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQ  459
             GK   D +AE LGFN  IPPYS  T    +L+GVNYAS A GI +E+G  +G  IS   Q
Sbjct  86    GKTTVDVIAELLGFNGYIPPYSN-TRGRDILRGVNYASAAAGIREETGQQLGGRISFSGQ  144

Query  460   LVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQF  639
             + NH   + +I   +    AA  YLNKC YSVG+G+NDY+NNY MP  Y SSR Y+PDQ+
Sbjct  145   VRNHQNIVRQIVNILGDQNAAADYLNKCIYSVGLGSNDYLNNYFMPLIYSSSRQYSPDQY  204

Query  640   AELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMFN  819
             A++L +++  QL  L+  GARK A+FG G +GC P  + +  +G  SC    N A QMFN
Sbjct  205   AQILIQQYTQQLSILYDNGARKFALFGVGQIGCSPNALASSPDGR-SCNQRYNFANQMFN  263

Query  820   DRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKAKGQCE  990
             +R+K ++D LN     A+FI I+   +    +  PS  G    N  CC + +   +  C 
Sbjct  264   NRLKSLVDQLNRDQPDARFIYIDSYGIFQDIINSPSSFGFRVTNAGCCGIGRNNGQITCL  323

Query  991   EGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
               Q PCSNR EY+FWD FH TE GN     R+Y+A  P+DAYP+DI  L QL
Sbjct  324   PFQTPCSNRREYLFWDAFHPTEAGNTIVGRRAYSAQRPSDAYPIDIRRLAQL  375



>gb|AFK47139.1| unknown [Lotus japonicus]
Length=348

 Score =   345 bits (886),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 169/338 (50%), Positives = 228/338 (67%), Gaps = 7/338 (2%)
 Frame = +1

Query  142   QVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNLADYLAEFLGF  321
             QVPC FIFGDSL D+GNNNNL T+A+ NY PYGIDFP GPTGRF+NG+ + D + + LGF
Sbjct  15    QVPCLFIFGDSLSDSGNNNNLRTDARVNYYPYGIDFPAGPTGRFTNGRTVIDIITQLLGF  74

Query  322   NSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNHGLTLARIALY  501
                IPP+   T+   +L+GVNYASGA GI +ESGTHMG  I  +QQL NH   +++IA  
Sbjct  75    EKFIPPFRD-TSGSDILQGVNYASGAAGIRNESGTHMGPDICWEQQLSNHKAIISKIAKK  133

Query  502   MKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAKKHYVQLKK  681
             + G   A+ +LNKC Y V +G+NDYINNY MP+ Y SSR YTP Q+A++L +++  Q+  
Sbjct  134   LGGNDKAQQHLNKCLYYVNIGSNDYINNYFMPEHYSSSRTYTPSQYAQVLRRQYSKQINA  193

Query  682   LHALGARKVAVFGPGVLGCIPEEMETHGN-GSLSCVDSINSAVQMFNDRMKPIIDDLNG-  855
             LH  GARK A+ G  ++GCIP ++E HG  GS  CV+  N AV +FND +K ++D  N  
Sbjct  194   LHKTGARKFALTGLSLVGCIPRQIELHGRKGSSKCVEEENEAVVIFNDNIKSLVDQFNND  253

Query  856   -SLKGAKFILINMTSLALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQVPCSNRNEYMF  1032
              SLK AKFI IN   ++  +P + G+ ++   CC+V      GQC   + PC +RN ++F
Sbjct  254   LSLKNAKFIYINNALISSDNPLLPGMRSITAKCCEVGDN---GQCVPDKKPCVHRNLHLF  310

Query  1033  WDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             WD+FH TEI N   A  ++ A+ P+  +PMDISSL +L
Sbjct  311   WDSFHPTEIANQILAKLAFRASFPSITHPMDISSLAKL  348



>ref|XP_010095106.1| GDSL esterase/lipase [Morus notabilis]
 gb|EXB58272.1| GDSL esterase/lipase [Morus notabilis]
Length=351

 Score =   345 bits (886),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 165/338 (49%), Positives = 224/338 (66%), Gaps = 3/338 (1%)
 Frame = +1

Query  133   AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNLADYLAEF  312
             AE QVPC+FIFGDSL D+GNNN L+T AK NY PYGID P GPTGRF+NG+   D L E 
Sbjct  10    AEEQVPCFFIFGDSLADSGNNNRLATLAKVNYSPYGIDMPSGPTGRFTNGRTTVDILGEL  69

Query  313   LGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNHGLTLARI  492
             LGF   I P++    T  +L GVNYASG+ GIL+E+G H+GE +   +QL NH + ++++
Sbjct  70    LGFTHFIQPFATADGTNNILDGVNYASGSAGILEETGRHLGENVYFFRQLQNHRIVMSQM  129

Query  493   ALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAKKHYVQ  672
                +      R +LNKC Y VG+G+NDYINNY  PQ Y SS++YTP+QFA LL +++  +
Sbjct  130   GEILGNKELRRRHLNKCLYWVGLGSNDYINNYYSPQFYNSSKIYTPEQFASLLIEQYRRR  189

Query  673   LKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMFNDRMKPIIDDLN  852
             + KL+  GARKVA+ G G +GC P  +  H     +CVD +N+AV+ FN ++  ++D LN
Sbjct  190   ILKLYKYGARKVALAGIGRIGCTPNSLSLHNTNGSACVDHMNNAVEFFNVKLLTLVDQLN  249

Query  853   GSLKGAKFILINMTSLALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQVPCSNRNEYMF  1032
              +L  AKFI IN   +  GDP+ +G       CC V+K    GQC   + PC NR EY+F
Sbjct  250   TNLTDAKFIYINSYGMGGGDPTAVGFKYWKVGCCAVNKV---GQCVPSEKPCENRREYVF  306

Query  1033  WDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             WD+FH TE  N  TA+R Y+A   +D+YPMD++ L+Q+
Sbjct  307   WDSFHPTEALNKITASRIYSAFDLSDSYPMDVNQLIQM  344



>ref|XP_006436372.1| hypothetical protein CICLE_v10033655mg [Citrus clementina]
 gb|ESR49612.1| hypothetical protein CICLE_v10033655mg [Citrus clementina]
Length=350

 Score =   345 bits (886),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 180/354 (51%), Positives = 238/354 (67%), Gaps = 9/354 (3%)
 Frame = +1

Query  97    LLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFS  276
             ++L   ++  +  E QVPCYFIFGDSL+DNGNNN L T  KANYLPYGIDFP GPTGRFS
Sbjct  2     IILNLSTISRVDGEQQVPCYFIFGDSLLDNGNNNALQTNVKANYLPYGIDFPTGPTGRFS  61

Query  277   NGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQ  456
             NG+N+AD  AE +GF   IP ++  +  E +LKGVNYASG  GI DE+G ++G VIS  +
Sbjct  62    NGRNIADITAELMGFVEYIPSFATASCRE-ILKGVNYASGGAGIRDETGQNLGTVISFSK  120

Query  457   QLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQ  636
             QL+NH  T++RI   +   ++    L+KC Y+VG+GNNDYINNYLMPQ YP+SRL+ PDQ
Sbjct  121   QLLNHKTTVSRIVSLLGDEKSTEKNLSKCIYTVGIGNNDYINNYLMPQFYPTSRLHMPDQ  180

Query  637   FAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHG-NGSLSCVDSINSAVQM  813
             +A LL +++  QLK L++ GARKVA+FG G +GC P  + T+  NGSL CVD IN AVQ 
Sbjct  181   YAALLIEQYSQQLKTLYSYGARKVALFGIGPIGCTPANIATYDTNGSL-CVDFINKAVQE  239

Query  814   FNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACCQVSKTKAKG---Q  984
             FN R+K ++D+LN +L+ AKFI +N+  ++ G   + G+   N  CC V+     G    
Sbjct  240   FNTRLKTLVDNLNHNLQDAKFIYVNVYGISSG--PLAGLQGPNP-CCSVANIANNGGILT  296

Query  985   CEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             C     PC  R   +F+D  H TE  NL  A RSY + LP+D +P+DI  L +L
Sbjct  297   CIPFSPPCPVRALEVFYDATHPTEAANLVVAGRSYVSLLPSDTHPIDIRQLARL  350



>ref|XP_004297889.1| PREDICTED: GDSL esterase/lipase At1g29660-like [Fragaria vesca 
subsp. vesca]
Length=373

 Score =   346 bits (887),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 173/341 (51%), Positives = 226/341 (66%), Gaps = 8/341 (2%)
 Frame = +1

Query  139   PQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNLADYLAEFLG  318
             PQ PCYFIFGDSL D+GNNN L T AK NY PYGIDF  GPTGRF NG+NL D +A+ LG
Sbjct  36    PQAPCYFIFGDSLSDSGNNNRLLTLAKVNYHPYGIDFSLGPTGRFCNGRNLVDIIAKLLG  95

Query  319   FNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNHGLTLAR-IA  495
             F+  I P+ A  T + + KGVNYASGA GI DESG + G  IS+++QL+NH + + R +A
Sbjct  96    FDDYISPF-ATATKDDITKGVNYASGAAGIRDESGRNQGMRISLNKQLINHQIIVKRLVA  154

Query  496   LYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAKKHYVQL  675
             L          YL+KC YSVGMG+NDYINNY MP+ Y +SRLYTP+Q+A++L +++  QL
Sbjct  155   LRGNNGSLVADYLSKCIYSVGMGSNDYINNYFMPKLYQTSRLYTPEQYADVLVQEYSQQL  214

Query  676   KKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMFNDRMKPIIDDLNG  855
             + L+  GARK+ +FG G++G  P E+   G+    CVD+IN+AVQ+FN R+K ++ DLN 
Sbjct  215   RTLYNSGARKIVIFGVGMIGSTPFEVAMCGSNGTLCVDNINNAVQLFNARLKSLVTDLNT  274

Query  856   SLKGAKFILINMTSL----ALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQVPCSNRNE  1023
             +L  AKFI I+   +    AL  P   G  N    CC+V +    G C   + PC NR +
Sbjct  275   NLTNAKFIYIDYYGIGLSGALSSPP--GSINYTAPCCEVERNSTTGLCTAFKTPCQNRTQ  332

Query  1024  YMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             Y FWD  H TEI N+    R+Y +TLPTD +P DIS L Q+
Sbjct  333   YAFWDAIHPTEISNVFIGARAYNSTLPTDVFPCDISHLAQM  373



>ref|XP_009351929.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Pyrus x bretschneideri]
Length=365

 Score =   345 bits (886),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 169/363 (47%), Positives = 240/363 (66%), Gaps = 11/363 (3%)
 Frame = +1

Query  79    WFA--IATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFP  252
             W +  I  + ++ +S   +  EP+VPC+FIFGDSL DNGNNN L T A+ANY PYGIDFP
Sbjct  9     WMSMMINVVFVITVSQSCVRGEPKVPCFFIFGDSLADNGNNNRLRTPARANYEPYGIDFP  68

Query  253   DGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHM  432
              GPTGRF+NG+   D++AEFLGF   IP Y+     + +++G+NYAS + G+ DE+G+HM
Sbjct  69    QGPTGRFTNGRTTVDFIAEFLGFEDPIPCYANTKGFKNMVRGLNYASASAGVRDETGSHM  128

Query  433   GEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPS  612
             GE +++++QL+NH  T+ RI   M   R +R +L KC YSVG+G+NDY+ NY  P+ YP+
Sbjct  129   GENVNLNKQLLNHKSTVKRITSIMGLKRLSRQHLQKCLYSVGLGSNDYLMNYFQPKFYPT  188

Query  613   SRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDS  792
             S+ YTP+Q+A +L K++  Q+K L+  GARKV + G G +GC P  + T  NGS +C ++
Sbjct  189   SKRYTPEQYASVLIKQYSKQMKTLYKYGARKVVLNGVGQVGCTPSSIST-TNGS-TCAEN  246

Query  793   INSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSII---GINNVNKACCQVS  963
             +N+AVQ FN ++K ++D LN  L  AKFI ++M  ++ G PS +   GI      CC V 
Sbjct  247   MNNAVQFFNQKLKSLVDQLNTELTHAKFIYVDMFGIS-GSPSEVTAAGIKVTKANCCPVD  305

Query  964   KTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQ  1143
             +    GQC   +  C NR+EY FWD FH TE  NL  A +SY ++  +D YP +I  L+Q
Sbjct  306   EF---GQCVRSKGTCQNRSEYAFWDLFHPTEASNLIIARKSYNSSNLSDTYPANIHHLVQ  362

Query  1144  LNL  1152
             L L
Sbjct  363   LRL  365



>ref|XP_010273431.1| PREDICTED: GDSL esterase/lipase At4g18970-like [Nelumbo nucifera]
Length=374

 Score =   346 bits (887),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 171/369 (46%), Positives = 236/369 (64%), Gaps = 15/369 (4%)
 Frame = +1

Query  49    ITLMASGVKVWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANY  228
             + L ASGV +W             + + AE +VPCYFIFGDSLVDNGNNN LS+ A+A+Y
Sbjct  18    LVLAASGVNLWGG-----------RVVQAEAEVPCYFIFGDSLVDNGNNNQLSSLARADY  66

Query  229   LPYGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGI  408
             +PYGIDF  GPTGRF NGK   D +A+ LGF+  IPPY A T  + LLKGVN+AS A GI
Sbjct  67    MPYGIDFDGGPTGRFCNGKTTTDVIAQLLGFDDYIPPY-ATTRGQDLLKGVNFASAAAGI  125

Query  409   LDESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNY  588
              DE+G  +G+ I+M+ Q+ N+    ++I   +    +A  +L+KC ++VGMG+NDY+NNY
Sbjct  126   RDETGRQLGDRITMNGQVRNYQSVASQIVQILGDEASAADHLSKCIFTVGMGSNDYLNNY  185

Query  589   LMPQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGN  768
              MP  Y +S+ YTP+Q+A+ L +++  QL+ L+  GARKVA+ G G +GC P ++  +  
Sbjct  186   FMPLYYTTSQEYTPEQYADALIQEYTGQLRTLYNYGARKVALIGVGQIGCSPNQLAQNSQ  245

Query  769   GSLSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNV  939
               ++CVD IN A QMFN+++K ++D+ N +L GAKF  IN   +    L +PS  G    
Sbjct  246   NGVACVDRINVANQMFNNKLKALVDNFNSNLDGAKFTYINAYGIFEDMLKNPSAYGFTVT  305

Query  940   NKACCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYP  1119
             N  CC V +   +  C   Q PC NRN+Y+FWD FH TE  N+    RSY A   +DAYP
Sbjct  306   NTGCCGVGRNNGQITCLPLQTPCQNRNQYLFWDAFHPTEAANVIVGKRSYRAQSSSDAYP  365

Query  1120  MDISSLLQL  1146
             +DI  L +L
Sbjct  366   VDIERLARL  374



>gb|ACJ85846.1| unknown [Medicago truncatula]
Length=370

 Score =   346 bits (887),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 171/364 (47%), Positives = 237/364 (65%), Gaps = 7/364 (2%)
 Frame = +1

Query  70    VKVWFAIATLLLMFLSL--KPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGI  243
             VK    +  ++++ L L    + A+PQVPCYFIFGDSLVD+GNNNNL++ AKANYLPYGI
Sbjct  9     VKWIMNLCVMMVVVLGLWSSKVEADPQVPCYFIFGDSLVDDGNNNNLNSLAKANYLPYGI  68

Query  244   DFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESG  423
             DF  GPTGRFSNGK   D +AE LGF   I PYS     E +L+GVNYAS A GI +E+G
Sbjct  69    DFNGGPTGRFSNGKTTVDVIAELLGFEGYISPYSTARDQE-ILQGVNYASAAAGIREETG  127

Query  424   THMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQK  603
               +G+ IS   Q+ N+  T++++   +     A  YL+KC YS+G+G+NDY+NNY MP  
Sbjct  128   QQLGDRISFSGQVQNYQKTVSQVVNLLGDEDTASNYLSKCIYSIGLGSNDYLNNYFMP-A  186

Query  604   YPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSC  783
             YPS R +TP Q+A++L + +  QL+ L+  GARK+ +FG G +GC P E+  +     +C
Sbjct  187   YPSGRQFTPQQYADVLIQAYAQQLRILYNYGARKMTLFGIGQIGCSPNELAQNSPDGTTC  246

Query  784   VDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKACC  954
             V+ INSA Q+FN+ +K +++ LN  L  A+FI +N   +    + +PS  GI   N+ CC
Sbjct  247   VERINSANQLFNNGLKSLVNQLNNELTDARFIYVNTYGIFQDIINNPSSFGIRVTNEGCC  306

Query  955   QVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISS  1134
              + +   +  C   Q PCSNRNEY+FWD FH TE+GN     R+Y A   +DAYP+DI+ 
Sbjct  307   GIGRNNGQITCLPLQTPCSNRNEYLFWDAFHPTEVGNTIIGRRAYNAQSESDAYPIDINR  366

Query  1135  LLQL  1146
             L Q+
Sbjct  367   LAQI  370



>ref|XP_004233002.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Solanum lycopersicum]
Length=365

 Score =   345 bits (884),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 177/364 (49%), Positives = 230/364 (63%), Gaps = 6/364 (2%)
 Frame = +1

Query  67    GVKVWFAIATLLLMFLSLKPL--VAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYG  240
             G ++   I  +LL F+SL         QVPCYFIFGDSLVDNGNNNN+ + AKANYLPYG
Sbjct  2     GSEMRRCILVVLLGFMSLGDYYETNAQQVPCYFIFGDSLVDNGNNNNIQSLAKANYLPYG  61

Query  241   IDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDES  420
             IDF  GPTGRFSNGK   D +AE LGFN +IPPY A      +L+GVNYAS A GI DE+
Sbjct  62    IDFSGGPTGRFSNGKTTVDVIAEQLGFNGNIPPY-ATARGRDVLRGVNYASAAAGIRDET  120

Query  421   GTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQ  600
             G  +G  IS   Q+ N+  T+ ++   +    AA  YL KC YSVG+G+NDY+NNY MP 
Sbjct  121   GRQLGGRISFSGQVNNYRNTVQQVVQILGNENAAADYLKKCIYSVGLGSNDYLNNYFMPL  180

Query  601   KYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLS  780
              YP+SR +TPDQ+A +L +++  QLK L++ GARK A+ G G +GC P  +  +     +
Sbjct  181   YYPTSRQFTPDQYATVLIQQYTQQLKILYSNGARKFALIGVGQIGCSPNALAQNSPDGRT  240

Query  781   CVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKAC  951
             CV  IN A Q+FN+++K ++D+LNG+   AKFI I+   +    + +P+  G    N  C
Sbjct  241   CVQRINVANQLFNNKLKALVDNLNGNTPDAKFIYIDAYGIFQDLIENPAAFGFRVTNAGC  300

Query  952   CQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDIS  1131
             C V +   +  C   Q PC NRNEY+FWD FH TE  N+    RSY A   +DAYP DIS
Sbjct  301   CGVGRNNGQITCLPFQRPCRNRNEYLFWDAFHPTEAANIVVGRRSYRAQKSSDAYPYDIS  360

Query  1132  SLLQ  1143
              L Q
Sbjct  361   RLAQ  364



>gb|KHG24391.1| hypothetical protein F383_02353 [Gossypium arboreum]
Length=362

 Score =   344 bits (883),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 170/362 (47%), Positives = 230/362 (64%), Gaps = 4/362 (1%)
 Frame = +1

Query  70    VKVWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDF  249
             VK+       +L+ LS   +   PQVPCYFIFGDSLVDNGNNN LS+ AKANY+PYGIDF
Sbjct  2     VKLCVLFGVAVLLSLSFGFINGAPQVPCYFIFGDSLVDNGNNNRLSSLAKANYMPYGIDF  61

Query  250   PDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTH  429
             P+GPTGRFSNGK   D +AE LGF + IPPYSA    + +L GVNYAS A GI +E+G  
Sbjct  62    PNGPTGRFSNGKTTVDVIAELLGFENYIPPYSAARGRQ-ILGGVNYASAAAGIREETGQQ  120

Query  430   MGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYP  609
             +G  IS   Q+ N+  T++++   +     A  YL+KC YS+G+G+NDY+NNY MP  Y 
Sbjct  121   LGARISFSGQVRNYRQTVSQVVNLLGSEANAANYLSKCIYSIGLGSNDYLNNYFMPLFYS  180

Query  610   SSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVD  789
             +SR Y P+Q+A +L +++  QL+ L+  GARK  + G G +GC P E+  +     +CV+
Sbjct  181   TSRRYNPEQYANVLIQQYTQQLQALYNYGARKFVLIGLGQIGCSPNELAQNSRDGRTCVE  240

Query  790   SINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQV  960
              IN+A ++FN+++K ++D  N +   AKFI I++  +      +PS  G    N  CC V
Sbjct  241   RINAANRIFNNKLKGLVDQFNNANSDAKFIYIDVYGIFQDITSNPSAYGFRVTNAGCCGV  300

Query  961   SKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLL  1140
              +   +  C   Q PC NRNEY+FWD FH TE  N+    RSY A  P+DAYP+DI  L 
Sbjct  301   GRNNGQITCLPLQRPCRNRNEYLFWDAFHPTEAANVIIGRRSYNAQKPSDAYPIDIRRLA  360

Query  1141  QL  1146
             QL
Sbjct  361   QL  362



>emb|CDO96911.1| unnamed protein product [Coffea canephora]
Length=369

 Score =   344 bits (883),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 178/375 (47%), Positives = 256/375 (68%), Gaps = 11/375 (3%)
 Frame = +1

Query  58    MASGVKVWFAIATL-LLMFLSLKPL-VAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYL  231
             M    K W  +  + +++F  L+P  +  PQVPCYFIFGDS  DNGNNN+L+T AKANY 
Sbjct  1     MTFVTKQWVLLPVVGMVIFFFLQPFALGNPQVPCYFIFGDSQDDNGNNNDLNTTAKANYP  60

Query  232   PYGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGIL  411
             PYGIDFP+GPTGRF+NG+N AD++AE LGF   +PP++ +   + + +GVNYAS A GIL
Sbjct  61    PYGIDFPEGPTGRFTNGRNHADFIAELLGFEGYMPPFANIKGQD-ITEGVNYASAASGIL  119

Query  412   DESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYL  591
             D++G  +G+++S++QQL NH    +++   +    A + YL KC Y+  +G+NDYI++YL
Sbjct  120   DQTGRQLGDIVSLNQQLQNHRRVTSQLVRLIGNEAATKEYLAKCLYTFAIGSNDYIDSYL  179

Query  592   MPQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNG  771
             +P+ Y +SRL TP QFA +L K++  QL+KL+ LGARK+A+FG G LGC+P  +   G  
Sbjct  180   LPECYATSRLCTPRQFARMLIKEYSQQLRKLYGLGARKIAIFGLGFLGCVPGLLSIDG--  237

Query  772   SLSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGD-PSIIGINNVNKA  948
               +CVDS+NS VQ+FN+ +KP++D+LN  L  A FI +N+T++ L   P+ I I+     
Sbjct  238   --TCVDSLNSEVQLFNEELKPLVDELNAELSSAHFIYVNVTAITLSTMPAEITIDKA--P  293

Query  949   CCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTA-TLPTDAYPMD  1125
             CC VS T + GQC  GQ+PCSNRNEY FWD+FH +EI    ++  +Y+A +   +AYP  
Sbjct  294   CCNVSTTVSAGQCIPGQIPCSNRNEYYFWDDFHPSEIVYEASSRLAYSALSSLLNAYPFG  353

Query  1126  ISSLLQLNLQAKSDI  1170
             I SL   + + K +I
Sbjct  354   IGSLADTDSRDKLEI  368



>gb|KHN06446.1| GDSL esterase/lipase [Glycine soja]
Length=357

 Score =   344 bits (882),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 169/357 (47%), Positives = 234/357 (66%), Gaps = 5/357 (1%)
 Frame = +1

Query  88    IATLLLMFLSLKPLV-AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPT  264
             +A ++++ L L   V   PQVPCYFIFGDSLVDNGNNN L + A+A+YLPYGIDFP GP+
Sbjct  2     LALIVVVSLGLWSGVQGAPQVPCYFIFGDSLVDNGNNNQLQSLARADYLPYGIDFPGGPS  61

Query  265   GRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVI  444
             GRFSNGK   D +AE LGF+  IPPY A  + + +LKGVNYAS A GI +E+G  +G  I
Sbjct  62    GRFSNGKTTVDAIAELLGFDDYIPPY-ADASGDAILKGVNYASAAAGIREETGQQLGGRI  120

Query  445   SMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLY  624
             S   Q+ N+  T++++   +    +A  YL+KC YS+G+G+NDY+NNY MPQ Y SSR Y
Sbjct  121   SFSGQVQNYQSTVSQVVNLLGNEDSAANYLSKCIYSIGLGSNDYLNNYFMPQFYSSSRQY  180

Query  625   TPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSA  804
             +PD++A++L + +  QLK L+  GARK+ +FG G +GC P E+  +     +CV+ INSA
Sbjct  181   SPDEYADVLIQAYTEQLKTLYNYGARKMVLFGIGQIGCSPNELAQNSPDGKTCVEKINSA  240

Query  805   VQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKA  975
              Q+FN+++K + D  N  L  A+ I +N   +    + +PS  G +  N  CC V +   
Sbjct  241   NQIFNNKLKGLTDQFNNQLPDARVIYVNSYGIFQDIISNPSAYGFSVTNAGCCGVGRNNG  300

Query  976   KGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             +  C   Q PC NR EY+FWD FH TE GN+  A R+Y+A   +DAYP+DI  L Q+
Sbjct  301   QITCLPMQTPCQNRREYLFWDAFHPTEAGNVVVAQRAYSAQSASDAYPVDIQRLAQI  357



>ref|XP_008225404.1| PREDICTED: GDSL esterase/lipase At1g29660-like [Prunus mume]
Length=370

 Score =   344 bits (883),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 172/376 (46%), Positives = 244/376 (65%), Gaps = 18/376 (5%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLM-----FLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKA  222
             MA G+K+      L L+     F+  K  V EPQVPC+FIFGDS+ DNGNNN L T AK 
Sbjct  1     MACGMKLLLVATALYLVLNTQHFVQGKLQVREPQVPCFFIFGDSVSDNGNNNLLPTFAKV  60

Query  223   NYLPYGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVN---YAS  393
             NY PYG+DFP GPTGRF NG+N+ D LAE LGF + IPP++    +E ++KGVN   Y +
Sbjct  61    NYSPYGVDFPQGPTGRFCNGRNIVDVLAELLGFENYIPPFAYANGSE-IVKGVNLSNYQA  119

Query  394   GAGGILDESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNND  573
                 +L       G  ISM +QL NH  T+ RI   +     A+ +LNKC YSVGMG+ND
Sbjct  120   LKNLLLQ------GARISMGEQLKNHRTTVLRIIDILGKRSLAKKHLNKCLYSVGMGSND  173

Query  574   YINNYLMPQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEM  753
             YINNY +PQ Y +S+ YT +++AE+L K++  Q+ +L   GARKV++ G G++GC P+ +
Sbjct  174   YINNYFLPQYYQTSKEYTLEEYAEVLIKQYTQQILRLRKYGARKVSLVGLGLIGCTPDAI  233

Query  754   ETHGNGSLSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGIN  933
             +T+G    SCV+ +N+A Q FN ++  ++D+LN +   +KFI +N   +  GDP+++G  
Sbjct  234   KTYGTNGSSCVEKLNNASQQFNQKLVALVDELNTNFTDSKFIYVNSYEMGSGDPTLVGFK  293

Query  934   NVNKACCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDA  1113
              ++  CC+V +    GQC   + PC NR +Y+FWD FH +E  NL TA+R+Y+A   +D 
Sbjct  294   VLDAGCCEVDQY---GQCAPNKTPCQNRTDYVFWDGFHPSEASNLITASRTYSAYNASDT  350

Query  1114  YPMDISSLLQLNLQAK  1161
             YPMDIS L+QL L+ +
Sbjct  351   YPMDISHLVQLQLEPQ  366



>dbj|BAB56037.1| putative proline-rich protein [Oryza sativa Japonica Group]
 gb|EAY75815.1| hypothetical protein OsI_03729 [Oryza sativa Indica Group]
 gb|EAZ13534.1| hypothetical protein OsJ_03450 [Oryza sativa Japonica Group]
Length=363

 Score =   344 bits (882),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 163/340 (48%), Positives = 227/340 (67%), Gaps = 4/340 (1%)
 Frame = +1

Query  136   EPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNLADYLAEFL  315
             EPQVPCYF+FGDSLVDNGNNNN+++ A+ANY PYG+DFP G TGRFSNG   AD ++  L
Sbjct  25    EPQVPCYFVFGDSLVDNGNNNNIASMARANYPPYGVDFPGGATGRFSNGLTTADAISRLL  84

Query  316   GFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNHGLTLARIA  495
             GF+  IPPY+   T+E LL GVN+AS A GI D++G  +GE IS   QL N+   + ++ 
Sbjct  85    GFDDYIPPYAG-ATSEQLLTGVNFASAAAGIRDDTGQQLGERISFSAQLQNYQAAVRQLV  143

Query  496   LYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAKKHYVQL  675
               + G  AA   L++C ++VGMG+NDY+NNY MP  YP+SR YTP+Q+A++L  ++  QL
Sbjct  144   SILGGEDAAANRLSQCIFTVGMGSNDYLNNYFMPAFYPTSRQYTPEQYADVLINQYAQQL  203

Query  676   KKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMFNDRMKPIIDDLNG  855
             + L+  GARKVAVFG G +GC P E+  +    ++C++ INSAV+MFN R+  +++  N 
Sbjct  204   RTLYNYGARKVAVFGVGQVGCSPNELAQNSRNGVTCIERINSAVRMFNRRVVVLVNQFNR  263

Query  856   SLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQVPCSNRNEY  1026
              L GA F  IN   +    +  P   G+   N+ CC V +   +  C   Q PC+NR+EY
Sbjct  264   LLPGALFTYINCYGIFESIMRTPVEHGLAVTNRGCCGVGRNNGQVTCLPYQAPCANRDEY  323

Query  1027  MFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             +FWD FH TE  N+    R+Y+A + +D YP+D+S+L QL
Sbjct  324   LFWDAFHPTEAANIFVGRRAYSAAMRSDVYPVDLSTLAQL  363



>gb|KDO77976.1| hypothetical protein CISIN_1g037608mg [Citrus sinensis]
Length=371

 Score =   344 bits (882),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 173/364 (48%), Positives = 236/364 (65%), Gaps = 9/364 (2%)
 Frame = +1

Query  79    WFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDG  258
             W      + +F    P+  +P VPCYF+FGDSLVD+GNNNNL+T+AK NY PYGIDFP G
Sbjct  12    WVMAFVFISVFNLQSPVWGKPAVPCYFVFGDSLVDSGNNNNLATDAKVNYWPYGIDFPKG  71

Query  259   PTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGE  438
             PTGRF NG+ +AD  AE LGF+  IPP++     E ++KGVNYASG+ GI DE+G+H G 
Sbjct  72    PTGRFCNGRTIADVTAERLGFDDYIPPFATANGPE-IIKGVNYASGSAGIRDETGSHQGV  130

Query  439   VISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSR  618
              IS+++QL NH + ++RIA ++  Y +A  +L KC YS  +G+NDYINNY +PQ Y SS+
Sbjct  131   CISLNKQLKNHKIIISRIAGFLGSYHSAYEHLKKCLYSFTIGSNDYINNYFLPQFYNSSQ  190

Query  619   LYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHG-NGSLSCVDSI  795
             LYTP  +A +L++++  QLK LH  GARKV + G G +GC P     +G NGSL CVD +
Sbjct  191   LYTPSAYARILSQQYSRQLKTLHRYGARKVTLAGIGAIGCTPNATSYYGTNGSL-CVDKM  249

Query  796   NSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSII-GINNVNKACCQVSKTK  972
             NSAVQ+FN R+  ++D LN   + +KFI +N  +L    P    G N     CC V+   
Sbjct  250   NSAVQLFNKRLVTLVDQLNVKHQDSKFIALN--TLVQTPPGFRPGFNMSTLRCCDVNDF-  306

Query  973   AKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQLNL  1152
               G C   + PCS R  ++FWD+FH  E+ NL  A +++ +   +DAYP DI  L+  N 
Sbjct  307   --GLCIRTKSPCSQRATHIFWDSFHPAEVLNLIAANKAFHSEATSDAYPTDIQRLVHFNP  364

Query  1153  QAKS  1164
             +A S
Sbjct  365   EAHS  368



>ref|XP_006355561.1| PREDICTED: GDSL esterase/lipase At5g45670-like [Solanum tuberosum]
Length=368

 Score =   344 bits (882),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 173/369 (47%), Positives = 236/369 (64%), Gaps = 4/369 (1%)
 Frame = +1

Query  49    ITLMASGVKVWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANY  228
             + + A GVK W  +  ++L+ L+L   V   QVPCYFIFGDSLVDNGNNNN+ + A+ANY
Sbjct  1     MIMGAWGVKRWIVVYVVVLLGLNLGINVNAQQVPCYFIFGDSLVDNGNNNNIQSLARANY  60

Query  229   LPYGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGI  408
             LPYGID+PDGPTGRFSNGK   D +AE LGF+  IPPY A    E +LKGVNYAS A GI
Sbjct  61    LPYGIDYPDGPTGRFSNGKTTVDVIAELLGFDDYIPPY-ASARGEDILKGVNYASAAAGI  119

Query  409   LDESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNY  588
              +E+G  +G  I+   Q+ N+  T+ ++   +    +A  YL+KC YS+G+G+NDY+NNY
Sbjct  120   REETGQQLGARITFGGQVNNYRNTVQQVVQILGDENSAANYLSKCIYSIGLGSNDYLNNY  179

Query  589   LMPQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGN  768
              MPQ Y +SR + PDQ+A++L +++  QLK L+  GARK  + G G +GC P  +  +  
Sbjct  180   FMPQYYSTSRQFNPDQYADVLIQQYTQQLKSLYDYGARKFVLIGVGQIGCSPNSLAQNSP  239

Query  769   GSLSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNV  939
                +C ++IN+A ++FN+R+K I+D+ NG+   AKFI IN   +    + +PS  G    
Sbjct  240   DGRTCAENINNANKLFNNRLKGIVDEFNGNTPDAKFIYINAYDIFQDLIDNPSAFGFRVT  299

Query  940   NKACCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYP  1119
             N  CC V +   +  C   Q PC NR+EY+FWD FH  E  N+    RSY A   +DAYP
Sbjct  300   NAGCCGVGRNNGQITCLPLQNPCQNRDEYLFWDAFHPGEAANIVVGRRSYRAERSSDAYP  359

Query  1120  MDISSLLQL  1146
              DI  L QL
Sbjct  360   FDIQRLAQL  368



>ref|XP_002522292.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF40150.1| zinc finger protein, putative [Ricinus communis]
Length=365

 Score =   343 bits (880),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 171/368 (46%), Positives = 231/368 (63%), Gaps = 6/368 (2%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPY  237
             M   +K W  +  + + FL L   +A  QVPCYFIFGDSLVDNGNNN LS+ A+A+YLPY
Sbjct  1     MEGVLKKWLWV--VCVAFLVLHGKIAAQQVPCYFIFGDSLVDNGNNNQLSSLARADYLPY  58

Query  238   GIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDE  417
             GIDF  GP+GRFSNGK   D +A+ LGF + IPPY A      +L GVNYAS A GI +E
Sbjct  59    GIDFAGGPSGRFSNGKTTVDEIAQLLGFRNYIPPY-ATARGRQILGGVNYASAAAGIREE  117

Query  418   SGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMP  597
             +G  +G+ I+   Q+ N+  T+++I   + G  AA  YL +C +S+G+G+NDY+NNY MP
Sbjct  118   TGQQLGDRITFSGQVRNYRNTVSQIVNLLGGEDAAADYLKQCIFSIGLGSNDYLNNYFMP  177

Query  598   QKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSL  777
             Q Y SSR YTP Q+A++L +++  QL  L+  GARK A+ G G +GC P E+  +     
Sbjct  178   QFYSSSRQYTPVQYADVLIRQYTEQLTNLYNYGARKFALIGVGQIGCSPSELAQNSPDGR  237

Query  778   SCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKA  948
             +CV  INSA Q+FN R++ ++D  NG+   A+FI IN   +    + +PS  G    N  
Sbjct  238   TCVQRINSANQIFNSRLRSLVDQFNGNTPDARFIYINAYGIFQDLINNPSRYGFRVTNAG  297

Query  949   CCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDI  1128
             CC V +   +  C   Q PC NRN+Y+FWD FH TE  N+    RSY+A   +DAYP DI
Sbjct  298   CCGVGRNNGQITCLPFQTPCQNRNQYLFWDAFHPTEAANVIIGRRSYSAQSGSDAYPFDI  357

Query  1129  SSLLQLNL  1152
               L Q+ L
Sbjct  358   RRLAQVRL  365



>ref|XP_010540543.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Tarenaya hassleriana]
Length=361

 Score =   343 bits (880),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 170/341 (50%), Positives = 222/341 (65%), Gaps = 5/341 (1%)
 Frame = +1

Query  133   AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNLADYLAEF  312
              +PQVPCYFIFGDSLVDNGNNN LS+ A+++Y PYGIDFP GPTGRFSNGK   D +AE 
Sbjct  23    GDPQVPCYFIFGDSLVDNGNNNGLSSLARSDYFPYGIDFPGGPTGRFSNGKTTVDVIAEL  82

Query  313   LGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNHGLTLARI  492
             LGFN  IPPY  V   E +L GVNYAS A GI +E+G  +G+ I+   Q+ N+  T++++
Sbjct  83    LGFNDYIPPYGGVNGQE-ILTGVNYASAAAGIREETGQQLGQRIAFSGQVQNYKNTVSQV  141

Query  493   ALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAKKHYVQ  672
                +    +A  YL KC YS+G+G+NDY+NNY MP  Y SSR +TP+QF++ L  ++  Q
Sbjct  142   VNLLGDENSAADYLKKCIYSIGLGSNDYLNNYFMPTFYSSSRQFTPEQFSDDLIDRYGQQ  201

Query  673   LKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMFNDRMKPIIDDLN  852
             L  L+  GARK A+ G G +GC P ++    +G  +C + INSA QMFN+++K ++D LN
Sbjct  202   LNALYNYGARKFALIGVGAIGCSPNKLADSQDGK-TCDEQINSANQMFNNKLKSLVDRLN  260

Query  853   GSLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQVPCSNRNE  1023
               L  AKFI IN   +    + +PS  G +  N  CC V +   +  C  GQ PC NR E
Sbjct  261   NDLSDAKFIFINAYGIFQDLISNPSAYGFSVTNAGCCGVGRNNGQITCLPGQSPCPNRKE  320

Query  1024  YMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             Y+FWD FH TE  N   A RSY A   +DAYP+DIS L QL
Sbjct  321   YVFWDAFHPTEAANAIIAQRSYKARSASDAYPIDISRLAQL  361



>ref|XP_009769554.1| PREDICTED: GDSL esterase/lipase At1g29670 isoform X1 [Nicotiana 
sylvestris]
Length=369

 Score =   343 bits (880),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 170/338 (50%), Positives = 222/338 (66%), Gaps = 4/338 (1%)
 Frame = +1

Query  142   QVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNLADYLAEFLGF  321
             QVPCYFIFGDSLVDNGNNNN+ + A+ANYLPYGIDFP GPTGRFSNGK   D +AE LGF
Sbjct  33    QVPCYFIFGDSLVDNGNNNNIQSLARANYLPYGIDFPGGPTGRFSNGKTTVDVIAEQLGF  92

Query  322   NSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNHGLTLARIALY  501
             N  IPPY A      +L GVNYAS A GI DE+G  +G  IS   Q+ N+  T+ ++   
Sbjct  93    NGYIPPY-ATARGRDILGGVNYASAAAGIRDETGRQLGGRISFSGQVNNYRNTVQQVVQI  151

Query  502   MKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAKKHYVQLKK  681
             +    AA  YL+KC YSVG+G+NDY+NNY MP  YP+SR +TP+Q+A +L +++  QLK 
Sbjct  152   LGNENAAADYLSKCIYSVGLGSNDYLNNYFMPLYYPTSRQFTPEQYASVLIQQYTQQLKI  211

Query  682   LHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMFNDRMKPIIDDLNGSL  861
             L+  GARK A+ G G +GC P  +  +     +CV  IN A Q+FN+++K ++D+LNG+ 
Sbjct  212   LYNNGARKFALIGVGQIGCSPNALAQNSPDGRTCVQRINVANQLFNNKLKALVDNLNGNT  271

Query  862   KGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQVPCSNRNEYMF  1032
               AKFI IN   +    + +PS  G++  N  CC V +   +  C   Q PC NR++Y+F
Sbjct  272   PDAKFIYINAYGIFQDLIDNPSAFGLSVTNAGCCGVGRNNGQITCLPFQRPCRNRDQYLF  331

Query  1033  WDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             WD FH TE+ N+    RSY A   +DAYP DIS L QL
Sbjct  332   WDAFHPTEVANVVVGRRSYRAQKSSDAYPFDISRLAQL  369



>gb|KDP21165.1| hypothetical protein JCGZ_21636 [Jatropha curcas]
Length=372

 Score =   343 bits (880),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 171/364 (47%), Positives = 233/364 (64%), Gaps = 8/364 (2%)
 Frame = +1

Query  73    KVWFAIATLLLMFLSL--KPLVAE--PQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYG  240
             K W+     LLM +S   +P+ A+   QVPC+FIFGDSL DNGNNN L T +K +Y PYG
Sbjct  7     KSWWMAVVGLLMVVSCWQEPVGADGSQQVPCFFIFGDSLADNGNNNLLHTLSKVDYSPYG  66

Query  241   IDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDES  420
             IDFP GPTGRF+NG+   D +AE LGF + IPP++     E +L GVNYASG+ GIL+E+
Sbjct  67    IDFPFGPTGRFTNGRTTVDVIAELLGFENYIPPFATADGLE-ILFGVNYASGSAGILNET  125

Query  421   GTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQ  600
                +G+ I +  QL +H +T++R+       R+  +YL++C YSVGMGNNDYINNY +PQ
Sbjct  126   ARQLGQRIPLGTQLEHHAITVSRLVKIFGSERSTDWYLSQCLYSVGMGNNDYINNYFLPQ  185

Query  601   KYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLS  780
              Y +S+ YT  QF  LL +++  QLK L+  GARK+A+FG G +GC P  + T+G     
Sbjct  186   YYNTSQEYTLQQFTTLLIQQYKQQLKTLYNYGARKIALFGLGEIGCTPNAISTYGTNGSY  245

Query  781   CVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACCQV  960
             CV+ +  A Q FN ++K ++++LN +L GAKF  IN  S+     S++   N +  CC V
Sbjct  246   CVEIMEEASQFFNSKLKSVVEELNSNLTGAKFTYINYYSIGADSSSVLDFENSSSGCCPV  305

Query  961   SKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLL  1140
             +   + GQC    +PC NR +Y FWD+FH TE  N   A RSY A   +DAYP DI  L+
Sbjct  306   A---SDGQCIPNGIPCKNRKKYAFWDSFHPTEAVNKYIAERSYIALNSSDAYPFDIHDLV  362

Query  1141  QLNL  1152
              LNL
Sbjct  363   MLNL  366



>ref|XP_010549442.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Tarenaya hassleriana]
Length=363

 Score =   342 bits (878),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 173/366 (47%), Positives = 230/366 (63%), Gaps = 6/366 (2%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPY  237
             M   ++ W      L + L  + +  EPQVPCYFIFGDSLVDNGNNN LS+ A+A+YLPY
Sbjct  1     MEGYLRKWCWCVVFLGLMLGSR-VNGEPQVPCYFIFGDSLVDNGNNNQLSSLARADYLPY  59

Query  238   GIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDE  417
             GIDFP GPTGRFSNG+   D +AE LGF+  IPPYS V   E +L GVNYAS A GI +E
Sbjct  60    GIDFPGGPTGRFSNGQTTVDVIAELLGFDDYIPPYSGVNGQE-ILTGVNYASAAAGIREE  118

Query  418   SGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMP  597
             SG  +G+ I+   Q+ N+  T+A++   +     A  YL KC YS+G+G+NDY+NNY MP
Sbjct  119   SGQQLGQRITFSGQVQNYQNTVAQVVNLLGDENTAADYLRKCIYSIGLGSNDYLNNYFMP  178

Query  598   QKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSL  777
               Y SSR +TP+Q+A+ L  ++  QL  L+  GARK A+ G G +GC P ++    +G+ 
Sbjct  179   TFYSSSRQFTPEQYADDLIDRYSQQLNALYNYGARKFALIGVGAIGCSPNKLANSPDGT-  237

Query  778   SCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKA  948
             +C D INSA Q+FN++++ ++D LN  L  AKF  +N   +    + +PS  G +  N  
Sbjct  238   TCDDEINSANQIFNNKLRSLVDRLNNELSDAKFTFVNAYGIFQDLINNPSAYGFSVTNAG  297

Query  949   CCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDI  1128
             CC V +   +  C  GQ PC NR EY+FWD FH TE  N     RSY A   +D YP+DI
Sbjct  298   CCGVGRNNGQITCLPGQNPCPNRKEYVFWDAFHPTEAANAIIGQRSYRAQSYSDVYPIDI  357

Query  1129  SSLLQL  1146
             S L QL
Sbjct  358   SRLAQL  363



>ref|NP_001242366.1| uncharacterized protein LOC100800635 precursor [Glycine max]
 gb|ACU19711.1| unknown [Glycine max]
Length=366

 Score =   342 bits (878),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 168/357 (47%), Positives = 234/357 (66%), Gaps = 5/357 (1%)
 Frame = +1

Query  88    IATLLLMFLSLKPLV-AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPT  264
             +A ++++ L L   V   PQVPCYFIFGDSLVDNGNNN L + A+A+YLPYGIDFP GP+
Sbjct  11    LALIVVVSLGLWSGVQGAPQVPCYFIFGDSLVDNGNNNQLQSLARADYLPYGIDFPGGPS  70

Query  265   GRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVI  444
             GRFSNGK   D +AE LGF+  IPPY A  + + +LKGVNYAS A GI +E+G  +G  I
Sbjct  71    GRFSNGKTTVDAIAELLGFDDYIPPY-ADASGDAILKGVNYASAAAGIREETGQQLGGRI  129

Query  445   SMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLY  624
             S   Q+ N+  T++++   +    +A  YL+KC YS+G+G+NDY+NNY MPQ Y SSR Y
Sbjct  130   SFSGQVQNYQSTVSQVVNLLGNEDSAANYLSKCIYSIGLGSNDYLNNYFMPQFYSSSRQY  189

Query  625   TPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSA  804
             +PD++A++L + +  QLK L+  GARK+ +FG G +GC P E+  +     +CV+ INSA
Sbjct  190   SPDEYADVLIQAYTEQLKTLYNYGARKMVLFGIGQIGCSPNELAQNSPDGKTCVEKINSA  249

Query  805   VQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKA  975
              Q+FN+++K + D  +  L  A+ I +N   +    + +PS  G +  N  CC V +   
Sbjct  250   NQIFNNKLKGLTDQFDNQLPDARVIYVNSYGIFQDIISNPSAYGFSVTNAGCCGVGRNNG  309

Query  976   KGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             +  C   Q PC NR EY+FWD FH TE GN+  A R+Y+A   +DAYP+DI  L Q+
Sbjct  310   QITCLPMQTPCQNRREYLFWDAFHPTEAGNVVVAQRAYSAQSASDAYPVDIQRLAQI  366



>gb|EYU28141.1| hypothetical protein MIMGU_mgv1a008629mg [Erythranthe guttata]
Length=367

 Score =   342 bits (878),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 169/368 (46%), Positives = 231/368 (63%), Gaps = 6/368 (2%)
 Frame = +1

Query  58    MASG-VKVWFAIATLLLMFLSLKP-LVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYL  231
             M SG +K W  +   L + ++L+  + AEPQVPCYFIFGDSLVDNGNNNN+ + AKANYL
Sbjct  1     MGSGFIKKWMILCVFLSVAVNLRDGVTAEPQVPCYFIFGDSLVDNGNNNNIQSLAKANYL  60

Query  232   PYGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGIL  411
             PYG DFP GPTGRFSNGK   D +AE LGF+  IPPY A    E +L+GVNYAS A GI 
Sbjct  61    PYGTDFPQGPTGRFSNGKTTVDVVAELLGFDDYIPPY-ATARGEQILRGVNYASAAAGIR  119

Query  412   DESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYL  591
              E+G  +G  I    Q+ N+  T+A++   +     A  YL KC YSVG+G+NDY+NNY 
Sbjct  120   QETGQQLGARIDFSAQINNYKNTVAQVVDILGDENTAADYLRKCIYSVGVGSNDYLNNYF  179

Query  592   MPQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNG  771
             MP  Y +SR YTP Q+A++L +++  Q++ L+  GARK A+ G G +GC P  +  +   
Sbjct  180   MPNYYSTSRQYTPQQYADVLIRQYSEQIRTLYNYGARKFALNGIGQIGCSPNALAQNSPD  239

Query  772   SLSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVN  942
              ++CV  IN A Q+FN R++ ++D+ N + + A+FI +N   +    + +PS  G    N
Sbjct  240   GVTCVQRINGANQIFNSRLRSLVDEFNSNSQDAQFIYLNAYDVFQDLIDNPSSFGFRVSN  299

Query  943   KACCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPM  1122
               CC V +   +  C   Q  C NR+EY+FWD FH TE  N+    R+Y+A   +DA+P 
Sbjct  300   AGCCGVGRNNGQITCLPFQNSCQNRDEYVFWDAFHPTEAANIIVGRRAYSAEKASDAHPF  359

Query  1123  DISSLLQL  1146
             DI  L QL
Sbjct  360   DIRRLAQL  367



>ref|XP_006436364.1| hypothetical protein CICLE_v10033788mg [Citrus clementina]
 gb|ESR49604.1| hypothetical protein CICLE_v10033788mg [Citrus clementina]
Length=369

 Score =   342 bits (878),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 184/372 (49%), Positives = 249/372 (67%), Gaps = 12/372 (3%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPY  237
             M  G+KV   + +L+LM LS K +    QVPCYFIFGDSL DNGNNN LST+AKANY PY
Sbjct  1     MPMGLKVCHLVLSLILMDLS-KWVNGAEQVPCYFIFGDSLWDNGNNNALSTKAKANYPPY  59

Query  238   GIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTT--EGLLKGVNYASGAGGIL  411
             GIDFP+G TGRF+NG+N+ D LA+ LGF + IP ++  +    + +L+GVNYASG  GI 
Sbjct  60    GIDFPEGATGRFTNGRNMGDILAQLLGFENFIPSFAHASNAKDQEILRGVNYASGGAGIR  119

Query  412   DESG-THMGEVISMDQQLVNHGLTLARIALYM-KGYRAARYYLNKCFYSVGMGNNDYINN  585
             +E+   ++G VISMD QL NH  T +RIA  +     +A  +L+KC YSVG+GNNDYINN
Sbjct  120   NETTRNNLGPVISMDMQLQNHQNTASRIAKILGNSEESAAKHLSKCIYSVGIGNNDYINN  179

Query  586   YLMPQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHG  765
             YL+PQ YP++  YTPDQ+A +L +++ +QLK L+  GARKVA+FG G++GC P  +  +G
Sbjct  180   YLLPQFYPTNSSYTPDQYATVLIQQYSLQLKTLYNFGARKVALFGLGLIGCTPGCIAMYG  239

Query  766   NGSLSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNK  945
             NG+ SCV+ IN+ VQMFN ++  ++D+LN + +  KFI +N +S++   P+ + IN    
Sbjct  240   NGT-SCVEYINNEVQMFNTKLVSLVDELNNNFQDTKFIYVNTSSVSSSVPATV-IN--TS  295

Query  946   ACCQVSKTKAKG---QCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAY  1116
              CC+V    A      C      C NR E++ WD  H TE   +  A RSY A LP+D Y
Sbjct  296   PCCEVGNLTANNGVLTCIPSGTACPNRAEHIMWDAAHPTEAAYVMMAERSYKAQLPSDTY  355

Query  1117  PMDISSLLQLNL  1152
             P+DI  L QLNL
Sbjct  356   PIDIHHLAQLNL  367



>ref|XP_006436366.1| hypothetical protein CICLE_v10033707mg, partial [Citrus clementina]
 gb|ESR49606.1| hypothetical protein CICLE_v10033707mg, partial [Citrus clementina]
Length=360

