BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18144_g1_i1 len=360 path=[1310:0-38 131:39-99 192:100-283
376:284-359]

Length=360
                                                                      Score     E

ref|XP_009776577.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  64.7    1e-09   
ref|XP_009594958.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  62.8    5e-09   
ref|XP_009594963.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  62.8    5e-09   
ref|XP_010681325.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  58.9    9e-08   
ref|XP_009593190.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  58.2    1e-07   
ref|XP_010681332.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  58.5    1e-07   
ref|XP_009593189.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  58.2    2e-07   
ref|XP_010681322.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  58.5    2e-07   
ref|XP_009609796.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  57.8    3e-07   
ref|XP_010678749.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  57.4    4e-07   
ref|XP_010681327.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  57.4    4e-07   
ref|XP_003613588.1|  F-box/FBD/LRR-repeat protein                     57.4    5e-07   
ref|XP_009607416.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  55.1    5e-07   
gb|AFK36982.1|  unknown                                               57.0    5e-07   
ref|XP_009762454.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  56.6    6e-07   
ref|XP_004305028.1|  PREDICTED: putative FBD-associated F-box pro...  57.0    7e-07   
gb|AET04918.2|  F-box/RNI/FBD-like domain protein                     56.6    7e-07   
ref|XP_010324854.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  56.2    8e-07   
ref|XP_009593186.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  56.2    1e-06   
ref|XP_003630442.1|  F-box/FBD/LRR-repeat protein                     55.8    1e-06   
ref|XP_006355223.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  55.8    1e-06   
ref|XP_009593185.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  55.8    1e-06   
ref|XP_009593184.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  55.8    1e-06   
ref|XP_010668248.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  55.5    1e-06   
ref|XP_010688381.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  55.8    2e-06   
ref|XP_009611095.1|  PREDICTED: putative F-box protein At3g58960      54.7    2e-06   
gb|EYU30161.1|  hypothetical protein MIMGU_mgv1a020306mg              54.7    2e-06   
ref|XP_010688383.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  55.5    2e-06   
gb|KEH39881.1|  F-box/RNI/FBD-like domain protein                     54.7    2e-06   
ref|XP_011074580.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  54.7    3e-06   
ref|XP_003588811.1|  F-box/FBD/LRR-repeat protein                     54.7    3e-06   
ref|XP_006365389.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  54.7    3e-06   
dbj|BAJ87969.1|  predicted protein                                    52.8    4e-06   
ref|XP_009770919.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  53.1    4e-06   
ref|XP_009770920.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  53.1    4e-06   
ref|XP_003562194.1|  PREDICTED: FBD-associated F-box protein At5g...  54.3    4e-06   
emb|CDP00517.1|  unnamed protein product                              54.3    4e-06   
ref|NP_001058931.1|  Os07g0158900                                     54.3    4e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004305027.1|  PREDICTED: F-box/FBD/LRR-repeat protein At5g...  54.3    4e-06   
ref|XP_003589307.1|  F-box/FBD/LRR-repeat protein                     54.7    4e-06   
ref|XP_009801908.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  53.9    5e-06   
gb|EYU25620.1|  hypothetical protein MIMGU_mgv1a0241701mg             53.1    5e-06   
emb|CAN72282.1|  hypothetical protein VITISV_043941                   53.9    5e-06   Vitis vinifera
gb|EYU22413.1|  hypothetical protein MIMGU_mgv1a020807mg              53.9    6e-06   
ref|XP_003589308.1|  F-box/FBD/LRR-repeat protein                     53.9    6e-06   
ref|XP_004239345.1|  PREDICTED: F-box/LRR-repeat protein At3g2692...  53.9    6e-06   
ref|XP_010681320.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  53.5    6e-06   
ref|XP_002278942.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  53.5    6e-06   Vitis vinifera
ref|XP_007020971.1|  Uncharacterized protein TCM_030985               54.3    7e-06   
gb|EAZ02849.1|  hypothetical protein OsI_24979                        53.9    7e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_009594964.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  53.5    7e-06   
gb|EYU42995.1|  hypothetical protein MIMGU_mgv1a024012mg              53.5    7e-06   
gb|EYU42996.1|  hypothetical protein MIMGU_mgv1a026224mg              53.5    7e-06   
gb|EYU30160.1|  hypothetical protein MIMGU_mgv1a023705mg              52.8    8e-06   
gb|KEH40079.1|  ubiquitin-protein ligase, putative                    53.5    9e-06   
ref|XP_006289902.1|  hypothetical protein CARUB_v10003518mg           53.1    1e-05   
gb|EYU35742.1|  hypothetical protein MIMGU_mgv1a023364mg              50.1    1e-05   
ref|XP_004246222.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  51.2    1e-05   
tpg|DAA60249.1|  TPA: hypothetical protein ZEAMMB73_859710            53.1    1e-05   
ref|XP_002459698.1|  hypothetical protein SORBIDRAFT_02g009030        53.1    1e-05   Sorghum bicolor [broomcorn]
gb|EYU44093.1|  hypothetical protein MIMGU_mgv1a025180mg              52.8    1e-05   
gb|EYU30252.1|  hypothetical protein MIMGU_mgv1a018436mg              49.7    1e-05   
ref|XP_002461443.1|  hypothetical protein SORBIDRAFT_02g002776        52.8    1e-05   Sorghum bicolor [broomcorn]
ref|XP_009591794.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  52.8    1e-05   
gb|EYU30210.1|  hypothetical protein MIMGU_mgv1a021323mg              52.0    2e-05   
ref|XP_007214334.1|  hypothetical protein PRUPE_ppb023005mg           50.8    2e-05   
gb|EYU34389.1|  hypothetical protein MIMGU_mgv1a020343mg              52.4    2e-05   
ref|XP_011021144.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  52.4    2e-05   
gb|EYU27275.1|  hypothetical protein MIMGU_mgv1a020644mg              52.4    2e-05   
ref|XP_004305029.1|  PREDICTED: F-box/FBD/LRR-repeat protein At5g...  52.4    2e-05   
ref|XP_006407053.1|  hypothetical protein EUTSA_v10022020mg           52.4    2e-05   
ref|XP_009621103.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  51.6    2e-05   
gb|EAZ38766.1|  hypothetical protein OsJ_23168                        52.4    2e-05   Oryza sativa Japonica Group [Japonica rice]
dbj|BAC79641.1|  unknown protein                                      52.4    2e-05   Oryza sativa Japonica Group [Japonica rice]
gb|KDP24339.1|  hypothetical protein JCGZ_25635                       52.0    2e-05   
ref|XP_010105226.1|  hypothetical protein L484_012341                 51.6    2e-05   
gb|EYU31508.1|  hypothetical protein MIMGU_mgv1a024186mg              52.0    3e-05   
ref|XP_006339772.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  52.0    3e-05   
ref|XP_006377716.1|  hypothetical protein POPTR_0011s10510g           51.6    3e-05   
ref|XP_011078662.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  51.6    3e-05   
ref|XP_010445828.1|  PREDICTED: putative FBD-associated F-box pro...  50.1    3e-05   
ref|XP_008227423.1|  PREDICTED: F-box/FBD/LRR-repeat protein At5g...  52.0    3e-05   
ref|XP_003566583.1|  PREDICTED: putative F-box/FBD/LRR-repeat pro...  51.6    3e-05   
gb|KEH16332.1|  F-box/RNI superfamily protein                         51.2    3e-05   
ref|XP_006373510.1|  hypothetical protein POPTR_0017s14390g           51.6    3e-05   
ref|XP_004490303.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  51.6    3e-05   
gb|EYU30180.1|  hypothetical protein MIMGU_mgv1a021107mg              51.6    3e-05   
emb|CDX98131.1|  BnaA06g08820D                                        51.6    3e-05   
ref|XP_009148668.1|  PREDICTED: FBD-associated F-box protein At5g...  51.6    3e-05   
ref|XP_009793685.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  51.2    4e-05   
ref|XP_008227424.1|  PREDICTED: F-box/FBD/LRR-repeat protein At5g...  51.6    4e-05   
ref|XP_003588839.1|  F-box/FBD/LRR-repeat protein                     51.2    4e-05   
ref|XP_004292956.1|  PREDICTED: putative FBD-associated F-box pro...  51.2    5e-05   
gb|KEH39256.1|  F-box/FBD/LRR protein                                 51.2    5e-05   
ref|XP_004962085.1|  PREDICTED: putative F-box protein At3g58860-...  51.2    5e-05   
gb|AES59090.2|  F-box/RNI/FBD-like domain protein                     51.2    5e-05   
ref|XP_004292758.1|  PREDICTED: FBD-associated F-box protein At4g...  50.8    5e-05   
ref|XP_006828595.1|  hypothetical protein AMTR_s00129p00054950        51.2    5e-05   
ref|XP_010424373.1|  PREDICTED: FBD-associated F-box protein At5g...  50.8    5e-05   
gb|EYU23721.1|  hypothetical protein MIMGU_mgv1a019171mg              50.8    5e-05   
ref|XP_006843912.1|  hypothetical protein AMTR_s00007p00268900        51.2    5e-05   
gb|EYU30182.1|  hypothetical protein MIMGU_mgv1a026803mg              50.4    6e-05   
ref|XP_006348791.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  50.8    6e-05   
gb|EYU30197.1|  hypothetical protein MIMGU_mgv1a024274mg              50.1    6e-05   
ref|XP_009801909.1|  PREDICTED: putative F-box/FBD/LRR-repeat pro...  50.1    6e-05   
ref|XP_010325642.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  50.8    6e-05   
gb|EYU22412.1|  hypothetical protein MIMGU_mgv1a006705mg              50.8    6e-05   
ref|XP_010325643.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  50.8    6e-05   
ref|XP_009761512.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  50.4    6e-05   
gb|KEH37794.1|  F-box/RNI/FBD-like domain protein                     50.8    6e-05   
ref|XP_007211593.1|  hypothetical protein PRUPE_ppa005417mg           50.8    6e-05   
emb|CCD74524.1|  F-box family protein                                 50.8    6e-05   
ref|XP_003589313.1|  F-box/FBD/LRR-repeat protein                     50.1    7e-05   
ref|XP_006344294.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  50.4    7e-05   
gb|AES59564.2|  F-box/FBD-like domain protein                         50.4    7e-05   
ref|XP_002459270.1|  hypothetical protein SORBIDRAFT_02g001570        50.4    7e-05   Sorghum bicolor [broomcorn]
ref|XP_004505475.1|  PREDICTED: putative F-box/FBD/LRR-repeat pro...  49.7    7e-05   
gb|EYU31507.1|  hypothetical protein MIMGU_mgv1a020990mg              50.8    7e-05   
ref|XP_008813247.1|  PREDICTED: F-box protein At5g03100-like          50.4    8e-05   
gb|KCW59707.1|  hypothetical protein EUGRSUZ_H02467                   49.7    8e-05   
ref|XP_010323653.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  50.4    8e-05   
gb|EYU31511.1|  hypothetical protein MIMGU_mgv1a021202mg              50.1    9e-05   
ref|XP_010493976.1|  PREDICTED: FBD-associated F-box protein At5g...  50.4    9e-05   
gb|EYU38949.1|  hypothetical protein MIMGU_mgv1a024102mg              50.4    9e-05   
gb|EYU31301.1|  hypothetical protein MIMGU_mgv1a018336mg              50.1    9e-05   
ref|XP_011044572.1|  PREDICTED: F-box/LRR-repeat protein At3g2692...  50.1    9e-05   
ref|XP_004293482.1|  PREDICTED: putative F-box protein At3g58860-...  50.1    1e-04   
gb|EYU29916.1|  hypothetical protein MIMGU_mgv1a020056mg              50.4    1e-04   
gb|EYU31289.1|  hypothetical protein MIMGU_mgv1a018403mg              50.1    1e-04   
gb|EYU30178.1|  hypothetical protein MIMGU_mgv1a025101mg              48.9    1e-04   
gb|EYU30192.1|  hypothetical protein MIMGU_mgv1a020895mg              50.1    1e-04   
ref|XP_010026603.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  50.1    1e-04   
gb|EYU30187.1|  hypothetical protein MIMGU_mgv11b017558mg             50.1    1e-04   
ref|XP_010312905.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  49.3    1e-04   
ref|XP_008385315.1|  PREDICTED: putative F-box/LRR-repeat protein...  48.9    1e-04   
gb|EYU46185.1|  hypothetical protein MIMGU_mgv1a025434mg              49.7    1e-04   
gb|EYU30170.1|  hypothetical protein MIMGU_mgv1a022468mg              50.1    1e-04   
ref|XP_008368777.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  49.3    1e-04   
ref|XP_009344644.1|  PREDICTED: putative F-box/FBD/LRR-repeat pro...  49.3    2e-04   
ref|XP_004288719.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  49.7    2e-04   
ref|XP_006368068.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  49.3    2e-04   
ref|XP_010034380.1|  PREDICTED: putative F-box/LRR-repeat protein...  49.3    2e-04   
ref|XP_010040691.1|  PREDICTED: FBD-associated F-box protein At2g...  49.3    2e-04   
gb|EYU30181.1|  hypothetical protein MIMGU_mgv1a007194mg              49.3    2e-04   
ref|XP_007026140.1|  F-box/RNI/FBD-like domains-containing protein    49.3    2e-04   
ref|XP_011074581.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  49.3    2e-04   
gb|EYU34195.1|  hypothetical protein MIMGU_mgv1a024133mg              49.3    2e-04   
ref|XP_002451681.1|  hypothetical protein SORBIDRAFT_04g005800        49.3    2e-04   Sorghum bicolor [broomcorn]
gb|EYU28491.1|  hypothetical protein MIMGU_mgv1a009525mg              48.9    2e-04   
ref|XP_006474549.1|  PREDICTED: F-box/FBD/LRR-repeat protein At5g...  49.3    2e-04   
ref|XP_006452924.1|  hypothetical protein CICLE_v10008333mg           49.3    2e-04   
ref|XP_006574988.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  48.9    2e-04   
emb|CDY36412.1|  BnaC05g10130D                                        48.9    2e-04   
ref|XP_006482338.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  48.9    2e-04   
gb|KDO73723.1|  hypothetical protein CISIN_1g046273mg                 48.9    2e-04   
gb|EYU30195.1|  hypothetical protein MIMGU_mgv1a023850mg              48.5    2e-04   
gb|EYU30186.1|  hypothetical protein MIMGU_mgv1a019769mg              48.9    2e-04   
ref|XP_009590127.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  48.9    2e-04   
gb|EYU33034.1|  hypothetical protein MIMGU_mgv1a019771mg              47.8    2e-04   
gb|KDO58879.1|  hypothetical protein CISIN_1g036695mg                 48.9    2e-04   
ref|XP_006430877.1|  hypothetical protein CICLE_v10011818mg           48.9    2e-04   
ref|XP_009590126.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  48.9    2e-04   
ref|XP_006356449.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  48.9    3e-04   
gb|KHN29904.1|  F-box/FBD/LRR-repeat protein                          48.9    3e-04   
ref|XP_010419264.1|  PREDICTED: putative FBD-associated F-box pro...  48.1    3e-04   
gb|EYU30205.1|  hypothetical protein MIMGU_mgv1a024593mg              48.5    3e-04   
gb|ACL52432.1|  unknown                                               48.9    3e-04   Zea mays [maize]
gb|AAM62702.1|  unknown                                               48.9    3e-04   
ref|XP_002874348.1|  hypothetical protein ARALYDRAFT_489554           48.9    3e-04   
gb|EYU30200.1|  hypothetical protein MIMGU_mgv1a018462mg              48.5    3e-04   
ref|NP_198127.1|  FBD-associated F-box protein                        48.5    3e-04   Arabidopsis thaliana [mouse-ear cress]
gb|EYU30214.1|  hypothetical protein MIMGU_mgv1a023526mg              48.5    3e-04   
ref|XP_009790183.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  48.5    3e-04   
ref|NP_191479.1|  F-box/LRR-repeat protein                            48.5    3e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002890021.1|  F16A14.1                                         48.5    3e-04   
ref|XP_009596698.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  48.5    3e-04   
gb|EYU30193.1|  hypothetical protein MIMGU_mgv1a021686mg              48.5    3e-04   
ref|XP_008242864.1|  PREDICTED: F-box/FBD/LRR-repeat protein At5g...  48.5    3e-04   
ref|XP_009790182.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  48.5    3e-04   
ref|XP_009790184.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  48.1    3e-04   
gb|EYU31288.1|  hypothetical protein MIMGU_mgv1a020404mg              48.1    4e-04   
ref|XP_009342918.1|  PREDICTED: F-box/LRR-repeat protein At3g5890...  48.5    4e-04   
gb|EYU44107.1|  hypothetical protein MIMGU_mgv1a023398mg              48.5    4e-04   
ref|XP_010495692.1|  PREDICTED: putative FBD-associated F-box pro...  46.6    4e-04   
ref|XP_004307296.1|  PREDICTED: putative FBD-associated F-box pro...  48.5    4e-04   
ref|XP_004490315.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  48.1    4e-04   
ref|NP_001168550.1|  uncharacterized protein LOC100382330             48.1    4e-04   Zea mays [maize]
emb|CDP00518.1|  unnamed protein product                              48.1    4e-04   
ref|XP_006430878.1|  hypothetical protein CICLE_v10011818mg           48.1    4e-04   
ref|XP_010481192.1|  PREDICTED: F-box/LRR-repeat protein At1g5566...  45.8    4e-04   
tpg|DAA60250.1|  TPA: hypothetical protein ZEAMMB73_745247            48.1    4e-04   
ref|NP_001144603.1|  uncharacterized protein LOC100277619             48.1    4e-04   Zea mays [maize]
ref|XP_011040385.1|  PREDICTED: F-box/LRR-repeat protein At3g2692...  48.1    4e-04   
ref|XP_006482340.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  47.8    5e-04   
ref|XP_009629620.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  48.1    5e-04   
ref|XP_011044570.1|  PREDICTED: F-box/LRR-repeat protein At3g2692...  48.1    5e-04   
ref|XP_004490314.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  48.1    5e-04   
ref|XP_009770147.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  48.1    5e-04   
ref|XP_007199086.1|  hypothetical protein PRUPE_ppa018890mg           47.8    5e-04   
gb|KEH29986.1|  ubiquitin-protein ligase, putative                    48.1    5e-04   
ref|XP_009803967.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  48.1    5e-04   
ref|XP_007208808.1|  hypothetical protein PRUPE_ppa024758mg           47.8    5e-04   
ref|XP_009761514.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  48.1    5e-04   
ref|XP_009606383.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  48.1    5e-04   
ref|XP_009344628.1|  PREDICTED: F-box/LRR-repeat protein At3g5890...  48.1    5e-04   
ref|XP_010417971.1|  PREDICTED: FBD-associated F-box protein At1g...  47.8    5e-04   
gb|EYU22466.1|  hypothetical protein MIMGU_mgv1a026699mg              48.1    5e-04   
ref|XP_006594775.1|  PREDICTED: FBD-associated F-box protein At5g...  47.8    5e-04   
ref|XP_006847185.1|  hypothetical protein AMTR_s00017p00248550        47.4    5e-04   
ref|XP_006344337.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  48.1    5e-04   
gb|EYU28246.1|  hypothetical protein MIMGU_mgv1a017752mg              47.8    6e-04   
ref|XP_008386352.1|  PREDICTED: putative F-box/LRR-repeat protein...  45.4    6e-04   
ref|XP_009339335.1|  PREDICTED: putative F-box/FBD/LRR-repeat pro...  47.8    6e-04   
ref|XP_002459711.1|  hypothetical protein SORBIDRAFT_02g009200        47.8    6e-04   Sorghum bicolor [broomcorn]
ref|XP_006290900.1|  hypothetical protein CARUB_v10017012mg           47.8    6e-04   
ref|XP_010654296.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  47.4    6e-04   
gb|AAF79391.1|AC068197_1  F16A14.1                                    47.8    6e-04   Arabidopsis thaliana [mouse-ear cress]
gb|KFK38825.1|  hypothetical protein AALP_AA3G165400                  48.1    6e-04   
gb|KFK38824.1|  hypothetical protein AALP_AA3G165400                  48.1    6e-04   
gb|EPS66566.1|  f-box family protein                                  46.2    6e-04   
ref|NP_172833.2|  F-box/RNI-like/FBD-like domains-containing protein  47.8    6e-04   Arabidopsis thaliana [mouse-ear cress]
gb|EYU42234.1|  hypothetical protein MIMGU_mgv1a018216mg              47.8    7e-04   
ref|XP_003588364.1|  F-box/FBD/LRR-repeat protein                     45.1    7e-04   
gb|EMT10886.1|  hypothetical protein F775_06693                       47.8    7e-04   
ref|XP_006400766.1|  hypothetical protein EUTSA_v10013474mg           47.8    7e-04   
ref|XP_002270150.2|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  47.4    7e-04   Vitis vinifera
ref|XP_009344632.1|  PREDICTED: putative F-box/LRR-repeat protein...  47.4    7e-04   
ref|XP_007033533.1|  Uncharacterized protein TCM_019702               47.8    7e-04   
ref|XP_008790134.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  47.4    7e-04   
gb|EYU26185.1|  hypothetical protein MIMGU_mgv1a026227mg              47.0    7e-04   
ref|XP_008339464.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  47.4    7e-04   
ref|XP_002876577.1|  hypothetical protein ARALYDRAFT_486543           47.0    7e-04   
ref|XP_006340108.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  46.6    7e-04   
ref|XP_002459702.1|  hypothetical protein SORBIDRAFT_02g009070        47.4    8e-04   Sorghum bicolor [broomcorn]
ref|XP_010319632.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  44.7    8e-04   
ref|XP_006346554.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  46.6    8e-04   
ref|XP_009373733.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  47.4    8e-04   
ref|XP_008339465.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  47.4    8e-04   
ref|XP_004309879.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  47.4    8e-04   
gb|EYU25809.1|  hypothetical protein MIMGU_mgv1a021367mg              46.2    8e-04   
ref|XP_006366448.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  47.4    8e-04   
ref|XP_002865307.1|  hypothetical protein ARALYDRAFT_494488           47.4    8e-04   
ref|XP_006348920.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  47.4    9e-04   
ref|XP_006356259.1|  PREDICTED: putative F-box/LRR-repeat protein...  47.4    9e-04   
ref|XP_006847183.1|  hypothetical protein AMTR_s00017p00248290        47.0    9e-04   
ref|XP_009787860.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  47.4    0.001   
ref|XP_008359370.1|  PREDICTED: probable FBD-associated F-box pro...  47.4    0.001   
ref|XP_010094148.1|  Putative F-box/FBD/LRR-repeat protein            47.0    0.001   
ref|XP_006279786.1|  hypothetical protein CARUB_v10027905mg           47.0    0.001   
gb|EYU30163.1|  hypothetical protein MIMGU_mgv1a005822mg              47.4    0.001   
emb|CDY13079.1|  BnaA09g17380D                                        45.1    0.001   
ref|XP_006594779.1|  PREDICTED: FBD-associated F-box protein At5g...  47.0    0.001   
gb|EYU41899.1|  hypothetical protein MIMGU_mgv1a009068mg              47.0    0.001   
gb|EYU21464.1|  hypothetical protein MIMGU_mgv1a023349mg              47.0    0.001   
gb|EYU28924.1|  hypothetical protein MIMGU_mgv1a006986mg              47.0    0.001   
gb|EYU30179.1|  hypothetical protein MIMGU_mgv1a008322mg              47.0    0.001   



