BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18133_g1_i2 len=1411 path=[2339:0-125 2767:126-213 2465:214-1410]

Length=1411
                                                                      Score     E

gb|AFY26876.1|  anionic peroxidase swpa8                                611   0.0      
ref|XP_007027286.1|  Peroxidase superfamily protein                     513   2e-177   
ref|XP_009790009.1|  PREDICTED: peroxidase 21                           512   3e-177   
gb|KHG08272.1|  Peroxidase 21 -like protein                             510   2e-176   
gb|KDP29096.1|  hypothetical protein JCGZ_16485                         508   1e-175   
ref|XP_009598152.1|  PREDICTED: peroxidase 21                           506   5e-175   
ref|XP_009601140.1|  PREDICTED: peroxidase 21-like                      506   1e-174   
ref|XP_006381476.1|  Peroxidase 21 precursor family protein             499   2e-172   
ref|XP_011094690.1|  PREDICTED: peroxidase 21                           498   9e-172   
ref|XP_004249496.1|  PREDICTED: peroxidase 21-like                      498   1e-171   
ref|XP_009769680.1|  PREDICTED: peroxidase 21-like                      498   2e-171   
ref|XP_004246673.1|  PREDICTED: peroxidase 21                           496   7e-171   
ref|XP_011004734.1|  PREDICTED: peroxidase 21                           496   7e-171   
ref|XP_006339298.1|  PREDICTED: peroxidase 21-like                      496   8e-171   
ref|XP_002275288.1|  PREDICTED: peroxidase 21                           490   2e-168   Vitis vinifera
ref|XP_009358151.1|  PREDICTED: peroxidase 21                           487   3e-167   
ref|XP_008239361.1|  PREDICTED: peroxidase 21                           486   4e-167   
ref|XP_008369744.1|  PREDICTED: peroxidase 21                           486   4e-167   
ref|XP_010107565.1|  Peroxidase 21                                      485   1e-166   
gb|EYU41619.1|  hypothetical protein MIMGU_mgv1a010067mg                483   1e-165   
gb|AFK33615.1|  unknown                                                 482   2e-165   
gb|KEH42268.1|  cationic peroxidase                                     480   1e-164   
gb|AFK39383.1|  unknown                                                 478   8e-164   
ref|XP_006410893.1|  hypothetical protein EUTSA_v10016921mg             477   2e-163   
ref|NP_181250.1|  peroxidase                                            477   2e-163   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010516960.1|  PREDICTED: peroxidase 21-like                      477   2e-163   
ref|XP_004497489.1|  PREDICTED: peroxidase 21-like                      476   6e-163   
ref|XP_006294588.1|  hypothetical protein CARUB_v10023623mg             476   6e-163   
gb|KEH42264.1|  cationic peroxidase                                     475   1e-162   
ref|XP_010253604.1|  PREDICTED: peroxidase 21-like isoform X2           475   1e-162   
ref|XP_010505278.1|  PREDICTED: peroxidase 21-like                      475   1e-162   
gb|AAM65003.1|  putative peroxidase ATP2a                               474   2e-162   Arabidopsis thaliana [mouse-ear cress]
emb|CAA66961.1|  peroxidase                                             474   2e-162   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010509387.1|  PREDICTED: peroxidase 21                           474   3e-162   
ref|XP_010696406.1|  PREDICTED: peroxidase 21                           474   4e-162   
ref|XP_006428826.1|  hypothetical protein CICLE_v10012170mg             474   4e-162   
emb|CDP06722.1|  unnamed protein product                                474   4e-162   
ref|XP_006480640.1|  PREDICTED: peroxidase 21-like                      473   5e-162   
ref|XP_010528140.1|  PREDICTED: peroxidase 21                           473   6e-162   
ref|XP_010264743.1|  PREDICTED: peroxidase 21-like                      473   7e-162   
gb|KFK36603.1|  hypothetical protein AALP_AA4G145000                    473   9e-162   
ref|XP_009133118.1|  PREDICTED: peroxidase 21 isoform X1                473   9e-162   
ref|NP_001118461.1|  peroxidase                                         471   1e-161   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006466081.1|  PREDICTED: peroxidase 21-like                      472   2e-161   
emb|CDX79717.1|  BnaC03g20530D                                          472   2e-161   
gb|KDO58640.1|  hypothetical protein CISIN_1g045164mg                   471   5e-161   
ref|XP_002881491.1|  peroxidase 21                                      471   5e-161   
ref|XP_004304410.1|  PREDICTED: peroxidase 21-like                      471   6e-161   
ref|XP_008442669.1|  PREDICTED: peroxidase 21-like                      471   6e-161   
gb|AGX27515.1|  POD21                                                   471   1e-160   
ref|XP_010253603.1|  PREDICTED: peroxidase 21-like isoform X1           470   1e-160   
ref|XP_009141629.1|  PREDICTED: peroxidase 21-like                      469   2e-160   
emb|CDY55434.1|  BnaA04g29190D                                          469   3e-160   
ref|XP_006426476.1|  hypothetical protein CICLE_v10026035mg             469   4e-160   
ref|XP_007143853.1|  hypothetical protein PHAVU_007G107400g             468   1e-159   
gb|KHN39097.1|  Peroxidase 21                                           467   1e-159   
ref|XP_003590492.1|  Peroxidase                                         467   1e-159   
ref|XP_003537275.1|  PREDICTED: peroxidase 21                           467   2e-159   
ref|XP_006850686.1|  hypothetical protein AMTR_s00034p00235030          466   4e-159   
ref|XP_004137814.1|  PREDICTED: peroxidase 21-like                      464   2e-158   
ref|XP_010046754.1|  PREDICTED: peroxidase 21                           463   5e-158   
gb|KCW88828.1|  hypothetical protein EUGRSUZ_A01166                     464   7e-158   
ref|XP_008793497.1|  PREDICTED: peroxidase 21                           462   1e-157   
gb|KHN48312.1|  Peroxidase 21                                           462   1e-157   
ref|XP_003542507.1|  PREDICTED: peroxidase 21                           462   1e-157   
ref|XP_010920894.1|  PREDICTED: peroxidase 21 isoform X2                458   2e-156   
ref|XP_010920892.1|  PREDICTED: peroxidase 21 isoform X1                458   6e-156   
ref|XP_007207867.1|  hypothetical protein PRUPE_ppa022386mg             454   9e-155   
gb|KEH42266.1|  cationic peroxidase                                     449   9e-153   
ref|XP_009392193.1|  PREDICTED: peroxidase 21                           448   4e-152   
ref|XP_004143352.1|  PREDICTED: peroxidase 21-like                      430   5e-145   
ref|XP_002439661.1|  hypothetical protein SORBIDRAFT_09g018150          428   6e-144   Sorghum bicolor [broomcorn]
ref|XP_004156341.1|  PREDICTED: peroxidase 21-like                      426   2e-143   
ref|XP_006658177.1|  PREDICTED: peroxidase 21-like                      425   3e-143   
gb|ACT35471.1|  peroxidase 21                                           421   1e-142   Brassica rapa
ref|XP_008449266.1|  PREDICTED: peroxidase 21-like                      421   2e-141   
gb|EMT14452.1|  Peroxidase 21                                           421   2e-141   
dbj|BAJ87808.1|  predicted protein                                      421   2e-141   
dbj|BAJ86378.1|  predicted protein                                      421   3e-141   
dbj|BAC84057.1|  putative peroxidase                                    402   3e-134   Oryza sativa Japonica Group [Japonica rice]
gb|AHN05533.1|  peroxidase                                              401   1e-133   
ref|XP_003590493.1|  Peroxidase                                         390   2e-130   
ref|XP_011086187.1|  PREDICTED: peroxidase 42-like                      391   1e-129   
ref|XP_004962309.1|  PREDICTED: peroxidase 21-like                      390   3e-129   
gb|ADD54644.1|  peroxidase                                              390   4e-129   Bruguiera gymnorhiza [Burma mangrove]
gb|EYU27791.1|  hypothetical protein MIMGU_mgv1a007622mg                392   4e-129   
ref|XP_011096066.1|  PREDICTED: peroxidase 42-like                      389   5e-129   
ref|XP_010052841.1|  PREDICTED: peroxidase 42-like                      389   8e-129   
ref|XP_008441087.1|  PREDICTED: peroxidase 42                           387   3e-128   
gb|AHW98115.1|  peroxidase                                              387   3e-128   
ref|XP_004145112.1|  PREDICTED: peroxidase 42-like                      386   8e-128   
ref|XP_004165387.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase 4...    386   8e-128   
ref|NP_001237601.1|  cationic peroxidase 2 precursor                    385   2e-127   
ref|XP_010092206.1|  Peroxidase 42                                      385   2e-127   
gb|KDP20749.1|  hypothetical protein JCGZ_21220                         385   3e-127   
gb|AFY26877.1|  basic peroxidase swpb6                                  384   4e-127   
gb|EAZ05247.1|  hypothetical protein OsI_27449                          392   5e-127   Oryza sativa Indica Group [Indian rice]
dbj|BAB16317.1|  secretory peroxidase                                   384   8e-127   Avicennia marina
gb|EAZ27428.1|  hypothetical protein OsJ_11374                          385   2e-126   Oryza sativa Japonica Group [Japonica rice]
gb|AEK87128.1|  class III peroxidase                                    383   2e-126   
gb|ADR70870.1|  secretory peroxidase                                    383   2e-126   
gb|ABK22252.1|  unknown                                                 383   2e-126   Picea sitchensis
ref|NP_001238183.1|  peroxidase precursor                               382   3e-126   
ref|XP_002304909.1|  Peroxidase 42 precursor family protein             382   4e-126   Populus trichocarpa [western balsam poplar]
gb|EPS68822.1|  secretory peroxidase                                    382   4e-126   
gb|ACT21094.1|  peroxidase                                              382   7e-126   Camellia oleifera [abura-tsubaki]
ref|XP_011037651.1|  PREDICTED: peroxidase 42                           381   8e-126   
ref|XP_002274769.1|  PREDICTED: peroxidase 42                           381   9e-126   Vitis vinifera
ref|XP_006449726.1|  hypothetical protein CICLE_v10015870mg             380   2e-125   
ref|XP_010686841.1|  PREDICTED: peroxidase 42                           380   2e-125   
ref|XP_007153945.1|  hypothetical protein PHAVU_003G078600g             380   3e-125   
ref|NP_001289781.1|  ceruloplasmin precursor                            379   6e-125   
ref|XP_009779064.1|  PREDICTED: peroxidase 42-like                      379   6e-125   
gb|AAY26520.1|  secretory peroxidase                                    379   7e-125   Catharanthus roseus [chatas]
ref|XP_004232712.1|  PREDICTED: peroxidase 42-like                      379   7e-125   
ref|XP_006467438.1|  PREDICTED: peroxidase 42-like                      379   8e-125   
gb|KDO78221.1|  hypothetical protein CISIN_1g019129mg                   378   8e-125   
emb|CDP04398.1|  unnamed protein product                                378   1e-124   
ref|XP_006348116.1|  PREDICTED: peroxidase 42-like                      378   1e-124   
ref|XP_007026071.1|  Peroxidase superfamily protein                     377   2e-124   
ref|XP_010057924.1|  PREDICTED: peroxidase 42-like                      377   3e-124   
ref|XP_009613011.1|  PREDICTED: peroxidase 42-like                      377   3e-124   
gb|AGV54491.1|  cationic peroxidase                                     377   3e-124   
ref|XP_004293288.1|  PREDICTED: peroxidase 42-like                      377   3e-124   
gb|AHA84196.1|  cationic peroxidase 2 precursor                         377   4e-124   
gb|AGV54649.1|  cationic peroxidase 2                                   377   5e-124   
ref|XP_010538938.1|  PREDICTED: peroxidase 42                           376   7e-124   
gb|AAA99868.1|  peroxidase                                              375   1e-123   Gossypium hirsutum [American cotton]
ref|XP_010278692.1|  PREDICTED: peroxidase 42-like                      374   7e-123   
ref|NP_001266136.1|  peroxidase 42-like precursor                       373   1e-122   
ref|XP_007211579.1|  hypothetical protein PRUPE_ppa008503mg             372   2e-122   
ref|XP_008224830.1|  PREDICTED: peroxidase 42                           372   3e-122   
ref|XP_009360637.1|  PREDICTED: peroxidase 42-like                      372   3e-122   
gb|AFY97687.1|  peroxidase 4                                            372   4e-122   
ref|XP_006413703.1|  hypothetical protein EUTSA_v10025680mg             371   5e-122   
ref|XP_008345825.1|  PREDICTED: peroxidase 42-like                      371   8e-122   
gb|ABU54828.1|  peroxidase                                              370   2e-121   Eutrema halophilum
ref|XP_009135472.1|  PREDICTED: peroxidase 42                           370   2e-121   
ref|XP_003610431.1|  Peroxidase                                         370   2e-121   
gb|KDO78226.1|  hypothetical protein CISIN_1g019129mg                   370   3e-121   
ref|XP_008358754.1|  PREDICTED: peroxidase 42-like                      369   4e-121   
ref|XP_006841743.1|  hypothetical protein AMTR_s00003p00260700          369   4e-121   
ref|XP_006282667.1|  hypothetical protein CARUB_v10005223mg             368   9e-121   
emb|CAA66862.1|  peroxidase ATP1a                                       368   1e-120   Arabidopsis thaliana [mouse-ear cress]
emb|CAA17163.1|  peroxidase prxr1                                       367   1e-120   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867801.1|  hypothetical protein ARALYDRAFT_492673             367   2e-120   
gb|AAL24415.1|  putative peroxidase ATP2a                               363   2e-120   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567641.1|  peroxidase 42                                         367   3e-120   Arabidopsis thaliana [mouse-ear cress]
gb|KFK28780.1|  hypothetical protein AALP_AA7G046800                    366   5e-120   
gb|ABC02343.1|  class III peroxidase                                    366   7e-120   
ref|XP_003610432.1|  Peroxidase                                         366   7e-120   
ref|NP_001289235.1|  uncharacterized protein LOC103948174 precursor     365   1e-119   
gb|KHG03947.1|  Peroxidase 42 -like protein                             360   1e-117   
gb|KDO78222.1|  hypothetical protein CISIN_1g019129mg                   354   3e-115   
ref|NP_001060737.2|  Os07g0694300                                       346   5e-113   Oryza sativa Japonica Group [Japonica rice]
gb|AAT07453.1|  peroxidase                                              343   2e-112   Mirabilis jalapa
ref|XP_002519557.1|  Peroxidase 21 precursor, putative                  339   5e-111   Ricinus communis
gb|ACM45784.1|  peroxidase                                              330   3e-107   Cucumis sativus [cucumbers]
gb|KDO78224.1|  hypothetical protein CISIN_1g019129mg                   332   1e-106   
gb|KDO78223.1|  hypothetical protein CISIN_1g019129mg                   327   6e-105   
gb|AID69227.1|  peroxidase                                              311   2e-100   