 Score =   342 bits (876),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 174/344 (51%), Positives = 228/344 (66%), Gaps = 11/344 (3%)
 Frame = +1

Query  142   QVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNLADYLAEFLGF  321
             QVPCYFIFGDSL DNGNNNNL T A+ANYLPYGID P GPTGRFSNG+NL D + + LGF
Sbjct  16    QVPCYFIFGDSLYDNGNNNNLPTRARANYLPYGIDLPGGPTGRFSNGRNLPDVITQLLGF  75

Query  322   NSSIPPYSAVTTTEGLLKGVNYASGAGGILDESG-THMGEVISMDQQLVNHGLTLARIAL  498
             ++ IPP++  +  E +LKGVNYASG  GI +E+G  ++G VIS++ QL NH  T++RIA 
Sbjct  76    DNFIPPFATASGQE-ILKGVNYASGGAGIREETGRNNLGVVISLNGQLQNHKTTVSRIAS  134

Query  499   YMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAKKHYVQLK  678
              +    +A  +L+KC Y+VG G+NDYINNYL+PQ YP+SR Y PDQ+A +L +++  +LK
Sbjct  135   ILGDQESATQHLSKCLYTVGFGSNDYINNYLLPQFYPTSRQYPPDQYATVLIQQYSQKLK  194

Query  679   KLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMFNDRMKPIIDDLNGS  858
              LH  GA+K+A+FG G LGC P  +  +G    +CVD IN A+Q+FN  +K ++DDLN  
Sbjct  195   TLHNYGAKKIALFGIGPLGCAPGPVAMYGTNGSACVDYINKAIQLFNTNLKTLVDDLNNQ  254

Query  859   LKGAKFILINMTSLALGDPSIIGINN-----VNKACCQVSKTKAKG---QCEEGQVPCSN  1014
              + AKFI IN   L   D S +GI +     +   CC V+          C      CSN
Sbjct  255   FRDAKFIYINTYDLLFADAS-VGIQDDLVTTIIGPCCPVANLPMNNGILTCIPFSTSCSN  313

Query  1015  RNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             R   +FWD  H +E  N+ T  R+Y A  PTDAYP+DI  L+QL
Sbjct  314   RYANIFWDGVHPSETVNVITGGRAYIALNPTDAYPIDIRRLIQL  357



>ref|XP_002267325.1| PREDICTED: GDSL esterase/lipase At1g29670 [Vitis vinifera]
 emb|CBI18439.3| unnamed protein product [Vitis vinifera]
Length=375

 Score =   342 bits (877),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 179/366 (49%), Positives = 235/366 (64%), Gaps = 11/366 (3%)
 Frame = +1

Query  85    AIATLLLMFLSLKPLV------AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGID  246
             AI   L +  S+   V       +  VPC+FIFG S  DNGNNN L T AKANY PYGID
Sbjct  10    AIRCFLFILFSVSGSVHGRHDHGQLMVPCFFIFGASSFDNGNNNALPTLAKANYPPYGID  69

Query  247   FPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGT  426
             FP GPTGRFSNG+++ D ++EFLGF+  IP +++    E +LKGVNYASG  GI  E+G 
Sbjct  70    FPAGPTGRFSNGRSIVDIISEFLGFDDYIPSFASTVGGENILKGVNYASGGSGIRAETGQ  129

Query  427   HMGEVISMDQQLVNHGLT-LARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQK  603
             H G  ISMD QL NH +T L+ I    +   AA+ YLNKC Y+ G+G NDY++NY +P  
Sbjct  130   HAGARISMDGQLRNHQITVLSLINRLGQNESAAKEYLNKCIYAAGLGTNDYVSNYFLPSL  189

Query  604   YPSSRLYTPDQFAELLAKKHYVQLKKLHA-LGARKVAVFGPGVLGCIPEEMETHG--NGS  774
             YP+SR+YTP+Q+A +LA+++  QLK L+   GARKVA+FG   LGC P  + + G  NGS
Sbjct  190   YPTSRIYTPEQYALVLAQQYSRQLKTLYTNYGARKVALFGLAQLGCAPSVVASKGATNGS  249

Query  775   LSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACC  954
              +CVD IN AVQ+FN+R+K ++D+LN +L  AKFI +N+  +A    S      ++  CC
Sbjct  250   -ACVDYINDAVQIFNNRLKELVDELNRNLTDAKFIYVNVYEIASEATSYPSFRVIDAPCC  308

Query  955   QVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISS  1134
              V+       C   Q PC NR+EY +WD  HL+E  N+  A RSY A  PTD  P+DIS 
Sbjct  309   PVASNNTLILCTINQTPCPNRDEYFYWDALHLSEATNMFIANRSYNAQSPTDTCPIDISD  368

Query  1135  LLQLNL  1152
             L +L L
Sbjct  369   LARLLL  374



>ref|XP_011085304.1| PREDICTED: GDSL esterase/lipase At5g45670-like [Sesamum indicum]
Length=367

 Score =   341 bits (875),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 168/345 (49%), Positives = 223/345 (65%), Gaps = 4/345 (1%)
 Frame = +1

Query  121   KPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNLADY  300
             + ++A PQVPC+FIFGDSLVDNGNNNN+ + AKANYLPYGIDFP GPTGRFSNGK   D 
Sbjct  24    RGILAAPQVPCFFIFGDSLVDNGNNNNIQSLAKANYLPYGIDFPRGPTGRFSNGKTTVDV  83

Query  301   LAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNHGLT  480
             +AE LGF+  IPPY+     E +LKGVNYAS A GI  E+G  +G  I    Q+ N+  T
Sbjct  84    VAELLGFDGYIPPYARARGQE-VLKGVNYASAAAGIRPETGQQLGGRIDFTGQVNNYKNT  142

Query  481   LARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAKK  660
             +A++   + G  AA  YL+KC YSVG+G+NDY+NNY MP  Y +SR Y+P+Q+A LL ++
Sbjct  143   VAQVVSLLGGQDAAATYLSKCIYSVGVGSNDYLNNYFMPLFYSTSRRYSPEQYATLLIQQ  202

Query  661   HYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMFNDRMKPII  840
             +  QL+ L+  GARK A+ G G +GC P  +  +     +CV  IN+A ++FN +++ ++
Sbjct  203   YAQQLRNLYNYGARKFALVGVGQIGCSPNALAQNSPDGSTCVQRINNANRIFNSKLRALV  262

Query  841   DDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQVPCS  1011
             DD N +   AKFI I+   +    + +PS  G    N  CC V +   +  C   Q PC 
Sbjct  263   DDFNRNATDAKFIYIDAYGIFQDLIDNPSSFGFRVKNAGCCGVGRNNGQITCLPLQTPCR  322

Query  1012  NRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             NRNEY+FWD FH TE  N+    RSY+A   +DAYP DI  L QL
Sbjct  323   NRNEYLFWDAFHPTEAANIIVGRRSYSAQKASDAYPFDIRRLAQL  367



>ref|XP_009612510.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Nicotiana tomentosiformis]
Length=369

 Score =   341 bits (875),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 176/370 (48%), Positives = 235/370 (64%), Gaps = 8/370 (2%)
 Frame = +1

Query  58    MASG-VKVWFAIA--TLLLMFLSLKPLVAEPQ-VPCYFIFGDSLVDNGNNNNLSTEAKAN  225
             M +G ++ W  +    ++L  +SL    A  Q VPCYFIFGDSLVDNGNNNN+ + A+AN
Sbjct  1     MGTGELRRWILVVQYVVVLGLISLGNYGANAQQVPCYFIFGDSLVDNGNNNNIQSLARAN  60

Query  226   YLPYGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGG  405
             YLPYGIDFP GPTGRFSNGK   D +AE LGFN  IPPY A      +L+GVNYAS A G
Sbjct  61    YLPYGIDFPGGPTGRFSNGKTTVDVIAEQLGFNGYIPPY-ATARGRDILRGVNYASAAAG  119

Query  406   ILDESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINN  585
             I DE+G  +G  IS   Q+ N+  T+ ++   +    AA  YL+KC YSVG+G+NDY+NN
Sbjct  120   IRDETGRQLGGRISFSGQVNNYINTVQQVVQILGDENAAADYLSKCIYSVGLGSNDYLNN  179

Query  586   YLMPQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHG  765
             Y MP  YP+SR +TP+Q+A +L +++  QLK L+  GARK A+ G G +GC P  +  + 
Sbjct  180   YFMPLYYPTSRQFTPEQYASVLIQQYTQQLKILYNNGARKFALIGVGQIGCSPNALAQNS  239

Query  766   NGSLSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINN  936
                 +CV  IN A Q+FN+++K ++D+LN +   AKFI I+   +    + +P   G++ 
Sbjct  240   PDGRTCVQRINVANQLFNNKLKALVDNLNRNTPDAKFIYIDAYGIFQDLIDNPFAFGLSV  299

Query  937   VNKACCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAY  1116
              N  CC V +   +  C   Q PC NRN+Y+FWD FH TE  N+    RSY A  P+DAY
Sbjct  300   TNAGCCGVGRNNGQITCLPFQRPCRNRNQYLFWDAFHPTEAANIVVGRRSYRAQKPSDAY  359

Query  1117  PMDISSLLQL  1146
             P DIS L QL
Sbjct  360   PFDISRLAQL  369



>ref|XP_010687164.1| PREDICTED: GDSL esterase/lipase At4g18970-like [Beta vulgaris 
subsp. vulgaris]
Length=356

 Score =   340 bits (873),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 179/337 (53%), Positives = 228/337 (68%), Gaps = 15/337 (4%)
 Frame = +1

Query  136   EPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDG-PTGRFSNGKNLADYLAEF  312
             EPQVPCYFIFGDSL D GNNN+L T+AKANY PYGIDFP G  TGRFSNG+N AD + E 
Sbjct  23    EPQVPCYFIFGDSLCDAGNNNDLVTKAKANYPPYGIDFPGGVATGRFSNGRNFADRITEL  82

Query  313   LGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNHGLTLARI  492
             LGF+  IPPYS     E +LKGVNYASGA GI  E+G H+GE IS+DQQ+ NH +T+A+ 
Sbjct  83    LGFDEYIPPYSTAKGKE-ILKGVNYASGAAGIRSETGKHLGERISLDQQIQNHAMTVAKF  141

Query  493   ALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAKKHYVQ  672
             A Y  G +  R  L KC Y+V MG+NDYINNY MPQ Y SS +Y+P ++AE L +++  Q
Sbjct  142   AWY--GPKKVRN-LGKCLYTVNMGSNDYINNYFMPQHYTSSSIYSPAEYAEALIRQYAAQ  198

Query  673   LKKLHALGARKVAVFGPGVLGCIPEEMETHG-NGSLSCVDSINSAVQMFNDRMKPIIDDL  849
             LK+L+ LGARK+AVFG G++GC   E+ T G NGSL CVD IN+AVQ FN R+  ++DDL
Sbjct  199   LKRLYFLGARKMAVFGLGLIGCSLGEIYTFGTNGSL-CVDKINAAVQPFNQRLVKLVDDL  257

Query  850   NGSLKGAKFILINMTSLALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQVPCSNRNEYM  1029
             N  L GA+F     T +A    +  G    N  CC+V   +   QC +    C  RN Y+
Sbjct  258   NNKLPGAQF-----TYIASSSNTDTGSAVANATCCEV---RDDYQCIQSNKICEGRNNYI  309

Query  1030  FWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLL  1140
             FWD FH TE+ N+ T   +Y+A    + +P+DI +L+
Sbjct  310   FWDGFHTTEVVNVITGETAYSAPDSNNVHPVDIRTLV  346



>ref|XP_010046959.1| PREDICTED: GDSL esterase/lipase At5g45670-like [Eucalyptus grandis]
Length=359

 Score =   340 bits (873),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 176/361 (49%), Positives = 237/361 (66%), Gaps = 12/361 (3%)
 Frame = +1

Query  73    KVWFAIATLLLMFLSLKP--LVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGID  246
             + W  I  +L +  S  P  ++  PQVPCYFI+GDSL DNGNNN+L T+AKANY PYGID
Sbjct  8     RAWGVILPVLFLISSNSPSWVLGAPQVPCYFIYGDSLADNGNNNDLETQAKANYPPYGID  67

Query  247   FPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGT  426
             FPD  TGRF+NG+   D +A  LGF+  I P+++   +E +L GVNYASG  GI DE+G 
Sbjct  68    FPDRATGRFTNGRTSVDIIAGLLGFDRYIQPFASAKGSE-ILIGVNYASGGSGIRDETGQ  126

Query  427   HMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKY  606
              +G+ IS++ QL NH +T++R+   +     A  YLNKC Y+VGMG+NDYINNY MP  Y
Sbjct  127   QLGDRISLNHQLQNHLVTISRVRDMLGSNATA--YLNKCIYTVGMGSNDYINNYFMPDVY  184

Query  607   PSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHG-NGSLSC  783
              +S+LYTP+Q+A++L K++  QLK L++ GARKVA+FG  V+GC P E+   G NGSL C
Sbjct  185   QTSKLYTPEQYADVLIKQYQQQLKTLYSYGARKVAIFGLSVIGCAPVEISRFGTNGSL-C  243

Query  784   VDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACCQVS  963
             VD INSAV +FNDR+KP++D+LN +L  AKF  I+     +    +  +   +  CC+V 
Sbjct  244   VDKINSAVMLFNDRLKPLVDELNRNLADAKFTYIDF--FGISTAGLPALRVASSTCCKV-  300

Query  964   KTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQ  1143
               +  G C   + PC  R  + F+D  H TEI NL    R+Y A L +DAYP+DI  L  
Sbjct  301   --REDGMCIPFETPCLIRLLHAFYDGIHPTEIVNLVFGARAYKALLSSDAYPIDIHHLAM  358

Query  1144  L  1146
             L
Sbjct  359   L  359



>ref|XP_010460737.1| PREDICTED: GDSL esterase/lipase At1g29660-like [Camelina sativa]
Length=364

 Score =   340 bits (872),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 168/357 (47%), Positives = 232/357 (65%), Gaps = 6/357 (2%)
 Frame = +1

Query  88    IATLLLMFLSLKPLV-AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPT  264
             + ++ ++F+ L   V AEPQVPCYFIFGDSLVDNGNNN L++ A+A+Y PYGIDF  GPT
Sbjct  10    LVSMFVLFIGLGFKVKAEPQVPCYFIFGDSLVDNGNNNRLTSIARADYFPYGIDF-GGPT  68

Query  265   GRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVI  444
             GRFSNGK   D LAE LGF++ IPPYS+V+  + +L+GVNYAS A GI DE+G  +G+ I
Sbjct  69    GRFSNGKTTVDVLAELLGFDNYIPPYSSVSGQQ-ILQGVNYASAAAGIRDETGAQLGQRI  127

Query  445   SMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLY  624
             +   Q+ N+  T++++   +     A  YL +C Y++GMG+NDY+NNY MPQ Y +SR Y
Sbjct  128   TFSGQVENYKNTVSQVVEILGDENTAADYLKRCIYTIGMGSNDYLNNYFMPQVYATSRQY  187

Query  625   TPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSA  804
             +P+Q+A+ L  ++  QL  L++ GARK A+ G G +GC P E+        +CV+ INSA
Sbjct  188   SPEQYAQDLITRYREQLNALYSYGARKFALVGVGAIGCSPNELAQGSPDGTTCVERINSA  247

Query  805   VQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKA  975
              ++FN+++K ++  LN     A+F  IN   +    + +PS  G    N ACC V +   
Sbjct  248   NRIFNNKLKSLVQQLNNDHSDARFTYINAYGVFQDIIANPSAYGFTVTNAACCGVGRNGG  307

Query  976   KGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             +  C  GQ PC NRNEY+FWD FH ++  N   A RSY A   +D YP DIS L QL
Sbjct  308   QLTCLPGQPPCPNRNEYVFWDAFHPSDAANTVIAQRSYNAQSSSDVYPYDISQLAQL  364



>gb|KDP21169.1| hypothetical protein JCGZ_21640 [Jatropha curcas]
Length=368

 Score =   340 bits (873),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 164/361 (45%), Positives = 227/361 (63%), Gaps = 4/361 (1%)
 Frame = +1

Query  73    KVWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFP  252
             K W+ +  +L++ L    + A PQ PCYFIFGDSLVDNGNNN L++ A+ANYLPYGIDFP
Sbjct  9     KWWWVVCVVLMVSLHGNGVKAAPQAPCYFIFGDSLVDNGNNNQLTSLARANYLPYGIDFP  68

Query  253   DGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHM  432
              GPTGRFSNGK   D +AE LGFN  I PYS     + +L+GVNYAS A GI +E+G  +
Sbjct  69    RGPTGRFSNGKTTVDVIAESLGFNGYISPYSTARGQD-ILRGVNYASAAAGIREETGQQL  127

Query  433   GEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPS  612
             G+ IS   Q+ N+  T+++I   +        YL+KC +S+G+G+NDY+NNY MPQ Y S
Sbjct  128   GQRISFSGQVKNYQNTVSQIVNLLGDENTTANYLSKCIFSIGLGSNDYLNNYFMPQFYSS  187

Query  613   SRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDS  792
             SR YTP+Q+A +L +++  QL+ L+  G RK  + G G +GC P E+  +     +CV  
Sbjct  188   SRQYTPEQYANVLIQQYTQQLRILYDNGGRKFVLIGLGQIGCSPSELAQNSPDGRTCVQR  247

Query  793   INSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVS  963
             INSA Q+FN++++ ++   N +   A+FI +N+  +      +P+  G    N  CC V 
Sbjct  248   INSANQIFNNKLRSLVSQFNSNTPDARFIYVNVYGMFQDITSNPARYGFTVTNAGCCGVG  307

Query  964   KTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQ  1143
             +   +  C   Q PC NRN+Y+FWD FH TE  N+    RSY+A   +DAYP DI  L Q
Sbjct  308   RNNGQITCLPFQTPCQNRNQYLFWDAFHPTEAANIIIGRRSYSAQSSSDAYPFDIRRLAQ  367

Query  1144  L  1146
             L
Sbjct  368   L  368



>ref|XP_011102152.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Sesamum indicum]
Length=360

 Score =   340 bits (872),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 168/367 (46%), Positives = 233/367 (63%), Gaps = 11/367 (3%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSL-KPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLP  234
             M SG+K W  +  ++ + ++L   +VAEPQVPCYFIFGDSLVDNGNNNN+ + A+ANYLP
Sbjct  1     MRSGLKPWIVVCVVVAVAVNLLNGVVAEPQVPCYFIFGDSLVDNGNNNNIQSLARANYLP  60

Query  235   YGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILD  414
             YGIDFPDGPTGRFSNGK   D +AE LGF+  IP        E +L+GVNYAS A GI  
Sbjct  61    YGIDFPDGPTGRFSNGKTTVDVIAELLGFDDYIP-------GEQILRGVNYASAAAGIRS  113

Query  415   ESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLM  594
             E+G  +G  I    Q+ N+  T+ ++   +    +A  YL+KC YS+G+G+NDY+NNY M
Sbjct  114   ETGQQLGARIDFTGQVNNYKDTVEQVVNILGDEDSAANYLSKCIYSIGVGSNDYLNNYFM  173

Query  595   PQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGS  774
             P  Y +SR Y+P+Q+A++L +++  Q++ L+  GARK A+ G G +GC P  +  +    
Sbjct  174   PLYYSTSRQYSPEQYADILIQQYSQQIRTLYNYGARKFALIGVGQIGCSPNALAQNSPDG  233

Query  775   LSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNK  945
              +CV  IN A Q+FN++++ ++D+ N   + AKFI IN   +    + +PS  G    N 
Sbjct  234   STCVQRINGANQIFNNKLRALVDEFNSDAQDAKFIYINAYGIFQDLIENPSAFGFRVTNA  293

Query  946   ACCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMD  1125
              CC V +   +  C   Q PC NR+EY+FWD FH TE  N+    RSY+A   +DAYP D
Sbjct  294   GCCGVGRNNGQITCLPLQTPCQNRDEYLFWDAFHPTEAANIIVGRRSYSAQKASDAYPFD  353

Query  1126  ISSLLQL  1146
             I  L QL
Sbjct  354   IRRLAQL  360



>ref|XP_010655321.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Vitis vinifera]
Length=371

 Score =   340 bits (872),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 170/338 (50%), Positives = 226/338 (67%), Gaps = 5/338 (1%)
 Frame = +1

Query  145   VPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNLADYLAEFLGFN  324
             VPC+FIFG S  DNGNNN L T  K+NY PYGIDFP GPTGRFSNG+N+ D ++EFLGF 
Sbjct  35    VPCFFIFGASSFDNGNNNALPTLVKSNYPPYGIDFPAGPTGRFSNGRNIVDIISEFLGFE  94

Query  325   SSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNHGLTLARIALYM  504
               IP +++    E +LKGVNYASG  GI  E+G H G  ISMD QL NH +T++R+   +
Sbjct  95    DYIPSFASTVGGEDILKGVNYASGGSGIRAETGQHNGARISMDAQLRNHHITVSRLINRL  154

Query  505   -KGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAKKHYVQLKK  681
              +   AA+ YLNKC Y+ G+G NDY++NY +P  YP+SR+YTP+Q+A +LA+++  QLK 
Sbjct  155   GQNESAAKEYLNKCIYAAGLGTNDYVSNYFLPSLYPTSRIYTPEQYALVLAQQYSRQLKT  214

Query  682   LHA-LGARKVAVFGPGVLGCIPEEMETHG--NGSLSCVDSINSAVQMFNDRMKPIIDDLN  852
             L+   GARKVA+FG   LGC P  + + G  NGS +CVD IN AVQ+FN+R+K ++D+LN
Sbjct  215   LYTNYGARKVALFGLAQLGCAPSVVASKGATNGS-ACVDYINDAVQIFNNRLKELVDELN  273

Query  853   GSLKGAKFILINMTSLALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQVPCSNRNEYMF  1032
              +L  AKFI +N+  +A    S      ++  CC V+       C   Q PC NR+EY++
Sbjct  274   RNLTDAKFIYVNVYEIASEATSYPSFRVIDAPCCPVASNNTLILCTINQTPCPNRDEYLY  333

Query  1033  WDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             WD  HL+E  N+  A RSY A  PT   P+DIS L +L
Sbjct  334   WDALHLSEATNMFIANRSYNAQSPTHTCPIDISDLAKL  371



>ref|XP_003629880.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AET04356.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=363

 Score =   340 bits (871),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 170/354 (48%), Positives = 232/354 (66%), Gaps = 6/354 (2%)
 Frame = +1

Query  97    LLLMFLSLKPLV-AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRF  273
             LL++ L L   V A+PQVPCYFIFGDSLVDNGNNN L + A+A+YLPYGIDF  GPTGRF
Sbjct  12    LLVVVLGLWSGVGADPQVPCYFIFGDSLVDNGNNNGLQSLARADYLPYGIDF-GGPTGRF  70

Query  274   SNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMD  453
             SNGK   D +AE LGF+  IPPY A  + + +LKGVNYAS A GI +E+G  +G  +S  
Sbjct  71    SNGKTTVDAIAELLGFDDYIPPY-ASASDDAILKGVNYASAAAGIREETGRQLGARLSFS  129

Query  454   QQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPD  633
              Q+ N+  T++++   +     A  +L+KC YS+G+G+NDY+NNY MPQ Y +   YTPD
Sbjct  130   AQVQNYQSTVSQVVNILGTEDQAASHLSKCIYSIGLGSNDYLNNYFMPQFYNTHDQYTPD  189

Query  634   QFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQM  813
             ++A+ L + +  QL+ L+  GARK+ +FG G +GC P E+ T     ++CV+ INSA Q+
Sbjct  190   EYADDLIQSYTEQLRTLYNNGARKMVLFGIGQIGCSPNELATRSADGVTCVEEINSANQI  249

Query  814   FNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKAKGQ  984
             FN+++K ++D  N  L  +K I +N   +    + +PS  G +  N  CC V +   +  
Sbjct  250   FNNKLKGLVDQFNNQLPDSKVIYVNSYGIFQDIISNPSAYGFSVTNAGCCGVGRNNGQFT  309

Query  985   CEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             C   Q PC NR EY+FWD FH TE GN+  A R+Y+A  P DAYP+DIS L QL
Sbjct  310   CLPLQTPCENRREYLFWDAFHPTEAGNVVVAQRAYSAQSPDDAYPIDISHLAQL  363



>ref|XP_010549444.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Tarenaya hassleriana]
Length=365

 Score =   340 bits (871),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 173/367 (47%), Positives = 230/367 (63%), Gaps = 6/367 (2%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLKPLV-AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLP  234
             M   ++ W+ +   L+  L L   V   PQVPCYFIFGDSLVDNGNNN L + A+ANY P
Sbjct  1     MEGYMRKWYMVFVGLIFGLMLGFRVNGAPQVPCYFIFGDSLVDNGNNNRLVSLARANYFP  60

Query  235   YGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILD  414
             YGIDFP GPTGRFSNGK   D +A+ LGF+  IPPYSA +  + +L GVNYAS A GI +
Sbjct  61    YGIDFPGGPTGRFSNGKTTVDVIAQLLGFDGYIPPYSAASGRQ-ILSGVNYASAAAGIRE  119

Query  415   ESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLM  594
             E+G  +G+ IS   Q+ N+  T++++   +     A  YL +C YSVG+G+NDY+NNY M
Sbjct  120   ETGRQLGQRISFSGQVRNYQNTVSQVVNLLGDENTAADYLRRCIYSVGLGSNDYLNNYFM  179

Query  595   PQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGS  774
             P  Y SSR +TP+QFA+ L  ++  QL  L+  GARK A+ G G +GC P ++    +G 
Sbjct  180   PTFYSSSRQFTPEQFADDLINRYSQQLNALYNYGARKFALIGVGAIGCSPNKLANSRDGR  239

Query  775   LSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNK  945
              +C + INSA Q+FN++++ ++D LN +L  AKFI IN   +    + +PS  G    N 
Sbjct  240   -TCDERINSANQIFNNKLRSLVDRLNNNLPDAKFIYINAYGIFQDLVNNPSAYGFRVTNA  298

Query  946   ACCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMD  1125
              CC V +   +  C  GQ PC +RN Y+FWD FH TE  N     RSY A   +DAYP D
Sbjct  299   GCCGVGRNGGQITCLPGQRPCQSRNAYVFWDAFHPTEAANTIIGQRSYRARSSSDAYPFD  358

Query  1126  ISSLLQL  1146
             IS L QL
Sbjct  359   ISRLAQL  365



>ref|XP_010924691.1| PREDICTED: GDSL esterase/lipase At5g45670-like [Elaeis guineensis]
Length=367

 Score =   339 bits (870),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 167/360 (46%), Positives = 227/360 (63%), Gaps = 5/360 (1%)
 Frame = +1

Query  76    VWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPD  255
             +W     LL     +  +  +PQVPCYFIFGDSLVDNGNNN++++ A+ANY+PYGIDFP 
Sbjct  10    LWVWWLMLLASSWLMGSVRMDPQVPCYFIFGDSLVDNGNNNDMASLARANYMPYGIDFPG  69

Query  256   GPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMG  435
             GPTGRFSNG    D +A+ LGF   I PY+A      LL GVN+AS A GI +E+G  +G
Sbjct  70    GPTGRFSNGLTAVDVIAQLLGFEDFISPYAA-ARDRALLTGVNFASAAAGIREETGQQLG  128

Query  436   EVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSS  615
             + IS   QL N+   +  +   +    +A  YL+KC +SVGMG+NDY+NNY MP  Y SS
Sbjct  129   DRISFSGQLENYQAAVQEVVNILGDEDSAANYLSKCIFSVGMGSNDYLNNYFMPAFYSSS  188

Query  616   RLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSI  795
             R YTP+Q+A +L +++  Q++ L+  GARKV + G G +GC P E+    +   +CV+ I
Sbjct  189   RQYTPEQYANVLIEQYSQQIRTLYNYGARKVVLMGVGQIGCSPNELAQQSSNGETCVNRI  248

Query  796   NSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSK  966
             NSA+Q+FN ++  ++D+ N +L GA F  IN   +    L +PS  G+   N+ CC V K
Sbjct  249   NSAIQIFNSKLIALVDEFN-TLDGAHFTYINAYGIFEDILRNPSAHGLTVTNRGCCGVGK  307

Query  967   TKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
                +  C   Q PC NRNEY+FWD FH TE  N+    RSY+A   +DAYPMDI  L Q+
Sbjct  308   NNGQITCLPYQTPCPNRNEYLFWDAFHPTEAANIVIGKRSYSAESSSDAYPMDIRHLAQI  367



>ref|XP_010272684.1| PREDICTED: GDSL esterase/lipase At4g18970-like [Nelumbo nucifera]
Length=351

 Score =   339 bits (869),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 162/345 (47%), Positives = 233/345 (68%), Gaps = 5/345 (1%)
 Frame = +1

Query  115   SLKPLV-AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNL  291
             +L P V A+PQVPCYFIFGDSLVDNGNNN LS+ A+A+Y PYGIDFP GPTGRF NG+  
Sbjct  5     NLSPTVRADPQVPCYFIFGDSLVDNGNNNILSSLARADYQPYGIDFPAGPTGRFCNGRTT  64

Query  292   ADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNH  471
              D +A+ LGF+  IPPY+++   E LL+G N+AS A GI DE+G  +G+ ISM+ Q+ N+
Sbjct  65    TDVIAQLLGFDDFIPPYASIRGQE-LLRGANFASAAAGIRDETGRQLGDRISMNGQVRNY  123

Query  472   GLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELL  651
                +A++   +    +A  +L+KC ++VGMG+NDY+NNY MP  Y + + ++P+++A++L
Sbjct  124   QTAVAQLVEILGDEDSAADHLSKCIFTVGMGSNDYLNNYFMPLYYTTGQQFSPEEYADVL  183

Query  652   AKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMFNDRMK  831
              +++  QL+ L+  GARKVAV G G +GC P E+  +    ++CV  INSA Q+FN+++K
Sbjct  184   IQEYSGQLRTLYDYGARKVAVIGVGQIGCSPNELAQNSPNGVTCVGRINSANQIFNEKLK  243

Query  832   PIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQV  1002
              ++DDLN +L GA F  IN   +    + +PS  G    N  CC V +   +  C   ++
Sbjct  244   ALVDDLNSNLDGAHFTYINAYGIFEDMMKNPSAYGFTVTNSGCCGVGRNNGQITCLPLEI  303

Query  1003  PCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSL  1137
             PC NR++Y+FWD FH TE  N+  A RSY+A   +DAYP+DI  L
Sbjct  304   PCQNRDQYLFWDAFHPTEAANVVVARRSYSAQSSSDAYPIDIRRL  348



>gb|EYU43295.1| hypothetical protein MIMGU_mgv1a008614mg [Erythranthe guttata]
Length=368

 Score =   339 bits (870),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 171/369 (46%), Positives = 223/369 (60%), Gaps = 7/369 (2%)
 Frame = +1

Query  58    MASGVKVWFAI---ATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANY  228
             MA  VK W  +   A  L   L    + AEPQVPC+FIFGDSLVDNGNNNN+ + A+ANY
Sbjct  1     MAITVKSWITVLIVAVTLATELRHAVVSAEPQVPCFFIFGDSLVDNGNNNNIQSLARANY  60

Query  229   LPYGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGI  408
             LPYGIDFP GPTGRFSNGK   D +AE LGF   I PY A    E +LKGVNYAS A GI
Sbjct  61    LPYGIDFPVGPTGRFSNGKTTVDVVAELLGFEDFIRPY-ATARGEQVLKGVNYASAAAGI  119

Query  409   LDESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNY  588
               E+G  +G  I    Q+ N+  T+ ++   +    +A  YL+KC YS+G+G+NDY+NNY
Sbjct  120   RSETGQQLGARIDFTGQVNNYKNTVNQVVNILGDQESASKYLSKCIYSIGLGSNDYLNNY  179

Query  589   LMPQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGN  768
              MP  Y +SR Y PDQ+A++L +++  QLK L+  GARK A+ G G +GC P  +  +  
Sbjct  180   FMPLYYSTSRQYLPDQYADILIQQYTEQLKTLYNFGARKFALIGIGQIGCSPNALAQNSP  239

Query  769   GSLSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNV  939
                +CV  IN A Q+FN+++K ++DD N +   AKF  I+   +    +  P+  G    
Sbjct  240   DGATCVQRINGANQIFNEKLKSLVDDFNRNTPDAKFTYIDAYGIFQDLINSPTSFGFKVT  299

Query  940   NKACCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYP  1119
             N  CC V +   +  C   Q PC NR+EY+FWD FH TE  N+    RSY A   TDAYP
Sbjct  300   NAGCCGVGRNNGQITCLPLQTPCQNRDEYLFWDAFHPTEAANIFVGKRSYAALKSTDAYP  359

Query  1120  MDISSLLQL  1146
              DI  L  +
Sbjct  360   FDIRRLAHI  368



>ref|XP_010478329.1| PREDICTED: GDSL esterase/lipase At1g29660 [Camelina sativa]
Length=364

 Score =   339 bits (869),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 169/353 (48%), Positives = 229/353 (65%), Gaps = 6/353 (2%)
 Frame = +1

Query  97    LLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFS  276
             +L + L  K + AEPQVPCYFIFGDSLVDNGNNN L++ A+A+Y PYGIDF  GPTGRFS
Sbjct  15    VLCLGLGFK-VKAEPQVPCYFIFGDSLVDNGNNNRLTSIARADYFPYGIDF-GGPTGRFS  72

Query  277   NGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQ  456
             NGK   D LAE LGF++ IPPYS+V+  + +L+GVNYAS A GI DE+G  +G+ I+   
Sbjct  73    NGKTTVDVLAELLGFDNYIPPYSSVSGQQ-ILQGVNYASAAAGIRDETGAQLGQRITFSG  131

Query  457   QLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQ  636
             Q+ N+  T++++   +     A  YL +C Y++GMG+NDY+NNY MPQ Y +SR Y+P+Q
Sbjct  132   QVENYKNTVSQVVEILGDENTAADYLKRCIYTIGMGSNDYLNNYFMPQVYATSRQYSPEQ  191

Query  637   FAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMF  816
             +AE L  ++  QL  L++ GARK A+ G G +GC P E+        +CV+ INSA ++F
Sbjct  192   YAEDLITRYRDQLNALYSYGARKFALVGVGAIGCSPNELAQGSPDGTTCVERINSANRIF  251

Query  817   NDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKAKGQC  987
             N+++K ++  LN     A+F  IN   +    + +PS  G    N ACC V +   +  C
Sbjct  252   NNKLKSLVQQLNNDHSDARFTYINAYGVFEDIIANPSAYGFTVTNAACCGVGRNGGQLTC  311

Query  988   EEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
               GQ PC NRNEY+FWD FH ++  N   A RSY A   +D YP DIS L QL
Sbjct  312   LPGQPPCPNRNEYVFWDAFHPSDAANTVIAQRSYNAQSSSDVYPYDISQLAQL  364



>gb|KHN48037.1| GDSL esterase/lipase [Glycine soja]
Length=358

 Score =   338 bits (868),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 165/339 (49%), Positives = 224/339 (66%), Gaps = 4/339 (1%)
 Frame = +1

Query  139   PQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNLADYLAEFLG  318
             PQVPCYFIFGDSLVDNGNNN L + A+A+YLPYGIDFP GP+GRFSNGK   D +AE LG
Sbjct  21    PQVPCYFIFGDSLVDNGNNNQLQSLARADYLPYGIDFPGGPSGRFSNGKTTVDAIAELLG  80

Query  319   FNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNHGLTLARIAL  498
             F+  IPPY A  + + +LKGVNYAS A GI +E+G  +G  IS   Q+ N+  T++++  
Sbjct  81    FDDYIPPY-ADASGDAILKGVNYASAAAGIREETGQQLGGRISFRGQVQNYQNTVSQVVN  139

Query  499   YMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAKKHYVQLK  678
              +    +A  YL+KC YS+G+G+NDY+NNY MPQ Y SSR Y+ D++A++L + +  QLK
Sbjct  140   LLGNEDSAANYLSKCIYSIGLGSNDYLNNYFMPQFYSSSRQYSTDEYADVLIQAYTEQLK  199

Query  679   KLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMFNDRMKPIIDDLNGS  858
              L+  GARK+ +FG G +GC P E+  +     +CV+ IN+A Q+FN+++K + D  N  
Sbjct  200   TLYNYGARKMVLFGIGQIGCSPNELAQNSPDGKTCVEIINTANQIFNNKLKGLTDQFNNQ  259

Query  859   LKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQVPCSNRNEYM  1029
             L  AK I IN   +    + +PS  G +  N  CC V +   +  C   Q PC NR EY+
Sbjct  260   LPDAKVIYINSYGIFQDIISNPSAYGFSVTNAGCCGVGRNNGQITCLPMQTPCQNRREYL  319

Query  1030  FWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             FWD FH TE GN+  A R+Y+A   +DAYP+DI  L Q+
Sbjct  320   FWDAFHPTEAGNVVVAQRAYSAQSASDAYPVDIQRLAQI  358



>gb|ABY59947.1| nectar protein 1 [Jacaranda mimosifolia]
Length=339

 Score =   338 bits (866),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 160/340 (47%), Positives = 222/340 (65%), Gaps = 4/340 (1%)
 Frame = +1

Query  136   EPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNLADYLAEFL  315
             +PQVPC+FIFGDSLVDNGNNNN+ + A+ANYLPYG+DFPDGPTGRFSNGK   D +AE L
Sbjct  1     KPQVPCFFIFGDSLVDNGNNNNIQSLARANYLPYGVDFPDGPTGRFSNGKTTVDVIAELL  60

Query  316   GFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNHGLTLARIA  495
             GF+  IPPY++ +  + +L+GVNYAS A GI  E+G  +G  I    Q+ N+  T+A++ 
Sbjct  61    GFDDYIPPYASASGDQ-ILRGVNYASAAAGIRSETGQQLGARIDFTGQVNNYKNTVAQVV  119

Query  496   LYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAKKHYVQL  675
               +    +A  YL+KC YSVG+G+NDY+NNY MP  Y S R Y+P+Q+++LL +++  Q+
Sbjct  120   DILGDEDSAANYLSKCIYSVGVGSNDYLNNYFMPLYYSSGRQYSPEQYSDLLIQQYSEQI  179

Query  676   KKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMFNDRMKPIIDDLNG  855
             + L+  GARK ++ G G +GC P  +  +     +C+  IN A QMFN++++ ++D+LN 
Sbjct  180   RTLYNYGARKFSLIGVGQIGCSPNALAQNSPDGSTCIRRINDANQMFNNKLRALVDELNN  239

Query  856   SLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQVPCSNRNEY  1026
               + AKFI IN   +    + +PS  G    N  CC V +   +  C   Q PC NR+EY
Sbjct  240   GAQDAKFIYINAYGIFQDLIDNPSAFGFRVTNAGCCGVGRNNGQITCLPMQTPCQNRDEY  299

Query  1027  MFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             +FWD FH TE  N+    RSY A   +DAYP DI  L QL
Sbjct  300   LFWDAFHPTEAANVVVGRRSYRAEKASDAYPFDIQRLAQL  339



>ref|XP_006355559.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Solanum tuberosum]
Length=366

 Score =   338 bits (868),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 170/365 (47%), Positives = 229/365 (63%), Gaps = 7/365 (2%)
 Frame = +1

Query  67    GVKVWFAIATLLLMFLSLKPL---VAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPY  237
             G ++   I  ++L F+ L          QVPCYFIFGDSLVDNGNNNN+ + A+ANYLPY
Sbjct  2     GSEMRRCILVVVLGFICLGDYYYGANAQQVPCYFIFGDSLVDNGNNNNIQSLARANYLPY  61

Query  238   GIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDE  417
             GIDFP GPTGRFSNGK   D +AE LGFN +IPPY++    + +L+GVNYAS A GI DE
Sbjct  62    GIDFPGGPTGRFSNGKTTVDVIAEQLGFNGNIPPYASARGRD-VLRGVNYASAAAGIRDE  120

Query  418   SGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMP  597
             +G  +G  IS   Q+ N+  T+ ++   +    A   YL KC YSVG+G+NDY+NNY MP
Sbjct  121   TGRQLGGRISFSGQVNNYRNTVQQVVQILGNENATADYLKKCIYSVGLGSNDYLNNYFMP  180

Query  598   QKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSL  777
               YP+SR +TPDQ+A +L +++  QLK L++ GARK A+ G G +GC P  +  +     
Sbjct  181   LTYPTSRQFTPDQYATVLIQQYTQQLKILYSNGARKFALIGVGQIGCSPNALAQNSPDGR  240

Query  778   SCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKA  948
             +CV  IN A Q+FN+++K ++D+LNG+   AKFI ++   +    + +P+  G    N  
Sbjct  241   TCVQRINVANQLFNNKLKALVDNLNGNTPDAKFIYLDAYGIFQDLIDNPAAFGFRVTNAG  300

Query  949   CCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDI  1128
             CC V +   +  C   Q PC NR EY+FWD FH TE  N+    R Y A   +DAYP DI
Sbjct  301   CCGVGRNNGQITCLPFQTPCRNRGEYLFWDAFHPTEAANIVVGRRQYRAQKSSDAYPYDI  360

Query  1129  SSLLQ  1143
             S L Q
Sbjct  361   SRLAQ  365



>ref|XP_006305157.1| hypothetical protein CARUB_v10009525mg [Capsella rubella]
 gb|EOA38055.1| hypothetical protein CARUB_v10009525mg [Capsella rubella]
Length=363

 Score =   338 bits (867),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 172/366 (47%), Positives = 232/366 (63%), Gaps = 6/366 (2%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPY  237
             M S +  W  +  LL    SL     + QVPC+F+FGDSLVDNGNNN L + A+ANY PY
Sbjct  1     MESYLSKWCLVFVLLSFGSSLVKAQPQAQVPCFFVFGDSLVDNGNNNGLVSFARANYFPY  60

Query  238   GIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDE  417
             GIDF  GPTGRFSNGK   D +AE LGFN  IP Y++V+  + +L GVNYAS A GI +E
Sbjct  61    GIDF-GGPTGRFSNGKTTVDEIAELLGFNGYIPAYNSVSGRQ-ILSGVNYASAAAGIREE  118

Query  418   SGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMP  597
             +G  +G+ IS   Q+ N+  T++++   +    +A  YL +C YSVG+G+NDY+NNY MP
Sbjct  119   TGRQLGQRISFSGQVRNYQNTVSQVVQLLGDEASAADYLKRCIYSVGLGSNDYLNNYFMP  178

Query  598   QKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSL  777
               Y SSR +TP+Q+A  L  ++  QL  L+  GARK A+ G G +GC P  +    +G  
Sbjct  179   NFYSSSRQFTPEQYANDLISRYSTQLNALYNYGARKFALSGIGAIGCSPNALSGSRDGR-  237

Query  778   SCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKA  948
             +CVD INSA Q+FN++++ ++D LN +   AKFI IN   +    + +PS  G    N  
Sbjct  238   TCVDRINSANQIFNNKLRSLVDQLNNNHPDAKFIYINAYGIFQDMITNPSRFGFRVTNAG  297

Query  949   CCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDI  1128
             CC + +   +  C  GQ PC+NRN Y+FWD+FH TE  N+  A RSY A  P+DAYPMDI
Sbjct  298   CCGIGRNAGQITCLPGQRPCNNRNAYVFWDSFHPTEAANVIIARRSYNAQSPSDAYPMDI  357

Query  1129  SSLLQL  1146
             S L +L
Sbjct  358   SRLARL  363



>gb|KFK44793.1| hypothetical protein AALP_AA1G304100 [Arabis alpina]
Length=364

 Score =   338 bits (867),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 172/367 (47%), Positives = 238/367 (65%), Gaps = 7/367 (2%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLKPLV-AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLP  234
             M S ++ W  + ++L+MFLSL  ++ AEPQVPCYFIFGDSLVDNGNNN L + A+A+Y P
Sbjct  1     MESYLRKW-CLVSMLVMFLSLGLMIKAEPQVPCYFIFGDSLVDNGNNNRLISVARADYFP  59

Query  235   YGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILD  414
             YGID    PTGRFSNGK   D LA  LGF++ IP YS V+  E +L+GVNYAS A GI +
Sbjct  60    YGIDLGR-PTGRFSNGKTTVDELAILLGFDNYIPAYSDVSG-EQILQGVNYASAAAGIRE  117

Query  415   ESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLM  594
             E+G  +G+ I+   Q+ N+  T++++   +     A  YL+KC Y++GMG+NDY+NNY M
Sbjct  118   ETGQQLGQRITFSGQVQNYKSTVSQVVQILGDENTAADYLSKCIYTIGMGSNDYLNNYFM  177

Query  595   PQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGS  774
             PQ Y +SR Y PDQ+A+ L  ++Y QL  L+  GARK A+ G G +GC P  +       
Sbjct  178   PQSYSTSRQYNPDQYADDLISRYYNQLNDLYRYGARKFALVGIGAIGCSPNALAQGSPDG  237

Query  775   LSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNK  945
              +CV+ INSA ++FN+++K +++ LN +   AKF  IN   +    + +PS  G  + N 
Sbjct  238   RTCVERINSANRIFNNKLKSMVNRLNNNRADAKFTYINAYGVFQDIISNPSQYGFTDTNT  297

Query  946   ACCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMD  1125
             ACC V +   +  C  GQ PC NR+E++FWD FH T+  N   A RSY A   +D YP+D
Sbjct  298   ACCGVGRNGGQLTCLPGQPPCLNRDEHVFWDAFHPTDAANTIIAQRSYQAQSSSDVYPID  357

Query  1126  ISSLLQL  1146
             IS+L QL
Sbjct  358   ISTLAQL  364



>ref|XP_004497726.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Cicer arietinum]
Length=367

 Score =   338 bits (867),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 168/359 (47%), Positives = 230/359 (64%), Gaps = 5/359 (1%)
 Frame = +1

Query  79    WFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDG  258
             W     ++++ +    +   PQVPCYFIFGDSLVD+GNNN LS+ AKANY PYGIDFP G
Sbjct  11    WIISVMVVVLGMWSCGVGGAPQVPCYFIFGDSLVDDGNNNQLSSLAKANYFPYGIDFPGG  70

Query  259   PTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGE  438
             PTGRFSNGK   D +AE LGF   I PY A      +LKGVNYAS A GI +E+G  +G+
Sbjct  71    PTGRFSNGKTTVDVIAELLGFEDYISPY-ATARDRDILKGVNYASAAAGIREETGQQLGD  129

Query  439   VISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSR  618
              IS   Q+ N+  T++++   +        YL+K  YS+G+G+NDY+NNY MP  Y SSR
Sbjct  130   RISFSGQVQNYQKTVSQMVNLLGDENTTANYLSKYIYSIGLGSNDYLNNYFMP-AYSSSR  188

Query  619   LYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSIN  798
              YTP QFA++L + +  QL+ L+  GARK+A+FG G +GC P E+  +     +CV+ I+
Sbjct  189   QYTPQQFADVLIQAYAEQLRILYNYGARKMALFGVGEIGCSPNELAQNSPDGRTCVERID  248

Query  799   SAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKT  969
             SA Q+FN+ +K ++D LN  L  A+FI +N+  +    + +PS  G+   N+ CC V + 
Sbjct  249   SANQLFNNGLKSLVDQLNNQLPDARFIYVNVYGIFQDIINNPSSFGLRVTNEGCCGVGRN  308

Query  970   KAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
               +  C   Q PC+NRNEY+FWD FH TEIGN     R+Y A   +DAYP+DI+ L Q+
Sbjct  309   NGQITCLPLQTPCNNRNEYLFWDAFHPTEIGNTIIGKRAYNAQSASDAYPIDINRLTQI  367



>ref|XP_009102833.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Brassica rapa]
Length=360

 Score =   338 bits (866),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 174/367 (47%), Positives = 231/367 (63%), Gaps = 11/367 (3%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLKPLVAEPQ-VPCYFIFGDSLVDNGNNNNLSTEAKANYLP  234
             M S  + W     ++ + L+L   VA+ Q VPCYFIFGDSLVDNGNNN L + A+ANY P
Sbjct  1     MESYSRKW----CVVFVLLALASSVAKAQQVPCYFIFGDSLVDNGNNNGLVSFARANYFP  56

Query  235   YGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILD  414
             YGIDF  GPTGRFSNGK   D +AE LGF   IP Y+ V+  + +L GVNYAS A GI +
Sbjct  57    YGIDF-GGPTGRFSNGKTTVDEIAELLGFKDYIPAYNTVSGRQ-ILTGVNYASAAAGIRE  114

Query  415   ESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLM  594
             E+G  +G+ IS   Q+ N+  T+ ++   + G   A  YL KC YSVG+G+NDY+NNY M
Sbjct  115   ETGRQLGQRISFSGQVRNYQTTVQQVVSVLGGEAQAADYLKKCIYSVGIGSNDYLNNYFM  174

Query  595   PQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGS  774
             P  Y SSR +TP+QFA+ L  ++  QL  L+  GARK A+ G G +GC P  + +    S
Sbjct  175   PTFYSSSRQFTPEQFADDLISRYTTQLNALYNYGARKFALIGVGAIGCSPNAL-SRSRDS  233

Query  775   LSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNK  945
              +C D INSA Q+FN++++ ++D LN +   A+F  IN   +    + +PS  G    N 
Sbjct  234   KTCDDRINSANQIFNNKLRSMVDQLNNNHPDARFTYINAYGIFQDMITNPSRFGFTTTNA  293

Query  946   ACCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMD  1125
              CC + +   +  C  GQ PC NRN Y+FWD FH TE  N+  A RSYTA  P+DAYP+D
Sbjct  294   GCCGIGRNAGQITCLPGQRPCGNRNAYVFWDAFHPTEAANVVIARRSYTAQSPSDAYPID  353

Query  1126  ISSLLQL  1146
             ISSL +L
Sbjct  354   ISSLARL  360



>ref|XP_004504253.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Cicer arietinum]
Length=362

 Score =   337 bits (865),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 162/341 (48%), Positives = 223/341 (65%), Gaps = 4/341 (1%)
 Frame = +1

Query  133   AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNLADYLAEF  312
             A PQVPCYFIFGDSLVDNGNNN L + A+A+YLPYGIDFP GP+GRFSNGK   D +AE 
Sbjct  23    AAPQVPCYFIFGDSLVDNGNNNALRSLARADYLPYGIDFPGGPSGRFSNGKTTVDAIAEL  82

Query  313   LGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNHGLTLARI  492
             LGF+  IPPY A  + + +LKGVNYAS A GI +E+G  +G  IS   Q+ N+  T++++
Sbjct  83    LGFDDYIPPY-ASASDDAILKGVNYASAAAGIREETGQQLGGRISFSGQVQNYQTTVSQV  141

Query  493   ALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAKKHYVQ  672
                +     A  YL+KC YS+G+G+NDY+NNY MPQ Y +   YTPD++A+ L + +  Q
Sbjct  142   VNLLGNEDQAATYLSKCIYSIGLGSNDYLNNYFMPQFYSTGSQYTPDEYADNLIQSYTEQ  201

Query  673   LKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMFNDRMKPIIDDLN  852
             LK L+  GARK+ +FG G +GC P ++  +     +CV+ INSA ++FN+++K ++D  N
Sbjct  202   LKTLYNYGARKMVLFGIGQIGCSPNQLAQNSPDGTTCVEKINSANEIFNNKLKSLVDQFN  261

Query  853   GSLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQVPCSNRNE  1023
               L  ++ I IN   +    + +PS  G +  N  CC V +   +  C   Q PC NR E
Sbjct  262   NQLPDSRVIYINSYGIFQDIISNPSAYGFSVTNAGCCGVGRNNGQITCLPMQTPCDNRRE  321

Query  1024  YMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             Y+FWD FH TE GN+  A R+Y A   +DAYP+DI+ L Q+
Sbjct  322   YLFWDAFHPTEAGNVVVAQRAYNAQSASDAYPIDINHLAQI  362



>gb|AAZ23955.1| GDSL-lipase 1 [Capsicum annuum]
Length=363

 Score =   337 bits (865),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 170/366 (46%), Positives = 233/366 (64%), Gaps = 7/366 (2%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLM-FLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLP  234
             M S ++ W  +  L+++ F+S     A+ QVPCYFIFGDSLVDNGNNNN+ + A+ANYLP
Sbjct  1     MGSEMRGWILVVQLVILGFMSFYGANAQ-QVPCYFIFGDSLVDNGNNNNIQSLARANYLP  59