>ref|XP_009776577.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Nicotiana 
sylvestris]
 ref|XP_009776578.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Nicotiana 
sylvestris]
 ref|XP_009776579.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Nicotiana 
sylvestris]
 ref|XP_009776580.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Nicotiana 
sylvestris]
Length=410

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 49/88 (56%), Gaps = 13/88 (15%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP ++LD+IL  LP  +A + ++LS +WR  W  R ELDFGYDFF      +Y + K
Sbjct  12   ISNLPCNVLDEILGCLPLKDAVKTSILSKHWRYKWATRQELDFGYDFFGSF--AHYQEAK  69

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKF  316
                        +I +VL+ H G I KF
Sbjct  70   T-----------IIYQVLLLHKGPILKF  86



>ref|XP_009594958.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009594959.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009594960.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009594961.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009594962.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X1 [Nicotiana tomentosiformis]
Length=422

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 50/91 (55%), Gaps = 13/91 (14%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP +++D+IL  LP  +A + ++LS  WR  W+ R ELDFGY+FF      + HD++
Sbjct  12   ISNLPCNVVDEILGCLPLKDAVKTSILSKDWRYKWVTRQELDFGYNFF----GSFAHDQE  67

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFN  325
                        +I +VL+ H G I KF   
Sbjct  68   AKT---------IIYQVLLIHKGPILKFKLG  89



>ref|XP_009594963.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X2 [Nicotiana tomentosiformis]
Length=421

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 50/91 (55%), Gaps = 13/91 (14%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP +++D+IL  LP  +A + ++LS  WR  W+ R ELDFGY+FF      + HD++
Sbjct  12   ISNLPCNVVDEILGCLPLKDAVKTSILSKDWRYKWVTRQELDFGYNFF----GSFAHDQE  67

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFN  325
                        +I +VL+ H G I KF   
Sbjct  68   AKT---------IIYQVLLIHKGPILKFKLG  89



>ref|XP_010681325.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
 ref|XP_010681326.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=412

 Score = 58.9 bits (141),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 32/94 (34%), Positives = 49/94 (52%), Gaps = 8/94 (9%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP D++ ++L  L   +AA+++VLS  WR+IW +   L F   FF  +L +   D  
Sbjct  18   ISNLPTDVIHELLERLSLKDAAQMSVLSHKWRDIWTSNPHLVFDEPFFARVLKQKVRDTD  77

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFNFPF  334
               +I        ++K+L QH G I KF+   P 
Sbjct  78   KFCNI--------VSKILFQHEGPILKFSLAMPL  103



>ref|XP_009593190.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X3 [Nicotiana tomentosiformis]
Length=304

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 52/99 (53%), Gaps = 17/99 (17%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP++++D IL LLP  +AAR ++L+  WR IW     L     FF  +  + + +  
Sbjct  18   ISALPSNVIDGILELLPVKDAARTSILAQKWRYIWAMLPNLVLDKCFFGKIPPRLFKE--  75

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFNF---PFST  340
                        ++N +L+QH G+I KF  +F   PFST
Sbjct  76   ------------IVNGILLQHIGVIVKFVLDFVGLPFST  102



>ref|XP_010681332.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=412

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 34/94 (36%), Positives = 50/94 (53%), Gaps = 8/94 (9%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP D++ K+L      +AAR++VLS  WR+IW +   L F   FF  +L +    E 
Sbjct  18   ISNLPTDVIYKLLERFSLKDAARMSVLSHKWRDIWTSNPHLVFDEPFFARVLKQ----EV  73

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFNFPF  334
             D D + +    V++ +L QH G I KF+   P 
Sbjct  74   RDTDKFCN----VVSNILFQHEGPILKFSLAMPL  103



>ref|XP_009593189.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X2 [Nicotiana tomentosiformis]
Length=356

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 52/99 (53%), Gaps = 17/99 (17%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP++++D IL LLP  +AAR ++L+  WR IW     L     FF  +  + + +  
Sbjct  18   ISALPSNVIDGILELLPVKDAARTSILAQKWRYIWAMLPNLVLDKCFFGKIPPRLFKE--  75

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFNF---PFST  340
                        ++N +L+QH G+I KF  +F   PFST
Sbjct  76   ------------IVNGILLQHIGVIVKFVLDFVGLPFST  102



>ref|XP_010681322.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010681323.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010681324.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=445

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 32/97 (33%), Positives = 50/97 (52%), Gaps = 8/97 (8%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP D++ ++L  L   +AA+++VLS  WR+IW +   L F   FF  +L +   D  
Sbjct  18   ISNLPTDVIHELLERLSLKDAAQMSVLSHKWRDIWTSNPHLVFDEPFFARVLKQKVRDTD  77

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFNFPFSTA  343
               +I        ++K+L QH G I KF+   P   +
Sbjct  78   KFCNI--------VSKILFQHEGPILKFSLYVPLGIS  106



>ref|XP_009609796.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Nicotiana 
tomentosiformis]
 ref|XP_009593187.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X1 [Nicotiana tomentosiformis]
Length=361

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 52/99 (53%), Gaps = 17/99 (17%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP++++D IL LLP  +AAR ++L+  WR IW     L     FF  +  + + +  
Sbjct  18   ISALPSNVIDGILELLPVKDAARTSILAQKWRYIWAMLPNLVLDKCFFGKIPPRLFKE--  75

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFNF---PFST  340
                        ++N +L+QH G+I KF  +F   PFST
Sbjct  76   ------------IVNGILLQHIGVIVKFVLDFVGLPFST  102



>ref|XP_010678749.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010678750.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Beta 
vulgaris subsp. vulgaris]
Length=444

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 36/99 (36%), Positives = 49/99 (49%), Gaps = 5/99 (5%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP ++  +IL  LP  EAAR +VLS++WR+ W    +L     FF  +L      E 
Sbjct  17   ISNLPENVTQRILECLPLQEAARTSVLSSHWRHKWAASQQLVLDEKFFTSILKN--RTET  74

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFNFPFSTAKE  349
             DI +  S     +N +L+ H G I KF    P    KE
Sbjct  75   TDISLAYSK---TVNDILLSHVGPIWKFVLYLPSWFPKE  110



>ref|XP_010681327.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010681328.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010681329.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010681330.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=445

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 34/93 (37%), Positives = 50/93 (54%), Gaps = 8/93 (9%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP D++ K+L      +AAR++VLS  WR+IW +   L F   FF  +L +    E 
Sbjct  18   ISNLPTDVIYKLLERFSLKDAARMSVLSHKWRDIWTSNPHLVFDEPFFARVLKQ----EV  73

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFNFP  331
             D D + +    V++ +L QH G I KF+   P
Sbjct  74   RDTDKFCN----VVSNILFQHEGPILKFSLYVP  102



>ref|XP_003613588.1| F-box/FBD/LRR-repeat protein [Medicago truncatula]
 gb|AES96546.1| F-box/FBD-like domain protein [Medicago truncatula]
Length=499

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 55/102 (54%), Gaps = 13/102 (13%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS+LP++++D IL  L   + AR ++LS  WR+IW++   L+F  DFF     K + D  
Sbjct  98   ISDLPSNVIDGILQHLNIRDLARTSILSRKWRDIWISFPWLEFDKDFFDLYDLKDFKDHS  157

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKF------AFNFPFST  340
             ++ I       +I +VL+ HNG I KF       FN PF  
Sbjct  158  PEVCI-------IITEVLLLHNGPINKFTLFIPSGFNIPFGC  192



>ref|XP_009607416.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Nicotiana 
tomentosiformis]
Length=191

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 48/88 (55%), Gaps = 12/88 (14%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            I +LP DIL ++L L+P  +AAR ++LS  W ++W  +  L F   FF     +Y  ++ 
Sbjct  17   IGDLPNDILHRVLELMPIQDAARTSILSKRWTHMWSTQPHLVFDRHFF-----QYVSNKD  71

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKF  316
            D +         +I+++LMQH G I  F
Sbjct  72   DSVA-------SIIHRILMQHTGPILGF  92



>gb|AFK36982.1| unknown [Medicago truncatula]
Length=418

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 55/102 (54%), Gaps = 13/102 (13%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS+LP++++D IL  L   + AR ++LS  WR+IW++   L+F  DFF     K + D  
Sbjct  17   ISDLPSNVIDGILQHLNIRDLARTSILSRKWRDIWISFPWLEFDKDFFDLYDLKDFKDHS  76

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKF------AFNFPFST  340
             ++ I       +I +VL+ HNG I KF       FN PF  
Sbjct  77   PEVCI-------IITEVLLLHNGPINKFTLFIPSGFNIPFGC  111



>ref|XP_009762454.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Nicotiana 
sylvestris]
Length=439

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 55/90 (61%), Gaps = 11/90 (12%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS+LP++++D+IL  + T E A+++VLS  W +IW     +         +L++ +H++ 
Sbjct  27   ISDLPSNVIDEILCRMTTKEIAQMSVLSKKWYHIWSTHPVI---------VLDRQFHEDI  77

Query  233  DDIDIWTSMGFY--VINKVLMQHNGLIRKF  316
            +  D   + G +  ++NK+L+QHNG I KF
Sbjct  78   NQDDSSVTYGGFKNIVNKILLQHNGPIVKF  107



>ref|XP_004305028.1| PREDICTED: putative FBD-associated F-box protein At5g56440-like 
[Fragaria vesca subsp. vesca]
Length=611

 Score = 57.0 bits (136),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 35/93 (38%), Positives = 52/93 (56%), Gaps = 8/93 (9%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP D++  I+ LLP  EAA  +VLST WR+IW   T LDF +D    L +      +
Sbjct  154  ISALPDDLIVSIVSLLPLKEAAATSVLSTRWRHIWTFVTTLDFHHDILFQLRSYKRVRIE  213

Query  233  DDIDIWTSMGFYVINKVLMQHNG----LIRKFA  319
             ++D++ +     +N V+ QH G    L+R +A
Sbjct  214  SELDMYLNW----VNSVMKQHRGPCINLLRVYA  242



>gb|AET04918.2| F-box/RNI/FBD-like domain protein [Medicago truncatula]
Length=481

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 34/88 (39%), Positives = 47/88 (53%), Gaps = 11/88 (13%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS+LP++++D IL  L   +  R +VLS  WR +W+    L+F  DFFC    KY   E 
Sbjct  17   ISDLPSNVIDGILEHLNARDLVRTSVLSRKWRYMWITVPRLEFCQDFFC----KYKDLEA  72

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKF  316
             D+         +I +VL  HNG I KF
Sbjct  73   LDVS-------RIITEVLFLHNGPIYKF  93



>ref|XP_010324854.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Solanum 
lycopersicum]
Length=407

 Score = 56.2 bits (134),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 50/93 (54%), Gaps = 13/93 (14%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            +S LP ++LDKIL  LP  +A + ++LS  W   W+ R ELDF  +F+      Y+++ +
Sbjct  6    LSNLPCNVLDKILGGLPLKDAVKTSILSKDWTYKWVTRAELDFRSEFY-----TYFNENQ  60

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFNFP  331
            + + I        I +VL  H G I KFA   P
Sbjct  61   EAMKI--------IYQVLRLHQGPILKFALERP  85



>ref|XP_009593186.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X3 [Nicotiana tomentosiformis]
Length=430

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 44/88 (50%), Gaps = 11/88 (13%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP D++D IL LLP  EAAR ++LS  WR IW     L    +F   L  K   +  
Sbjct  18   ISALPRDVIDGILELLPVEEAARTSILSKEWRYIWATLPYLVLDKNFCLKLTKKSAFNLI  77

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKF  316
            D ID           K+L+QH G I KF
Sbjct  78   DTID-----------KILLQHTGDIVKF  94



>ref|XP_003630442.1| F-box/FBD/LRR-repeat protein [Medicago truncatula]
Length=380

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 34/88 (39%), Positives = 47/88 (53%), Gaps = 11/88 (13%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS+LP++++D IL  L   +  R +VLS  WR +W+    L+F  DFFC    KY   E 
Sbjct  17   ISDLPSNVIDGILEHLNARDLVRTSVLSRKWRYMWITVPRLEFCQDFFC----KYKDLEA  72

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKF  316
             D+         +I +VL  HNG I KF
Sbjct  73   LDVS-------RIITEVLFLHNGPIYKF  93



>ref|XP_006355223.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Solanum 
tuberosum]
Length=423

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 46/91 (51%), Gaps = 14/91 (15%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS+LP ++LD IL  LP  +A + ++LS  WR  W+ R EL+F Y FF            
Sbjct  12   ISDLPCNVLDGILGCLPLKDAVKTSILSRDWRYKWVTRQELEFDYQFF------------  59

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFN  325
              +    +    +I +VL+ H G I KF+  
Sbjct  60   --VTYACNQATAIIYQVLLLHKGPILKFSLG  88



>ref|XP_009593185.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X2 [Nicotiana tomentosiformis]
Length=473

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 44/88 (50%), Gaps = 11/88 (13%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP D++D IL LLP  EAAR ++LS  WR IW     L    +F   L  K   +  
Sbjct  61   ISALPRDVIDGILELLPVEEAARTSILSKEWRYIWATLPYLVLDKNFCLKLTKKSAFNLI  120

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKF  316
            D ID           K+L+QH G I KF
Sbjct  121  DTID-----------KILLQHTGDIVKF  137



>ref|XP_009593184.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X1 [Nicotiana tomentosiformis]
Length=474

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 44/88 (50%), Gaps = 11/88 (13%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP D++D IL LLP  EAAR ++LS  WR IW     L    +F   L  K   +  
Sbjct  62   ISALPRDVIDGILELLPVEEAARTSILSKEWRYIWATLPYLVLDKNFCLKLTKKSAFNLI  121

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKF  316
            D ID           K+L+QH G I KF
Sbjct  122  DTID-----------KILLQHTGDIVKF  138



>ref|XP_010668248.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Beta 
vulgaris subsp. vulgaris]
Length=447

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 36/99 (36%), Positives = 48/99 (48%), Gaps = 5/99 (5%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP +I  KIL  LP  EAAR +VLS++WR+ W    +L      +  +L      E 
Sbjct  17   ISNLPENITQKILECLPLQEAARTSVLSSHWRHKWAASQQLVLDEKLYTSILKN--RTET  74

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFNFPFSTAKE  349
             DI +  S     +N +L+ H G I KF    P    KE
Sbjct  75   TDISLAYSK---TVNDILLSHVGPIWKFVLYLPSWFPKE  110



>ref|XP_010688381.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
 ref|XP_010688382.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=798

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/101 (31%), Positives = 49/101 (49%), Gaps = 7/101 (7%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS +P ++ DKI+  LP   AA+++VLS  WR  WL+   L F  DF       +    K
Sbjct  21   ISSVPTEVTDKIMKRLPLKTAAKMSVLSRKWRRNWLSHRYLVFDRDF-------WKEQRK  73

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFNFPFSTAKEFS  355
            +    W  +   +I+ +L  HNG ++ F  + P  +    S
Sbjct  74   NGKIEWHKISVIIISNILFLHNGPVQVFHLHIPDGSGDNIS  114



>ref|XP_009611095.1| PREDICTED: putative F-box protein At3g58960 [Nicotiana tomentosiformis]
Length=306

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 48/88 (55%), Gaps = 12/88 (14%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            I +LP DIL ++L L+P  +AA+ ++LS  W  IW  +  L F   FF ++ NK      
Sbjct  2    IGDLPNDILHRVLELIPIQDAAKTSILSKRWTQIWSTQPHLVFDRHFFQYVSNK------  55

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKF  316
             D  + +     +I+K+LMQH G I  F
Sbjct  56   -DASVAS-----IIHKILMQHTGNILGF  77



>gb|EYU30161.1| hypothetical protein MIMGU_mgv1a020306mg, partial [Erythranthe 
guttata]
Length=320

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFF  196
            ISELP +IL +IL  L   EA R +VLS  WRNIW  R  LDF  D F
Sbjct  4    ISELPEEILQRILYFLSQKEAIRTSVLSKSWRNIWCTRPNLDFSDDTF  51



>ref|XP_010688383.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X3 [Beta vulgaris subsp. vulgaris]
Length=769

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 47/93 (51%), Gaps = 7/93 (8%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS +P ++ DKI+  LP   AA+++VLS  WR  WL+   L F  DF       +    K
Sbjct  34   ISSVPTEVTDKIMKRLPLKTAAKMSVLSRKWRRNWLSHRYLVFDRDF-------WKEQRK  86

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFNFP  331
            +    W  +   +I+ +L  HNG ++ F  + P
Sbjct  87   NGKIEWHKISVIIISNILFLHNGPVQVFHLHIP  119



>gb|KEH39881.1| F-box/RNI/FBD-like domain protein [Medicago truncatula]
Length=347

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 46/91 (51%), Gaps = 7/91 (8%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP  ++D+IL L+P  EA R +VLS+ WRN W     L F         +KY     
Sbjct  21   ISCLPGHVIDQILSLMPIKEAVRTSVLSSSWRNKWYTLPNLVFNKHCISVAASKY-----  75

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFN  325
                +  +    +++ VL+QH+G I KF  +
Sbjct  76   --TSVINNKFLRIVDHVLLQHSGPINKFMLS  104



>ref|XP_011074580.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Sesamum 
indicum]
Length=505

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 45/91 (49%), Gaps = 13/91 (14%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP D++D IL  LP  EA R +VLS  WR  W     L FG     +LL KY     
Sbjct  13   ISSLPCDVIDNILKYLPLCEAVRTSVLSREWRYQWETIPCLVFGSTCKVNLLRKYD----  68

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFN  325
                 W S    +I+++L+ H G I KF+  
Sbjct  69   -----WVS----IIDQILLLHKGSITKFSLT  90



>ref|XP_003588811.1| F-box/FBD/LRR-repeat protein [Medicago truncatula]
 gb|AES59062.1| F-box/RNI/FBD-like domain protein [Medicago truncatula]
Length=449

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 46/91 (51%), Gaps = 7/91 (8%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP  ++D+IL L+P  EA R +VLS+ WRN W     L F         +KY     
Sbjct  21   ISCLPGHVIDQILSLMPIKEAVRTSVLSSSWRNKWYTLPNLVFNKHCISVAASKY-----  75

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFN  325
                +  +    +++ VL+QH+G I KF  +
Sbjct  76   --TSVINNKFLRIVDHVLLQHSGPINKFMLS  104



>ref|XP_006365389.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006365390.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X2 [Solanum tuberosum]
Length=432

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 46/88 (52%), Gaps = 13/88 (15%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP ++LD IL  LP  +A + ++LS  WR  W+ R ELDF  +FF      +  DE+
Sbjct  12   ISNLPCNVLDGILGCLPWKDAVKTSILSKDWRYKWVTRQELDFNDEFF----KSFKQDEE  67

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKF  316
                        +I +VL+ H G I KF
Sbjct  68   AK---------RIIYQVLLVHQGPILKF  86



>dbj|BAJ87969.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=211

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 47/96 (49%), Gaps = 13/96 (14%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP  +L  I+ LLPT E AR  +LS+ WR++WL+   L    +  C  L + Y  E+
Sbjct  51   ISSLPDAVLGDIISLLPTDEGARTQILSSKWRHLWLSSAPL----NLDCTHLRERYGRER  106

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFNFPFST  340
                        +I+++L  H G  R+   +   +T
Sbjct  107  ---------AAGIISRILSSHPGPGRRLRIDDGLAT  133



>ref|XP_009770919.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X1 [Nicotiana sylvestris]
Length=235