ref|XP_001768671.1|  predicted protein                                  301   1e-94    
gb|ACJ84264.1|  unknown                                                 296   9e-94    Medicago truncatula
dbj|BAD94372.1|  putative peroxidase ATP2a                              290   2e-92    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006449725.1|  hypothetical protein CICLE_v10015870mg             291   4e-92    
gb|ACN60164.1|  cationic peroxidase                                     291   5e-92    Tamarix hispida
gb|KDO78227.1|  hypothetical protein CISIN_1g019129mg                   291   6e-92    
ref|XP_002518482.1|  Peroxidase 63 precursor, putative                  259   2e-79    Ricinus communis
gb|KDO48108.1|  hypothetical protein CISIN_1g0200841mg                  254   2e-78    
ref|XP_010254703.1|  PREDICTED: peroxidase 72-like                      252   9e-76    
ref|XP_004146491.1|  PREDICTED: peroxidase 72-like                      251   4e-75    
ref|XP_008452113.1|  PREDICTED: peroxidase 72-like                      251   5e-75    
ref|XP_009591264.1|  PREDICTED: peroxidase 72-like                      248   4e-74    
ref|XP_001784989.1|  predicted protein                                  246   9e-74    
ref|XP_010059581.1|  PREDICTED: peroxidase 29                           246   1e-73    
ref|XP_009621858.1|  PREDICTED: peroxidase 72-like                      246   2e-73    
ref|XP_006425607.1|  hypothetical protein CICLE_v10026054mg             246   2e-73    
gb|EYU31175.1|  hypothetical protein MIMGU_mgv1a009720mg                245   7e-73    
gb|KDO71031.1|  hypothetical protein CISIN_1g020149mg                   244   8e-73    
ref|XP_009771827.1|  PREDICTED: peroxidase 72-like                      244   8e-73    
ref|XP_006466861.1|  PREDICTED: peroxidase 72-like                      244   8e-73    
ref|XP_004149985.1|  PREDICTED: peroxidase 72-like                      244   9e-73    
ref|XP_009396319.1|  PREDICTED: peroxidase 72-like                      244   1e-72    
ref|XP_011083175.1|  PREDICTED: peroxidase 72-like                      243   2e-72    
gb|KCW75248.1|  hypothetical protein EUGRSUZ_E03999                     243   2e-72    
dbj|BAB89258.1|  putative peroxidase ATP6a                              243   3e-72    Oryza sativa Japonica Group [Japonica rice]
dbj|BAA94962.1|  peroxidase                                             243   3e-72    Asparagus officinalis
ref|NP_001043276.1|  Os01g0543100                                       243   3e-72    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010924103.1|  PREDICTED: peroxidase 72-like                      243   3e-72    
ref|XP_008440774.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase 49      243   3e-72    
ref|XP_003517206.1|  PREDICTED: peroxidase 72-like                      243   4e-72    
ref|XP_006590700.1|  PREDICTED: peroxidase 72-like                      243   4e-72    
ref|XP_010252387.1|  PREDICTED: peroxidase 72-like                      243   4e-72    
ref|XP_010252386.1|  PREDICTED: peroxidase 72-like                      242   6e-72    
ref|XP_009395537.1|  PREDICTED: peroxidase 72-like                      242   8e-72    
gb|ACK76695.1|  peroxidase                                              237   8e-72    Pyrus x bretschneideri [bai li]
ref|XP_004232442.2|  PREDICTED: peroxidase 49-like                      243   9e-72    
gb|AHL39156.1|  class III peroxidase                                    242   9e-72    
ref|XP_002275309.1|  PREDICTED: peroxidase 72                           242   1e-71    Vitis vinifera
ref|XP_010275548.1|  PREDICTED: peroxidase 72-like                      241   1e-71    
ref|XP_009762369.1|  PREDICTED: peroxidase 72-like                      241   2e-71    
ref|XP_002310274.1|  Peroxidase 49 precursor family protein             241   2e-71    Populus trichocarpa [western balsam poplar]
ref|XP_009778388.1|  PREDICTED: peroxidase 72-like                      241   2e-71    
ref|XP_006340673.1|  PREDICTED: peroxidase 49-like                      241   2e-71    
ref|XP_004232440.1|  PREDICTED: peroxidase 72-like                      241   2e-71    
dbj|BAJ98142.1|  predicted protein                                      241   3e-71    
ref|XP_002961515.1|  hypothetical protein SELMODRAFT_77725              239   3e-71    
emb|CCJ34840.1|  horseradish peroxidase isoenzyme HRP_6117              241   3e-71    
ref|XP_009346064.1|  PREDICTED: peroxidase 72-like                      240   3e-71    
ref|XP_003612078.1|  Peroxidase                                         240   3e-71    
ref|XP_009587109.1|  PREDICTED: peroxidase 72                           240   4e-71    
ref|XP_007202348.1|  hypothetical protein PRUPE_ppa008349mg             240   6e-71    
gb|ACI22425.1|  pericarp peroxidase 3                                   239   6e-71    Litchi chinensis [litchi]
ref|XP_006340671.1|  PREDICTED: peroxidase 72-like                      239   7e-71    
ref|XP_010938174.1|  PREDICTED: peroxidase 5-like                       239   7e-71    
ref|XP_008338047.1|  PREDICTED: peroxidase 72-like                      239   8e-71    
ref|XP_006409192.1|  hypothetical protein EUTSA_v10022774mg             239   1e-70    
ref|XP_008241745.1|  PREDICTED: peroxidase 72-like                      239   1e-70    
ref|XP_002886150.1|  hypothetical protein ARALYDRAFT_480719             239   1e-70    
ref|XP_010029741.1|  PREDICTED: peroxidase 72                           239   2e-70    
ref|XP_009102275.1|  PREDICTED: peroxidase 15                           239   2e-70    
ref|XP_008352450.1|  PREDICTED: peroxidase 72-like                      239   2e-70    
ref|XP_010548306.1|  PREDICTED: peroxidase 49                           238   2e-70    
ref|XP_007158602.1|  hypothetical protein PHAVU_002G166300g             238   2e-70    
gb|KHG08031.1|  Peroxidase 72 -like protein                             238   2e-70    
ref|XP_006299700.1|  hypothetical protein CARUB_v10015891mg             238   2e-70    
ref|XP_002455760.1|  hypothetical protein SORBIDRAFT_03g024460          238   2e-70    Sorghum bicolor [broomcorn]
ref|XP_006383152.1|  hypothetical protein POPTR_0005s12070g             238   3e-70    
emb|CDY46313.1|  BnaA07g01880D                                          238   3e-70    
ref|XP_004232441.1|  PREDICTED: peroxidase 72-like                      238   3e-70    
ref|XP_006340672.1|  PREDICTED: peroxidase 72-like                      238   3e-70    
ref|XP_010936646.1|  PREDICTED: peroxidase 72-like                      238   3e-70    
ref|XP_009778389.1|  PREDICTED: peroxidase 72-like                      238   3e-70    
gb|EAY74439.1|  hypothetical protein OsI_02330                          238   3e-70    Oryza sativa Indica Group [Indian rice]
ref|XP_009793693.1|  PREDICTED: peroxidase 72-like                      238   4e-70    
emb|CBI23244.3|  unnamed protein product                                232   4e-70    
ref|XP_009599956.1|  PREDICTED: peroxidase 72-like                      238   4e-70    
ref|XP_008337703.1|  PREDICTED: peroxidase 72-like                      238   4e-70    
ref|NP_179407.1|  peroxidase 15                                         238   4e-70    Arabidopsis thaliana [mouse-ear cress]
gb|AAP42506.1|  anionic peroxidase swpb1                                237   5e-70    Ipomoea batatas [batate]
ref|XP_009393610.1|  PREDICTED: peroxidase 72-like                      237   5e-70    
gb|AAM61616.1|  putative peroxidase                                     238   5e-70    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006840851.1|  hypothetical protein AMTR_s00083p00110830          237   5e-70    
gb|ABG49114.1|  peroxidase                                              237   5e-70    Dimocarpus longan [longan]
ref|XP_008337713.1|  PREDICTED: peroxidase 72-like                      237   5e-70    
ref|XP_007156087.1|  hypothetical protein PHAVU_003G257400g             237   5e-70    
ref|XP_002992254.1|  hypothetical protein SELMODRAFT_134943             237   6e-70    
ref|XP_007046814.1|  Peroxidase superfamily protein                     237   6e-70    
ref|XP_006645977.1|  PREDICTED: peroxidase 72-like                      241   7e-70    
ref|XP_008344257.1|  PREDICTED: peroxidase 72-like                      237   7e-70    
gb|AFW57508.1|  peroxidase 1                                            237   7e-70    
ref|XP_004968895.1|  PREDICTED: peroxidase 72-like                      237   8e-70    
ref|XP_004967775.1|  PREDICTED: peroxidase 72-like                      237   8e-70    
ref|XP_008655973.1|  PREDICTED: peroxidase 72-like                      237   8e-70    
ref|XP_004234547.1|  PREDICTED: peroxidase 72                           237   9e-70    
ref|XP_006296673.1|  hypothetical protein CARUB_v10016420mg             237   9e-70    
ref|XP_002521512.1|  Peroxidase 72 precursor, putative                  236   1e-69    Ricinus communis
gb|EMS60222.1|  Peroxidase 72                                           236   1e-69    
ref|XP_002450360.1|  hypothetical protein SORBIDRAFT_05g004180          236   1e-69    Sorghum bicolor [broomcorn]
ref|XP_006340670.1|  PREDICTED: peroxidase 49-like                      237   2e-69    
ref|XP_004507667.1|  PREDICTED: peroxidase 29-like                      235   2e-69    
ref|XP_010413957.1|  PREDICTED: peroxidase 15-like                      236   2e-69    
ref|XP_010231893.1|  PREDICTED: peroxidase 72-like                      236   2e-69    
gb|EMT21494.1|  Peroxidase 72                                           235   3e-69    
ref|XP_010679791.1|  PREDICTED: peroxidase 72-like                      235   3e-69    
ref|XP_006343385.1|  PREDICTED: peroxidase 72-like                      235   4e-69    
ref|XP_002446477.1|  hypothetical protein SORBIDRAFT_06g016610          235   5e-69    Sorghum bicolor [broomcorn]
gb|KHN35717.1|  Peroxidase 29                                           234   5e-69    
ref|XP_010467620.1|  PREDICTED: peroxidase 15-like                      234   6e-69    
ref|XP_004512077.1|  PREDICTED: peroxidase 72-like                      234   6e-69    
gb|KFK34345.1|  hypothetical protein AALP_AA5G133200                    234   6e-69    
ref|XP_011025859.1|  PREDICTED: peroxidase 72                           234   7e-69    
ref|XP_003612079.1|  Peroxidase                                         234   7e-69    
ref|XP_011028580.1|  PREDICTED: peroxidase 72-like                      234   7e-69    
gb|ABR23055.1|  basic peroxidase swpb5                                  234   8e-69    Ipomoea batatas [batate]
ref|XP_003528697.2|  PREDICTED: peroxidase 29-like                      234   8e-69    
ref|XP_003550481.1|  PREDICTED: peroxidase 29-like                      233   1e-68    
ref|NP_201440.1|  peroxidase 72                                         234   1e-68    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002455405.1|  hypothetical protein SORBIDRAFT_03g010240          234   1e-68    Sorghum bicolor [broomcorn]
ref|NP_001148509.1|  peroxidase 72 precursor                            234   1e-68    
ref|XP_004287858.1|  PREDICTED: peroxidase 72-like                      233   1e-68    
emb|CDY25139.1|  BnaC07g03680D                                          234   1e-68    
emb|CDY25140.1|  BnaC07g03670D                                          233   2e-68    
ref|XP_004967776.1|  PREDICTED: peroxidase 72-like                      233   2e-68    
ref|NP_001148340.1|  peroxidase 1 precursor                             233   2e-68    
gb|AAP42507.1|  anionic peroxidase swpb2                                233   2e-68    
ref|XP_008667349.1|  PREDICTED: hypothetical protein isoform X1         233   2e-68    
ref|XP_008662930.1|  PREDICTED: peroxidase 5-like                       233   2e-68    
emb|CAA66964.1|  peroxidase                                             233   2e-68    
ref|XP_010489511.1|  PREDICTED: peroxidase 15                           233   2e-68    
ref|NP_001168269.1|  uncharacterized protein LOC100382033 precursor     233   3e-68    
ref|XP_004509315.1|  PREDICTED: peroxidase 72-like                      232   4e-68    
ref|XP_008784965.1|  PREDICTED: peroxidase 72-like                      232   5e-68    
ref|XP_009417065.1|  PREDICTED: peroxidase 72-like                      232   6e-68    
ref|XP_002982227.1|  hypothetical protein SELMODRAFT_115982             232   6e-68    
ref|XP_004967774.1|  PREDICTED: peroxidase 72-like                      233   7e-68    
ref|XP_006412001.1|  hypothetical protein EUTSA_v10025683mg             231   7e-68    
ref|XP_010919027.1|  PREDICTED: peroxidase 5-like                       231   9e-68    
ref|NP_001136736.1|  uncharacterized protein LOC100216875 precursor     232   9e-68    
emb|CDX69223.1|  BnaC01g02300D                                          231   9e-68    
ref|XP_004233538.1|  PREDICTED: peroxidase 72-like                      231   9e-68    
ref|XP_006346979.1|  PREDICTED: peroxidase 72-like                      231   1e-67    
ref|XP_010679794.1|  PREDICTED: peroxidase 72-like                      231   1e-67    
gb|AAM28296.1|  peroxidase                                              231   1e-67    
ref|NP_195361.1|  peroxidase 49                                         231   1e-67    
ref|XP_002455406.1|  hypothetical protein SORBIDRAFT_03g010250          231   1e-67    
gb|KHN00512.1|  Peroxidase 72                                           231   1e-67    
gb|ABZ80408.1|  class III peroxidase                                    231   2e-67    
ref|XP_002440543.1|  hypothetical protein SORBIDRAFT_09g002810          231   2e-67    
ref|XP_003629389.1|  Peroxidase                                         231   2e-67    
ref|XP_008364540.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase 2...    234   2e-67    
ref|XP_009138426.1|  PREDICTED: peroxidase 49                           230   2e-67    
ref|XP_003520284.1|  PREDICTED: peroxidase 72                           230   2e-67    
gb|KFK40198.1|  hypothetical protein AALP_AA3G342700                    230   3e-67    
ref|XP_010432175.1|  PREDICTED: peroxidase 49                           230   3e-67    
ref|XP_010109912.1|  Peroxidase 72                                      230   3e-67    
gb|KDO48106.1|  hypothetical protein CISIN_1g0200842mg                  223   3e-67    
ref|XP_010484652.1|  PREDICTED: peroxidase 72                           230   4e-67    
gb|ACG44598.1|  peroxidase 72 precursor                                 230   4e-67    
ref|XP_003610433.1|  Peroxidase                                         225   5e-67    
ref|XP_010679792.1|  PREDICTED: peroxidase 72-like                      229   5e-67    
ref|XP_010426640.1|  PREDICTED: peroxidase 36                           229   5e-67    
emb|CDP01966.1|  unnamed protein product                                229   5e-67    
emb|CDY64926.1|  BnaAnng19770D                                          229   6e-67    
ref|XP_010921348.1|  PREDICTED: peroxidase 5-like                       229   6e-67    
ref|XP_002439234.1|  hypothetical protein SORBIDRAFT_09g002830          229   6e-67    
gb|KFK30268.1|  hypothetical protein AALP_AA7G239300                    229   7e-67    