Query  235   YGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILD  414
             YGIDFP GPTGRFSNGK   D +AE LGFN+ IPPY++    + +L+GVNYAS A GI +
Sbjct  60    YGIDFPGGPTGRFSNGKTTVDVIAEQLGFNN-IPPYASARGRD-ILRGVNYASAAAGIRE  117

Query  415   ESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLM  594
             E+G  +G  I    Q+ N+  T+ ++   +    AA  YL KC YS+G+G+NDY+NNY M
Sbjct  118   ETGRQLGARIPFSGQVNNYRNTVQQVVQILGNENAAADYLKKCIYSIGLGSNDYLNNYFM  177

Query  595   PQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGS  774
             P  Y +SR +TP+Q+A +L +++  QL+ L+  GARK A+ G G +GC P  +  +    
Sbjct  178   PMYYSTSRQFTPEQYANVLIQQYTQQLRILYNNGARKFALIGVGQIGCSPNALAQNSPDG  237

Query  775   LSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNK  945
              +CV  IN A Q+FN+++K ++D+ NG+   AKFI I+   +    + +PS  G    N 
Sbjct  238   RTCVQRINVANQIFNNKLKALVDNFNGNAPDAKFIYIDAYGIFQDLIENPSAFGFRVTNA  297

Query  946   ACCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMD  1125
              CC V +   +  C   Q PC NRNEY+FWD FH TE  N+    RSY A   +DAYP D
Sbjct  298   GCCGVGRNNGQITCLPFQRPCPNRNEYLFWDAFHPTEAANIIVGRRSYRAQRSSDAYPFD  357

Query  1126  ISSLLQ  1143
             IS L Q
Sbjct  358   ISRLAQ  363



>ref|XP_006415557.1| hypothetical protein EUTSA_v10008016mg [Eutrema salsugineum]
 gb|ESQ33910.1| hypothetical protein EUTSA_v10008016mg [Eutrema salsugineum]
Length=360

 Score =   337 bits (864),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 175/366 (48%), Positives = 230/366 (63%), Gaps = 9/366 (2%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPY  237
             M S +K W  +  LL + LS+   V   QVPCYFIFGDSLVDNGNNN L + A+ANY PY
Sbjct  1     MESYLKKWRVVFVLLSLGLSV---VKAQQVPCYFIFGDSLVDNGNNNGLVSFARANYFPY  57

Query  238   GIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDE  417
             GIDF  GPTGRFSNGK  AD LAE LGFN  IP Y+AV     +L GVNYAS A GI +E
Sbjct  58    GIDF-GGPTGRFSNGKTTADELAELLGFNGYIPAYNAVRGRR-ILTGVNYASAAAGIREE  115

Query  418   SGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMP  597
             +G  +G+ IS   Q+ N+  T+ ++   + G   A  YL +C YSVG+G+NDY+NNY MP
Sbjct  116   TGRQLGQRISFSGQVRNYQNTVQQVVSLLGGETQAADYLKRCIYSVGLGSNDYLNNYFMP  175

Query  598   QKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSL  777
               Y SSR +TP+Q+A+ L  ++  QL  L+  GARK A+ G G +GC P  +      S 
Sbjct  176   TFYSSSRQFTPEQYADDLISRYSTQLNALYNYGARKFALIGVGAIGCSPNAL-ARSRDSR  234

Query  778   SCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKA  948
             +C + INSA Q+FN++++ ++D LN +   A+F  IN   +    + +PS  G    N  
Sbjct  235   TCDNRINSANQIFNNKLRSLVDTLNNNHPDARFTYINAYGIFQDMITNPSRFGFRVTNAG  294

Query  949   CCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDI  1128
             CC + +   +  C  GQ PC NRN Y+FWD FH TE  N+  A RSY A  P+DAYP+DI
Sbjct  295   CCGIGRNAGQITCLPGQRPCPNRNAYVFWDAFHPTEAANVVIAKRSYNAQSPSDAYPIDI  354

Query  1129  SSLLQL  1146
             S+L +L
Sbjct  355   SALARL  360



>emb|CDY35297.1| BnaC03g59260D [Brassica napus]
Length=364

 Score =   337 bits (865),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 176/367 (48%), Positives = 235/367 (64%), Gaps = 7/367 (2%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLKPLV-AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLP  234
             M S ++ W  + ++L+++L L   V AEPQVPCYFIFGDSLVDNGNNN LS+ A+A+YLP
Sbjct  1     MESYLRKW-CLVSVLVLYLGLGFNVKAEPQVPCYFIFGDSLVDNGNNNGLSSLARADYLP  59

Query  235   YGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILD  414
             YGID   GPTGRFSNGK   D +AE LGF++ IP YS V+  E +L+GVNYAS A GI +
Sbjct  60    YGIDL-GGPTGRFSNGKTTVDEIAELLGFDNYIPAYSDVSG-EQILQGVNYASAAAGIRE  117

Query  415   ESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLM  594
             E+G  +G+ I    Q+ N+  T+A++   +     A  YL KC YSVG+G+NDY+NNY M
Sbjct  118   ETGQQLGQRIPFSGQVQNYQNTVAQVVELLGDENTAADYLRKCIYSVGLGSNDYLNNYFM  177

Query  595   PQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGS  774
             PQ Y +SR YTP+Q+A+ L  ++  QL  L+  GARK A+ G G +GC P  +       
Sbjct  178   PQYYSTSRQYTPEQYADDLINRYRDQLNALYNYGARKFALVGVGAIGCSPNALAQGSPDG  237

Query  775   LSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNK  945
              +CV+ +NSA ++FN+R+K ++  LN     AKF  IN   +    + +PS  G    N 
Sbjct  238   TTCVERLNSANRIFNNRLKSMVQQLNNEHSDAKFTYINAYGVFQDIIANPSTYGFTVTNA  297

Query  946   ACCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMD  1125
             ACC V K   +  C  GQ PC NRNEY+FWD FH T+  N   A RSY A   +D YP+D
Sbjct  298   ACCGVGKNGGQLTCLPGQGPCPNRNEYVFWDAFHPTDAANTIIAQRSYNARSSSDVYPID  357

Query  1126  ISSLLQL  1146
             IS+L +L
Sbjct  358   ISALARL  364



>ref|XP_002890825.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH67084.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=363

 Score =   337 bits (865),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 172/366 (47%), Positives = 229/366 (63%), Gaps = 6/366 (2%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPY  237
             M S +K W  +  LL    S+    A+ QVPCYFIFGDSLVDNGNNN L + A++NY PY
Sbjct  1     MESYLKKWCVVLVLLCFGFSVVKAQAQAQVPCYFIFGDSLVDNGNNNGLISIARSNYFPY  60

Query  238   GIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDE  417
             GIDF  GPTGRFSNGK   D +AE LGFN  IP Y+ V+  + +L GVNYAS A GI +E
Sbjct  61    GIDF-GGPTGRFSNGKTTVDEIAELLGFNDYIPAYNTVSGRQ-ILSGVNYASAAAGIREE  118

Query  418   SGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMP  597
             +G  +G+ IS   Q+ N+  T++++   +     A  YL +C YSVG+G+NDY+NNY MP
Sbjct  119   TGRQLGQRISFSGQVRNYQNTVSQVVQLLGDETRAADYLKRCIYSVGLGSNDYLNNYFMP  178

Query  598   QKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSL  777
               Y SSR +TP+Q+A  L  ++  QL  L+  GARK A+ G G +GC P  +    +G  
Sbjct  179   TFYSSSRQFTPEQYANDLISRYSTQLNALYNYGARKFALSGIGAIGCSPNALAGSRDGR-  237

Query  778   SCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKA  948
             +CVD INSA Q+FN++++ ++D LN +   AKFI IN   +    + +PS  G    N  
Sbjct  238   TCVDRINSANQIFNNKLRSLVDQLNNNHPDAKFIYINAYGIFQDMITNPSRFGFRVTNAG  297

Query  949   CCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDI  1128
             CC + +   +  C  GQ PC +RN Y+FWD FH TE  N+  A RS+ A   +DAYPMDI
Sbjct  298   CCGIGRNAGQITCLPGQRPCRDRNAYVFWDAFHPTEAANVIIARRSFNAQSASDAYPMDI  357

Query  1129  SSLLQL  1146
             S L QL
Sbjct  358   SRLAQL  363



>ref|XP_002522290.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF40148.1| zinc finger protein, putative [Ricinus communis]
Length=379

 Score =   337 bits (865),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 172/342 (50%), Positives = 234/342 (68%), Gaps = 7/342 (2%)
 Frame = +1

Query  133   AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNLADYLAEF  312
             AEP+VPC+FIFGDSL DNGNNNNL+T AKANY PYGID+ DGPTGRF+NG+N  D LA+ 
Sbjct  27    AEPEVPCFFIFGDSLADNGNNNNLNTLAKANYPPYGIDYADGPTGRFTNGRNTVDILADL  86

Query  313   LGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNHGLTLAR-  489
             LGF+  IPP+ A    + +L+GVNYASG+ GIL E+G H+G+ + +DQQ+ NH +T++R 
Sbjct  87    LGFDHHIPPF-ATAKGQIILQGVNYASGSAGILQETGKHLGQNMDLDQQIKNHQITISRM  145

Query  490   IALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAKKHYV  669
             I++      AA   LN+C Y VGMG+NDYINNY +P+ YP+S+ ++ D +A+ L  ++  
Sbjct  146   ISILGNNETAATKQLNRCIYGVGMGSNDYINNYFLPENYPTSKTFSLDSYAKALISQYSK  205

Query  670   QLKKLHALGARKVAVFGPGVLGCIPEEME-THGNGSLSCVDSINSAVQMFNDRMKPIIDD  846
             QL  L+  GARK+A+ G G +GCIP        NGSL C D +N AV +FN+++  ++  
Sbjct  206   QLMALYNQGARKIALAGLGNIGCIPHSTAIRRRNGSL-CADIMNEAVHLFNNQLVSLVQQ  264

Query  847   LNGSLKGAKFILINMTSLALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQVPCSNRNEY  1026
             LN +L  AKFI IN TS+A GDP+ +G  N+   CC+    +  GQC E Q PC +R  +
Sbjct  265   LNRNLSDAKFIYINSTSIAAGDPTTVGFRNLTSGCCEA---RQDGQCIENQAPCPDRRVF  321

Query  1027  MFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQLNL  1152
             +FWD FH TE  NL TA R+Y +   +D YP D+ SL QL+ 
Sbjct  322   VFWDTFHPTEASNLFTAGRTYKSLNSSDCYPFDLHSLAQLDF  363



>ref|XP_004232990.1| PREDICTED: GDSL esterase/lipase At5g45670 [Solanum lycopersicum]
Length=367

 Score =   337 bits (864),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 163/338 (48%), Positives = 220/338 (65%), Gaps = 4/338 (1%)
 Frame = +1

Query  142   QVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNLADYLAEFLGF  321
             QVPCYFIFGDSLVDNGNNNN+ + A+ANYLPYGID+PDGPTGRFSNGK   D +AE LGF
Sbjct  31    QVPCYFIFGDSLVDNGNNNNIQSLARANYLPYGIDYPDGPTGRFSNGKTTVDVIAELLGF  90

Query  322   NSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNHGLTLARIALY  501
             +  IPPY A    E +LKGVN+AS A GI +E+G  +G  I+   Q+ N+  T+ ++   
Sbjct  91    DDYIPPY-ASARGEDILKGVNFASAAAGIREETGQQLGARITFGGQVNNYRNTVQQVVQI  149

Query  502   MKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAKKHYVQLKK  681
             +    +A  YL+KC YS+G+G+NDY+NNY MPQ Y +SR + PDQ+A++L +++  QLK 
Sbjct  150   LGDENSAANYLSKCIYSIGLGSNDYLNNYFMPQYYSTSRQFNPDQYADVLIQQYSQQLKT  209

Query  682   LHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMFNDRMKPIIDDLNGSL  861
             L+  GARK  + G G +GC P  +  +     +C ++IN+A ++FN+R+K I+D+ NG+ 
Sbjct  210   LYDYGARKFVLIGVGQIGCSPNALAQNSPDGRTCAENINNANKLFNNRLKGIVDEFNGNT  269

Query  862   KGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQVPCSNRNEYMF  1032
               AKFI IN   +    + +PS  G    N  CC V +   +  C   Q PC NR+EY+F
Sbjct  270   PDAKFIYINAYDIFQDLIDNPSAFGFRVTNAGCCGVGRNNGQITCLPLQNPCQNRDEYVF  329

Query  1033  WDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             WD FH  E  N+    RSY A   +DAYP DI  L QL
Sbjct  330   WDAFHPGEAANIVVGRRSYRAERSSDAYPFDIQRLAQL  367



>ref|XP_006465150.1| PREDICTED: GDSL esterase/lipase At1g29660-like [Citrus sinensis]
Length=377

 Score =   337 bits (865),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 172/344 (50%), Positives = 226/344 (66%), Gaps = 11/344 (3%)
 Frame = +1

Query  142   QVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNLADYLAEFLGF  321
             QVPCYFIFGDSL DNGNNNNL T A+ANYLPYGID P GPTGRFSNG+NL D + + LGF
Sbjct  33    QVPCYFIFGDSLYDNGNNNNLPTRARANYLPYGIDLPGGPTGRFSNGRNLTDVITQLLGF  92

Query  322   NSSIPPYSAVTTTEGLLKGVNYASGAGGILDESG-THMGEVISMDQQLVNHGLTLARIAL  498
             ++ IPP++  +  E +LKGVNYASG  GI +E+G  ++G VIS++ QL NH  T++RIA 
Sbjct  93    DNFIPPFATASGQE-ILKGVNYASGGAGIREETGRNNLGVVISLNGQLQNHKTTVSRIAS  151

Query  499   YMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAKKHYVQLK  678
              +    +A  +L+KC Y+VG G+NDYINNYL+PQ YP+SR Y PDQ+A +L +++  +LK
Sbjct  152   ILGDQESATQHLSKCLYTVGFGSNDYINNYLLPQFYPTSRQYPPDQYATVLIQQYSQKLK  211

Query  679   KLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMFNDRMKPIIDDLNGS  858
              LH  GA+K+A+FG G LGC P  +  +G    +CVD IN A+Q+FN  +K ++DDLN  
Sbjct  212   TLHNYGAKKIALFGIGPLGCAPGPVAMYGTNGSACVDYINKAIQLFNTNLKTLVDDLNNQ  271

Query  859   LKGAKFILINMTSLALGDPSIIGINN-----VNKACCQVSKTKAKG---QCEEGQVPCSN  1014
              + AKFI IN   L   D S +GI +     +   CC V+          C      CS 
Sbjct  272   FRDAKFIYINAYDLLFADAS-VGIQDDLVTTIIGPCCPVANLPMNNGILTCIPFSTSCSI  330

Query  1015  RNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             R   +FWD  H +E  N+ T  R+Y A  PTD YP+DI  L+QL
Sbjct  331   RYANIFWDGVHSSETVNVITGRRAYMALNPTDTYPIDIRRLIQL  374



>ref|NP_001242353.1| uncharacterized protein LOC100777335 precursor [Glycine max]
 gb|ACU17972.1| unknown [Glycine max]
Length=367

 Score =   337 bits (863),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 164/339 (48%), Positives = 223/339 (66%), Gaps = 4/339 (1%)
 Frame = +1

Query  139   PQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNLADYLAEFLG  318
             PQVPCYFIFGDSLVDNGNNN L + A+A+YLPYGIDFP GP+GRFSNGK   D +AE LG
Sbjct  30    PQVPCYFIFGDSLVDNGNNNQLQSLARADYLPYGIDFPGGPSGRFSNGKTTVDAIAELLG  89

Query  319   FNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNHGLTLARIAL  498
             F+  IPPY A  + + +LKGVNYAS A GI +E+G  +G  IS   Q+ N+  T++++  
Sbjct  90    FDDYIPPY-ADASGDAILKGVNYASAAAGIREETGQQLGGRISFRGQVQNYQNTVSQVVN  148

Query  499   YMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAKKHYVQLK  678
              +    +A  YL+KC YS+G+G+NDY+NNY MPQ Y SSR Y+ D +A++L + +  QLK
Sbjct  149   LLGNEDSAANYLSKCIYSIGLGSNDYLNNYFMPQFYSSSRQYSTDGYADVLIQAYTEQLK  208

Query  679   KLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMFNDRMKPIIDDLNGS  858
              L+  GARK+ +FG G +GC P E+  +     +CV+ IN+A Q+FN+++K + D  N  
Sbjct  209   TLYNYGARKMVLFGIGQIGCSPNELAQNSPDGKTCVEKINTANQIFNNKLKGLTDQFNNQ  268

Query  859   LKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQVPCSNRNEYM  1029
             L  AK I IN   +    + +PS  G +  N  CC V +   +  C   Q PC +R EY+
Sbjct  269   LPDAKVIYINSYGIFQDIISNPSAYGFSVTNAGCCGVGRNNGQITCLPMQTPCQDRREYL  328

Query  1030  FWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             FWD FH TE GN+  A R+Y+A   +DAYP+DI  L Q+
Sbjct  329   FWDAFHPTEAGNVVVAQRAYSAQSASDAYPVDIQRLAQI  367



>emb|CBI18440.3| unnamed protein product [Vitis vinifera]
Length=371

 Score =   336 bits (862),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 168/338 (50%), Positives = 226/338 (67%), Gaps = 5/338 (1%)
 Frame = +1

Query  145   VPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNLADYLAEFLGFN  324
             VPC+FIFG S  DNGNNN L T  K+NY PYGIDFP GPTGRFSNG+N+ D ++EFLGF 
Sbjct  35    VPCFFIFGASSFDNGNNNALPTLVKSNYPPYGIDFPAGPTGRFSNGRNIVDIISEFLGFE  94

Query  325   SSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNHGLTLARIALYM  504
               IP +++    E +LKGVNYASG  GI  E+G H G  ISMD QL NH +T++R+   +
Sbjct  95    DYIPSFASTVGGEDILKGVNYASGGSGIRAETGQHNGARISMDAQLRNHHITVSRLINRL  154

Query  505   -KGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAKKHYVQLKK  681
              +   AA+ YLNKC Y+ G+G NDY++NY +P  YP+SR+YTP+Q+A +LA+++  QLK 
Sbjct  155   GQNESAAKEYLNKCIYAAGLGTNDYVSNYFLPLLYPTSRIYTPEQYALVLAQQYSQQLKT  214

Query  682   LHA-LGARKVAVFGPGVLGCIPEEMETHG--NGSLSCVDSINSAVQMFNDRMKPIIDDLN  852
             L+   GARK+A+FG   LGC P  + ++G  NGS +CVD IN AVQ+FN+R+K ++ +LN
Sbjct  215   LYTNYGARKIALFGLAQLGCAPSVVASNGATNGS-ACVDYINDAVQLFNNRLKELVGELN  273

Query  853   GSLKGAKFILINMTSLALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQVPCSNRNEYMF  1032
              +L  AKFI +N+  +A    S      ++  CC V+       C   Q PC NR+EY++
Sbjct  274   RNLTDAKFIYVNVYEIASEATSYPSFRVIDAPCCPVASNNTLILCTINQTPCPNRDEYLY  333

Query  1033  WDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             WD  HL+E  N+  A RSY A  PT   P+DIS L +L
Sbjct  334   WDALHLSEATNMFIANRSYNAQSPTHTCPIDISDLAKL  371



>ref|XP_011102202.1| PREDICTED: uncharacterized protein LOC105180227 [Sesamum indicum]
Length=740

 Score =   348 bits (892),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 170/367 (46%), Positives = 235/367 (64%), Gaps = 5/367 (1%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSL-KPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLP  234
             M SG+K W  +  ++ + ++L   +VAEPQVPCYFIFGDSLVDNGNNNN+ + A+ANYLP
Sbjct  1     MRSGLKPWIVVCVVVAVAVNLLNGVVAEPQVPCYFIFGDSLVDNGNNNNIQSLARANYLP  60

Query  235   YGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILD  414
             YGIDFPDGPTGRFSNGK   D +AE LGF+  IPPY A    E +L+GVNYAS A GI  
Sbjct  61    YGIDFPDGPTGRFSNGKTTVDVIAELLGFDDYIPPY-ASARGEQILRGVNYASAAAGIRS  119

Query  415   ESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLM  594
             E+G  +G  I    Q+ N+  T+ ++   +    +A  YL+KC YS+G+G+NDY+NNY M
Sbjct  120   ETGQQLGARIDFTGQVNNYKDTVEQVVNILGDEDSAANYLSKCIYSIGVGSNDYLNNYFM  179

Query  595   PQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGS  774
             P  Y +SR Y+P+Q+A++L +++  Q++ L+  GARK A+ G G +GC P  +  +    
Sbjct  180   PLYYSTSRQYSPEQYADILIQQYSQQIRTLYNYGARKFALIGVGQIGCSPNALAQNSPDG  239

Query  775   LSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNK  945
              +CV  IN A Q+FN++++ ++D+ N   + AKFI IN   +    + +PS  G    N 
Sbjct  240   STCVQRINGANQIFNNKLRALVDEFNSDAQDAKFIYINAYGIFQDLIENPSAFGFRVTNA  299

Query  946   ACCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMD  1125
              CC V +   +  C   Q PC NR+EY+FWD FH TE  N+    RSY+A   +DAYP D
Sbjct  300   GCCGVGRNNGQITCLPLQTPCQNRDEYLFWDAFHPTEAANIIVGRRSYSAQKASDAYPFD  359

Query  1126  ISSLLQL  1146
             I  L Q 
Sbjct  360   IRRLAQF  366


 Score =   320 bits (819),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 171/365 (47%), Positives = 238/365 (65%), Gaps = 17/365 (5%)
 Frame = +1

Query  40    YTSITLMASGVKVWFAIATLLLMFLS---LKPLVAEPQVPCYFIFGDSLVDNGNNNNLST  210
             Y++    ++ + V F    L L+F++      +V EP+VPC+FIFGDSLVDNGNN N +T
Sbjct  380   YSAKMTHSNNINVCF----LFLLFIASTLQTIVVGEPKVPCFFIFGDSLVDNGNNINRNT  435

Query  211   EAKANYLPYGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYA  390
              AK NY PYGIDFP GPTGRF+NG+N+AD +AE LGF+  I P+ A  T + +L+GVNY 
Sbjct  436   TAKVNYFPYGIDFPGGPTGRFNNGRNIADIIAELLGFDKYIAPF-ANATNQDILRGVNYG  494

Query  391   SGAGGILDESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNN  570
             SG  GIL+E+G   G+VI+  +QL NH + ++R+A  +     A+ +L++C YSVGMGNN
Sbjct  495   SGGSGILEETGHLFGDVINFKEQLSNHEVVISRVARLLGSESVAKQHLSRCIYSVGMGNN  554

Query  571   DYINNYLMPQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEE  750
             DY+ NYL PQ +  +  YTP QFA L+  ++  QL++L+  GARKVAVF  G LGCIP++
Sbjct  555   DYLANYL-PQYHSKTTPYTPRQFASLVIAQYSKQLRRLYDAGARKVAVFALGKLGCIPQQ  613

Query  751   METHG--NGSLSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSII  924
             +  +G  +GS SCV++ N+ V+ FN+ +K +I  LN +L  AKF+    TS      S  
Sbjct  614   LAAYGASDGS-SCVETSNNVVKSFNEYLKILIHYLNSNLADAKFVYTQDTS---DSESYG  669

Query  925   GINNVNKACCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLP  1104
              I+N+++ CC VS     GQC  G  PCSNR+ Y+FWD FH TE  +L +A  +Y    P
Sbjct  670   NISNLSEPCCGVSAE--DGQCVAGSAPCSNRDAYLFWDAFHPTEAASLLSAKIAYDHMSP  727

Query  1105  TDAYP  1119
               A P
Sbjct  728   LFAEP  732



>ref|XP_009769556.1| PREDICTED: GDSL esterase/lipase At5g45670-like [Nicotiana sylvestris]
Length=367

 Score =   336 bits (861),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 170/369 (46%), Positives = 228/369 (62%), Gaps = 8/369 (2%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLKPLVA---EPQVPCYFIFGDSLVDNGNNNNLSTEAKANY  228
             M   V  W  +  +LL  L+L        +PQVPCYFIFGDSLVDNGNNNN+ + A+ANY
Sbjct  1     MGREVMKWMMVYVVLLG-LNLGEYYGARGDPQVPCYFIFGDSLVDNGNNNNIQSLARANY  59

Query  229   LPYGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGI  408
             LPYGID+P GPTGRFSNGK   D +AE LGF   IPPY+A    E +L+GVNYAS A GI
Sbjct  60    LPYGIDYPGGPTGRFSNGKTTVDVIAELLGFEDYIPPYAA-ARGEDILRGVNYASAAAGI  118

Query  409   LDESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNY  588
              +E+G  +G  IS   Q+ N+  T+ ++   +    +A  YL+KC YSVG+G+NDY+NNY
Sbjct  119   REETGQQLGARISFAAQVNNYRNTVQQVVQILGDEDSAANYLSKCIYSVGLGSNDYLNNY  178

Query  589   LMPQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGN  768
              MP  Y +SR + P+Q+A++L +++  QLK L+  GARK  + G G +GC P  +  +  
Sbjct  179   FMPLYYSTSRQFNPEQYADVLIQQYTQQLKTLYDYGARKFVLIGVGQIGCSPNSLAQNSP  238

Query  769   GSLSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNV  939
                +C  +IN A Q+FN+R++ I+DD N +   AKFI IN   +    + +PS  G    
Sbjct  239   DGKTCAQNINVANQIFNNRLRGIVDDFNSNTPDAKFIYINAYDIFQDLIDNPSAFGFRVT  298

Query  940   NKACCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYP  1119
             N  CC V +   +  C   Q PC NR+EY+FWD FH  E  N+    RSY A  P+D+YP
Sbjct  299   NAGCCGVGRNNGQITCLPLQNPCPNRDEYLFWDAFHPGEAANVIVGRRSYRAERPSDSYP  358

Query  1120  MDISSLLQL  1146
              DI  L QL
Sbjct  359   FDIQRLAQL  367



>ref|XP_006467574.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Citrus sinensis]
Length=366

 Score =   335 bits (860),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 165/366 (45%), Positives = 233/366 (64%), Gaps = 9/366 (2%)
 Frame = +1

Query  70    VKVWFAIATLLLMFLSLKPLV----AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPY  237
             ++ W+ +  LL++ ++++       A PQVPCYFIFGDSLVDNGNNN LS+ A+ANYLPY
Sbjct  3     LRKWWVVMVLLVL-INIQNYYYGAKAAPQVPCYFIFGDSLVDNGNNNQLSSLARANYLPY  61

Query  238   GIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDE  417
             GIDFP+GPTGRFSNGK   D +A+ LGF+  IPPYSA    + +L+GVNYAS A GI +E
Sbjct  62    GIDFPNGPTGRFSNGKTTVDVIAQLLGFDGYIPPYSAARGQD-ILRGVNYASAAAGIREE  120

Query  418   SGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMP  597
             +G  +G+ IS   Q+ N+  T+ ++   +     A  YL++C YS+G+G+NDY+NNY  P
Sbjct  121   TGRQLGDRISFSGQVKNYQNTVQQVVNLLGNQDQAANYLSRCIYSIGLGSNDYLNNYFQP  180

Query  598   QKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSL  777
               Y + R YTP+Q+A+LL +++  QL+ L+  GARK  + G G +GC P ++  +     
Sbjct  181   LYYSTGRQYTPEQYADLLIQQYTQQLQALYNYGARKFVLIGVGQIGCSPNQLAQNSPDGR  240

Query  778   SCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKA  948
             +CV  +N A  +FN++++ ++D  N +   AKFI IN   +      +P+  G    N  
Sbjct  241   TCVKRVNDANVIFNNKLRGLVDQFNNNDSDAKFIYINAYGIFQDITANPARYGFRVTNTG  300

Query  949   CCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDI  1128
             CC V +   +  C   Q PC NR EY+FWD FH TE  N   ATRSY+A  P+DAYP+DI
Sbjct  301   CCGVGRNNGQITCLPLQNPCPNRREYVFWDAFHPTEAANTIIATRSYSAQSPSDAYPIDI  360

Query  1129  SSLLQL  1146
               L QL
Sbjct  361   RRLAQL  366



>ref|XP_006449582.1| hypothetical protein CICLE_v10015686mg [Citrus clementina]
 gb|ESR62822.1| hypothetical protein CICLE_v10015686mg [Citrus clementina]
Length=366

 Score =   335 bits (860),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 165/366 (45%), Positives = 233/366 (64%), Gaps = 9/366 (2%)
 Frame = +1

Query  70    VKVWFAIATLLLMFLSLKPLV----AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPY  237
             ++ W+ +  LL++ ++++       A PQVPCYFIFGDSLVDNGNNN LS+ A+ANYLPY
Sbjct  3     LRKWWVVMVLLVL-INIQNYYYGAKAAPQVPCYFIFGDSLVDNGNNNQLSSLARANYLPY  61

Query  238   GIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDE  417
             GIDFP+GPTGRFSNGK   D +A+ LGF+  IPPYSA    + +L+GVNYAS A GI +E
Sbjct  62    GIDFPNGPTGRFSNGKTTVDVIAQLLGFDGYIPPYSAARGQD-ILRGVNYASAAAGIREE  120

Query  418   SGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMP  597
             +G  +G+ IS   Q+ N+  T+ ++   +     A  YL++C YS+G+G+NDY+NNY  P
Sbjct  121   TGRQLGDRISFSGQVKNYQNTVQQVVNLLGNEDQAANYLSRCIYSIGLGSNDYLNNYFQP  180

Query  598   QKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSL  777
               Y + R YTP+Q+A+LL +++  QL+ L+  GARK  + G G +GC P ++  +     
Sbjct  181   LYYSTGRQYTPEQYADLLIQQYTQQLQALYNYGARKFVLIGVGQIGCSPNQLAQNSPDGR  240

Query  778   SCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKA  948
             +CV  +N A  +FN++++ ++D  N +   AKFI IN   +      +P+  G    N  
Sbjct  241   TCVQRVNDANVIFNNKLRGLVDQFNNNDSDAKFIYINAYGIFQDITANPARYGFRVTNTG  300

Query  949   CCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDI  1128
             CC V +   +  C   Q PC NR EY+FWD FH TE  N   ATRSY+A  P+DAYP+DI
Sbjct  301   CCGVGRNNGQITCLPLQNPCPNRREYVFWDAFHPTEAANTIIATRSYSAQSPSDAYPIDI  360

Query  1129  SSLLQL  1146
               L QL
Sbjct  361   RRLAQL  366



>ref|XP_010499475.1| PREDICTED: LOW QUALITY PROTEIN: GDSL esterase/lipase At1g29660 
[Camelina sativa]
Length=364

 Score =   334 bits (857),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 164/341 (48%), Positives = 221/341 (65%), Gaps = 5/341 (1%)
 Frame = +1

Query  133   AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNLADYLAEF  312
             AEPQVPCYFIFGDSLVDNGNNN L++ A+A+Y PYGIDF  GPTGRFSNGK   D LAE 
Sbjct  26    AEPQVPCYFIFGDSLVDNGNNNRLTSIARADYFPYGIDF-GGPTGRFSNGKTTVDVLAEL  84

Query  313   LGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNHGLTLARI  492
             LGF++ IP YS V+  + +L+GVNYAS A GI DE+G  +G+ I+   Q+ N+  T++++
Sbjct  85    LGFDNYIPAYSTVSGQQ-ILQGVNYASAAAGIRDETGAQLGQRITFSGQVENYXNTVSQV  143

Query  493   ALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAKKHYVQ  672
                +     A  YL +C Y++GMG+NDY+NNY MPQ Y +SR Y+P+Q+A+ L  ++  Q
Sbjct  144   VEILGDENTAADYLKRCIYTIGMGSNDYLNNYFMPQVYATSRQYSPEQYAQDLITRYREQ  203

Query  673   LKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMFNDRMKPIIDDLN  852
             L  L++ GARK A+ G G +GC P E+        +CV+ INSA ++FN+++K ++  LN
Sbjct  204   LNALYSYGARKFALVGVGAIGCSPNELAQGSPDGTTCVERINSANRIFNNKLKSLVQQLN  263

Query  853   GSLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQVPCSNRNE  1023
                  A+F  IN   +    + +PS  G    N ACC V +   +  C  GQ PC NRNE
Sbjct  264   NDHSDARFTYINAYGVFEDIIANPSAYGFTVTNAACCGVGRNGGQLTCLPGQPPCPNRNE  323

Query  1024  YMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             Y+FWD FH ++  N   A RSY A   +D YP DIS L QL
Sbjct  324   YVFWDAFHPSDAANTVIAQRSYNAQSSSDVYPYDISQLAQL  364



>emb|CDX90201.1| BnaA08g17830D [Brassica napus]
Length=364

 Score =   334 bits (857),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 174/367 (47%), Positives = 234/367 (64%), Gaps = 7/367 (2%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLKPLV-AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLP  234
             M S ++ W  + ++L+++L L   V AEPQVPCYFIFGDSLVDNGNNN LS+ A+A+Y P
Sbjct  1     MESYLRKW-CLVSVLVLYLGLGFNVKAEPQVPCYFIFGDSLVDNGNNNGLSSLARADYYP  59

Query  235   YGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILD  414
             YGID   GPTGRFSNGK   D +AE LGF++ IP YS V+  E +L+GVNYAS A GI +
Sbjct  60    YGIDL-GGPTGRFSNGKTTVDEIAELLGFDNYIPAYSDVSG-EQILQGVNYASAAAGIRE  117

Query  415   ESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLM  594
             E+G  +G+ I    Q+ N+  T+A++   +     A  YL KC YSVG+G+NDY+NNY M
Sbjct  118   ETGQQLGQRIPFSGQVQNYQNTVAQVVELLGDENTAADYLRKCIYSVGLGSNDYLNNYFM  177

Query  595   PQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGS  774
             PQ Y +SR YTP+Q+A+ L  ++  QL  L+  GARK A+ G G +GC P  +       
Sbjct  178   PQYYSTSRQYTPEQYADDLINRYRDQLNALYNYGARKFALVGVGAIGCSPNALAQGSPDG  237

Query  775   LSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNK  945
              +CV+ +NSA ++FN+R+K ++  LN     AKF  IN   +    + +PS  G    N 
Sbjct  238   TTCVERLNSANRIFNNRLKSMVQQLNNEHSDAKFTYINAYGVFQDIIANPSAYGFTVTNA  297

Query  946   ACCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMD  1125
             ACC V +   +  C  GQ PC NRNEY+FWD FH T+  N   A RSY A   +D YP+D
Sbjct  298   ACCGVGRNGGQLTCLPGQGPCPNRNEYVFWDAFHPTDAANTIIAQRSYKAQSSSDVYPID  357

Query  1126  ISSLLQL  1146
             IS+L +L
Sbjct  358   ISALARL  364



>emb|CBI30762.3| unnamed protein product [Vitis vinifera]
Length=400

 Score =   335 bits (860),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 182/377 (48%), Positives = 238/377 (63%), Gaps = 11/377 (3%)
 Frame = +1

Query  28    FSATYTSITLMASGV-KVWFAIATLLLMFLSLKPLV-AEPQVPCYFIFGDSLVDNGNNNN  201
             F  +Y   +LMA    KVW  +A LL +   L+     +PQVPCYFI GDSL DNGNNN 
Sbjct  31    FLPSYCLSSLMACNQHKVWRRVAFLLSLLSILQICARGDPQVPCYFILGDSLSDNGNNNG  90

Query  202   LSTEAKANYLPYGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGV  381
             LST+AKAN+ PYGIDFP GPTGRFSNG+ + D  AE LGF   IPP+++    + +LKGV
Sbjct  91    LSTKAKANFKPYGIDFPVGPTGRFSNGRTIVDVTAELLGFGEYIPPFTSAKGRD-VLKGV  149

Query  382   NYASGAGGILDESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGM  561
             NYAS + GILDESG  +G+ I +  QL N+  T ++I+  + G  AA  YLNKC ++VG+
Sbjct  150   NYASASAGILDESGKQLGQAIPLGGQLKNYLKTFSQISKILGGGTAAHKYLNKCMFTVGI  209

Query  562   GNNDYINNYLMPQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCI  741
             G+ND+INNY MP  + +S LY+ D+F   L  ++   L+ L+  GARKVA+FG G +GC 
Sbjct  210   GSNDFINNYFMPDVFRTSELYSLDRFVATLIDQYSQYLQTLYKCGARKVALFGLGPIGCA  269

Query  742   PEEMETHGN--GSLSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDP  915
             P E+  +G   GS+ CVD IN AV  FN R+  ++DDLN + K AKF  IN+  +  GD 
Sbjct  270   PAELARYGATPGSI-CVDKINDAVVRFNKRLISLVDDLNDNYKDAKFTYINILEIGTGDA  328

Query  916   SIIGINNVNKACCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTA  1095
             +  G    N  CC   K      C     PC NR+EY FWD FH T+  N+  A R+Y A
Sbjct  329   TAAGFKVTNSGCCGGQK-----GCLPLATPCKNRDEYTFWDEFHPTDAMNVIFANRAYKA  383

Query  1096  TLPTDAYPMDISSLLQL  1146
               PTDA+P+DIS+L  L
Sbjct  384   LTPTDAHPIDISTLACL  400



>ref|XP_009612511.1| PREDICTED: GDSL esterase/lipase At5g45670-like [Nicotiana tomentosiformis]
Length=367

 Score =   334 bits (857),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 163/341 (48%), Positives = 217/341 (64%), Gaps = 4/341 (1%)
 Frame = +1

Query  133   AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNLADYLAEF  312
              +PQVPCYFIFGDSLVDNGNNNN+ + A+ANYLPYGID+P GPTGRFSNGK   D +AE 
Sbjct  28    GDPQVPCYFIFGDSLVDNGNNNNIQSLARANYLPYGIDYPGGPTGRFSNGKTTVDVIAEL  87

Query  313   LGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNHGLTLARI  492
             LGF   IPPY+A    E +L+GVNYAS A GI +E+G  +G  IS   Q+ N+  T+ ++
Sbjct  88    LGFEDYIPPYAA-ARGEDILRGVNYASAAAGIREETGQQLGARISFAAQVNNYRNTVQQV  146

Query  493   ALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAKKHYVQ  672
                +    +A  YL+KC YSVG+G+NDY+NNY MP  Y +SR + P+Q+A++L +++  Q
Sbjct  147   VQILGDEDSAANYLSKCIYSVGLGSNDYLNNYFMPLYYSTSRQFNPEQYADVLIQQYTQQ  206

Query  673   LKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMFNDRMKPIIDDLN  852
             LK L+  GARK  + G G +GC P  +  +     +C  +IN A Q+FN R++ I+DD N
Sbjct  207   LKTLYDYGARKFVLIGVGQIGCSPNSLAQNSPDGKTCAQNINVANQLFNSRLRGIVDDFN  266

Query  853   GSLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQVPCSNRNE  1023
              +   AKFI IN   +    + +PS  G    N  CC V +   +  C   Q PC NR+E
Sbjct  267   SNTPDAKFIYINAYDIFQDLIDNPSAFGFRVTNAGCCGVGRNNGQITCLPLQNPCPNRDE  326

Query  1024  YMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             Y+FWD FH  E  N+    RSY A  P+D+YP DI  L QL
Sbjct  327   YLFWDAFHPGEAANVIVGRRSYRAERPSDSYPFDIQRLAQL  367



>ref|NP_174260.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9C7N4.1|GDL15_ARATH RecName: Full=GDSL esterase/lipase At1g29670; AltName: Full=Extracellular 
lipase At1g29670; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG51758.1|AC068667_37 lipase/hydrolase, putative; 118270-120144 [Arabidopsis thaliana]
 gb|AAL57681.1| At1g29670/F15D2_22 [Arabidopsis thaliana]
 gb|AEE31116.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=363

 Score =   334 bits (856),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 169/366 (46%), Positives = 228/366 (62%), Gaps = 6/366 (2%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPY  237
             M S +  W  +  LL    S+    A+ QVPC+F+FGDSLVDNGNNN L + A++NY PY
Sbjct  1     MESYLTKWCVVLVLLCFGFSVVKAQAQAQVPCFFVFGDSLVDNGNNNGLISIARSNYFPY  60

Query  238   GIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDE  417
             GIDF  GPTGRFSNGK   D +AE LGFN  IP Y+ V+  + +L GVNYAS A GI +E
Sbjct  61    GIDF-GGPTGRFSNGKTTVDVIAELLGFNGYIPAYNTVSGRQ-ILSGVNYASAAAGIREE  118

Query  418   SGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMP  597
             +G  +G+ IS   Q+ N+  T++++   +     A  YL +C YSVG+G+NDY+NNY MP
Sbjct  119   TGRQLGQRISFSGQVRNYQTTVSQVVQLLGDETRAADYLKRCIYSVGLGSNDYLNNYFMP  178

Query  598   QKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSL  777
               Y SSR +TP+Q+A  L  ++  QL  L+  GARK A+ G G +GC P  +    +G  
Sbjct  179   TFYSSSRQFTPEQYANDLISRYSTQLNALYNYGARKFALSGIGAVGCSPNALAGSPDGR-  237

Query  778   SCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKA  948
             +CVD INSA Q+FN++++ ++D LN +   AKFI IN   +    + +P+  G    N  
Sbjct  238   TCVDRINSANQIFNNKLRSLVDQLNNNHPDAKFIYINAYGIFQDMITNPARFGFRVTNAG  297

Query  949   CCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDI  1128
             CC + +   +  C  GQ PC +RN Y+FWD FH TE  N+  A RSY A   +DAYPMDI
Sbjct  298   CCGIGRNAGQITCLPGQRPCRDRNAYVFWDAFHPTEAANVIIARRSYNAQSASDAYPMDI  357

Query  1129  SSLLQL  1146
             S L QL
Sbjct  358   SRLAQL  363



>ref|XP_006471326.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Citrus sinensis]
Length=366

 Score =   334 bits (857),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 164/366 (45%), Positives = 232/366 (63%), Gaps = 9/366 (2%)
 Frame = +1

Query  70    VKVWFAIATLLLMFLSLKPLV----AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPY  237
             ++ W+ +  LL++ ++++       A PQVPCYFIFGDSLVDNGNNN LS+ A+ANYLPY
Sbjct  3     LRKWWVVMVLLVL-INIQNYYYGAKAAPQVPCYFIFGDSLVDNGNNNQLSSLARANYLPY  61

Query  238   GIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDE  417
             GIDFP+GPTGRFSNGK   D +A+ LGF+  IPPYSA    + +L+GVNYAS A GI +E
Sbjct  62    GIDFPNGPTGRFSNGKTTVDVIAQLLGFDGYIPPYSAARGQD-ILRGVNYASAAAGIREE  120

Query  418   SGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMP  597
             +G  +G+ IS   Q+ N+  T+ ++   +     A  YL++C YS+G+G+NDY+NNY  P
Sbjct  121   TGRQLGDRISFSGQVKNYQNTVQQVVNLLGNEDQAANYLSRCIYSIGLGSNDYLNNYFQP  180

Query  598   QKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSL  777
               Y + R YTP+Q+A+LL +++  QL+  +  GARK  + G G +GC P ++  +     
Sbjct  181   LYYSTGRQYTPEQYADLLIQQYTQQLQAFYNYGARKFVLIGVGQIGCSPNQLAQNSPDGR  240

Query  778   SCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKA  948
             +CV  +N A  +FN++++ ++D  N +   AKFI IN   +      +P+  G    N  
Sbjct  241   TCVKRVNDANVIFNNKLRGLVDQFNNNNSDAKFIYINAYGIFQDITANPARYGFRVTNTG  300

Query  949   CCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDI  1128
             CC V +   +  C   Q PC NR EY+FWD FH TE  N   ATRSY+A  P+DAYP+DI
Sbjct  301   CCGVGRNNGQITCLPLQNPCPNRREYVFWDAFHPTEAANTIIATRSYSAQSPSDAYPIDI  360

Query  1129  SSLLQL  1146
               L QL
Sbjct  361   RRLAQL  366



>ref|XP_002263997.1| PREDICTED: GDSL esterase/lipase At5g45670 [Vitis vinifera]
Length=360

 Score =   334 bits (856),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 177/361 (49%), Positives = 231/361 (64%), Gaps = 10/361 (3%)
 Frame = +1

Query  73    KVWFAIATLLLMFLSLKPLV-AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDF  249
             KVW  +A LL +   L+     +PQVPCYFI GDSL DNGNNN LST+AKAN+ PYGIDF
Sbjct  7     KVWRRVAFLLSLLSILQICARGDPQVPCYFILGDSLSDNGNNNGLSTKAKANFKPYGIDF  66

Query  250   PDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTH  429
             P GPTGRFSNG+ + D  AE LGF   IPP+++    + +LKGVNYAS + GILDESG  
Sbjct  67    PVGPTGRFSNGRTIVDVTAELLGFGEYIPPFTSAKGRD-VLKGVNYASASAGILDESGKQ  125

Query  430   MGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYP  609
             +G+ I +  QL N+  T ++I+  + G  AA  YLNKC ++VG+G+ND+INNY MP  + 
Sbjct  126   LGQAIPLGGQLKNYLKTFSQISKILGGGTAAHKYLNKCMFTVGIGSNDFINNYFMPDVFR  185

Query  610   SSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGN--GSLSC  783
             +S LY+ D+F   L  ++   L+ L+  GARKVA+FG G +GC P E+  +G   GS+ C
Sbjct  186   TSELYSLDRFVATLIDQYSQYLQTLYKCGARKVALFGLGPIGCAPAELARYGATPGSI-C  244

Query  784   VDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACCQVS  963
             VD IN AV  FN R+  ++DDLN + K AKF  IN+  +  GD +  G    N  CC   
Sbjct  245   VDKINDAVVRFNKRLISLVDDLNDNYKDAKFTYINILEIGTGDATAAGFKVTNSGCCGGQ  304

Query  964   KTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQ  1143
             K      C     PC NR+EY FWD FH T+  N+  A R+Y A  PTDA+P+DIS+L  
Sbjct  305   K-----GCLPLATPCKNRDEYTFWDEFHPTDAMNVIFANRAYKALTPTDAHPIDISTLAC  359

Query  1144  L  1146
             L
Sbjct  360   L  360



>gb|AAM65973.1| lipase/hydrolase, putative [Arabidopsis thaliana]
Length=364

 Score =   334 bits (856),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 170/367 (46%), Positives = 230/367 (63%), Gaps = 7/367 (2%)
 Frame = +1

Query  58    MASGVKVWFAIAT-LLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLP  234
             M S ++ W  ++  +LL+ L  K + AEPQVPCYFIFGDSLVDNGNNN L + A+A+Y P
Sbjct  1     MESYLRKWCLVSVWVLLLGLGFK-VKAEPQVPCYFIFGDSLVDNGNNNRLRSIARADYFP  59

Query  235   YGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILD  414
             YGIDF  GPTGRFSNG+   D L E LGF++ IP YS V+  E +L+GVNYAS A GI +
Sbjct  60    YGIDF-GGPTGRFSNGRTTVDVLTELLGFDNYIPAYSTVSGQE-ILQGVNYASAAAGIRE  117

Query  415   ESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLM  594
             E+G  +G+ I+   Q+ N+  T+A++   +     A  YL +C YSVGMG+NDY+NNY M
Sbjct  118   ETGAQLGQRITFSGQVENYKNTVAQVVEILGDEYTAADYLKRCIYSVGMGSNDYLNNYFM  177

Query  595   PQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGS  774
             PQ Y +SR YTP+Q+A+ L  ++  QL  L+  GARK A+ G G +GC P  +       
Sbjct  178   PQXYSTSRQYTPEQYADDLISRYRDQLNALYNYGARKFALVGIGAIGCSPNALAQGSEDG  237

Query  775   LSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNK  945
              +CV+ INSA ++FN+R+  ++  LN +   A F  IN        + +PS  G  N N 
Sbjct  238   TTCVERINSANRIFNNRLISMVQQLNNAHSDASFTYINAYGAFQDIITNPSAYGFTNTNT  297

Query  946   ACCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMD  1125
             ACC + +   +  C  G+ PC NR+EY+FWD FH +   N   A RSY A   +D YP+D
Sbjct  298   ACCGIGRNGGQLTCLPGEPPCLNRDEYVFWDAFHPSAAANTAIAKRSYNAQRSSDVYPID  357

Query  1126  ISSLLQL  1146
             IS L QL
Sbjct  358   ISQLAQL  364



>ref|NP_174259.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9C7N5.1|GDL14_ARATH RecName: Full=GDSL esterase/lipase At1g29660; AltName: Full=Extracellular 
lipase At1g29660; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG51756.1|AC068667_35 lipase/hydrolase, putative; 114382-116051 [Arabidopsis thaliana]
 gb|AAK91429.1| At1g29660/F15D2_21 [Arabidopsis thaliana]
 gb|AAM91390.1| At1g29660/F15D2_21 [Arabidopsis thaliana]
 gb|AEE31115.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=364

 Score =   333 bits (855),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 170/367 (46%), Positives = 230/367 (63%), Gaps = 7/367 (2%)
 Frame = +1

Query  58    MASGVKVWFAIAT-LLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLP  234
             M S ++ W  ++  +LL+ L  K + AEPQVPCYFIFGDSLVDNGNNN L + A+A+Y P
Sbjct  1     MESYLRKWCLVSVWVLLLGLGFK-VKAEPQVPCYFIFGDSLVDNGNNNRLRSIARADYFP  59

Query  235   YGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILD  414
             YGIDF  GPTGRFSNG+   D L E LGF++ IP YS V+  E +L+GVNYAS A GI +
Sbjct  60    YGIDF-GGPTGRFSNGRTTVDVLTELLGFDNYIPAYSTVSGQE-ILQGVNYASAAAGIRE  117

Query  415   ESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLM  594
             E+G  +G+ I+   Q+ N+  T+A++   +     A  YL +C YSVGMG+NDY+NNY M
Sbjct  118   ETGAQLGQRITFSGQVENYKNTVAQVVEILGDEYTAADYLKRCIYSVGMGSNDYLNNYFM  177

Query  595   PQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGS  774
             PQ Y +SR YTP+Q+A+ L  ++  QL  L+  GARK A+ G G +GC P  +       
Sbjct  178   PQFYSTSRQYTPEQYADDLISRYRDQLNALYNYGARKFALVGIGAIGCSPNALAQGSQDG  237

Query  775   LSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNK  945
              +CV+ INSA ++FN+R+  ++  LN +   A F  IN        + +PS  G  N N 
Sbjct  238   TTCVERINSANRIFNNRLISMVQQLNNAHSDASFTYINAYGAFQDIIANPSAYGFTNTNT  297

Query  946   ACCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMD  1125
             ACC + +   +  C  G+ PC NR+EY+FWD FH +   N   A RSY A   +D YP+D
Sbjct  298   ACCGIGRNGGQLTCLPGEPPCLNRDEYVFWDAFHPSAAANTAIAKRSYNAQRSSDVYPID  357

Query  1126  ISSLLQL  1146
             IS L QL
Sbjct  358   ISQLAQL  364



>gb|AAM64368.1| lipase/hydrolase, putative [Arabidopsis thaliana]
Length=363

 Score =   333 bits (855),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 169/366 (46%), Positives = 228/366 (62%), Gaps = 6/366 (2%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPY  237
             M S +  W  +  LL    S+    A+ QVPC+F+FGDSLVDNGNNN L + A++NY PY
Sbjct  1     MESYLTKWCVVLVLLCFGFSVVKAQAQAQVPCFFVFGDSLVDNGNNNGLISIARSNYFPY  60

Query  238   GIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDE  417
             GIDF  GPTGRFSNGK   D +AE LGFN  IP Y+ V+  + +L GVNYAS A GI +E
Sbjct  61    GIDF-GGPTGRFSNGKTTVDVIAELLGFNGYIPAYNTVSGRQ-ILSGVNYASAAAGIREE  118

Query  418   SGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMP  597
             +G  +G+ IS   Q+ N+  T++++   +     A  YL +C YSVG+G+NDY+NNY MP
Sbjct  119   TGRQLGQRISFSGQVRNYQTTVSQVVQLLGDETRAADYLKRCIYSVGLGSNDYLNNYFMP  178

Query  598   QKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSL  777
               Y SSR +TP+Q+A  L  ++  QL  L+  GARK A+ G G +GC P  +    +G  
Sbjct  179   TFYSSSRQFTPEQYANDLISRYSTQLNALYNYGARKFALSGIGSVGCSPNALAGSPDGR-  237