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 47/93 (51%), Gaps = 13/93 (14%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS L  ++L++IL  LP  +A + +VLS  WR  W+ R +LDF  +FF      + HD+ 
Sbjct  23   ISNLQCNVLEEILGCLPLKDAVKTSVLSKGWRYKWVTRQKLDFSDEFF----RSFAHDQD  78

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFNFP  331
                        +I +VL+ H G I KF    P
Sbjct  79   AKT---------IIYQVLLLHKGQILKFKLGGP  102



>ref|XP_009770920.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X2 [Nicotiana sylvestris]
 ref|XP_009770921.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X2 [Nicotiana sylvestris]
Length=224

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 47/93 (51%), Gaps = 13/93 (14%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS L  ++L++IL  LP  +A + +VLS  WR  W+ R +LDF  +FF      + HD+ 
Sbjct  12   ISNLQCNVLEEILGCLPLKDAVKTSVLSKGWRYKWVTRQKLDFSDEFF----RSFAHDQD  67

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFNFP  331
                        +I +VL+ H G I KF    P
Sbjct  68   AKT---------IIYQVLLLHKGQILKFKLGGP  91



>ref|XP_003562194.1| PREDICTED: FBD-associated F-box protein At5g38590-like [Brachypodium 
distachyon]
Length=448

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 32/94 (34%), Positives = 44/94 (47%), Gaps = 19/94 (20%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            ++ LP DIL KIL  LP  EA R ++LS  WR  W   + LDF + F           E+
Sbjct  11   LASLPTDILCKILSQLPIKEAVRTSILSAQWRYAWCCHSNLDFSFRF-----------EQ  59

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFNFPF  334
            +  +         +  VL QH+GL+    F  PF
Sbjct  60   ESTE--------GVESVLQQHSGLVDNIQFVGPF  85



>emb|CDP00517.1| unnamed protein product [Coffea canephora]
Length=458

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 53/104 (51%), Gaps = 12/104 (12%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYY-HDE  229
            IS LP +++D I V LPT +AAR ++LS+ WR IW     +         +LNK +  D 
Sbjct  32   ISSLPDNVIDHIFVYLPTRDAARTSILSSKWRYIWAGHPNI---------VLNKQFAEDV  82

Query  230  KDDIDIWTSMGFYV--INKVLMQHNGLIRKFAFNFPFSTAKEFS  355
            + +        +YV  ++K+L QH G I KF    P     E+S
Sbjct  83   RGNRSAIEFQQYYVKTVSKILFQHVGPILKFDLQVPDLPLDEYS  126



>ref|NP_001058931.1| Os07g0158900 [Oryza sativa Japonica Group]
 dbj|BAC84338.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF20845.1| Os07g0158900 [Oryza sativa Japonica Group]
 gb|EAZ02834.1| hypothetical protein OsI_24963 [Oryza sativa Indica Group]
 dbj|BAG89305.1| unnamed protein product [Oryza sativa Japonica Group]
Length=496

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 49/91 (54%), Gaps = 5/91 (5%)
 Frame = +2

Query  56   SELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEKD  235
            ++LP DIL  I+  LP  EAAR ++LS++W+ IW +   L+F +      L    HD + 
Sbjct  17   NDLPTDILIGIISRLPIKEAARTSILSSHWKKIWCSHVNLEFSFYSMSPRLASTSHDAR-  75

Query  236  DIDIWTSMGFYVINKVLMQHNGL-IRKFAFN  325
               +   M    +++V  QH+GL ++K A  
Sbjct  76   ---LRMKMFIERVSQVFAQHSGLSVQKIAIQ  103



>ref|XP_004305027.1| PREDICTED: F-box/FBD/LRR-repeat protein At5g56420-like [Fragaria 
vesca subsp. vesca]
Length=472

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 35/93 (38%), Positives = 51/93 (55%), Gaps = 8/93 (9%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP D++  I+ LLP  EAA  +VLST WR+IW   T LDF +D    L +      +
Sbjct  88   ISALPDDLIVSIVSLLPLKEAAATSVLSTRWRHIWTFVTTLDFHHDILFQLRSYKRVRIE  147

Query  233  DDIDIWTSMGFYVINKVLMQHNG----LIRKFA  319
             ++D + +     +N V+ QH G    L+R +A
Sbjct  148  SELDRYLNW----VNNVMKQHRGPSINLLRVYA  176



>ref|XP_003589307.1| F-box/FBD/LRR-repeat protein [Medicago truncatula]
Length=660

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 34/91 (37%), Positives = 48/91 (53%), Gaps = 8/91 (9%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP  I+D+IL +LP  EA R ++LST WR  W     L F  D  C        D  
Sbjct  251  ISSLPGHIIDQILSILPIKEAVRTSILSTKWRYKWATLPNLVF--DSQC------ISDTS  302

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFN  325
            +D+ +  S    +I+ VL+ H+G I+KF  +
Sbjct  303  EDLLVIKSKLSRIIDHVLLLHSGPIKKFKLS  333



>ref|XP_009801908.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X1 [Nicotiana sylvestris]
Length=426

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 48/92 (52%), Gaps = 11/92 (12%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP +++D IL LLP  +AAR ++LS  WR IW+    L     F   L  +  +  K
Sbjct  19   ISALPKNVIDGILELLPVEDAARTSILSKNWRYIWVMLPNLVLNKLFCNKLAARSQYVFK  78

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFNF  328
            D++D           K+L+QH+G I KF  + 
Sbjct  79   DNVD-----------KILLQHSGDIVKFVLDL  99



>gb|EYU25620.1| hypothetical protein MIMGU_mgv1a0241701mg, partial [Erythranthe 
guttata]
Length=253

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFF  196
            IS+LP +IL +IL  L   +A R +VLS  WRNIW  R  LDF  D F
Sbjct  20   ISKLPEEILQRILYFLSQKQAVRTSVLSKSWRNIWCTRPNLDFSDDTF  67



>emb|CAN72282.1| hypothetical protein VITISV_043941 [Vitis vinifera]
Length=397

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 51/91 (56%), Gaps = 10/91 (11%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCH-LLNKYYHDE  229
            IS LP D+LD ILV LP  +AAR ++LS+ WR  W++ ++  F    F + LLNK     
Sbjct  13   ISNLPWDVLDAILVHLPLKDAARTSILSSKWRYKWISLSQFVFDDKCFSNTLLNK-----  67

Query  230  KDDIDIWTSMGFYVINKVLMQHNGLIRKFAF  322
               +D W  +   +I++V   H+G I KF  
Sbjct  68   ---VDRWGEI-MKIIHRVQKNHSGPIEKFKL  94



>gb|EYU22413.1| hypothetical protein MIMGU_mgv1a020807mg, partial [Erythranthe 
guttata]
Length=491

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDF  181
            IS LP D+L  IL  LP  EAAR +VLST WRN+W+ R  L+F
Sbjct  5    ISYLPGDVLRVILYFLPQKEAARTSVLSTAWRNLWIRRKNLEF  47



>ref|XP_003589308.1| F-box/FBD/LRR-repeat protein [Medicago truncatula]
 gb|KEH40078.1| ubiquitin-protein ligase, putative [Medicago truncatula]
Length=428

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 34/91 (37%), Positives = 48/91 (53%), Gaps = 8/91 (9%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP  I+D+IL +LP  EA R ++LST WR  W     L F  D  C        D  
Sbjct  19   ISSLPGHIIDQILSILPIKEAVRTSILSTKWRYKWATLPNLVF--DSQC------ISDTS  70

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFN  325
            +D+ +  S    +I+ VL+ H+G I+KF  +
Sbjct  71   EDLLVIKSKLSRIIDHVLLLHSGPIKKFKLS  101



>ref|XP_004239345.1| PREDICTED: F-box/LRR-repeat protein At3g26922-like [Solanum lycopersicum]
Length=401

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 34/88 (39%), Positives = 45/88 (51%), Gaps = 12/88 (14%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            ISELP   L +IL L+P   AAR ++LS +WR +W  +  L F   FF H+ N    D  
Sbjct  18   ISELPIGALHRILELMPIKYAARSSILSKHWRQLWSTQPNLVFDPMFFQHVSNT--EDSA  75

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKF  316
              I          I+K+LM+H G I  F
Sbjct  76   ASI----------IHKILMKHTGDILGF  93



>ref|XP_010681320.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010681321.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Beta 
vulgaris subsp. vulgaris]
Length=352

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 50/93 (54%), Gaps = 8/93 (9%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS+LP D++ K L  LP  +AAR+  LS  W +IW +   L F + FF  +L       K
Sbjct  19   ISDLPRDVIYKTLERLPLKDAARMCFLSHKWHDIWTSNPYLVFNHAFFESVL-------K  71

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFNFP  331
            ++I   T     +++K+L QH G I KFA   P
Sbjct  72   EEIR-KTDKLHSIVSKILFQHEGPILKFALYVP  103



>ref|XP_002278942.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X1 [Vitis vinifera]
 ref|XP_010660533.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X1 [Vitis vinifera]
Length=425

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 51/91 (56%), Gaps = 10/91 (11%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCH-LLNKYYHDE  229
            IS LP D+LD ILV LP  +AAR ++LS+ WR  W++ ++  F    F + LLNK     
Sbjct  13   ISNLPWDVLDAILVHLPLKDAARTSILSSKWRYKWISLSQFVFDDKCFSNTLLNK-----  67

Query  230  KDDIDIWTSMGFYVINKVLMQHNGLIRKFAF  322
               +D W  +   +I++V   H+G I KF  
Sbjct  68   ---VDRWGEI-MKIIHRVQKNHSGPIEKFKL  94



>ref|XP_007020971.1| Uncharacterized protein TCM_030985 [Theobroma cacao]
 gb|EOY12496.1| Uncharacterized protein TCM_030985 [Theobroma cacao]
Length=816

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 31/92 (34%), Positives = 47/92 (51%), Gaps = 7/92 (8%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP D+L   L  LPT EA R +VLST W+ +W++   L      F  LL  Y H  +
Sbjct  36   ISNLPEDVLVHSLSFLPTKEAIRTSVLSTRWQTLWMSLPNLT-----FTDLL--YLHSNQ  88

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFNF  328
            D +    +    ++++ +  HN  IRK + + 
Sbjct  89   DRVPELRASFMKLVDRSIHHHNACIRKLSLSL  120


 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDF  181
            IS LP D+L  IL  +PT EA R +VLST W+N+W++   L F
Sbjct  482  ISSLPDDVLVHILSFIPTKEAVRTSVLSTRWKNLWISLPNLTF  524



>gb|EAZ02849.1| hypothetical protein OsI_24979 [Oryza sativa Indica Group]
Length=510

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 53/92 (58%), Gaps = 15/92 (16%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            + +L  DIL++I+ LLP  EAAR +VLS +W+NIW +R  L F    F  +L+ ++H ++
Sbjct  26   LGDLHTDILNRIISLLPLKEAARTSVLSNHWKNIWCSRESLVFR---FYTVLSMHHHIKR  82

Query  233  DDIDIWTSMGFYV--------INKVLMQHNGL  304
                 WTS G  +        ++ VL Q +GL
Sbjct  83   ----CWTSDGQRLNKELFIERVDSVLKQRSGL  110



>ref|XP_009594964.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Nicotiana 
tomentosiformis]
Length=433

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 48/91 (53%), Gaps = 13/91 (14%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP +++D IL  LP  +A + ++LS  WR  W+ R ELDF  +FF     K + +++
Sbjct  12   ISNLPCNVVDGILGCLPLKDAVKTSILSKDWRYKWVTRQELDFSDEFF-----KSFKEKQ  66

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFN  325
            +           +I +VL+ H G I KF   
Sbjct  67   E--------AKAIIYQVLLLHRGPILKFKLG  89



>gb|EYU42995.1| hypothetical protein MIMGU_mgv1a024012mg, partial [Erythranthe 
guttata]
Length=445

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGY  187
            ISELP D+L KIL  L   EAAR +VLS  WR IW  R  LDF Y
Sbjct  4    ISELPDDVLRKILYFLSQEEAARTSVLSKPWRYIWCTRPNLDFSY  48



>gb|EYU42996.1| hypothetical protein MIMGU_mgv1a026224mg, partial [Erythranthe 
guttata]
Length=409

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGY  187
            ISELP D+L KIL  L   EAAR ++LS  WR IW  R  LDF Y
Sbjct  8    ISELPKDVLRKILYFLSQEEAARTSILSKPWRYIWCTRPNLDFSY  52



>gb|EYU30160.1| hypothetical protein MIMGU_mgv1a023705mg, partial [Erythranthe 
guttata]
Length=279

 Score = 52.8 bits (125),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFF  196
            ISELP DIL +IL  +   +A R +VLS  WRNIW  R  LDF  + F
Sbjct  17   ISELPEDILQRILYFVSQDDAVRTSVLSKSWRNIWCTRPNLDFSDNTF  64



>gb|KEH40079.1| ubiquitin-protein ligase, putative [Medicago truncatula]
Length=499

 Score = 53.5 bits (127),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 34/91 (37%), Positives = 48/91 (53%), Gaps = 8/91 (9%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP  I+D+IL +LP  EA R ++LST WR  W     L F  D  C        D  
Sbjct  90   ISSLPGHIIDQILSILPIKEAVRTSILSTKWRYKWATLPNLVF--DSQC------ISDTS  141

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFN  325
            +D+ +  S    +I+ VL+ H+G I+KF  +
Sbjct  142  EDLLVIKSKLSRIIDHVLLLHSGPIKKFKLS  172



>ref|XP_006289902.1| hypothetical protein CARUB_v10003518mg [Capsella rubella]
 gb|EOA22800.1| hypothetical protein CARUB_v10003518mg [Capsella rubella]
Length=449

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHL  205
            +SELP  ++ +IL+ LPT ++ + +VLST W+N+WLN   LD   + FC++
Sbjct  7    LSELPEHLITQILLCLPTKDSVKTSVLSTRWKNLWLNVPGLDLNRNDFCNV  57



>gb|EYU35742.1| hypothetical protein MIMGU_mgv1a023364mg, partial [Erythranthe 
guttata]
Length=82

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 28/48 (58%), Gaps = 0/48 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFF  196
            IS LP  IL +IL  L   E  R++VLS  WRNIW  R  LDF  + F
Sbjct  4    ISMLPEHILQRILYFLSQTEVVRISVLSKSWRNIWCTRPNLDFSINAF  51



>ref|XP_004246222.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Solanum 
lycopersicum]
Length=184

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 45/87 (52%), Gaps = 13/87 (15%)
 Frame = +2

Query  56   SELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEKD  235
            + LP DILD IL  LP  +AA+ ++LS  WR  W  R EL+F Y FF      ++ + K 
Sbjct  14   NNLPRDILDGILGRLPLKDAAKSSILSKDWRYKWATRKELEFDYHFFESF--AHFQEAKT  71

Query  236  DIDIWTSMGFYVINKVLMQHNGLIRKF  316
                       +I +VL+ H G I KF
Sbjct  72   -----------IIYQVLLLHKGPILKF  87



>tpg|DAA60249.1| TPA: hypothetical protein ZEAMMB73_859710 [Zea mays]
Length=486

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 33/103 (32%), Positives = 50/103 (49%), Gaps = 20/103 (19%)
 Frame = +2

Query  53   ISELPADILD-KILVLLPTIEAARLAVLSTYWRNIWLNRT-ELDFGYDFFCHLLNKYYHD  226
            IS LP  ++  +I+  LP  +AARL +LST WRNIW +    LD            YYHD
Sbjct  9    ISNLPDCVIGGEIITRLPVADAARLQILSTRWRNIWRSSPLNLDLPVPI-------YYHD  61

Query  227  EKDDIDIWTSMGFYVINKVLMQHNGLIRKFAFNFPFSTAKEFS  355
             KD           +++ +L  H G  R+   ++P+   + +S
Sbjct  62   YKD-----------IVSTILAAHPGPARRLKVDWPYDDGESYS  93



>ref|XP_002459698.1| hypothetical protein SORBIDRAFT_02g009030 [Sorghum bicolor]
 gb|EER96219.1| hypothetical protein SORBIDRAFT_02g009030 [Sorghum bicolor]
Length=465

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 49/90 (54%), Gaps = 14/90 (16%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP +IL +I+ LLPT++ AR   LS+ W ++WL+   L+F Y   C L  K  HD+K
Sbjct  32   ISRLPNNILGEIISLLPTMDCARTKCLSSKWSDLWLS-GPLNFDY---CDL--KDPHDDK  85

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAF  322
            D + I        I+ +   H G  R+F  
Sbjct  86   DLVSI--------ISSIFNAHPGPARRFCI  107



>gb|EYU44093.1| hypothetical protein MIMGU_mgv1a025180mg [Erythranthe guttata]
Length=464

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFF  196
            IS+LP +IL +IL  L   +A R +VLS  WRNIW  R  LDF  D F
Sbjct  4    ISKLPEEILQRILYFLSQKQAVRTSVLSKSWRNIWCTRPNLDFSDDTF  51



>gb|EYU30252.1| hypothetical protein MIMGU_mgv1a018436mg [Erythranthe guttata]
Length=86

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 28/45 (62%), Gaps = 0/45 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGY  187
            ISELP DIL +IL  L   EA R +VLS  WR+IW  R  LD  +
Sbjct  11   ISELPKDILQRILYFLSQKEAVRTSVLSKSWRSIWRTRPNLDLDF  55



>ref|XP_002461443.1| hypothetical protein SORBIDRAFT_02g002776 [Sorghum bicolor]
 gb|EER97964.1| hypothetical protein SORBIDRAFT_02g002776 [Sorghum bicolor]
Length=462

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 36/103 (35%), Positives = 54/103 (52%), Gaps = 9/103 (9%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCH--LLNKYYHD  226
            IS +P DIL KIL L+   EAA    LS+ WR++W N  +L      F    L N  Y  
Sbjct  62   ISAMPDDILVKILSLVTIREAAMTDCLSSRWRHLWENIHQLSLKARAFGMQVLPNSNY--  119

Query  227  EKDDIDIWTSMG---FYVINKVLMQHNGL-IRKFAFNFPFSTA  343
              ++ D+W S      + +N++L  HNG  +++F   FP ++A
Sbjct  120  -LENPDLWNSEATKFVHKVNELLRHHNGSGVQEFKVQFPLTSA  161



>ref|XP_009591794.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Nicotiana 
tomentosiformis]
Length=425

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 46/91 (51%), Gaps = 11/91 (12%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP +++D IL LLP  +AAR ++LS  WR IW     L     F   L  +  +  K
Sbjct  19   ISTLPRNVIDGILELLPVEDAARTSILSNNWRYIWAMLPNLVLNKLFCNKLAARSQYVFK  78

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFN  325
            D ID           K+L+QH+G I KF  +
Sbjct  79   DTID-----------KILLQHSGDIVKFVLD  98



>gb|EYU30210.1| hypothetical protein MIMGU_mgv1a021323mg, partial [Erythranthe 
guttata]
Length=307

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFF  196
            IS+LP DIL +IL  L   +A R +VLS  WR+IW  R  LDF  D F
Sbjct  4    ISDLPKDILQRILYFLSQEDAVRTSVLSKSWRDIWCTRPNLDFSSDNF  51



>ref|XP_007214334.1| hypothetical protein PRUPE_ppb023005mg, partial [Prunus persica]
 gb|EMJ15533.1| hypothetical protein PRUPE_ppb023005mg, partial [Prunus persica]
Length=204

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYH  223
            ISELP  +L +IL  LPT+ A R  VLST   N+W   + LDF  + FC L  +++ 
Sbjct  25   ISELPDALLCRILSFLPTMWAVRTTVLSTRLNNVWTCVSNLDFAAENFCCLRRRHFE  81



>gb|EYU34389.1| hypothetical protein MIMGU_mgv1a020343mg [Erythranthe guttata]
Length=529

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 28/45 (62%), Gaps = 0/45 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGY  187
            ISELP D+L KIL  L   EA R +VLS  WR IW  R  LDF Y
Sbjct  4    ISELPNDVLRKILYFLSQKEATRTSVLSKQWRYIWCTRPNLDFTY  48



>ref|XP_011021144.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Populus 
euphratica]
 ref|XP_011021145.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Populus 
euphratica]
Length=441

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 46/90 (51%), Gaps = 8/90 (9%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP D+LD ILV LP  +AAR ++LS+ WR  W N ++        C+ ++       
Sbjct  31   ISNLPWDVLDTILVRLPLRDAARTSILSSKWRYKWTNISQFILDDKCICNSIS-------  83

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAF  322
            D    W  +   +I++V   HNG I KF  
Sbjct  84   DKASRWIEIR-KIIDQVQSNHNGPIEKFKL  112



>gb|EYU27275.1| hypothetical protein MIMGU_mgv1a020644mg [Erythranthe guttata]
Length=473

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/43 (56%), Positives = 28/43 (65%), Gaps = 0/43 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDF  181
            ISELP DIL +IL  LP   A R +VLS  WR+IW  R+ L F
Sbjct  4    ISELPEDILQRILYFLPQSAAVRTSVLSKSWRHIWCTRSNLSF  46



>ref|XP_004305029.1| PREDICTED: F-box/FBD/LRR-repeat protein At5g53840-like [Fragaria 
vesca subsp. vesca]
Length=572

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 31/83 (37%), Positives = 45/83 (54%), Gaps = 4/83 (5%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP D++  I+ LLP  EA   +VLST WR+IW   T LDF +D    L +      +
Sbjct  109  ISALPDDLIVSIVSLLPLKEATATSVLSTRWRHIWTFVTTLDFHHDILFQLRSYKRVRIE  168