gb|EAZ12255.1|  hypothetical protein OsJ_02142                          230   7e-67    
gb|AAF63026.1|AF244923_1  peroxidase prx14 precursor                    229   7e-67    
ref|XP_004960409.1|  PREDICTED: peroxidase 5-like                       229   8e-67    
ref|XP_010679790.1|  PREDICTED: peroxidase 72-like                      229   9e-67    
ref|XP_003566708.1|  PREDICTED: peroxidase 72-like                      229   1e-66    
ref|XP_008779533.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase 42      225   1e-66    
ref|XP_009798542.1|  PREDICTED: peroxidase 44-like                      228   1e-66    
ref|XP_010444803.1|  PREDICTED: peroxidase 72-like                      229   1e-66    
ref|XP_010446794.1|  PREDICTED: peroxidase 49-like                      228   2e-66    
ref|XP_006284092.1|  hypothetical protein CARUB_v10005221mg             228   2e-66    
dbj|BAB97197.2|  peroxidase 1                                           228   2e-66    
ref|XP_003566714.1|  PREDICTED: peroxidase 72-like                      228   2e-66    
gb|KHG06184.1|  Peroxidase 72                                           228   2e-66    
ref|XP_004960411.1|  PREDICTED: peroxidase 5-like                       228   3e-66    
ref|XP_010033444.1|  PREDICTED: peroxidase 49                           228   3e-66    
ref|XP_010919026.1|  PREDICTED: peroxidase 5-like                       227   3e-66    
ref|NP_001141025.1|  uncharacterized protein LOC100273104 precursor     228   3e-66    
gb|KDO48107.1|  hypothetical protein CISIN_1g0200842mg                  220   3e-66    
gb|KFK40197.1|  hypothetical protein AALP_AA3G342600                    227   3e-66    
ref|XP_010911662.1|  PREDICTED: peroxidase 5-like                       227   4e-66    
ref|XP_004968729.1|  PREDICTED: peroxidase 72-like                      228   4e-66    
ref|XP_006281424.1|  hypothetical protein CARUB_v10027498mg             227   4e-66    
emb|CCJ34843.1|  horseradish peroxidase isoenzyme HRP_08562.1           227   4e-66    
ref|XP_002976455.1|  hypothetical protein SELMODRAFT_105029             226   4e-66    
gb|AAF63027.1|AF244924_1  peroxidase prx15 precursor                    227   5e-66    
gb|KHN36076.1|  Peroxidase 72                                           225   5e-66    
ref|XP_007017633.1|  Peroxidase superfamily protein                     227   5e-66    
ref|XP_003566702.1|  PREDICTED: peroxidase 72-like                      227   6e-66    
ref|XP_006652285.1|  PREDICTED: peroxidase 72-like                      227   6e-66    
ref|XP_008808268.1|  PREDICTED: peroxidase 5-like                       226   6e-66    
emb|CDX75574.1|  BnaA01g01280D                                          226   7e-66    
gb|KDP37453.1|  hypothetical protein JCGZ_08294                         224   7e-66    
ref|XP_009799014.1|  PREDICTED: peroxidase 5-like                       226   7e-66    
gb|KHN41941.1|  Peroxidase 72                                           224   7e-66    
ref|XP_009112290.1|  PREDICTED: peroxidase 72-like                      226   7e-66    
ref|XP_006343384.1|  PREDICTED: peroxidase 72-like                      226   9e-66    
gb|KDO36614.1|  hypothetical protein CISIN_1g044740mg                   219   1e-65    
ref|XP_009129875.1|  PREDICTED: peroxidase 49-like                      226   1e-65    
gb|EAY94133.1|  hypothetical protein OsI_15906                          226   1e-65    
ref|XP_010679795.1|  PREDICTED: peroxidase 72-like                      226   1e-65    
ref|NP_001052799.1|  Os04g0423800                                       226   1e-65    
emb|CCJ34844.1|  horseradish peroxidase isoenzyme HRP_08562.4           226   1e-65    
ref|XP_010465558.1|  PREDICTED: peroxidase 72-like isoform X1           226   1e-65    
ref|XP_003547959.1|  PREDICTED: peroxidase 72-like                      226   2e-65    
ref|XP_002987268.1|  hypothetical protein SELMODRAFT_125747             224   2e-65    
ref|XP_003610467.1|  Peroxidase                                         225   2e-65    
gb|KHN27034.1|  Peroxidase 72                                           225   2e-65    
ref|XP_006843805.1|  hypothetical protein AMTR_s00007p00253160          225   2e-65    
ref|XP_007161895.1|  hypothetical protein PHAVU_001G106600g             224   2e-65    
ref|XP_006403967.1|  hypothetical protein EUTSA_v10011077mg             225   3e-65    
gb|AAF63025.1|AF244922_1  peroxidase prx13 precursor                    224   3e-65    
ref|XP_006292998.1|  hypothetical protein CARUB_v10019275mg             224   3e-65    
emb|CDX81401.1|  BnaC09g08120D                                          224   4e-65    
ref|XP_009103543.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase 72      224   4e-65    
ref|XP_003520954.1|  PREDICTED: peroxidase 44-like                      224   5e-65    
ref|XP_002452710.1|  hypothetical protein SORBIDRAFT_04g031120          224   6e-65    
ref|XP_002990944.1|  hypothetical protein SELMODRAFT_132762             223   6e-65    
emb|CDM82667.1|  unnamed protein product                                224   6e-65    
gb|ABI37011.1|  peroxidase                                              224   7e-65    
emb|CDY65385.1|  BnaCnng46860D                                          224   8e-65    
ref|XP_002876063.1|  predicted protein                                  224   8e-65    
ref|XP_010671321.1|  PREDICTED: peroxidase 5-like                       223   9e-65    
gb|ABB45838.1|  hypothetical protein                                    224   1e-64    
ref|XP_009602319.1|  PREDICTED: peroxidase 44-like                      223   1e-64    
gb|EAY73397.1|  hypothetical protein OsI_01277                          224   1e-64    
ref|XP_006393821.1|  hypothetical protein EUTSA_v10004548mg             223   1e-64    
ref|XP_009144604.1|  PREDICTED: peroxidase 49-like                      223   1e-64    
dbj|BAJ94853.1|  predicted protein                                      223   1e-64    
ref|NP_001042657.1|  Os01g0263300                                       223   1e-64    
ref|XP_002982845.1|  hypothetical protein SELMODRAFT_116945             223   1e-64    
ref|XP_010503773.1|  PREDICTED: peroxidase 36-like                      223   1e-64    
ref|XP_010921347.1|  PREDICTED: peroxidase 5-like                       223   1e-64    
ref|XP_008781197.1|  PREDICTED: peroxidase 5-like                       223   2e-64    
gb|EMT08941.1|  Peroxidase 72                                           223   2e-64    
ref|XP_008388923.1|  PREDICTED: peroxidase 5-like                       223   2e-64    
ref|XP_006644025.1|  PREDICTED: peroxidase 72-like                      223   2e-64    
ref|XP_008390085.1|  PREDICTED: peroxidase 5-like                       223   2e-64    
ref|XP_006654965.1|  PREDICTED: peroxidase 5-like                       223   2e-64    
ref|XP_010270944.1|  PREDICTED: peroxidase 5-like                       223   2e-64    
gb|ADN96690.1|  peroxidase 3                                            222   3e-64    
emb|CDM82668.1|  unnamed protein product                                222   3e-64    
ref|NP_179406.1|  peroxidase 14                                         222   3e-64    
emb|CDY59700.1|  BnaC07g51170D                                          222   4e-64    
gb|EMT23111.1|  Peroxidase 72                                           222   4e-64    
ref|XP_010437350.1|  PREDICTED: peroxidase 49-like                      222   4e-64    
dbj|BAB63629.1|  putative peroxidase                                    223   4e-64    
ref|NP_001136740.1|  uncharacterized protein LOC100216881 precursor     222   5e-64    
emb|CDM82666.1|  unnamed protein product                                222   5e-64    
ref|XP_004234603.1|  PREDICTED: peroxidase 72-like                      221   5e-64    
gb|EMT23112.1|  Peroxidase 72                                           221   6e-64    
ref|XP_002987767.1|  hypothetical protein SELMODRAFT_126670             221   7e-64    
ref|XP_007209356.1|  hypothetical protein PRUPE_ppa008666mg             221   7e-64    
ref|XP_008810563.1|  PREDICTED: peroxidase 4-like                       221   7e-64    
ref|XP_009335532.1|  PREDICTED: peroxidase 5-like                       220   8e-64    
gb|AAM65659.1|  putative peroxidase                                     221   8e-64    
ref|NP_187017.1|  peroxidase                                            221   8e-64    
ref|XP_003579740.2|  PREDICTED: peroxidase 72-like                      220   9e-64    
gb|EMT08942.1|  Peroxidase 15                                           221   9e-64    
gb|EMT26481.1|  Peroxidase 72                                           219   1e-63    
emb|CDM82669.1|  unnamed protein product                                221   1e-63    
ref|XP_010659811.1|  PREDICTED: peroxidase 5-like                       220   1e-63    
ref|XP_011043754.1|  PREDICTED: peroxidase 5-like                       221   1e-63    
ref|XP_009365500.1|  PREDICTED: peroxidase 5-like                       220   1e-63    
ref|XP_008390088.1|  PREDICTED: peroxidase 57-like                      221   1e-63    
ref|XP_009801996.1|  PREDICTED: peroxidase 29                           220   1e-63    
ref|XP_007161894.1|  hypothetical protein PHAVU_001G106500g             220   1e-63    
ref|XP_009629163.1|  PREDICTED: peroxidase 5 {ECO:0000250|UniProt...    221   1e-63    
ref|XP_008373603.1|  PREDICTED: peroxidase 20                           221   1e-63    
ref|XP_009382469.1|  PREDICTED: peroxidase 5 {ECO:0000250|UniProt...    220   1e-63    
ref|XP_009768802.1|  PREDICTED: peroxidase 5-like                       221   1e-63    
dbj|BAJ94181.1|  predicted protein                                      220   2e-63    
ref|XP_010271091.1|  PREDICTED: peroxidase 5-like                       220   2e-63    
gb|KHG27001.1|  Peroxidase 9 -like protein                              220   2e-63    
gb|EMS54022.1|  Peroxidase 72                                           220   2e-63    
ref|XP_002993742.1|  hypothetical protein SELMODRAFT_137572             220   2e-63    
gb|KFK28312.1|  hypothetical protein AALP_AA8G500000                    220   2e-63    
ref|XP_009371221.1|  PREDICTED: peroxidase 20                           221   3e-63    
ref|XP_010515480.1|  PREDICTED: peroxidase 36-like                      220   3e-63    
ref|XP_001753324.1|  predicted protein                                  219   3e-63    
ref|NP_190668.2|  peroxidase 36                                         220   3e-63    
ref|XP_006343383.1|  PREDICTED: peroxidase 72-like                      219   3e-63    
emb|CAB62621.1|  peroxidase-like protein                                219   4e-63    
ref|XP_010558694.1|  PREDICTED: peroxidase 57-like                      219   4e-63    
ref|XP_010485714.1|  PREDICTED: peroxidase 28-like isoform X1           219   4e-63    
ref|XP_004300922.1|  PREDICTED: peroxidase 57-like                      223   5e-63    
ref|XP_010024692.1|  PREDICTED: peroxidase 5-like                       219   5e-63    
ref|XP_010552483.1|  PREDICTED: peroxidase 9                            219   6e-63    
gb|KDP27791.1|  hypothetical protein JCGZ_18871                         219   6e-63    
gb|ABD47725.1|  peroxidase                                              216   6e-63    
dbj|BAM05630.1|  peroxidase 1                                           216   7e-63    
ref|XP_002991057.1|  hypothetical protein SELMODRAFT_132865             218   7e-63    
gb|EMS61935.1|  Peroxidase 72                                           218   7e-63    
ref|XP_009411603.1|  PREDICTED: peroxidase 5 {ECO:0000250|UniProt...    218   8e-63    
gb|ADP95696.1|  class III heme peroxidase                               217   8e-63    
ref|XP_001762477.1|  predicted protein                                  218   8e-63    
gb|AAR31108.1|  peroxidase precursor                                    218   8e-63    
dbj|BAD43693.1|  putative peroxidase                                    218   9e-63    
ref|XP_006830089.1|  hypothetical protein AMTR_s00123p00050310          218   9e-63    
ref|XP_004965313.1|  PREDICTED: peroxidase 1-like                       218   1e-62    
dbj|BAM05634.1|  peroxidase 2                                           218   1e-62    
gb|KCW61137.1|  hypothetical protein EUGRSUZ_H03910                     217   1e-62    
ref|XP_004251979.1|  PREDICTED: peroxidase 5-like                       219   1e-62    
ref|XP_006840292.1|  hypothetical protein AMTR_s00045p00063130          218   1e-62    
ref|XP_007011215.1|  Peroxidase superfamily protein isoform 1           218   1e-62    
ref|XP_003611449.1|  Peroxidase                                         218   1e-62    
ref|XP_002520835.1|  Peroxidase 52 precursor, putative                  218   1e-62    
ref|XP_008221883.1|  PREDICTED: peroxidase 44-like                      218   1e-62    
ref|XP_002991681.1|  hypothetical protein SELMODRAFT_186230             218   1e-62    
emb|CDP07473.1|  unnamed protein product                                218   1e-62    
ref|XP_004136140.1|  PREDICTED: peroxidase 5-like                       218   1e-62    
gb|EYU39442.1|  hypothetical protein MIMGU_mgv1a009821mg                218   1e-62    
gb|ADQ43201.1|  unknown                                                 218   1e-62    
ref|XP_003516641.1|  PREDICTED: peroxidase 20-like                      218   1e-62    
ref|XP_010067582.1|  PREDICTED: peroxidase P7-like                      217   2e-62    
gb|EYU39443.1|  hypothetical protein MIMGU_mgv1a009818mg                218   2e-62    
gb|KDO78228.1|  hypothetical protein CISIN_1g019129mg                   213   2e-62    
ref|XP_004953531.1|  PREDICTED: peroxidase 5-like                       217   2e-62    
ref|XP_002961802.1|  hypothetical protein SELMODRAFT_140930             218   2e-62    
ref|XP_004493228.1|  PREDICTED: peroxidase 44-like                      217   2e-62    
ref|XP_007226228.1|  hypothetical protein PRUPE_ppa016743mg             218   2e-62    
ref|XP_008340088.1|  PREDICTED: peroxidase 57-like                      217   2e-62    
ref|XP_002964876.1|  hypothetical protein SELMODRAFT_167284             217   2e-62    
ref|XP_004135967.1|  PREDICTED: peroxidase 5-like                       217   2e-62    
ref|XP_006646719.1|  PREDICTED: cationic peroxidase SPC4-like           218   2e-62    
ref|XP_010067580.1|  PREDICTED: peroxidase 4-like                       217   3e-62    
ref|XP_007218699.1|  hypothetical protein PRUPE_ppa008820mg             216   3e-62    
ref|XP_002982960.1|  hypothetical protein SELMODRAFT_228898             217   3e-62    
ref|XP_009592784.1|  PREDICTED: peroxidase 29-like                      217   3e-62    
ref|XP_004310166.1|  PREDICTED: peroxidase 1-like                       218   3e-62    
ref|XP_006466288.1|  PREDICTED: peroxidase 4-like                       216   3e-62    
ref|XP_009606959.1|  PREDICTED: peroxidase 72-like                      218   3e-62    
ref|XP_010550432.1|  PREDICTED: peroxidase 72                           217   3e-62    
gb|KHN27032.1|  Peroxidase 72                                           216   4e-62    