Query  778   SCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKA  948
             +CVD INSA Q+FN++++ ++D LN +   AKFI IN   +    + +P+  G    N  
Sbjct  238   TCVDRINSANQIFNNKLRSLVDQLNNNHPDAKFIYINAYGIFQDMITNPARFGFRVTNAG  297

Query  949   CCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDI  1128
             CC + +   +  C  GQ PC +RN Y+FWD FH TE  N+  A RSY A   +DAYPMDI
Sbjct  298   CCGIGRNAGQITCLPGQRPCRDRNAYVFWDAFHPTEAANVIIARRSYNAQSASDAYPMDI  357

Query  1129  SSLLQL  1146
             S L QL
Sbjct  358   SRLAQL  363



>emb|CAN71483.1| hypothetical protein VITISV_004374 [Vitis vinifera]
Length=360

 Score =   333 bits (854),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 177/361 (49%), Positives = 230/361 (64%), Gaps = 10/361 (3%)
 Frame = +1

Query  73    KVWFAIATLLLMFLSLKPLV-AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDF  249
             KVW  +A LL +   L+     +PQVPCYFI GDSL DNGNNN LST+AKAN+ PYGIDF
Sbjct  7     KVWRRVAFLLSLLSILQICARGDPQVPCYFILGDSLSDNGNNNGLSTKAKANFKPYGIDF  66

Query  250   PDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTH  429
             P GPTGRFSNG+ + D  AE LGF   IPP+++    + +LKGVNYAS + GILDESG  
Sbjct  67    PVGPTGRFSNGRTIVDVTAELLGFGEYIPPFTSAKGRD-VLKGVNYASASAGILDESGKQ  125

Query  430   MGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYP  609
             +G+ I +  QL N+  T ++I+  + G  AA  YLNKC ++VG+G+ND+INNY MP  + 
Sbjct  126   LGQAIPLGGQLKNYLKTFSQISKILGGGTAAHKYLNKCMFTVGIGSNDFINNYFMPDVFR  185

Query  610   SSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGN--GSLSC  783
             +S LY+ D+F   L  ++   L  L+  GARKVA+FG G +GC P E+  +G   GS+ C
Sbjct  186   TSELYSLDRFVATLIDQYSQXLXTLYKCGARKVALFGLGPIGCAPAELARYGATPGSI-C  244

Query  784   VDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACCQVS  963
             VD IN AV  FN R+  ++DDLN + K AKF  IN+  +  GD +  G    N  CC   
Sbjct  245   VDKINDAVVRFNKRLISLVDDLNDNYKDAKFTYINILEIGTGDATAAGFKVTNSGCCGGQ  304

Query  964   KTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQ  1143
             K      C     PC NR+EY FWD FH T+  N+  A R+Y A  PTDA+P+DIS+L  
Sbjct  305   K-----GCLPLATPCKNRDEYTFWDEFHPTDAMNVIFANRAYKALTPTDAHPIDISTLAC  359

Query  1144  L  1146
             L
Sbjct  360   L  360



>ref|XP_010499477.1| PREDICTED: GDSL esterase/lipase At1g29670 [Camelina sativa]
Length=363

 Score =   333 bits (854),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 170/366 (46%), Positives = 232/366 (63%), Gaps = 6/366 (2%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPY  237
             M S ++    +  LL    S+    A+ QVPC+F+FGDSLVDNGNNN L + A+ANY PY
Sbjct  1     MESYLRKCCVVFVLLSFGFSVVKAQAQAQVPCFFVFGDSLVDNGNNNGLVSFARANYFPY  60

Query  238   GIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDE  417
             GIDF  GPTGRFSNGK   D +AE LGFN  IP Y++V+  + +L GVNYAS A GI +E
Sbjct  61    GIDF-GGPTGRFSNGKTTVDEIAELLGFNGYIPAYNSVSGRQ-ILSGVNYASAAAGIREE  118

Query  418   SGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMP  597
             +G  +G+ IS   Q+ N+  T++++   +     A  YL +C YSVG+G+NDY+NNY MP
Sbjct  119   TGRQLGQRISFSGQVRNYQSTVSQVVQLLGDETRAADYLKRCIYSVGLGSNDYLNNYFMP  178

Query  598   QKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSL  777
               Y SSR +TP+Q+A+ L  ++  QL  L+  GARK A+ G G +GC P  +    +G  
Sbjct  179   TFYSSSRQFTPEQYADDLISRYSTQLNALYNYGARKFALSGVGAVGCSPNALAGSRDGR-  237

Query  778   SCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKA  948
             +CV+ INSA Q+FN+++K ++D LN +   AKFI IN   +    + +P+  G    N  
Sbjct  238   TCVERINSANQIFNNKLKSLVDQLNNNHPDAKFIYINAYGIFQDMITNPARFGFRVTNAG  297

Query  949   CCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDI  1128
             CC + +   +  C  GQ PC+NRN Y+ WD+FH TE  N+  A RSY A  P+DAYPMDI
Sbjct  298   CCGIGRNAGQITCLPGQRPCNNRNAYVCWDSFHPTEAANVIIARRSYNAQSPSDAYPMDI  357

Query  1129  SSLLQL  1146
             S L QL
Sbjct  358   SRLAQL  363



>ref|XP_010911116.1| PREDICTED: GDSL esterase/lipase At5g45670-like [Elaeis guineensis]
Length=367

 Score =   333 bits (854),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 166/362 (46%), Positives = 232/362 (64%), Gaps = 7/362 (2%)
 Frame = +1

Query  70    VKVWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDF  249
             V+VW+ +  +  + + L  +  +PQVPCYFIFGDSLVDNGNNN +++ A+ANY+PYGIDF
Sbjct  10    VEVWWLMLLVSSLLMGL--VRPDPQVPCYFIFGDSLVDNGNNNYIASLARANYMPYGIDF  67

Query  250   PDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTH  429
             P GP+GRFSNG    D +A+ LGF+  IPPY A T  + LL G N+AS A GI +E+G  
Sbjct  68    PGGPSGRFSNGMTTVDVIAQLLGFDDFIPPY-ATTRGQALLTGANFASAAAGIREETGQQ  126

Query  430   MGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYP  609
             +G  I+   QL N+   +  +   +    +A  YL+KC +SVGMG+NDY+NNY MP  Y 
Sbjct  127   LGGRINFGGQLQNYQAAVQEVVNILGDEDSAASYLSKCIFSVGMGSNDYLNNYFMPAFYS  186

Query  610   SSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVD  789
             SSR YTP Q+A++L +++  Q++ L+  GARKV + G G +GC P E+         CVD
Sbjct  187   SSRQYTPVQYADVLIEQYSQQIRTLYNYGARKVVLIGLGQVGCSPNELAQLSPNGEVCVD  246

Query  790   SINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQV  960
              I+SA+Q+FN ++  ++D  N +L+GA F  IN   +    + +PS  G+   N+ CC V
Sbjct  247   RIDSAIQIFNRKLIALVDQFN-TLEGAHFTYINANGIFADIMRNPSAYGLTVTNRGCCGV  305

Query  961   SKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLL  1140
              +   +  C   Q PC NRNEY+FWD FH TE  N+    RSY+A   +DAYPMDIS L+
Sbjct  306   GRNNGQITCLPYQTPCPNRNEYLFWDAFHPTEAANIIIGKRSYSAESSSDAYPMDISHLV  365

Query  1141  QL  1146
             Q+
Sbjct  366   QV  367



>emb|CDX90202.1| BnaA08g17820D [Brassica napus]
Length=360

 Score =   333 bits (853),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 171/366 (47%), Positives = 225/366 (61%), Gaps = 9/366 (2%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPY  237
             M S ++ W  +  LL +  S+       QVPCYFIFGDSLVDNGNNN L + A+ANY PY
Sbjct  1     MESYLRKWCVVFVLLGLAFSV---TKAQQVPCYFIFGDSLVDNGNNNGLVSFARANYFPY  57

Query  238   GIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDE  417
             GIDF  GPTGRFSNG+   D +AE LGFN  IP Y++V   + +L GVNYAS A GI DE
Sbjct  58    GIDF-GGPTGRFSNGRTTVDEIAELLGFNDYIPAYNSVRGRQ-ILTGVNYASAAAGIRDE  115

Query  418   SGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMP  597
             +G  +G+ IS   Q+ N+  T+ ++   + G   A  YL +C YSVGMG+NDY+NNY MP
Sbjct  116   TGRQLGQRISFSGQVRNYQNTVQQVVSLLGGATQAADYLKRCIYSVGMGSNDYLNNYFMP  175

Query  598   QKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSL  777
               Y SSR +TP+Q+A  L  ++  QL  L+  GARK A+ G G +GC P  +      S 
Sbjct  176   TFYSSSRQFTPEQYANDLISRYSTQLNALYNYGARKFALIGIGAIGCSPNAL-ARSRDSR  234

Query  778   SCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKA  948
             +C + INSA Q+FN +++ ++D LN +   AKF  IN   +    + +PS  G    N  
Sbjct  235   TCDERINSANQIFNSKLRSLVDQLNNNHPDAKFTYINAYDIFQDMIKNPSRFGFRVTNAG  294

Query  949   CCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDI  1128
             CC + +   +  C  GQ PC +RN Y+FWD FH TE  N+  A RSY A  P+DAYPMDI
Sbjct  295   CCGIGRNAGQITCLPGQRPCRDRNAYVFWDAFHPTEAANIVIARRSYKAESPSDAYPMDI  354

Query  1129  SSLLQL  1146
             S L +L
Sbjct  355   SGLARL  360



>gb|KCW78677.1| hypothetical protein EUGRSUZ_C00134, partial [Eucalyptus grandis]
Length=333

 Score =   332 bits (850),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 169/338 (50%), Positives = 226/338 (67%), Gaps = 10/338 (3%)
 Frame = +1

Query  127   LVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNLADYLA  306
             ++  PQVPCYFI+GDSL DNGNNN+L T+AKANY PYGIDFPD  TGRF+NG+   D +A
Sbjct  2     VLGAPQVPCYFIYGDSLADNGNNNDLETQAKANYPPYGIDFPDRATGRFTNGRTSVDIIA  61

Query  307   EFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNHGLTLA  486
               LGF+  I P+++   +E +L GVNYASG  GI DE+G  +G+ IS++ QL NH +T++
Sbjct  62    GLLGFDRYIQPFASAKGSE-ILIGVNYASGGAGIRDETGQQLGDRISLNHQLQNHLVTIS  120

Query  487   RIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAKKHY  666
             R+   +     A  YLNKC Y+VGMG+NDYINNY MP  Y + +LY P+Q+A++L +++ 
Sbjct  121   RVRDMLGSNATA--YLNKCIYTVGMGSNDYINNYFMPDVYQTGKLYMPEQYADVLIEQYQ  178

Query  667   VQLKKLHALGARKVAVFGPGVLGCIPEEMETHG-NGSLSCVDSINSAVQMFNDRMKPIID  843
              QLK L++ GARKVA+FG  V+GC P E+   G NGSL CVD INSAV +FNDR+KP++D
Sbjct  179   QQLKTLYSYGARKVAIFGLSVIGCAPTEISRFGTNGSL-CVDKINSAVMLFNDRLKPLVD  237

Query  844   DLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQVPCSNRNE  1023
             +LN +L  AKF  I+   +A     +  +      CC+V +    G C   + PC  R  
Sbjct  238   ELNRNLVDAKFTYIDFFGIATA--GLPALRVAGSTCCKVQE---DGMCIPFETPCLIRLL  292

Query  1024  YMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSL  1137
             + F+D FH TEI NL    R+Y A L +DAYP DI  L
Sbjct  293   HAFYDGFHPTEIANLVFGARAYKALLSSDAYPFDIHHL  330



>ref|XP_007025248.1| GDSL-like Lipase/Acylhydrolase superfamily protein [Theobroma 
cacao]
 gb|EOY27870.1| GDSL-like Lipase/Acylhydrolase superfamily protein [Theobroma 
cacao]
Length=361

 Score =   332 bits (852),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 161/339 (47%), Positives = 220/339 (65%), Gaps = 4/339 (1%)
 Frame = +1

Query  139   PQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNLADYLAEFLG  318
             PQVPCYFIFGDSLVDNGNNN LS+ A+ANYLPYGIDFP+GPTGRFSNGK   D +AE LG
Sbjct  24    PQVPCYFIFGDSLVDNGNNNQLSSLARANYLPYGIDFPNGPTGRFSNGKTTIDVIAELLG  83

Query  319   FNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNHGLTLARIAL  498
             F++ IPPYS V+  + +L GVNYAS A GI +E+G  +G  IS   Q+ N+  T++++  
Sbjct  84    FDNYIPPYSTVSGRQ-ILGGVNYASAAAGIREETGQQLGGRISFSGQVRNYRETVSQVVN  142

Query  499   YMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAKKHYVQLK  678
              +     A  YL+KC YS+G+G+NDY+NNY MP  Y +SR Y P+Q+A++L +++  QL+
Sbjct  143   LLGDEDTAANYLSKCIYSIGLGSNDYLNNYFMPAFYSTSRQYNPEQYADVLIQQYTEQLQ  202

Query  679   KLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMFNDRMKPIIDDLNGS  858
              L+  GARK  + G G +GC P E+  +     +CV+ IN A ++FN +++ ++D  N +
Sbjct  203   DLYNYGARKFVLVGLGQIGCSPNELAQNSGDGRTCVERINDANRIFNSKLRALVDQFNNN  262

Query  859   LKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQVPCSNRNEYM  1029
                AKFI IN   +      +P+  G    N  CC V +   +  C   Q PC NR+EY+
Sbjct  263   NSDAKFIYINAYGIFQDITSNPAAYGFKVTNAGCCGVGRNNGQITCLPYQTPCQNRDEYL  322

Query  1030  FWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             FWD FH  E  N+    RSY+A   +DAYP+DI  L QL
Sbjct  323   FWDAFHPGEAANVIIGRRSYSAQSSSDAYPIDIRRLAQL  361



>ref|XP_004134596.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Cucumis sativus]
 ref|XP_004169530.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Cucumis sativus]
 gb|KGN49344.1| hypothetical protein Csa_6G520420 [Cucumis sativus]
Length=374

 Score =   332 bits (852),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 167/337 (50%), Positives = 215/337 (64%), Gaps = 5/337 (1%)
 Frame = +1

Query  145   VPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNLADYLAEFLGFN  324
             VPCYFIFGDSLVDNGNNN LS+ A+A+YLPYGIDFP GPTGRFSNGK   D +AE LGFN
Sbjct  40    VPCYFIFGDSLVDNGNNNRLSSLARADYLPYGIDFPRGPTGRFSNGKTTVDVIAELLGFN  99

Query  325   SSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNHGLTLARIALYM  504
               IPPYS  T    +L+GVNYAS A GI +E+G  +G  IS   Q+ NH   + +I   +
Sbjct  100   GYIPPYSN-TRGRDILRGVNYASAAAGIREETGQQLGGRISFSGQVRNHQNIVTQIVNIL  158

Query  505   KGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAKKHYVQLKKL  684
                  A  YLNKC YS+G+G+NDY+NNY MPQ Y SSR Y PDQ+A++L +++  QL  L
Sbjct  159   GDENTAADYLNKCIYSIGLGSNDYLNNYFMPQIYSSSRQYAPDQYAQILIQQYTQQLSIL  218

Query  685   HALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMFNDRMKPIIDDLNGSLK  864
             +  GARK  +FG G +GC P  + +  +G  SC    N A Q+FN+R+K ++D LN +  
Sbjct  219   YDNGARKFVLFGVGQIGCSPNALASSPDGR-SCNQRYNFANQLFNNRLKGLVDQLNRNQP  277

Query  865   GAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQVPCSNRNEYMFW  1035
              A+FI I+   +    +  PS  G    N  CC + +   +  C   Q PC+NR EY+FW
Sbjct  278   DARFIYIDSYGIFQDIINSPSSFGFRVTNAGCCGIGRNNGQITCLPFQTPCANRREYLFW  337

Query  1036  DNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             D FH TE GN     R+Y+A   +DAYP+DI  L QL
Sbjct  338   DAFHPTEAGNSIVGRRAYSAQRSSDAYPIDIRRLAQL  374



>ref|XP_007225031.1| hypothetical protein PRUPE_ppa019929mg, partial [Prunus persica]
 gb|EMJ26230.1| hypothetical protein PRUPE_ppa019929mg, partial [Prunus persica]
Length=334

 Score =   331 bits (848),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 173/339 (51%), Positives = 224/339 (66%), Gaps = 11/339 (3%)
 Frame = +1

Query  148   PCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNLADYLAEFLGFNS  327
             PCYF+FGDSL D GNNN L T A+ NY PYGIDFP GPTGRFSNG+NL D +AE LGF+ 
Sbjct  1     PCYFVFGDSLSDTGNNNGLLTLARVNYPPYGIDFPRGPTGRFSNGRNLVDVIAELLGFSH  60

Query  328   SIPPYSAVTTTEGL--LKGVNYASGAGGILDESGTHMGEVISMDQQLVNHGLTLARIALY  501
              IPP++   T  GL  L+GVNYASGA GI DESG +    IS +QQL+NH +T+ RIA  
Sbjct  61    YIPPFA---TARGLKILEGVNYASGAAGIRDESGRNQLIRISFNQQLLNHQITVNRIASL  117

Query  502   MKGYR-AARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAKKHYVQLK  678
             M+  R +A  YL KC Y+VG+G NDYIN Y +P+ Y +SR YTPDQ+A +L ++   QL+
Sbjct  118   MRNNRPSAVQYLGKCIYTVGIGTNDYINKYFLPRLYSTSRKYTPDQYAGVLIQEFSEQLR  177

Query  679   KLHALGARKVAVFGPGVLGCIPEEMETHGNGSLS--CVDSINSAVQMFNDRMKPIIDDLN  852
             +L+  GARK+A+FG G +G  P E++  G  +++  C   INSAVQ+FN+R+K ++ DLN
Sbjct  178   RLYKTGARKIALFGIGAIGSTPFEVDKCGGTNITSLCSAKINSAVQLFNERLKSLVTDLN  237

Query  853   GSLKGAKFILINMTSLALGDPSIIGINNVNKA-CCQVSKTKAKGQCEEGQVPCSNRNEYM  1029
              +L  AKF  I+   + L   +    + V+ A CC+       G C     PC NR +Y 
Sbjct  238   TNLIDAKFTFIDYFGIGLSSAAASAGSMVSDAPCCEAE--SETGLCVPFSTPCQNRTQYS  295

Query  1030  FWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             FWD FH TEI N+    R+Y ATLPTDA P DIS L Q+
Sbjct  296   FWDAFHPTEISNVVVGRRAYKATLPTDAVPYDISHLAQV  334



>ref|XP_009109657.1| PREDICTED: GDSL esterase/lipase At1g29660 [Brassica rapa]
Length=364

 Score =   332 bits (850),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 172/357 (48%), Positives = 229/357 (64%), Gaps = 6/357 (2%)
 Frame = +1

Query  88    IATLLLMFLSLKPLV-AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPT  264
             + ++L+++L L   V AEPQVPCYFIFGDSLVDNGNNN LS+ A+A+Y PYGID   GPT
Sbjct  10    LVSVLVLYLGLGFNVKAEPQVPCYFIFGDSLVDNGNNNGLSSLARADYYPYGIDL-GGPT  68

Query  265   GRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVI  444
             GRFSNGK   D +AE LGF++ IP YS V+  E +L+GVNYAS A GI +E+G  +G+ I
Sbjct  69    GRFSNGKTTVDEIAELLGFDNYIPAYSDVSG-EQILQGVNYASAAAGIREETGQQLGQRI  127

Query  445   SMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLY  624
                 Q+ N+  T+A++   +     A  YL KC YSVG+G+NDY+NNY MPQ Y +SR Y
Sbjct  128   PFSGQVQNYQNTVAQVVELLGDENTAADYLRKCIYSVGLGSNDYLNNYFMPQYYSTSRQY  187

Query  625   TPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSA  804
             TP+Q+A+ L  ++  QL  L+  GARK A+ G G +GC P  +        +CV+ +NSA
Sbjct  188   TPEQYADDLINRYRDQLNALYNYGARKFALVGVGAIGCSPNALAQGSPDGTTCVERLNSA  247

Query  805   VQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKA  975
              ++FN+R+K ++  LN     AKF  IN   +    + +PS  G    N ACC V +   
Sbjct  248   NRIFNNRLKSMVQQLNNEHSDAKFSYINAYGVFQDIIANPSAYGFTVTNAACCGVGRNGG  307

Query  976   KGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             +  C  GQ PC NRNEY+FWD FH T+  N   A RSY A   +D YP+DISSL +L
Sbjct  308   QLTCLPGQGPCPNRNEYVFWDAFHPTDAANTIIAQRSYKAQSSSDVYPIDISSLARL  364



>ref|XP_010054297.1| PREDICTED: GDSL esterase/lipase At5g45670-like [Eucalyptus grandis]
 gb|KCW76041.1| hypothetical protein EUGRSUZ_D00409 [Eucalyptus grandis]
Length=370

 Score =   332 bits (850),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 164/342 (48%), Positives = 221/342 (65%), Gaps = 5/342 (1%)
 Frame = +1

Query  133   AEPQVPCYFIFGDSLVDNGNNNNLSTE-AKANYLPYGIDFPDGPTGRFSNGKNLADYLAE  309
             A+PQVPC+FI GDSL+DNGNNN L+   AKANY PYGIDF  GPTGRFSNGK   D +++
Sbjct  30    AQPQVPCFFILGDSLLDNGNNNGLAASLAKANYRPYGIDFSAGPTGRFSNGKTAGDVISQ  89

Query  310   FLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNHGLTLAR  489
              LGF++ IPPY A T    LLKGVNYAS A GI +E+G  +G  I+  +Q+ N+  T+++
Sbjct  90    LLGFSNYIPPY-ATTRGNALLKGVNYASAAAGIREETGRQLGGRITFSRQVQNYQSTVSQ  148

Query  490   IALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAKKHYV  669
             +   + G   A  YL+KC + VGMG+NDY+NNY MPQ Y SS+ Y+P+Q+A++L +++  
Sbjct  149   LVSILGGNSTAADYLSKCIFVVGMGSNDYLNNYYMPQFYTSSQQYSPEQWADILIQQYVQ  208

Query  670   QLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMFNDRMKPIIDDL  849
             QL+ ++  GARKVA+ G G +GC P E+  + + + +CV  IN A Q+FN+++KP++DD 
Sbjct  209   QLRIMYNNGARKVALIGLGQIGCSPSELARNSSDNSTCVQKINDACQIFNNKLKPVVDDF  268

Query  850   NGSLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQVPCSNRN  1020
             N +   AKF  IN  ++    L  PS  G   +N  CC V +   +  C   Q PC NR 
Sbjct  269   NKNYANAKFTYINTYNIFQDLLTKPSSFGFRIINSGCCGVGRNNGQITCLPLQNPCPNRK  328

Query  1021  EYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             EY+FWD FH TE  N     RSY A    DAYP DI  L  L
Sbjct  329   EYLFWDAFHPTEAANTVVGQRSYMAQSSADAYPSDIRRLATL  370



>ref|XP_002316749.2| GDSL-motif lipase/hydrolase family protein [Populus trichocarpa]
 gb|EEE97361.2| GDSL-motif lipase/hydrolase family protein [Populus trichocarpa]
Length=365

 Score =   331 bits (849),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 170/365 (47%), Positives = 228/365 (62%), Gaps = 4/365 (1%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPY  237
             M +  K W+ +  + L+ LS+K      QVPCYFIFGDSLVDNGNNN LS+ AKANY+PY
Sbjct  1     MEAVQKKWWVVCVVFLVLLSVKYGARAQQVPCYFIFGDSLVDNGNNNQLSSLAKANYMPY  60

Query  238   GIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDE  417
             GIDFP GPTGRFSNG+   D +AE LGF + IPPY A      +L GVNYAS A GI +E
Sbjct  61    GIDFPRGPTGRFSNGRTTVDVIAEQLGFRNYIPPY-ATARGRDILGGVNYASAAAGIREE  119

Query  418   SGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMP  597
             +G  +G+ IS   Q+ N+  T+++I   +        YL+KC  S+ +G+NDY+NNY MP
Sbjct  120   TGRQLGDRISFSGQVRNYQNTVSQIVNILGDKNTTANYLSKCILSIALGSNDYLNNYFMP  179

Query  598   QKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSL  777
             Q Y SS+ YTP+Q+A +L +++  QL+ L+  GARK A+ G G +GC P E+  +     
Sbjct  180   QLYSSSQQYTPEQYANVLIQQYTQQLRILYNNGARKFALIGLGQIGCSPSELAQNSPDGR  239

Query  778   SCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKA  948
             +CV  INSA Q+FND+++ ++   NG+   A+FI IN   +    +  P+  G  N N  
Sbjct  240   TCVQRINSANQIFNDKLRSLVAQFNGNTPDARFIYINAYGIFQDLITRPAAFGFTNTNTG  299

Query  949   CCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDI  1128
             CC V +   +  C   Q PC NRN+Y+FWD FH TE  NL    RSY+A   +DAYP DI
Sbjct  300   CCGVGRNNGQITCLPLQAPCRNRNQYVFWDAFHPTEAVNLIIGRRSYSAQSASDAYPYDI  359

Query  1129  SSLLQ  1143
               L Q
Sbjct  360   RQLAQ  364



>ref|XP_002890824.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH67083.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=364

 Score =   331 bits (848),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 171/367 (47%), Positives = 228/367 (62%), Gaps = 7/367 (2%)
 Frame = +1

Query  58    MASGVKVWFAIAT-LLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLP  234
             M S ++ W  ++  +LL+ L  K + AEPQVPCYFIFGDSLVDNGNNN L + A+A+Y P
Sbjct  1     MESYLRKWCLVSVWVLLLGLGFK-VKAEPQVPCYFIFGDSLVDNGNNNRLRSIARADYFP  59

Query  235   YGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILD  414
             YGIDF  GPTGRFSNGK   D L E LGF++ IP YS V+  + +L+GVNYAS A GI +
Sbjct  60    YGIDF-GGPTGRFSNGKTTVDVLTELLGFDNYIPAYSTVSGQQ-ILQGVNYASAAAGIRE  117

Query  415   ESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLM  594
             E+G  +G+ I+   Q+ N+  T+A +   +     A  YL +C YSVGMG+NDY+NNY M
Sbjct  118   ETGAQLGQRITFSGQVENYKNTVAAVVELLGDANTAADYLRRCIYSVGMGSNDYLNNYFM  177

Query  595   PQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGS  774
             PQ YP+SRLYTP+Q+A+ L  ++  QL  L+  GARK A+ G G +GC P  +       
Sbjct  178   PQFYPTSRLYTPEQYADDLISRYREQLNALYNYGARKFALVGIGAIGCSPNALAQGSPDG  237

Query  775   LSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNK  945
              +CV+ INSA ++FN R+  ++  LN     A+F  IN        + +PS  G    N 
Sbjct  238   TTCVERINSANRIFNSRLISMVQQLNNEHSDARFTYINAYGAFQDIIANPSAYGFTVTNT  297

Query  946   ACCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMD  1125
             ACC + +   +  C  GQ PC NR+EY+FWD FH +   N   A RSY A   +D  P+D
Sbjct  298   ACCGIGRNGGQLTCLPGQPPCLNRDEYVFWDAFHPSAAANTVIAQRSYNAQRSSDVNPID  357

Query  1126  ISSLLQL  1146
             IS L QL
Sbjct  358   ISQLAQL  364



>emb|CDX94689.1| BnaC07g09690D [Brassica napus]
Length=364

 Score =   330 bits (847),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 170/367 (46%), Positives = 234/367 (64%), Gaps = 7/367 (2%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLKPLV-AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLP  234
             M S +K W  + ++ +++L L+  V AEPQVPCYFIFGDSLVDNGNNN L++ A+A+Y P
Sbjct  1     MESYLKKW-CLVSMFVLYLGLRFKVKAEPQVPCYFIFGDSLVDNGNNNRLASIARADYYP  59

Query  235   YGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILD  414
             YGID    PTGRFSNGK   D +AE LGF++ IP YS V+  E +L+G NYAS A GI +
Sbjct  60    YGIDLGR-PTGRFSNGKTTVDEIAELLGFDNYIPAYSDVSG-EQILQGCNYASAAAGIRE  117

Query  415   ESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLM  594
             E+G  +G+ I+   Q+ N+  T++++   +    +A  YL +C YSVG+G+NDY+NNY M
Sbjct  118   ETGQQLGQRITFSGQVQNYLNTVSQVVQILGDENSAADYLRQCIYSVGLGSNDYLNNYFM  177

Query  595   PQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGS  774
             PQ Y +SR YTP+Q+A+ L  ++  QL  L+  GARK A+ G G +GC P  + T     
Sbjct  178   PQFYSTSRQYTPEQYADDLINRYKDQLNALYNYGARKFALVGVGAIGCSPNSLATGSPDG  237

Query  775   LSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNK  945
              +CV+SINSA ++FN R+K ++  LN     A+F  IN   +    + +PS  G    N 
Sbjct  238   TTCVESINSANRIFNSRLKSMVQQLNNDHSDARFTYINAYGVFQDIIANPSAYGFRVTNA  297

Query  946   ACCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMD  1125
             ACC V +   +  C  GQ PC NR+EY+FWD FH T+  N   A RSY A    D YP+D
Sbjct  298   ACCGVGRNGGQLTCLPGQSPCPNRDEYVFWDAFHPTDHANTIIAQRSYNAQSSDDVYPID  357

Query  1126  ISSLLQL  1146
             IS+L +L
Sbjct  358   ISALARL  364



>ref|XP_010057187.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Eucalyptus grandis]
Length=369

 Score =   330 bits (847),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 166/341 (49%), Positives = 225/341 (66%), Gaps = 4/341 (1%)
 Frame = +1

Query  133   AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNLADYLAEF  312
             A+PQVPCYFIFGDSLVDNGNNN L++ A++NYLPYGIDF  GPTGRFSNGK   D +AE 
Sbjct  30    ADPQVPCYFIFGDSLVDNGNNNGLNSLARSNYLPYGIDFAAGPTGRFSNGKTTVDVIAEL  89

Query  313   LGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNHGLTLARI  492
             LGF+  IPPY+ V + + +LKGVNYAS A GI  E+G  +G  I+ + QL N+  T++++
Sbjct  90    LGFDDYIPPYT-VASGDAILKGVNYASAAAGIRAETGQQLGARIAFEGQLQNYQSTVSQL  148

Query  493   ALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAKKHYVQ  672
                +     A  YL+KC YSVGMG+NDY+NNY MPQ Y SS  +TPDQ+A+ L +++  Q
Sbjct  149   VNILGNEDTAANYLSKCIYSVGMGSNDYLNNYFMPQYYSSSNQFTPDQYADELIQEYSQQ  208

Query  673   LKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMFNDRMKPIIDDLN  852
             L+ L+  GARKV + G G +GC P  +        +CVD IN A Q++N+++K ++D LN
Sbjct  209   LRTLYNYGARKVVLIGVGQIGCSPNALAQSSADGTTCVDRINVACQIYNNKLKSLVDQLN  268

Query  853   GSLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQVPCSNRNE  1023
              +L  A+FI ++   +    +  P+  G +  N  CC V +   +  C   Q PC NRNE
Sbjct  269   TNLSDARFIYVDAYGIFQDLMTRPASFGFSVTNAGCCGVGRNNGQITCLPFQTPCQNRNE  328

Query  1024  YMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             Y+FWD +H +E  N+    RSY+A  PTDAYP+DI  L QL
Sbjct  329   YLFWDAYHPSEAANIIVGRRSYSAEAPTDAYPIDIRRLAQL  369



>ref|XP_008443704.1| PREDICTED: GDSL esterase/lipase At5g45670-like [Cucumis melo]
Length=374

 Score =   330 bits (847),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 165/338 (49%), Positives = 217/338 (64%), Gaps = 5/338 (1%)
 Frame = +1

Query  142   QVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNLADYLAEFLGF  321
             QVPCYFIFGDSLVDNGNNN L + A+A+YLPYGIDF  GPTGRFSNGK   D +AE LGF
Sbjct  39    QVPCYFIFGDSLVDNGNNNQLQSLARADYLPYGIDF-GGPTGRFSNGKTTVDVIAELLGF  97

Query  322   NSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNHGLTLARIALY  501
             +  IPPY A      +L+GVNYAS A GI +E+G  +G  IS   Q+ N+  T++++   
Sbjct  98    DDYIPPY-ATARGRDILRGVNYASAAAGIREETGRQLGGRISFSGQVENYQNTVSQVVDL  156

Query  502   MKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAKKHYVQLKK  681
             +    +A  YL+KC YS+G+G+NDY+NNY MPQ Y +   YTP Q++E L +++  QL+ 
Sbjct  157   LGDEDSAAEYLSKCIYSIGLGSNDYLNNYFMPQFYSTGNQYTPQQYSENLIQQYAEQLRL  216

Query  682   LHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMFNDRMKPIIDDLNGSL  861
             L+  GARK  +FG G +GC P E+  +     +CV  INSA Q+FN  +K ++D  N + 
Sbjct  217   LYNYGARKFVLFGIGQIGCSPNELAQNSPDGRTCVQRINSANQIFNAGLKSLVDQFNNNQ  276

Query  862   KGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQVPCSNRNEYMF  1032
               AKFI I+   +    + +PS  G   VN  CC V +   +  C   Q PCSNR+EY+F
Sbjct  277   ADAKFIYIDSFGIFQDVIDNPSAFGFRVVNTGCCGVGRNNGQITCLPFQTPCSNRDEYLF  336

Query  1033  WDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             WD FH TE GN     R+Y+A  PTDAYP+DI  L QL
Sbjct  337   WDAFHPTEAGNTVVGRRAYSAQRPTDAYPVDIRRLAQL  374



>ref|XP_008371536.1| PREDICTED: GDSL esterase/lipase At5g45670 [Malus domestica]
Length=365

 Score =   330 bits (847),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 166/367 (45%), Positives = 228/367 (62%), Gaps = 5/367 (1%)
 Frame = +1

Query  55    LMASGVKVWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLP  234
             +  +  ++W A   +  + +      AEPQVPCYFIFGDSLVDNGNNN L + A+ANYLP
Sbjct  1     MAGTARRMWVATVVVXAVSMWWSGARAEPQVPCYFIFGDSLVDNGNNNQLQSLARANYLP  60

Query  235   YGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILD  414
             YGIDF  GPTGRFSNGK   D +AE LGF+  IPPY A    + +LKGVN+AS A GI +
Sbjct  61    YGIDF-GGPTGRFSNGKTTVDVVAELLGFDDFIPPY-ATARGQDVLKGVNFASAAAGIRE  118

Query  415   ESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLM  594
             E+G  +G  I+   Q+ N+  T++++   + G   A  YL+KC YSVG+G+NDY+NNY M
Sbjct  119   ETGRQLGGRITFSGQVKNYQNTVSQVVNLLXGEDQAANYLSKCIYSVGLGSNDYLNNYFM  178

Query  595   PQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGS  774
             PQ Y ++  +TP+Q+A+ L   +  QL+ L+  GARKV +FG G +GC P E+  +    
Sbjct  179   PQFYNTANQFTPEQYADSLIHDYSQQLRILYNYGARKVVLFGIGQVGCSPSELAQNSPDG  238

Query  775   LSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNK  945
              +CV  INSA Q+FN ++K + ++ N +L  A+FI ++   +    +  P+  G    N 
Sbjct  239   STCVQKINSANQIFNSKLKALANEFNTNLADARFIFVDTYGIFQDIISSPAQYGFRVTNA  298

Query  946   ACCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMD  1125
              CC V +   +  C   Q PC NRNEY+FWD FH TE GN   A R Y+A   +DAYP+D
Sbjct  299   GCCGVGRNNGQITCLPFQTPCQNRNEYLFWDAFHPTEAGNAVIARRGYSAVRASDAYPID  358

Query  1126  ISSLLQL  1146
             I  L  L
Sbjct  359   IRRLALL  365



>ref|XP_009102834.1| PREDICTED: GDSL esterase/lipase At1g29660-like [Brassica rapa]
 emb|CDY44295.1| BnaA07g07790D [Brassica napus]
Length=364

 Score =   330 bits (846),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 170/367 (46%), Positives = 235/367 (64%), Gaps = 7/367 (2%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLKPLV-AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLP  234
             M S +K W  + ++ +++L L+  V AEPQVPCYFIFGDSLVDNGNNN L++ A+A+Y P
Sbjct  1     MESYLKKW-CLVSMFVLYLGLRFKVKAEPQVPCYFIFGDSLVDNGNNNRLASIARADYYP  59

Query  235   YGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILD  414
             YGID    PTGRFSNGK   D +AE LGF++ IP YS V+  E +L+GVNYAS A GI +
Sbjct  60    YGIDLGR-PTGRFSNGKTTVDEIAELLGFDNYIPAYSDVSG-EQILQGVNYASAAAGIRE  117

Query  415   ESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLM  594
             E+G  +G+ I+   Q+ N+  T++++   +    +A  YL +C YSVG+G+NDY+NNY M
Sbjct  118   ETGQQLGQRITFSGQVQNYLNTVSQVVQILGDENSAADYLRQCIYSVGLGSNDYLNNYFM  177

Query  595   PQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGS  774
             PQ Y +SR +TP+Q+A+ L  ++  QL  L+  GARK A+ G G +GC P  + T     
Sbjct  178   PQFYSTSRQFTPEQYADDLINRYRDQLNALYNYGARKFALVGVGAIGCSPNALATGSPDG  237

Query  775   LSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNK  945
              +CV+SINSA ++FN R+K ++  LN     A+F  IN   +    + +PS  G    N 
Sbjct  238   TTCVESINSANRIFNSRLKSMVQQLNNDHSDARFTYINAYGVFQDIIANPSAYGFRVTNA  297

Query  946   ACCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMD  1125
             ACC V +   +  C  GQ PC NR+EY+FWD FH T+  N   A RSY A    D YP+D
Sbjct  298   ACCGVGRNGGQLTCLPGQGPCPNRDEYVFWDAFHPTDHANTIIAQRSYNAQSSDDVYPID  357

Query  1126  ISSLLQL  1146
             IS+L +L
Sbjct  358   ISALARL  364



>ref|XP_007224226.1| hypothetical protein PRUPE_ppa018058mg, partial [Prunus persica]
 gb|EMJ25425.1| hypothetical protein PRUPE_ppa018058mg, partial [Prunus persica]
Length=335

 Score =   328 bits (842),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 171/343 (50%), Positives = 221/343 (64%), Gaps = 13/343 (4%)
 Frame = +1

Query  136   EPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNLADYLAEFL  315
             +PQVPCYFIFGDSL D+GNNN L T AKAN+ PYGIDFP GPTGRFSNG+NL D +AE L
Sbjct  1     QPQVPCYFIFGDSLSDSGNNNGLFTVAKANFRPYGIDFPRGPTGRFSNGRNLVDAVAELL  60

Query  316   GFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNHGLTLARIA  495
             G  S IPP++     E +LKGVNYASG+ GI +E+G  +G++ISM  QL NH   + +IA
Sbjct  61    GLGSYIPPFATARGKE-ILKGVNYASGSAGIRNETGRQVGQIISMAMQLQNHQSIVKQIA  119

Query  496   LYM-KGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAKKHYVQ  672
              +    Y +A  +L KC YSVG+G NDY  NY +P    +SR YTP Q+A +L +++  Q
Sbjct  120   SFRGNNYSSAEEHLGKCIYSVGIGTNDYFINYFVPLS-STSRQYTPQQYARVLIEQYSQQ  178

Query  673   LKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMFNDRMKPIIDDLN  852
             L+ L+  GARK+ +FG G +G  P E+   G    SCV  INSAVQ+FN R+K ++ +LN
Sbjct  179   LRTLYNFGARKIVLFGLGAIGSAPSEVAACGTKGSSCVAYINSAVQIFNGRLKSLVQELN  238

Query  853   GSLKGAKFILINM----TSLALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQVPCSNRN  1020
              +L+ AKFI I+     +S AL   S+I     N +CC V        C   Q+PC NR 
Sbjct  239   SNLRNAKFIYIDYYGIGSSYALSRGSLI----TNVSCCGVK--DGLNTCIPFQIPCRNRT  292

Query  1021  EYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQLN  1149
              +MFWD  H TE  N+  A R+Y A   TDA+P DI SL QL+
Sbjct  293   RFMFWDGIHPTEATNVFIAARAYKAEFLTDAFPYDIHSLAQLS  335



>emb|CDY35296.1| BnaC03g59270D [Brassica napus]
Length=360

 Score =   329 bits (844),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 169/366 (46%), Positives = 225/366 (61%), Gaps = 9/366 (2%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPY  237
             M S ++ W  +  +L +  S+       QVPCYFIFGDSLVDNGNNN L + A+ANYLPY
Sbjct  1     MESYLRKWCVVFVVLGLAFSV---TKAQQVPCYFIFGDSLVDNGNNNGLVSFARANYLPY  57

Query  238   GIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDE  417
             GIDF  GPTGRFSNG+   D +AE LGFN  IP Y++V   + +L GVNYAS A GI +E
Sbjct  58    GIDF-GGPTGRFSNGRTTVDEIAELLGFNDYIPAYNSVRGRQ-ILTGVNYASAAAGIREE  115

Query  418   SGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMP  597
             +G  +G+ IS   Q+ N+  T+ ++   + G   A  YL +C YSVGMG+NDY+NNY MP
Sbjct  116   TGRQLGQRISFSGQVRNYQNTVQQVVSLLGGETQAADYLKRCIYSVGMGSNDYLNNYFMP  175

Query  598   QKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSL  777
               Y SSR +TP+Q+A  L  ++  QL  L+  GARK A+ G G +GC P  +        
Sbjct  176   TFYSSSRQFTPEQYANDLISRYSTQLNALYNYGARKFALIGIGAIGCSPNAL-ARSRDRR  234

Query  778   SCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKA  948
             +C + INSA Q+FN +++ ++D LN +   AKF  IN   +    + +PS  G    N  
Sbjct  235   TCDERINSANQIFNSKLRSLVDQLNNNHPDAKFTYINAYDIFQDMIKNPSRFGFRVTNAG  294

Query  949   CCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDI  1128
             CC + +   +  C  GQ PC +RN Y+FWD FH TE  N+  A RSY A  P+DAYPMDI
Sbjct  295   CCGIGRNAGQITCLPGQRPCRDRNAYVFWDAFHPTEAANIVIARRSYKAESPSDAYPMDI  354

Query  1129  SSLLQL  1146
             S L +L
Sbjct  355   SGLARL  360



>ref|XP_010540541.1| PREDICTED: GDSL esterase/lipase At1g29670-like isoform X1 [Tarenaya 
hassleriana]
Length=367

 Score =   330 bits (845),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 166/356 (47%), Positives = 218/356 (61%), Gaps = 4/356 (1%)
 Frame = +1

Query  88    IATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTG  267
             +  +L + L  +     PQVPCYFIFGDSLVDNGNNN L + A+A+Y PYGIDFP GPTG
Sbjct  13    VGLILELMLCFRAKGEPPQVPCYFIFGDSLVDNGNNNRLPSLARADYFPYGIDFPQGPTG  72

Query  268   RFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVIS  447
             RFSNGK   D +AE LGF+  IPPYS     E LL GVNYAS A GI +E+G  +G+ IS
Sbjct  73    RFSNGKTAVDVMAEILGFDHYIPPYSDAVGEE-LLDGVNYASAAAGIREETGQQLGDRIS  131

Query  448   MDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYT  627
               QQ+ NH   ++R+   + G   A  +L++C YS+G+G NDY+NNY MP  YP SRLYT
Sbjct  132   FRQQVQNHRRLVSRVVNILGGEEMAANHLSRCIYSIGLGGNDYLNNYFMPLSYPFSRLYT  191

Query  628   PDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAV  807
             PDQFA+ L   +  QL  L+  GARK  + G G +GC P E+        +C+  INSA+
Sbjct  192   PDQFADDLIDIYSKQLCLLYRYGARKFVLNGVGPVGCTPAELAGSSPDGRTCIGRINSAI  251

Query  808   QMFNDRMKPIIDDLNGSLKGAKFILINMTSLALG---DPSIIGINNVNKACCQVSKTKAK  978
             ++FN ++  ++D +NG+L G   I  N   + L    +PS  G    N  CC V + + +
Sbjct  252   RIFNRKLTSLVDRINGNLPGVTSIYTNSYGILLDILYNPSSYGFRVTNAGCCGVGRNRGQ  311

Query  979   GQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
               C  G+ PC NR+EY+FWD FH T   N     R Y     +D YPMD+S+L QL
Sbjct  312   ITCLPGEDPCPNRDEYVFWDAFHPTTAANAIITRRFYRRRTFSDVYPMDVSTLAQL  367



>ref|XP_002265963.1| PREDICTED: GDSL esterase/lipase At1g29670 isoform X1 [Vitis vinifera]
 ref|XP_010655592.1| PREDICTED: GDSL esterase/lipase At1g29670 isoform X1 [Vitis vinifera]
 ref|XP_010655593.1| PREDICTED: GDSL esterase/lipase At1g29670 isoform X1 [Vitis vinifera]
Length=366

 Score =   329 bits (844),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 166/366 (45%), Positives = 233/366 (64%), Gaps = 7/366 (2%)
 Frame = +1

Query  73    KVWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFP  252
             K+W  +  LLL+F        EP+VPCYFIFGDSL D+GNNN L T  +AN+ P GIDFP
Sbjct  6     KMWRVVPVLLLVFYLQHCAHGEPEVPCYFIFGDSLSDSGNNNKLVTLGRANFPPNGIDFP  65

Query  253   DGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHM  432
             +GPTGRF NG+ + D LAE L     IPPY+ V+    +L+G N+ASG+ GI DE+G H 
Sbjct  66    NGPTGRFCNGRTIVDVLAELLKLEDYIPPYATVSDYR-ILQGANFASGSSGIRDETGRHY  124

Query  433   GEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPS  612
             G++I+M +QL N+ + ++RI   +    AA  +L+KC ++VG+G++DYINNY +PQ YP+
Sbjct  125   GDLITMKEQLKNYQIAVSRITNILGNDTAAMDHLSKCLFTVGIGSHDYINNYYLPQLYPT  184

Query  613   SRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGS-LSCVD  789
             +  YTP Q+A +L  +++ QLK L+  GARKVA+FG G LGC+P E+  +G  S   CV+
Sbjct  185   NSEYTPVQYASVLINQYFQQLKTLYKHGARKVAIFGLGRLGCMPLEVGLYGEVSDTECVE  244

Query  790   SINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACCQVSKT  969
              IN AVQ+FNDR+  ++D LN +L  A F  INM+ +   D +  G    N  CC     
Sbjct  245   FINDAVQVFNDRLVRLVDGLNANLTDAHFAYINMSGIQSFDAAAFGFRVRNNGCC-----  299

Query  970   KAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQLN  1149
               +  C     PCSNR E+++WD  + TE  N+  A R+Y +  P+DA+PMDI +L Q  
Sbjct  300   GGQLPCLPFSGPCSNRTEHIYWDFINPTEAANMIYAQRAYISETPSDAHPMDIHTLAQFA  359

Query  1150  LQAKSD  1167
                + D
Sbjct  360   SGEEDD  365



>gb|AAX20033.1| GDSL-lipase protein [Capsicum annuum]
Length=371

 Score =   329 bits (844),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 165/364 (45%), Positives = 223/364 (61%), Gaps = 6/364 (2%)
 Frame = +1

Query  70    VKVWFAIATLLLMFLSLKPL--VAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGI  243
             V+ W  +  ++L+ L+L     V   QVPCYFIFGDSLVDNGNNNN+ + A+ANYLPYGI
Sbjct  9     VRKWIVMYVVVLLGLNLWGYYGVNAQQVPCYFIFGDSLVDNGNNNNIQSLARANYLPYGI  68

Query  244   DFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESG  423
             D+P GPTGRFSNGK   D +AE LGF   IPPY A    E +LKGVNYAS A GI DE+G
Sbjct  69    DYPGGPTGRFSNGKTTVDVIAELLGFEDYIPPY-ADARGEDILKGVNYASAAAGIRDETG  127

Query  424   THMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQK  603
               +G  I    Q+ N+  T+ ++   +    +A  YL+KC Y +G+G+NDY+NNY MP  
Sbjct  128   QQLGARIPFGGQVNNYRDTVQQVVQILGNEDSAATYLSKCVYPIGLGSNDYLNNYFMPMY  187

Query  604   YPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSC  783
             Y + R Y P+Q+A++L +++   LK L+  GARK  + G G +GC P  +  +     +C
Sbjct  188   YSTGRQYNPEQYADILIQQYTQHLKTLYDYGARKFVLIGVGQIGCSPNALAQNSADGRTC  247

Query  784   VDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKACC  954
               +IN+A Q+FN+R++ ++D+ NG+   AKFI IN   +    + +PS  G    N  CC
Sbjct  248   AQNINAANQLFNNRLRGLVDEFNGNTPDAKFIYINAYDIFQDLIDNPSAFGFRVTNAGCC  307

Query  955   QVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISS  1134
              V +   +  C   Q PC NR+EY+FWD FH  E  N     RSY A   +DAYP DI  
Sbjct  308   GVGRNNGQITCLPLQNPCPNRDEYLFWDAFHPGEAANTIVGRRSYRAERSSDAYPFDIQH  367

Query  1135  LLQL  1146
             L QL
Sbjct  368   LAQL  371



>ref|XP_007147964.1| hypothetical protein PHAVU_006G169100g [Phaseolus vulgaris]
 gb|ESW19958.1| hypothetical protein PHAVU_006G169100g [Phaseolus vulgaris]
Length=365

 Score =   329 bits (843),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 168/366 (46%), Positives = 224/366 (61%), Gaps = 4/366 (1%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPY  237
             MASG  +      +L++ L    +    QVPCYFIFGDSLVDNGNNN L++ AKANYLPY
Sbjct  1     MASGKHIMNIGLVMLVVILWSNGVGFAQQVPCYFIFGDSLVDNGNNNRLNSLAKANYLPY  60

Query  238   GIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDE  417
             GIDF  GPTGRFSNGK   D +AE LGFN  I PY A      +L+GVNYAS A GI DE
Sbjct  61    GIDFSGGPTGRFSNGKTTVDVVAELLGFNGYISPY-ATARGRDILRGVNYASAAAGIRDE  119

Query  418   SGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMP  597
             +G  +G  IS   Q+ N+  T+++I   +     A  YL+KC YS+G+G+NDY+NNY MP
Sbjct  120   TGQQLGGRISFSGQVQNYQRTVSQIVNLLGDENTAANYLSKCIYSIGLGSNDYLNNYFMP  179

Query  598   QKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSL  777
               Y SSR YTP Q+A+LL + +  QL+ L+  GARK+A+FG G +GC P  +  +     
Sbjct  180   LVYSSSRRYTPQQYADLLIQAYTQQLRILYNNGARKMALFGVGQIGCSPNALAQNSPDGR  239

Query  778   SCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKA  948
             +CV  INSA Q+FN+ ++ ++D  N     A+ I +N+  +    + +P+  G    N  
Sbjct  240   TCVARINSANQLFNNGLRSLVDQFNNQFPDARVIYVNVYGIFQDIINNPASFGFRVTNAG  299

Query  949   CCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDI  1128
             CC V +   +  C   Q PC NR EY+FWD FH TE  N     R+Y A   +DAYP+DI
Sbjct  300   CCGVGRNNGQITCLPLQPPCRNRREYLFWDAFHPTESANTVIGRRAYNAQSASDAYPIDI  359

Query  1129  SSLLQL  1146
             + L Q+
Sbjct  360   NRLAQI  365



>ref|XP_011010176.1| PREDICTED: GDSL esterase/lipase At5g45670-like [Populus euphratica]
Length=365

 Score =   329 bits (843),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 168/365 (46%), Positives = 229/365 (63%), Gaps = 4/365 (1%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPY  237
             M +  K W+ +  + L+ LS+K      QVPCYFIFGDSLVDNGNNN LS+ AKANY+PY
Sbjct  1     MEAVQKKWWVVCVVFLVLLSVKYGARAQQVPCYFIFGDSLVDNGNNNQLSSLAKANYMPY  60

Query  238   GIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDE  417
             GIDFP GPTGRFSNG+   D +A+ LGF + IPPY A      +L GVNYAS A GI +E
Sbjct  61    GIDFPRGPTGRFSNGRTTVDVIAQQLGFRNYIPPY-ATARGRDILGGVNYASAAAGIREE  119