Query  233  DDIDIWTSMGFYVINKVLMQHNG  301
             ++D + +     +N V+ QH G
Sbjct  169  SELDRYLNW----VNSVMKQHRG  187



>ref|XP_006407053.1| hypothetical protein EUTSA_v10022020mg [Eutrema salsugineum]
 gb|ESQ48506.1| hypothetical protein EUTSA_v10022020mg [Eutrema salsugineum]
Length=440

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 28/43 (65%), Gaps = 0/43 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDF  181
            IS+LP  IL  IL  LPT+EA R  VLS  WR IW N TEL F
Sbjct  20   ISDLPDSILSMILSHLPTVEAVRTCVLSKTWRTIWTNVTELRF  62



>ref|XP_009621103.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Nicotiana 
tomentosiformis]
 ref|XP_009621104.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Nicotiana 
tomentosiformis]
Length=272

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 46/91 (51%), Gaps = 11/91 (12%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP ++ D+IL LLP  +AAR ++LS  WR IW     L   Y FF  L+ +     K
Sbjct  18   ISGLPRNVTDRILELLPAQDAARTSILSRNWRYIWATLPNLVLDYQFFHELIEEPESKLK  77

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFN  325
                        V++++L+ H G I KF  +
Sbjct  78   Q-----------VVDEILLLHMGDIVKFILD  97



>gb|EAZ38766.1| hypothetical protein OsJ_23168 [Oryza sativa Japonica Group]
Length=495

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 50/86 (58%), Gaps = 15/86 (17%)
 Frame = +2

Query  71   DILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEKDDIDIW  250
            DIL++I+ LLP  EAAR +VLS +W+NIW +R  L F    F  +L+ ++H ++     W
Sbjct  43   DILNRIISLLPLKEAARTSVLSNHWKNIWCSRESLVFR---FYTVLSMHHHIKR----CW  95

Query  251  TSMGFYV--------INKVLMQHNGL  304
            TS G  +        ++ VL Q +GL
Sbjct  96   TSDGQRLNKELFIERVDSVLKQRSGL  121



>dbj|BAC79641.1| unknown protein [Oryza sativa Japonica Group]
Length=506

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 50/86 (58%), Gaps = 15/86 (17%)
 Frame = +2

Query  71   DILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEKDDIDIW  250
            DIL++I+ LLP  EAAR +VLS +W+NIW +R  L F    F  +L+ ++H ++     W
Sbjct  54   DILNRIISLLPLKEAARTSVLSNHWKNIWCSRESLVFR---FYTVLSMHHHIKR----CW  106

Query  251  TSMGFYV--------INKVLMQHNGL  304
            TS G  +        ++ VL Q +GL
Sbjct  107  TSDGQRLNKELFIERVDSVLKQRSGL  132



>gb|KDP24339.1| hypothetical protein JCGZ_25635 [Jatropha curcas]
Length=421

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 45/90 (50%), Gaps = 8/90 (9%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP D+LD ILV LP  EAAR ++LS  WR  W   ++  F +D  C           
Sbjct  10   ISNLPWDVLDSILVHLPLREAARTSILSRKWRYKWTGLSQ--FVFDDKC-----IRSSLS  62

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAF  322
            D +  W  +   +INKV   H+G I KF  
Sbjct  63   DKVARWVEI-MKIINKVRFYHSGPIEKFKL  91



>ref|XP_010105226.1| hypothetical protein L484_012341 [Morus notabilis]
 gb|EXC04104.1| hypothetical protein L484_012341 [Morus notabilis]
Length=365

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 45/90 (50%), Gaps = 9/90 (10%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS+L   I +KIL  LP  +A R ++LS+ WR  W + T+L FG D  C     Y HD++
Sbjct  10   ISDLRESITEKILTHLPIRDAVRTSILSSKWRYNWASITQLVFGED--CGYSFNYLHDDQ  67

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAF  322
              +          I K L+ H GLI  F  
Sbjct  68   KRL-------IEFITKALLLHQGLIHSFQL  90



>gb|EYU31508.1| hypothetical protein MIMGU_mgv1a024186mg [Erythranthe guttata]
Length=512

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFG  184
            ISELP DIL +IL  L   +A R +VLS  WRNIW  R  LDF 
Sbjct  4    ISELPKDILHRILYFLSQKDAVRTSVLSKSWRNIWCTRPNLDFS  47



>ref|XP_006339772.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Solanum 
tuberosum]
Length=434

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 45/88 (51%), Gaps = 13/88 (15%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            I  LP  +LD IL  LP  +A + ++LS  WR  W+ R ELDF  +FF     K +  +K
Sbjct  12   IGNLPCSVLDAILRCLPWRDAVKTSILSKDWRYKWVTRQELDFNDEFF-----KSFKQDK  66

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKF  316
            +           +I +VL+ H G I KF
Sbjct  67   E--------AKRIIYQVLLVHKGPILKF  86



>ref|XP_006377716.1| hypothetical protein POPTR_0011s10510g [Populus trichocarpa]
 ref|XP_006377717.1| hypothetical protein POPTR_0011s10510g [Populus trichocarpa]
 gb|ERP55513.1| hypothetical protein POPTR_0011s10510g [Populus trichocarpa]
 gb|ERP55514.1| hypothetical protein POPTR_0011s10510g [Populus trichocarpa]
Length=378

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 53/102 (52%), Gaps = 9/102 (9%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP  +L  IL  L  ++  +  VLS  W N+W +   LDF ++ F  L++ YY+D  
Sbjct  18   ISTLPNVLLHHILSFLDAVQVVQTCVLSKRWMNVWKSHPYLDFNFETFSSLISSYYYD--  75

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFNFPFSTAKEFSY  358
            DD++ +T      I+ VL++ N +    AF     T ++  Y
Sbjct  76   DDMNNFTDF----ISHVLVRRNNVK---AFKLSLDTRRDCQY  110



>ref|XP_011078662.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Sesamum 
indicum]
Length=438

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 45/90 (50%), Gaps = 13/90 (14%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP D++D IL  LP  +A R +VLS  WR  W     L FG     +LL +Y     
Sbjct  13   ISSLPCDVIDNILKYLPLCDAVRTSVLSREWRYNWETIPCLIFGSTCKVNLLRRYD----  68

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAF  322
                 W S    +I+++L+ H G I KF+ 
Sbjct  69   -----WVS----IIDQILLLHKGSITKFSL  89



>ref|XP_010445828.1| PREDICTED: putative FBD-associated F-box protein At5g44940 [Camelina 
sativa]
Length=195

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFF  196
            ISELP  ++ +IL+ LPT ++ + +VLST WRN+WLN   LD   D F
Sbjct  6    ISELPEFLITQILLWLPTKDSVKTSVLSTKWRNLWLNVPGLDLNSDDF  53



>ref|XP_008227423.1| PREDICTED: F-box/FBD/LRR-repeat protein At5g22700-like isoform 
X1 [Prunus mume]
Length=525

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 32/84 (38%), Positives = 47/84 (56%), Gaps = 1/84 (1%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHL-LNKYYHDE  229
            ISELP +IL  I+ LLP  EAA  +VLS  W+ +W + T L+F   F  H  L +++  +
Sbjct  59   ISELPDEILFSIVSLLPLKEAAATSVLSKRWQYVWTSTTTLNFDAKFEVHENLWRFFQMK  118

Query  230  KDDIDIWTSMGFYVINKVLMQHNG  301
             +  D+ T      +N V+ QH G
Sbjct  119  PELKDLETRRYIDWVNTVVEQHRG  142



>ref|XP_003566583.1| PREDICTED: putative F-box/FBD/LRR-repeat protein At5g22670 [Brachypodium 
distachyon]
Length=473

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 34/91 (37%), Positives = 49/91 (54%), Gaps = 17/91 (19%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDF-FCHLLNKYYHDE  229
            ISELP  IL  I+ LLPT + AR  VLS  WR +WL+ T LD   ++  C      ++D 
Sbjct  35   ISELPDAILCTIISLLPTKDGARTQVLSRRWRPLWLS-TPLDLDANYRIC------FNDF  87

Query  230  KDDIDIWTSMGFYVINKVLMQHNGLIRKFAF  322
            K          F +++++L  H G +R+F F
Sbjct  88   KR---------FSIVSQILYDHPGPVRRFHF  109



>gb|KEH16332.1| F-box/RNI superfamily protein, partial [Medicago truncatula]
Length=338

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/94 (32%), Positives = 48/94 (51%), Gaps = 9/94 (10%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS+LP +++D IL  L   E    ++LS  WR +W +  +L F  DFFC    +  +D  
Sbjct  17   ISDLPCNVIDGILERLNIQELVSTSLLSRKWRYMWNSVPQLQFCEDFFCRF--EDLNDPG  74

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFNFPF  334
             +I         +I ++L+ HNG I +F  + P 
Sbjct  75   PEIS-------RIITEILLLHNGPIYRFILDIPL  101



>ref|XP_006373510.1| hypothetical protein POPTR_0017s14390g [Populus trichocarpa]
 gb|ERP51307.1| hypothetical protein POPTR_0017s14390g [Populus trichocarpa]
Length=441

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 46/90 (51%), Gaps = 8/90 (9%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP D+LD ILV LP  +AAR ++LS+ WR  W N ++  F  D  C      ++   
Sbjct  31   ISNLPWDVLDTILVCLPLRDAARTSILSSKWRYKWTNLSQ--FILDDKC-----IHYSIS  83

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAF  322
            D    W  +   +I+ V   HNG I KF  
Sbjct  84   DKTSRWIEIR-KIIDHVQSNHNGPIEKFKL  112



>ref|XP_004490303.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Cicer 
arietinum]
Length=399

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 52/93 (56%), Gaps = 9/93 (10%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS+LP++++D IL  L  ++  + ++LS  WR +W++  +L F  DFF  ++ ++  D  
Sbjct  17   ISDLPSNVIDAILEHLNIVDLVKTSILSRKWRYMWMSVQQLVFKRDFF--IMFEHLDDPG  74

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFNFP  331
             +          +I+K+L+ HNG I KF    P
Sbjct  75   PE-------ASRIISKILLLHNGPIYKFTLFLP  100



>gb|EYU30180.1| hypothetical protein MIMGU_mgv1a021107mg [Erythranthe guttata]
Length=480

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 29/48 (60%), Gaps = 0/48 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFF  196
            ISELP  IL +IL  L   +A R +VLS  WRNIW  R  LDF  + F
Sbjct  4    ISELPKHILQRILYFLSQEDAVRTSVLSKLWRNIWCTRPNLDFSDNTF  51



>emb|CDX98131.1| BnaA06g08820D [Brassica napus]
Length=440

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 29/48 (60%), Gaps = 0/48 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFF  196
            ISELP  +L  IL  LPT  +   +VLST W+N+WLN   LD   D F
Sbjct  8    ISELPESLLTHILSFLPTSHSVETSVLSTRWKNLWLNVPALDLNCDHF  55



>ref|XP_009148668.1| PREDICTED: FBD-associated F-box protein At5g27750-like [Brassica 
rapa]
Length=437

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 29/48 (60%), Gaps = 0/48 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFF  196
            ISELP  +L  IL  LPT  +   +VLST W+N+WLN   LD   D F
Sbjct  8    ISELPESLLTHILSFLPTSHSVETSVLSTRWKNLWLNVPALDLNCDHF  55



>ref|XP_009793685.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Nicotiana 
sylvestris]
Length=393

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 32/88 (36%), Positives = 45/88 (51%), Gaps = 12/88 (14%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            I +LP DI  +IL  +P   AAR ++LS  W  IW  +  L F + FF ++ N       
Sbjct  18   IGDLPTDIKQRILEYMPIQVAARTSILSKRWPYIWSTQPNLVFDHHFFQYVSNNR-----  72

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKF  316
                   S G  +I+K+LM+H GLI  F
Sbjct  73   ------ASAG-RIIHKILMRHTGLILGF  93



>ref|XP_008227424.1| PREDICTED: F-box/FBD/LRR-repeat protein At5g22700-like isoform 
X2 [Prunus mume]
Length=491

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 32/84 (38%), Positives = 47/84 (56%), Gaps = 1/84 (1%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHL-LNKYYHDE  229
            ISELP +IL  I+ LLP  EAA  +VLS  W+ +W + T L+F   F  H  L +++  +
Sbjct  25   ISELPDEILFSIVSLLPLKEAAATSVLSKRWQYVWTSTTTLNFDAKFEVHENLWRFFQMK  84

Query  230  KDDIDIWTSMGFYVINKVLMQHNG  301
             +  D+ T      +N V+ QH G
Sbjct  85   PELKDLETRRYIDWVNTVVEQHRG  108



>ref|XP_003588839.1| F-box/FBD/LRR-repeat protein [Medicago truncatula]
Length=532

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 48/93 (52%), Gaps = 6/93 (6%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP  ++D+IL  LP  EA + +VLS+ WRN W     + F  +   ++      +  
Sbjct  58   ISCLPGHVIDQILSYLPIREAVKTSVLSSEWRNKWHTLPNIVFDLNCVSNI------EAI  111

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFNFP  331
             D  I+ S    +++ VL+ H+G I KF  + P
Sbjct  112  KDPSIFMSKLLRIVDHVLLLHSGPINKFQLSDP  144



>ref|XP_004292956.1| PREDICTED: putative FBD-associated F-box protein At5g56410-like 
[Fragaria vesca subsp. vesca]
Length=473

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 35/93 (38%), Positives = 51/93 (55%), Gaps = 8/93 (9%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP D+L  I+ LL   EAA  +VLST WR+IW   T LDF +D    L +    + +
Sbjct  26   ISALPNDLLVSIVSLLNLKEAAATSVLSTRWRHIWTFVTTLDFHHDVLFRLRSFRRVEIE  85

Query  233  DDIDIWTSMGFYVINKVLMQHNG----LIRKFA  319
             ++D + +     +N V+ QH G    L+R +A
Sbjct  86   SELDRYLNW----VNSVVKQHRGSTIKLLRVYA  114



>gb|KEH39256.1| F-box/FBD/LRR protein [Medicago truncatula]
Length=442

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 47/91 (52%), Gaps = 7/91 (8%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP  ++D+IL  LP  EA R +VLS+ WR  W     L F  D  C          +
Sbjct  23   ISCLPGHVIDQILSCLPIREAVRTSVLSSQWRYKWYTLPNLVF--DRRC----VSARGSQ  76

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFN  325
            D +DI   +   +++ VL+ H+G I KF F+
Sbjct  77   DPLDIENKL-LKIVDHVLLLHSGPINKFEFS  106



>ref|XP_004962085.1| PREDICTED: putative F-box protein At3g58860-like [Setaria italica]
Length=424

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 43/92 (47%), Gaps = 10/92 (11%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP  I DKIL  LP  EA    +LS  WR  W + TEL F  D F         D  
Sbjct  20   ISNLPDVIKDKILCCLPIKEAVGTCLLSRKWRYTWASMTELTFREDDF---------DLG  70

Query  233  DDIDIWTSMGF-YVINKVLMQHNGLIRKFAFN  325
            + I+   S  F Y I  VL  HNG I KF  N
Sbjct  71   NGIEEGESNKFVYFIIMVLSLHNGPILKFELN  102



>gb|AES59090.2| F-box/RNI/FBD-like domain protein [Medicago truncatula]
Length=477

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 48/93 (52%), Gaps = 6/93 (6%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP  ++D+IL  LP  EA + +VLS+ WRN W     + F  +   ++      +  
Sbjct  58   ISCLPGHVIDQILSYLPIREAVKTSVLSSEWRNKWHTLPNIVFDLNCVSNI------EAI  111

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFNFP  331
             D  I+ S    +++ VL+ H+G I KF  + P
Sbjct  112  KDPSIFMSKLLRIVDHVLLLHSGPINKFQLSDP  144



>ref|XP_004292758.1| PREDICTED: FBD-associated F-box protein At4g10400-like [Fragaria 
vesca subsp. vesca]
Length=405

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 28/43 (65%), Gaps = 0/43 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDF  181
            ISELP +IL  IL  LPTI A R  VLST W N+W +   LDF
Sbjct  25   ISELPDEILCHILSFLPTIHAVRTTVLSTRWNNLWFSVPSLDF  67



>ref|XP_006828595.1| hypothetical protein AMTR_s00129p00054950 [Amborella trichopoda]
 gb|ERM96011.1| hypothetical protein AMTR_s00129p00054950 [Amborella trichopoda]
Length=504

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 35/99 (35%), Positives = 51/99 (52%), Gaps = 16/99 (16%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP  IL+ IL LLP+ EA R  +LST WR +W +   LD  +       N    + K
Sbjct  51   ISCLPDVILNSILALLPSKEAVRTCILSTRWRFLWTSIPNLDLEW-------NPRDSECK  103

Query  233  DDIDIWTSMGFYV--INKVLMQHNGLIRKFAFNFPFSTA  343
            ++       G ++  I++VL  H G I KF  ++PF  +
Sbjct  104  NE-------GTFIQWIDRVLRIHQGPIHKFRLSWPFQIS  135



>ref|XP_010424373.1| PREDICTED: FBD-associated F-box protein At5g27750-like [Camelina 
sativa]
Length=455

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDF  181
            +SELP  ++ +IL+ LPT E+A+ +VLST W+N+WLN   LD 
Sbjct  7    LSELPESLITQILLCLPTKESAKTSVLSTRWKNLWLNVPGLDL  49



>gb|EYU23721.1| hypothetical protein MIMGU_mgv1a019171mg, partial [Erythranthe 
guttata]
Length=442

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDF  181
            ISELP DIL  IL LLP   AAR ++LS+ W N+W N + LDF
Sbjct  13   ISELPDDILVTILHLLPMKAAARTSILSSRWINLWKNISSLDF  55



>ref|XP_006843912.1| hypothetical protein AMTR_s00007p00268900 [Amborella trichopoda]
 gb|ERN05587.1| hypothetical protein AMTR_s00007p00268900 [Amborella trichopoda]
Length=566

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 33/91 (36%), Positives = 45/91 (49%), Gaps = 9/91 (10%)
 Frame = +2

Query  56   SELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEKD  235
            S LP +IL+ IL  LPT EA R +VLS  W+ +W     LDF  + FC         EK 
Sbjct  67   SSLPDNILNSILSYLPTKEAVRTSVLSNRWKYMWTGILVLDFDENCFCGKGENSRKREK-  125

Query  236  DIDIWTSMGFYVINKVLMQHNGLIRKFAFNF  328
                   +G  ++N+VL  H G + +F   F
Sbjct  126  ------MVG--IVNRVLKLHFGHVERFKLVF  148



>gb|EYU30182.1| hypothetical protein MIMGU_mgv1a026803mg [Erythranthe guttata]
Length=339

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFG  184
            IS+LP DIL +IL  L   +A R +VLS  WRNIW  R  LDF 
Sbjct  4    ISDLPKDILQRILYFLSQEDAVRTSVLSKSWRNIWCTRPNLDFS  47



>ref|XP_006348791.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Solanum 
tuberosum]
Length=412

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 29/94 (31%), Positives = 48/94 (51%), Gaps = 9/94 (10%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            + +LP ++LD+IL+ LP  +  R ++LS  WRN+W     L   +          +  E+
Sbjct  15   LCDLPRNVLDEILMCLPFRDVVRTSILSKKWRNLWHGLPVLTLSHTL--------WKPEE  66

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFNFPF  334
            D  D+ TS    +IN +L+ H G + KF    P+
Sbjct  67   DLADL-TSNLVKIINHILIFHTGPVTKFTLCVPY  99



>gb|EYU30197.1| hypothetical protein MIMGU_mgv1a024274mg, partial [Erythranthe 
guttata]
Length=263

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 29/48 (60%), Gaps = 0/48 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFF  196
            ISELP  IL +IL  L   EA R +VLS  W NIW  R  LDF ++ F
Sbjct  4    ISELPKHILQRILYFLSQKEAVRTSVLSKSWGNIWCTRPNLDFLFNNF  51



>ref|XP_009801909.1| PREDICTED: putative F-box/FBD/LRR-repeat protein At5g56810 isoform 
X2 [Nicotiana sylvestris]
Length=268

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 44/83 (53%), Gaps = 11/83 (13%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP +++D IL LLP  +AAR ++LS  WR IW+    L     F   L  +  +  K
Sbjct  19   ISALPKNVIDGILELLPVEDAARTSILSKNWRYIWVMLPNLVLNKLFCNKLAARSQYVFK  78

Query  233  DDIDIWTSMGFYVINKVLMQHNG  301
            D++D           K+L+QH+G
Sbjct  79   DNVD-----------KILLQHSG  90



>ref|XP_010325642.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X1 [Solanum lycopersicum]
Length=442

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 46/88 (52%), Gaps = 13/88 (15%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP ++LD IL  LP  +A + ++LS  W+  W+ R ELDF  +F+      +  DE+
Sbjct  24   ISNLPCNVLDVILGCLPWKDAVKTSILSKDWKYKWVTRQELDFNDEFY----KSFKQDEE  79

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKF  316
                        +I +VL+ H G I KF
Sbjct  80   AK---------RIIYQVLLVHKGPILKF  98



>gb|EYU22412.1| hypothetical protein MIMGU_mgv1a006705mg [Erythranthe guttata]
Length=434