>gb|AFY26876.1| anionic peroxidase swpa8 [Ipomoea batatas]
Length=328

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/308 (94%), Positives = 300/308 (97%), Gaps = 0/308 (0%)
 Frame = +2

Query  311   HIRCAKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASI  490
             HIRCAKGDLQMGYYS+SCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVK+CDASI
Sbjct  20    HIRCAKGDLQMGYYSKSCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKSCDASI  79

Query  491   LLDSVAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKG  670
             LLDSVAGVESER+SPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKG
Sbjct  80    LLDSVAGVESERKSPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKG  139

Query  671   PRAEMKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRV  850
             PR EMKTGR+DSKE YLAEVE+FIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRV
Sbjct  140   PRGEMKTGRKDSKENYLAEVESFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRV  199

Query  851   HCINIVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYK  1030
             HCINIVHRLYPTVDPTLDPTYADYLKLRCPSAEPDP+AVEPTY+R DR+TPMILDNMYYK
Sbjct  200   HCINIVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPKAVEPTYARKDRKTPMILDNMYYK  259

Query  1031  NILEHKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIR  1210
             NILE KGLLVVDELLA    TAPFVEKMAADNQYFHDQFARALV++SENNPLTGDQGEIR
Sbjct  260   NILEPKGLLVVDELLALILRTAPFVEKMAADNQYFHDQFARALVVLSENNPLTGDQGEIR  319

Query  1211  KNCRYVNT  1234
             KNCRYVN+
Sbjct  320   KNCRYVNS  327



>ref|XP_007027286.1| Peroxidase superfamily protein [Theobroma cacao]
 gb|EOY07788.1| Peroxidase superfamily protein [Theobroma cacao]
Length=332

 Score =   513 bits (1321),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 232/304 (76%), Positives = 279/304 (92%), Gaps = 2/304 (1%)
 Frame = +2

Query  323   AKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDS  502
              K DLQ+ YY+ESCP AE+IIK++VIKLY++HGNTAVSW+RNLFHDCMVK+CDAS+LL++
Sbjct  30    GKSDLQLNYYAESCPNAEEIIKQEVIKLYDKHGNTAVSWVRNLFHDCMVKSCDASLLLET  89

Query  503   VAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAE  682
             V G++SE+ S R+FGMRNFKY++TIK ALE+ECP TVSCADIV+LSARDG V+L GPR E
Sbjct  90    VNGIQSEQLSDRSFGMRNFKYVKTIKQALEKECPMTVSCADIVSLSARDGIVLLGGPRIE  149

Query  683   MKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCIN  862
             MKTGR+DSKE+YL EVEN IPNHND+MELVLSRFQSIG+DTEGTVALLGAHSVGRVHC+N
Sbjct  150   MKTGRKDSKESYLTEVENTIPNHNDTMELVLSRFQSIGIDTEGTVALLGAHSVGRVHCVN  209

Query  863   IVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILE  1042
             +VHRLYPTVDPTLDP YA+YLK RCP+ +P+P+AV   Y+RNDR+TPMILDNMYYKN+LE
Sbjct  210   LVHRLYPTVDPTLDPHYAEYLKGRCPTPDPNPKAV--LYARNDRKTPMILDNMYYKNLLE  267

Query  1043  HKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCR  1222
             HKGLL+VD+ L + P T+PFVEKMAADN YFHDQFARA+++++ENNPLTGDQGE+RK+CR
Sbjct  268   HKGLLLVDQQLTSDPTTSPFVEKMAADNGYFHDQFARAVLLLAENNPLTGDQGEVRKDCR  327

Query  1223  YVNT  1234
             YVN+
Sbjct  328   YVNS  331



>ref|XP_009790009.1| PREDICTED: peroxidase 21 [Nicotiana sylvestris]
Length=324

 Score =   512 bits (1318),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 240/308 (78%), Positives = 267/308 (87%), Gaps = 2/308 (1%)
 Frame = +2

Query  311   HIRCAKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASI  490
             HI   + +LQ+ YYSESCPRAE+IIKEQV +LY +HGNTAVSW+RNLFHDCMVK+CDASI
Sbjct  18    HIHYVRSELQLNYYSESCPRAEEIIKEQVAQLYHKHGNTAVSWIRNLFHDCMVKSCDASI  77

Query  491   LLDSVAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKG  670
              LD+    ESE+ SP+NFGMRNFKY++TIK ALE ECPNTVSCADIVALSARDG + L G
Sbjct  78    YLDTANDQESEKNSPKNFGMRNFKYVETIKKALESECPNTVSCADIVALSARDGLLWLGG  137

Query  671   PRAEMKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRV  850
             PR EM+TGR+DSKE+YLAEVE+ IPNHNDSM  VLSRFQSIGVDTEGTVAL GAHSVGRV
Sbjct  138   PRVEMRTGRKDSKESYLAEVESSIPNHNDSMSSVLSRFQSIGVDTEGTVALFGAHSVGRV  197

Query  851   HCINIVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYK  1030
             HC+N+VHRLYPTVDPTLDP YA YLK RCP+  PDP AV   YSRNDR T MILDNMYYK
Sbjct  198   HCVNLVHRLYPTVDPTLDPDYAKYLKGRCPTPNPDPEAV--LYSRNDRETTMILDNMYYK  255

Query  1031  NILEHKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIR  1210
             NIL HKGLL+VD+ L + P T+PFVEKMAADN YFHDQFARALVI+SENNPLTGDQGEIR
Sbjct  256   NILNHKGLLIVDQELVSDPNTSPFVEKMAADNGYFHDQFARALVILSENNPLTGDQGEIR  315

Query  1211  KNCRYVNT  1234
             K CRYVN+
Sbjct  316   KVCRYVNS  323



>gb|KHG08272.1| Peroxidase 21 -like protein [Gossypium arboreum]
Length=329

 Score =   510 bits (1314),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 231/305 (76%), Positives = 277/305 (91%), Gaps = 2/305 (1%)
 Frame = +2

Query  323   AKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDS  502
              KG+LQ+ YY++SCP AE+IIK+QVIKLY +HGNTAVSW+RNLFHDCMVK+CDAS+LL++
Sbjct  27    VKGNLQLNYYAQSCPNAEEIIKQQVIKLYNKHGNTAVSWVRNLFHDCMVKSCDASLLLET  86

Query  503   VAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAE  682
             V G+ESE++S R+FGMRNFKY++TIK ALE+ECP TVSCADIV+LSARDG V+L GPR E
Sbjct  87    VNGIESEQKSDRSFGMRNFKYVKTIKDALEQECPRTVSCADIVSLSARDGIVLLGGPRIE  146

Query  683   MKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCIN  862
             MKTGR+DSK +YL EVEN IPNHNDSMELVLSRFQSIG+DT+G VALLGAHSVGRVHC+N
Sbjct  147   MKTGRKDSKRSYLPEVENTIPNHNDSMELVLSRFQSIGIDTQGVVALLGAHSVGRVHCVN  206

Query  863   IVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILE  1042
             +VHRLYPTVDPTL+P YA+YLK RCP+ +PDP AV   YSRNDR TPMILDNMYYKN+L+
Sbjct  207   LVHRLYPTVDPTLEPDYAEYLKGRCPTPDPDPEAV--LYSRNDRETPMILDNMYYKNLLK  264

Query  1043  HKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCR  1222
             HKGLLV+D+ L + P T+PFVEKMAADN YFHDQFARA++++SENNPLTGD+GE+RK+CR
Sbjct  265   HKGLLVIDQQLTSDPTTSPFVEKMAADNGYFHDQFARAVLLLSENNPLTGDEGEVRKDCR  324

Query  1223  YVNTK  1237
             YVN++
Sbjct  325   YVNSE  329



>gb|KDP29096.1| hypothetical protein JCGZ_16485 [Jatropha curcas]
Length=326

 Score =   508 bits (1307),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 231/308 (75%), Positives = 271/308 (88%), Gaps = 2/308 (1%)
 Frame = +2

Query  311   HIRCAKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASI  490
              I   K +LQ+GYY+ +CPRAE+IIKEQVI LY EHGNTAVSWLRNLFHDC+VK+CD S+
Sbjct  20    QIHSGKSELQLGYYANTCPRAEEIIKEQVINLYNEHGNTAVSWLRNLFHDCIVKSCDGSL  79

Query  491   LLDSVAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKG  670
             LL++V G+ESE+ S R+FGMRNFKY+ TIKAALE ECP+TVSCAD+VALSARDG VML G
Sbjct  80    LLETVNGIESEKASSRSFGMRNFKYVNTIKAALEAECPSTVSCADVVALSARDGIVMLGG  139

Query  671   PRAEMKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRV  850
             PR EMKTGRRDSKE+Y A +E+FIPNHNDS+ LVLSRFQS+GVD EGTVALLG HSVGRV
Sbjct  140   PRIEMKTGRRDSKESYAAVIEDFIPNHNDSISLVLSRFQSVGVDVEGTVALLGGHSVGRV  199

Query  851   HCINIVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYK  1030
             HC+N+V RLYPTVDPTLDP YA+YLK RCP+ +PDP+AV   Y+RNDR TPMILDN YYK
Sbjct  200   HCMNLVQRLYPTVDPTLDPEYAEYLKGRCPTPDPDPKAV--LYARNDRETPMILDNFYYK  257

Query  1031  NILEHKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIR  1210
             NIL HKGLL VD+ LA+ P T+PFVE+MAADN YFHDQFARA++++SENNP+TGD+GEIR
Sbjct  258   NILNHKGLLSVDQQLASDPITSPFVERMAADNGYFHDQFARAVLLLSENNPITGDEGEIR  317

Query  1211  KNCRYVNT  1234
             K+CRYVN+
Sbjct  318   KDCRYVNS  325



>ref|XP_009598152.1| PREDICTED: peroxidase 21 [Nicotiana tomentosiformis]
 ref|XP_009598153.1| PREDICTED: peroxidase 21 [Nicotiana tomentosiformis]
Length=330

 Score =   506 bits (1304),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 237/308 (77%), Positives = 265/308 (86%), Gaps = 2/308 (1%)
 Frame = +2

Query  311   HIRCAKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASI  490
             HI   + +LQ+ YY ESCPRAE+IIKEQV +LY +HGNTAVSW+RNLFHDCMVK+CDASI
Sbjct  24    HIHHVRSELQLNYYLESCPRAEEIIKEQVAQLYHKHGNTAVSWIRNLFHDCMVKSCDASI  83

Query  491   LLDSVAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKG  670
              LD+  G ESE+ SP+NFGMRNFKY++TIK ALE ECPNTVSCADIVALSARDG + L G
Sbjct  84    YLDTANGQESEKTSPKNFGMRNFKYVETIKQALESECPNTVSCADIVALSARDGLLWLGG  143

Query  671   PRAEMKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRV  850
             PR EM+TGR+DSKE+YLAEVE+ +PNHNDSM  VLSRFQSIGVDTEGTVAL GAHSVGRV
Sbjct  144   PRVEMRTGRKDSKESYLAEVESSLPNHNDSMSSVLSRFQSIGVDTEGTVALFGAHSVGRV  203

Query  851   HCINIVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYK  1030
             HC+N+VHRLYPTVDPTLDP YA YLK RCP+  PDP AV   YSRNDR T MILDNMYYK
Sbjct  204   HCVNLVHRLYPTVDPTLDPDYAKYLKGRCPTPNPDPEAV--LYSRNDRETTMILDNMYYK  261

Query  1031  NILEHKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIR  1210
             NIL HKGLL+VD+ L T   T+PFVEKMAADN YFHDQFARAL I+SENNPLTGD+GEIR
Sbjct  262   NILNHKGLLIVDQELVTDSTTSPFVEKMAADNGYFHDQFARALFILSENNPLTGDEGEIR  321

Query  1211  KNCRYVNT  1234
             K CRYVN+
Sbjct  322   KVCRYVNS  329



>ref|XP_009601140.1| PREDICTED: peroxidase 21-like [Nicotiana tomentosiformis]
Length=329

 Score =   506 bits (1302),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 233/303 (77%), Positives = 265/303 (87%), Gaps = 2/303 (1%)
 Frame = +2

Query  323   AKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDS  502
             AK DLQ+ YYSESCPRAE+I+KEQVIKLY +HGNTAVSW+RNLFHDCMVK+CDASILLD+
Sbjct  28    AKSDLQLNYYSESCPRAEEIVKEQVIKLYHKHGNTAVSWIRNLFHDCMVKSCDASILLDT  87

Query  503   VAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAE  682
               G +SE+ S RNFGMRNFKYI+TIK ALE ECPNTVSCADIV LSARDG VML GP  E
Sbjct  88    TKGQKSEKTSQRNFGMRNFKYIETIKEALENECPNTVSCADIVVLSARDGVVMLGGPHIE  147

Query  683   MKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCIN  862
             MKTGRRDSK++YL EVENFIPNHNDSM  VLSRFQS+GVDTEGTVALLGAH+VGRVHC+N
Sbjct  148   MKTGRRDSKDSYLTEVENFIPNHNDSMSFVLSRFQSVGVDTEGTVALLGAHTVGRVHCVN  207

Query  863   IVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILE  1042
             IVHRLYPTVDPTLDP YA+YLK RCP   PDP+AVE  Y+RNDR TPM+LDN+YYKNIL 
Sbjct  208   IVHRLYPTVDPTLDPNYANYLKGRCPFPNPDPKAVE--YARNDRVTPMVLDNVYYKNILS  265

Query  1043  HKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCR  1222
             +KGLL+VD+ L + P T PFVEK A DN YF  QFA+AL+I+SEN+P++GD+GEIRK CR
Sbjct  266   NKGLLIVDQQLVSDPTTYPFVEKFANDNGYFQSQFAKALIILSENSPISGDKGEIRKVCR  325

Query  1223  YVN  1231
             +VN
Sbjct  326   HVN  328



>ref|XP_006381476.1| Peroxidase 21 precursor family protein [Populus trichocarpa]
 gb|ACN97181.1| peroxidase [Populus trichocarpa]
 gb|ERP59273.1| Peroxidase 21 precursor family protein [Populus trichocarpa]
 gb|AHL39145.1| class III peroxidase [Populus trichocarpa]
Length=331

 Score =   499 bits (1286),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 229/304 (75%), Positives = 270/304 (89%), Gaps = 2/304 (1%)
 Frame = +2