Query  418   SGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMP  597
             +G  +G+ IS   Q+ N+  T+++I   +        YL+KC  S+ +G+NDY+NNY MP
Sbjct  120   TGRQLGDRISFSGQVRNYQNTVSQIVNILGDKNTTANYLSKCIVSIALGSNDYLNNYFMP  179

Query  598   QKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSL  777
             Q Y SSR YTP+Q+A +L +++  QL+ L+  GARK A+ G G +GC P E+  +     
Sbjct  180   QFYSSSRQYTPEQYANVLIQQYTQQLRILYNNGARKFALIGLGQIGCSPSELAQNSPDGR  239

Query  778   SCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKA  948
             +CV  INSA Q+FN++++ ++   NG+   A+FI IN+  +    +  P+  G  N N  
Sbjct  240   TCVQRINSANQIFNNKLRSLVAQFNGNTPDARFIYINVYGIFQDLITRPAAYGFTNTNAG  299

Query  949   CCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDI  1128
             CC V +   +  C   Q PC NRN+Y+FWD FH TE  N+    RSY+A   +DAYP DI
Sbjct  300   CCGVGRNNGQITCLPLQSPCQNRNQYVFWDAFHPTEAVNIIIGRRSYSAQSASDAYPYDI  359

Query  1129  SSLLQ  1143
               L Q
Sbjct  360   RRLAQ  364



>ref|XP_010095110.1| GDSL esterase/lipase [Morus notabilis]
 gb|EXB58276.1| GDSL esterase/lipase [Morus notabilis]
Length=375

 Score =   329 bits (843),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 167/376 (44%), Positives = 233/376 (62%), Gaps = 14/376 (4%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLK---PLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANY  228
             M  G ++W  I  ++L  +S        AEPQVPCYFIFGDSLVDNGNNN L + A+ANY
Sbjct  1     MGEGKRMWNVIVCVVLGVMSTMLSFGTRAEPQVPCYFIFGDSLVDNGNNNELQSLARANY  60

Query  229   LPYGIDFPDGPTGRFSNGKNLAD---YLAEFLGFNSS----IPPYSAVTTTEGLLKGVNY  387
             LPYGIDFP GP+GRFSNGK   D   YL   L    +    IPPY+  +  E +L GVN+
Sbjct  61    LPYGIDFPGGPSGRFSNGKTTVDVVGYLRILLYQQHNEIYYIPPYATASGQE-ILGGVNF  119

Query  388   ASGAGGILDESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGN  567
             AS A GI +E+G  +G  I+   Q+ N+  T++++   +     A  YL+KC +S+G+G+
Sbjct  120   ASAAAGIREETGRQLGGRITFRGQVENYRNTVSQVVELLGDEDTAANYLSKCIFSIGLGS  179

Query  568   NDYINNYLMPQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPE  747
             NDY+NNY MPQ Y +   YTP+++A  L +++  QL+ L+  GARKV ++G G +GC P 
Sbjct  180   NDYLNNYFMPQFYNTGNQYTPEEYATDLIQRYTQQLRILYNYGARKVVLYGIGQIGCSPN  239

Query  748   EMETHGNGSLSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPS  918
             ++  +     +CV+ INSA ++FN R+K ++D  N     A+FI I+   +    +  PS
Sbjct  240   QLAQNSQDGKTCVEKINSANRIFNARLKGVVDQFNNQFTDARFIYIDSYGIFQDIIASPS  299

Query  919   IIGINNVNKACCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTAT  1098
               G +NVN+ CC V +   +  C   Q PC+NRN Y+FWD FH TE GN   A R+YTA 
Sbjct  300   TYGFSNVNEGCCGVGRNNGQITCLPLQTPCANRNAYLFWDAFHPTEAGNAVVARRAYTAQ  359

Query  1099  LPTDAYPMDISSLLQL  1146
              P+DAYP+DI  L Q+
Sbjct  360   RPSDAYPVDIRRLAQI  375



>ref|XP_009351953.1| PREDICTED: LOW QUALITY PROTEIN: GDSL esterase/lipase At5g45670-like 
[Pyrus x bretschneideri]
Length=365

 Score =   328 bits (842),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 164/367 (45%), Positives = 227/367 (62%), Gaps = 5/367 (1%)
 Frame = +1

Query  55    LMASGVKVWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLP  234
             +  +  ++W A   +L + +      AE QVPCYFIFGDSLVDNGNNN L + A+A+YLP
Sbjct  1     MAGTARRMWVATVVVLAVSMWWSGARAEXQVPCYFIFGDSLVDNGNNNQLQSLARADYLP  60

Query  235   YGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILD  414
             YGIDF  GPTGRFSNGK   D +AE LGF+  IPPY A    + +LKGVN+AS A GI +
Sbjct  61    YGIDF-GGPTGRFSNGKTTVDVVAELLGFDDFIPPY-ATARGQDVLKGVNFASAAAGIRE  118

Query  415   ESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLM  594
             E+G  +G  I+   Q+ N+  T++++   + G   A  YL+KC YSVG+G+NDY+NNY M
Sbjct  119   ETGRQLGGRITFSGQVKNYQNTVSQVVNLLGGEDQAANYLSKCIYSVGLGSNDYLNNYFM  178

Query  595   PQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGS  774
             PQ Y ++  +TP+Q+A+ L   +  QL+ L+  GARKV +FG G +GC P E+  +    
Sbjct  179   PQFYNTANQFTPEQYADSLIHDYSQQLRILYNYGARKVVLFGIGQVGCSPSELAQNSPDG  238

Query  775   LSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNK  945
              +CV  INSA Q+FN ++K + ++ N +L  A+FI ++   +    +  P+  G    N 
Sbjct  239   STCVQKINSANQIFNGKLKALANEFNTNLADARFIFVDTYGIFQDIISSPAQYGFRVTNA  298

Query  946   ACCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMD  1125
              CC V +   +  C   Q PC NR EY+FWD FH TE GN   A R Y+A   +DAYP+D
Sbjct  299   GCCGVGRNNGQITCLPLQTPCQNRKEYLFWDAFHPTEAGNAVIARRGYSAVRASDAYPID  358

Query  1126  ISSLLQL  1146
             I  L  L
Sbjct  359   IRRLALL  365



>gb|KEH15769.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=365

 Score =   328 bits (842),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 163/354 (46%), Positives = 226/354 (64%), Gaps = 5/354 (1%)
 Frame = +1

Query  97    LLLMFLSLKPLVA-EPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRF  273
             ++++ LSL   +    QVPCYFIFGDSLVDNGNNN L++ AKANYLPYGIDFP GPTGRF
Sbjct  13    IVVLVLSLWSGIGVAQQVPCYFIFGDSLVDNGNNNQLTSIAKANYLPYGIDFPGGPTGRF  72

Query  274   SNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMD  453
             SNGK   D +AE LGFN  IP Y++    + +L+GVNYAS A GI +E+G  +G+ IS  
Sbjct  73    SNGKTTVDVIAEQLGFNGYIPSYASARGRQ-ILRGVNYASAAAGIREETGQQLGQRISFR  131

Query  454   QQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPD  633
              Q+ N+  T++++  Y      A  YL+KC Y++G+G+NDY+NNY MP  Y +SR +TP 
Sbjct  132   GQVQNYQRTVSQLVNYFGDENTAANYLSKCIYTIGLGSNDYLNNYFMPTIYSTSRQFTPQ  191

Query  634   QFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQM  813
             Q+A +L + +  QL+ L+  GARK+A+FG G +GC P  +  +     +CV  INSA Q+
Sbjct  192   QYANVLLQAYAQQLRILYNYGARKMALFGVGQIGCTPNALAQNSPDGRTCVARINSANQL  251

Query  814   FNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKAKGQ  984
             FN+ ++ ++D LN  L  A+FI +N+  +    +  PS  G    N  CC V +   +  
Sbjct  252   FNNGLRSLVDQLNNQLPDARFIYVNVYGIFQDIITSPSTYGFRVTNAGCCGVGRNNGQIT  311

Query  985   CEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             C   Q  C +RN ++FWD FH TE GN     R+Y A   +DAYP+DI+ L QL
Sbjct  312   CLPFQPACRDRNGFLFWDAFHPTEAGNSVIGRRAYNAQSASDAYPIDINRLAQL  365



>ref|XP_010057371.1| PREDICTED: GDSL esterase/lipase At5g45670-like [Eucalyptus grandis]
 gb|KCW74536.1| hypothetical protein EUGRSUZ_E03249 [Eucalyptus grandis]
Length=363

 Score =   328 bits (841),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 167/354 (47%), Positives = 233/354 (66%), Gaps = 11/354 (3%)
 Frame = +1

Query  76    VWFAIATLLLMFLS--LKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDF  249
              W  I ++L +  S         PQVPCYFI+GDSL D+GNNN+L T+AKANY PYG+DF
Sbjct  2     AWRVILSVLFLISSNLQGGAAGAPQVPCYFIYGDSLCDSGNNNDLVTDAKANYPPYGVDF  61

Query  250   PDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTH  429
             P+G TGRF+NG+  AD++AE LGF+  IPP++    ++ +L+GVNYASG  GI DE+G  
Sbjct  62    PEGATGRFTNGRTFADFIAELLGFDEYIPPFATANGSD-ILRGVNYASGGAGIRDETGQQ  120

Query  430   MGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYP  609
             +G  IS++ QL NH +T+ RI   +     A  YLNKC Y++ MG+NDY+NNYLMP  YP
Sbjct  121   LGGRISLNHQLQNHLITILRIREMLGA--DAETYLNKCAYTIWMGSNDYLNNYLMPDIYP  178

Query  610   SSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHG-NGSLSCV  786
             +S LYTP+++A++L +++  QLK L++ GAR++A+FG   +GC P E+  +G NGSL CV
Sbjct  179   TSTLYTPEEYADVLIEQYEQQLKTLYSYGARRLAIFGLSEIGCAPAEVAEYGTNGSL-CV  237

Query  787   DSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACCQVSK  966
             D I+  V  FNDR+KP+I +LN +L GA+F+ +N   +     ++ G +  +  CC+V K
Sbjct  238   DEIDDLVLPFNDRLKPLIKELNSNLTGAEFVYVNTYGVTTN--AVPGASLTSPTCCKVKK  295

Query  967   TKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDI  1128
                 GQC     PC NR  Y ++D FH TE  +L  A   Y A L +DA P DI
Sbjct  296   D--DGQCIPFSTPCLNRTLYSYYDGFHPTETVHLEVAEIGYAALLSSDASPFDI  347



>ref|XP_002304022.1| hypothetical protein POPTR_0003s21730g [Populus trichocarpa]
 gb|EEE79001.1| hypothetical protein POPTR_0003s21730g [Populus trichocarpa]
Length=362

 Score =   328 bits (841),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 170/360 (47%), Positives = 232/360 (64%), Gaps = 8/360 (2%)
 Frame = +1

Query  76    VWFAIATLLLMFLSLKPLVA--EPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDF  249
             +W+   T+ L+ +S     A  EPQVPC+F+FGDSL DNGNNNNLST AKANY PYGIDF
Sbjct  8     LWWIFFTIPLLIISNLQNCAYGEPQVPCFFVFGDSLFDNGNNNNLSTLAKANYTPYGIDF  67

Query  250   PDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGT-  426
               GPTGRFSNG N AD +A+ LGF+  IP ++    T+ +L+GVNYASG+ GI +ESG  
Sbjct  68    SKGPTGRFSNGNNTADVIAKLLGFDDYIPTFNEAKATKNILRGVNYASGSAGIRNESGRL  127

Query  427   HMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKY  606
              +G+VIS+D+QL NH + ++ I   +    +A  +LNKC Y++ MGNNDY  NY +PQ Y
Sbjct  128   AVGDVISLDEQLQNHRIIISLITEALGNKDSAMKHLNKCIYTIDMGNNDYTMNYFLPQLY  187

Query  607   PSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCV  786
              +SR ++  Q+A +L +++  QL+ L+ LGARKVAV G    GC P  + T+G    SCV
Sbjct  188   NTSRQFSAHQYATVLIQQYSQQLESLYDLGARKVAVAGLIQNGCSPNALATYGTNGSSCV  247

Query  787   DSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACCQVSK  966
             + IN+AVQ+FN ++ P++ +LN +L GAKF  IN   +            V  ACC ++ 
Sbjct  248   EVINNAVQIFNSKLIPLVTNLNANLPGAKFTYINFYQIDAESTRAFRFTRV--ACCNLTS  305

Query  967   TKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             T   G C+   +PC +R EY F+D+ H TE   L    R+Y A   TDA+P+DIS L QL
Sbjct  306   T---GLCDPSTIPCPDRTEYAFYDSAHPTEARALILGRRAYRAQSVTDAFPVDISLLAQL  362



>ref|XP_004293650.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Fragaria vesca 
subsp. vesca]
Length=367

 Score =   328 bits (840),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 162/341 (48%), Positives = 221/341 (65%), Gaps = 5/341 (1%)
 Frame = +1

Query  133   AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNLADYLAEF  312
             AEPQVPCYFIFGDSLVDNGNNN L + A+A+YLPYGIDF  GPTGRFSNGK + D +AE 
Sbjct  29    AEPQVPCYFIFGDSLVDNGNNNQLQSLARADYLPYGIDF-GGPTGRFSNGKTIVDVVAEL  87

Query  313   LGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNHGLTLARI  492
             LGF+  IPPY A    + +LKGVN+AS A GI +E+G  +G  I+   Q+ N+  T++++
Sbjct  88    LGFDDYIPPY-ATARDQQILKGVNFASAAAGIREETGRQLGGRITFSGQVRNYQNTVSQV  146

Query  493   ALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAKKHYVQ  672
                +     A  YL KC YS+G+G+NDY+NNY MPQ Y +   YTP+++A  L + +  Q
Sbjct  147   VNLLGDEDTAANYLGKCMYSIGLGSNDYLNNYFMPQYYNTGNQYTPEEYATSLIQDYSKQ  206

Query  673   LKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMFNDRMKPIIDDLN  852
             L+ L+  GARKV +FG G +GC P E+  +     +CV  INSA Q+FN ++K + ++ N
Sbjct  207   LQILYNYGARKVVLFGIGQVGCSPSELAQNSPDGKTCVAKINSANQIFNGKLKALANEFN  266

Query  853   GSLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQVPCSNRNE  1023
              +    +FI I+  ++    +  P+  G  N+N  CC V +   +  C   Q PC+NR+E
Sbjct  267   TNFPDGRFIFIDSYAIFADIVNSPAQYGFTNINTGCCGVGRNNGQITCLPYQTPCANRDE  326

Query  1024  YMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             Y+FWD FH TE GN   A RSY A   +DAYP+DI+SL  L
Sbjct  327   YLFWDAFHPTEAGNAVVARRSYNAVRASDAYPVDIASLAAL  367



>ref|XP_004234068.1| PREDICTED: GDSL esterase/lipase At5g45670-like [Solanum lycopersicum]
Length=366

 Score =   328 bits (840),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 162/367 (44%), Positives = 222/367 (60%), Gaps = 4/367 (1%)
 Frame = +1

Query  55    LMASGVKVWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLP  234
             +M   +K+      +L +         EPQVPCYFIFGDSLVDNGNNN + + A+A+YLP
Sbjct  1     MMCGDLKIMCVFLLILNLLGDNYGAKGEPQVPCYFIFGDSLVDNGNNNVIRSLARADYLP  60

Query  235   YGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILD  414
             YGIDFPDGPTGRFSNGK   D +AE LGF+  IPPY+     E +L+GVN+AS A GI +
Sbjct  61    YGIDFPDGPTGRFSNGKTTVDVIAELLGFDDYIPPYATARGRE-ILRGVNFASAAAGIRE  119

Query  415   ESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLM  594
             E+G  +G  ++   Q+ N+     +I   +    +A  YL+KC YS+G+G+NDY+NNY M
Sbjct  120   ETGQQLGGRVTFSGQVNNYKNIAQQIVRIIGNENSAANYLSKCIYSIGVGSNDYLNNYFM  179

Query  595   PQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGS  774
             PQ Y +SR YTP Q+A +L +++  QLK L+  GARK  + G G +GC P  +  +    
Sbjct  180   PQYYSTSRQYTPQQYANVLIQQYTQQLKTLYNYGARKFVLIGVGQIGCSPNALAQNSPDG  239

Query  775   LSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNK  945
              +C  +IN A Q+FN++++ ++D+LN +   AK I IN   +    + +P   G    N 
Sbjct  240   RTCAQNINVANQLFNNKLRALVDNLNRNTPNAKLIYINAYGIFQDLIDNPFAFGFRVTNA  299

Query  946   ACCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMD  1125
              CC + +   +  C   Q PC NRNEY+FWD FH  E  N+    RSY A   TDAYP D
Sbjct  300   GCCGIGRNNGQITCLPFQNPCQNRNEYLFWDAFHPGEAANIIVGRRSYRAQKSTDAYPFD  359

Query  1126  ISSLLQL  1146
             I  L QL
Sbjct  360   IQRLAQL  366



>ref|XP_009109655.1| PREDICTED: GDSL esterase/lipase At1g29670 [Brassica rapa]
Length=361

 Score =   327 bits (839),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 168/362 (46%), Positives = 222/362 (61%), Gaps = 9/362 (2%)
 Frame = +1

Query  70    VKVWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDF  249
             ++ W  +  LL +  S+       QVPCYFIFGDSLVDNGNNN L + A+ANY PYGIDF
Sbjct  6     LRKWCVVFVLLGLAFSV---TKAQQVPCYFIFGDSLVDNGNNNGLVSFARANYFPYGIDF  62

Query  250   PDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTH  429
               GPTGRFSN +   D +AE LGFN  IP Y++V   + +L GVNYAS A GI DE+G  
Sbjct  63    -GGPTGRFSNRRTTVDEIAELLGFNDYIPAYNSVRGRQ-ILTGVNYASAAAGIRDETGRQ  120

Query  430   MGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYP  609
             +G+ IS   Q+ N+  T+ ++   + G   A  YL +C YSVGMG+NDY+NNY MP  Y 
Sbjct  121   LGQRISFSGQVRNYQNTVQQVVSLLGGETQAADYLKRCIYSVGMGSNDYLNNYFMPTFYS  180

Query  610   SSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVD  789
             SSR +TP+Q+A  L  ++  QL  L+  GARK A+ G G +GC P  +      S +C +
Sbjct  181   SSRQFTPEQYANDLISRYSTQLNALYNYGARKFALIGIGAIGCSPNAL-ARSRDSRTCDE  239

Query  790   SINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQV  960
              INSA Q+FN +++ ++D LN +   AKF  IN   +    + +PS  G    N  CC +
Sbjct  240   RINSANQIFNSKLRSLVDQLNNNHPDAKFTYINAYDIFQDMIKNPSRFGFRVTNAGCCGI  299

Query  961   SKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLL  1140
              +   +  C  GQ PC +RN Y+FWD FH TE  N+  A RSY A  P+DAYPMDIS L 
Sbjct  300   GRNAGQITCLPGQRPCRDRNAYVFWDAFHPTEAANIVIARRSYKAESPSDAYPMDISGLA  359

Query  1141  QL  1146
             +L
Sbjct  360   RL  361



>ref|XP_010655594.1| PREDICTED: GDSL esterase/lipase At1g29670 isoform X2 [Vitis vinifera]
Length=361

 Score =   327 bits (839),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 165/365 (45%), Positives = 232/365 (64%), Gaps = 7/365 (2%)
 Frame = +1

Query  76    VWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPD  255
             +W  +  LLL+F        EP+VPCYFIFGDSL D+GNNN L T  +AN+ P GIDFP+
Sbjct  2     MWRVVPVLLLVFYLQHCAHGEPEVPCYFIFGDSLSDSGNNNKLVTLGRANFPPNGIDFPN  61

Query  256   GPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMG  435
             GPTGRF NG+ + D LAE L     IPPY+ V+    +L+G N+ASG+ GI DE+G H G
Sbjct  62    GPTGRFCNGRTIVDVLAELLKLEDYIPPYATVSDYR-ILQGANFASGSSGIRDETGRHYG  120

Query  436   EVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSS  615
             ++I+M +QL N+ + ++RI   +    AA  +L+KC ++VG+G++DYINNY +PQ YP++
Sbjct  121   DLITMKEQLKNYQIAVSRITNILGNDTAAMDHLSKCLFTVGIGSHDYINNYYLPQLYPTN  180

Query  616   RLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGS-LSCVDS  792
               YTP Q+A +L  +++ QLK L+  GARKVA+FG G LGC+P E+  +G  S   CV+ 
Sbjct  181   SEYTPVQYASVLINQYFQQLKTLYKHGARKVAIFGLGRLGCMPLEVGLYGEVSDTECVEF  240

Query  793   INSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACCQVSKTK  972
             IN AVQ+FNDR+  ++D LN +L  A F  INM+ +   D +  G    N  CC      
Sbjct  241   INDAVQVFNDRLVRLVDGLNANLTDAHFAYINMSGIQSFDAAAFGFRVRNNGCC-----G  295

Query  973   AKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQLNL  1152
              +  C     PCSNR E+++WD  + TE  N+  A R+Y +  P+DA+PMDI +L Q   
Sbjct  296   GQLPCLPFSGPCSNRTEHIYWDFINPTEAANMIYAQRAYISETPSDAHPMDIHTLAQFAS  355

Query  1153  QAKSD  1167
               + D
Sbjct  356   GEEDD  360



>ref|XP_006305152.1| hypothetical protein CARUB_v10009519mg [Capsella rubella]
 gb|EOA38050.1| hypothetical protein CARUB_v10009519mg [Capsella rubella]
Length=364

 Score =   327 bits (839),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 164/357 (46%), Positives = 227/357 (64%), Gaps = 6/357 (2%)
 Frame = +1

Query  88    IATLLLMFLSLKPLV-AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPT  264
             + +L ++FL L   V AEPQVPC FIFGDSLVDNGNNN L++ A+A+Y PYGIDF  GPT
Sbjct  10    LVSLCVLFLGLGFKVKAEPQVPCLFIFGDSLVDNGNNNRLTSIARADYFPYGIDF-GGPT  68

Query  265   GRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVI  444
             GRFSNGK   D LAE LGF++ IP YS V+  + +L+GVN+AS A GI +E+G  +G+ I
Sbjct  69    GRFSNGKTTVDVLAELLGFDNYIPAYSTVSGQQ-ILQGVNFASAAAGIREETGAQLGQRI  127

Query  445   SMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLY  624
             +   Q+ N+  T++++   +    +A  YL +C Y++GMG+NDY+NNY MPQ YP+SR Y
Sbjct  128   TFSGQVENYKNTVSQVVELLGDENSAADYLRQCIYTIGMGSNDYLNNYFMPQFYPTSRQY  187

Query  625   TPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSA  804
             +P+Q+AE L  ++  QL  L++ GARK A+ G G +GC P  +        +CV+ +N  
Sbjct  188   SPEQYAEDLIARYRDQLNALYSYGARKFALVGVGAIGCSPNALAQGSPDGTTCVERLNGP  247

Query  805   VQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKA  975
              ++FN+R++ ++  LN     A+F  IN        + +PS  G    N ACC V +   
Sbjct  248   NRIFNNRLRSLVQQLNNDHSDARFTYINAYGAFEDIIANPSAYGFRITNTACCGVGRNGG  307

Query  976   KGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             +  C  G+ PC NRNEY+FWD FH T+  N   A RSY A   +D YP DIS L QL
Sbjct  308   QLTCLPGEPPCQNRNEYVFWDAFHPTDAANTVIAQRSYNAQSSSDVYPYDISQLAQL  364



>gb|KFK44794.1| hypothetical protein AALP_AA1G304300 [Arabis alpina]
Length=360

 Score =   327 bits (839),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 168/366 (46%), Positives = 228/366 (62%), Gaps = 9/366 (2%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPY  237
             M S +  W  +  LL +  S+   V   QVPCYFIFGDSLVDNGNNN L + A++NY PY
Sbjct  1     MESYLNKWCVVFVLLGLGFSV---VKAQQVPCYFIFGDSLVDNGNNNGLVSFARSNYFPY  57

Query  238   GIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDE  417
             GIDF  GPTGRF NGK   D +AE LGFN  IP YS V+  + +L GVNYAS A GI +E
Sbjct  58    GIDF-GGPTGRFCNGKTTVDEIAELLGFNGYIPAYSDVSGRQ-ILSGVNYASAAAGIREE  115

Query  418   SGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMP  597
             +G  +G+ IS   Q+ N+  T++++   + G   A  YL +C YSVG+G+NDY+NNY MP
Sbjct  116   TGRQLGQRISFSGQVRNYQSTVSQVVNLLGGETQAADYLKRCIYSVGLGSNDYLNNYFMP  175

Query  598   QKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSL  777
               Y SSR +TP+Q+A  L  ++  QL  L+  GARK ++ G G +GC P  +    +G  
Sbjct  176   TFYSSSRQFTPEQYATDLINRYTTQLNALYNYGARKFSLIGIGAIGCSPNALAGSRDGR-  234

Query  778   SCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKA  948
             +CV+ INSA Q+FN++++ ++D LN     AKF  IN   +    + +PS  G +  N  
Sbjct  235   TCVERINSANQIFNNKLRSLVDQLNNQHPDAKFTYINAYGIFQDMIQNPSRFGFSVTNAG  294

Query  949   CCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDI  1128
             CC + +   +  C  GQ PC NRN Y+FWD+FH TE  N+  A RSY A   +DAYP+DI
Sbjct  295   CCGIGRNAGQITCLPGQRPCRNRNAYVFWDSFHPTEAANVVIARRSYNAQSASDAYPIDI  354

Query  1129  SSLLQL  1146
             + L +L
Sbjct  355   AGLARL  360



>ref|XP_004485963.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Cicer arietinum]
Length=367

 Score =   327 bits (838),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 160/338 (47%), Positives = 216/338 (64%), Gaps = 4/338 (1%)
 Frame = +1

Query  142   QVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNLADYLAEFLGF  321
             QVPCYFIFGDSLVDNGNNN L++ AKANY PYGIDFP GP+GRFSNGK   D +AE LGF
Sbjct  31    QVPCYFIFGDSLVDNGNNNQLTSLAKANYFPYGIDFPGGPSGRFSNGKTAVDVIAENLGF  90

Query  322   NSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNHGLTLARIALY  501
             NS IP Y++    + +LKGVNYAS A GI +E+G  +G+ IS   Q+ N+  T++++   
Sbjct  91    NSYIPSYASARGQD-ILKGVNYASAAAGIREETGQQLGQRISFRGQVQNYQRTVSQVVNI  149

Query  502   MKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAKKHYVQLKK  681
             +     A  YL+KC Y++G+G+NDY+NNY MP  Y SSR YTP Q+A+ L + +  QL+ 
Sbjct  150   LGDENTAANYLSKCIYTIGLGSNDYLNNYFMPTIYSSSRQYTPQQYADALIQAYAQQLRI  209

Query  682   LHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMFNDRMKPIIDDLNGSL  861
             L+  GARK+A+FG G +GC P E+  +     +CV  INSA Q+FN+ +K ++D  N   
Sbjct  210   LYNYGARKMALFGIGAIGCSPSELAQNSPDGRTCVSRINSANQLFNNGLKSLVDQFNNQF  269

Query  862   KGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQVPCSNRNEYMF  1032
               A+FI IN+  +    + +PS  G    N  CC + K   +  C   Q PC +R  ++F
Sbjct  270   PDARFIYINVYDIFQDIINNPSSYGFRVTNAGCCGIGKNNGQITCLPLQAPCRDRKGFLF  329

Query  1033  WDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             WD FH TE GN     R+Y A    DA+P DI+ L Q+
Sbjct  330   WDAFHPTEAGNSVIGRRAYNAQSALDAHPYDINRLAQI  367



>ref|XP_008803727.1| PREDICTED: GDSL esterase/lipase At5g45670-like [Phoenix dactylifera]
Length=367

 Score =   327 bits (838),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 173/360 (48%), Positives = 231/360 (64%), Gaps = 9/360 (3%)
 Frame = +1

Query  88    IATLLLMFL----SLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPD  255
             +  L LMFL    S   + A+PQVPCYFIFGDSLVDNGNNN++++ A+ANYLPYGIDFP 
Sbjct  10    VVVLWLMFLVSSLSRGLVRADPQVPCYFIFGDSLVDNGNNNDMASLARANYLPYGIDFPG  69

Query  256   GPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMG  435
             GPTGRFSNG    D LA+ LGF+  IPPY+A TT + LL G N+AS A GI +E+G  +G
Sbjct  70    GPTGRFSNGLTTVDVLAQLLGFDHPIPPYAA-TTGQALLAGANFASAAAGIREETGQQLG  128

Query  436   EVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSS  615
               IS   QL N+   +  +   +    +A  YL+KC +SVGMG+NDY+NNY MP  Y SS
Sbjct  129   GRISFSGQLQNYQAVVQEVLNILGDEDSAANYLSKCIFSVGMGSNDYLNNYFMPAFYSSS  188

Query  616   RLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSI  795
               YTP+Q+A++L +++  Q++ L+  GARKV + G G +GC P  +        +CVD I
Sbjct  189   SQYTPEQYADVLIQQYSQQIRTLYNYGARKVVLIGVGQIGCSPNVLARLSPNGETCVDRI  248

Query  796   NSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSK  966
             +SA+Q+FN ++  ++D+ N SL+GA F  IN   +    L  PS  G+   N+ CC V +
Sbjct  249   DSAIQIFNRKLIALVDEFN-SLEGAHFTYINGYGIFEDILRKPSAYGLTVTNRGCCGVGR  307

Query  967   TKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
                +  C   Q PC NRNEY+FWD FH TE  N+    RSY+A   +DAYPMDI  L Q+
Sbjct  308   NNGQITCLPYQTPCPNRNEYLFWDAFHPTEAANIIIGKRSYSAQSSSDAYPMDIRHLAQI  367



>ref|XP_010050223.1| PREDICTED: uncharacterized protein LOC104438742 [Eucalyptus grandis]
Length=786

 Score =   340 bits (871),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 177/358 (49%), Positives = 237/358 (66%), Gaps = 15/358 (4%)
 Frame = +1

Query  73    KVWFAIATLLLMFLSLKP--LVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGID  246
             + W  I  +L +  S  P  ++  PQVPCYFI+GDSL DNGNNNNL T+AKANY PYGID
Sbjct  8     RAWGVILPVLFLISSNSPSWVLGAPQVPCYFIYGDSLADNGNNNNLETQAKANYPPYGID  67

Query  247   FPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGT  426
             FPD  TGRF+NG    D +A  LGF+  I P+++   +E +L GVNYASG  GI DE+G 
Sbjct  68    FPDKATGRFTNGHTSIDIIAGLLGFDRYIQPFASAKGSE-ILIGVNYASGGAGIRDETGQ  126

Query  427   HMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKY  606
              +G+ IS++ QL NH +T++R+   +     A  YLN+C Y+VGMG+NDYINNY MP  Y
Sbjct  127   QLGDRISLNHQLQNHLVTISRVRDMLGSNATA--YLNECIYTVGMGSNDYINNYFMPDVY  184

Query  607   PSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHG-NGSLSC  783
              + +LY P+Q+A++L K++  QLK L++ GARKVA+FG  V+GC P ++   G NGSL C
Sbjct  185   QTGKLYMPEQYADVLIKQYQQQLKTLYSYGARKVAIFGLSVIGCAPTKISRFGTNGSL-C  243

Query  784   VDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACCQVS  963
             VD INSAV + NDR+KP++D+LN +L  AKF  I+   +A     I G+   +  CC+V 
Sbjct  244   VDKINSAVMLLNDRLKPLVDELNRNLADAKFTYIDFFGIA-----IAGLPVASSTCCKVR  298

Query  964   KTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSL  1137
             ++   G C   + PCS R  + F+D FH TEI NL    R+YTA L +DAYP DI  L
Sbjct  299   ES---GLCIPFETPCSIRLLHAFYDGFHPTEIVNLVFGARAYTALLSSDAYPFDIHHL  353


 Score =   337 bits (864),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 180/377 (48%), Positives = 242/377 (64%), Gaps = 14/377 (4%)
 Frame = +1

Query  22    ALFSATYTSITLMASGV--KVWFAIATLLLMFLSLKP--LVAEPQVPCYFIFGDSLVDNG  189
             ++F   Y S   MAS    + W  I  +L +  S  P  ++  PQVPCYFI+GDSL DNG
Sbjct  416   SVFLHRYISHFKMASFEYNRAWGVIFPVLFLISSNSPSWVLGAPQVPCYFIYGDSLADNG  475

Query  190   NNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGL  369
             NNN+L T+AKANY PYGIDFPD  TGRF+NG+   D +A  LGF+  I P+++   +E +
Sbjct  476   NNNDLETQAKANYPPYGIDFPDRATGRFTNGRTSVDIIAGLLGFDRYIQPFASAKGSE-I  534

Query  370   LKGVNYASGAGGILDESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFY  549
             L GVNYASG  GI DE+G  +G+ IS++ QL NH +T++R+   +     A  YLNKC Y
Sbjct  535   LIGVNYASGGAGIRDETGQQLGDRISLNHQLQNHLVTISRVRDMLGSNATA--YLNKCIY  592

Query  550   SVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGV  729
             +VGMG+NDYINNY MP  Y + +LY P+Q+A++L +++  QLK L++ GARKVA+FG  V
Sbjct  593   TVGMGSNDYINNYFMPDVYQTGKLYMPEQYADVLIEQYQQQLKTLYSYGARKVAIFGLSV  652

Query  730   LGCIPEEMETHG-NGSLSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLAL  906
             +GC P E+   G NGSL CVD INSAV +FNDR+KP++D+LN +L  AKF  I+   +A 
Sbjct  653   IGCAPTEISRFGTNGSL-CVDKINSAVMLFNDRLKPLVDELNRNLVDAKFTYIDFFGIAT  711

Query  907   GDPSIIGINNVNKACCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRS  1086
                 +  +      CC+V +    G C   + PC  R  + F+D FH TEI NL    R+
Sbjct  712   A--GLPALRVAGSTCCKVQE---DGMCIPFETPCLIRLLHAFYDGFHPTEIANLVFGARA  766

Query  1087  YTATLPTDAYPMDISSL  1137
             Y A L +DAYP DI  L
Sbjct  767   YKALLSSDAYPFDIHHL  783



>emb|CBI30764.3| unnamed protein product [Vitis vinifera]
Length=450

 Score =   329 bits (844),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 166/366 (45%), Positives = 233/366 (64%), Gaps = 7/366 (2%)
 Frame = +1

Query  73    KVWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFP  252
             K+W  +  LLL+F        EP+VPCYFIFGDSL D+GNNN L T  +AN+ P GIDFP
Sbjct  90    KMWRVVPVLLLVFYLQHCAHGEPEVPCYFIFGDSLSDSGNNNKLVTLGRANFPPNGIDFP  149

Query  253   DGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHM  432
             +GPTGRF NG+ + D LAE L     IPPY+ V+    +L+G N+ASG+ GI DE+G H 
Sbjct  150   NGPTGRFCNGRTIVDVLAELLKLEDYIPPYATVSDYR-ILQGANFASGSSGIRDETGRHY  208

Query  433   GEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPS  612
             G++I+M +QL N+ + ++RI   +    AA  +L+KC ++VG+G++DYINNY +PQ YP+
Sbjct  209   GDLITMKEQLKNYQIAVSRITNILGNDTAAMDHLSKCLFTVGIGSHDYINNYYLPQLYPT  268

Query  613   SRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGS-LSCVD  789
             +  YTP Q+A +L  +++ QLK L+  GARKVA+FG G LGC+P E+  +G  S   CV+
Sbjct  269   NSEYTPVQYASVLINQYFQQLKTLYKHGARKVAIFGLGRLGCMPLEVGLYGEVSDTECVE  328

Query  790   SINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACCQVSKT  969
              IN AVQ+FNDR+  ++D LN +L  A F  INM+ +   D +  G    N  CC     
Sbjct  329   FINDAVQVFNDRLVRLVDGLNANLTDAHFAYINMSGIQSFDAAAFGFRVRNNGCC-----  383

Query  970   KAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQLN  1149
               +  C     PCSNR E+++WD  + TE  N+  A R+Y +  P+DA+PMDI +L Q  
Sbjct  384   GGQLPCLPFSGPCSNRTEHIYWDFINPTEAANMIYAQRAYISETPSDAHPMDIHTLAQFA  443

Query  1150  LQAKSD  1167
                + D
Sbjct  444   SGEEDD  449



>ref|XP_011025221.1| PREDICTED: GDSL esterase/lipase At4g18970-like [Populus euphratica]
Length=360

 Score =   326 bits (836),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 170/365 (47%), Positives = 232/365 (64%), Gaps = 7/365 (2%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLKPLV-AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLP  234
             M +  K+ + I T+ L+  +L+     EPQVPCYF+FGDSL DNGNNNNLST AKANY P
Sbjct  1     MENEPKMLWWIFTIPLLISNLQNCAYGEPQVPCYFVFGDSLFDNGNNNNLSTLAKANYTP  60

Query  235   YGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILD  414
             YG DF +GPTGRFSNG N AD +A+ LGF+  IP ++    T+ +L+GVNYASG+ GI +
Sbjct  61    YGFDFSEGPTGRFSNGNNTADVIAKLLGFDDYIPTFNEAKATKNILRGVNYASGSAGIRN  120

Query  415   ESGT-HMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYL  591
             ESG   +GEVIS+D+QL NH + ++ I   +    AA  +LNKC Y++ MG NDY  NY 
Sbjct  121   ESGRLAVGEVISLDEQLQNHRIIISLITEVLGSKDAAMKHLNKCIYTIDMGTNDYTMNYF  180

Query  592   MPQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNG  771
             +PQ Y +SR +   Q+A +L +++  QLK L+ LGARKVAV G    GC P  + T+G  
Sbjct  181   LPQLYNTSRQFNVHQYATVLIQQYSQQLKSLYDLGARKVAVVGLIQSGCSPNALATYGTN  240

Query  772   SLSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKAC  951
               SCV+ IN+AVQ+FN ++ P++ +LN +L GAKF  IN   +            V  AC
Sbjct  241   GSSCVEMINNAVQIFNSKLIPLVTNLNANLPGAKFTYINFYQIDAESTRAFRFTRV--AC  298

Query  952   CQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDIS  1131
             C ++ T   G C+   +PC +R EY ++D+ H TE   L    R+Y     TDA+P+DIS
Sbjct  299   CNLTST---GLCDPSTIPCPDRTEYAYYDSVHPTEARALILGRRAYRVQSLTDAFPVDIS  355

Query  1132  SLLQL  1146
              L +L
Sbjct  356   LLAEL  360



>ref|XP_004147394.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Cucumis sativus]
Length=366

 Score =   326 bits (836),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 164/338 (49%), Positives = 215/338 (64%), Gaps = 5/338 (1%)
 Frame = +1

Query  142   QVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNLADYLAEFLGF  321
             QVPCYFIFGDSLVDNGNNN L + A+A+YLPYGIDF  GPTGRFSNGK   D +AE LGF
Sbjct  31    QVPCYFIFGDSLVDNGNNNQLQSLARADYLPYGIDF-GGPTGRFSNGKTTVDVIAELLGF  89

Query  322   NSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNHGLTLARIALY  501
             +  IPPY A      +L GVNYAS A GI +E+G  +G  IS   Q+ N+  T++++   
Sbjct  90    DDYIPPY-ATARGRDILGGVNYASAAAGIREETGRQLGGRISFSGQVENYQNTVSQVVEL  148

Query  502   MKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAKKHYVQLKK  681
             +    +A  YL+KC YS+G+G+NDY+NNY MPQ Y +   YTP Q++E L +++  QL+ 
Sbjct  149   LGDEDSAAEYLSKCIYSIGLGSNDYLNNYFMPQFYSTGNQYTPQQYSENLIQQYAEQLRL  208

Query  682   LHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMFNDRMKPIIDDLNGSL  861
             L+  GARK  +FG G +GC P E+  +     +CV  INSA Q+FN  +K ++D  N + 
Sbjct  209   LYNYGARKFVLFGIGQIGCSPNELAQNSPDGRTCVQRINSANQIFNAGLKSLVDQFNNNQ  268

Query  862   KGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQVPCSNRNEYMF  1032
               AKFI I+   +    + +PS  G   VN  CC V +   +  C   Q PCSNR+EY+F
Sbjct  269   ADAKFIFIDSYGIFQDVIDNPSAFGFRVVNAGCCGVGRNNGQITCLPFQTPCSNRDEYLF  328

Query  1033  WDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             WD FH TE GN     R+Y+A   TDAYP+DI  L QL
Sbjct  329   WDAFHPTEAGNAVIGRRAYSAQQQTDAYPVDIRRLAQL  366



>ref|XP_009406156.1| PREDICTED: GDSL esterase/lipase At5g45670-like [Musa acuminata 
subsp. malaccensis]
Length=365

 Score =   326 bits (835),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 160/355 (45%), Positives = 229/355 (65%), Gaps = 5/355 (1%)
 Frame = +1

Query  91    ATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGR  270
             A  LL++ +   +  EPQVPCYFIFGDSLVDNGNNNN+++ A ANY PYGIDFP GP+GR
Sbjct  13    ARWLLLWAAFVSVRPEPQVPCYFIFGDSLVDNGNNNNIASLAVANYPPYGIDFPSGPSGR  72

Query  271   FSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISM  450
             F+NG    D +A+ LGF+  +PPY A T  + LL GVN+AS A GI DE+G  +G  I  
Sbjct  73    FTNGLTTVDVIAQLLGFDDFVPPY-ASTRGQALLTGVNFASAAAGIRDETGQQLGGRIPF  131

Query  451   DQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTP  630
               QL N+   +  +   +    +A  YL+KC +SVG+G+NDY+NNY MP  Y + + YTP
Sbjct  132   GGQLRNYQSAVQEMVRILGDEDSAANYLSKCIFSVGLGSNDYLNNYFMPAFYSTGQRYTP  191

Query  631   DQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQ  810
             +Q+A+ L +++  QL+ L+  GARKV + G G +GC P E+       ++CV+ I+SA++
Sbjct  192   EQYADELIQQYSQQLRTLYNYGARKVVLIGVGQVGCSPNELAQRSPNGVACVEEIDSAIR  251

Query  811   MFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKAKG  981
             +FN ++  ++D+ N +L GA FI IN   +    L +P+  G++  N+ CC V +   + 
Sbjct  252   IFNAKLIDLVDEFN-ALDGAHFIYINGYGIFEDILRNPAANGLSVTNRGCCGVGRNNGQI  310

Query  982   QCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
              C   Q PC NR+EY+F+D FH TE  N+    RSY+A  P+DAYPMDI  L ++
Sbjct  311   TCLPYQAPCPNRDEYLFFDAFHPTEAANIIIGKRSYSARSPSDAYPMDIRRLARV  365



>gb|KHG06516.1| hypothetical protein F383_33590 [Gossypium arboreum]
Length=361

 Score =   326 bits (835),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 158/362 (44%), Positives = 228/362 (63%), Gaps = 4/362 (1%)
 Frame = +1

Query  70    VKVWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDF  249
             ++ W+ +  L+L+      +  EPQVPCYFIFGDSLVDNGNNN L + A+A+YLPYGIDF
Sbjct  1     MEKWYGVLGLVLVLSLFCGVKGEPQVPCYFIFGDSLVDNGNNNELRSLARADYLPYGIDF  60

Query  250   PDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTH  429
              +GPTGRFSNG+   D +AE LGF+  IPPYS  +  + +L  VNYAS A GI +E+G  
Sbjct  61    ANGPTGRFSNGRTTVDVIAELLGFDDYIPPYSTASGRQ-ILGEVNYASAAAGIREETGQQ  119

Query  430   MGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYP  609
             +G  IS   Q+ N+  T+ ++   +    +A  YL +C YS+G+G+NDY+NNY MP  Y 
Sbjct  120   LGARISFSGQVKNYQQTVQQVVNLLGDEDSAANYLRQCIYSIGLGSNDYLNNYFMPLYYS  179

Query  610   SSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVD  789
             +SR Y+P+++A  L +++  QL+ L+  GARK  + G G +GC P E+  +     +CV+
Sbjct  180   TSRQYSPEEYANSLIQEYTEQLQALYNYGARKFVLIGLGQIGCSPNELAQNSGDGRTCVE  239

Query  790   SINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQV  960
              IN+A ++FN++++ ++D  N +   AKF+ IN   +      +P+  G    N  CC V
Sbjct  240   RINAANRIFNNKLRGLVDQFNNANSDAKFVYINAYGIFQDITSNPAAYGFKVTNAGCCGV  299

Query  961   SKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLL  1140
              +   +  C   Q PC NR+EY+FWD FH +E  N+    RSY+A  PTDAYP+DI  L 
Sbjct  300   GRNNGQITCLPFQTPCQNRDEYLFWDAFHPSEAANVIIGRRSYSAQSPTDAYPIDIRRLA  359

Query  1141  QL  1146
             QL
Sbjct  360   QL  361



>ref|XP_007147963.1| hypothetical protein PHAVU_006G169000g [Phaseolus vulgaris]
 gb|ESW19957.1| hypothetical protein PHAVU_006G169000g [Phaseolus vulgaris]
Length=359

 Score =   325 bits (834),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 154/341 (45%), Positives = 219/341 (64%), Gaps = 4/341 (1%)
 Frame = +1

Query  133   AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNLADYLAEF  312
             A+ Q PCYFIFGDSL D+GNNNNL + AKANYLPYGID+P GPTGRFSNGK L D +AE 
Sbjct  20    AQQQAPCYFIFGDSLADSGNNNNLWSYAKANYLPYGIDYPQGPTGRFSNGKTLVDVVAEL  79

Query  313   LGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNHGLTLARI  492
             LG N  I PYS V   + +  GVNYAS   GI DE+G H+G   S   Q+ NH  T++ +
Sbjct  80    LGLNGYIRPYSRVIDRD-IFYGVNYASAGAGIRDETGQHLGSRTSFRGQVQNHIRTVSYM  138

Query  493   ALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAKKHYVQ  672
                ++ +     YLN+C YS+G+G+ DY+NNY +P+ Y SS  Y+ DQ+A LL +++   
Sbjct  139   VNLVRDWNRTAGYLNRCIYSIGLGSEDYLNNYFLPRIYSSSTQYSSDQYANLLIQQYAQY  198

Query  673   LKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMFNDRMKPIIDDLN  852
             L+ L+  GARK+ +FG   +GC P  +  +    ++CV+ INS +Q+FN R++ ++D+LN
Sbjct  199   LRVLYGYGARKMVLFGIAPIGCSPYALAQNSPDGITCVERINSPIQLFNTRLRSMVDELN  258

Query  853   GSLKGAKFILINMTSLALG---DPSIIGINNVNKACCQVSKTKAKGQCEEGQVPCSNRNE  1023
               L+ A+F  +N+  +      +PS +G   +N  CC+      +  C   Q PCSNRNE
Sbjct  259   TQLRNARFTYVNVYGIVQNIRTNPSPLGFRVINAGCCRAGGNNGQYTCVALQPPCSNRNE  318

Query  1024  YMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
              +FWD +HL+E  N     R+Y A   +DAYP+DI+SL+++
Sbjct  319   VLFWDAYHLSEAANTIIGRRAYNAPSTSDAYPIDINSLVRI  359



>ref|XP_006356087.1| PREDICTED: GDSL esterase/lipase At5g45670-like [Solanum tuberosum]
Length=365

 Score =   325 bits (834),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 162/366 (44%), Positives = 221/366 (60%), Gaps = 4/366 (1%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPY  237
             M   +K+      +L +F        EPQVPCYFIFGDSLVDNGNNN + + A+A+YLPY
Sbjct  1     MCGDLKIICVFLLMLSLFGDNYGTKGEPQVPCYFIFGDSLVDNGNNNVIRSLARADYLPY  60

Query  238   GIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDE  417
             GIDFPDGPTGRFSNGK   D +AE LGF+  IPPY+     E +L GVN+AS A GI +E
Sbjct  61    GIDFPDGPTGRFSNGKTTVDVIAELLGFDDYIPPYATARGRE-ILGGVNFASAAAGIREE  119

Query  418   SGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMP  597
             +G  +G  ++   Q+ N+     +I   +    +A  YL+KC YS+G+G+NDY+NNY MP
Sbjct  120   TGQQLGGRVTFSGQVNNYKNIAQQIVRIIGNENSAANYLSKCIYSIGVGSNDYLNNYFMP  179

Query  598   QKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSL  777
             Q Y +SR +TP Q+A +L +++  QLK L+  GARK  + G G +GC P  +  +     
Sbjct  180   QYYSTSRQFTPQQYANVLIQQYTQQLKTLYNYGARKFVLIGVGQIGCSPNALAQNSPDGR  239

Query  778   SCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKA  948
             +C  +IN A Q+FN++++ ++D+LN +   AK I IN   +    + +P   G    N  
Sbjct  240   TCAQNINVANQLFNNKLRALVDNLNRNTPNAKLIYINAYGIFQDLIDNPFAFGFRVTNAG  299

Query  949   CCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDI  1128
             CC + +   +  C   Q PC NRNEY+FWD FH  E  N+    RSY A   TDAYP DI
Sbjct  300   CCGIGRNNGQITCLPFQNPCPNRNEYLFWDAFHPGEAANIIVGRRSYRAQKSTDAYPFDI  359

Query  1129  SSLLQL  1146
               L QL
Sbjct  360   QRLAQL  365



>emb|CDO96913.1| unnamed protein product [Coffea canephora]
Length=367

 Score =   325 bits (833),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 166/343 (48%), Positives = 221/343 (64%), Gaps = 4/343 (1%)
 Frame = +1

Query  127   LVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNLADYLA  306
             ++A+PQVPCYFIFGDSLVDNGNNNN+++ AKANYLPYGIDFP GPTGRF NGK   D + 
Sbjct  26    VLAQPQVPCYFIFGDSLVDNGNNNNINSLAKANYLPYGIDFPGGPTGRFCNGKTTVDVIT  85

Query  307   EFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNHGLTLA  486
             E LGFN  I P++     + +LKGVNYAS A GI +E+G  +G   S   Q+ N+  T++
Sbjct  86    ELLGFNGYIQPFTRAQGQD-ILKGVNYASAAAGIREETGQQLGARTSFTGQVNNYNSTVS  144

Query  487   RIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAKKHY  666
             +I   +     A  YL+KC YSVG+G+NDY+NNY MP  Y SSR +TP+QFA  L  ++ 
Sbjct  145   QIVSLLGDQNRAAAYLSKCIYSVGLGSNDYLNNYFMPLFYSSSRQFTPEQFANALIGQYS  204

Query  667   VQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMFNDRMKPIIDD  846
              Q+++L+ LGARK+ + G G +GC P E+  +     +CV  INSA QMFN ++K ++D 
Sbjct  205   QQIRRLYNLGARKLVLIGVGQIGCSPNELAQNSPDGRTCVARINSANQMFNSKLKSLVDT  264

Query  847   LNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQVPCSNR  1017
             LN     A+FI I+   +    +  PS  G    N+ CC V +   +  C   Q PC NR
Sbjct  265   LNNQFTDARFIYIDAYGIFQDLISSPSAFGFTVTNRGCCGVGRNNGQITCLPFQTPCPNR  324

Query  1018  NEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             N+++FWD FH TE  N+    RSY A   +DAYP+DIS L QL
Sbjct  325   NQHLFWDAFHPTEAANIIVGRRSYRAQKSSDAYPIDISRLAQL  367



>gb|ABF72016.1| GDSL-motif lipase/hydrolase family protein [Musa acuminata]
Length=356

 Score =   324 bits (831),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 160/355 (45%), Positives = 228/355 (64%), Gaps = 5/355 (1%)
 Frame = +1

Query  91    ATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGR  270
             A  LL++ +   +  EPQVPCYFIFGDSLVDNGNNNN+++ A ANY PYGIDFP GP+GR
Sbjct  4     ARWLLLWAAFVSVRPEPQVPCYFIFGDSLVDNGNNNNIASLAVANYPPYGIDFPSGPSGR  63

Query  271   FSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISM  450
             F+NG    D +A+ LGF+  +PPY A T  + LL GVN+AS A GI +E+G  +G  I  
Sbjct  64    FTNGLTTVDVIAQLLGFDDFVPPY-ASTRGQALLTGVNFASAAAGIREETGQQLGGRIPF  122

Query  451   DQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTP  630
               QL N+   +  +   +    +A  YL+KC +SVG+G+NDY+NNY MP  Y + + YTP
Sbjct  123   GGQLQNYQSAVQEMVSILGDEDSAANYLSKCIFSVGLGSNDYLNNYFMPAFYSTGQRYTP  182