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFF  196
            ISELP DIL +IL  L   EA R++VLS  WR  W  RT LD  Y+ F
Sbjct  4    ISELPRDILQQILNFLSQKEAVRISVLSKSWRYNWCIRTNLDLSYNNF  51



>ref|XP_010325643.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X2 [Solanum lycopersicum]
Length=430

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 46/88 (52%), Gaps = 13/88 (15%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP ++LD IL  LP  +A + ++LS  W+  W+ R ELDF  +F+      +  DE+
Sbjct  12   ISNLPCNVLDVILGCLPWKDAVKTSILSKDWKYKWVTRQELDFNDEFY----KSFKQDEE  67

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKF  316
                        +I +VL+ H G I KF
Sbjct  68   AK---------RIIYQVLLVHKGPILKF  86



>ref|XP_009761512.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Nicotiana 
sylvestris]
Length=294

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 54/106 (51%), Gaps = 8/106 (8%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP +++  IL  +P  EA R +V S  WR  +LN  +L F  D FC  L+ +  ++ 
Sbjct  18   ISNLPRNLIACILGKMPIREAVRTSVFSKKWRYYYLNIPQLVFD-DQFCKELDDFSVNKG  76

Query  233  DDIDIWTSMGFY----VINKVLMQHNGLIRKFAFNFPFSTAKEFSY  358
             +I    ++ FY    +I K LM H G + +F    PF+ +    Y
Sbjct  77   ANI---YALKFYQFDEIITKSLMLHPGGLERFKVCIPFNPSTVVPY  119



>gb|KEH37794.1| F-box/RNI/FBD-like domain protein [Medicago truncatula]
Length=534

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 44/91 (48%), Gaps = 7/91 (8%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP  ++D+IL  LP  EA R +VLS  WRN W     L F  D  C     Y     
Sbjct  117  ISCLPGHVIDQILTYLPIREAVRTSVLSKKWRNKWYTLPNLVF--DRQCLSAAAY-----  169

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFN  325
            +D  +       ++N VL+ H+G I  F F+
Sbjct  170  EDTLVIQMKFLKIVNSVLLHHSGPINIFKFS  200



>ref|XP_007211593.1| hypothetical protein PRUPE_ppa005417mg [Prunus persica]
 gb|EMJ12792.1| hypothetical protein PRUPE_ppa005417mg [Prunus persica]
Length=462

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 53/93 (57%), Gaps = 8/93 (9%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS+LP ++L  IL  LPT  A R ++LST W+N+W     LDF Y         Y+ ++K
Sbjct  30   ISKLPNEVLCHILSFLPTKYAVRTSILSTRWKNVWAFVPNLDFKY----VEAKSYFFNKK  85

Query  233  DDIDIWTSMGFYV-INKVL-MQHNGLIRKFAFN  325
             D    TS GF+  +++V+ ++ +  I+KF  +
Sbjct  86   KDKS--TSAGFFTFVDRVICLRGSADIKKFCLH  116



>emb|CCD74524.1| F-box family protein [Arabidopsis halleri subsp. halleri]
Length=550

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 26/64 (41%), Positives = 38/64 (59%), Gaps = 11/64 (17%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            +S+LP  +L +IL  LPT ++ R +VLS  WRN+W + + LD G           +HD K
Sbjct  146  LSDLPEYLLCQILSKLPTKDSVRTSVLSPRWRNLWSHVSALDLG-----------FHDFK  194

Query  233  DDID  244
            DD+D
Sbjct  195  DDLD  198



>ref|XP_003589313.1| F-box/FBD/LRR-repeat protein [Medicago truncatula]
Length=293

 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 46/91 (51%), Gaps = 8/91 (9%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            +S LP  ++D IL +LP  EAAR ++LST WR  W     L F         N+   +  
Sbjct  30   VSSLPGHVIDHILSILPIKEAARTSILSTNWRYKWTTLPNLVFD--------NECLSETS  81

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFN  325
             D+ +  S    +I+ VL+  +G I+KF  +
Sbjct  82   KDLLVIKSKLSRIIDHVLLLRSGPIKKFKLS  112



>ref|XP_006344294.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Solanum 
tuberosum]
Length=422

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 45/98 (46%), Gaps = 9/98 (9%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            +S+LP  I++ ILV +P ++A R ++LS  WR  W   TEL F         N       
Sbjct  10   LSDLPQSIIESILVKVPLVDAVRTSILSRKWRYKWAAITELVF---------NDTCRTSG  60

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFNFPFSTAK  346
             D  I +      I + L  H+G I KF  N  +S A 
Sbjct  61   HDKSIISCNLVNFITRCLFLHDGPIHKFELNTSYSPAS  98



>gb|AES59564.2| F-box/FBD-like domain protein [Medicago truncatula]
Length=431

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 46/91 (51%), Gaps = 8/91 (9%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            +S LP  ++D IL +LP  EAAR ++LST WR  W     L F         N+   +  
Sbjct  30   VSSLPGHVIDHILSILPIKEAARTSILSTNWRYKWTTLPNLVFD--------NECLSETS  81

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFN  325
             D+ +  S    +I+ VL+  +G I+KF  +
Sbjct  82   KDLLVIKSKLSRIIDHVLLLRSGPIKKFKLS  112



>ref|XP_002459270.1| hypothetical protein SORBIDRAFT_02g001570 [Sorghum bicolor]
 gb|EER95791.1| hypothetical protein SORBIDRAFT_02g001570 [Sorghum bicolor]
Length=417

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 35/106 (33%), Positives = 51/106 (48%), Gaps = 25/106 (24%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP D+L  I+ LLPT + AR  VLS+ WR++W +              LN  +HD  
Sbjct  24   ISSLPDDVLVDIVSLLPTKDGARTQVLSSMWRHLWCSAP------------LNLDFHD--  69

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAF-------NFPFSTAKE  349
            D + I  S     I+ +L  H G +R+F          +P ST ++
Sbjct  70   DHVGIVASD----ISHILSTHPGPVRRFVMPRPCHGKQYPTSTVRD  111



>ref|XP_004505475.1| PREDICTED: putative F-box/FBD/LRR-repeat protein At3g49030-like 
[Cicer arietinum]
Length=253

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDF  181
            ISELP D+L  IL LLPT +A R ++L+T WRN+W   +  DF
Sbjct  25   ISELPEDVLLYILSLLPTKDAVRTSILATKWRNLWTCLSAFDF  67



>gb|EYU31507.1| hypothetical protein MIMGU_mgv1a020990mg [Erythranthe guttata]
Length=522

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFG  184
            +SELP +IL KIL  +   EA R +VLS  WRNIW  R  LDF 
Sbjct  4    LSELPKEILHKILYFMSQKEAVRTSVLSKSWRNIWCTRPNLDFS  47



>ref|XP_008813247.1| PREDICTED: F-box protein At5g03100-like [Phoenix dactylifera]
Length=473

 Score = 50.4 bits (119),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 43/85 (51%), Gaps = 0/85 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP  +L  IL  +PT  A R + L+  WR++W     LD     + +L  K Y + +
Sbjct  8    ISSLPDTLLHNILSRMPTKMAVRTSALAQRWRHLWKAVPVLDLDEGIWEYLKRKKYPNGE  67

Query  233  DDIDIWTSMGFYVINKVLMQHNGLI  307
            D +D  T      +++ L QHNG +
Sbjct  68   DRVDSMTRDYVRFVDQFLRQHNGPV  92



>gb|KCW59707.1| hypothetical protein EUGRSUZ_H02467 [Eucalyptus grandis]
Length=278

 Score = 49.7 bits (117),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 46/88 (52%), Gaps = 10/88 (11%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP  ILD+IL  LP  EA R +VLST WR  W  R+     +D  C   N +    +
Sbjct  12   ISLLPGHILDEILWRLPIKEAGRTSVLSTKWRYRW--RSLPHLWFDNRCTWSNGHGQTSQ  69

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKF  316
            + + I        I++VLM H+G I+ F
Sbjct  70   NLVKI--------IDRVLMLHSGPIQSF  89



>ref|XP_010323653.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Solanum 
lycopersicum]
 ref|XP_010323654.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Solanum 
lycopersicum]
 ref|XP_010323655.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Solanum 
lycopersicum]
 ref|XP_010323656.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Solanum 
lycopersicum]
 ref|XP_010323657.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Solanum 
lycopersicum]
 ref|XP_010323658.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Solanum 
lycopersicum]
 ref|XP_010323659.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Solanum 
lycopersicum]
 ref|XP_010323660.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Solanum 
lycopersicum]
 ref|XP_010323661.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Solanum 
lycopersicum]
Length=426

 Score = 50.4 bits (119),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 50/91 (55%), Gaps = 10/91 (11%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP +++D IL+LLP  +A R +VLS  WR  W  RTEL          L++    ++
Sbjct  18   ISNLPHNVIDVILILLPFKDAVRTSVLSKKWRYHWCRRTELT---------LDESLWKQR  68

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFN  325
            +D++  T     +I+++L  H G I KF  +
Sbjct  69   EDLN-PTVRFREIISQLLTLHEGPITKFTLD  98



>gb|EYU31511.1| hypothetical protein MIMGU_mgv1a021202mg, partial [Erythranthe 
guttata]
Length=340

 Score = 50.1 bits (118),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 27/44 (61%), Gaps = 0/44 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFG  184
            ISELP DIL  IL  L   +A R +VLS  WRNIW  R  LDF 
Sbjct  4    ISELPKDILHIILYFLSQKDAVRTSVLSNSWRNIWCTRPNLDFS  47



>ref|XP_010493976.1| PREDICTED: FBD-associated F-box protein At5g27750-like [Camelina 
sativa]
Length=457

 Score = 50.4 bits (119),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFF  196
            +SELP  ++ +IL+ LPT ++A+ +VLST W+N+WLN   LD     F
Sbjct  7    LSELPESLITQILLCLPTKDSAKTSVLSTRWKNLWLNVPGLDLNRQDF  54



>gb|EYU38949.1| hypothetical protein MIMGU_mgv1a024102mg [Erythranthe guttata]
Length=469

 Score = 50.4 bits (119),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 26/43 (60%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDF  181
            ISELP DIL  IL LLP  EAAR +VLS+ W  +W N + LDF
Sbjct  49   ISELPDDILVTILHLLPLKEAARTSVLSSRWIYLWKNISSLDF  91



>gb|EYU31301.1| hypothetical protein MIMGU_mgv1a018336mg, partial [Erythranthe 
guttata]
Length=344

 Score = 50.1 bits (118),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFG  184
            ISELP DIL +IL  L   +A R +VLS  WRNIW  R  L+F 
Sbjct  16   ISELPQDILQRILYWLSQEDAVRTSVLSKSWRNIWCTRPNLNFS  59



>ref|XP_011044572.1| PREDICTED: F-box/LRR-repeat protein At3g26922-like [Populus euphratica]
 ref|XP_011044574.1| PREDICTED: F-box/LRR-repeat protein At3g26922-like [Populus euphratica]
Length=378

 Score = 50.1 bits (118),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 52/102 (51%), Gaps = 9/102 (9%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP  +L  IL  L  ++  +  VLS  W N+W +   LDF ++ F  L++ YY+D  
Sbjct  18   ISTLPNVLLHHILSFLDAVQVVQTCVLSKRWMNVWKSHPYLDFNFETFSSLISSYYYD--  75

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFNFPFSTAKEFSY  358
            DD++ +T      I+ VL++ N +     F     T ++  Y
Sbjct  76   DDMNNFTDF----ISHVLLRRNNID---VFKLSLDTRRDCQY  110



>ref|XP_004293482.1| PREDICTED: putative F-box protein At3g58860-like [Fragaria vesca 
subsp. vesca]
Length=452

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  59   ELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFF  196
            +LPA+IL  IL L+PT+EA R +++S  WR +W     LDF YD F
Sbjct  21   DLPAEILIHILTLIPTLEAIRTSLVSRQWRPLWSRLPCLDFPYDLF  66



>gb|EYU29916.1| hypothetical protein MIMGU_mgv1a020056mg [Erythranthe guttata]
Length=535

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFG  184
            ISELP DIL +IL  L   +A R +VLS  WRNIW  R  L+F 
Sbjct  16   ISELPQDILQRILYWLSQEDAVRTSVLSKSWRNIWCTRPNLNFS  59



>gb|EYU31289.1| hypothetical protein MIMGU_mgv1a018403mg, partial [Erythranthe 
guttata]
Length=510

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFG  184
            ISELP DIL +IL  L   +A R +VLS  WRNIW  R  L+F 
Sbjct  16   ISELPQDILQRILYWLSQEDAVRTSVLSKSWRNIWCTRPNLNFS  59



>gb|EYU30178.1| hypothetical protein MIMGU_mgv1a025101mg [Erythranthe guttata]
Length=236

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 29/48 (60%), Gaps = 0/48 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFF  196
            ISELP +IL +IL  L   +A R +VLS  WR IW  R  LDF +  F
Sbjct  4    ISELPKEILHRILYFLSQKDAVRTSVLSKSWRYIWCTRPNLDFSHKSF  51



>gb|EYU30192.1| hypothetical protein MIMGU_mgv1a020895mg, partial [Erythranthe 
guttata]
Length=472

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 29/47 (62%), Gaps = 0/47 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDF  193
            ISELP DIL +IL  L   +A R +VLS  WR+IW  R  LDF   F
Sbjct  16   ISELPNDILQRILYFLSQEDAVRTSVLSKSWRDIWRTRPNLDFRGPF  62



>ref|XP_010026603.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Eucalyptus 
grandis]
Length=434

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 34/88 (39%), Positives = 46/88 (52%), Gaps = 10/88 (11%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP  ILD+IL  LP  EA R +VLST WR  W  R+     +D  C   N +    +
Sbjct  12   ISLLPGHILDEILWRLPIKEAGRTSVLSTKWRYRW--RSLPHLWFDNRCTWSNGHGQTSQ  69

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKF  316
            + + I        I++VLM H+G I+ F
Sbjct  70   NLVKI--------IDRVLMLHSGPIQSF  89



>gb|EYU30187.1| hypothetical protein MIMGU_mgv11b017558mg [Erythranthe guttata]
Length=505

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 29/48 (60%), Gaps = 0/48 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFF  196
            IS+LP DIL +IL LL   +A R + LS  WR +W  R  LDF  D F
Sbjct  16   ISDLPKDILQRILSLLSQKDAVRTSALSKSWRYVWCTRPNLDFSDDTF  63



>ref|XP_010312905.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Solanum 
lycopersicum]
Length=285

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 46/91 (51%), Gaps = 9/91 (10%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            +S LP +I+D IL+ LP  EA R  +LS  WR  W   TEL          +++ +   +
Sbjct  17   LSNLPDNIIDVILICLPCKEAVRTNILSKKWRYHWRRLTELT---------IDQSHWSTE  67

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFN  325
            +D+   TS    ++ ++L  H G I KF  N
Sbjct  68   EDLLYPTSKFLKIVYQLLTLHEGPITKFTLN  98



>ref|XP_008385315.1| PREDICTED: putative F-box/LRR-repeat protein At5g54820 [Malus 
domestica]
Length=223

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 48/100 (48%), Gaps = 8/100 (8%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDF-------GYDFFCHLLN  211
            IS LP +IL  I+ LLP  EAA  ++LS  WR++W + T L F       G       + 
Sbjct  23   ISNLPPEILVCIVSLLPLKEAAATSILSRRWRHVWASTTTLSFDAVNFDVGDGTITTTIQ  82

Query  212  KYYHDEKDDIDIWTSMGFYVINKVLMQHNG-LIRKFAFNF  328
            ++   EK   D  + +    ++ +L QH G  I +F   F
Sbjct  83   RFLKLEKQARDQESRLYVNWVDHILGQHRGQCIERFGVCF  122



>gb|EYU46185.1| hypothetical protein MIMGU_mgv1a025434mg, partial [Erythranthe 
guttata]
Length=320

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 43/93 (46%), Gaps = 13/93 (14%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP DIL + L  LP  +A R + LS  WR+ W +  EL   YD  C      YHD +
Sbjct  16   ISNLPEDILLEFLRRLPLRDAVRTSALSREWRDKWRSIQELVLNYDAGCFKFP--YHDYQ  73

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFNFP  331
                         I +V++ H G I KF+   P
Sbjct  74   -----------ICIYQVVLNHRGTIMKFSLKVP  95



>gb|EYU30170.1| hypothetical protein MIMGU_mgv1a022468mg, partial [Erythranthe 
guttata]
Length=506

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFF  196
            IS+LP +IL +IL  L   +A R +VLS  WR +W  R  LDF +D F
Sbjct  23   ISDLPKEILQRILYFLAQKDAVRTSVLSKSWRYVWCTRPNLDFTHDSF  70



>ref|XP_008368777.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g16930-like [Malus 
domestica]
Length=314

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFF  196
            ISELP ++L  IL  LPT  A R + LST W+NIW +   L+F +++F
Sbjct  4    ISELPVEVLRHILSFLPTKYAVRTSCLSTKWKNIWASVPILNFHHEYF  51



>ref|XP_009344644.1| PREDICTED: putative F-box/FBD/LRR-repeat protein At4g00315 [Pyrus 
x bretschneideri]
Length=408

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFF  196
            ISELP ++L  +L  LPT  A R + LST W+NIW +   L+F +++F
Sbjct  15   ISELPVEVLRHVLSFLPTKYAVRTSCLSTKWKNIWASVPILNFHHEYF  62



>ref|XP_004288719.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g16930-like [Fragaria 
vesca subsp. vesca]
Length=488

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 48/93 (52%), Gaps = 14/93 (15%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS+LP  +L  +L  LPT  A R ++LST W+NIW +   LD         L  YY DE+
Sbjct  17   ISQLPDAVLSHMLSFLPTKHAVRTSILSTRWKNIWASVPTLD---------LEHYYCDER  67

Query  233  DDIDIWTSMGFY-VINKVLMQHNGLIRKFAFNF  328
              +      GF   I++VL   +  I++F  ++
Sbjct  68   RSL----HAGFVSSIDRVLYCESSDIQRFRLHY  96



>ref|XP_006368068.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like, partial 
[Solanum tuberosum]
Length=332

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 52/101 (51%), Gaps = 16/101 (16%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            +++LP ++  +I   L   EAAR++VLS  W++IW++  +L F  D FCH  NK      
Sbjct  19   LTDLPINVKHQIQEHLSVEEAARMSVLSRPWKHIWVSIPKLVFSAD-FCH--NK------  69

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFNFPFSTAKEFS  355
                    +   VIN +L+QH G I+ F  N     + + S
Sbjct  70   -------PLIIDVINTILLQHCGAIKTFLVNISSIPSSQHS  103



>ref|XP_010034380.1| PREDICTED: putative F-box/LRR-repeat protein At3g28410 [Eucalyptus 
grandis]
Length=421

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDF  181
            + +LP D+L  IL LLP  EAAR +VLS  WR++W + + LDF
Sbjct  1    MDKLPTDVLVSILYLLPMKEAARTSVLSRAWRDLWKHVSSLDF  43



>ref|XP_010040691.1| PREDICTED: FBD-associated F-box protein At2g26860-like [Eucalyptus 
grandis]
Length=421

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDF  181
            + +LP D+L  IL LLP  EAAR +VLS  WR++W + + LDF
Sbjct  1    MDKLPTDVLVSILYLLPMKEAARTSVLSRAWRDLWKHVSSLDF  43



>gb|EYU30181.1| hypothetical protein MIMGU_mgv1a007194mg [Erythranthe guttata]
Length=415

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/43 (56%), Positives = 28/43 (65%), Gaps = 0/43 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDF  181
            IS+LP DIL +IL LL   +A R +VLS  WR IW  R  LDF
Sbjct  4    ISDLPKDILQRILYLLSQEDAVRTSVLSKSWRYIWCTRPNLDF  46



>ref|XP_007026140.1| F-box/RNI/FBD-like domains-containing protein [Theobroma cacao]
 gb|EOY28762.1| F-box/RNI/FBD-like domains-containing protein [Theobroma cacao]
Length=405

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 46/93 (49%), Gaps = 0/93 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP  +L+ IL  LPT  A R  VLS  W+++W+++  +   +D     + ++ +   
Sbjct  8    ISNLPDPLLEHILTFLPTKYAIRTGVLSKRWKDLWVSQPYISLSHDGLIGRIAEFKNLSV  67

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFNFP  331
             D  +  S      NKVL+Q    ++K   + P
Sbjct  68   RDRTVKVSKYKNFFNKVLLQPQAKVKKLQISAP  100



>ref|XP_011074581.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Sesamum 
indicum]
Length=425

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 45/93 (48%), Gaps = 15/93 (16%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFC--HLLNKYYHD  226
            +S LP DI+D IL LLP +EA R ++LS  WR  W+    L F    F    +  KY   
Sbjct  9    LSNLPCDIMDNILKLLPLVEAVRTSILSREWRYKWVTIPHLIFDPKTFPPKSITKKY---  65

Query  227  EKDDIDIWTSMGFYVINKVLMQHNGLIRKFAFN  325
                      + + VI +VL+ H G I KF+  
Sbjct  66   ----------IAWSVIYQVLLLHKGPIVKFSLK  88



>gb|EYU34195.1| hypothetical protein MIMGU_mgv1a024133mg [Erythranthe guttata]
Length=454

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 29/48 (60%), Gaps = 0/48 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFF  196
            ISELP +I  +IL  L   +A R +VLS  WRNIW  R  LDF  + F
Sbjct  4    ISELPQEISQRILYFLSQEDAVRTSVLSKLWRNIWCTRPNLDFSDNNF  51