Query  323   AKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDS  502
              K +LQ  YY++SCPRAE+IIKEQVIKLY +HGNTAVSW+RNLFHDC+VK+CDAS+LL++
Sbjct  29    GKSELQFNYYAQSCPRAEEIIKEQVIKLYNKHGNTAVSWVRNLFHDCIVKSCDASLLLET  88

Query  503   VAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAE  682
             V G+ESE+ S R+ GMRNFKY+ TIKAALE ECP TVSCADIVALSARDG VML GPR E
Sbjct  89    VNGIESEKASQRSLGMRNFKYVNTIKAALESECPVTVSCADIVALSARDGIVMLGGPRVE  148

Query  683   MKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCIN  862
             MKTGRRDS E+Y A VE+FIPNHNDS+ LVLSRFQSIGVD EGTVALLG+HSVGRVHC+N
Sbjct  149   MKTGRRDSTESYGAVVEDFIPNHNDSISLVLSRFQSIGVDVEGTVALLGSHSVGRVHCVN  208

Query  863   IVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILE  1042
             +VHR+YPTVDPT+DP YA+YLK RCP+ +PDP+AV   Y+RNDR TPMILDN YYKN+L 
Sbjct  209   LVHRIYPTVDPTMDPDYAEYLKGRCPTPDPDPQAV--LYARNDRETPMILDNYYYKNLLG  266

Query  1043  HKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCR  1222
             HKGLL+VD+ L + P T+P+VEKMAADN YFHDQF+RA+V++SENNPLTG+QGEIRK+CR
Sbjct  267   HKGLLMVDQQLTSDPLTSPYVEKMAADNGYFHDQFSRAVVLLSENNPLTGNQGEIRKDCR  326

Query  1223  YVNT  1234
             YVN+
Sbjct  327   YVNS  330



>ref|XP_011094690.1| PREDICTED: peroxidase 21 [Sesamum indicum]
Length=323

 Score =   498 bits (1282),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 234/303 (77%), Positives = 266/303 (88%), Gaps = 2/303 (1%)
 Frame = +2

Query  323   AKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDS  502
              K DLQ+ YYSESCPRAE IIKEQV KLY++HGNTAVSW+RNLFHDC+VK+CDAS+LL++
Sbjct  21    GKSDLQLNYYSESCPRAEAIIKEQVTKLYQKHGNTAVSWIRNLFHDCIVKSCDASLLLET  80

Query  503   VAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAE  682
             V GVESE+ S R+FGMRNFKYI TIK ALE+ECP TVSCADIV+LSARDGAV+L GP  E
Sbjct  81    VNGVESEKTSSRSFGMRNFKYINTIKDALEKECPMTVSCADIVSLSARDGAVLLGGPYIE  140

Query  683   MKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCIN  862
             MKTGRRDSKE++ A V++ IPNHND++  VLS FQSIG+DTEGTVALLGAHSVGRVHCIN
Sbjct  141   MKTGRRDSKESHAALVDSSIPNHNDTISSVLSTFQSIGIDTEGTVALLGAHSVGRVHCIN  200

Query  863   IVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILE  1042
             IVHRLYPTVDPTLDP YA YLK RCPS  PDP AVE  Y+RNDR TPM+LDNMYYKNIL 
Sbjct  201   IVHRLYPTVDPTLDPDYAGYLKGRCPSPYPDPNAVE--YARNDRETPMVLDNMYYKNILS  258

Query  1043  HKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCR  1222
             HKGLL+VD+ L + P+T PFVEKMAADN YFHD F+RAL+ +SENNPLTGD+GEIRK+CR
Sbjct  259   HKGLLLVDQQLVSDPSTYPFVEKMAADNGYFHDHFSRALLTLSENNPLTGDEGEIRKDCR  318

Query  1223  YVN  1231
             YVN
Sbjct  319   YVN  321



>ref|XP_004249496.1| PREDICTED: peroxidase 21-like [Solanum lycopersicum]
Length=329

 Score =   498 bits (1281),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 230/307 (75%), Positives = 265/307 (86%), Gaps = 2/307 (1%)
 Frame = +2

Query  311   HIRCAKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASI  490
             HI  AK DL++ YYSESCPRAE+IIKEQV KLY +HGNTAVSW+RNLFHDCMVK+CDASI
Sbjct  24    HIHYAKSDLRLNYYSESCPRAEEIIKEQVNKLYHKHGNTAVSWIRNLFHDCMVKSCDASI  83

Query  491   LLDSVAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKG  670
             LLD      SE+ S RNFGMRNFKYI+TIK ALE ECPN VSCADIVAL+ARDG VML G
Sbjct  84    LLDKTKEQTSEKTSQRNFGMRNFKYIETIKEALENECPNIVSCADIVALAARDGIVMLGG  143

Query  671   PRAEMKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRV  850
             P+ EMKTGR DSK++YLAEVE+FIPNHNDSM LVLSRF S+GVDT+GTVALLGAH+VGRV
Sbjct  144   PQIEMKTGRWDSKDSYLAEVESFIPNHNDSMSLVLSRFNSVGVDTQGTVALLGAHTVGRV  203

Query  851   HCINIVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYK  1030
             HC+NIVHRLYPTVDPTLDP +A YLK RCPSAEPDP+AVE  Y+RND   PM+ DN+YYK
Sbjct  204   HCVNIVHRLYPTVDPTLDPDFAKYLKTRCPSAEPDPKAVE--YARNDHVNPMVWDNLYYK  261

Query  1031  NILEHKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIR  1210
             NI+ +KGLL+VD+ L + P T PFVEK AA+N YF+DQFA++ +I+SENNPL+GDQGEIR
Sbjct  262   NIMSNKGLLIVDQQLVSDPTTYPFVEKFAANNSYFNDQFAKSFIILSENNPLSGDQGEIR  321

Query  1211  KNCRYVN  1231
             K CR+VN
Sbjct  322   KVCRHVN  328



>ref|XP_009769680.1| PREDICTED: peroxidase 21-like [Nicotiana sylvestris]
Length=329

 Score =   498 bits (1281),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 231/303 (76%), Positives = 264/303 (87%), Gaps = 2/303 (1%)
 Frame = +2

Query  323   AKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDS  502
             AK DLQ+ YYS+SCPRAE+I+KEQVIKLY +HGNTAVSW+RNLFHDCMVK+CDASILLD+
Sbjct  28    AKSDLQLNYYSQSCPRAEEIVKEQVIKLYHKHGNTAVSWIRNLFHDCMVKSCDASILLDT  87

Query  503   VAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAE  682
                 +SE+ S RNFGMRNFKYI+TIK ALE ECPNTVSCADIV LSARDG VML GP  E
Sbjct  88    TKEQKSEKTSQRNFGMRNFKYIETIKEALENECPNTVSCADIVVLSARDGVVMLGGPHIE  147

Query  683   MKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCIN  862
             MKTGRRDSK +YL EVENFIPNHNDSM LVLSRFQS+GVDTEGTVALLGAH+VGRVHC+N
Sbjct  148   MKTGRRDSKGSYLTEVENFIPNHNDSMSLVLSRFQSVGVDTEGTVALLGAHTVGRVHCVN  207

Query  863   IVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILE  1042
             IV+RLYPTVDPTLDP YA+YLK RCPS  P  +AVE  Y+RNDR TPM+LDN+YYKNIL 
Sbjct  208   IVNRLYPTVDPTLDPNYANYLKGRCPSPNPVLKAVE--YARNDRVTPMVLDNVYYKNILS  265

Query  1043  HKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCR  1222
             +KGLL+VD+ L + P T PFVEK A DN YFH QFA+AL+I+SEN+P++GD+GEIRK CR
Sbjct  266   NKGLLIVDQQLVSDPTTYPFVEKFANDNGYFHSQFAKALIILSENSPISGDKGEIRKVCR  325

Query  1223  YVN  1231
             +VN
Sbjct  326   HVN  328



>ref|XP_004246673.1| PREDICTED: peroxidase 21 [Solanum lycopersicum]
Length=324

 Score =   496 bits (1276),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 233/309 (75%), Positives = 264/309 (85%), Gaps = 3/309 (1%)
 Frame = +2

Query  311   HIRCAKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASI  490
             HI   K +LQ+ YY++SCPRAEDIIKEQV  LY +HGNTAVSW+RNLFHDCMVK+CDAS+
Sbjct  17    HIHNVKSELQLNYYTKSCPRAEDIIKEQVATLYHKHGNTAVSWIRNLFHDCMVKSCDASL  76

Query  491   LLDSVAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKG  670
              LD+  G+ESE+ESPRNFGMRNFKYI+TIK ALE+ECPNTVSCADIVALSARDG + L G
Sbjct  77    YLDTANGLESEKESPRNFGMRNFKYIETIKQALEKECPNTVSCADIVALSARDGLLWLGG  136

Query  671   P-RAEMKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGR  847
             P + EMKTGR+DSKETY +EVE ++PNHNDS+  VLSRFQSIGVDTEGTVALLGAHSVGR
Sbjct  137   PIKIEMKTGRKDSKETYFSEVEKYLPNHNDSISSVLSRFQSIGVDTEGTVALLGAHSVGR  196

Query  848   VHCINIVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYY  1027
             VHC+N+VHRLYPTVDPT+DP YA YLK RCPS  PDP AV   YSR DR T MILDNMYY
Sbjct  197   VHCVNLVHRLYPTVDPTIDPDYAKYLKGRCPSPNPDPEAV--LYSRFDRETTMILDNMYY  254

Query  1028  KNILEHKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEI  1207
             KNIL  KGLL+VD+ L + P T+PFV KMA DN YFH QFARA++I+SENNPL GDQGEI
Sbjct  255   KNILNKKGLLIVDQELVSDPNTSPFVVKMANDNNYFHQQFARAMLILSENNPLIGDQGEI  314

Query  1208  RKNCRYVNT  1234
             RK CRYVN+
Sbjct  315   RKVCRYVNS  323



>ref|XP_011004734.1| PREDICTED: peroxidase 21 [Populus euphratica]
Length=330

 Score =   496 bits (1277),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 226/304 (74%), Positives = 269/304 (88%), Gaps = 2/304 (1%)
 Frame = +2

Query  323   AKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDS  502
              K +LQ  YY ++CPRAE+IIKEQVIKLY +HGNTAVSW+RNLFHDC+VK+CDAS+LL++
Sbjct  28    GKSELQFNYYEQNCPRAEEIIKEQVIKLYNKHGNTAVSWIRNLFHDCIVKSCDASLLLET  87

Query  503   VAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAE  682
             V G+ESE+ S R+FGMRNFKY+ TIKAALE ECP TVSCADIVALSARDG VML GPR E
Sbjct  88    VNGIESEKASQRSFGMRNFKYVNTIKAALESECPVTVSCADIVALSARDGIVMLGGPRVE  147

Query  683   MKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCIN  862
             MKTGRRDS E+Y A VE+FIP+HNDS+ LVLSRFQSIG+D EGTVALLG+HSVGRVHC+N
Sbjct  148   MKTGRRDSTESYGAVVEDFIPDHNDSISLVLSRFQSIGIDVEGTVALLGSHSVGRVHCVN  207

Query  863   IVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILE  1042
             +VHR+YPTVDPT+DP YA+YLK RCP+ +PDP+AV   Y+RNDR TPM LDN YYKN+L 
Sbjct  208   LVHRIYPTVDPTMDPDYAEYLKGRCPTPDPDPQAV--LYARNDRETPMTLDNYYYKNLLG  265

Query  1043  HKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCR  1222
             HKGLL+VD+ L + P T+P+VEKMAADN YFH+QF+RA+V++SENNPLTGDQGEIRK+CR
Sbjct  266   HKGLLMVDQQLTSDPLTSPYVEKMAADNGYFHEQFSRAVVLLSENNPLTGDQGEIRKDCR  325

Query  1223  YVNT  1234
             YVN+
Sbjct  326   YVNS  329



>ref|XP_006339298.1| PREDICTED: peroxidase 21-like [Solanum tuberosum]
Length=329

 Score =   496 bits (1276),  Expect = 8e-171, Method: Compositional matrix adjust.
 Identities = 228/307 (74%), Positives = 266/307 (87%), Gaps = 2/307 (1%)
 Frame = +2

Query  311   HIRCAKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASI  490
             HI  AK DL++ YYSESCPRAE+IIKEQV KLY +HGNTAVSW+RNLFHDCMVK+CDASI
Sbjct  24    HIHYAKSDLKLNYYSESCPRAEEIIKEQVNKLYHKHGNTAVSWIRNLFHDCMVKSCDASI  83

Query  491   LLDSVAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKG  670
             LLD      SE+ S RNFGMRNFKYI+TIK ALE ECPN VSCADIVALSARDG VML G
Sbjct  84    LLDKTKEQTSEKTSQRNFGMRNFKYIETIKEALENECPNIVSCADIVALSARDGIVMLGG  143

Query  671   PRAEMKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRV  850
             P+ E+KTGR DSK++YLAEVE+F+PNHNDSM LVLSRF S+GVDT+GTVALLGAH+VGRV
Sbjct  144   PQIEIKTGRWDSKDSYLAEVESFLPNHNDSMSLVLSRFNSVGVDTQGTVALLGAHTVGRV  203

Query  851   HCINIVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYK  1030
             HC+NIVHRLYPTVDPTLDP +A+YLK RCPS +PDP+AVE  Y+RND   PM+ DN+YYK
Sbjct  204   HCVNIVHRLYPTVDPTLDPDFANYLKTRCPSPQPDPKAVE--YARNDHINPMVWDNLYYK  261

Query  1031  NILEHKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIR  1210
             NI+ +KGLL+VD+ L + P T PFVEK AA+N YF+DQFA++L+I+SENNPL+GDQGEIR
Sbjct  262   NIMSNKGLLIVDQQLVSDPTTYPFVEKFAANNSYFNDQFAKSLIILSENNPLSGDQGEIR  321

Query  1211  KNCRYVN  1231
             K CR+VN
Sbjct  322   KVCRHVN  328



>ref|XP_002275288.1| PREDICTED: peroxidase 21 [Vitis vinifera]
 emb|CBI32706.3| unnamed protein product [Vitis vinifera]
Length=328

 Score =   490 bits (1261),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 226/299 (76%), Positives = 261/299 (87%), Gaps = 2/299 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             LQ+ YYSESCPRAE+IIK+QV+ LY +HGNTAVSW+RNLFHDCMVK+CDAS+LL++  GV
Sbjct  31    LQLNYYSESCPRAEEIIKQQVVNLYHKHGNTAVSWIRNLFHDCMVKSCDASLLLETARGV  90

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
             ESE+ S R+FGMRNFKYI TIK A+E ECP TVSCADIV LSARDG  +L GP  EMKTG
Sbjct  91    ESEKLSSRSFGMRNFKYIDTIKKAVESECPQTVSCADIVVLSARDGFELLGGPYIEMKTG  150

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRDSKE+Y   VE+ IPNHNDSM LVLSRFQSIG+D EGTVALLGAHSVGRVHC+N+V+R
Sbjct  151   RRDSKESYATVVEDSIPNHNDSMSLVLSRFQSIGIDAEGTVALLGAHSVGRVHCVNVVNR  210