Query  631   DQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQ  810
             +Q+A+ L +++  QL+ L+  GARKV + G G +GC P E+       ++CV+ INSA++
Sbjct  183   EQYADELIQQYSQQLRTLYNYGARKVVLIGVGQVGCSPNELAQRSPNGVACVEEINSAIR  242

Query  811   MFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKAKG  981
             +FN ++  ++D+ N +L GA FI IN   +    L +P+  G++  N+ CC V +   + 
Sbjct  243   IFNAKLIDLVDEFN-ALDGAHFIYINGYGIFEDILRNPAANGLSVTNRGCCGVGRNNGQI  301

Query  982   QCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
              C   Q PC NR+EY+F+D FH TE  N+    RSY+A  P DAYPMDI  L ++
Sbjct  302   TCLPYQAPCPNRDEYLFFDAFHPTEAANIIIGKRSYSARSPGDAYPMDIRRLARV  356



>ref|XP_002324947.2| hypothetical protein POPTR_0018s03490g [Populus trichocarpa]
 gb|EEF03512.2| hypothetical protein POPTR_0018s03490g [Populus trichocarpa]
Length=357

 Score =   324 bits (830),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 166/353 (47%), Positives = 227/353 (64%), Gaps = 11/353 (3%)
 Frame = +1

Query  88    IATLLLMFLSLKP-LVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPT  264
             I  LL +  S++P ++    VPCYFIFGDSLVD+GNNN LST AK NY PYGIDFP GPT
Sbjct  13    IFILLTVASSMQPYILVAASVPCYFIFGDSLVDSGNNNGLSTSAKVNYPPYGIDFPAGPT  72

Query  265   GRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVI  444
             GRF+NGK +AD + E LG    I P++  T +E ++ GVNYASG+ GI DE+G ++G  +
Sbjct  73    GRFTNGKTVADIITELLGLKDYIQPFATATASE-IINGVNYASGSSGIRDEAGRNLGTHV  131

Query  445   SMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLY  624
               +QQL NH +T++ +   +K   AA  +LN+C Y+VGMG+NDYIN+Y +P    S++ Y
Sbjct  132   GFNQQLNNHQITISSLTKTLKDSTAA--HLNQCLYTVGMGSNDYINDYFLPGSATSTQ-Y  188

Query  625   TPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHG-NGSLSCVDSINS  801
             TPDQFA +L  ++  Q++ LH  GARK+A+FG G + C P  +   G NG  +C +SI  
Sbjct  189   TPDQFAGVLIDQYSKQIRTLHDAGARKIALFGLGAISCTPNSIVLFGKNG--TCAESITG  246

Query  802   AVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACCQVSKTKAKG  981
             AVQ+FN R+K ++D LN  L  +K I IN       +P+ +G      +CCQ++     G
Sbjct  247   AVQLFNVRLKSLVDQLNKELTDSKVIYINSIGTLRRNPTKLGFKVFKSSCCQLNNA---G  303

Query  982   QCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLL  1140
              C      C NRNE++FWD FH TE  N  TA R++ A  P+DAYP  IS L+
Sbjct  304   LCNPSSTACPNRNEFIFWDGFHPTEAMNKLTAARAFHAADPSDAYPFGISQLV  356



>gb|KGN65589.1| hypothetical protein Csa_1G467090 [Cucumis sativus]
Length=408

 Score =   325 bits (834),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 164/338 (49%), Positives = 215/338 (64%), Gaps = 5/338 (1%)
 Frame = +1

Query  142   QVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNLADYLAEFLGF  321
             QVPCYFIFGDSLVDNGNNN L + A+A+YLPYGIDF  GPTGRFSNGK   D +AE LGF
Sbjct  73    QVPCYFIFGDSLVDNGNNNQLQSLARADYLPYGIDF-GGPTGRFSNGKTTVDVIAELLGF  131

Query  322   NSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNHGLTLARIALY  501
             +  IPPY A      +L GVNYAS A GI +E+G  +G  IS   Q+ N+  T++++   
Sbjct  132   DDYIPPY-ATARGRDILGGVNYASAAAGIREETGRQLGGRISFSGQVENYQNTVSQVVEL  190

Query  502   MKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAKKHYVQLKK  681
             +    +A  YL+KC YS+G+G+NDY+NNY MPQ Y +   YTP Q++E L +++  QL+ 
Sbjct  191   LGDEDSAAEYLSKCIYSIGLGSNDYLNNYFMPQFYSTGNQYTPQQYSENLIQQYAEQLRL  250

Query  682   LHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMFNDRMKPIIDDLNGSL  861
             L+  GARK  +FG G +GC P E+  +     +CV  INSA Q+FN  +K ++D  N + 
Sbjct  251   LYNYGARKFVLFGIGQIGCSPNELAQNSPDGRTCVQRINSANQIFNAGLKSLVDQFNNNQ  310

Query  862   KGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQVPCSNRNEYMF  1032
               AKFI I+   +    + +PS  G   VN  CC V +   +  C   Q PCSNR+EY+F
Sbjct  311   ADAKFIFIDSYGIFQDVIDNPSAFGFRVVNAGCCGVGRNNGQITCLPFQTPCSNRDEYLF  370

Query  1033  WDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             WD FH TE GN     R+Y+A   TDAYP+DI  L QL
Sbjct  371   WDAFHPTEAGNAVIGRRAYSAQQQTDAYPVDIRRLAQL  408



>ref|XP_008223778.1| PREDICTED: uncharacterized protein LOC103323554 [Prunus mume]
Length=889

 Score =   339 bits (870),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 179/363 (49%), Positives = 236/363 (65%), Gaps = 7/363 (2%)
 Frame = +1

Query  73    KVW-FAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDF  249
             ++W F I  L+ + L    +  EPQVPCYF+FGDS+ D GNNN L T A+ NY PYGIDF
Sbjct  8     QLWVFTILLLVAINLCCNLVHGEPQVPCYFVFGDSISDTGNNNGLLTLARVNYPPYGIDF  67

Query  250   PDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTH  429
             P GPTGRFSNG+NL D +AE LGF+  IPP+ A      +L+GVNYASGA GI DESG +
Sbjct  68    PRGPTGRFSNGRNLVDVIAELLGFSHYIPPF-ATARGRKILEGVNYASGAAGIRDESGRN  126

Query  430   MGEVISMDQQLVNHGLTLARIALYMK-GYRAARYYLNKCFYSVGMGNNDYINNYLMPQKY  606
                 IS +QQL+NH +T+ RI   M+  + +A  YL KC Y+VG+G+NDYINNY MP+ Y
Sbjct  127   QLIRISFNQQLLNHQITINRIESLMRNNHPSAVQYLGKCIYTVGIGSNDYINNYFMPRLY  186

Query  607   PSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGN---GSL  777
              +SR YTPDQ+A +L ++   QL++L+  GARK+A+FG G +G  P E+   G     SL
Sbjct  187   STSRKYTPDQYAGVLIQEFSEQLRRLYKTGARKIALFGIGAIGSTPFEVAMCGGTNISSL  246

Query  778   SCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACCQ  957
              C   IN+AVQ+FN+ +K ++ DLN +L  AKF  I+   + L   +    + V+ A C 
Sbjct  247   LCSAKINNAVQLFNEGLKSLVTDLNTNLIDAKFTFIDYFGIGLSSAAASVGSVVSDAPCC  306

Query  958   VSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSL  1137
              ++T+  G C     PC NR +Y FWD FH TEI N+    R+Y ATLPTDA P DIS L
Sbjct  307   EAETET-GLCVPLSTPCQNRTQYSFWDAFHPTEISNVVVGRRAYKATLPTDAVPYDISHL  365

Query  1138  LQL  1146
              Q+
Sbjct  366   AQV  368


 Score =   308 bits (789),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 166/335 (50%), Positives = 218/335 (65%), Gaps = 17/335 (5%)
 Frame = +1

Query  76    VWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPD  255
             +W   + + L++L      A+PQVPCYFIFGDSL DNGNNN L T AKAN+ PYGIDFP 
Sbjct  414   LWTLFSAIFLIYLVNG--AAQPQVPCYFIFGDSLSDNGNNNPLITSAKANFPPYGIDFPR  471

Query  256   GPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMG  435
             GPTGRFSNG+NL D +A  LG ++ IPP++     E +LKGVNYASG+ GI +E+G   G
Sbjct  472   GPTGRFSNGRNLVDVVAGLLGSDNYIPPFATARGME-ILKGVNYASGSAGIRNETGRQKG  530

Query  436   EVISMDQQLVNHGLTLARIA-LYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPS  612
             ++ISMD QL NH   + +IA L      +A  YL KC Y+VGMG NDYI NY +     +
Sbjct  531   QIISMDMQLQNHQSIVKQIASLRGNNDLSAEEYLGKCIYTVGMGTNDYILNYFVSLS-ST  589

Query  613   SRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDS  792
             SR YTPDQ+A +L +++  QL+ L+  GARK+A+FG G LG IP E+   G    SCV  
Sbjct  590   SRQYTPDQYATVLIEQYSQQLRTLYNFGARKIALFGLGPLGSIPYEVAACGTKGSSCVSY  649

Query  793   INSAVQMFNDRMKPIIDDLNGSLKGAKFILINM----TSLALGDPSIIGINNVNKACCQV  960
             IN+AVQ+FN R+K ++ +LN +L+ AKFI I+     +S AL   S+I     N +CC+V
Sbjct  650   INNAVQIFNWRLKSLVQELNSNLRNAKFIYIDYYGIGSSYALSQGSLIS----NVSCCEV  705

Query  961   SKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGN  1065
                  +G C   Q+PC NR +Y+FWD  H TE  N
Sbjct  706   ----IEGACIPFQIPCRNRTQYIFWDGVHPTEATN  736



>ref|XP_007014322.1| GDSL-like Lipase/Acylhydrolase superfamily protein, putative 
[Theobroma cacao]
 gb|EOY31941.1| GDSL-like Lipase/Acylhydrolase superfamily protein, putative 
[Theobroma cacao]
Length=383

 Score =   325 bits (832),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 165/373 (44%), Positives = 242/373 (65%), Gaps = 11/373 (3%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLKPLV-AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLP  234
             +AS  + W+ +    L+  +      AEPQVPCYFIFGDSL D+GNNNNL+T AK NY P
Sbjct  3     LASKFQPWWLLPVSFLLATNFHDCANAEPQVPCYFIFGDSLSDDGNNNNLATTAKVNYAP  62

Query  235   YGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILD  414
             YGIDFP GPTGRF+NG+ + D + + L F   IPP++     E +LKGVNYASG+ GIL+
Sbjct  63    YGIDFPRGPTGRFTNGRTMQDIIVQLLDFEEFIPPFATARGIE-ILKGVNYASGSAGILN  121

Query  415   ESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLM  594
             E+G  +G+ ISM++QL NH + ++ +   + G  +A   L+KC Y+V +G+NDY+NNY +
Sbjct  122   ETGEQLGDRISMNKQLSNHQIIISTMGEIL-GKCSASKLLSKCIYAVQIGSNDYLNNYFI  180

Query  595   PQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHG-NG  771
             P+ Y +SRLYTPDQ+A  L +++  Q+K L+  GAR +A+FG G +GC P  M  +G NG
Sbjct  181   PEFYNTSRLYTPDQYAAYLIEQYSQQIKTLYNDGARMLALFGIGSIGCTPNAMAVYGTNG  240

Query  772   SLSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKAC  951
             SL CV+ +++A Q+FN+R+  ++D+LN +L  A F  +N +     +   +G    N +C
Sbjct  241   SL-CVEKLDNAAQLFNERLISLVDELNSNLTDATFTYLNPSGTDTANS--LGFTVTNASC  297

Query  952   CQVSKTKAKGQ-CEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDI  1128
             CQV    + G+ C     PC++R++Y+FWD  H ++  NL  AT +YT+   T AYP++I
Sbjct  298   CQVG---SDGELCIPDSEPCADRSQYVFWDAVHPSDAWNLLIATEAYTSQSSTQAYPLNI  354

Query  1129  SSLLQLNLQAKSD  1167
               L QL    + D
Sbjct  355   QKLAQLQSDDEGD  367



>ref|XP_006852691.1| hypothetical protein AMTR_s00021p00254410 [Amborella trichopoda]
 gb|ERN14158.1| hypothetical protein AMTR_s00021p00254410 [Amborella trichopoda]
Length=436

 Score =   326 bits (836),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 158/338 (47%), Positives = 212/338 (63%), Gaps = 4/338 (1%)
 Frame = +1

Query  142   QVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNLADYLAEFLGF  321
             QVPCYF+FGDSLVDNGNNNN+++ A+ANY PYGIDFP GPTGRFSNG    D  A+ LGF
Sbjct  100   QVPCYFVFGDSLVDNGNNNNIASLARANYPPYGIDFPQGPTGRFSNGLTTTDVTAQLLGF  159

Query  322   NSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNHGLTLARIALY  501
             N  I PY A  +   +L+GVNYAS A GI +E+G  +G  I    Q+ N+  T+ ++   
Sbjct  160   NQLILPY-ATASGRQILRGVNYASAAAGIREETGQQLGARIPFGGQIENYRNTVNQVIAL  218

Query  502   MKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAKKHYVQLKK  681
             +    +A  YL+KC YSVGMGNNDY+NNY MP  Y +SR YTP  +A++L +++  QL +
Sbjct  219   LGDEDSAADYLSKCIYSVGMGNNDYLNNYFMPALYSTSRQYTPQAYADVLIQQYTRQLTQ  278

Query  682   LHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMFNDRMKPIIDDLNGSL  861
             L+ LGARKVA+ G G +GC P  +  +     +CV  +N  +Q+FN R++ ++D  N + 
Sbjct  279   LYNLGARKVALIGVGQIGCSPNALAQNSPNGATCVQRLNQPIQIFNSRLRSLVDYFNNNF  338

Query  862   KGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQVPCSNRNEYMF  1032
             +GA FI +N   +    +  P   G    N  CC V +   +  C   Q PC NR +Y+F
Sbjct  339   QGAAFIYVNAYGIFDDLISRPRAYGFTVTNVGCCGVGRNNGQITCLPYQTPCQNRRQYVF  398

Query  1033  WDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             WD FH TE  N+  A RSY A   +DAYP+DI  L QL
Sbjct  399   WDAFHPTEAANIVIARRSYAAQSSSDAYPIDIRRLAQL  436



>ref|XP_008387170.1| PREDICTED: GDSL esterase/lipase At5g45670-like [Malus domestica]
Length=369

 Score =   324 bits (830),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 175/363 (48%), Positives = 232/363 (64%), Gaps = 11/363 (3%)
 Frame = +1

Query  76    VWFAIATLLLMFLSLKPLV-AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFP  252
             +W     LL+  L     V   PQVPCYFIFGDSL D+GNNN L T AKANY PYGIDFP
Sbjct  10    LWVXPILLLVSILHYSCFVDGAPQVPCYFIFGDSLSDSGNNNGLLTLAKANYKPYGIDFP  69

Query  253   DGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHM  432
              GPTGRFSNG+NL D +AE LGF+  IPP++A    + +L GVNYASGA GI DESG + 
Sbjct  70    RGPTGRFSNGRNLVDVIAELLGFSHYIPPFAAAIGWK-ILHGVNYASGAAGIRDESGRNQ  128

Query  433   GEVISMDQQLVNHGLTLARI-ALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYP  609
             G  ++ ++QLVNH   + +I +L      AA  YL KC Y+V +G+NDYINNY MP+ Y 
Sbjct  129   GMRVTFNKQLVNHQNIVRQIVSLQGNNNSAAIQYLGKCIYTVTIGSNDYINNYFMPRLYS  188

Query  610   SSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEM----ETHGNGSL  777
             +SR +T +Q+A +L +++  Q+K L+  GARK+A+FG G +G IP E+     +  N SL
Sbjct  189   TSRZFTSEQYAGVLIQQYSGQIKTLYNSGARKIALFGLGTIGSIPFEVAMCNRSTNNVSL  248

Query  778   SCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSI-IGINNVNKACC  954
              C D++NSAVQ+FN R++ ++DDLN +L  AKF  I+   + L   +  +G    +  CC
Sbjct  249   -CSDNMNSAVQVFNARLQSLVDDLNSNLTDAKFTYIDFYGIGLSSAAASLGSVIFDAPCC  307

Query  955   QVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISS  1134
             +V   +  G C     PC NR +Y FWD  H +E  N+    R+Y ATLPTDA P DI+ 
Sbjct  308   EV--VRETGLCVPFNTPCQNRTQYSFWDAIHPSESSNVVLGGRAYNATLPTDAVPFDINQ  365

Query  1135  LLQ  1143
             L Q
Sbjct  366   LAQ  368



>ref|XP_003526254.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Glycine max]
 gb|KHN07786.1| GDSL esterase/lipase [Glycine soja]
Length=360

 Score =   323 bits (829),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 173/364 (48%), Positives = 226/364 (62%), Gaps = 9/364 (2%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLKPLV-AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLP  234
             M +  K    +  LLL+ + ++  V  E QVPC F+FGDSL DNGNNNNL +  K+NY P
Sbjct  1     MEAKTKSCVVLPFLLLVAIFMQQCVHGESQVPCLFVFGDSLSDNGNNNNLPSTTKSNYKP  60

Query  235   YGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILD  414
             YGIDFP GPTGRF+NG+   D +A+ LGF + IPP+ A T+    LKGVNYASGA GIL 
Sbjct  61    YGIDFPTGPTGRFTNGQTSIDLIAQLLGFENFIPPF-ANTSGSDTLKGVNYASGAAGILP  119

Query  415   ESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLM  594
             ESGTHMG  I++  Q++NH    + IA+ + G+  A+ YLNKC Y V +G+NDYINNY +
Sbjct  120   ESGTHMGANINLRVQMLNHLFMYSTIAIKLGGFVKAKQYLNKCLYYVNIGSNDYINNYFL  179

Query  595   PQKYPSSRLYTPDQFAELLAKKHYVQLKKLH-ALGARKVAVFGPGVLGCIPEEMETHGNG  771
             PQ Y +SR+YTPDQ+A +L  +    ++ LH  +GARK  + G G++GC P  + TH N 
Sbjct  180   PQFYLTSRIYTPDQYANILIAQLSQYMQTLHDEVGARKFVLVGMGLIGCTPNAISTH-NT  238

Query  772   SLSCVDSINSAVQMFNDRMKPIIDDLNGSLKG-AKFILINMTSLALGDPSIIGINNVNKA  948
             + SCV+ +N+A  MFN ++K  +D  N      +KFI IN TS  L   S +G    N +
Sbjct  239   NGSCVEEMNNATFMFNAKLKSKVDQFNNKFSADSKFIFINSTSGGLD--SSLGFTVANAS  296

Query  949   CCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDI  1128
             CC    T   G C   Q PC NR  Y+FWD FH TE  N   A  SY  + P   YPMDI
Sbjct  297   CCPSLGT--NGLCIPNQTPCQNRTTYVFWDQFHPTEAVNRIIAINSYNGSNPALTYPMDI  354

Query  1129  SSLL  1140
               L+
Sbjct  355   KHLV  358



>gb|AGJ83937.1| GLIP [Brassica napus]
Length=361

 Score =   323 bits (829),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 166/362 (46%), Positives = 222/362 (61%), Gaps = 9/362 (2%)
 Frame = +1

Query  70    VKVWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDF  249
             ++ W  +  +L +  S+       QVPCYFIFGDSLVDNGNNN L + A+ANYLPYGIDF
Sbjct  6     LRKWCVVFVVLGLAFSV---TKAQQVPCYFIFGDSLVDNGNNNGLVSFARANYLPYGIDF  62

Query  250   PDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTH  429
               GPTGRFSNG+   D +AE LGFN  IP Y++V   + +L GVNYAS A GI +E+G  
Sbjct  63    -GGPTGRFSNGRTTVDEIAELLGFNDYIPAYNSVRGRQ-ILTGVNYASAAAGIREETGRQ  120

Query  430   MGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYP  609
             +G+ IS   Q+ N+  T+ ++   + G   A  YL +C YSVGMG+NDY+NNY MP  Y 
Sbjct  121   LGQRISFSGQVRNYQNTVQQVVSLLGGETQAADYLKRCIYSVGMGSNDYLNNYSMPTFYS  180

Query  610   SSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVD  789
             SSR +TP+Q+A  L  ++  QL  L+  GARK A+ G G +GC P  +        +C +
Sbjct  181   SSRQFTPEQYANDLISRYSTQLNALYNYGARKFALIGIGAIGCSPNAL-ARSRDRRTCDE  239

Query  790   SINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQV  960
              INSA Q+FN +++ ++D  N +   AKF  IN   +    + +PS  G    N  CC +
Sbjct  240   RINSANQIFNSKLRSLVDQPNNNHPDAKFTYINAYDIFQDMIKNPSRFGFRVTNAGCCGI  299

Query  961   SKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLL  1140
              +   +  C  GQ PC +RN Y+FWD FH TE  N+  A RSY A  P+DAYPMDIS L 
Sbjct  300   GRNAGQITCLPGQRPCRDRNAYVFWDAFHPTEAANIVIARRSYKAESPSDAYPMDISGLA  359

Query  1141  QL  1146
             +L
Sbjct  360   RL  361



>ref|XP_004969944.1| PREDICTED: GDSL esterase/lipase At5g45670-like [Setaria italica]
Length=366

 Score =   323 bits (829),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 155/340 (46%), Positives = 219/340 (64%), Gaps = 5/340 (1%)
 Frame = +1

Query  136   EPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNLADYLAEFL  315
             EPQVPCYF+FGDSLVDNGNNN++++ A+ANY PYGIDFP G TGRFSNG    D ++  L
Sbjct  29    EPQVPCYFVFGDSLVDNGNNNDIASLARANYPPYGIDFPGGATGRFSNGLTTVDAISRLL  88

Query  316   GFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNHGLTLARIA  495
             GF+  IP Y+  +  + LL GVN+AS A GI DE+G  +G+ IS   QL N+   + ++ 
Sbjct  89    GFDDYIPAYAGASNDQ-LLTGVNFASAAAGIRDETGQQLGQRISFGGQLQNYQAAVQQLV  147

Query  496   LYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAKKHYVQL  675
               +    +A  +L++C ++VGMG+NDY+NNY MP  Y +S+ YTP+Q+A+ LA ++  QL
Sbjct  148   SILGDEDSAANHLSQCIFTVGMGSNDYLNNYFMPAVYSTSQQYTPEQYADALAGQYSQQL  207

Query  676   KKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMFNDRMKPIIDDLNG  855
             + L+  GARKVA+ G G +GC P E+        +CV  IN+A+ +FN R+  ++D  N 
Sbjct  208   RTLYNYGARKVALMGVGQVGCSPNELAQRSPDGATCVSEINAAIDIFNRRLVALVDQFN-  266

Query  856   SLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQVPCSNRNEY  1026
             +L GA F  IN   +    L  P   G+   N+ CC V +   +  C   Q PC+NRNEY
Sbjct  267   ALPGAHFTYINAYGIFEDILRSPGSHGLTVTNRGCCGVGRNNGQVTCLPFQTPCTNRNEY  326

Query  1027  MFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             +FWD FH TE  N+    R+Y+A LP+D +P+D+ +L QL
Sbjct  327   LFWDAFHPTEAANILVGRRAYSAALPSDVHPVDLRTLAQL  366



>ref|XP_008366613.1| PREDICTED: GDSL esterase/lipase At5g45670-like [Malus domestica]
Length=369

 Score =   323 bits (829),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 175/363 (48%), Positives = 232/363 (64%), Gaps = 11/363 (3%)
 Frame = +1

Query  76    VWFAIATLLLMFLSLKPLV-AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFP  252
             +W     LL+  L     V   PQVPCYFIFGDSL D+GNNN L T AKANY PYGIDFP
Sbjct  10    LWVXPILLLVSILHYSCFVDGAPQVPCYFIFGDSLSDSGNNNGLLTLAKANYKPYGIDFP  69

Query  253   DGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHM  432
              GPTGRFSNG+NL D +AE LGF+  IPP++A    + +L GVNYASGA GI DESG + 
Sbjct  70    RGPTGRFSNGRNLVDVIAELLGFSHYIPPFAAAIGWK-ILHGVNYASGAAGIRDESGRNQ  128

Query  433   GEVISMDQQLVNHGLTLARI-ALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYP  609
             G  ++ ++QLVNH   + +I +L      AA  YL KC Y+V +G+NDYINNY MP+ Y 
Sbjct  129   GMRVTFNKQLVNHQNIVRQIVSLQGNNNSAAIQYLGKCIYTVTIGSNDYINNYFMPRLYS  188

Query  610   SSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEM----ETHGNGSL  777
             +SR +T +Q+A +L +++  Q+K L+  GARK+A+FG G +G IP E+     +  N SL
Sbjct  189   TSREFTSEQYAGVLIQQYSGQIKTLYNSGARKIALFGLGTIGSIPFEVAMCNRSTNNVSL  248

Query  778   SCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSI-IGINNVNKACC  954
              C D++NSAVQ+FN R++ ++DDLN +L  AKF  I+   + L   +  +G    +  CC
Sbjct  249   -CSDNMNSAVQVFNARLQSLVDDLNSNLTDAKFTYIDFYGIGLSSAAASLGSVIFDAPCC  307

Query  955   QVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISS  1134
             +V   +  G C     PC NR +Y FWD  H +E  N+    R+Y ATLPTDA P DI+ 
Sbjct  308   EV--VRETGLCVPFNTPCQNRTQYSFWDAIHPSESSNVVLGGRAYNATLPTDAVPFDINQ  365

Query  1135  LLQ  1143
             L Q
Sbjct  366   LAQ  368



>emb|CDO96914.1| unnamed protein product [Coffea canephora]
Length=367

 Score =   323 bits (828),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 166/343 (48%), Positives = 226/343 (66%), Gaps = 4/343 (1%)
 Frame = +1

Query  127   LVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNLADYLA  306
             ++A+PQVPCYFIFGDSLVDNGNNNNL++ AKANYLPYGIDFP GPTGRFSNGK   D + 
Sbjct  26    VLAQPQVPCYFIFGDSLVDNGNNNNLNSLAKANYLPYGIDFPRGPTGRFSNGKTTVDVIT  85

Query  307   EFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNHGLTLA  486
             E LGF+  IPPYS V   + +L+GVNYAS A GI +E+G  +G+ IS   Q+ N+  T+ 
Sbjct  86    EELGFDRYIPPYSRVRGQD-ILRGVNYASAAAGIREETGRQLGQRISFSGQVRNYINTVR  144

Query  487   RIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAKKHY  666
              I   +    AA  YL++C +SVG+G+NDY+NNY MP  YP+SR YTP+Q+A++L +++ 
Sbjct  145   GIVNILGDENAAADYLSQCIFSVGLGSNDYLNNYFMPLIYPTSRQYTPEQYAQVLIQQYA  204

Query  667   VQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMFNDRMKPIIDD  846
              Q++ ++  GARK+ + G G +GC P  +  +     +CV  IN+A Q+FN+++K ++D 
Sbjct  205   EQIRIMYNYGARKLVLLGVGQIGCSPNALAQNSPDGRTCVARINNANQLFNNQLKALVDT  264

Query  847   LNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQVPCSNR  1017
             LN     A+FI I+   +    L  PS  G    N+ CC V +   +  C   Q PC NR
Sbjct  265   LNNQFTDARFIYIDSYGIFQDILNSPSSYGFTVTNRGCCGVGRNNGQITCLPLQTPCRNR  324

Query  1018  NEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             N+Y+FWD FH TE  N     R+Y A   +DAYP+DIS L QL
Sbjct  325   NQYLFWDAFHPTEAANTIVGRRAYRAQKSSDAYPIDISRLAQL  367



>ref|XP_008792294.1| PREDICTED: GDSL esterase/lipase At5g45670-like [Phoenix dactylifera]
Length=367

 Score =   323 bits (827),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 160/359 (45%), Positives = 222/359 (62%), Gaps = 8/359 (2%)
 Frame = +1

Query  79    WFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDG  258
             W  +     +  S++P   +PQVPCYFIFGDSLVDNGNNN++++ A+A+Y+PYGIDF  G
Sbjct  14    WLMLLASSWLMGSVRP---DPQVPCYFIFGDSLVDNGNNNDIASLARADYMPYGIDFAGG  70

Query  259   PTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGE  438
             PTGRF NG    D +A+ LGF   IPPY+A      LL GVN+AS A GI +E+G  +G+
Sbjct  71    PTGRFGNGLTTVDVIAQLLGFEDFIPPYAA-ARGRALLTGVNFASAAAGIREETGQQLGD  129

Query  439   VISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSR  618
              IS   QL N+   +  +   +    +A  YL+KC +SVGMG+NDY+NNY MP  Y SS 
Sbjct  130   RISFSGQLQNYQAAVQEVVSILGDEDSAANYLSKCIFSVGMGSNDYLNNYFMPAFYSSSS  189

Query  619   LYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSIN  798
              YTP+Q+A++L +++  Q++ L+  GARKV + G G +GC P E+  +     +CV  IN
Sbjct  190   QYTPEQYADVLIEQYSQQIRTLYNYGARKVVLMGVGQIGCSPNELAQNSPNGQTCVHRIN  249

Query  799   SAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKT  969
             S +Q+FN ++  ++D  N +L  A F  IN   +      +PS  G+   N+ CC V K 
Sbjct  250   SGIQIFNRKLIALVDQFN-TLNQANFTYINAYGIFEDIWRNPSKHGLTVTNRGCCGVGKN  308

Query  970   KAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
               +  C   Q PC NRNEY+FWD FH +E  N+    RSY+A   +DAYPMDI  L Q+
Sbjct  309   NGQITCLPYQTPCPNRNEYLFWDAFHPSEAANIIIGKRSYSAESSSDAYPMDIRHLAQI  367



>ref|XP_008366024.1| PREDICTED: GDSL esterase/lipase At5g45670-like [Malus domestica]
Length=366

 Score =   323 bits (827),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 160/341 (47%), Positives = 219/341 (64%), Gaps = 5/341 (1%)
 Frame = +1

Query  133   AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNLADYLAEF  312
             AEPQVPCYFIFGDSLVDNGNNN L + A+A+YLPYG+DF  GPTGRFSNGK   D +AE 
Sbjct  28    AEPQVPCYFIFGDSLVDNGNNNQLQSLARADYLPYGVDF-GGPTGRFSNGKTTVDVVAEL  86

Query  313   LGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNHGLTLARI  492
             LGF+  IPPY A    + +LKGVN+AS A GI +E+G  +G+ I+   Q+ N+  T++++
Sbjct  87    LGFDDFIPPY-ATARGQDVLKGVNFASAAAGIREETGRQLGDRITFSGQVKNYQNTVSQV  145

Query  493   ALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAKKHYVQ  672
                +     A  YL+KC YSVG+G+NDY+NNY MPQ Y +   +TP+++A+ L   +  Q
Sbjct  146   VNLLGDEDQAANYLSKCIYSVGLGSNDYLNNYFMPQFYSTGNQFTPEEYADSLIHDYGQQ  205

Query  673   LKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMFNDRMKPIIDDLN  852
             L  L+  GARKV +FG G +GC P E+  +     SCV  INSA Q+FN ++K + ++ N
Sbjct  206   LTILYNYGARKVVLFGIGQIGCSPNELAQNSPDGSSCVQKINSANQIFNSKLKALANEFN  265

Query  853   GSLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQVPCSNRNE  1023
              +L  A+FI ++   +    + +P+  G    N  CC V +   +  C   Q PC NR+E
Sbjct  266   TNLADARFIFVDSYGIFQDIISNPAQYGFRVTNAGCCGVGRNNGQITCLPFQTPCQNRDE  325

Query  1024  YMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             Y+FWD FH TE GN   A R+Y+A   +DAYP+DI  L  L
Sbjct  326   YLFWDAFHPTEAGNAVIARRAYSAVQASDAYPVDIRRLALL  366



>ref|NP_001149080.1| anther-specific proline-rich protein APG precursor [Zea mays]
 gb|ACF78736.1| unknown [Zea mays]
 gb|ACF85836.1| unknown [Zea mays]
 gb|ACG32365.1| anther-specific proline-rich protein APG [Zea mays]
 gb|ACG34104.1| anther-specific proline-rich protein APG [Zea mays]
 tpg|DAA57639.1| TPA: anther-specific proline-rich protein APG [Zea mays]
Length=369

 Score =   323 bits (827),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 153/341 (45%), Positives = 221/341 (65%), Gaps = 5/341 (1%)
 Frame = +1

Query  133   AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNLADYLAEF  312
             AEPQVPCYF+FGDSLVDNGNNN++++ A+ANY PYGIDF  GPTGRFSNG    D ++  
Sbjct  31    AEPQVPCYFVFGDSLVDNGNNNDIASLARANYPPYGIDFAAGPTGRFSNGLTTVDAISRL  90

Query  313   LGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNHGLTLARI  492
             LGF+  IP Y+  +  + LL GVN+AS A GI DE+G  +G+ IS   QL N+   + ++
Sbjct  91    LGFDDYIPAYAGASGDQ-LLTGVNFASAAAGIRDETGQQLGQRISFGGQLQNYQAAVQQL  149

Query  493   ALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAKKHYVQ  672
                +    +A  +L++C ++VGMG+NDY+NNY MP  Y +S+ YTP+Q+A++L  ++  Q
Sbjct  150   VSILGDEDSAASHLSQCIFTVGMGSNDYLNNYFMPAVYSTSQQYTPEQYADVLINQYSQQ  209

Query  673   LKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMFNDRMKPIIDDLN  852
             L+ L++ GARKVA+ G G +GC P E+        +CV  IN A+ +FN ++  ++D  N
Sbjct  210   LRTLYSYGARKVALMGVGQVGCSPNELAQRSTDGTTCVPQINGAIDIFNRKLVALVDQFN  269

Query  853   GSLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQVPCSNRNE  1023
              +L GA F  IN+  +    L  P   G+   N+ CC V +   +  C   Q PC+NRNE
Sbjct  270   -ALPGAHFTYINVYGIFQDILRAPGSHGLTVTNQGCCGVGRNNGQVTCLPFQTPCANRNE  328

Query  1024  YMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             Y+FWD FH TE  N+    R+Y+A LP+D +PMD+ +L ++
Sbjct  329   YLFWDAFHPTEAANILVGRRAYSAALPSDVHPMDLRTLARI  369



>ref|XP_006415558.1| hypothetical protein EUTSA_v10007994mg [Eutrema salsugineum]
 gb|ESQ33911.1| hypothetical protein EUTSA_v10007994mg [Eutrema salsugineum]
Length=364

 Score =   322 bits (826),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 165/366 (45%), Positives = 229/366 (63%), Gaps = 5/366 (1%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPY  237
             M S ++ W  ++ L+L+      + AEPQVPCYFIFGDSLVDNGNNN L + A+A+Y PY
Sbjct  1     MESYLRKWCLVSVLVLVLGLGFKIKAEPQVPCYFIFGDSLVDNGNNNRLVSIARADYYPY  60

Query  238   GIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDE  417
             GID    PTGRFSNGK   D +AE LGF++ IP Y+ V+  E +L+GVNYAS A GI +E
Sbjct  61    GIDLGR-PTGRFSNGKTTVDEIAELLGFDNYIPAYTDVSG-EQILQGVNYASAAAGIREE  118

Query  418   SGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMP  597
             +G  +G+ ++   Q+ N+  T++++   +     A  YL +C YSVG+G+NDY+NNY MP
Sbjct  119   TGQQLGQRVTFSGQVQNYKTTVSQVVELLGDENTAADYLKRCIYSVGLGSNDYLNNYFMP  178

Query  598   QKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSL  777
             Q Y +SR YTP+Q+A+ L  ++  QL  L+  GARK A+ G G +GC P  +        
Sbjct  179   QFYSTSRQYTPEQYADDLINRYSDQLNALYNYGARKFALVGVGAIGCSPNALAQGSLDGT  238

Query  778   SCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKA  948
             +CV+  NSA ++FNDR+K ++  LN     AKF  IN   +    + +PS  G    N A
Sbjct  239   TCVERYNSANRIFNDRLKSMVQQLNNDHPDAKFTYINAYGVFQDIIANPSAYGFRVTNAA  298

Query  949   CCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDI  1128
             CC V +   +  C  GQ PC NR+E++FWD FH T+  N   A RS+ A   +D YP+DI
Sbjct  299   CCGVGRNGGQLTCLPGQAPCPNRDEFVFWDAFHPTDAANTIIAQRSFNAQSSSDVYPIDI  358

Query  1129  SSLLQL  1146
             S+L QL
Sbjct  359   STLAQL  364



>emb|CDO96915.1| unnamed protein product [Coffea canephora]
Length=369

 Score =   322 bits (826),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 165/358 (46%), Positives = 229/358 (64%), Gaps = 4/358 (1%)
 Frame = +1

Query  82    FAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGP  261
             F +  LLL+      +  EPQVPCYFIFGDSLVDNGNNNN+++ AKANYLPYG+D+P GP
Sbjct  13    FLVGCLLLVLNLDNGVYGEPQVPCYFIFGDSLVDNGNNNNINSLAKANYLPYGVDYPGGP  72

Query  262   TGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEV  441
             +GRFSNGK   D +AE LGF   IPPY+ V+  E +LKGVNYAS A GI +E+G  +G  
Sbjct  73    SGRFSNGKTTVDVIAELLGFEGPIPPYAEVSGQE-ILKGVNYASAAAGIREETGQQLGAR  131

Query  442   ISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRL  621
             IS   Q+ N+  T+++I   +    +   YL+KC YS+G+G+NDY+NNY MP  Y SSR 
Sbjct  132   ISFTAQVNNYKNTVSQIVNILGDENSTADYLSKCIYSIGVGSNDYLNNYFMPLYYSSSRQ  191

Query  622   YTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINS  801
             ++P+Q++++L +++  Q++ L+  GARK A+ G G +GC P  +  +     +CV  INS
Sbjct  192   FSPEQYSQVLIEQYTEQIRTLYDFGARKFALIGVGQIGCSPNALAQNSPDGTACVQRINS  251

Query  802   AVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTK  972
             A Q+FN+ ++ ++D  N     AKF  IN   +    + +PS  G    N  CC V +  
Sbjct  252   ANQIFNNGLRGLVDQFNNDRSDAKFAYINAFGIFQDLINNPSAFGFRVTNAGCCGVGRNN  311

Query  973   AKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
              +  C   Q PC+NR+EY+FWD FH +E  N+    RSY A   +DAYP+DIS L QL
Sbjct  312   GQITCLPFQTPCANRDEYLFWDAFHPSEAANIIVGRRSYRAEKQSDAYPVDISRLAQL  369



>ref|XP_003569805.1| PREDICTED: GDSL esterase/lipase At1g29660-like [Brachypodium 
distachyon]
Length=362

 Score =   322 bits (825),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 154/339 (45%), Positives = 219/339 (65%), Gaps = 5/339 (1%)
 Frame = +1

Query  139   PQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNLADYLAEFLG  318
             PQVPCYF+FGDSLVDNGNNN++++ A+ANY PYGIDFP G TGRFSNG    D ++  LG
Sbjct  26    PQVPCYFVFGDSLVDNGNNNDIASLARANYPPYGIDFPGGATGRFSNGLTTVDAISRLLG  85

Query  319   FNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNHGLTLARIAL  498
             F+  IP Y+     + LL GVN+AS A GI DE+G  +G+ IS   QL N+   + ++  
Sbjct  86    FDDYIPAYAGANNDQ-LLTGVNFASAAAGIRDETGQQLGQRISFGGQLQNYQAAVQQLVS  144

Query  499   YMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAKKHYVQLK  678
              +    +A  +L++C ++VGMG+NDY+NNY MP  Y SSR YTP+Q+A++L  ++  QL 
Sbjct  145   ILGDEDSAANHLSQCIFTVGMGSNDYLNNYFMPAVYSSSRQYTPEQYADVLINQYSQQLT  204

Query  679   KLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMFNDRMKPIIDDLNGS  858
              L+  GARKVA+ G G +GC P E+    +  ++CVD INSA+++FN ++  +++  NG 
Sbjct  205   TLYNNGARKVALMGVGQVGCSPNELAQQSDNGVTCVDRINSAIEIFNQKLVDLVNQFNGQ  264

Query  859   LKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQVPCSNRNEYM  1029
               GA F  IN   +    L  P   G+   NK CC V +   +  C   Q PC+NR++Y+
Sbjct  265   -PGAHFTYINAYGIFQDILRAPGAHGLTVTNKGCCGVGRNNGQVTCLPFQTPCANRDQYL  323

Query  1030  FWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             FWD FH TE  N+    R+Y+A LP+D +P+D+ +L QL
Sbjct  324   FWDAFHPTEAANILVGRRAYSAALPSDVHPVDLRTLAQL  362



>ref|XP_003629878.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AET04354.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=351

 Score =   322 bits (824),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 168/365 (46%), Positives = 231/365 (63%), Gaps = 16/365 (4%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLKP--LVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYL  231
             M    K+W     ++  F S     +V +PQVPC FIFGDSL D+GNNNNL+T+AK NY 
Sbjct  1     MDHKTKLW-----MVFFFFSSATYCVVGKPQVPCLFIFGDSLSDSGNNNNLATDAKVNYR  55

Query  232   PYGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGIL  411
             PYGIDFP GPTGRF+NG+   D + E LGF+  IPPY A T    +++GVNYASGA GI 
Sbjct  56    PYGIDFPAGPTGRFTNGRTSIDIITELLGFDHFIPPY-ANTHGADIVQGVNYASGAAGIR  114

Query  412   DESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYL  591
             +E+GT +G  ISM  QL +H   +++IA  + GY   + +LNKC Y V +G+ND++NNY 
Sbjct  115   NETGTQLGPNISMGLQLQHHTDIVSQIAKKL-GYDKVQQHLNKCLYYVNIGSNDFLNNYF  173

Query  592   MPQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNG  771
             +PQ YP+   YT DQ+A  L ++    LK +H LGARK ++ G  +LGC+P E+ THG  
Sbjct  174   LPQHYPTKGKYTTDQYAAALVQELSTYLKAIHGLGARKFSLVGLSLLGCVPHEISTHGKN  233

Query  772   SLSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKAC  951
                C+   N+A  +FND++KP++D LN  L  +KFI IN   + L   S + + ++ K C
Sbjct  234   DSRCIQEENNAALLFNDKLKPLVDHLNKELTDSKFIFINSAVIRL---SQLKLQDLVK-C  289

Query  952   CQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDIS  1131
             C+V    + GQC     PC  RN + F+D FH TE+ N  +A  +Y A  P+ AYPMDI 
Sbjct  290   CKVG---SNGQCIPNTKPCKARNLHPFFDAFHPTEVVNKLSANLAYNAPAPSFAYPMDIG  346

Query  1132  SLLQL  1146
              L++L
Sbjct  347   RLVKL  351



>dbj|BAJ85694.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=365

 Score =   321 bits (823),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 157/340 (46%), Positives = 215/340 (63%), Gaps = 4/340 (1%)
 Frame = +1

Query  136   EPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNLADYLAEFL  315
             EPQVPCYF+FGDSLVDNGNNN + + A+ANY PYG+DF  GPTGRFSNG    D +++ L
Sbjct  27    EPQVPCYFVFGDSLVDNGNNNGIVSLARANYPPYGVDFAGGPTGRFSNGLTTVDVISQLL  86

Query  316   GFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNHGLTLARIA  495
             GF+  IPP++  T+ + LL GVN+AS A GI +E+G  +G  IS   Q+ N+   + ++ 
Sbjct  87    GFDDFIPPFAGATSDQ-LLTGVNFASAAAGIREETGQQLGGRISFSGQVQNYQSAVEQLV  145

Query  496   LYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAKKHYVQL  675
               M    AA   L++C ++VGMG+NDY+NNY MP  Y +   YTP Q+A+ LA ++   L
Sbjct  146   SIMGDEGAAANRLSQCIFTVGMGSNDYLNNYFMPAFYDTGSRYTPTQYADDLAARYTPLL  205

Query  676   KKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMFNDRMKPIIDDLNG  855
             + L++ GARKVA+ G G +GC P E+ T     ++CVD IN AV+MFN R+  ++D  N 
Sbjct  206   RALYSYGARKVALIGVGQVGCSPNELATQSANGVACVDRINVAVRMFNQRLVGMVDQFNR  265

Query  856   SLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQVPCSNRNEY  1026
              L GA F  IN+  +    L  P   G+   N+ CC V +   +  C   Q PC NRNEY
Sbjct  266   LLPGAHFTYINIDGIFSDILRAPGGHGLRVTNRGCCGVGRNNGQVTCLPFQTPCPNRNEY  325

Query  1027  MFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             +FWD FH TE  N+    R+Y A L +D +P+DIS+L  L
Sbjct  326   LFWDAFHPTEAANVLVGQRAYAARLASDVHPVDISTLAHL  365



>ref|XP_003546057.1| PREDICTED: GDSL esterase/lipase At1g29670 [Glycine max]
 gb|KHN06933.1| GDSL esterase/lipase [Glycine soja]
Length=364

 Score =   321 bits (822),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 159/338 (47%), Positives = 213/338 (63%), Gaps = 4/338 (1%)
 Frame = +1

Query  142   QVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNLADYLAEFLGF  321
             QVPCYFIFGDSLVDNGNNN L++ AKANYLPYGIDF  GPTGRFSNGK   D +AE LGF
Sbjct  28    QVPCYFIFGDSLVDNGNNNQLNSLAKANYLPYGIDFAGGPTGRFSNGKTTVDVVAELLGF  87

Query  322   NSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNHGLTLARIALY  501
             N  I PY+     + +L GVNYAS A GI +E+G  +G  IS   Q+ N+  T++++   
Sbjct  88    NGYIRPYARARGRD-ILSGVNYASAAAGIREETGQQLGGRISFRGQVQNYQRTVSQMVNL  146

Query  502   MKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAKKHYVQLKK  681
             +        YL+KC YS+GMG+NDY+NNY MP  Y SSR +TP Q+A++L + +  QL+ 
Sbjct  147   LGDENTTANYLSKCIYSIGMGSNDYLNNYFMPLIYSSSRQFTPQQYADVLVQAYAQQLRI  206

Query  682   LHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMFNDRMKPIIDDLNGSL  861
             L+  GARK+A+FG G +GC P  +  +     +CV  INSA Q+FN+ ++ ++D LN  +
Sbjct  207   LYKYGARKMALFGVGQIGCSPNALAQNSPDGRTCVARINSANQLFNNGLRSLVDQLNNQV  266

Query  862   KGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQVPCSNRNEYMF  1032
               A+FI IN+  +    L +PS  G    N  CC V +   +  C   Q PC  R  ++F
Sbjct  267   PDARFIYINVYGIFQDILSNPSSYGFRVTNAGCCGVGRNNGQVTCLPLQTPCRTRGAFLF  326

Query  1033  WDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             WD FH TE  N     R+Y A   +DAYP+DI+ L Q+
Sbjct  327   WDAFHPTEAANTIIGRRAYNAQSASDAYPVDINRLAQI  364



>ref|XP_008225405.1| PREDICTED: GDSL esterase/lipase At5g45670-like [Prunus mume]
Length=364

 Score =   321 bits (822),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 163/364 (45%), Positives = 229/364 (63%), Gaps = 9/364 (2%)
 Frame = +1

Query  73    KVWFAIATLLLMFLSLKPLV---AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGI  243
             K+W A+  ++++ L+L   +   A PQVPCYFIFGDSLVDNGNNN L + A+A+YLPYGI
Sbjct  4     KMW-AVCMVVVLALNLWCNIGARAAPQVPCYFIFGDSLVDNGNNNQLQSLARADYLPYGI  62

Query  244   DFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESG  423
             DF  GPTGRFSNGK   D +AE LGF+  IPPY A    + +LKGVN+AS A GI +E+G
Sbjct  63    DF-GGPTGRFSNGKTTVDVVAELLGFDDYIPPY-ATARGQDILKGVNFASAAAGIREETG  120

Query  424   THMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQK  603
               +G  I+   Q+ N+   ++++  ++     A  YL KC YSVG+G+NDY+NNY MPQ 
Sbjct  121   RQLGGRITFSGQVKNYQNVVSQVVNFLGDEDQAANYLGKCIYSVGLGSNDYLNNYFMPQF  180

Query  604   YPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSC  783
             Y +   +TP+++A  L + +  QL+ L+  GARK+ +FG G +GC P E+  +     SC
Sbjct  181   YSTGNQFTPEEYATSLIQDYSQQLRILYNYGARKIVLFGIGQIGCSPNELAQNSPDGASC  240

Query  784   VDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKACC  954
             V+ INSA Q+FN ++K + ++ N +L  A+ I ++   +    +  P+  G    N  CC
Sbjct  241   VEKINSANQIFNSKLKALANEFNTNLSDARVIFVDSYGIFQDIITSPAQYGFRVTNAGCC  300

Query  955   QVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISS  1134
              V +   +  C   Q PC NRNEY+FWD FH TE GN   A R+Y+A   +DAYP+DI  
Sbjct  301   GVGRNNGQITCLPLQTPCQNRNEYLFWDAFHPTEAGNNVVARRAYSAVRASDAYPVDIRR  360

Query  1135  LLQL  1146
             L  L
Sbjct  361   LALL  364



>gb|EYU28139.1| hypothetical protein MIMGU_mgv1a008961mg [Erythranthe guttata]
Length=357

 Score =   320 bits (820),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 174/360 (48%), Positives = 226/360 (63%), Gaps = 10/360 (3%)
 Frame = +1

Query  64    SGVKVWFAIATLLLMFLSL-KPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYG  240
             S + +W+ +A ++++  S  + +V EP+VPC FIFGDSLVDNGNNN   T AK NY PYG
Sbjct  4     SRLNLWYLLACVVIILQSHHRMVVGEPKVPCLFIFGDSLVDNGNNNYRETTAKVNYEPYG  63

Query  241   IDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDES  420
             +DFP GPTGRF+NG+N  D +AE LGF+  IPPY A  T + +L GVNY SG  GIL ES
Sbjct  64    VDFPAGPTGRFTNGRNTIDIIAEMLGFDEYIPPY-ATATNQNILGGVNYGSGGAGILYES  122

Query  421   GTHM-GEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMP  597
             G  + G+VIS D+QL NH  T++RIA  + G  AA+ +L  C YSVG+GNNDY+ NYL P
Sbjct  123   GRQLYGDVISFDEQLSNHEATISRIAKLVGGKSAAKKHLKSCLYSVGLGNNDYLANYL-P  181

Query  598   QKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSL  777
             + Y S+   T   FA LL  K+  QL KL+  GAR V VF PG LGC+P+++ T+G+   
Sbjct  182   KYYASTAKQTSQTFAALLIAKYTKQLIKLYKTGARNVVVFAPGKLGCVPQQISTYGSSDG  241

Query  778   S-CVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACC  954
             S C ++ N  VQ+F D +K +ID LN  L GAKFI  + ++      S   I    + CC
Sbjct  242   SFCFETSNEIVQIFADGVKLLIDSLNKLLPGAKFIHTDTSTAT----SYGNITVATEPCC  297

Query  955   QVSKTKA-KGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDIS  1131
               S   +  G C  G V CSNR+EY+FWD FH TE  NL +A   Y    P  A P+  S
Sbjct  298   PTSTDVSNSGHCIRGSVVCSNRDEYLFWDAFHPTEAANLISAKIVYDDIYPLFADPIAAS  357



>ref|XP_009392443.1| PREDICTED: GDSL esterase/lipase At5g45670-like [Musa acuminata 
subsp. malaccensis]
Length=366

 Score =   320 bits (821),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 161/362 (44%), Positives = 222/362 (61%), Gaps = 10/362 (3%)
 Frame = +1

Query  70    VKVWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDF  249
             V  W     LLL+F +   +   PQVPCYFIFGDSLVDNGNNNN+++ A ANY PYGIDF
Sbjct  12    VTCW-----LLLLFSAFGSVRPAPQVPCYFIFGDSLVDNGNNNNMASLAVANYPPYGIDF  66

Query  250   PDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTH  429
             P GP+GRFSNG    D +A  LGF   IPPY A T  + LL GVN+AS A GI +E+G  
Sbjct  67    PGGPSGRFSNGLTTVDAIAALLGFEDFIPPY-ANTRGQALLSGVNFASAAAGIREETGRQ  125

Query  430   MGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYP  609
             +G       QL N+   + ++   +     A  YL KC +SVGMG+NDY+NNY MP  YP
Sbjct  126   LGGRTPFSGQLQNYQQAVQQMVNILGDEDTAANYLRKCIFSVGMGSNDYLNNYFMPAFYP  185