>ref|XP_002451681.1| hypothetical protein SORBIDRAFT_04g005800 [Sorghum bicolor]
 gb|EES04657.1| hypothetical protein SORBIDRAFT_04g005800 [Sorghum bicolor]
Length=468

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLN  163
            IS LP D+L +ILV LP  + AR AVLST WR +WL+
Sbjct  80   ISGLPDDLLSRILVRLPAKDGARTAVLSTRWRGLWLS  116



>gb|EYU28491.1| hypothetical protein MIMGU_mgv1a009525mg [Erythranthe guttata]
Length=339

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 45/96 (47%), Gaps = 1/96 (1%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            ISELP DI+  IL  L   EAAR +VLS+ W N+W   T L    D     L + Y   +
Sbjct  60   ISELPDDIVVHILSFLTVEEAARTSVLSSRWINLWEYTTRLKLDGDEGLAKLRRQYMFRR  119

Query  233  DDIDIWTSMGFYVINKVLMQHNGL-IRKFAFNFPFS  337
              I+         +N+VL  H  L +++F   F   
Sbjct  120  KLIESEERKYVRRVNRVLQSHKALTLKEFRIRFALQ  155



>ref|XP_006474549.1| PREDICTED: F-box/FBD/LRR-repeat protein At5g53840-like, partial 
[Citrus sinensis]
Length=428

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 36/101 (36%), Positives = 52/101 (51%), Gaps = 11/101 (11%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDF-GYDFFCHLLNKYYHDE  229
            +S+LP DIL  I+  L  +EAAR  VLS+ WR +W   T LDF G         +Y+ + 
Sbjct  15   VSQLPDDILINIISKLTLMEAARTCVLSSRWRYLWTFTTALDFDGIREILPRTKRYFREY  74

Query  230  KDDIDIWTSMGFYVINKVLMQHNGL-IRKFAFNFPFSTAKE  349
            K     W       +NKVL+ H G  + +F  +F  S++ E
Sbjct  75   K--FVRW-------VNKVLVLHRGSNVSQFRVSFYLSSSLE  106



>ref|XP_006452924.1| hypothetical protein CICLE_v10008333mg [Citrus clementina]
 gb|ESR66164.1| hypothetical protein CICLE_v10008333mg [Citrus clementina]
Length=437

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 36/101 (36%), Positives = 52/101 (51%), Gaps = 11/101 (11%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDF-GYDFFCHLLNKYYHDE  229
            +S+LP DIL  I+  L  +EAAR  VLS+ WR +W   T LDF G         +Y+ + 
Sbjct  24   VSQLPDDILINIISKLTLMEAARTCVLSSRWRYLWTFTTALDFDGIREILPRTKRYFREY  83

Query  230  KDDIDIWTSMGFYVINKVLMQHNGL-IRKFAFNFPFSTAKE  349
            K     W       +NKVL+ H G  + +F  +F  S++ E
Sbjct  84   K--FVRW-------VNKVLVLHRGSNVSQFRVSFYLSSSLE  115



>ref|XP_006574988.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Glycine 
max]
Length=427

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/93 (30%), Positives = 46/93 (49%), Gaps = 11/93 (12%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS+LP+ ++D IL  LP  +  R ++LS+ WR  W +  +LDF  DFF    +   H+  
Sbjct  17   ISDLPSHLIDFILQRLPLQDVVRTSLLSSKWRYKWTSIPKLDFSNDFFQKCRDLELHEVS  76

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFNFP  331
                         I ++L+ H+G + +F    P
Sbjct  77   S-----------TITEILLIHDGQLDEFVLCIP  98



>emb|CDY36412.1| BnaC05g10130D [Brassica napus]
Length=447

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFF  196
            ISELP  +L  IL  LPT  + + +VLST W+N+WLN   LD   + F
Sbjct  7    ISELPESLLTHILSYLPTKHSVKTSVLSTRWKNLWLNVPALDLNCEDF  54



>ref|XP_006482338.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X1 [Citrus sinensis]
 ref|XP_006482339.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X2 [Citrus sinensis]
Length=422

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 34/88 (39%), Positives = 47/88 (53%), Gaps = 9/88 (10%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP D+LD ILV LP  EAAR ++LS+ WR  W   ++L F    F   L+    +E+
Sbjct  14   ISNLPWDVLDTILVNLPLREAARTSILSSKWRYKWTGLSQLVFDDKCFSSSLSM---EER  70

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKF  316
                 W  +   +I+ V   H+G I KF
Sbjct  71   -----WGEI-MKIIHMVQSYHSGPIEKF  92



>gb|KDO73723.1| hypothetical protein CISIN_1g046273mg [Citrus sinensis]
Length=437

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 36/101 (36%), Positives = 52/101 (51%), Gaps = 11/101 (11%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDF-GYDFFCHLLNKYYHDE  229
            +S+LP DIL  I+  L  +EAAR  VLS+ WR +W   T LDF G         +Y+ + 
Sbjct  24   VSQLPDDILINIISKLTLMEAARTCVLSSRWRYLWTFTTALDFDGIREILPRTKRYFREY  83

Query  230  KDDIDIWTSMGFYVINKVLMQHNGL-IRKFAFNFPFSTAKE  349
            K     W       +NKVL+ H G  + +F  +F  S++ E
Sbjct  84   K--FVRW-------VNKVLVLHRGSNVSQFRVSFYLSSSLE  115



>gb|EYU30195.1| hypothetical protein MIMGU_mgv1a023850mg, partial [Erythranthe 
guttata]
Length=316

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 26/44 (59%), Gaps = 0/44 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFG  184
            ISELP  IL +IL  L   +A R +VLS  WRNIW  R  LD  
Sbjct  4    ISELPKHILQRILYFLSQKDAVRTSVLSKSWRNIWCTRPNLDLS  47



>gb|EYU30186.1| hypothetical protein MIMGU_mgv1a019769mg [Erythranthe guttata]
Length=493

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 25/44 (57%), Gaps = 0/44 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFG  184
            ISELP  IL  I  LL   EA R +VLS  WRNIW  R  LD  
Sbjct  16   ISELPEGILQGIFSLLSQEEAVRTSVLSKSWRNIWCTRPNLDLS  59



>ref|XP_009590127.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X2 [Nicotiana tomentosiformis]
 ref|XP_009590128.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X2 [Nicotiana tomentosiformis]
 ref|XP_009590129.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X2 [Nicotiana tomentosiformis]
Length=436

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/94 (28%), Positives = 45/94 (48%), Gaps = 9/94 (10%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            +S LP  ++D+IL+ LP  +A R ++LS  WR IW    +L   +  +          ++
Sbjct  20   LSNLPQKVIDEILICLPLRDAVRTSILSKKWRYIWRRLPQLTLEHTLW---------KKR  70

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFNFPF  334
            +DI   T     ++  +   H G I+KF    P+
Sbjct  71   EDITDLTRNFSEIVRHIYCYHAGPIKKFTLCIPY  104



>gb|EYU33034.1| hypothetical protein MIMGU_mgv1a019771mg [Erythranthe guttata]
Length=206

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFG  184
            +S+LP DIL +IL  L   +A R +VLST WR IW  R  LDF 
Sbjct  4    LSDLPKDILHRILYFLSQEDAVRTSVLSTSWRYIWCTRPNLDFS  47



>gb|KDO58879.1| hypothetical protein CISIN_1g036695mg [Citrus sinensis]
Length=419

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 34/88 (39%), Positives = 47/88 (53%), Gaps = 9/88 (10%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP D+LD ILV LP  EAAR ++LS+ WR  W   ++L F    F   L+    +E+
Sbjct  11   ISNLPWDVLDTILVNLPLREAARTSILSSKWRYKWTGLSQLVFDDKCFSSSLSM---EER  67

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKF  316
                 W  +   +I+ V   H+G I KF
Sbjct  68   -----WGEI-MKIIHMVQSYHSGPIEKF  89



>ref|XP_006430877.1| hypothetical protein CICLE_v10011818mg [Citrus clementina]
 ref|XP_006430879.1| hypothetical protein CICLE_v10011818mg [Citrus clementina]
 ref|XP_006430880.1| hypothetical protein CICLE_v10011818mg [Citrus clementina]
 gb|ESR44117.1| hypothetical protein CICLE_v10011818mg [Citrus clementina]
 gb|ESR44119.1| hypothetical protein CICLE_v10011818mg [Citrus clementina]
 gb|ESR44120.1| hypothetical protein CICLE_v10011818mg [Citrus clementina]
Length=422

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 34/88 (39%), Positives = 47/88 (53%), Gaps = 9/88 (10%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP D+LD ILV LP  EAAR ++LS+ WR  W   ++L F    F   L+    +E+
Sbjct  14   ISNLPWDVLDTILVNLPLREAARTSILSSKWRYKWTGLSQLVFDDKCFSSSLSM---EER  70

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKF  316
                 W  +   +I+ V   H+G I KF
Sbjct  71   -----WGEI-MKIIHMVQSYHSGPIEKF  92



>ref|XP_009590126.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X1 [Nicotiana tomentosiformis]
Length=445

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/94 (28%), Positives = 45/94 (48%), Gaps = 9/94 (10%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            +S LP  ++D+IL+ LP  +A R ++LS  WR IW    +L   +  +          ++
Sbjct  29   LSNLPQKVIDEILICLPLRDAVRTSILSKKWRYIWRRLPQLTLEHTLW---------KKR  79

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFNFPF  334
            +DI   T     ++  +   H G I+KF    P+
Sbjct  80   EDITDLTRNFSEIVRHIYCYHAGPIKKFTLCIPY  113



>ref|XP_006356449.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Solanum 
tuberosum]
Length=528

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 32/88 (36%), Positives = 44/88 (50%), Gaps = 12/88 (14%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            ISE P   L +IL L+P   AAR ++LS  WR +W  +  L F   FF     +Y  + K
Sbjct  133  ISESPIVALHRILELMPIKYAARSSILSKLWRQLWSTQPNLVFDPLFF-----QYVSNTK  187

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKF  316
            D           VI+K+L++H G I  F
Sbjct  188  DS-------AASVIHKILLKHTGDILGF  208



>gb|KHN29904.1| F-box/FBD/LRR-repeat protein [Glycine soja]
Length=427

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 28/93 (30%), Positives = 46/93 (49%), Gaps = 11/93 (12%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS+LP+ ++D IL  LP  +  R ++LS+ WR  W +  +LDF  DFF    +   H+  
Sbjct  17   ISDLPSHLIDFILQRLPLQDVVRTSLLSSKWRYKWTSIPKLDFSNDFFQKCRDLELHEVS  76

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFNFP  331
                         I ++L+ H+G + +F    P
Sbjct  77   S-----------TITEILLIHDGQLDEFVLCIP  98



>ref|XP_010419264.1| PREDICTED: putative FBD-associated F-box protein At5g53640 [Camelina 
sativa]
Length=231

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 34/61 (56%), Gaps = 13/61 (21%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWL-------------NRTELDFGYDF  193
            IS+LP D++ +IL  LPT +A R +VLST W N+WL             NRT L F   F
Sbjct  51   ISQLPDDLICQILSHLPTKDAVRTSVLSTRWTNLWLWLPRLELSFVGIRNRTPLSFANRF  110

Query  194  F  196
            F
Sbjct  111  F  111



>gb|EYU30205.1| hypothetical protein MIMGU_mgv1a024593mg, partial [Erythranthe 
guttata]
Length=380

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 29/48 (60%), Gaps = 0/48 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFF  196
            IS+LP DI  +IL  L   +A R +VLS  WR+IW  R  LDF  D F
Sbjct  4    ISDLPKDISQRILYFLSQEDAVRTSVLSKSWRDIWCTRPNLDFIEDSF  51



>gb|ACL52432.1| unknown [Zea mays]
Length=515

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 30/103 (29%), Positives = 50/103 (49%), Gaps = 19/103 (18%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLN-RTELDFGYDFFCHLLNKYYHDE  229
            IS LP  ++ +I+  LPT +A R+ VLS  WR+IW++    LD G          YY D 
Sbjct  13   ISILPDGVIGEIVTRLPTADAVRVQVLSRRWRHIWISCPLNLDLGSP-------NYYTDY  65

Query  230  KDDIDIWTSMGFYVINKVLMQHNGLIRKFAFNFPFSTAKEFSY  358
            K            V++ +L  H G  R+   ++P+   + +++
Sbjct  66   KR-----------VVSGILAAHPGPCRRLKVDWPYDDGESYNH  97



>gb|AAM62702.1| unknown [Arabidopsis thaliana]
Length=459

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDF  181
            ISELP  ++ +IL+ LPT ++ + +VLST W+N+WLN   LD 
Sbjct  7    ISELPESLITQILLCLPTKDSVKTSVLSTRWKNLWLNVPGLDL  49



>ref|XP_002874348.1| hypothetical protein ARALYDRAFT_489554 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50607.1| hypothetical protein ARALYDRAFT_489554 [Arabidopsis lyrata subsp. 
lyrata]
Length=457

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFG  184
            ISELP  ++ +IL+ LPT ++ + +VLST W+N+WLN   LD  
Sbjct  7    ISELPESLITQILLCLPTKDSVKTSVLSTRWKNLWLNVPGLDLN  50



>gb|EYU30200.1| hypothetical protein MIMGU_mgv1a018462mg, partial [Erythranthe 
guttata]
Length=412

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCH  202
            ISEL  DIL +IL LL   +A R +VLS  WR+IW  R  LD     F H
Sbjct  4    ISELSNDILQRILSLLSQEDAVRTSVLSKSWRDIWCTRPNLDLSDTNFKH  53



>ref|NP_198127.1| FBD-associated F-box protein [Arabidopsis thaliana]
 sp|Q0V7P8.1|FBD15_ARATH RecName: Full=FBD-associated F-box protein At5g27750 [Arabidopsis 
thaliana]
 gb|ABH04629.1| At5g27750 [Arabidopsis thaliana]
 gb|AED93721.1| FBD-associated F-box protein [Arabidopsis thaliana]
Length=459

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDF  181
            ISELP  ++ +IL+ LPT ++ + +VLST W+N+WLN   LD 
Sbjct  7    ISELPESLITQILLCLPTKDSVKTSVLSTRWKNLWLNVPGLDL  49



>gb|EYU30214.1| hypothetical protein MIMGU_mgv1a023526mg, partial [Erythranthe 
guttata]
Length=466

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 28/48 (58%), Gaps = 0/48 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFF  196
            ISELP +IL +IL  L   +A R +VLS  W NIW  R  LDF    F
Sbjct  4    ISELPKEILQQILYFLSQEDAVRTSVLSKSWHNIWCTRPNLDFSEATF  51



>ref|XP_009790183.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X2 [Nicotiana sylvestris]
Length=377

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 37/64 (58%), Gaps = 0/64 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP +++D IL LLP  +AAR ++LS+ WR IW   + L   YDF   L+ +     K
Sbjct  18   ISGLPRNVIDHILELLPVQDAARTSILSSNWRYIWSTLSNLVLDYDFCRKLIGESESKFK  77

Query  233  DDID  244
              +D
Sbjct  78   LAVD  81



>ref|NP_191479.1| F-box/LRR-repeat protein [Arabidopsis thaliana]
 sp|Q9LX51.1|FBL64_ARATH RecName: Full=F-box/LRR-repeat protein At3g59200 [Arabidopsis 
thaliana]
 emb|CAB91590.1| putative protein [Arabidopsis thaliana]
 dbj|BAC42525.1| unknown protein [Arabidopsis thaliana]
 gb|AAO64837.1| At3g59200 [Arabidopsis thaliana]
 gb|AEE79888.1| F-box/LRR-repeat protein [Arabidopsis thaliana]
Length=520

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 34/92 (37%), Positives = 47/92 (51%), Gaps = 10/92 (11%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP  ++  IL  LPT EAA  +VLS  WR ++   T LDF         +  Y D K
Sbjct  9    ISSLPNPVVSHILSFLPTKEAASTSVLSKKWRYLFAYVTNLDFD--------DSDYQDGK  60

Query  233  DDIDIWTSMGFY-VINKVL-MQHNGLIRKFAF  322
               D+  S  F   +++VL +Q NG + KF+ 
Sbjct  61   PKSDVELSRSFMEFVDRVLALQGNGSVNKFSL  92



>ref|XP_002890021.1| F16A14.1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66280.1| F16A14.1 [Arabidopsis lyrata subsp. lyrata]
Length=455

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFG  184
            ISELP  ++ +IL+ LPT ++ + +VLST W+N+WLN   LD  
Sbjct  8    ISELPESLISQILLHLPTKDSVKTSVLSTRWKNLWLNVPGLDLN  51



>ref|XP_009596698.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570 [Nicotiana 
tomentosiformis]
Length=422

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 45/100 (45%), Gaps = 13/100 (13%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFF--CHLLNKYYHD  226
            IS+LP  IL+ IL+ LP ++A R +VLS  WR  W   T+L F       CH        
Sbjct  10   ISDLPQSILETILIKLPLLDAVRTSVLSRKWRYKWATITKLVFNDTCLIPCH--------  61

Query  227  EKDDIDIWTSMGFYVINKVLMQHNGLIRKFAFNFPFSTAK  346
               D  I +      I + L  H+G I KF  N  +S   
Sbjct  62   ---DKAIISCNLVNFITRCLFLHDGPIHKFELNTSYSPTS  98



>gb|EYU30193.1| hypothetical protein MIMGU_mgv1a021686mg, partial [Erythranthe 
guttata]
Length=479

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 26/44 (59%), Gaps = 0/44 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFG  184
            ISEL  DIL +IL LL   EA R +VLS  WR IW  R  LD  
Sbjct  4    ISELSEDILQRILSLLSQEEAVRTSVLSKSWREIWCTRPNLDLS  47



>ref|XP_008242864.1| PREDICTED: F-box/FBD/LRR-repeat protein At5g22700-like [Prunus 
mume]
Length=452

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 33/93 (35%), Positives = 47/93 (51%), Gaps = 17/93 (18%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIW-----LNRTELDFGY----DFFCHL  205
            ISELP +++  I+ LLP  EA   ++LS  WR +W     LN   ++F Y    ++FC L
Sbjct  39   ISELPYEVIVSIVSLLPLKEAVATSILSRRWRYVWSSTTTLNLETVNFEYPETVNYFCQL  98

Query  206  -LNKYYHDEKDDIDIWTSMGFYVINKVLMQHNG  301
              +K   +E      W       +N VL QHNG
Sbjct  99   DCDKRDQEEGHKYVNW-------VNHVLEQHNG  124



>ref|XP_009790182.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X1 [Nicotiana sylvestris]
Length=407

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 37/64 (58%), Gaps = 0/64 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP +++D IL LLP  +AAR ++LS+ WR IW   + L   YDF   L+ +     K
Sbjct  48   ISGLPRNVIDHILELLPVQDAARTSILSSNWRYIWSTLSNLVLDYDFCRKLIGESESKFK  107

Query  233  DDID  244
              +D
Sbjct  108  LAVD  111



>ref|XP_009790184.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X3 [Nicotiana sylvestris]
Length=373

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 37/64 (58%), Gaps = 0/64 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP +++D IL LLP  +AAR ++LS+ WR IW   + L   YDF   L+ +     K
Sbjct  48   ISGLPRNVIDHILELLPVQDAARTSILSSNWRYIWSTLSNLVLDYDFCRKLIGESESKFK  107

Query  233  DDID  244
              +D
Sbjct  108  LAVD  111



>gb|EYU31288.1| hypothetical protein MIMGU_mgv1a020404mg [Erythranthe guttata]
Length=375

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 27/48 (56%), Gaps = 0/48 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFF  196
            IS LP  IL KIL  L   EA R +VLS  WR+IW  R  LDF    F
Sbjct  16   ISILPEHILQKILYFLSQKEAVRTSVLSKSWRSIWCTRPNLDFSIQAF  63



>ref|XP_009342918.1| PREDICTED: F-box/LRR-repeat protein At3g58900-like [Pyrus x bretschneideri]
Length=462

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 28/88 (32%), Positives = 47/88 (53%), Gaps = 7/88 (8%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            ISELP  +L ++L L+PT  A R +VLS  W+N+W+    +D   +      N++++   
Sbjct  24   ISELPDPVLCRMLSLIPTKYAVRTSVLSKRWKNVWVFVPNIDLDDE------NEHFYRRN  77

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKF  316
             D + +     +V ++VL  H   I KF
Sbjct  78   RDTNDYVRFSMFV-DRVLFLHETDIHKF  104



>gb|EYU44107.1| hypothetical protein MIMGU_mgv1a023398mg [Erythranthe guttata]
Length=469

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 27/44 (61%), Gaps = 0/44 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFG  184
            ISELP DIL +IL  L   +A R +VLS  WRNIW  R  L F 
Sbjct  4    ISELPQDILQRILYWLSQEDAVRTSVLSKSWRNIWCTRHNLHFS  47



>ref|XP_010495692.1| PREDICTED: putative FBD-associated F-box protein At5g44940 [Camelina 
sativa]
Length=174

 Score = 46.6 bits (109),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFF  196
            ISELP  ++ +IL+ LPT ++ + +VLST WRN+WLN   +D     F
Sbjct  6    ISELPEFLITQILLWLPTKDSVKTSVLSTRWRNLWLNVPGVDLNSSDF  53



>ref|XP_004307296.1| PREDICTED: putative FBD-associated F-box protein At5g56700-like 
[Fragaria vesca subsp. vesca]
Length=511