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYPTVDPTLDP YA+YL+ RCPS EPDP+AV+  Y+RND  TPM+LDNMYYKNIL HKGL
Sbjct  211   LYPTVDPTLDPEYAEYLERRCPSPEPDPKAVQ--YARNDLETPMVLDNMYYKNILSHKGL  268

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             L+VD+ L + P T+PFVEKMA DN YFHDQF+RAL+++SENNPLTGD GEIRK+CRYVN
Sbjct  269   LLVDQQLVSDPTTSPFVEKMADDNGYFHDQFSRALLLLSENNPLTGDDGEIRKDCRYVN  327



>ref|XP_009358151.1| PREDICTED: peroxidase 21 [Pyrus x bretschneideri]
Length=330

 Score =   487 bits (1253),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 223/303 (74%), Positives = 262/303 (86%), Gaps = 2/303 (1%)
 Frame = +2

Query  323   AKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDS  502
              K +LQ+ YYS SCP+AE+IIK++V KLY EHGNTAVSWLRNLFHDCMV+ CDAS+LL+S
Sbjct  28    GKSELQLNYYSNSCPKAEEIIKQEVTKLYYEHGNTAVSWLRNLFHDCMVQGCDASLLLES  87

Query  503   VAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAE  682
             V G ESE+ S R+FGMRNFKY+ TIK ALE+ECP+TVSCAD+VALSARDG VML GPR E
Sbjct  88    VNGTESEKASGRSFGMRNFKYVNTIKKALEDECPSTVSCADVVALSARDGIVMLGGPRIE  147

Query  683   MKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCIN  862
             MKTGR+DSKE+Y + VE FIPNHNDS+  VLSRFQSIG+D EGTVA+LGAHSVGRVHC+N
Sbjct  148   MKTGRKDSKESYASVVEEFIPNHNDSISSVLSRFQSIGIDAEGTVAILGAHSVGRVHCVN  207

Query  863   IVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILE  1042
             +V RLYPTVDPTLDP +A+YLK RCP+  PDP+AV   Y+RNDR TPM+LDN YYKN+L 
Sbjct  208   LVGRLYPTVDPTLDPDHAEYLKGRCPNPTPDPKAV--LYARNDRETPMLLDNYYYKNLLS  265

Query  1043  HKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCR  1222
             HKGLL VD+ LA+ P T PFVEKMAADN YF +QF+RA +++SENNPLTGDQGE+RK+CR
Sbjct  266   HKGLLTVDQELASDPGTLPFVEKMAADNDYFSEQFSRAALLLSENNPLTGDQGEVRKDCR  325

Query  1223  YVN  1231
             YVN
Sbjct  326   YVN  328



>ref|XP_008239361.1| PREDICTED: peroxidase 21 [Prunus mume]
Length=329

 Score =   486 bits (1252),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 223/308 (72%), Positives = 264/308 (86%), Gaps = 2/308 (1%)
 Frame = +2

Query  311   HIRCAKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASI  490
               +  K +LQ+ YYSESCP+AE+IIK++V KLY EHGNTAVSWLRNLFHDC V+ CDAS+
Sbjct  23    QFQFGKSELQLNYYSESCPKAEEIIKQEVTKLYYEHGNTAVSWLRNLFHDCFVQGCDASL  82

Query  491   LLDSVAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKG  670
             LL+SV G+ESE+ S R+FGMRNFKY+ TIK A+E ECP+TVSCAD+VALSARDG VML G
Sbjct  83    LLESVNGIESEKASGRSFGMRNFKYVNTIKKAVENECPSTVSCADVVALSARDGIVMLGG  142

Query  671   PRAEMKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRV  850
             P  EMKTGRRDSKE+Y   VE FIPNHNDS+  VLS FQS+G+D EGTVALLGAHSVGRV
Sbjct  143   PHIEMKTGRRDSKESYAKIVEEFIPNHNDSLSSVLSSFQSVGIDVEGTVALLGAHSVGRV  202

Query  851   HCINIVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYK  1030
             HC+N+VHRLYPTVDPTLDP YA+YLK RCP+  PDP AV+  YSRNDR TPMILDN YYK
Sbjct  203   HCVNLVHRLYPTVDPTLDPDYAEYLKGRCPTPIPDPSAVQ--YSRNDRETPMILDNNYYK  260

Query  1031  NILEHKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIR  1210
             N+L++KGLL+VD  LA+ PAT PFV+KMA+DN YF +QF+RA +++SEN+PLTGDQGE+R
Sbjct  261   NLLKNKGLLIVDSELASDPATLPFVQKMASDNDYFTEQFSRAALLLSENSPLTGDQGEVR  320

Query  1211  KNCRYVNT  1234
             K+CRYVNT
Sbjct  321   KDCRYVNT  328



>ref|XP_008369744.1| PREDICTED: peroxidase 21 [Malus domestica]
Length=329

 Score =   486 bits (1252),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 221/303 (73%), Positives = 264/303 (87%), Gaps = 2/303 (1%)
 Frame = +2

Query  323   AKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDS  502
              K +LQ+ YYS SCP+AE++IK++V KLY EHGNTAVSWLRNLFHDC+V+ CDAS+LL+S
Sbjct  27    GKSELQLNYYSNSCPKAEEVIKQEVTKLYHEHGNTAVSWLRNLFHDCVVQGCDASLLLES  86

Query  503   VAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAE  682
             V G+ESE+ S R+FGMRNFKY+ TIK ALE+ECP+TVSCAD+VALSARDG VML GPR E
Sbjct  87    VTGIESEKASGRSFGMRNFKYVNTIKKALEDECPSTVSCADVVALSARDGIVMLGGPRIE  146

Query  683   MKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCIN  862
             MKTGR+DSKE+Y + VE FIPNHNDS+  VLSRFQSIG+D EGTVA+LGAHSVGRVHC+N
Sbjct  147   MKTGRKDSKESYASVVEEFIPNHNDSISSVLSRFQSIGIDAEGTVAILGAHSVGRVHCVN  206

Query  863   IVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILE  1042
             +V RLYPTVDPTLDP +A+YLK RCP+  PDP+AV   Y+RNDR TPM+LDN YYKN+L 
Sbjct  207   LVDRLYPTVDPTLDPDHAEYLKGRCPTPTPDPKAV--LYARNDRETPMLLDNYYYKNLLS  264

Query  1043  HKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCR  1222
             HKGLL VD+ LA+ PAT PFVEKMAADN YF +QF+RA++++SENNPLTGD GE+RK+CR
Sbjct  265   HKGLLTVDQELASDPATLPFVEKMAADNGYFSEQFSRAVLLLSENNPLTGDXGEVRKDCR  324

Query  1223  YVN  1231
             YVN
Sbjct  325   YVN  327



>ref|XP_010107565.1| Peroxidase 21 [Morus notabilis]
 gb|EXC16247.1| Peroxidase 21 [Morus notabilis]
Length=327

 Score =   485 bits (1248),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 221/303 (73%), Positives = 264/303 (87%), Gaps = 2/303 (1%)
 Frame = +2

Query  323   AKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDS  502
              K +LQ+ YY+ SCP AE+IIK+QVI LY +HGNTAVSW+RNLFHDCMVK+CDAS+LL+S
Sbjct  27    GKSELQLNYYANSCPNAEEIIKQQVINLYHKHGNTAVSWIRNLFHDCMVKSCDASLLLES  86

Query  503   VAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAE  682
             + G+ESE+   R+FGMRNFKY+ TIKAA+E+ECP TVSCAD+VALSARDG VML GPR E
Sbjct  87    LNGIESEKTVERSFGMRNFKYVNTIKAAVEKECPLTVSCADVVALSARDGIVMLGGPRIE  146

Query  683   MKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCIN  862
             MKTGR+DS+E+Y + V++FIPNHNDS+ LVLS+FQSIG+DTEGTVALLGAHSVGRVHC N
Sbjct  147   MKTGRKDSRESYASVVDDFIPNHNDSISLVLSQFQSIGIDTEGTVALLGAHSVGRVHCKN  206

Query  863   IVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILE  1042
             +V RLYPTVDPTLDP YA YLK RCPS  PDP AV   YSRNDR TPMILDN+YY N+L+
Sbjct  207   LVQRLYPTVDPTLDPDYATYLKGRCPSPNPDPNAV--LYSRNDRETPMILDNVYYTNVLK  264

Query  1043  HKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCR  1222
             HKGLL+VD+ L +  +T PFVEKMAADN YFH+QF+RA+++MSENNPLT DQGE+RK+CR
Sbjct  265   HKGLLIVDQQLTSDTSTLPFVEKMAADNDYFHEQFSRAVLLMSENNPLTDDQGEVRKDCR  324

Query  1223  YVN  1231
             +VN
Sbjct  325   FVN  327



>gb|EYU41619.1| hypothetical protein MIMGU_mgv1a010067mg [Erythranthe guttata]
Length=323

 Score =   483 bits (1242),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 221/303 (73%), Positives = 260/303 (86%), Gaps = 2/303 (1%)
 Frame = +2

Query  323   AKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDS  502
              K +LQ+ YYS+SCPRAE+IIKEQV  LY +HGNTAVSW+RNLFHDC+VK+CDAS+LLD+
Sbjct  22    VKSELQLNYYSKSCPRAEEIIKEQVAILYRKHGNTAVSWIRNLFHDCVVKSCDASLLLDT  81

Query  503   VAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAE  682
             V GV SE+ + R+FGMRNFKYI TIK ALE+ECP TVSCADI+AL+ARDGA +LKGP  +
Sbjct  82    VVGVTSEKTAARSFGMRNFKYIDTIKDALEKECPLTVSCADIIALTARDGAALLKGPEIK  141

Query  683   MKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCIN  862
             MKTGR+DSKE+Y A V+  IPNHNDSM LVLS FQSIG+DTEGTVALLGAHSVGRVHC N
Sbjct  142   MKTGRKDSKESYAAVVDKLIPNHNDSMSLVLSTFQSIGIDTEGTVALLGAHSVGRVHCRN  201

Query  863   IVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILE  1042
             IV R+YPTVDP+LDP YADYLK RCPS  PDP+ V+  Y RND  TPM LDNMYYKN+L 
Sbjct  202   IVQRIYPTVDPSLDPQYADYLKFRCPSPNPDPKVVD--YVRNDLETPMELDNMYYKNLLS  259

Query  1043  HKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCR  1222
             HKGLL++D  L ++P T PFV KMAADN YFHDQF+RAL+I+SENNPL+GDQG+IRK+CR
Sbjct  260   HKGLLLIDSELVSNPTTYPFVVKMAADNAYFHDQFSRALLILSENNPLSGDQGDIRKDCR  319

Query  1223  YVN  1231
             ++N
Sbjct  320   FLN  322



>gb|AFK33615.1| unknown [Lotus japonicus]
Length=325

 Score =   482 bits (1240),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 223/307 (73%), Positives = 261/307 (85%), Gaps = 2/307 (1%)
 Frame = +2

Query  311   HIRCAKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASI  490
             H    K  LQ+ YYS+SCP+AE+IIK+QVIKLY EHGNTAVSW+RNLFHDC+VK+CDAS+
Sbjct  19    HFNLGKSQLQLNYYSQSCPKAEEIIKQQVIKLYNEHGNTAVSWVRNLFHDCIVKSCDASL  78

Query  491   LLDSVAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKG  670
             LL +V GV SE+ S R+FGMRNFK++ TIKAA+EEECP TVSCADIVALSARDG VML G
Sbjct  79    LLTTVRGVVSEQTSGRSFGMRNFKFVNTIKAAVEEECPLTVSCADIVALSARDGIVMLGG  138

Query  671   PRAEMKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRV  850
             P  EMKTGRRDSKE+Y   VE+FIPNHNDS+ LVLSRFQSIG+D E TVALLGAHSVGRV
Sbjct  139   PSIEMKTGRRDSKESYATVVEDFIPNHNDSISLVLSRFQSIGIDVEATVALLGAHSVGRV  198

Query  851   HCINIVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYK  1030
             HC N+V RLYP VD T+D   A+YLK RCP+  PDP+ V+  YSRND+ TPMI+DN YYK
Sbjct  199   HCTNMVQRLYPDVDKTMDLAQAEYLKRRCPTPNPDPKVVQ--YSRNDQITPMIIDNNYYK  256

Query  1031  NILEHKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIR  1210
             NIL+HKGLL VDE LAT P T+P+V KMAADN+YFH QF+RA++++SENNP+TGDQGEIR
Sbjct  257   NILQHKGLLTVDEELATDPITSPYVIKMAADNEYFHQQFSRAIILLSENNPITGDQGEIR  316

Query  1211  KNCRYVN  1231
             K+CRYVN
Sbjct  317   KDCRYVN  323



>gb|KEH42268.1| cationic peroxidase [Medicago truncatula]
Length=325

 Score =   480 bits (1235),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 222/303 (73%), Positives = 264/303 (87%), Gaps = 2/303 (1%)
 Frame = +2

Query  323   AKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDS  502
              K  LQ+ YYS+SCP+AE+IIK++VI+LY EHGNTAVSW+RNLFHDC+V++CDAS+LL+S
Sbjct  23    GKSQLQLNYYSKSCPKAEEIIKQKVIELYNEHGNTAVSWVRNLFHDCIVESCDASLLLES  82

Query  503   VAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAE  682
             V  V SE+ S R+ GMRNFKY++TIKAA+E+ECP TVSCADIVALSARDG  ML GP+ E
Sbjct  83    VGDVVSEQTSERSSGMRNFKYVKTIKAAVEKECPLTVSCADIVALSARDGIAMLGGPKFE  142

Query  683   MKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCIN  862
             MKTGRRD KE+++  VE FIPNHNDS+ LVLSRFQ+IGVD E TVALLG HSVGRVHC+N
Sbjct  143   MKTGRRDGKESHVTMVEEFIPNHNDSISLVLSRFQAIGVDVEATVALLGGHSVGRVHCMN  202

Query  863   IVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILE  1042
             +VHRLYPTVDP LDPTYA YLKLRCP+  PDP AV   Y+RNDR+TPMI+DN YYKNIL+
Sbjct  203   MVHRLYPTVDPKLDPTYAAYLKLRCPTPNPDPNAV--LYARNDRKTPMIIDNNYYKNILQ  260

Query  1043  HKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCR  1222
             HKGLL VDE LAT P T+P+V+KMAADN YF++QF+RA+ ++SENNPLTGDQGEIRK+CR
Sbjct  261   HKGLLTVDEELATDPRTSPYVKKMAADNGYFNEQFSRAVQLLSENNPLTGDQGEIRKDCR  320

Query  1223  YVN  1231
             YVN
Sbjct  321   YVN  323



>gb|AFK39383.1| unknown [Medicago truncatula]
Length=325

 Score =   478 bits (1230),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 221/303 (73%), Positives = 264/303 (87%), Gaps = 2/303 (1%)
 Frame = +2