Query  610   SSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVD  789
             + + YTP+++A+ L  ++  QLK L+  GARKVA+ G G +GC P E+       ++CV+
Sbjct  186   TGQQYTPEEYADDLIAQYARQLKVLYNYGARKVALIGVGRVGCSPNELAQRSPNGITCVE  245

Query  790   SINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQV  960
              I+SA+++FN ++  ++D+ N +L GA F  IN   +    L   +  G+   N+ CC V
Sbjct  246   EIDSAIRIFNSKLMRLVDEFN-TLDGAHFTYINGYGIFDDILKHSAAYGLRVTNRGCCGV  304

Query  961   SKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLL  1140
              +   +  C   Q PC +RN Y+FWD FH +E  N+    RSY+A  P+D YPMDI +L 
Sbjct  305   GRNNGQITCLPYQAPCPDRNRYLFWDAFHPSEAANIIVGKRSYSAQSPSDVYPMDIRTLA  364

Query  1141  QL  1146
             ++
Sbjct  365   RI  366



>ref|XP_011035467.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Populus euphratica]
Length=367

 Score =   320 bits (820),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 163/361 (45%), Positives = 219/361 (61%), Gaps = 5/361 (1%)
 Frame = +1

Query  73    KVWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDF-  249
             K W       ++ LS        QVP YFIFGDSLVDNGNNN LS+ A+A+YLPYGIDF 
Sbjct  7     KCWMVGVIFAVVLLSEPYGARAQQVPGYFIFGDSLVDNGNNNQLSSLARADYLPYGIDFR  66

Query  250   PDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTH  429
             P  PTGRFSNGK   D +AE LGF + IPPY A      +L GVNYAS A GI DE+G  
Sbjct  67    PPRPTGRFSNGKTTVDVIAEQLGFRNYIPPY-ATARGRAILGGVNYASAAAGIRDETGRQ  125

Query  430   MGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYP  609
             +G+ IS   Q+ N+  T+++I   +     A  YL++C +S+ +G+NDY+NNY MPQ Y 
Sbjct  126   LGDRISFSGQVRNYQNTVSQIVNILGDEDTAANYLSRCIFSIALGSNDYLNNYFMPQIYS  185

Query  610   SSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVD  789
             SSR YTP+Q+A +L +++  QLK L+  GARK  + G G +GC P ++  +     +CV 
Sbjct  186   SSRQYTPEQYANVLIQQYTDQLKILYNYGARKFVLVGVGQIGCSPSQLAQNSPDGRTCVQ  245

Query  790   SINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQV  960
              INSA Q+FN++++ ++   NG+   A+FI IN   +    +  P+  G    N  CC V
Sbjct  246   KINSANQIFNNKLRSLVAQFNGNTPDARFIYINAYGIFQDIISRPATFGFTVTNAGCCGV  305

Query  961   SKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLL  1140
              +   +  C   Q PC NRN+Y+FWD FH TE  N+    RSY+A   +DAYP DI  L 
Sbjct  306   GRNNGQITCLPLQNPCRNRNQYVFWDAFHPTEAANVIIGRRSYSAQSASDAYPFDIRRLA  365

Query  1141  Q  1143
             Q
Sbjct  366   Q  366



>gb|EYU32864.1| hypothetical protein MIMGU_mgv1a024394mg [Erythranthe guttata]
Length=348

 Score =   319 bits (818),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 164/349 (47%), Positives = 227/349 (65%), Gaps = 6/349 (2%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPY  237
             MA  V+V F I   ++M + +  + A  QVPC+F+FGDSLVDNGNNN L TEAK +YLPY
Sbjct  1     MAFAVRVSFFIVIFVIMQIQVL-ISANHQVPCFFVFGDSLVDNGNNNRLVTEAKVDYLPY  59

Query  238   GIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDE  417
             G+DFP GPTGRF+NG+N AD LA+ LGFNSS+PP+ A      ++KGVNYASG+ GI  E
Sbjct  60    GVDFPQGPTGRFTNGRNTADILAQLLGFNSSVPPF-ATAQGNDVIKGVNYASGSSGIRSE  118

Query  418   SGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMP  597
             +G  +G+ IS+D+QL NH  T + I+  +    +A+ +L+KC Y   +G+NDYINNY MP
Sbjct  119   TGEQLGDRISLDRQLQNHETTFSSISRLLGNDTSAKIHLSKCVYYFVVGSNDYINNYNMP  178

Query  598   QKYPSSRLYTPDQFAELLAKKHYVQLKKLH-ALGARKVAVFGPGVLGCIPEEMETHGNGS  774
             + Y +S  Y P +++ +L +++  QL  L+   GARKV V G G LGC P E+    NG+
Sbjct  179   EYYTTSTKYNPQEYSSILVQQYSQQLNSLYNNFGARKVVVSGVGPLGCTPAEIAKGTNGT  238

Query  775   LSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACC  954
              +C DS+N AV +FND++K +++ LN +L GA+F+      L   D   +GI  V K CC
Sbjct  239   -ACADSVNDAVTLFNDKLKLMVNGLNQNLTGAEFVYNGAMDLRPKDLIALGIRIVGKPCC  297

Query  955   QVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATL  1101
             +VS     GQC +G+ PC  R  + F+DNFH TE+ N   A  +Y   L
Sbjct  298   KVS--SKTGQCIKGEKPCLVRALHAFFDNFHPTEVVNNAVAAATYIQIL  344



>ref|XP_007014320.1| GDSL-like Lipase/Acylhydrolase superfamily protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY31939.1| GDSL-like Lipase/Acylhydrolase superfamily protein, putative 
isoform 1 [Theobroma cacao]
Length=360

 Score =   320 bits (819),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 159/365 (44%), Positives = 231/365 (63%), Gaps = 8/365 (2%)
 Frame = +1

Query  58    MASGVKV-WFAIATLLLMFLSLKPLV-AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYL  231
             MAS +K+ W    + LL+   L     A PQVPCYFIFGDSL DNGNNNNL T AK NYL
Sbjct  1     MASKLKLFWMLPVSFLLLSNCLHNGANAAPQVPCYFIFGDSLSDNGNNNNLKTLAKVNYL  60

Query  232   PYGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGIL  411
             PYGIDFP+GPTGRFSN +N+ D + E+LGF + +PP+ A      +LKGVNYASG+ GI 
Sbjct  61    PYGIDFPEGPTGRFSNDRNMQDVIVEYLGFQNYMPPF-ARAQGRSILKGVNYASGSAGIR  119

Query  412   DESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYL  591
             DESG  +G+ I +++QL NH + ++RI   ++   + R  LN+C YS+ +G+NDYINNY 
Sbjct  120   DESGKQLGDRIPLNEQLKNHKIIISRIRQILRNDTSTRKLLNQCIYSIQIGSNDYINNYF  179

Query  592   MPQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNG  771
             +P+ Y +SR YTP+Q+A +L +++  Q+K L+  GARK A++G G++GC P  +  +G  
Sbjct  180   VPEFYNTSRQYTPEQYAAVLVEQYSHQIKVLYGHGARKFALYGIGLIGCTPYAISVYGTN  239

Query  772   SLSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKAC  951
                CVD +N+   +FN+R+ P++ +LN +L  AKF  +N +       S +     N  C
Sbjct  240   GSPCVDKLNTNATLFNERLMPLVKELNTNLTDAKFTYLNPSPSPQDVLSFV----TNSTC  295

Query  952   CQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDIS  1131
             C+V     +  C     PCS+R+ ++FWD  H T+  N   A  +Y     ++A+P +I 
Sbjct  296   CEVGGGGGE-LCVRNSKPCSDRSRFVFWDAVHPTDAWNELLAESAYRTNSTSEAHPFNIQ  354

Query  1132  SLLQL  1146
             +L +L
Sbjct  355   TLAKL  359



>ref|XP_009594106.1| PREDICTED: GDSL esterase/lipase At1g29670-like isoform X2 [Nicotiana 
tomentosiformis]
Length=312

 Score =   318 bits (814),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 155/284 (55%), Positives = 205/284 (72%), Gaps = 2/284 (1%)
 Frame = +1

Query  292   ADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNH  471
             A + AE LGF+S IPP+      E +LKGVNYASG  GI DE+G   G+  SM++QLVNH
Sbjct  28    AKFKAELLGFDSFIPPFVTARGKE-ILKGVNYASGVAGIRDETGYRWGDRWSMNRQLVNH  86

Query  472   GLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELL  651
              +T++RI   +    +A+  L+KC Y+V MGNNDY+NNYL PQ YP+S LYTPDQFA +L
Sbjct  87    FVTVSRIISILGNVTSAKGLLSKCLYTVDMGNNDYLNNYLQPQFYPTSLLYTPDQFATVL  146

Query  652   AKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMFNDRMK  831
              ++   QL+ L++ GARKVAV   G+LGC+PEE+E  G  +  CVD IN+ VQ+FND++K
Sbjct  147   VQQFSQQLRTLYSYGARKVAVSNIGLLGCLPEELEVFGRNASGCVDFINNYVQLFNDKLK  206

Query  832   PIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQVPCS  1011
              +IDDLN +L  A+FI IN TS++ G PS +G   V+ +CC    T AKGQC +G+VPC+
Sbjct  207   LLIDDLNINLPNARFIYINQTSISSGGPSPVGF-TVDSSCCITLDTIAKGQCRKGEVPCN  265

Query  1012  NRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQ  1143
             NRN+Y+F+DNFH TEI N+ TA RS+ A LP+DAYP DIS L+Q
Sbjct  266   NRNQYIFFDNFHPTEIANIATARRSFNAFLPSDAYPTDISQLVQ  309



>emb|CDM83980.1| unnamed protein product [Triticum aestivum]
Length=362

 Score =   319 bits (817),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 151/341 (44%), Positives = 221/341 (65%), Gaps = 5/341 (1%)
 Frame = +1

Query  133   AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNLADYLAEF  312
             A+PQVPCYF+FGDSLVDNGNNN++++ A+ANY PYGIDFP G TGRFSNG    D ++  
Sbjct  24    ADPQVPCYFVFGDSLVDNGNNNDIASLARANYPPYGIDFPGGATGRFSNGLTTVDAISRL  83

Query  313   LGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNHGLTLARI  492
             LGF+  IP Y+     + LL GVN+AS A GI DE+G  +G+ IS   QL N+   + ++
Sbjct  84    LGFDDYIPAYAGANNDQ-LLSGVNFASAAAGIRDETGQQLGQRISFGGQLQNYQAAVQQL  142

Query  493   ALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAKKHYVQ  672
                +    +A  +L++C ++VGMG+NDY+NNY MP  Y +SR YTP+Q+A++L  ++  Q
Sbjct  143   VSILGDEDSAANHLSQCIFTVGMGSNDYLNNYFMPAVYATSRQYTPEQYADVLVSQYTQQ  202

Query  673   LKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMFNDRMKPIIDDLN  852
             L+ L+  GARKVA+ G G +GC P E+    +  ++CV  IN A+++FN ++  ++D  N
Sbjct  203   LRILYNNGARKVALMGVGQVGCSPNELAQQSSDGVTCVARINGAIEIFNQKLVELVDQFN  262

Query  853   GSLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQVPCSNRNE  1023
              +L GA F  IN   +    +  P   G+  ++K CC V +   +  C   Q PC+NRNE
Sbjct  263   -TLPGAHFTYINAYGIFQDIIRSPGANGLTVLDKGCCGVGRNNGQVTCLPFQTPCANRNE  321

Query  1024  YMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             Y+FWD FH TE  N+    R+Y+A  P+D +P+D+ +L +L
Sbjct  322   YLFWDAFHPTEAANILVGRRAYSAAQPSDVHPVDLQTLARL  362



>ref|XP_006858605.1| hypothetical protein AMTR_s00071p00200630 [Amborella trichopoda]
 gb|ERN20072.1| hypothetical protein AMTR_s00071p00200630 [Amborella trichopoda]
Length=366

 Score =   319 bits (817),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 167/366 (46%), Positives = 227/366 (62%), Gaps = 9/366 (2%)
 Frame = +1

Query  67    GVKVWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGID  246
             G+K +  I    L  +S +   +  +VPC FIFGDSLVDNGNNN++ T A+ANYLPYG+D
Sbjct  2     GLKTFTLIIVSFLGLVSARSR-SRGKVPCMFIFGDSLVDNGNNNDILTLARANYLPYGVD  60

Query  247   FPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGT  426
             FP G TGRF NG+   D+LA FLGF+  IPPY A T+   LL+GVN+ASGA GI DE+G 
Sbjct  61    FPGGVTGRFCNGRTTVDFLAAFLGFSEYIPPY-ATTSGTALLRGVNFASGAAGIRDETGR  119

Query  427   HMGEVISMDQQLVNHGLTLARI-ALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQK  603
             ++GE +SM+QQ+ N   ++  + AL  +   +   YL KC +SVGMG+NDY+NNY MP  
Sbjct  120   NLGEHLSMNQQVANFARSVEEMRALLSRSNISVTAYLRKCIFSVGMGSNDYLNNYFMPDY  179

Query  604   YPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLS-  780
             Y +   YTP ++A  L + +  QL +L+ LGARKVAV G G +GCIP E+    N   + 
Sbjct  180   YNTGSQYTPREYASSLIQDYGRQLMELYELGARKVAVIGVGQIGCIPYELARSTNDDANG  239

Query  781   --CVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNK  945
               CV  IN+A+ +FN  +  ++   N  L GAKF  IN  S     + + S  G   V+K
Sbjct  240   ARCVSRINNAIILFNSGLLSLVKSFNSRLPGAKFTYINSYSSFQHLIANASSYGFTVVDK  299

Query  946   ACCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMD  1125
              CC V +   +  C   Q PCSNR EY+FWD FH TE  N+  A ++Y +   +DAYP++
Sbjct  300   GCCGVGRNNGQVTCLPFQQPCSNRTEYIFWDAFHPTEAANIILAQKAYASKYCSDAYPIN  359

Query  1126  ISSLLQ  1143
             I  L +
Sbjct  360   IRQLAK  365



>ref|XP_011102156.1| PREDICTED: GDSL esterase/lipase At4g18970-like [Sesamum indicum]
Length=357

 Score =   318 bits (816),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 168/349 (48%), Positives = 232/349 (66%), Gaps = 13/349 (4%)
 Frame = +1

Query  88    IATLLLMFL--SLKPLVA-EPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDG  258
             +  L L+F+  +L+ +V  EP+VPC+FIFGDSLVDNGNN N +T  K NY PYGIDFP G
Sbjct  9     VCFLFLLFIASTLQTIVVGEPKVPCFFIFGDSLVDNGNNINRNTTTKVNYFPYGIDFPGG  68

Query  259   PTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGE  438
             PTGRF+NG+N+AD +AE LGF+  I P+ A  T + +L+GVNY SG  GIL+E+G   G+
Sbjct  69    PTGRFNNGRNIADIIAELLGFDKYIAPF-ANATNQDILRGVNYGSGGSGILEETGHLFGD  127

Query  439   VISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSR  618
             VI+  +QL NH + ++R+A  +     A+ +L++C YSVGMGNNDY+ NYL PQ +  + 
Sbjct  128   VINFKEQLSNHEVVISRVARLLGSESVAKQHLSRCIYSVGMGNNDYLANYL-PQYHSKTT  186

Query  619   LYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHG--NGSLSCVDS  792
              YTP QFA L+  ++  QL++L+  GARKVAVF  G LGCIP+++  +G  +GS SCV++
Sbjct  187   PYTPRQFASLVIAQYSKQLRRLYDAGARKVAVFALGKLGCIPQQLAAYGASDGS-SCVET  245

Query  793   INSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACCQVSKTK  972
              N+ V+ FN+ +K +I  LN +L  AKF+    TS      S   I+N+++ CC VS   
Sbjct  246   SNNVVKSFNEYLKILIHYLNSNLADAKFVYTQDTS---DSESYGNISNLSEPCCGVSAE-  301

Query  973   AKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYP  1119
               GQC  G  PCSNR+ Y+FWD FH TE  +L +A  +Y    P  A P
Sbjct  302   -DGQCVAGSAPCSNRDAYLFWDAFHPTEAASLLSAKIAYDHMSPLFAEP  349



>ref|XP_010687162.1| PREDICTED: GDSL esterase/lipase At5g45670 [Beta vulgaris subsp. 
vulgaris]
Length=363

 Score =   319 bits (817),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 156/360 (43%), Positives = 222/360 (62%), Gaps = 5/360 (1%)
 Frame = +1

Query  76    VWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPD  255
             +WF    + L+ L    +  +PQVPCYF+FGDSLVDNGNNNN+++ A+ANYLPYGIDFP 
Sbjct  6     LWFICFAIFLVIL-WGGVNGDPQVPCYFVFGDSLVDNGNNNNIASLARANYLPYGIDFPA  64

Query  256   GPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMG  435
             GPTGRFSNGK   D +AE LGF    P   A  + E +L+GVNYAS A GI +E+G  +G
Sbjct  65    GPTGRFSNGKTTVDVIAEQLGF-EDYPLAYAQASGEDILRGVNYASAAAGIREETGQQLG  123

Query  436   EVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSS  615
               IS   Q+ N+  T++++   +     A  YL++C YS+G+G+NDY+NNY MP  Y +S
Sbjct  124   GRISFGGQVRNYQSTVSQVVQILGDEDQASSYLSRCIYSIGLGSNDYLNNYFMPMYYQTS  183

Query  616   RLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSI  795
             R Y P Q+A++L +++   ++ L+  GARK A+ G G +GC P ++        +C D++
Sbjct  184   RQYNPQQYADVLIQEYSQHIRSLYNYGARKFALIGIGQIGCSPNQLAQRSPDGATCDDTV  243

Query  796   NSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSK  966
             NSA ++FN  ++ ++  LN  L  A+F  IN+  +    + +PS  G    N  CC V +
Sbjct  244   NSANRIFNSGLRSLVQQLNNELSDARFAYINVYDMFQDLIENPSNYGFRVTNAGCCGVGR  303

Query  967   TKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
                +  C   Q PC NR+EY+FWD FH  E  N+    RSY+A   +DAYP DI  L Q+
Sbjct  304   NNGQITCLPLQTPCPNRDEYVFWDAFHPGEAANVIIGRRSYSAQSSSDAYPFDIQRLAQI  363



>ref|XP_004961487.1| PREDICTED: GDSL esterase/lipase At5g45670-like [Setaria italica]
Length=368

 Score =   318 bits (815),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 154/347 (44%), Positives = 218/347 (63%), Gaps = 4/347 (1%)
 Frame = +1

Query  115   SLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNLA  294
             +++P VA PQVPCYFIFGDSLVDNGNNN + + A+ANY PYGIDF  GPTGRFSNG    
Sbjct  23    TVRPAVAAPQVPCYFIFGDSLVDNGNNNFIVSMARANYPPYGIDFAGGPTGRFSNGLTTV  82

Query  295   DYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNHG  474
             D LA+ LGF+  IPP++  ++ + LL GVN+AS A GI +E+G  +G  IS   Q+ N+ 
Sbjct  83    DVLAKLLGFDDFIPPFAGASSQQ-LLTGVNFASAAAGIREETGQQLGGRISFSGQVQNYQ  141

Query  475   LTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLA  654
               +  +   +    +A  +L++C +SVGMG+NDY+NNY MP  Y +   YTP+Q+A+ LA
Sbjct  142   SAVQELISILGDEGSAATHLSRCIFSVGMGSNDYLNNYFMPAFYDTGSRYTPEQYADSLA  201

Query  655   KKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMFNDRMKP  834
               +   L  ++  GARKVAV G G +GC P E+        +CV++IN+A+++FN R+  
Sbjct  202   ADYSRLLMVMYRYGARKVAVIGVGQVGCSPNELAQRSPDGATCVEAINAAIRIFNQRLVG  261

Query  835   IIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQVP  1005
             ++D  N  L GA+F  +N   +    L  P   G+   N  CC V +   +  C   Q+P
Sbjct  262   LVDRFNRQLPGARFTYVNAYGIFDDILRSPGAHGLRVTNAGCCGVGRNNGQVTCLPFQMP  321

Query  1006  CSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             C+NR+EY+FWD FH TE  N+    R+Y A L +D +P DI +L +L
Sbjct  322   CANRHEYLFWDAFHPTEAANVLVGQRTYAARLASDVHPYDIRTLARL  368



>ref|XP_011046354.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Populus euphratica]
Length=358

 Score =   318 bits (814),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 171/366 (47%), Positives = 229/366 (63%), Gaps = 9/366 (2%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLKPLV-AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLP  234
             MA  +KVW  +  LL +   L+    A PQVPC++IFGDSL D+GNNN+L T +KANY P
Sbjct  1     MAYKIKVWCLLLVLLKLESILQNCANAAPQVPCFYIFGDSLPDSGNNNHLVTTSKANYRP  60

Query  235   YGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILD  414
             +GIDFP+G TGRF+NG+   D + E LGF+  IPP+        +L GVNYASG   I D
Sbjct  61    HGIDFPNGTTGRFTNGRTTVDIIGELLGFDKFIPPF-VTARGRDILVGVNYASG---IRD  116

Query  415   ESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLM  594
             ESG  +G+ IS+++QL NH  T  R+   +   +AA  YLNKC Y V +G NDYINNY +
Sbjct  117   ESGRELGDRISLNEQLQNHAATFNRLIQLLGTKQAATNYLNKCLYYVSLGTNDYINNYFV  176

Query  595   PQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGS  774
             P  Y +SRLYTPDQ+A++L  ++  Q+K L+  GARK+A+ G   LG IP    T  + +
Sbjct  177   PGNYITSRLYTPDQYAKVLIDQYSQQIKCLYLFGARKIALPGLVPLGSIPCASSTLCHNN  236

Query  775   LSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACC  954
             LSCV +IN+AV  FN  +  ++  LN  L   +FI +N++ ++  DPS+ G    N  CC
Sbjct  237   LSCVANINNAVLPFNAGLFSLVHQLNKELNDTRFIYLNVSGMSSSDPSVHGFRVTNVGCC  296

Query  955   QVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISS  1134
              V  +     C     PC NR EY+FWD  H TE  N  TA RSY+A LP+DAYP DIS 
Sbjct  297   PVLGSA----CILDSTPCVNRTEYVFWDAIHPTESSNQFTARRSYSAFLPSDAYPYDISH  352

Query  1135  LLQLNL  1152
             L+ + +
Sbjct  353   LVNMQI  358



>ref|XP_002305046.1| GDSL-motif lipase/hydrolase family protein [Populus trichocarpa]
 gb|EEE85557.1| GDSL-motif lipase/hydrolase family protein [Populus trichocarpa]
Length=367

 Score =   318 bits (814),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 161/361 (45%), Positives = 219/361 (61%), Gaps = 5/361 (1%)
 Frame = +1

Query  73    KVWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDF-  249
             K W       ++ LS        QVP YFIFGDSLVDNGNNN LS+ A+A+YLPYGIDF 
Sbjct  7     KCWVVGVIFAVVLLSEPYGARAQQVPGYFIFGDSLVDNGNNNQLSSLARADYLPYGIDFR  66

Query  250   PDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTH  429
             P  PTGRF NG+   D +AE LGF + IPPY A      +L GVNYAS A GI DE+G  
Sbjct  67    PPRPTGRFCNGRTTVDVIAEQLGFRNYIPPY-ATARGRAILGGVNYASAAAGIRDETGQQ  125

Query  430   MGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYP  609
             +G+ IS   Q+ N+  T+++I   +     A  YL++C +S+G+G+NDY+NNY MPQ Y 
Sbjct  126   LGDRISFSGQVRNYQNTVSQIVNILGDEDTAANYLSRCIFSIGLGSNDYLNNYFMPQIYS  185

Query  610   SSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVD  789
             SSR YTP+Q+A +L +++  QLK L+  GARK  + G G +GC P ++  +     +CV 
Sbjct  186   SSRQYTPEQYANVLIQQYTDQLKILYNYGARKFVLIGVGQIGCSPSQLAQNSPDGRTCVQ  245

Query  790   SINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQV  960
              INSA Q+FN++++ ++   NG+   A+FI IN   +    +  P+  G    N  CC V
Sbjct  246   KINSANQIFNNKLRSLVAQFNGNTPDARFIYINAYGIFQDIINRPATFGFTVTNAGCCGV  305

Query  961   SKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLL  1140
              +   +  C   Q PC NR++Y+FWD FH TE  N+    RSY+A   +DAYP DI  L 
Sbjct  306   GRNNGQITCLPLQNPCRNRDQYVFWDAFHPTEAANVIIGRRSYSAQSASDAYPFDIRRLA  365

Query  1141  Q  1143
             Q
Sbjct  366   Q  366



>ref|XP_008441774.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Cucumis melo]
Length=367

 Score =   318 bits (814),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 167/365 (46%), Positives = 225/365 (62%), Gaps = 12/365 (3%)
 Frame = +1

Query  76    VWFAIATLLLMFLSLK---PLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGID  246
             +W++I   +++ LSL+    +  EP+ PCYFIFGDSL DNGNNNNL T AKANY+PYGID
Sbjct  7     IWYSIVVYVIV-LSLEGKSRVFGEPRAPCYFIFGDSLSDNGNNNNLVTRAKANYIPYGID  65

Query  247   FPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEG--LLKGVNYASGAGGILDES  420
             FP+G TGRFSNG N+ D++AE L F++ IPP+     T G  + +GVNYASGA GI  E+
Sbjct  66    FPEGTTGRFSNGGNVVDFIAEKLNFSNYIPPF---MNTRGFNIAQGVNYASGAAGIRKET  122

Query  421   GTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARY-YLNKCFYSVGMGNNDYINNYLMP  597
             G   G+VISMD+QL NH L + +I   M+   +A   YL +C Y V +G+NDY+NNY +P
Sbjct  123   GRAQGQVISMDEQLRNHNLIIRQIRQSMRNNDSATMTYLKQCLYMVEIGSNDYLNNYYVP  182

Query  598   QKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSL  777
               YP+S L++  ++A +L ++   QLK L+  GARK+A FG G+LGC P    T      
Sbjct  183   SFYPTSSLFSTQEYANVLIQQLSSQLKSLYGKGARKIATFGVGLLGCTPYARATFETNGS  242

Query  778   SCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACCQ  957
              CVD+IN A Q FN  +K ++D LN     AKF +I++  ++   P   G    +  CC+
Sbjct  243   PCVDNINDATQQFNIGLKSLVDQLNSRYNDAKFTMIDVAQISTVQPPNQGQIISDVPCCE  302

Query  958   VSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSL  1137
             V       QC      C NR+ Y+F+D  H T  G  G A RS+ A  P D YP DI  L
Sbjct  303   VQSDNV--QCVPFGRVCGNRSGYLFYDGVHPTAFGYEGLANRSFIAQFPNDTYPCDIQQL  360

Query  1138  LQLNL  1152
             +QL L
Sbjct  361   VQLKL  365



>ref|XP_002456353.1| hypothetical protein SORBIDRAFT_03g034560 [Sorghum bicolor]
 gb|EES01473.1| hypothetical protein SORBIDRAFT_03g034560 [Sorghum bicolor]
Length=370

 Score =   318 bits (814),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 158/372 (42%), Positives = 227/372 (61%), Gaps = 11/372 (3%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLKPLVA------EPQVPCYFIFGDSLVDNGNNNNLSTEAK  219
             M      W   A +LL+  +    VA      EPQVPCYF+FGDSLVDNGNNN++++ A+
Sbjct  1     MGRATMRWPQPALMLLVVAARLATVAVVVVRGEPQVPCYFVFGDSLVDNGNNNDIASLAR  60

Query  220   ANYLPYGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGA  399
             ANY PYGIDF  G TGRFSNG    D ++  LGF+  IP Y+  +  + LL GVN+AS A
Sbjct  61    ANYPPYGIDFAGGATGRFSNGLTTVDAISRLLGFDDYIPAYAGASGDQ-LLTGVNFASAA  119

Query  400   GGILDESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYI  579
              GI DE+G  +G+ IS   QL N+   + ++   +    +A  +L++C ++VGMG+NDY+
Sbjct  120   AGIRDETGQQLGQRISFGGQLQNYQAAVQQLVSILGDEDSAANHLSQCIFTVGMGSNDYL  179

Query  580   NNYLMPQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMET  759
             NNY MP  Y +S+ YTP Q+A++L  ++  Q++ L+  GARKVA+ G G +GC P E+  
Sbjct  180   NNYFMPAVYSTSQQYTPAQYADVLIDQYSQQVRTLYNYGARKVALMGVGQVGCSPNELAQ  239

Query  760   HGNGSLSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGI  930
             H     +CV  IN A+ +FN ++  ++D  N +L GA F  IN+  +    L  P   G+
Sbjct  240   HSADGATCVPEINGAIDIFNRKLVALVDQFN-ALPGAHFTYINVYGIFEDILRAPGSHGL  298

Query  931   NNVNKACCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTD  1110
                N+ CC V +   +  C   Q PC+NRNEY+FWD FH TE  N+    R+Y+A  P+D
Sbjct  299   TVTNRGCCGVGRNNGQVTCLPFQTPCANRNEYLFWDAFHPTEAANVLVGRRAYSAAQPSD  358

Query  1111  AYPMDISSLLQL  1146
              +P+D+ +L QL
Sbjct  359   VHPVDLRTLAQL  370



>ref|XP_010522212.1| PREDICTED: GDSL esterase/lipase At1g29660-like [Tarenaya hassleriana]
Length=364

 Score =   317 bits (813),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 161/338 (48%), Positives = 208/338 (62%), Gaps = 4/338 (1%)
 Frame = +1

Query  142   QVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNLADYLAEFLGF  321
             QVPC F FGDSL DNGNNN L T A+ANYLPYGIDFP GPTGRFSNGKN  D++AE LGF
Sbjct  28    QVPCLFAFGDSLSDNGNNNRLPTLARANYLPYGIDFPGGPTGRFSNGKNFVDFMAELLGF  87

Query  322   NSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNHGLTLARIALY  501
                IPPYS     E +L G+NYASG+ GI +ESG  +GE I+  +Q+ NH   ++ +   
Sbjct  88    GHYIPPYSEAKGEE-MLSGLNYASGSAGIREESGQQLGERITFGRQVQNHKKVVSLVVDL  146

Query  502   MKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAKKHYVQLKK  681
             + G  AA  +L KC YS+ +G+NDYINNY MP  YP+SRLYTP+Q+A+ L   +  QL  
Sbjct  147   IGGEEAAANHLKKCIYSITIGSNDYINNYFMPDAYPTSRLYTPEQYADGLIDLYGQQLNL  206

Query  682   LHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMFNDRMKPIIDDLNGSL  861
             L+  GARK  + G G  GC P  +        +CV S NS + +FND++K +ID LN   
Sbjct  207   LYNYGARKFLLSGLGTTGCAPNALARASPDGKTCVRSFNSVIGVFNDKLKSLIDRLNNHF  266

Query  862   KGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQVPCSNRNEYMF  1032
               AKF+  N   +    L + S  G     +ACC   +      C  G+  C NRNE++F
Sbjct  267   SHAKFVYGNTYDIFQDLLNNSSAYGFKVTKEACCGGGRNHGAMMCMPGERSCPNRNEFVF  326

Query  1033  WDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             WD++H TE      A R Y +  P+D YP+DIS+L QL
Sbjct  327   WDSYHPTEATIRIVAQRLYRSRSPSDIYPIDISTLAQL  364



>ref|XP_007211471.1| hypothetical protein PRUPE_ppa007546mg [Prunus persica]
 gb|EMJ12670.1| hypothetical protein PRUPE_ppa007546mg [Prunus persica]
Length=364

 Score =   317 bits (812),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 158/341 (46%), Positives = 215/341 (63%), Gaps = 5/341 (1%)
 Frame = +1

Query  133   AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNLADYLAEF  312
             A PQVPCYFIFGDSLVDNGNNN L + A+A+YLPYGIDF  GPTGRFSNGK   D +AE 
Sbjct  26    AAPQVPCYFIFGDSLVDNGNNNQLQSLARADYLPYGIDF-GGPTGRFSNGKTTVDVVAEL  84

Query  313   LGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNHGLTLARI  492
             LGF+  IPPY A    + +LKGVN+AS A GI +E+G  +G  I+   Q+ N+   ++++
Sbjct  85    LGFDDYIPPY-ATARGQDILKGVNFASAAAGIREETGRQLGGRITFSGQVKNYQNVVSQV  143

Query  493   ALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAKKHYVQ  672
                +     A  YL KC YSVG+G+NDY+NNY MPQ Y +   +T +++A  L + +  Q
Sbjct  144   VNLLGDEDQAANYLGKCIYSVGLGSNDYLNNYFMPQFYSTGNQFTTEEYATSLIQDYSQQ  203

Query  673   LKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMFNDRMKPIIDDLN  852
             L+ L+  GARK+ +FG G +GC P E+  +     SCV+ INSA Q+FN ++K + ++ N
Sbjct  204   LRILYNYGARKIVLFGIGQIGCSPNELAQNSPDGASCVEKINSANQIFNSKLKALANEFN  263

Query  853   GSLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQVPCSNRNE  1023
              +L  A+ I ++   +    +  P+  G    N  CC V +   +  C   Q PC NRNE
Sbjct  264   TNLSDARVIFVDSYGIFQDIITSPAQYGFRVTNAGCCGVGRNNGQITCLPLQTPCQNRNE  323

Query  1024  YMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             Y+FWD FH TE GN   A R+Y+A  P+DAYP+DI  L  L
Sbjct  324   YLFWDAFHPTEAGNNVVARRAYSAVRPSDAYPVDIRRLALL  364



>gb|KDP25050.1| hypothetical protein JCGZ_22585 [Jatropha curcas]
Length=363

 Score =   316 bits (809),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 161/360 (45%), Positives = 229/360 (64%), Gaps = 8/360 (2%)
 Frame = +1

Query  82    FAIATLLL-MFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDG  258
             FA+  +L+ + L +     EPQVPCYFIFG S  DNGNNN L + AKAN+LPYGID+P G
Sbjct  4     FALYVVLVALHLPIWFCDGEPQVPCYFIFGASYYDNGNNNRLLSAAKANFLPYGIDYPRG  63

Query  259   PTGRFSNGKNLADYLAEFLGFNSSIPPYSAV--TTTEGLLKGVNYASGAGGILDESGTHM  432
             PTGRF+NG+  AD+LAE+LGF + IP ++++    +  +LKGVNYASG+ GIL+E+G H+
Sbjct  64    PTGRFTNGRTTADFLAEYLGFENDIPSFASIGIRNSNDILKGVNYASGSSGILEETGKHV  123

Query  433   GEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPS  612
             G+   MD QL NH   ++RIA  +    AA  +L+KC YSV MG+NDYINNY     Y +
Sbjct  124   GDRTGMDGQLNNHRSIISRIAETLGDKTAAENHLHKCLYSVAMGDNDYINNYFKKLLYDT  183

Query  613   SRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEM-ETHGNGSLSCVD  789
             S  Y+P+++A LL +K+  QL  L+  GARK+ VFG   L C P  + E  G     CV 
Sbjct  184   SSKYSPEKYAHLLLEKYNQQLVSLYNDGARKIVVFGIPPLDCSPAALSEESGKSKSGCVG  243

Query  790   SINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACCQVSKT  969
                 A+ +FN  ++ +++D+N +L  +KF+L+++  ++    S + + +    CC+V  +
Sbjct  244   ERTHAINLFNSGLREMVEDINKNLTDSKFVLVDVYGISRSSLSSLKVTDA--PCCKVETS  301

Query  970   KAKG--QCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQ  1143
                    C  G +PC+NRN+YM+WD  H TE      A RSY +  PTDA+PMDIS L+Q
Sbjct  302   IGIKFPMCIPGSIPCANRNDYMWWDQLHQTEAAYKIFADRSYKSQAPTDAFPMDISRLVQ  361



>ref|XP_003566036.1| PREDICTED: GDSL esterase/lipase At5g45670-like [Brachypodium 
distachyon]
Length=364

 Score =   314 bits (805),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 156/364 (43%), Positives = 227/364 (62%), Gaps = 8/364 (2%)
 Frame = +1

Query  73    KVWFAIATLL---LMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGI  243
             +VW ++  LL   ++  + +   A PQVPCYF+FGDSLVDNGNNN + + A+ANY PYGI
Sbjct  3     RVWRSLIVLLVAAMVGTAARTAGAAPQVPCYFVFGDSLVDNGNNNVIVSMARANYPPYGI  62

Query  244   DFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESG  423
             DF  GPTGRFSNG    D ++  LGF+  IPP++  ++ + LL GVN+AS A GI +E+G
Sbjct  63    DFAGGPTGRFSNGLTTVDVISRLLGFDDFIPPFAGASSDQ-LLTGVNFASAAAGIREETG  121

Query  424   THMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQK  603
               +G  IS   Q+ N+   + ++   +    AA  +L++C ++VGMG+NDY+NNY MP  
Sbjct  122   QQLGGRISFSGQVQNYQSAVQQLVSILGDEDAAAAHLSRCIFTVGMGSNDYLNNYFMPAF  181

Query  604   YPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSC  783
             Y +   YTP Q+A+ LA ++   L+ L+  GARKVA+ G G +GC P E+       ++C
Sbjct  182   YNTGSRYTPQQYADDLAARYTELLRVLYGYGARKVALMGVGQVGCSPNELAQGSANGVAC  241

Query  784   VDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKACC  954
             VD I++AV+MFN R+  I+D  N +L GA F  +N+  +    L  P   G+   N  CC
Sbjct  242   VDRIDTAVRMFNRRLTGIVDQFN-ALPGAHFTYVNIDGIFADILKAPGAHGLKVTNAGCC  300

Query  955   QVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISS  1134
              V +   +  C   Q PC+NR+EY+FWD FH TE  N     R+Y+A LP+D +P+D+ +
Sbjct  301   GVGRNNGQVTCLPFQTPCANRHEYLFWDAFHPTEAANELVGQRAYSARLPSDVHPVDLRT  360

Query  1135  LLQL  1146
             L +L
Sbjct  361   LARL  364



>ref|XP_010687168.1| PREDICTED: GDSL esterase/lipase At4g18970-like [Beta vulgaris 
subsp. vulgaris]
Length=354

 Score =   313 bits (803),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 163/361 (45%), Positives = 231/361 (64%), Gaps = 13/361 (4%)
 Frame = +1

Query  76    VWFAIATLLLMFLSLKPLV-AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFP  252
             +W   A L  + +    LV  E  VPCYFIFGDSL D G NN L T AKANY PYG+DFP
Sbjct  1     MWRISAILFSIIILFFNLVNGEQDVPCYFIFGDSLSDAGINNGLITMAKANYTPYGVDFP  60

Query  253   DG-PTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTT--EGLLKGVNYASGAGGILDESG  423
             +  PTGRF+NG+   D++++FLGF   I PYS+ +T   + +L+GVNYASG+ GIL E+G
Sbjct  61    EKIPTGRFTNGRTAVDFISQFLGFQRFITPYSSDSTQMDQDILRGVNYASGSAGILVETG  120

Query  424   THMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQK  603
             +H+G+ + MD+QL  +G+T++++   ++G  +   YLNKC Y+V +G+NDYINNY MP+ 
Sbjct  121   SHLGDRVWMDRQLQYYGMTISKLQSLIQG--SVDKYLNKCLYTVNIGSNDYINNYFMPEH  178

Query  604   YPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSC  783
             YP+  L+TP Q+AELL  ++  QL+ L++ GARKVAVFG G +GC+P EM    N +  C
Sbjct  179   YPTKTLFTPGQYAELLIGQYKSQLQTLYSSGARKVAVFGLGKIGCVPAEMVM--NNATEC  236

Query  784   VDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACCQVS  963
             V+ IN AV +FN ++  ++D  N    GAKF  IN++++   D  + G       CC   
Sbjct  237   VEEINQAVDLFNTKLVSLVDYFNAKFDGAKFTFINVSAMQSLDRILPGFIT-RSTCC---  292

Query  964   KTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTD-AYPMDISSLL  1140
             K ++  QCE    PC+NRN + F D FH TE+ N   AT ++    P    +PM IS L+
Sbjct  293   KLRSDFQCEPLTPPCTNRNLHAFMDGFHPTEVVNKLVATMAFYTPFPLSLVHPMSISKLI  352

Query  1141  Q  1143
             +
Sbjct  353   R  353



>ref|XP_004504254.1| PREDICTED: GDSL esterase/lipase At4g18970-like [Cicer arietinum]
Length=352

 Score =   311 bits (798),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 162/363 (45%), Positives = 227/363 (63%), Gaps = 11/363 (3%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPY  237
             M    K+W  +  L  +F +   +V  PQVPC FIFGDSL D+GNNNNL+TEAKAN++PY
Sbjct  1     MDRETKLWLVV--LFFLFSATYCVVGVPQVPCLFIFGDSLSDSGNNNNLNTEAKANFMPY  58

Query  238   GIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDE  417
             G+DFP GPTGRF+NG+   D + + LGF+  IPPY+    T+  L GVNYASGA GI +E
Sbjct  59    GVDFPAGPTGRFTNGRTSVDIITQLLGFDHFIPPYANTNGTDIAL-GVNYASGAAGIRNE  117

Query  418   SGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMP  597
             +GTHMGE IS   Q+ +H   ++++   + G    + +LNKC Y V +GNNDY+NNY +P
Sbjct  118   TGTHMGEDISFGLQVQHHRDIVSQLTTKL-GTDKVQQHLNKCLYYVNIGNNDYLNNYFLP  176

Query  598   QKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSL  777
             + YPS+  YT +Q+A  LA ++   +K L+ LGARK ++ G  ++GCIP E+ THG    
Sbjct  177   EHYPSNSNYTTEQYAIALAIEYSTYVKDLYELGARKFSLIGLNLIGCIPYEISTHGKNDS  236

Query  778   SCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACCQ  957
              CV   + A Q+FN+ +K ++D  N  L GAKFI +N   +   +  +      +  CC 
Sbjct  237   MCVQEESQAAQLFNEELKALVDRYNKELVGAKFIYVNSAFMKYSNFKLPD----SLKCC-  291

Query  958   VSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSL  1137
               K K  G C   +  C  R+ + F+D FH TE  NL TA  +Y++ +PT  YPMDIS L
Sbjct  292   --KDKENGLCFPNEESCIGRHLHPFFDAFHPTEKVNLFTARCAYSSPIPTYTYPMDISQL  349

Query  1138  LQL  1146
             ++L
Sbjct  350   VKL  352



>ref|XP_002513318.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF48721.1| zinc finger protein, putative [Ricinus communis]
Length=367

 Score =   311 bits (796),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 159/360 (44%), Positives = 219/360 (61%), Gaps = 10/360 (3%)
 Frame = +1

Query  85    AIATLLLMFLSLKPLVAE--PQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDG  258
             A+  +L + L L   +A   PQVPCYFIFG S  DNGNNN L T A+ANY PYGIDFP G
Sbjct  10    AVFLVLAVTLKLSSTLASGNPQVPCYFIFGASYYDNGNNNRLITLARANYRPYGIDFPQG  69

Query  259   PTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTE-----GLLKGVNYASGAGGILDESG  423
             PTGRF+NG+   D+LA+FLGF   IPP++  +  +      +LKGVNYASG+ GIL E+ 
Sbjct  70    PTGRFTNGRTTGDFLAKFLGFKDFIPPFANASYHQRAPNNDILKGVNYASGSSGILKETS  129

Query  424   THMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQK  603
              H+G  I MD QL NH   ++RIA  +    AA+ +LNKC Y+V +G+NDYI NY +P  
Sbjct  130   KHVGARICMDGQLQNHQTAVSRIASILGNKDAAKNHLNKCLYTVAIGDNDYIGNYFLPLL  189

Query  604   YPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSC  783
             Y +S  Y+P+QFA  L +K  +QL  L+ LGARK+AVFG   L C P   +   +    C
Sbjct  190   YNTSSRYSPEQFATKLIQKFTLQLTTLYNLGARKIAVFGIPPLDCSPSATKASRSAG-KC  248

Query  784   VDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACCQVS  963
             V+    ++ +FN R++ ++D LN +L  +KF+ +N   ++    S   + +   ACC+V 
Sbjct  249   VEERTHSISIFNSRLRQLVDGLNKNLTNSKFMSVNTYGISRSSLSRFKVTDA--ACCKVE  306

Query  964   KTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQ  1143
             +      C      C NRNEYM+WD  H TE      A R+Y +  P+D YP+DIS L++
Sbjct  307   ERVGITTCIPHGRSCDNRNEYMWWDAVHQTEAAYKIIAERAYKSQSPSDTYPVDISRLVR  366



>ref|XP_002441391.1| hypothetical protein SORBIDRAFT_09g025780 [Sorghum bicolor]
 gb|EES19821.1| hypothetical protein SORBIDRAFT_09g025780 [Sorghum bicolor]
Length=366

 Score =   311 bits (796),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 151/339 (45%), Positives = 216/339 (64%), Gaps = 5/339 (1%)
 Frame = +1

Query  139   PQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNLADYLAEFLG  318
             PQVPCYFIFGDSLVDNGNNN + + A+ANY PYGIDF  GPTGRFSNG    D +A+ LG
Sbjct  30    PQVPCYFIFGDSLVDNGNNNFIVSMARANYPPYGIDFAGGPTGRFSNGLTTVDAIAKLLG  89

Query  319   FNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNHGLTLARIAL  498
             F+  +PP+S  ++ + LL+G N+AS A GI +E+G  +G  IS   Q+ N+   +  +  
Sbjct  90    FDDFVPPFSGASSQQ-LLRGANFASAAAGIREETGQQLGGRISFSGQVQNYQSAVQEVIS  148

Query  499   YMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAKKHYVQLK  678
              +    +A  +L++C ++VGMG+NDY+NNY MP  Y +   YTP+Q+AE LA  +   L+
Sbjct  149   ILGDEGSAATHLSRCIFTVGMGSNDYLNNYFMPAFYSTGSQYTPEQYAESLADDYSRLLQ  208

Query  679   KLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMFNDRMKPIIDDLNGS  858
              ++  GARKVA+ G G +GC P E+       ++CV+ IN+AV+MFN R+  ++D  N  
Sbjct  209   VMYRYGARKVALIGVGQVGCSPNELAQRSANGVTCVEQINAAVRMFNRRLVGLVDRFN-K  267

Query  859   LKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQVPCSNRNEYM  1029
             L GA F  IN+  +    L  P   G+   N  CC V +   +  C   Q+PC+NR+EY+
Sbjct  268   LPGAHFTYINIYGIFDDILRSPGAHGLKVTNAGCCGVGRNNGQVTCLPFQMPCANRHEYL  327

Query  1030  FWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             FWD FH TE  N+  A R+Y+A L +D +P+D+ +L +L
Sbjct  328   FWDAFHPTEAANVLVAQRTYSAKLASDVHPVDLRTLARL  366



>ref|XP_006655493.1| PREDICTED: GDSL esterase/lipase At4g18970-like [Oryza brachyantha]
Length=364

 Score =   310 bits (795),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 154/366 (42%), Positives = 231/366 (63%), Gaps = 5/366 (1%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPY  237
             MA   + W  +A ++++  S    VA PQVPCYF+FGDSLVDNGNNN++ + A+ANY PY
Sbjct  1     MARACRRWGVVAAVVVLAASAGAAVAAPQVPCYFVFGDSLVDNGNNNDIVSLARANYPPY  60

Query  238   GIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDE  417
             GIDF  GPTGRFSNG    D +++ LGF+  IPP++  ++ + LL GVN+AS A GI +E
Sbjct  61    GIDFAGGPTGRFSNGLTTVDVISKLLGFDDFIPPFAGASSDQ-LLTGVNFASAAAGIREE  119

Query  418   SGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMP  597
             +G  +G  IS   Q+ N+   + ++   +     A  +L++C ++VGMG+NDY+NNY MP
Sbjct  120   TGQQLGARISFSGQVQNYQSAVQQLVSILGDEDTAAAHLSQCIFTVGMGSNDYLNNYFMP  179

Query  598   QKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSL  777
               Y +   YTP+Q+A+ L  ++   L+ +++ GARKVA+ G G +GC P E+       +
Sbjct  180   AFYNTGSQYTPEQYADDLIGRYTQLLRAMYSNGARKVALVGVGQVGCSPNELAQQSANGV  239

Query  778   SCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKA  948
             +CV+ INSA++MFN ++  ++D  N +L GA F  IN+  +    L  P   G+   N+ 
Sbjct  240   TCVERINSAIRMFNQKLSGLVDQFN-TLPGAHFTYINIYGIFEDILRSPGSHGLKVTNQG  298

Query  949   CCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDI  1128
             CC V +   +  C   Q PC+NR+EY+FWD FH TE  N+    R+Y A LP+D +P+D+
Sbjct  299   CCGVGRNNGQVTCLPFQTPCANRHEYVFWDAFHPTEAANVLVGQRAYAARLPSDVHPVDL  358

Query  1129  SSLLQL  1146
              +L +L
Sbjct  359   RTLARL  364



>ref|XP_011045057.1| PREDICTED: GDSL esterase/lipase At1g29670-like, partial [Populus 
euphratica]
Length=339

 Score =   309 bits (791),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 154/324 (48%), Positives = 209/324 (65%), Gaps = 8/324 (2%)
 Frame = +1

Query  151   CYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNLADYLAEFLGFNSS  330
             CYFIFGDSLVD+GNNN LST A+  Y PYGIDFP GPTGRF+NGK +AD + E LG    
Sbjct  1     CYFIFGDSLVDSGNNNGLSTSARVKYPPYGIDFPAGPTGRFTNGKTVADIITELLGLKDY  60

Query  331   IPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNHGLTLARIALYMKG  510
             I P++ VT +E ++ GVNYASG+ GI DE+G ++G  +  +QQL NH +T++ +   +K 
Sbjct  61    IQPFATVTESE-IINGVNYASGSSGIRDEAGRNLGTHVGFNQQLNNHKITISSLTKTLKD  119

Query  511   YRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAKKHYVQLKKLHA  690
               AA  +LNKC Y+VGMG+NDYIN+Y +P+   S++ YTPDQFA +L  ++  Q++ LH 
Sbjct  120   STAA--HLNKCLYTVGMGSNDYINDYFLPRSATSTQ-YTPDQFAGVLIDQYSKQIRTLHD  176

Query  691   LGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMFNDRMKPIIDDLNGSLKGA  870
              GARK+A+FG G + C P  +   G    +C + I  AVQ+FN R+K ++D LN  L  +
Sbjct  177   AGARKIALFGLGAISCTPNSIVLFGKNG-TCAERITGAVQLFNVRLKSLVDQLNKELTDS  235

Query  871   KFILINMTSLALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHL  1050
             K I IN T      P+ +G      +CC+V+     G C      C NRNE++FWD FH 
Sbjct  236   KVIYINSTGTLGRYPNKLGFKVFKSSCCRVNNV---GLCNPSSTACPNRNEFIFWDGFHP  292

Query  1051  TEIGNLGTATRSYTATLPTDAYPM  1122
             TE  N  TA R++ A  P+DAYP 
Sbjct  293   TEAMNKLTAARAFHAADPSDAYPF  316



>ref|XP_010518837.1| PREDICTED: GDSL esterase/lipase At5g45670-like isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010518838.1| PREDICTED: GDSL esterase/lipase At5g45670-like isoform X2 [Tarenaya 
hassleriana]
Length=398

 Score =   310 bits (795),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 155/353 (44%), Positives = 211/353 (60%), Gaps = 4/353 (1%)
 Frame = +1

Query  97    LLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFS  276
             +++M L++    +EP  PCYFIFGDSLVD+GNNN LS+ A+A+Y PYGIDFP GPTGRFS
Sbjct  47    VIMMALAMNMASSEPLAPCYFIFGDSLVDSGNNNQLSSLARADYFPYGIDFPFGPTGRFS  106

Query  277   NGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQ  456
             NGK   D +AE LGF   I PY      + +L+GVNYAS A GI +E+G  +G  I+   
Sbjct  107   NGKTTVDVIAELLGFEDYITPY-VTARGQDILRGVNYASAAAGIREETGRQLGGRITFAG  165

Query  457   QLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQ  636
             Q+  H  T+AR+   +     A  YL+KC YS+G+G+NDY+NNY MP  Y +   ++PDQ
Sbjct  166   QVSYHVNTVARVVNILGDESKAANYLSKCIYSIGLGSNDYLNNYFMPLYYSTGSQFSPDQ  225