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 35/102 (34%), Positives = 51/102 (50%), Gaps = 21/102 (21%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDF------------GYDF-  193
            IS+ P +IL  +L LLP  EAA  +VLS  WR +W +  +L+F            G+   
Sbjct  47   ISDSPCEILVNVLSLLPLKEAAGTSVLSRRWRRVWESTMKLNFDASNYVAGTNDQGFVLN  106

Query  194  FCHLLNKYYHDEKDDIDIWTSMGFYVINKVLMQHNG-LIRKF  316
            F HL +K   +  D+   W       +N+VL +H G  IR+F
Sbjct  107  FMHLEDKLKDENMDNYVSW-------VNRVLERHRGSKIRQF  141



>ref|XP_004490315.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X2 [Cicer arietinum]
Length=400

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 29/93 (31%), Positives = 51/93 (55%), Gaps = 10/93 (11%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            I++LP +++D IL  L   E    ++LS  WR +W++  +L+F  DFF +   +YY  E 
Sbjct  17   ITDLPWNVIDGILKYLNIRELVGTSILSRKWRYMWMSVLQLEFDEDFF-YYCEEYY--EG  73

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFNFP  331
             +I         ++ ++LM H+G + KF  + P
Sbjct  74   PEIS-------RIMMEILMLHSGPLYKFTLSLP  99



>ref|NP_001168550.1| uncharacterized protein LOC100382330 [Zea mays]
 ref|XP_008648083.1| PREDICTED: uncharacterized protein LOC100382330 isoform X1 [Zea 
mays]
 gb|ACN28634.1| unknown [Zea mays]
 gb|AFW78013.1| hypothetical protein ZEAMMB73_494429 [Zea mays]
Length=424

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 44/91 (48%), Gaps = 8/91 (9%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP  I DKIL  LP  EA R  +LS  WR  W + TEL F  D F  L N    +E 
Sbjct  20   ISNLPDVIKDKILCCLPIKEAVRTCLLSRKWRYTWASMTELMFREDDFA-LGNG---NED  75

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFN  325
             D D +     Y +   L  H+G I KF  N
Sbjct  76   GDSDRFV----YFVITFLSLHDGPILKFEMN  102



>emb|CDP00518.1| unnamed protein product [Coffea canephora]
Length=432

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 48/93 (52%), Gaps = 6/93 (6%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP +++D IL  +P  +AAR ++LS+ WR +      L F   F   +       E 
Sbjct  18   ISSLPRNVIDLILDRVPIRDAARASLLSSKWRYVLAEYPHLRFNQQFSNAIARNRLPSEF  77

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFNFP  331
            ++  +      +++N++L+QH G I KF  + P
Sbjct  78   NNDYV------HIVNRILLQHFGPILKFVLDLP  104



>ref|XP_006430878.1| hypothetical protein CICLE_v10011818mg [Citrus clementina]
 gb|ESR44118.1| hypothetical protein CICLE_v10011818mg [Citrus clementina]
Length=346

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 47/90 (52%), Gaps = 9/90 (10%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP D+LD ILV LP  EAAR ++LS+ WR  W   ++L F    F   L+    +E+
Sbjct  14   ISNLPWDVLDTILVNLPLREAARTSILSSKWRYKWTGLSQLVFDDKCFSSSLS---MEER  70

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAF  322
                 W  +   +I+ V   H+G I KF  
Sbjct  71   -----WGEI-MKIIHMVQSYHSGPIEKFKL  94



>ref|XP_010481192.1| PREDICTED: F-box/LRR-repeat protein At1g55660-like [Camelina 
sativa]
Length=133

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGY  187
            IS+LP D+L K+L  LPT +AA  ++LS  W  +W+   +LD+GY
Sbjct  4    ISQLPDDVLVKVLSFLPTKDAASTSILSKRWEFLWMWLPKLDYGY  48



>tpg|DAA60250.1| TPA: hypothetical protein ZEAMMB73_745247 [Zea mays]
Length=530

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 30/103 (29%), Positives = 50/103 (49%), Gaps = 19/103 (18%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLN-RTELDFGYDFFCHLLNKYYHDE  229
            IS LP  ++ +I+  LPT +A R+ VLS  WR+IW++    LD G          YY D 
Sbjct  13   ISILPDGVIGEIVTRLPTADAVRVQVLSRRWRHIWISCPLNLDLGSP-------NYYTDY  65

Query  230  KDDIDIWTSMGFYVINKVLMQHNGLIRKFAFNFPFSTAKEFSY  358
            K            V++ +L  H G  R+   ++P+   + +++
Sbjct  66   KR-----------VVSGILAAHPGPCRRLKVDWPYDDGESYNH  97



>ref|NP_001144603.1| uncharacterized protein LOC100277619 [Zea mays]
 gb|ACG41701.1| hypothetical protein [Zea mays]
Length=530

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 30/103 (29%), Positives = 50/103 (49%), Gaps = 19/103 (18%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLN-RTELDFGYDFFCHLLNKYYHDE  229
            IS LP  ++ +I+  LPT +A R+ VLS  WR+IW++    LD G          YY D 
Sbjct  13   ISILPDGVIGEIVTRLPTADAVRVQVLSRRWRHIWISCPLNLDLGSP-------NYYTDY  65

Query  230  KDDIDIWTSMGFYVINKVLMQHNGLIRKFAFNFPFSTAKEFSY  358
            K            V++ +L  H G  R+   ++P+   + +++
Sbjct  66   KR-----------VVSGILAAHPGPCRRLKVDWPYDDGESYNH  97



>ref|XP_011040385.1| PREDICTED: F-box/LRR-repeat protein At3g26922-like [Populus euphratica]
Length=395

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/74 (34%), Positives = 43/74 (58%), Gaps = 2/74 (3%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP  +L  IL  +  ++A +  VLS  W N+W +   LDF ++ F  L+N  Y+D  
Sbjct  37   ISTLPNVLLHHILSFVDAVQAVQTCVLSKRWMNVWKSHPYLDFNFETFSSLINSDYYD--  94

Query  233  DDIDIWTSMGFYVI  274
            D+++ +T   ++V+
Sbjct  95   DEVNNFTDFIYHVL  108



>ref|XP_006482340.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X3 [Citrus sinensis]
Length=346

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 47/90 (52%), Gaps = 9/90 (10%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP D+LD ILV LP  EAAR ++LS+ WR  W   ++L F    F   L+    +E+
Sbjct  14   ISNLPWDVLDTILVNLPLREAARTSILSSKWRYKWTGLSQLVFDDKCFSSSLS---MEER  70

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAF  322
                 W  +   +I+ V   H+G I KF  
Sbjct  71   -----WGEI-MKIIHMVQSYHSGPIEKFKL  94



>ref|XP_009629620.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like, partial 
[Nicotiana tomentosiformis]
Length=391

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 48/93 (52%), Gaps = 10/93 (11%)
 Frame = +2

Query  56   SELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEKD  235
            S LP +++D+IL+ LP  +A R ++LS  W+  W    EL          L++     K 
Sbjct  20   SNLPENVIDEILICLPFKDAVRTSILSKKWKYNWCRLPELT---------LDRTIWTSKK  70

Query  236  DIDIW-TSMGFYVINKVLMQHNGLIRKFAFNFP  331
            D  ++ TS   Y+I  +L+ H+G I KF  + P
Sbjct  71   DFSLFSTSEITYIIYHILILHDGPITKFILDVP  103



>ref|XP_011044570.1| PREDICTED: F-box/LRR-repeat protein At3g26922-like [Populus euphratica]
Length=395

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/74 (34%), Positives = 43/74 (58%), Gaps = 2/74 (3%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP  +L  IL  +  ++A +  VLS  W N+W +   LDF ++ F  L+N  Y+D  
Sbjct  37   ISTLPNVLLHHILSFVDAVQAVQTCVLSKRWMNVWKSHPYLDFNFETFSSLINSDYYD--  94

Query  233  DDIDIWTSMGFYVI  274
            D+++ +T   ++V+
Sbjct  95   DEVNNFTDFIYHVL  108



>ref|XP_004490314.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X1 [Cicer arietinum]
Length=434

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 29/93 (31%), Positives = 51/93 (55%), Gaps = 10/93 (11%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            I++LP +++D IL  L   E    ++LS  WR +W++  +L+F  DFF +   +YY  E 
Sbjct  17   ITDLPWNVIDGILKYLNIRELVGTSILSRKWRYMWMSVLQLEFDEDFF-YYCEEYY--EG  73

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFNFP  331
             +I         ++ ++LM H+G + KF  + P
Sbjct  74   PEIS-------RIMMEILMLHSGPLYKFTLSLP  99



>ref|XP_009770147.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Nicotiana 
sylvestris]
Length=420

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 45/91 (49%), Gaps = 11/91 (12%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            I  LP ++ D IL LLP  +AAR ++LS  WR IW     L   YD FC  L        
Sbjct  18   IRGLPRNVTDLILELLPAQDAARTSILSRNWRYIWATLPNLVLDYD-FCRKL--------  68

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFN  325
              I+   SM    ++++L+ H G I KF  +
Sbjct  69   --IEESESMFKLAVDEILLLHMGNIVKFILD  97



>ref|XP_007199086.1| hypothetical protein PRUPE_ppa018890mg [Prunus persica]
 gb|EMJ00285.1| hypothetical protein PRUPE_ppa018890mg [Prunus persica]
Length=382

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 33/92 (36%), Positives = 47/92 (51%), Gaps = 17/92 (18%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDF-----FCHL--LN  211
            IS LP +IL  IL LLP  EAA  ++LS  W+ +W++   L+F  +F      CH   L 
Sbjct  42   ISALPDEILVSILALLPLKEAAATSILSRRWQYVWMSTMVLNFDANFDVGSNICHFGALK  101

Query  212  KYYHDEKDDIDIWTSMGFYV--INKVLMQHNG  301
            +   D +         G YV  +N+V+ QH G
Sbjct  102  RKLRDLES--------GRYVNWVNRVVEQHRG  125



>gb|KEH29986.1| ubiquitin-protein ligase, putative [Medicago truncatula]
Length=444

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 46/88 (52%), Gaps = 7/88 (8%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP ++ D+IL+ LP  EA R +VLS+ WRN W     L F      H ++     + 
Sbjct  24   ISSLPGNVTDQILLHLPIKEALRTSVLSSKWRNKWYTMPNLVFDK----HCVSDATFQDP  79

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKF  316
              I   ++    +++ VL+ H+G I KF
Sbjct  80   SGI---SNKFLRIVDHVLLLHSGSIDKF  104



>ref|XP_009803967.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570 [Nicotiana 
sylvestris]
Length=422

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 44/98 (45%), Gaps = 9/98 (9%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS+LP  I++ IL+ LP ++A R +VLS  WR  W   TEL F         N       
Sbjct  10   ISDLPQSIIETILIKLPLLDAVRTSVLSRKWRYKWATITELVF---------NDTCLIPC  60

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFNFPFSTAK  346
             D  I +      I + L  H+G I KF  N  +S   
Sbjct  61   QDKAIISCNLVNFITRCLFLHDGPIHKFELNTSYSPTS  98



>ref|XP_007208808.1| hypothetical protein PRUPE_ppa024758mg [Prunus persica]
 gb|EMJ10007.1| hypothetical protein PRUPE_ppa024758mg [Prunus persica]
Length=388

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 47/97 (48%), Gaps = 12/97 (12%)
 Frame = +2

Query  53   ISELPADILDKILV-LLPTIEAARLAVLSTYWRNIWLNRTELDFGYD----FFCHLLNKY  217
            ISELP +IL  I++ LLP  EAA  ++LS  WR +W   T L F  D    +F  L  + 
Sbjct  11   ISELPEEILGGIILSLLPLKEAAATSILSKRWRYVWCFTTNLYFDDDDNLLYFRALEPEV  70

Query  218  YHDEKDDIDIWTSMGFYVINKVLMQHNGLIRKFAFNF  328
             H +      W       +N VL QH G + +F   F
Sbjct  71   RHQKSCRYVNW-------VNHVLKQHRGSVEQFRVCF  100



>ref|XP_009761514.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Nicotiana 
sylvestris]
 ref|XP_009761515.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Nicotiana 
sylvestris]
Length=433

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/94 (27%), Positives = 49/94 (52%), Gaps = 9/94 (10%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            +S LP  ++D+IL+ LP  +A R ++LS  WR  W    +L   +  +          ++
Sbjct  20   LSNLPRKVIDEILMCLPLRDAVRTSILSKRWRYKWRRLPQLTLEHTLW---------KKE  70

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFNFPF  334
            ++I   TS    +++ +L+ H G ++KF+   P+
Sbjct  71   ENITDLTSNFSEIVSHILVYHAGPVKKFSLCIPY  104



>ref|XP_009606383.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Nicotiana 
tomentosiformis]
 ref|XP_009606384.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Nicotiana 
tomentosiformis]
 ref|XP_009606385.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Nicotiana 
tomentosiformis]
 ref|XP_009606386.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Nicotiana 
tomentosiformis]
 ref|XP_009606388.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Nicotiana 
tomentosiformis]
Length=432

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 30/101 (30%), Positives = 51/101 (50%), Gaps = 14/101 (14%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            +++LP ++  +I   +   +AAR++VLS+ WR++W +  +L    D FC   N     + 
Sbjct  19   LTDLPINVRHQIQEHMTIEDAARMSVLSSNWRHVWASNPKLRISAD-FCRKRN-----QT  72

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFNFPFSTAKEFS  355
              IDI        IN++L+QH G I+ F  +       E S
Sbjct  73   GTIDI--------INRILLQHYGPIKTFLLDISMIHPSELS  105



>ref|XP_009344628.1| PREDICTED: F-box/LRR-repeat protein At3g58900-like isoform X1 
[Pyrus x bretschneideri]
 ref|XP_009344629.1| PREDICTED: F-box/LRR-repeat protein At3g58900-like isoform X1 
[Pyrus x bretschneideri]
 ref|XP_009344631.1| PREDICTED: F-box/LRR-repeat protein At3g58900-like isoform X1 
[Pyrus x bretschneideri]
Length=455

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 40/78 (51%), Gaps = 5/78 (6%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            ISELP  IL  +L  L T+ A R  VLST W N+W     L F  D++     KY   E 
Sbjct  15   ISELPDTILCHVLSFLETVHAVRTTVLSTRWNNLWTKVPNLHF--DYYPSFSPKY---ED  69

Query  233  DDIDIWTSMGFYVINKVL  286
            +D D+  +     +++VL
Sbjct  70   EDADVCRNHFMTFVDRVL  87



>ref|XP_010417971.1| PREDICTED: FBD-associated F-box protein At1g60410-like [Camelina 
sativa]
 ref|XP_010417972.1| PREDICTED: FBD-associated F-box protein At1g60410-like [Camelina 
sativa]
Length=406

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 21/48 (44%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFF  196
            +S+LP D+L +IL  L T E+ R ++LS  W+++W     LD GYD F
Sbjct  9    LSDLPCDVLCRILSQLSTKESVRTSILSRRWKDLWSQVPALDLGYDDF  56



>gb|EYU22466.1| hypothetical protein MIMGU_mgv1a026699mg [Erythranthe guttata]
Length=451

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 29/48 (60%), Gaps = 0/48 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFF  196
            ISELP DIL +IL  L   EA + +VLS  WR  W  RT LD  +D F
Sbjct  4    ISELPRDILQQILNFLSQKEAVQTSVLSKSWRYNWCIRTNLDLSFDNF  51



>ref|XP_006594775.1| PREDICTED: FBD-associated F-box protein At5g60610-like isoform 
X1 [Glycine max]
 ref|XP_006594776.1| PREDICTED: FBD-associated F-box protein At5g60610-like isoform 
X2 [Glycine max]
 ref|XP_006594777.1| PREDICTED: FBD-associated F-box protein At5g60610-like isoform 
X3 [Glycine max]
 ref|XP_006594778.1| PREDICTED: FBD-associated F-box protein At5g60610-like isoform 
X4 [Glycine max]
Length=412

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 24/49 (49%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFC  199
            IS LP +I+  IL  LPTIEA   +VLST WR++W     LDF  ++ C
Sbjct  44   ISSLPDEIICHILSFLPTIEAVTTSVLSTRWRSLWTLVLTLDFDDNWPC  92



>ref|XP_006847185.1| hypothetical protein AMTR_s00017p00248550 [Amborella trichopoda]
 gb|ERN08766.1| hypothetical protein AMTR_s00017p00248550 [Amborella trichopoda]
Length=285

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/95 (33%), Positives = 44/95 (46%), Gaps = 23/95 (24%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDF----GYDFFCHLLNKYY  220
            ISELP +I+  IL +L   EAAR +VLS  WR+ W +   L+F     Y + CH  N   
Sbjct  8    ISELPTEIILMILSMLTIREAARTSVLSRRWRSSWTSIPALNFVPDTAYSYSCHWAN---  64

Query  221  HDEKDDIDIWTSMGFYVINKVLMQHNGLIRKFAFN  325
                            +++ VL +H G I  F  +
Sbjct  65   ----------------IVDSVLSRHRGPISAFRLD  83



>ref|XP_006344337.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Solanum 
tuberosum]
Length=502

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 43/87 (49%), Gaps = 11/87 (13%)
 Frame = +2

Query  56   SELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEKD  235
            S LP +++D+IL LLP  +AAR ++LS  WR IW     L     F   L  K     K+
Sbjct  17   SALPRNLIDEILRLLPVHDAARTSILSKNWRYIWAAHPNLMLDKTFCSKLAVKSQSVLKE  76

Query  236  DIDIWTSMGFYVINKVLMQHNGLIRKF  316
             ID+           +L+QH G I KF
Sbjct  77   TIDM-----------ILLQHIGDIVKF  92



>gb|EYU28246.1| hypothetical protein MIMGU_mgv1a017752mg [Erythranthe guttata]
Length=504

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 27/48 (56%), Gaps = 0/48 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFF  196
            IS LP  IL KIL  L   EA R +VLS  WR+IW  R  LDF    F
Sbjct  16   ISILPEHILQKILYFLSQKEAVRTSVLSKSWRSIWCTRPNLDFSIQAF  63



>ref|XP_008386352.1| PREDICTED: putative F-box/LRR-repeat protein At3g59160 [Malus 
domestica]
Length=118

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 33/56 (59%), Gaps = 0/56 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYY  220
            ISELP  +L  IL  +PT  AAR ++LST W++ W++   LDF +     +  K Y
Sbjct  24   ISELPDAVLCHILSFVPTKYAARTSILSTXWKDKWVSVPNLDFEHKSKSFIAEKKY  79



>ref|XP_009339335.1| PREDICTED: putative F-box/FBD/LRR-repeat protein At4g13965 [Pyrus 
x bretschneideri]
 ref|XP_009339336.1| PREDICTED: putative F-box/FBD/LRR-repeat protein At4g13965 [Pyrus 
x bretschneideri]
 ref|XP_009339337.1| PREDICTED: putative F-box/FBD/LRR-repeat protein At4g13965 [Pyrus 
x bretschneideri]
 ref|XP_009339338.1| PREDICTED: putative F-box/FBD/LRR-repeat protein At4g13965 [Pyrus 
x bretschneideri]
Length=465

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 48/93 (52%), Gaps = 17/93 (18%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            ISELP  +L  IL  LP ++A +  +LS  W+N+W +  EL+F  + F H          
Sbjct  14   ISELPNSLLCHILSFLPILDAVQTTILSRRWKNLWTSIPELEFNDEGFNH----------  63

Query  233  DDIDIWTSMGFYV--INKVLMQHNGL-IRKFAF  322
                 WT    ++  +++VL  H+   I+KF+F
Sbjct  64   ----SWTEFNRFMTFVDRVLFLHDSTDIKKFSF  92



>ref|XP_002459711.1| hypothetical protein SORBIDRAFT_02g009200 [Sorghum bicolor]
 gb|EER96232.1| hypothetical protein SORBIDRAFT_02g009200 [Sorghum bicolor]
Length=476

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 30/90 (33%), Positives = 42/90 (47%), Gaps = 14/90 (16%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            +S LP DILD I+ LLP  ++AR  +LS  WR  W N   L+   +     LNK  H   
Sbjct  33   LSRLPDDILDSIITLLPAKDSARTQILSRRWRTFWRN-APLNLEANISYKNLNKDAH---  88

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAF  322
                         I  +L +H G +R+F+ 
Sbjct  89   ----------MASICSLLSRHEGPLRRFSL  108



>ref|XP_006290900.1| hypothetical protein CARUB_v10017012mg [Capsella rubella]
 gb|EOA23798.1| hypothetical protein CARUB_v10017012mg [Capsella rubella]
Length=523

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 33/91 (36%), Positives = 47/91 (52%), Gaps = 6/91 (7%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP  ++  IL  LPT EAA  +VLS  WR ++   T LDF  D  C       H+ K
Sbjct  9    ISSLPNPLISHILSFLPTKEAASTSVLSKRWRYLFGFVTNLDFD-DSVCE-----DHEGK  62

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFN  325
             D +I  S   +V   + +Q NG + +F+ +
Sbjct  63   SDAEISRSFMEFVDRVLALQGNGNVDRFSLD  93



>ref|XP_010654296.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570 isoform X2 
[Vitis vinifera]
Length=361

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 42/91 (46%), Gaps = 16/91 (18%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP  I++ ILV LP  EA R ++LS+ WR  W   T+L F  D F  LLN       
Sbjct  10   ISNLPLSIIESILVRLPIREAVRTSILSSKWRYRWSGITDLVFEDDLF--LLNDKLKK--  65