Query  323   AKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDS  502
              K  LQ+ YYS+SCP+AE+IIK++VI+L+ EHGNTAVSW+RNLFHDC+V++CDAS+LL+S
Sbjct  23    GKSQLQLNYYSKSCPKAEEIIKQKVIELHNEHGNTAVSWVRNLFHDCIVESCDASLLLES  82

Query  503   VAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAE  682
             V  V SE+ S R+ GMRNFKY++TIKAA+E+ECP TVSCADIVALSARDG  ML GP+ E
Sbjct  83    VGDVVSEQTSERSSGMRNFKYVKTIKAAVEKECPLTVSCADIVALSARDGIAMLGGPKFE  142

Query  683   MKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCIN  862
             MKTGRRD KE+++  VE FIPNHNDS+ LVLSRFQ+IGVD E TVALLG HSVGRVHC+N
Sbjct  143   MKTGRRDGKESHVTMVEEFIPNHNDSISLVLSRFQAIGVDVEATVALLGGHSVGRVHCMN  202

Query  863   IVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILE  1042
             +VHRLYPTVDP LDPTYA YLKLRCP+  PDP AV   Y+RNDR+TPMI+DN YYKNIL+
Sbjct  203   MVHRLYPTVDPKLDPTYAAYLKLRCPTPNPDPNAV--LYARNDRKTPMIIDNNYYKNILQ  260

Query  1043  HKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCR  1222
             HKGLL VDE LAT P T+P+V+KMAADN YF++QF+RA+ ++SENNPLTGDQGEIRK+CR
Sbjct  261   HKGLLTVDEELATDPRTSPYVKKMAADNGYFNEQFSRAVQLLSENNPLTGDQGEIRKDCR  320

Query  1223  YVN  1231
             YVN
Sbjct  321   YVN  323



>ref|XP_006410893.1| hypothetical protein EUTSA_v10016921mg [Eutrema salsugineum]
 dbj|BAJ34558.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ52346.1| hypothetical protein EUTSA_v10016921mg [Eutrema salsugineum]
Length=328

 Score =   477 bits (1228),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 219/304 (72%), Positives = 261/304 (86%), Gaps = 3/304 (1%)
 Frame = +2

Query  323   AKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDS  502
               G+L+M YY ESCP+AE+II++QV  LY +HGNTAVSWLRNLFHDC+VK+CDAS+LL++
Sbjct  27    GNGELEMNYYRESCPKAEEIIRQQVETLYYKHGNTAVSWLRNLFHDCVVKSCDASLLLET  86

Query  503   VAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAE  682
               GVESE++S R+FGMRNFKY++TIK ALE+ CPNTVSCADIVALSARDG VMLKGP+ E
Sbjct  87    ARGVESEQKSTRSFGMRNFKYVKTIKDALEKACPNTVSCADIVALSARDGIVMLKGPKIE  146

Query  683   M-KTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCI  859
             M KTGRRDS+ +YL +VE  IPNHNDS+  VLS F SIG+D E TVALLGAHSVGRVHC+
Sbjct  147   MIKTGRRDSRGSYLGDVETLIPNHNDSLSSVLSTFNSIGIDVEATVALLGAHSVGRVHCV  206

Query  860   NIVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNIL  1039
             N+VHRLYPT+DPTLDP+YA YLK RCP+  PDP AV   YSRNDR TPM++DNMYYKNI+
Sbjct  207   NLVHRLYPTIDPTLDPSYALYLKNRCPTPNPDPNAV--LYSRNDRETPMVVDNMYYKNIM  264

Query  1040  EHKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNC  1219
              HKGLLV+D+ LA+ P TAPFV KMA+DN YFH+QF+R + ++SE NPLTGDQGEIRK+C
Sbjct  265   AHKGLLVIDDELASDPRTAPFVAKMASDNSYFHEQFSRGVTLLSETNPLTGDQGEIRKDC  324

Query  1220  RYVN  1231
             RYVN
Sbjct  325   RYVN  328



>ref|NP_181250.1| peroxidase [Arabidopsis thaliana]
 sp|Q42580.1|PER21_ARATH RecName: Full=Peroxidase 21; Short=Atperox P21; AltName: Full=ATP2a/ATP2b; 
AltName: Full=PRXR5; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAA66863.1| peroxidase ATP2a [Arabidopsis thaliana]
 gb|AAD18146.1| putative peroxidase ATP2a [Arabidopsis thaliana]
 gb|AEC09354.1| peroxidase [Arabidopsis thaliana]
Length=327

 Score =   477 bits (1227),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 220/304 (72%), Positives = 261/304 (86%), Gaps = 3/304 (1%)
 Frame = +2

Query  323   AKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDS  502
               G+L+M YY ESCP+AE+II++QV  LY +HGNTAVSWLRNLFHDC+VK+CDAS+LL++
Sbjct  26    GNGELEMNYYKESCPKAEEIIRQQVETLYYKHGNTAVSWLRNLFHDCVVKSCDASLLLET  85

Query  503   VAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAE  682
               GVESE++S R+FGMRNFKY++ IK ALE+ECP+TVSCADIVALSARDG VMLKGP+ E
Sbjct  86    ARGVESEQKSKRSFGMRNFKYVKIIKDALEKECPSTVSCADIVALSARDGIVMLKGPKIE  145

Query  683   M-KTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCI  859
             M KTGRRDS+ +YL +VE  IPNHNDS+  V+S F SIG+D E TVALLGAHSVGRVHC+
Sbjct  146   MIKTGRRDSRGSYLGDVETLIPNHNDSLSSVISTFNSIGIDVEATVALLGAHSVGRVHCV  205

Query  860   NIVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNIL  1039
             N+VHRLYPT+DPTLDP+YA YLK RCPS  PDP AV   YSRNDR TPM++DNMYYKNI+
Sbjct  206   NLVHRLYPTIDPTLDPSYALYLKKRCPSPTPDPNAV--LYSRNDRETPMVVDNMYYKNIM  263

Query  1040  EHKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNC  1219
              HKGLLV+D+ LAT P TAPFV KMAADN YFH+QF+R + ++SE NPLTGDQGEIRK+C
Sbjct  264   AHKGLLVIDDELATDPRTAPFVAKMAADNNYFHEQFSRGVRLLSETNPLTGDQGEIRKDC  323

Query  1220  RYVN  1231
             RYVN
Sbjct  324   RYVN  327



>ref|XP_010516960.1| PREDICTED: peroxidase 21-like [Camelina sativa]
Length=327

 Score =   477 bits (1227),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 221/307 (72%), Positives = 262/307 (85%), Gaps = 3/307 (1%)
 Frame = +2

Query  314   IRCAKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASIL  493
             I    G+L+M YY ESCP+AE+II++QV  LY +HGNTAVSWLRNLFHDC+VK+CDAS+L
Sbjct  23    IHIGNGELEMNYYRESCPKAEEIIRQQVETLYYKHGNTAVSWLRNLFHDCVVKSCDASLL  82

Query  494   LDSVAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGP  673
             L++  GVESE++S R+FGMRNFKY++ IK ALE+ECP+TVSCADIVALSARDG VMLKGP
Sbjct  83    LETARGVESEQKSTRSFGMRNFKYVKIIKDALEKECPSTVSCADIVALSARDGIVMLKGP  142

Query  674   RAEM-KTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRV  850
             + EM KTGRRDS+ +YL +VE  IPNHNDS+  VLS F SIG+D E TVALLGAHSVGRV
Sbjct  143   KIEMIKTGRRDSRGSYLGDVETLIPNHNDSLSSVLSTFDSIGIDVEATVALLGAHSVGRV  202

Query  851   HCINIVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYK  1030
             HC+N+VHRLYPT+DPTLDP+YA YLK RCP+  PDP AV   YSRNDR TPM++DNMYYK
Sbjct  203   HCVNLVHRLYPTIDPTLDPSYALYLKKRCPTPTPDPNAV--LYSRNDRETPMVVDNMYYK  260

Query  1031  NILEHKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIR  1210
             NI+ HKGLLV+D+ LAT P TAPFV KMAADN YFH+QF+R + ++SE NPLTGDQGEIR
Sbjct  261   NIMAHKGLLVIDDELATDPRTAPFVAKMAADNGYFHEQFSRGVRLLSETNPLTGDQGEIR  320

Query  1211  KNCRYVN  1231
             K+CRYVN
Sbjct  321   KDCRYVN  327



>ref|XP_004497489.1| PREDICTED: peroxidase 21-like [Cicer arietinum]
Length=326

 Score =   476 bits (1224),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 222/304 (73%), Positives = 261/304 (86%), Gaps = 3/304 (1%)
 Frame = +2

Query  323   AKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDS  502
              K  LQ+ YYS+SCP+AE+IIK+QV +LY EHGNTA+SW+RNLFHDC+VKACDAS+LL++
Sbjct  23    GKSQLQVNYYSKSCPKAEEIIKQQVTELYNEHGNTAISWVRNLFHDCLVKACDASLLLET  82

Query  503   VAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAE  682
             V GV SE+ S R+FGMRNFKY+ TIKAA+E+ECP TVSCADIVALSARDG  ML GP  E
Sbjct  83    VHGVVSEQTSERSFGMRNFKYVNTIKAAVEKECPLTVSCADIVALSARDGIAMLGGPNIE  142

Query  683   MKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCIN  862
             MK+GRRDSKE+Y+  VE+FIPNHNDS+ LVLSRFQ+IGVD E TVALLGAHSVGRVHC+N
Sbjct  143   MKSGRRDSKESYVKVVEDFIPNHNDSISLVLSRFQAIGVDVEATVALLGAHSVGRVHCMN  202

Query  863   IVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILE  1042
             IVHRLYPTVD TLDPT+A YLK RCP+  PDP+AV+  Y RND +TPMI+DN YYKNIL+
Sbjct  203   IVHRLYPTVDTTLDPTHAAYLKRRCPTPNPDPKAVQ--YVRNDLKTPMIIDNNYYKNILQ  260

Query  1043  HKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTG-DQGEIRKNC  1219
             HKGLL VDE LA  P TAP+V+KMA DN YF  QF+RA++++SENNPLT  DQGEIRK+C
Sbjct  261   HKGLLTVDEELANDPITAPYVQKMADDNTYFRQQFSRAVLLLSENNPLTADDQGEIRKDC  320

Query  1220  RYVN  1231
             RYVN
Sbjct  321   RYVN  324



>ref|XP_006294588.1| hypothetical protein CARUB_v10023623mg [Capsella rubella]
 gb|EOA27486.1| hypothetical protein CARUB_v10023623mg [Capsella rubella]
Length=327

 Score =   476 bits (1224),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 221/304 (73%), Positives = 262/304 (86%), Gaps = 3/304 (1%)
 Frame = +2

Query  323   AKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDS  502
               G+L+M YY ESCP+AE+II++QV  LY +HGNTAVSWLRNLFHDC+VK+CDAS+LL++
Sbjct  26    GNGELEMNYYRESCPKAEEIIRQQVETLYYKHGNTAVSWLRNLFHDCVVKSCDASLLLET  85

Query  503   VAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAE  682
               GVESE++S R+FGMRNFKY++ IK ALE+ECP+TVSCADIVALSARDG VMLKGP+ E
Sbjct  86    ARGVESEQKSTRSFGMRNFKYVKIIKDALEKECPSTVSCADIVALSARDGIVMLKGPKIE  145

Query  683   M-KTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCI  859
             M KTGRRDS+ +YLA+VE  IPNHNDS+  VLS F S+G+D E TVALLGAHSVGRVHC+
Sbjct  146   MIKTGRRDSRGSYLADVETLIPNHNDSLSSVLSTFDSLGIDVEATVALLGAHSVGRVHCV  205

Query  860   NIVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNIL  1039
             N+VHRLYPTVDPTLDP+YA YLK RCP+  PDP AV   YSRNDR TPM++DNMYYKNI+
Sbjct  206   NLVHRLYPTVDPTLDPSYALYLKNRCPTPTPDPNAV--LYSRNDRETPMVVDNMYYKNIM  263

Query  1040  EHKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNC  1219
              HKGLLV+D+ LAT P TAPFV KMAADN YFH+QF+R + ++SE NPLTGDQGEIRK+C
Sbjct  264   AHKGLLVIDDELATDPRTAPFVAKMAADNGYFHEQFSRGVRLLSETNPLTGDQGEIRKDC  323

Query  1220  RYVN  1231
             RYVN
Sbjct  324   RYVN  327



>gb|KEH42264.1| cationic peroxidase [Medicago truncatula]
Length=325

 Score =   475 bits (1222),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 220/303 (73%), Positives = 259/303 (85%), Gaps = 2/303 (1%)
 Frame = +2

Query  323   AKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDS  502
              K  LQ+ YYS SCP+AE+IIK+QV +LY +HGNTA+SW+RNLFHDC V +CDAS+LL +
Sbjct  23    GKSQLQLNYYSNSCPKAEEIIKQQVTELYNQHGNTAISWVRNLFHDCTVNSCDASLLLAT  82

Query  503   VAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAE  682
             V GV SE+ S R+FGMRNFKY+ TIKAA+E+ECP TVSCADIVALSARDG  ML GP  E
Sbjct  83    VHGVVSEQTSVRSFGMRNFKYVNTIKAAVEKECPLTVSCADIVALSARDGIAMLGGPNIE  142

Query  683   MKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCIN  862
             MK+GRRDSKE+Y   VE FIPNHNDS+ LVLSRFQ+IGVD E TVALLGAHSVGRVHC+N
Sbjct  143   MKSGRRDSKESYANVVEEFIPNHNDSISLVLSRFQAIGVDVEATVALLGAHSVGRVHCMN  202

Query  863   IVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILE  1042
             +VHRLYPTVDPTLDPT+A YLK RCP+  PDP+AV+  Y RND +TPMI+DN YYKNIL+
Sbjct  203   LVHRLYPTVDPTLDPTHATYLKRRCPTPNPDPKAVQ--YVRNDLKTPMIIDNNYYKNILQ  260

Query  1043  HKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCR  1222
             HKGLL VDE LAT P T+P+V+KMAADN YF++QF+RA+ ++SENNPL GDQGEIRK+CR
Sbjct  261   HKGLLTVDEELATDPRTSPYVKKMAADNGYFNEQFSRAVQLLSENNPLIGDQGEIRKDCR  320

Query  1223  YVN  1231
             YVN
Sbjct  321   YVN  323



>ref|XP_010253604.1| PREDICTED: peroxidase 21-like isoform X2 [Nelumbo nucifera]
Length=331

 Score =   475 bits (1223),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 217/303 (72%), Positives = 266/303 (88%), Gaps = 3/303 (1%)
 Frame = +2

Query  332   DLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAG  511
             DL + +YSESCPRAE+I+KEQV KLY++HGNTAVSW+RNLFHDCMVK+CDAS+LLD+ + 
Sbjct  31    DLGLNFYSESCPRAEEIVKEQVTKLYQKHGNTAVSWVRNLFHDCMVKSCDASVLLDTTSR  90

Query  512   VESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPR-AEMK  688
             + SE++S R+FGMRNFKYI TIK ALE ECP TVSCADIVALSAR+  VML GP  A MK
Sbjct  91    IVSEKKSQRSFGMRNFKYINTIKEALERECPMTVSCADIVALSAREAIVMLGGPYIAGMK  150