Query  637   FAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMF  816
             +A+ L  ++  QL+ L+  GARK A+ G G +GC P E+        +C + IN A +MF
Sbjct  226   YADDLISRYADQLRILYNNGARKFALVGIGAIGCSPNELAQRSQDGRTCDERINEANRMF  285

Query  817   NDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKAKGQC  987
             N R+  ++D  N     AKF  IN   +    + +P+  G    N  CC V +   +  C
Sbjct  286   NARLISLVDQFNQKTPDAKFTYINAYGVFQDIVNNPARYGFGVTNAGCCGVGRNNGQITC  345

Query  988   EEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
               GQ PC NRNE++FWD FH  E  N+    RS+ A  P DA+P DI  L  L
Sbjct  346   LPGQAPCLNRNEFVFWDAFHPGEAANIIIGRRSFRAESPNDAHPYDIEHLAML  398



>ref|XP_011081388.1| PREDICTED: GDSL esterase/lipase At1g29670-like, partial [Sesamum 
indicum]
Length=580

 Score =   316 bits (810),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 157/340 (46%), Positives = 229/340 (67%), Gaps = 7/340 (2%)
 Frame = +1

Query  46    SITLMASGVKVWFAIATLLLMFLSLKP--LVAEPQVPCYFIFGDSLVDNGNNNNLSTEAK  219
             S   M   V+    +A  L+++++L+P  L   PQVPC+FIFGDS+VDNGNNN L T  K
Sbjct  228   SFLRMVFAVRTNEVVALFLVVYINLQPSALSTAPQVPCFFIFGDSIVDNGNNNQLKTTTK  287

Query  220   ANYLPYGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGA  399
              NY PYGIDFPDGPTGRF+NG N AD+LA+ LGF S++P ++     E ++KGVNYASG+
Sbjct  288   VNYPPYGIDFPDGPTGRFTNGPNPADFLADLLGFKSAVPSFATAKGRE-IIKGVNYASGS  346

Query  400   GGILDESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYI  579
              GI +E+G  +G  ISM++QL++H +T++RIA  +    + + +L+KC Y   +G+NDY+
Sbjct  347   AGIRNETGKQLGHRISMNEQLLHHNVTVSRIARLLGHTPSRKDHLSKCLYYFVVGSNDYM  406

Query  580   NNYLMPQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMET  759
             NNY  P+ Y +S+ Y+ +++A +L +++  QLKKL++ GARKVAV G   +GC+P E+  
Sbjct  407   NNYFKPEYYSTSKKYSTEEYAAVLIREYSQQLKKLYSFGARKVAVTGLSAIGCVPAELAR  466

Query  760   HGNGSLSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNV  939
               NGSL CVD+IN A  +FN +++ ++  LN  L  A+FI I    L+   P + GI  +
Sbjct  467   GTNGSL-CVDAINDAAVLFNHKLQALVQSLNNHLPDAQFIYIPGVELSEHIP-VPGIKFL  524

Query  940   NKACCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEI  1059
              K CC+V+KT   G C  G+ PC +R  ++F+DNFH T I
Sbjct  525   LKPCCEVAKT--TGLCIRGKKPCRDRALHLFFDNFHPTSI  562


 Score =   184 bits (468),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 97/228 (43%), Positives = 140/228 (61%), Gaps = 5/228 (2%)
 Frame = +1

Query  418   SGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMP  597
             +G  +G  I+++ QL NH +T+ RIA  +     A   LNKC Y   +G+NDYINNY +P
Sbjct  1     TGEQLGFRINLNNQLKNHNVTMTRIAGLLGS--GASELLNKCLYYFVIGSNDYINNYFVP  58

Query  598   QKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSL  777
             + YP+S +YTP+Q+A +L +++  QLK L+  GARKVAV G G +GC P E+    NGS 
Sbjct  59    EYYPTSSMYTPEQYATVLVQQYSQQLKTLYDFGARKVAVNGIGPVGCAPAELARGTNGS-  117

Query  778   SCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACCQ  957
             +CVD +N AVQ+FND++K +++D N ++K AKF+ ++   L       +GI  ++K CC 
Sbjct  118   ACVDWMNKAVQLFNDKLKHLVNDFNTNIKDAKFVYLDAMDLRPTQLIALGIRFLSKPCCN  177

Query  958   VSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATL  1101
             VS     G C  G+ PC  R  + F+D FH +EI N   A  SY   L
Sbjct  178   VSNI--TGLCIPGETPCPIRALHAFYDGFHPSEIVNRVVAVASYIELL  223



>gb|EPS68861.1| hypothetical protein M569_05905 [Genlisea aurea]
Length=365

 Score =   309 bits (792),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 151/347 (44%), Positives = 215/347 (62%), Gaps = 4/347 (1%)
 Frame = +1

Query  115   SLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNLA  294
             SL     + Q PC F+FGDSLVDNGNNNN+ + A+ANYLPYG+D+PDGPTGRFSNGK   
Sbjct  20    SLANAQRQQQGPCLFVFGDSLVDNGNNNNIQSLARANYLPYGVDYPDGPTGRFSNGKTSV  79

Query  295   DYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNHG  474
             D +AE LG +  I PYS+ +  + +L+GVN+AS A GI  E+G  +G  I+  +Q+ N+ 
Sbjct  80    DVIAELLGIDQPILPYSSASGQD-VLRGVNFASAAAGIRQETGMQLGARIAFSEQVNNYK  138

Query  475   LTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLA  654
              T A +   +    +A  Y+ KC +SVGMG+NDY+NNY MPQ Y +S+ YTP+++A+ L 
Sbjct  139   NTAAEVVNILGDEDSAANYIGKCVFSVGMGSNDYLNNYFMPQYYQTSQQYTPEEYADALI  198

Query  655   KKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMFNDRMKP  834
             +++  Q++ L+  GARK A+ G   +GC P  +        +CV+ IN A +MFNDR+  
Sbjct  199   QEYTHQIQALYNYGARKFALIGISQIGCSPNSLAQGSPDGRTCVERINGANRMFNDRLYT  258

Query  835   IIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQVP  1005
             ++D+ N + + A F  IN  ++    + +PS  G    N  CC V +   +  C   Q P
Sbjct  259   LVDEFNSNSQDANFTYINAYAIFQDLIANPSPYGFRVTNAGCCGVGRNNGQITCLPLQTP  318

Query  1006  CSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             CSNR EY+FWD FH TE  N     RS+ A   +D++P DI  L Q+
Sbjct  319   CSNREEYVFWDAFHPTERANTIIGRRSFRAEKASDSHPYDIRQLAQI  365



>emb|CDY59325.1| BnaCnng34700D [Brassica napus]
Length=356

 Score =   308 bits (790),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 149/353 (42%), Positives = 217/353 (61%), Gaps = 4/353 (1%)
 Frame = +1

Query  97    LLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFS  276
             ++++ +++  + ++P  PCYFIFGDSLVDNGNNN L++ A+ANY PYGIDF  GPTGRFS
Sbjct  5     IIIVAVAINMVASDPIAPCYFIFGDSLVDNGNNNQLNSLARANYFPYGIDFSQGPTGRFS  64

Query  277   NGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQ  456
             NGK   D + E LGF+  I PY+A    E +L+GVNYAS A GI +E+G  +G  I+   
Sbjct  65    NGKTTVDVITELLGFDDYITPYAAARG-EDILRGVNYASAAAGIREETGRQLGGRIAFAG  123

Query  457   QLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQ  636
             Q+ NH  T++++   +     A  YL+KC YS+G+G+NDY+NNY MP  Y +   ++P+ 
Sbjct  124   QVANHVNTVSQVVNILGDEDQASSYLSKCIYSIGLGSNDYLNNYFMPTFYSTGNQFSPES  183

Query  637   FAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMF  816
             +++ L  ++  QL+ L+  GARK A+ G G +GC P E+  +     +C + INSA ++F
Sbjct  184   YSDDLIARYTEQLRILYNNGARKFALIGVGAIGCSPNELAQNSRDGRTCDERINSANRIF  243

Query  817   NDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKAKGQC  987
             N ++  I+D+ N +   AKF  IN   +    + +P+  G    N  CC V +   +  C
Sbjct  244   NSKLISIVDNFNQNTPDAKFTYINAYGIFQDIVANPARYGFTVTNAGCCGVGRNNGQITC  303

Query  988   EEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
               GQ PC NRNEY+FWD FH  E  N+   TRS+     +DA+P DI  L  L
Sbjct  304   LPGQAPCLNRNEYVFWDAFHPGEAANVIIGTRSFRREAASDAHPYDIQQLATL  356



>ref|XP_009114398.1| PREDICTED: GDSL esterase/lipase At5g45670-like [Brassica rapa]
Length=361

 Score =   309 bits (791),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 152/353 (43%), Positives = 214/353 (61%), Gaps = 4/353 (1%)
 Frame = +1

Query  97    LLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFS  276
             L+++ +++  + ++P  PCYFIFGDSLVDNGNNN L++ A+ANY PYGIDF  GPTGRFS
Sbjct  10    LIMVSIAINMVASDPIAPCYFIFGDSLVDNGNNNQLNSLARANYFPYGIDFSLGPTGRFS  69

Query  277   NGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQ  456
             NGK   D + E LGF++ I PY+A    E +L+GVNYAS A GI +E+G  +G  I+   
Sbjct  70    NGKTTVDVITELLGFDNYITPYAAARG-EDILRGVNYASAAAGIREETGRQLGGRIAFAG  128

Query  457   QLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQ  636
             Q+ NH  T++++   +     A  YL+KC YS+G+G+NDY+NNY MP  Y +   +TPD 
Sbjct  129   QVANHVNTVSQVVNILGDQNQASSYLSKCIYSIGLGSNDYLNNYFMPTFYSTGNQFTPDS  188

Query  637   FAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMF  816
             F + L  ++  QL+ L+  GARK A+ G G +GC P E+  +     +C + INSA ++F
Sbjct  189   FGDDLIARYTEQLRILYNNGARKFALIGVGAIGCSPNELAQNSRDGKTCDERINSANRLF  248

Query  817   NDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKAKGQC  987
             N ++  I+D  N +   AKF  IN   +    + +P   G    N  CC V +   +  C
Sbjct  249   NSKLVTIVDHFNQNTPDAKFTYINAYGIFQDIVTNPGRYGFRVTNAGCCGVGRNNGQITC  308

Query  988   EEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
               GQ PC NRNEY+FWD FH  E  N+    RS+     +DA+P DI  L  L
Sbjct  309   LPGQAPCLNRNEYVFWDAFHPGEAANIIIGRRSFRREAASDAHPYDIQQLATL  361



>emb|CDY13043.1| BnaA09g17740D [Brassica napus]
Length=361

 Score =   309 bits (791),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 152/353 (43%), Positives = 213/353 (60%), Gaps = 4/353 (1%)
 Frame = +1

Query  97    LLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFS  276
             L+++ +++  + ++P  PCYFIFGDSLVDNGNNN L + A+ANY PYGIDF  GPTGRFS
Sbjct  10    LIMVSIAINMVASDPIAPCYFIFGDSLVDNGNNNQLDSLARANYFPYGIDFSLGPTGRFS  69

Query  277   NGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQ  456
             NGK   D + E LGF++ I PY+A    E +L+GVNYAS A GI +E+G  +G  I+   
Sbjct  70    NGKTTVDVITELLGFDNYITPYAAARG-EDILRGVNYASAAAGIREETGRQLGGRIAFAG  128

Query  457   QLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQ  636
             Q+ NH  T++++   +     A  YL+KC YS+G+G+NDY+NNY MP  Y +   +TPD 
Sbjct  129   QVANHVNTVSQVVNILGDQNQASSYLSKCIYSIGLGSNDYLNNYFMPTFYSTGNQFTPDS  188

Query  637   FAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMF  816
             F + L  ++  QL+ L+  GARK A+ G G +GC P E+  +     +C + INSA ++F
Sbjct  189   FGDDLIARYTEQLRILYNNGARKFALIGVGAIGCSPNELAQNSRDGKTCDERINSANRLF  248

Query  817   NDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKAKGQC  987
             N ++  I+D  N +   AKF  IN   +    + +P   G    N  CC V +   +  C
Sbjct  249   NSKLVTIVDHFNQNTPDAKFTYINAYGIFQDIVTNPGRYGFRVTNAGCCGVGRNNGQITC  308

Query  988   EEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
               GQ PC NRNEY+FWD FH  E  N+    RS+     +DA+P DI  L  L
Sbjct  309   LPGQAPCLNRNEYVFWDAFHPGEAANIIIGRRSFRREAASDAHPYDIQQLATL  361



>ref|XP_006398248.1| hypothetical protein EUTSA_v10000937mg [Eutrema salsugineum]
 gb|ESQ39701.1| hypothetical protein EUTSA_v10000937mg [Eutrema salsugineum]
Length=360

 Score =   308 bits (790),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 150/353 (42%), Positives = 214/353 (61%), Gaps = 4/353 (1%)
 Frame = +1

Query  97    LLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFS  276
             ++++ +++  + ++P  PCYFIFGDSLVDNGNNN LS+ A+ANY PYGIDF  GPTGRFS
Sbjct  9     MIMVAMTINMVASDPIAPCYFIFGDSLVDNGNNNQLSSLARANYFPYGIDFALGPTGRFS  68

Query  277   NGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQ  456
             NGK   D + E LGF+  I PY+A    + +L+GVNYAS A GI +E+G  +G  I+   
Sbjct  69    NGKTTVDVITELLGFDDYITPYAAARGQD-ILRGVNYASAAAGIREETGRQLGGRIAFAG  127

Query  457   QLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQ  636
             Q+ NH  T++++   +     A  YL+KC YS+G+G+NDY+NNY MP  Y +   +TP+ 
Sbjct  128   QVANHVNTVSQVVNILGDENQASSYLSKCIYSIGLGSNDYLNNYFMPTFYSTGNQFTPES  187

Query  637   FAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMF  816
             F + L  ++  QL+ L+  GARK A+ G G +GC P E+  +     +C + INSA ++F
Sbjct  188   FGDDLIARYTEQLRILYNNGARKFALVGVGAIGCSPNELAQNSRDGTTCDERINSANRIF  247

Query  817   NDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKAKGQC  987
             N ++  I+D  N +   AKF  IN   +    + +P+  G    N  CC V +   +  C
Sbjct  248   NSKLITIVDQFNQNTPDAKFTYINAYGIFQDIVANPARYGFRVTNAGCCGVGRNNGQITC  307

Query  988   EEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
               GQ PC NRNEY+FWD FH  E  N+    RS+     +DA+P DI  L  L
Sbjct  308   LPGQAPCLNRNEYVFWDAFHPGEAANIIIGRRSFRREAASDAHPYDIQQLATL  360



>ref|XP_006468197.1| PREDICTED: GDSL esterase/lipase At4g18970-like [Citrus sinensis]
Length=358

 Score =   308 bits (789),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 163/370 (44%), Positives = 222/370 (60%), Gaps = 34/370 (9%)
 Frame = +1

Query  79    WFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDG  258
             W      + +F    P+  +P VPCYF+FGDSLVD+GNNNNL+T+AK NY PYGIDFP G
Sbjct  12    WVMAFVFISVFNLQSPVWGKPAVPCYFVFGDSLVDSGNNNNLATDAKVNYWPYGIDFPKG  71

Query  259   PTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGE  438
             PTGRF NG+ +AD  AE LGF+  IPP++     E ++KGVNYASG+ GI DE+G+H G 
Sbjct  72    PTGRFCNGRTIADVTAERLGFDDYIPPFATANGPE-IIKGVNYASGSAGIRDETGSHQGV  130

Query  439   VISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSR  618
              IS+++QL NH + ++RIA ++  Y +A  +L KC YS  +G+NDYINNY +PQ Y SS+
Sbjct  131   CISLNKQLKNHKIIISRIAGFLGSYHSAYEHLKKCLYSFTIGSNDYINNYFLPQFYNSSQ  190

Query  619   LYTPDQFAELLAKKHYVQLKKL---HALGAR----KVAVFGPGVLGCIPEEMETHG-NGS  774
             LYTP  +A +L++++  QLK     H +       KV + G G +GC P     +G NGS
Sbjct  191   LYTPSAYARILSQQYSRQLKVTEIDHFISVSSESLKVTLAGIGAIGCTPNATSYYGTNGS  250

Query  775   LSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACC  954
             L CVD +NSAVQ+FN R+            G  + LI             G N     CC
Sbjct  251   L-CVDKMNSAVQLFNKRL----------CTGDMYTLITS-----------GFNMSTLRCC  288

Query  955   QVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISS  1134
              V+     G C   + PCS R  ++FWD+FH  E+ NL  A +++ +   +DAYP DI  
Sbjct  289   DVNDF---GLCIRAKSPCSQRATHIFWDSFHPAEVLNLIAANKAFHSEATSDAYPTDIQR  345

Query  1135  LLQLNLQAKS  1164
             L+  N +A S
Sbjct  346   LVHFNPEAHS  355



>ref|XP_010518836.1| PREDICTED: GDSL esterase/lipase At5g45670-like isoform X1 [Tarenaya 
hassleriana]
Length=421

 Score =   310 bits (795),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 155/353 (44%), Positives = 211/353 (60%), Gaps = 4/353 (1%)
 Frame = +1

Query  97    LLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFS  276
             +++M L++    +EP  PCYFIFGDSLVD+GNNN LS+ A+A+Y PYGIDFP GPTGRFS
Sbjct  70    VIMMALAMNMASSEPLAPCYFIFGDSLVDSGNNNQLSSLARADYFPYGIDFPFGPTGRFS  129

Query  277   NGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQ  456
             NGK   D +AE LGF   I PY      + +L+GVNYAS A GI +E+G  +G  I+   
Sbjct  130   NGKTTVDVIAELLGFEDYITPY-VTARGQDILRGVNYASAAAGIREETGRQLGGRITFAG  188

Query  457   QLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQ  636
             Q+  H  T+AR+   +     A  YL+KC YS+G+G+NDY+NNY MP  Y +   ++PDQ
Sbjct  189   QVSYHVNTVARVVNILGDESKAANYLSKCIYSIGLGSNDYLNNYFMPLYYSTGSQFSPDQ  248

Query  637   FAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMF  816
             +A+ L  ++  QL+ L+  GARK A+ G G +GC P E+        +C + IN A +MF
Sbjct  249   YADDLISRYADQLRILYNNGARKFALVGIGAIGCSPNELAQRSQDGRTCDERINEANRMF  308

Query  817   NDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKAKGQC  987
             N R+  ++D  N     AKF  IN   +    + +P+  G    N  CC V +   +  C
Sbjct  309   NARLISLVDQFNQKTPDAKFTYINAYGVFQDIVNNPARYGFGVTNAGCCGVGRNNGQITC  368

Query  988   EEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
               GQ PC NRNE++FWD FH  E  N+    RS+ A  P DA+P DI  L  L
Sbjct  369   LPGQAPCLNRNEFVFWDAFHPGEAANIIIGRRSFRAESPNDAHPYDIEHLAML  421



>ref|XP_009101579.1| PREDICTED: GDSL esterase/lipase At5g45670 [Brassica rapa]
Length=359

 Score =   308 bits (789),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 149/353 (42%), Positives = 216/353 (61%), Gaps = 4/353 (1%)
 Frame = +1

Query  97    LLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFS  276
             ++++ +++  + ++P  PCYFIFGDSLVDNGNNN L++ A+ANY PYGIDF  GPTGRFS
Sbjct  8     MIIVAVAITMVASDPIAPCYFIFGDSLVDNGNNNQLNSLARANYFPYGIDFSQGPTGRFS  67

Query  277   NGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQ  456
             NGK   D + E LGF+  I PY+A    E +L+GVNYAS A GI +E+G  +G  I+   
Sbjct  68    NGKTTVDVITELLGFDDYITPYAAARG-EDILRGVNYASAAAGIREETGRQLGGRIAFAG  126

Query  457   QLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQ  636
             Q+ NH  T++++   +     A  YL+KC YS+G+G+NDY+NNY MP  Y +   ++P+ 
Sbjct  127   QVANHVNTVSQVVNILGDEDQASSYLSKCIYSIGLGSNDYLNNYFMPTFYSTGNQFSPES  186

Query  637   FAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMF  816
             +++ L  ++  QL+ L+  GARK A+ G G +GC P E+  +     +C + INSA ++F
Sbjct  187   YSDDLIARYTEQLRILYNNGARKFALIGVGAIGCSPNELAQNSRDGRTCDERINSANRIF  246

Query  817   NDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKAKGQC  987
             N ++  I+D  N +   AKF  IN   +    + +P+  G    N  CC V +   +  C
Sbjct  247   NSKLISIVDSFNQNTPDAKFTYINAYGIFQDIVTNPARYGFTVTNAGCCGVGRNNGQITC  306

Query  988   EEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
               GQ PC NRNEY+FWD FH  E  N+   TRS+     +DA+P DI  L  L
Sbjct  307   LPGQAPCLNRNEYVFWDAFHPGEAANVIIGTRSFRREAASDAHPYDIQQLAAL  359



>ref|XP_010481545.1| PREDICTED: GDSL esterase/lipase At5g45670 [Camelina sativa]
Length=361

 Score =   308 bits (788),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 151/341 (44%), Positives = 209/341 (61%), Gaps = 4/341 (1%)
 Frame = +1

Query  133   AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNLADYLAEF  312
             +EP  PCYFIFGDSLVDNGNNN L + A+ANY PYGIDF  GPTGRFSNGK   D +AE 
Sbjct  22    SEPIAPCYFIFGDSLVDNGNNNQLQSLARANYFPYGIDFAFGPTGRFSNGKTTVDVIAEL  81

Query  313   LGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNHGLTLARI  492
             LGF+  I PY+A    + +L+GVNYAS A GI +E+G  +G  I+   Q+ NH  T++++
Sbjct  82    LGFDDYITPYAAARGQD-ILRGVNYASAAAGIREETGRQLGGRITFAGQVANHVNTVSQV  140

Query  493   ALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAKKHYVQ  672
                +     A  YL+KC YS+G+G+NDY+NNY MP  Y +   ++P+ +A+ L  ++  Q
Sbjct  141   VNILGDQNEASNYLSKCIYSIGLGSNDYLNNYFMPTFYSTGNQFSPESYADDLVARYTEQ  200

Query  673   LKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMFNDRMKPIIDDLN  852
             L+ L+  GARK A+ G G +GC P E+  +     +C + INSA ++FN+++  I+D  N
Sbjct  201   LRILYTNGARKFALIGVGAIGCSPNELAQNSRDGRTCDERINSANRIFNNKLISIVDAFN  260

Query  853   GSLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQVPCSNRNE  1023
              +   AKF  IN   +    + +P+  G    N  CC V +   +  C  GQ PC NRNE
Sbjct  261   QNTPDAKFTYINAYGIFQDIVTNPARYGFRVTNAGCCGVGRNNGQITCLPGQAPCLNRNE  320

Query  1024  YMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             Y+FWD FH  E  N+   TRS+     +DA+P DI  L  L
Sbjct  321   YVFWDAFHPGEAANIVIGTRSFRREAASDAHPYDIQQLATL  361



>ref|XP_010441685.1| PREDICTED: GDSL esterase/lipase At5g45670-like [Camelina sativa]
Length=362

 Score =   308 bits (788),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 151/341 (44%), Positives = 209/341 (61%), Gaps = 4/341 (1%)
 Frame = +1

Query  133   AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNLADYLAEF  312
             +EP  PCYFIFGDSLVDNGNNN L + A+ANY PYGIDF  GPTGRFSNGK   D +AE 
Sbjct  23    SEPIAPCYFIFGDSLVDNGNNNQLQSLARANYFPYGIDFAFGPTGRFSNGKTTVDVIAEL  82

Query  313   LGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNHGLTLARI  492
             LGF+  I PY+A    + +L+GVNYAS A GI +E+G  +G  I+   Q+ NH  T++++
Sbjct  83    LGFDDYITPYAAARGQD-ILRGVNYASAAAGIREETGRQLGGRITFAGQVANHVNTVSQV  141

Query  493   ALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAKKHYVQ  672
                +     A  YL+KC YS+G+G+NDY+NNY MP  Y +   ++P+ +A+ L  ++  Q
Sbjct  142   VNILGDQNEASNYLSKCIYSIGLGSNDYLNNYFMPTFYSTGNQFSPESYADDLVARYTEQ  201

Query  673   LKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMFNDRMKPIIDDLN  852
             L+ L+  GARK A+ G G +GC P E+  +     +C + INSA ++FN+++  I+D  N
Sbjct  202   LRILYTNGARKFALIGVGAIGCSPNELAQNSRDGRTCDERINSANRIFNNKLISIVDAFN  261

Query  853   GSLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQVPCSNRNE  1023
              +   AKF  IN   +    + +P+  G    N  CC V +   +  C  GQ PC NRNE
Sbjct  262   QNTPDAKFTYINAYGIFQDIVTNPARYGFRVTNAGCCGVGRNNGQITCLPGQAPCLNRNE  321

Query  1024  YMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             Y+FWD FH  E  N+   TRS+     +DA+P DI  L  L
Sbjct  322   YVFWDAFHPGEAANIVIGTRSFRREAASDAHPYDIQQLATL  362



>ref|XP_008383578.1| PREDICTED: GDSL esterase/lipase At1g29660-like [Malus domestica]
Length=327

 Score =   306 bits (785),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 148/320 (46%), Positives = 217/320 (68%), Gaps = 10/320 (3%)
 Frame = +1

Query  88    IATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTG  267
             I  +L++ L    +  EP+VPC+FIFGDSL DNGNNN L T ++ NY PYGIDFP GPTG
Sbjct  10    INVVLVISLLQSCVCGEPKVPCFFIFGDSLADNGNNNRLQTPSRGNYKPYGIDFPQGPTG  69

Query  268   RFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVIS  447
             RF+NG+ + D LAE LGF + IP ++     + +++G+NYAS + G+ DE+G+HMGE ++
Sbjct  70    RFTNGRTIVDILAELLGFENPIPCFANTRGYKNIVRGLNYASASAGLRDETGSHMGENVN  129

Query  448   MDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYT  627
             +++QL+NH  T+ RI   M   + +R +L KC YSVGMG+NDY+ NY  P+ YP+S+ YT
Sbjct  130   LNKQLLNHKSTVKRITSIMGLKQLSRQHLQKCLYSVGMGSNDYLMNYFQPKFYPTSKQYT  189

Query  628   PDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAV  807
              +Q+A +L ++++ Q+K L+  GARKV + G G++GC P  + T  NGS +C +++N+AV
Sbjct  190   LEQYASVLIEQYFQQIKTLYKYGARKVVLNG-GLVGCTPSSISTT-NGS-TCAENLNNAV  246

Query  808   QMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSII---GINNVNKACCQVSKTKAK  978
             Q FN ++K ++D LN  L  AKFI ++M  ++ G PS +   G       CC V ++   
Sbjct  247   QFFNQKLKSLVDQLNAKLTDAKFIYVDMFGIS-GSPSDLTAAGFKVTKANCCPVDES---  302

Query  979   GQCEEGQVPCSNRNEYMFWD  1038
             GQC   + PC NR+EYMFWD
Sbjct  303   GQCLPSKAPCQNRSEYMFWD  322



>ref|XP_010494685.1| PREDICTED: GDSL esterase/lipase At5g45670-like [Camelina sativa]
Length=364

 Score =   308 bits (788),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 151/341 (44%), Positives = 209/341 (61%), Gaps = 4/341 (1%)
 Frame = +1

Query  133   AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNLADYLAEF  312
             +EP  PCYFIFGDSLVDNGNNN L + A+ANY PYGIDF  GPTGRFSNGK   D +AE 
Sbjct  25    SEPIAPCYFIFGDSLVDNGNNNQLQSLARANYFPYGIDFAFGPTGRFSNGKTTVDVIAEL  84

Query  313   LGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNHGLTLARI  492
             LGF+  I PY+A    + +L+GVNYAS A GI +E+G  +G  I+   Q+ NH  T++++
Sbjct  85    LGFDDYITPYAAARGQD-ILRGVNYASAAAGIREETGRQLGGRITFAGQVANHVNTVSQV  143

Query  493   ALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAKKHYVQ  672
                +     A  YL+KC YS+G+G+NDY+NNY MP  Y +   ++P+ +A+ L  ++  Q
Sbjct  144   VNILGDQNEASNYLSKCIYSIGLGSNDYLNNYFMPTFYSTGNQFSPESYADDLVARYTEQ  203

Query  673   LKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMFNDRMKPIIDDLN  852
             L+ L+  GARK A+ G G +GC P E+  +     +C + INSA ++FN+++  I+D  N
Sbjct  204   LRILYTNGARKFALIGVGAIGCSPNELAQNSRDGRTCDERINSANRIFNNKLISIVDAFN  263

Query  853   GSLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQVPCSNRNE  1023
              +   AKF  IN   +    + +P+  G    N  CC V +   +  C  GQ PC NRNE
Sbjct  264   QNTPDAKFTYINAYGIFQDIVTNPARYGFRVTNAGCCGVGRNNGQITCLPGQAPCLNRNE  323

Query  1024  YMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             Y+FWD FH  E  N+   TRS+     +DA+P DI  L  L
Sbjct  324   YVFWDAFHPGEAANVVIGTRSFRREAASDAHPYDIQQLATL  364



>gb|KGN61305.1| hypothetical protein Csa_2G078090 [Cucumis sativus]
Length=370

 Score =   307 bits (787),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 165/367 (45%), Positives = 221/367 (60%), Gaps = 11/367 (3%)
 Frame = +1

Query  76    VWFAIATLLLMF-------LSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLP  234
             +W+ I   +L+        +S +P V   QVPCYF FGDSL DNGNNNNL+T AKANY P
Sbjct  5     IWYLIVVYVLVLSLEGKSMVSGEPQVPCAQVPCYFTFGDSLSDNGNNNNLATRAKANYRP  64

Query  235   YGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILD  414
             YGIDFP G TGRFSNG+NL D++AE L F++ IPP+   T    + +GVNYASG  GI  
Sbjct  65    YGIDFPGGTTGRFSNGRNLVDFIAEKLNFSNYIPPFMN-TRGFNIAQGVNYASGGAGIRF  123

Query  415   ESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARY-YLNKCFYSVGMGNNDYINNYL  591
             ++G  +G+VISM +QL NH + + +I   M+   +A   YL +C Y V +G+NDY+NNY 
Sbjct  124   QTGRALGQVISMGEQLRNHNIIIRQIRRSMRNNNSATMAYLKQCLYMVEIGSNDYLNNYY  183

Query  592   MPQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNG  771
             +P  Y +SR ++  ++A  L  +  +QL+ L A GARKVA FG G+LGC      T    
Sbjct  184   VPSFYSTSRRFSTQEYATRLINQLSLQLEDLIAKGARKVATFGVGLLGCTLYARATFETN  243

Query  772   SLSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSLALGDPSIIGINNVNKAC  951
                CV+ IN A+Q+FN  +K +ID LN   K AKFI+I++  ++   P   G    +  C
Sbjct  244   GSPCVNDINDAIQLFNIGLKSLIDKLNSRYKNAKFIMIDVAQISTVQPPNQGQIISDAPC  303

Query  952   CQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDIS  1131
             C+V       QC      C NR+ Y+F+D  H TE G  G A RS+ A  P D YP DI 
Sbjct  304   CEVQYDNV--QCVPFGRVCDNRDGYLFYDGVHPTEFGFEGLANRSFIAQFPNDTYPCDIQ  361

Query  1132  SLLQLNL  1152
              L+QL L
Sbjct  362   QLVQLKL  368



>ref|XP_002865231.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH41490.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=360

 Score =   307 bits (786),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 148/353 (42%), Positives = 215/353 (61%), Gaps = 4/353 (1%)
 Frame = +1

Query  97    LLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFS  276
             ++++ +++    ++P  PCYFIFGDSLVDNGNNN L + A+ANY PYGIDF  GPTGRFS
Sbjct  9     MIMVAMTMNIAKSDPIAPCYFIFGDSLVDNGNNNQLQSLARANYFPYGIDFAAGPTGRFS  68

Query  277   NGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQ  456
             NG+   D +AE LGF+  I PY++    + +L+GVNYAS A GI DE+G  +G  I+   
Sbjct  69    NGRTTVDVIAELLGFDDYITPYASARGQD-ILRGVNYASAAAGIRDETGRQLGGRIAFAG  127

Query  457   QLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQ  636
             Q+ NH  T++++   +     A  YL+KC YS+G+G+NDY+NNY MP  Y +   ++P+ 
Sbjct  128   QVANHVNTVSQVVNILGDQNEASNYLSKCIYSIGLGSNDYLNNYFMPNFYSTGNQFSPES  187

Query  637   FAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMF  816
             +A+ L  ++  QL+ L+  GARK A+ G G +GC P E+  +     +C + INSA ++F
Sbjct  188   YADDLVARYTEQLRILYTNGARKFALIGVGAIGCSPNELAQNSRDGRTCDERINSANRIF  247

Query  817   NDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKAKGQC  987
             N ++  I+D  N +   AKF  IN   +    + +P+  G +  N  CC V +   +  C
Sbjct  248   NSKLISIVDAFNQNTPDAKFTYINAYGIFQDIVTNPARYGFSVTNAGCCGVGRNNGQITC  307

Query  988   EEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
               GQ PC NRNEY+FWD FH  E  N+    RS+     +DA+P DI  L  L
Sbjct  308   LPGQAPCLNRNEYVFWDAFHPGEAANIVIGRRSFKREAASDAHPYDIQQLASL  360



>emb|CDY23109.1| BnaC09g18630D [Brassica napus]
Length=361

 Score =   306 bits (785),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 152/353 (43%), Positives = 213/353 (60%), Gaps = 4/353 (1%)
 Frame = +1

Query  97    LLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFS  276
             L+L+ +++  + ++P  PCYFIFGDSLVDNGNNN L++ A+ANY PYGIDF  GPTGRFS
Sbjct  10    LILVSIAINMVASDPIAPCYFIFGDSLVDNGNNNQLNSLARANYFPYGIDFSLGPTGRFS  69

Query  277   NGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQ  456
             NGK   D + E LGF++ I PY+A    E +L+GVNYAS A GI +E+G  +G  I+   
Sbjct  70    NGKTTVDVITELLGFDNYITPYAAARG-EDILRGVNYASAAAGIREETGRQLGGRIAFAG  128

Query  457   QLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQ  636
             Q+ NH  T++++   +     A  YL+KC YS+G+G+NDY+NNY MP  Y +   +TPD 
Sbjct  129   QVANHVNTVSQVVNILGDQNQASSYLSKCIYSIGLGSNDYLNNYFMPTFYSTGNQFTPDS  188

Query  637   FAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMF  816
             F + L  ++  QL+ L+  G RK A+ G G +GC P E+  +     +C + INSA ++F
Sbjct  189   FGDDLIARYTEQLRILYNNGGRKFALIGVGAIGCSPNELAQNSRDGTTCDERINSANRLF  248

Query  817   NDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKAKGQC  987
             N ++  I+D  N +   AKF  IN   +    + +P+  G    N  CC V +   +  C
Sbjct  249   NSKLITIVDHFNQNTPDAKFTYINAYGIFQDIVTNPARYGFRVTNAGCCGVGRNNGQITC  308

Query  988   EEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
               GQ PC NRNEY+FWD FH  E  N     RS+     +DA+P DI  L  L
Sbjct  309   LPGQAPCLNRNEYVFWDAFHPGEAANNIIGRRSFRREAASDAHPYDIQQLATL  361



>gb|ABF72017.1| GDSL-motif lipase/hydrolase family protein [Musa acuminata]
Length=387

 Score =   307 bits (787),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 160/386 (41%), Positives = 228/386 (59%), Gaps = 36/386 (9%)
 Frame = +1

Query  91    ATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGR  270
             A  LL++ +   +  EPQVPCYFIFGDSLVDNGNNNN+++ A ANY PYGIDFP GP+GR
Sbjct  4     ARWLLLWAAFVSVRPEPQVPCYFIFGDSLVDNGNNNNIASLAVANYPPYGIDFPSGPSGR  63

Query  271   FSNGKNLADYL-------------------------------AEFLGFNSSIPPYSAVTT  357
             F+NG    D +                               A+ LGF+  +PPY A T 
Sbjct  64    FTNGLTTVDVIGMAFYVCQPINSLSVTNSMFLCSTILSKPGCAQLLGFDDFVPPY-ASTR  122

Query  358   TEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLN  537
              + LL GVN+AS A GI +E+G  +G  I    QL N+   +  +   +    +A  YL+
Sbjct  123   GQALLTGVNFASAAAGIREETGQQLGGRIPFGGQLQNYQSAVQEMVSILGDEDSAANYLS  182

Query  538   KCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVF  717
             KC +SVG+G+NDY+NNY MP  Y + + YTP+Q+A+ L +++  QL+ L+  GARKV + 
Sbjct  183   KCIFSVGLGSNDYLNNYFMPAFYSTGQRYTPEQYADELIQQYSQQLRTLYNYGARKVVLI  242

Query  718   GPGVLGCIPEEMETHGNGSLSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTS  897
             G G +GC P E+       ++CV+ INSA+++FN ++  ++D+ N +L GA FI IN   
Sbjct  243   GVGQVGCSPNELAQRSPNGVACVEEINSAIRIFNAKLIDLVDEFN-ALDGAHFIYINGYG  301

Query  898   L---ALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNL  1068
             +    L +P+  G++  N+ CC V +   +  C   Q PC NR+EY+F+D FH TE  N+
Sbjct  302   IFEDILRNPAANGLSVTNRGCCGVGRNNGQITCLPYQAPCPNRDEYLFFDAFHPTEAANI  361

Query  1069  GTATRSYTATLPTDAYPMDISSLLQL  1146
                 RSY+A  P DAYPMDI  L ++
Sbjct  362   IIGKRSYSARSPGDAYPMDIRRLARV  387



>gb|ABF70089.1| GDSL-motif lipase/hydrolase family protein [Musa balbisiana]
Length=387

 Score =   307 bits (787),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 160/386 (41%), Positives = 228/386 (59%), Gaps = 36/386 (9%)
 Frame = +1

Query  91    ATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGR  270
             A  LL++ +   +  EPQVPCYFIFGDSLVDNGNNNN+++ A ANY PYGIDFP+GP+GR
Sbjct  4     ARWLLLWAAFVSVRPEPQVPCYFIFGDSLVDNGNNNNIASLAVANYPPYGIDFPNGPSGR  63

Query  271   FSNGKNLADYL-------------------------------AEFLGFNSSIPPYSAVTT  357
             F+NG    D +                               A+ LGF+  +PPY A T 
Sbjct  64    FTNGLTTVDVIGTAFYICQPINSLSVTNSMFLCSAILSKPGCAQLLGFDDFVPPY-ASTR  122

Query  358   TEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLN  537
              + LL GVN+AS A GI +E+G  +G  I    QL N+   +  +   +    +A  YL+
Sbjct  123   GQALLTGVNFASAAAGIREETGQQLGGRIPFGGQLQNYQSAVQEMVRILGDEDSAANYLS  182

Query  538   KCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVF  717
             KC +SVG+G+NDY+NNY MP  Y + + YTP+Q+A+ L +++  QL+ L+  GARKV + 
Sbjct  183   KCIFSVGLGSNDYLNNYFMPAFYSTGQQYTPEQYADELIQQYSQQLRTLYNYGARKVVLI  242

Query  718   GPGVLGCIPEEMETHGNGSLSCVDSINSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTS  897
             G G +GC P E+       ++CV+ INSA+++FN ++  ++D+ N +L GA FI IN   
Sbjct  243   GVGQVGCSPNELAQRSPNGVTCVEEINSAIRIFNAKLIDLVDEFN-ALDGAHFIYINGYG  301

Query  898   L---ALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNL  1068
             +    L +P+  G++  N+ CC V +   +  C   Q PC NR+EY+F+D FH TE  N+
Sbjct  302   IFEDILRNPAANGLSVTNRGCCGVGRNNGQITCLPYQAPCRNRDEYLFFDAFHPTEAANI  361

Query  1069  GTATRSYTATLPTDAYPMDISSLLQL  1146
                 RSY A  P DAYPMDI  L ++
Sbjct  362   IIGKRSYHARSPGDAYPMDIRRLARV  387



>ref|XP_009770266.1| PREDICTED: GDSL esterase/lipase At1g33811 isoform X1 [Nicotiana 
sylvestris]
Length=367

 Score =   306 bits (784),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 158/361 (44%), Positives = 222/361 (61%), Gaps = 12/361 (3%)
 Frame = +1

Query  97    LLLMFLSLKPLVA-------EPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPD  255
             ++L FLS   L         EPQVPC+FIFGDSLVDNGNNN + T A+ANY+PYGIDFP 
Sbjct  8     VILAFLSFFLLTTKAWSQEQEPQVPCFFIFGDSLVDNGNNNGILTLARANYMPYGIDFPQ  67

Query  256   GPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMG  435
             G TGRF+NG+   D LA+ LGF++ IPPYS V     LL+G NYASGA GI DE+G ++G
Sbjct  68    GATGRFTNGRTYVDILAQLLGFSNYIPPYSRV-RGRALLRGANYASGAAGIRDETGNNLG  126

Query  436   EVISMDQQLVNHGLTLARIALYMKG-YRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPS  612
             + +SM+QQ+ N   T+  +    +G   A   YL+KC +  G+G+NDY+NNY M   Y +
Sbjct  127   DHMSMNQQVENFARTVEELRRLFRGNNNALNGYLSKCIFYSGLGSNDYLNNYFMTDYYST  186

Query  613   SRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDS  792
                YTP  +A  L + +  QL +L+ LGARKV V G G +GCIP E+  +      C + 
Sbjct  187   HSQYTPQAYATALLQDYCKQLSELYNLGARKVVVTGVGQIGCIPYELARYDGNDSRCNEE  246

Query  793   INSAVQMFNDRMKPIIDDLNGSLKGAKFILIN---MTSLALGDPSIIGINNVNKACCQVS  963
             IN+A+ +FN  +K ++   N  L GAKF+ ++    T   + +    G   V+K CC V 
Sbjct  247   INNAILLFNSGLKKLVVRFNKVLPGAKFVFLDSFESTKDLVVNAKTYGFEVVDKGCCGVG  306

Query  964   KTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQ  1143
             +   +  C   Q PC +R++Y+FWD FH TE+ N+  A +S+++   T AYP++I  L +
Sbjct  307   RNNGQITCLPLQQPCEDRSKYIFWDAFHPTEVANIILAKKSFSSISKTFAYPINIQQLAR  366

Query  1144  L  1146
             L
Sbjct  367   L  367



>ref|XP_010540540.1| PREDICTED: GDSL esterase/lipase At1g29660-like [Tarenaya hassleriana]
Length=363

 Score =   306 bits (783),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 159/361 (44%), Positives = 218/361 (60%), Gaps = 10/361 (3%)
 Frame = +1

Query  79    WFAIATLLLMFLSLKPLVAEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDG  258
             W+ +   L++    +     PQVPC FIFGDSL DNGNNN L T A+A+Y PYGIDFP G
Sbjct  8     WYMVFVGLVLGFRAQ---GAPQVPCAFIFGDSLCDNGNNNKLRTIARADYSPYGIDFPQG  64

Query  259   PTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGE  438
              TGRF NG+ + D++ EF+G +  +PPYS  +T E +L GVNYAS + GI +ESG  +GE
Sbjct  65    STGRFCNGRTIIDFMTEFIGLDRYLPPYSE-STDEDVLTGVNYASASAGIREESGRQLGE  123

Query  439   VISMDQQL-VNHGLTLARIALYMKGYR-AARYYLNKCFYSVGMGNNDYINNYLMPQKYPS  612
              I+  +Q+  NH   ++R+   + G + AA  +L KC YS+ MGNNDY+NNY     YP+
Sbjct  124   RITFREQVEENHREMVSRVVNMLGGDKNAAANHLGKCLYSIEMGNNDYLNNYF-SASYPT  182

Query  613   SRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDS  792
              + YTP+QFA+ L   +  QL  L++ GARK  + G G +GC P  +        +CV+ 
Sbjct  183   RKQYTPEQFADNLIDLYGQQLNVLYSYGARKFVLSGVGAIGCCPNVLARFSPDGKTCVEF  242

Query  793   INSAVQMFNDRMKPIIDDLNGSLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVS  963
             IN AV++FND++K ++D LN  L  AKFI  N   +    L +PS  G N  N+ CC   
Sbjct  243   INYAVRLFNDKLKSLVDQLNNDLADAKFIYANNYDILQDLLNNPSAYGFNVTNEGCCGSG  302

Query  964   KTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQ  1143
             + +   QC     PC NRNEY+FWD +H TE  N   A R Y    P+D YP+D+ +L  
Sbjct  303   RNRGLFQCLPRAKPCPNRNEYVFWDVYHPTEAANAIIAQRLYRRRDPSDIYPVDVFTLAN  362

Query  1144  L  1146
             L
Sbjct  363   L  363



>ref|XP_006280692.1| hypothetical protein CARUB_v10026655mg [Capsella rubella]
 gb|EOA13590.1| hypothetical protein CARUB_v10026655mg [Capsella rubella]
Length=360

 Score =   305 bits (782),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 149/341 (44%), Positives = 209/341 (61%), Gaps = 4/341 (1%)
 Frame = +1

Query  133   AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNLADYLAEF  312
             +EP  PCYFIFGDSLVDNGNNN L + A+ANY PYGIDF  GPTGRFSNGK   D +AE 
Sbjct  21    SEPIAPCYFIFGDSLVDNGNNNQLQSLARANYFPYGIDFAFGPTGRFSNGKTTVDVIAEL  80

Query  313   LGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNHGLTLARI  492
             LGF+  I PY+A    + +L+GVNYAS A GI +E+G  +G  I+   Q+ NH  T++++
Sbjct  81    LGFDDYITPYAAARGQD-ILRGVNYASAAAGIREETGRQLGGRIAFAGQVANHVNTVSQV  139

Query  493   ALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAKKHYVQ  672
                +     A  YL+KC YS+G+G+NDY+NNY MP  Y +   ++P+ +A+ L  ++  Q
Sbjct  140   VNILGDQNEASNYLSKCIYSIGLGSNDYLNNYFMPTFYSTGNQFSPESYADDLVARYTEQ  199

Query  673   LKKLHALGARKVAVFGPGVLGCIPEEMETHGNGSLSCVDSINSAVQMFNDRMKPIIDDLN  852
             L+ L+  GARK A+ G G +GC P E+  +     +C + INSA ++FN+++  ++D  N
Sbjct  200   LRVLYTNGARKFALIGVGAIGCSPNELAQNSRDGRTCDERINSANRIFNNKLISMVDAFN  259

Query  853   GSLKGAKFILINMTSL---ALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQVPCSNRNE  1023
              +   AKF  IN   +    + +P+  G +  N  CC V +   +  C  GQ PC NRNE
Sbjct  260   QNTPDAKFTYINAYGIFQDIVANPARYGFSVTNAGCCGVGRNNGQITCLPGQAPCLNRNE  319

Query  1024  YMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQL  1146
             Y+FWD FH  E  N+    RS+     +DA+P DI  L  L
Sbjct  320   YVFWDAFHPGEAANIVIGRRSFRREAASDAHPYDIEQLATL  360



>gb|KEH36667.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=371

 Score =   306 bits (783),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 164/373 (44%), Positives = 224/373 (60%), Gaps = 12/373 (3%)
 Frame = +1

Query  58    MASGVKVWFAIATLLLMFLSLKPLV-AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLP  234
             MA  +K W  +  L+     L+  V  + QVPC FIFGDSL D+GNNNNL T AK+NY P
Sbjct  1     MACEIKTWLMVLILIFSANYLQQFVNGKSQVPCLFIFGDSLSDSGNNNNLPTSAKSNYKP  60

Query  235   YGIDFPDGPTGRFSNGKNLADYLAEFLGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILD  414
             YGIDFP GPTGRF+NG+   D + + LGF   IPP++ +  ++ +LKGVNYASGA GI  
Sbjct  61    YGIDFPMGPTGRFTNGRTSIDIITQLLGFEKFIPPFANINGSD-ILKGVNYASGAAGIRI  119

Query  415   ESGTHMGEVISMDQQLVNHGLTLARIALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLM  594
             E+    G VIS+  QL NH + ++RIA  ++G   A+ YL+KC Y V +G+NDYINNY  
Sbjct  120   ETSITTGFVISLGLQLENHKVIVSRIASRLEGIDKAQEYLSKCLYYVNIGSNDYINNYFR  179

Query  595   PQKYPSSRLYTPDQFAELLAKKHYVQLKKLHALGARKVAVFGPGVLGCIPEEMETHGNGS  774
             PQ YP+S++Y+P+Q+AE L ++  + L  LH +GARK  + G G+LGC P  + THG   
Sbjct  180   PQFYPTSQIYSPEQYAEALIQELSLNLLTLHDIGARKYVLVGLGLLGCTPSAIFTHGTNG  239

Query  775   LSCVDSINSAVQMFNDRMKPIIDDLNGSLKG-AKFILINMTSLALGDPSIIGINNVNKAC  951
              SCVD  N+   +FN ++K ++D  N      +KFI +N T+L     +  G    N  C
Sbjct  240   -SCVDEENAPALIFNFKLKFLVDHFNNKFSADSKFIFVN-TTLESDAQNSDGFLVSNVPC  297

Query  952   CQVSKTKAKGQCEEGQVPCSNRNEYMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDIS  1131
             C          C   + PC NR+EY FWD  H TE  N   A RSY +      YPMDI 
Sbjct  298   C-------PSGCIPDERPCYNRSEYAFWDEVHPTEASNQLYAIRSYNSHNSGFTYPMDIK  350

Query  1132  SLLQLNLQAKSDI  1170
             +L++  ++ + D 
Sbjct  351   NLVEQEIEMELDF  363



>ref|XP_006372072.1| hypothetical protein POPTR_0018s09660g [Populus trichocarpa]
 gb|ERP49869.1| hypothetical protein POPTR_0018s09660g [Populus trichocarpa]
Length=379

 Score =   306 bits (784),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 158/343 (46%), Positives = 209/343 (61%), Gaps = 7/343 (2%)
 Frame = +1

Query  133   AEPQVPCYFIFGDSLVDNGNNNNLSTEAKANYLPYGIDFPDGPTGRFSNGKNLADYLAEF  312
             A PQVPCYF+FGDSL DNGNNN L   AK NYLPYGIDF  G +GR SNG N+AD +AE 
Sbjct  28    AVPQVPCYFVFGDSLFDNGNNNYLDNAAKVNYLPYGIDFDTGASGRCSNGLNIADTIAEQ  87

Query  313   LGFNSSIPPYSAVTTTEGLLKGVNYASGAGGILDESGTHMGEVISMDQQLVNHGLTLARI  492
             LGF+S I  +  V      L GVNY S   GILD +G+  GE+ +M+ QL NH +T++RI
Sbjct  88    LGFDSYITDF-GVGGCTNFLDGVNYGSSGAGILDITGSLAGELFTMNAQLFNHNITVSRI  146

Query  493   ALYMKGYRAARYYLNKCFYSVGMGNNDYINNYLMPQKYPSSRLYTPDQFAELLAKKHYVQ  672
             +  +     AR YL++C Y   MG+NDY+NNY   ++Y SS+ YTP++FA+LL + +  Q
Sbjct  147   SKILGSEEVARKYLSQCIYVSDMGHNDYLNNYF-KEEYNSSKQYTPEKFAQLLIETYETQ  205

Query  673   LKKLHALGARKVAVFGPGVLGCIPEEMETHGNG---SLSCVDSINSAVQMFNDRMKPIID  843
             L+KL+  GARK+AVFG   +GC+P   + H N    S SCV+  NS VQ FND++  ++ 
Sbjct  206   LEKLYCSGARKIAVFGLIRVGCMPHNRQNHPNDVDESSSCVEKFNSDVQFFNDKLPALLH  265

Query  844   DLNGSLKGAKFILINMTSLALGDPSIIGINNVNKACCQVSKTKAKGQCEEGQVPCSNRNE  1023
              LN     A F  IN   +   D +  G     K+CC+V        C+    PCSNR++
Sbjct  266   KLNTKHSDAVFTYINSYEIDSDDQTNTGFTQTRKSCCEVEPGSVP--CKSLSFPCSNRSD  323

Query  1024  YMFWDNFHLTEIGNLGTATRSYTATLPTDAYPMDISSLLQLNL  1152
             Y++WD  H TE        R+Y    P DAYP DIS L++L L
Sbjct  324   YVYWDGAHFTEAKAWAFGKRAYKRQSPKDAYPYDISELVKLKL  366



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4161078891900