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFN  325
                         I +VL+ H G I KF   
Sbjct  66   ------------FITQVLLLHAGPIHKFQIT  84



>gb|AAF79391.1|AC068197_1 F16A14.1 [Arabidopsis thaliana]
 gb|AAS99710.1| At1g13780 [Arabidopsis thaliana]
Length=451

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFG  184
            ISELP  ++ +IL+ LPT  + + +VLST W+N+WLN   LD  
Sbjct  7    ISELPESLISQILLHLPTKASVKTSVLSTRWKNLWLNVPGLDLN  50



>gb|KFK38825.1| hypothetical protein AALP_AA3G165400 [Arabis alpina]
Length=968

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 27/42 (64%), Gaps = 0/42 (0%)
 Frame = +2

Query  56   SELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDF  181
            S L   +L +IL  LPT+EA R +VLS  WRN W N TEL F
Sbjct  557  SGLHESVLSRILSYLPTVEAVRTSVLSKTWRNAWTNVTELWF  598



>gb|KFK38824.1| hypothetical protein AALP_AA3G165400 [Arabis alpina]
Length=928

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 27/42 (64%), Gaps = 0/42 (0%)
 Frame = +2

Query  56   SELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDF  181
            S L   +L +IL  LPT+EA R +VLS  WRN W N TEL F
Sbjct  557  SGLHESVLSRILSYLPTVEAVRTSVLSKTWRNAWTNVTELWF  598



>gb|EPS66566.1| f-box family protein, partial [Genlisea aurea]
Length=181

 Score = 46.2 bits (108),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 43/91 (47%), Gaps = 14/91 (15%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            ISELP  + + IL  LP +EA R +VLS  WR  W + T++ F              D++
Sbjct  10   ISELPQSVAEIILTKLPILEAVRTSVLSRRWRYRWSSLTDIVF--------------DDR  55

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFN  325
              I          I K+L  HNG + KF+ +
Sbjct  56   SVIKSRIDRTNDFITKLLFAHNGPVHKFSIS  86



>ref|NP_172833.2| F-box/RNI-like/FBD-like domains-containing protein [Arabidopsis 
thaliana]
 sp|Q56XS8.1|FDL2_ARATH RecName: Full=F-box/FBD/LRR-repeat protein At1g13780 [Arabidopsis 
thaliana]
 dbj|BAD95126.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29068.1| F-box/RNI-like/FBD-like domains-containing protein [Arabidopsis 
thaliana]
Length=456

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFG  184
            ISELP  ++ +IL+ LPT  + + +VLST W+N+WLN   LD  
Sbjct  12   ISELPESLISQILLHLPTKASVKTSVLSTRWKNLWLNVPGLDLN  55



>gb|EYU42234.1| hypothetical protein MIMGU_mgv1a018216mg [Erythranthe guttata]
Length=488

 Score = 47.8 bits (112),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 27/45 (60%), Gaps = 0/45 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGY  187
            ISELP DIL +IL  L   E+ R +VLS  WR IW  R  LD  +
Sbjct  8    ISELPKDILQRILYFLSQKESIRTSVLSKSWRTIWRTRPNLDLDF  52



>ref|XP_003588364.1| F-box/FBD/LRR-repeat protein, partial [Medicago truncatula]
Length=100

 Score = 45.1 bits (105),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/89 (34%), Positives = 44/89 (49%), Gaps = 9/89 (10%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS+LP  I++ IL+ LP  +A R ++LS  WR  W   T+L F          K Y +  
Sbjct  17   ISDLPQSIIETILIQLPIRDAVRTSILSRKWRYKWSTITQLVFD--------EKCYPNST  68

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFA  319
            D   +  S+  + I ++L  H G I KF 
Sbjct  69   DREVVQKSVVEF-ITRLLFLHQGPIHKFQ  96



>gb|EMT10886.1| hypothetical protein F775_06693 [Aegilops tauschii]
Length=632

 Score = 47.8 bits (112),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 28/90 (31%), Positives = 45/90 (50%), Gaps = 10/90 (11%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            + +LP D+   I+ LLP  EA R +++ST WR +W  R  L F    + H         +
Sbjct  48   MEDLPVDVQAVIMSLLPLKEAVRTSIVSTSWRMLWTFRCNLSFKGPRYLH---------E  98

Query  233  DDIDIWTSMGFYVINKVLMQHNGL-IRKFA  319
            +D  I  +     +N V+ QH+ + I KF+
Sbjct  99   NDTKIQQAKCIETVNCVIQQHSRIGINKFS  128



>ref|XP_006400766.1| hypothetical protein EUTSA_v10013474mg [Eutrema salsugineum]
 gb|ESQ42219.1| hypothetical protein EUTSA_v10013474mg [Eutrema salsugineum]
Length=462

 Score = 47.8 bits (112),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 23/61 (38%), Positives = 37/61 (61%), Gaps = 6/61 (10%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDF------GYDFFCHLLNK  214
            IS+LP  ++ +IL+ LPT EA R +VLS  W+++WL+   LD        Y  F  +++K
Sbjct  20   ISKLPDSLISQILLYLPTEEAVRTSVLSNRWKSLWLSIPGLDLDSRVFPNYKVFVRIMDK  79

Query  215  Y  217
            +
Sbjct  80   F  80



>ref|XP_002270150.2| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570 isoform X1 
[Vitis vinifera]
Length=414

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 42/91 (46%), Gaps = 16/91 (18%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP  I++ ILV LP  EA R ++LS+ WR  W   T+L F  D F  LLN       
Sbjct  10   ISNLPLSIIESILVRLPIREAVRTSILSSKWRYRWSGITDLVFEDDLF--LLNDKLKK--  65

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFN  325
                         I +VL+ H G I KF   
Sbjct  66   ------------FITQVLLLHAGPIHKFQIT  84



>ref|XP_009344632.1| PREDICTED: putative F-box/LRR-repeat protein At4g13960 isoform 
X2 [Pyrus x bretschneideri]
Length=385

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 40/78 (51%), Gaps = 5/78 (6%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            ISELP  IL  +L  L T+ A R  VLST W N+W     L F  D++     KY   E 
Sbjct  15   ISELPDTILCHVLSFLETVHAVRTTVLSTRWNNLWTKVPNLHF--DYYPSFSPKY---ED  69

Query  233  DDIDIWTSMGFYVINKVL  286
            +D D+  +     +++VL
Sbjct  70   EDADVCRNHFMTFVDRVL  87



>ref|XP_007033533.1| Uncharacterized protein TCM_019702 [Theobroma cacao]
 gb|EOY04459.1| Uncharacterized protein TCM_019702 [Theobroma cacao]
Length=697

 Score = 47.8 bits (112),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFF  196
            IS+LP  +L  IL  LPTIEA + +VL+T WR +W +   LDF  D F
Sbjct  17   ISKLPEKVLGHILSHLPTIEAVQTSVLATKWRYLWTHIDNLDFDADDF  64



>ref|XP_008790134.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Phoenix 
dactylifera]
Length=420

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 33/88 (38%), Positives = 45/88 (51%), Gaps = 13/88 (15%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP DILDKILV LP  +A R + LS  WR+ W +   L F  D              
Sbjct  22   ISILPKDILDKILVRLPLRDAIRTSSLSRTWRHAWASMPALMFIDDSI----------PS  71

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKF  316
            +++D   +     +++VL+ HNG I KF
Sbjct  72   NNLD---AKFLLFVDRVLLLHNGPILKF  96



>gb|EYU26185.1| hypothetical protein MIMGU_mgv1a026227mg [Erythranthe guttata]
Length=262

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 27/44 (61%), Gaps = 0/44 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFG  184
            IS+LP DIL +IL  L   +A R +VLS  WR IW  R  LDF 
Sbjct  14   ISDLPKDILHRILYFLSQEDAVRTSVLSKSWRYIWCTRPNLDFS  57



>ref|XP_008339464.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g16930-like [Malus 
domestica]
Length=449

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 35/95 (37%), Positives = 48/95 (51%), Gaps = 9/95 (9%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            ISELP ++L  I+ LL   EAA + +LST WRN+W +   L+F  D       K    E+
Sbjct  14   ISELPDEVLVSIVSLLSLREAAAMRILSTRWRNVWKSTWTLNFDAD------PKALERER  67

Query  233  DDIDIWTSMGFYV--INKVLMQHNGL-IRKFAFNF  328
               D  T    YV  ++  L QH G+ I +F   F
Sbjct  68   YVTDXETLKERYVKWVDSTLEQHQGMSIEQFRICF  102



>ref|XP_002876577.1| hypothetical protein ARALYDRAFT_486543 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52836.1| hypothetical protein ARALYDRAFT_486543 [Arabidopsis lyrata subsp. 
lyrata]
Length=265

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIW  157
            IS+LP ++L +IL+ LPT E+ R +VLST WRN+W
Sbjct  7    ISQLPNELLHEILLNLPTSESVRTSVLSTRWRNLW  41



>ref|XP_006340108.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X1 [Solanum tuberosum]
Length=232

 Score = 46.6 bits (109),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/92 (33%), Positives = 52/92 (57%), Gaps = 13/92 (14%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            I  LP +++D IL LLP  +AAR ++LS+ WR+IW++   L    ++FC  L        
Sbjct  20   IIALPRNVVDLILELLPVHDAARTSILSSKWRDIWVSLPFLVLN-NYFCKKLTAK-----  73

Query  233  DDIDIWTSMGFYV-INKVLMQHNGLIRKFAFN  325
                  +++ F + ++++L+QH G I KF  +
Sbjct  74   ------SAIFFRITVDEILLQHVGDIVKFVLD  99



>ref|XP_002459702.1| hypothetical protein SORBIDRAFT_02g009070 [Sorghum bicolor]
 gb|EER96223.1| hypothetical protein SORBIDRAFT_02g009070 [Sorghum bicolor]
Length=401

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 29/88 (33%), Positives = 45/88 (51%), Gaps = 2/88 (2%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP  +L +I+ LL T EAAR  +L++ WR++WL    +  G D     +     D+K
Sbjct  67   ISGLPDAVLGEIVSLLSTKEAARTQILASRWRHVWLASPLVLDGTDLSTEPMAYRRDDKK  126

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKF  316
             D D         ++++L  H G  R+F
Sbjct  127  FDADKEALAS--AVSRILSAHRGPARRF  152



>ref|XP_010319632.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Solanum 
lycopersicum]
Length=76

 Score = 44.7 bits (104),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 27/85 (32%), Positives = 47/85 (55%), Gaps = 10/85 (12%)
 Frame = +2

Query  62   LPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEKDDI  241
            +P +++D IL L+P  +AAR ++LS+ WRNIW+    L         +LN Y+  +K   
Sbjct  1    MPRNVVDLILELIPVRDAARTSILSSKWRNIWVALLYL---------VLNNYFR-KKFHC  50

Query  242  DIWTSMGFYVINKVLMQHNGLIRKF  316
              +       ++++L++H G I KF
Sbjct  51   KTYNYFFLKTVDEILLEHVGDIVKF  75



>ref|XP_006346554.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Solanum 
tuberosum]
Length=232

 Score = 46.6 bits (109),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 32/95 (34%), Positives = 48/95 (51%), Gaps = 17/95 (18%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLL---NKYYH  223
            IS LP++I+D IL  LP  +AAR ++LS  WR IW     L    + FC+ L   ++Y  
Sbjct  10   ISSLPSNIIDCILEFLPVQDAARTSILSKKWRYIWAMLLNLKLD-NLFCNKLASRSQYVF  68

Query  224  DEKDDIDIWTSMGFYVINKVLMQHNGLIRKFAFNF  328
            ++              I+K+L+ H G I KF  + 
Sbjct  69   EQ-------------TIDKILLHHIGDIVKFDLDL  90



>ref|XP_009373733.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Pyrus 
x bretschneideri]
 ref|XP_009373734.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Pyrus 
x bretschneideri]
Length=450

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 30/95 (32%), Positives = 45/95 (47%), Gaps = 22/95 (23%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP D+LD ILV LP  E  R ++LS+ WR  W                ++++  D+K
Sbjct  45   ISSLPWDVLDGILVRLPLKEVVRTSILSSRWRRKWTG--------------ISQFVIDDK  90

Query  233  -------DDIDIWTSMGFYVINKVLMQHNGLIRKF  316
                   D +  W S+   ++ +V + H G I KF
Sbjct  91   CIPSRISDKVARWESI-MEILRQVQLHHTGPIEKF  124



>ref|XP_008339465.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g16930-like [Malus 
domestica]
Length=449

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 35/95 (37%), Positives = 48/95 (51%), Gaps = 9/95 (9%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            ISELP ++L  I+ LL   EAA + +LST WRN+W +   L+F  D       K    E+
Sbjct  14   ISELPDEVLVSIVSLLSLREAAAMRILSTRWRNVWKSTWTLNFDAD------PKALERER  67

Query  233  DDIDIWTSMGFYV--INKVLMQHNGL-IRKFAFNF  328
               D  T    YV  ++  L QH G+ I +F   F
Sbjct  68   YVTDXETLKERYVKWVDSTLEQHQGMSIEQFRICF  102



>ref|XP_004309879.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Fragaria 
vesca subsp. vesca]
Length=428

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 36/88 (41%), Positives = 49/88 (56%), Gaps = 5/88 (6%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LP D+ +KIL  L   EAAR +VLST WR  + +    D  +D  C   ++  + E 
Sbjct  6    ISSLPNDVTEKILSHLLPREAARTSVLSTKWR--YKSAMLHDLEFDECC--WSESQNREV  61

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKF  316
            DD D  TS    +++ VL+ H G IRKF
Sbjct  62   DDCDDQTSF-VKMVDHVLLLHIGPIRKF  88



>gb|EYU25809.1| hypothetical protein MIMGU_mgv1a021367mg, partial [Erythranthe 
guttata]
Length=212

 Score = 46.2 bits (108),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 28/43 (65%), Gaps = 0/43 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDF  181
            IS+LP DIL  IL LL   EA R +VLST W N+W +   LDF
Sbjct  17   ISQLPDDILVDILCLLSLKEAGRTSVLSTRWINLWKHTPSLDF  59



>ref|XP_006366448.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006366449.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006366450.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X3 [Solanum tuberosum]
 ref|XP_006366451.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X4 [Solanum tuberosum]
 ref|XP_006366452.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X5 [Solanum tuberosum]
 ref|XP_006366453.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X6 [Solanum tuberosum]
Length=431

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 32/91 (35%), Positives = 44/91 (48%), Gaps = 8/91 (9%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS LPA I+DKIL  L   +A R +VLST WRN W+    L F         N+      
Sbjct  23   ISNLPAQIVDKILSHLSLRDAVRTSVLSTKWRNKWVTLPNLVFD--------NQSLLISS  74

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFN  325
             D     +    +++ VL+ H+G I KF  +
Sbjct  75   QDQTFIKNKIVNIVDHVLLLHSGPIHKFKLS  105



>ref|XP_002865307.1| hypothetical protein ARALYDRAFT_494488 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41566.1| hypothetical protein ARALYDRAFT_494488 [Arabidopsis lyrata subsp. 
lyrata]
Length=386

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 33/47 (70%), Gaps = 3/47 (6%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNR---TELDFG  184
            ISELP  ++ +IL+ LPT ++ + +VLST WRN+WLN    T +D G
Sbjct  6    ISELPESLITQILLWLPTKDSIKTSVLSTRWRNLWLNEWIATAVDSG  52



>ref|XP_006348920.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006348921.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006348922.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X3 [Solanum tuberosum]
 ref|XP_006348923.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X4 [Solanum tuberosum]
 ref|XP_006348924.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X5 [Solanum tuberosum]
 ref|XP_006348925.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform 
X6 [Solanum tuberosum]
Length=428

 Score = 47.4 bits (111),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 30/91 (33%), Positives = 46/91 (51%), Gaps = 9/91 (10%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            +S LP +++D IL+ LP  +A R +VLS  WR  W  RTEL          L++     +
Sbjct  18   LSNLPHNVIDVILIHLPCKDAVRTSVLSKKWRYHWCRRTELT---------LDESLWKTR  68

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFN  325
            +D+   T     +I ++L  H G + KF  N
Sbjct  69   EDLLNPTVRFREIIYQLLTLHEGPVTKFTLN  99



>ref|XP_006356259.1| PREDICTED: putative F-box/LRR-repeat protein At3g18150-like [Solanum 
tuberosum]
Length=521

 Score = 47.4 bits (111),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 46/93 (49%), Gaps = 16/93 (17%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            IS+LP  +LD IL  L   +AA+ + LS  W +IW   + LDFG        + Y H  K
Sbjct  7    ISKLPEPVLDHILSFLDIKDAAKTSTLSKVWNSIWTYLSSLDFG--------DNYLHKSK  58

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFNFP  331
            + +D+       + N+  +  N  I++F  N P
Sbjct  59   NTVDL------ILANR--LNQNISIKRFKVNLP  83



>ref|XP_006847183.1| hypothetical protein AMTR_s00017p00248290 [Amborella trichopoda]
 gb|ERN08764.1| hypothetical protein AMTR_s00017p00248290 [Amborella trichopoda]
Length=315

 Score = 47.0 bits (110),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 31/95 (33%), Positives = 45/95 (47%), Gaps = 23/95 (24%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDF----GYDFFCHLLNKYY  220
            ISELP +I+  IL +L   EAAR +VLS  WR+ W +   L+F     Y + CH  N   
Sbjct  8    ISELPTEIILMILSMLTIREAARTSVLSRRWRSSWTSIPALNFVPDTVYSYSCHWAN---  64

Query  221  HDEKDDIDIWTSMGFYVINKVLMQHNGLIRKFAFN  325
                            +++ VL +H+G I  F  +
Sbjct  65   ----------------IVDSVLSRHHGPISAFRLD  83



>ref|XP_009787860.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Nicotiana 
sylvestris]
Length=432

 Score = 47.4 bits (111),  Expect = 0.001, Method: Composition-based stats.
 Identities = 26/92 (28%), Positives = 48/92 (52%), Gaps = 14/92 (15%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            +++LP +++ +I   +   +AAR++VLS+ WR++W +  +L    DF        Y  EK
Sbjct  19   LTDLPINVIHQIQEYMTIEDAARMSVLSSKWRHVWASNPKLRISTDF--------YRKEK  70

Query  233  DDIDIWTSMGFYVINKVLMQHNGLIRKFAFNF  328
                   S    +IN++L+ H G I+ F  + 
Sbjct  71   Q------SSTTDIINRILLHHYGPIKTFLLDL  96



>ref|XP_008359370.1| PREDICTED: probable FBD-associated F-box protein At1g32375 [Malus 
domestica]
 ref|XP_008359371.1| PREDICTED: probable FBD-associated F-box protein At1g32375 [Malus 
domestica]
 ref|XP_008359372.1| PREDICTED: probable FBD-associated F-box protein At1g32375 [Malus 
domestica]
 ref|XP_008366526.1| PREDICTED: probable FBD-associated F-box protein At1g32375 [Malus 
domestica]
 ref|XP_008366527.1| PREDICTED: probable FBD-associated F-box protein At1g32375 [Malus 
domestica]
 ref|XP_008366528.1| PREDICTED: probable FBD-associated F-box protein At1g32375 [Malus 
domestica]
Length=465

 Score = 47.4 bits (111),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 48/93 (52%), Gaps = 17/93 (18%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFFCHLLNKYYHDEK  232
            ISELP  +L  IL  LP ++A    +LS  W+N+W +  EL+F  + F H          
Sbjct  14   ISELPNALLCHILSFLPILDAVHTTILSRRWKNLWTSLPELEFDDEGFNH----------  63

Query  233  DDIDIWTSMGFYV--INKVLMQHNGL-IRKFAF  322
                 WT +  ++  +++VL  H+   I+KF+F
Sbjct  64   ----SWTELNRFMMFVDRVLFLHDSTDIKKFSF  92



>ref|XP_010094148.1| Putative F-box/FBD/LRR-repeat protein [Morus notabilis]
 gb|EXB55281.1| Putative F-box/FBD/LRR-repeat protein [Morus notabilis]
Length=417

 Score = 47.0 bits (110),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +2

Query  56   SELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGYDFF  196
            SELP  IL  IL  +PT EAAR ++LS  W++ W +R+++D   + F
Sbjct  4    SELPQHILHHILNFVPTKEAARTSILSKTWKSTWDSRSKVDLDLNIF  50



>ref|XP_006279786.1| hypothetical protein CARUB_v10027905mg [Capsella rubella]
 gb|EOA12684.1| hypothetical protein CARUB_v10027905mg [Capsella rubella]
Length=356

 Score = 47.0 bits (110),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFGY  187
            IS+LP  ++ +IL  LPT +A R + LST WRN+W +   LD  Y
Sbjct  24   ISKLPESLISEILYHLPTRDAVRTSALSTRWRNLWQSVPTLDLSY  68



>gb|EYU30163.1| hypothetical protein MIMGU_mgv1a005822mg [Erythranthe guttata]
Length=469

 Score = 47.4 bits (111),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = +2

Query  53   ISELPADILDKILVLLPTIEAARLAVLSTYWRNIWLNRTELDFG  184
            +SELP +IL +IL LL   EA R +VLS  WR+IW  R  L F 
Sbjct  16   LSELPKEILQRILCLLSQEEAVRTSVLSKPWRHIWRTRPNLVFS  59



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 518329882422