Query  689   TGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIV  868
             TGRRDS+E++++ V++FIPNHND++ LVLSRFQS+G+D EGTVALLGAHSVGRVHC+NIV
Sbjct  151   TGRRDSRESHISVVDDFIPNHNDTISLVLSRFQSVGIDVEGTVALLGAHSVGRVHCLNIV  210

Query  869   HRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHK  1048
              RLYP VDPTLDP Y++YLK RCPS +PDP+AV+  Y+RNDR TPM+LDNMYYKN+   +
Sbjct  211   GRLYPNVDPTLDPEYSEYLKRRCPSPQPDPQAVQ--YARNDRETPMVLDNMYYKNLRTQR  268

Query  1049  GLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYV  1228
             GLL+VD+ L + P T+PFVEKMA+DN YFH QF+RAL+++SENNPLTGDQGEIRK+CR+V
Sbjct  269   GLLLVDQQLVSDPNTSPFVEKMASDNAYFHHQFSRALLLLSENNPLTGDQGEIRKDCRFV  328

Query  1229  NTK  1237
             NT+
Sbjct  329   NTQ  331



>ref|XP_010505278.1| PREDICTED: peroxidase 21-like [Camelina sativa]
Length=327

 Score =   475 bits (1222),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 220/304 (72%), Positives = 261/304 (86%), Gaps = 3/304 (1%)
 Frame = +2

Query  323   AKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDS  502
               G+L+M YY ESCP+AE+II++QV  LY +HGNTAVSWLRNLFHDC+VK+CDAS+LL++
Sbjct  26    GNGELEMNYYRESCPKAEEIIRQQVETLYYKHGNTAVSWLRNLFHDCVVKSCDASLLLET  85

Query  503   VAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAE  682
               GVESE++S R+FGMRNFKY++ IK ALE+ECP+TVSCADIVALSARDG VMLKGP+ E
Sbjct  86    ARGVESEQKSTRSFGMRNFKYVKIIKDALEKECPSTVSCADIVALSARDGIVMLKGPKIE  145

Query  683   M-KTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCI  859
             M KTGRRDS+ +YL +VE  IPNHNDS+  VLS F SIG+D E TVALLGAHSVGRVHC+
Sbjct  146   MIKTGRRDSRGSYLGDVETLIPNHNDSLSSVLSTFDSIGIDVEATVALLGAHSVGRVHCV  205

Query  860   NIVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNIL  1039
             N+VHRLYPT+DPTLDP+YA YLK RCP+  PDP AV   YSRNDR TPM++DNMYYKNI+
Sbjct  206   NLVHRLYPTIDPTLDPSYALYLKKRCPTPTPDPNAV--LYSRNDRETPMVVDNMYYKNIM  263

Query  1040  EHKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNC  1219
              HKGLLV+D+ LAT P TAPFV KMAADN YFH+QF+R + ++SE NPLTGDQGEIRK+C
Sbjct  264   AHKGLLVIDDELATDPRTAPFVAKMAADNGYFHEQFSRGVRLLSETNPLTGDQGEIRKDC  323

Query  1220  RYVN  1231
             RYVN
Sbjct  324   RYVN  327



>gb|AAM65003.1| putative peroxidase ATP2a [Arabidopsis thaliana]
Length=327

 Score =   474 bits (1221),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 219/304 (72%), Positives = 260/304 (86%), Gaps = 3/304 (1%)
 Frame = +2

Query  323   AKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDS  502
               G+L+M YY ESCP+AE+II++QV  LY +HGNTAVSWLRNLFHDC+VK+CDAS+LL++
Sbjct  26    GNGELEMNYYKESCPKAEEIIRQQVETLYYKHGNTAVSWLRNLFHDCVVKSCDASLLLET  85

Query  503   VAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAE  682
               GVESE++S R+FGMRNFKY++ IK ALE+ECP+TVSCADIVALSARDG VMLKGP+ E
Sbjct  86    ARGVESEQKSKRSFGMRNFKYVKIIKDALEKECPSTVSCADIVALSARDGIVMLKGPKIE  145

Query  683   M-KTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCI  859
             M KTGR DS+ +YL +VE  IPNHNDS+  V+S F SIG+D E TVALLGAHSVGRVHC+
Sbjct  146   MIKTGRXDSRGSYLGDVETLIPNHNDSLSSVISTFNSIGIDVEATVALLGAHSVGRVHCV  205

Query  860   NIVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNIL  1039
             N+VHRLYPT+DPTLDP+YA YLK RCPS  PDP AV   YSRNDR TPM++DNMYYKNI+
Sbjct  206   NLVHRLYPTIDPTLDPSYALYLKKRCPSPTPDPNAV--LYSRNDRETPMVVDNMYYKNIM  263

Query  1040  EHKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNC  1219
              HKGLLV+D+ LAT P TAPFV KMAADN YFH+QF+R + ++SE NPLTGDQGEIRK+C
Sbjct  264   AHKGLLVIDDELATDPRTAPFVAKMAADNNYFHEQFSRGVRLLSETNPLTGDQGEIRKDC  323

Query  1220  RYVN  1231
             RYVN
Sbjct  324   RYVN  327



>emb|CAA66961.1| peroxidase [Arabidopsis thaliana]
Length=327

 Score =   474 bits (1221),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 220/304 (72%), Positives = 260/304 (86%), Gaps = 3/304 (1%)
 Frame = +2

Query  323   AKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDS  502
               G+L+M YY ESCP+AE+II++QV  LY +HGNTAVSWLRNLFHDC+VK+CDAS+LL++
Sbjct  26    GNGELEMNYYKESCPKAEEIIRQQVETLYYKHGNTAVSWLRNLFHDCVVKSCDASLLLET  85

Query  503   VAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAE  682
               GVESE++S R+FGMRNFKY++ IK ALE+ECP+TVSCADIVALSARDG VMLKGP+ E
Sbjct  86    ARGVESEQKSKRSFGMRNFKYVKIIKDALEKECPSTVSCADIVALSARDGIVMLKGPKIE  145

Query  683   M-KTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCI  859
             M KTGRRDS+ +YL +VE  IPNHNDS+  VLS F SIG+D E TVALLGAHSVGRVHC+
Sbjct  146   MIKTGRRDSRGSYLGDVETLIPNHNDSLSSVLSTFNSIGIDVEATVALLGAHSVGRVHCV  205

Query  860   NIVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNIL  1039
             N+VHRLYPT+DPTLDP+YA YLK RCPS  PDP AV   YSRNDR TPM++DNMYYKNI+
Sbjct  206   NLVHRLYPTIDPTLDPSYALYLKKRCPSPTPDPNAV--LYSRNDRETPMVVDNMYYKNIM  263

Query  1040  EHKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNC  1219
              HKGLLV+D+ LAT   TAPFV KMAADN YFH+QF+R + ++SE NPLTGDQGEIRK+C
Sbjct  264   AHKGLLVIDDELATDSRTAPFVAKMAADNGYFHEQFSRGVRLLSETNPLTGDQGEIRKDC  323

Query  1220  RYVN  1231
             RYVN
Sbjct  324   RYVN  327



>ref|XP_010509387.1| PREDICTED: peroxidase 21 [Camelina sativa]
Length=327

 Score =   474 bits (1220),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 219/304 (72%), Positives = 261/304 (86%), Gaps = 3/304 (1%)
 Frame = +2

Query  323   AKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDS  502
               G+L+M YY ESCP+AE+II++QV  LY +HGNTAVSWLRNLFHDC+VK+CDAS+LL++
Sbjct  26    GNGELEMNYYRESCPKAEEIIRQQVETLYYKHGNTAVSWLRNLFHDCVVKSCDASLLLET  85

Query  503   VAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAE  682
               GVESE++S R+FGMRNFKY++ IK A+E+ECP+TVSCADIVALSARDG VMLKGP+ E
Sbjct  86    ARGVESEQKSTRSFGMRNFKYVKIIKDAVEKECPSTVSCADIVALSARDGIVMLKGPKIE  145

Query  683   M-KTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCI  859
             M KTGRRDS+ +YL +VE  IPNHNDS+  VLS F SIG+D E TVALLGAHSVGRVHC+
Sbjct  146   MIKTGRRDSRGSYLGDVETLIPNHNDSLSSVLSTFDSIGIDVEATVALLGAHSVGRVHCV  205

Query  860   NIVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNIL  1039
             N+VHRLYPT+DPTLDP+YA YLK RCP+  PDP AV   YSRNDR TPM++DNMYYKNI+
Sbjct  206   NLVHRLYPTIDPTLDPSYALYLKKRCPTPTPDPNAV--LYSRNDRETPMVVDNMYYKNIM  263

Query  1040  EHKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNC  1219
              HKGLLV+D+ LAT P TAPFV KMAADN YFH+QF+R + ++SE NPLTGDQGEIRK+C
Sbjct  264   AHKGLLVIDDELATDPRTAPFVAKMAADNGYFHEQFSRGVRLLSETNPLTGDQGEIRKDC  323

Query  1220  RYVN  1231
             RYVN
Sbjct  324   RYVN  327



>ref|XP_010696406.1| PREDICTED: peroxidase 21 [Beta vulgaris subsp. vulgaris]
Length=326

 Score =   474 bits (1219),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 220/301 (73%), Positives = 259/301 (86%), Gaps = 4/301 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLD--SVA  508
             L + YYS+SCP AE I+KE+V KLY +HGNTAVSW+RNLFHDCMVK+CDASILLD    +
Sbjct  26    LDLNYYSDSCPNAETIVKEEVTKLYHKHGNTAVSWVRNLFHDCMVKSCDASILLDEDQTS  85

Query  509   GVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMK  688
             G+ESE+ S RNFGMRNFKYI TIK ALE ECP TVSCADIVALSARDG  +L GPR EMK
Sbjct  86    GIESEKLSSRNFGMRNFKYINTIKEALENECPATVSCADIVALSARDGVELLGGPRIEMK  145

Query  689   TGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIV  868
             TGR+DS+E+Y A VE+F+PNHND++ LVLSRFQ+IGVD EGTVALLGAHSVGRVHC+N+V
Sbjct  146   TGRKDSRESYAAVVEDFLPNHNDTISLVLSRFQAIGVDQEGTVALLGAHSVGRVHCVNLV  205

Query  869   HRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHK  1048
             +RLYPTVDPTLDP YA+YLK RCP+ +PDP AVE  Y+RND  TPM+LDNM+YK++L H+
Sbjct  206   NRLYPTVDPTLDPDYAEYLKRRCPTPDPDPNAVE--YARNDLETPMVLDNMFYKHLLSHE  263

Query  1049  GLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYV  1228
             GLL+VD+ LA+ P+T PFVE MAADN YFHDQFARA++IMSENNPL GDQGEIR +C  +
Sbjct  264   GLLLVDQQLASDPSTLPFVENMAADNTYFHDQFARAMIIMSENNPLIGDQGEIRTHCSRL  323

Query  1229  N  1231
             N
Sbjct  324   N  324



>ref|XP_006428826.1| hypothetical protein CICLE_v10012170mg [Citrus clementina]
 gb|ESR42066.1| hypothetical protein CICLE_v10012170mg [Citrus clementina]
Length=330

 Score =   474 bits (1219),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 215/300 (72%), Positives = 258/300 (86%), Gaps = 2/300 (1%)
 Frame = +2

Query  332   DLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAG  511
             +LQ  YY++SCP+AE+IIK+QV++LY +HGNTAVSW+RNLFHDC VK+CDAS+LL++V G
Sbjct  32    ELQFNYYAQSCPKAEEIIKQQVVQLYYKHGNTAVSWVRNLFHDCAVKSCDASLLLETVTG  91

Query  512   VESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKT  691
             V SE+ S R+FGMRNFKY+ TIKAALE ECP  VSCADIVALSAR+G VML GPR  +KT
Sbjct  92    VASEQASERSFGMRNFKYVSTIKAALEAECPLKVSCADIVALSAREGIVMLGGPRIPIKT  151

Query  692   GRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVH  871
             GRRDS+ +YLAEVE FIPNH+DS+   LS F SIG+D EG VAL GAHSVGRVHC+N+VH
Sbjct  152   GRRDSRVSYLAEVEKFIPNHDDSIATALSVFNSIGIDDEGVVALYGAHSVGRVHCVNLVH  211

Query  872   RLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKG  1051
             RLYPT+DPTLDP YA+YLK RCP+ +PDP AV   Y+RNDR TPMILDN YYKNI+ HKG
Sbjct  212   RLYPTIDPTLDPVYAEYLKGRCPTPDPDPDAV--VYARNDRETPMILDNNYYKNIINHKG  269

Query  1052  LLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             LL+VD+ LA+ P T PFV+KMAADN YFH+QF+RA+ ++SENNPLTGDQGE+RK+CRYVN
Sbjct  270   LLIVDQQLASDPRTTPFVQKMAADNSYFHEQFSRAIALLSENNPLTGDQGEVRKDCRYVN  329



>emb|CDP06722.1| unnamed protein product [Coffea canephora]
Length=329

 Score =   474 bits (1219),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 216/304 (71%), Positives = 259/304 (85%), Gaps = 2/304 (1%)
 Frame = +2

Query  323   AKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDS  502
              K DLQ+ YYSESCPRAE+IIKEQVI LY +HGNTA+SWLRN+FHDCMVK+CDAS+LLD+
Sbjct  27    GKSDLQLNYYSESCPRAEEIIKEQVINLYHKHGNTAISWLRNIFHDCMVKSCDASLLLDN  86

Query  503   VAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAE  682
               G+ESE+ S R+FGMRNFKYI TIK ALE ECP TVSCADIVALSARDG V+L GP  E
Sbjct  87    APGMESEKNSARSFGMRNFKYINTIKQALESECPGTVSCADIVALSARDGVVLLGGPEIE  146

Query  683   MKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCIN  862
             MKTGR+DSK ++ A+V++ IPNHNDSM  VLSRFQS+G+D EGTVALLG HSVGR+HCIN
Sbjct  147   MKTGRKDSKVSHAADVDSLIPNHNDSMSSVLSRFQSVGIDAEGTVALLGGHSVGRIHCIN  206

Query  863   IVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILE  1042
              V RLYP  DPTL+P + +YLK RCPS +PDP+AVE  YSR+D  TPM+LDN+Y+K+IL+
Sbjct  207   FVDRLYPNADPTLNPAHVEYLKRRCPSPKPDPKAVE--YSRDDLATPMVLDNLYHKSILD  264

Query  1043  HKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCR  1222
              KGLL+VD+ LA+ P T+PFV+KMAADN YFHDQF+RAL+I+SENNPL  D+GEIRK+CR
Sbjct  265   GKGLLIVDQELASDPLTSPFVQKMAADNDYFHDQFSRALLILSENNPLLNDEGEIRKDCR  324

Query  1223  YVNT  1234
             + N 
Sbjct  325   FANN  328



>ref|XP_006480640.1| PREDICTED: peroxidase 21-like [Citrus sinensis]
Length=330

 Score =   473 bits (1218),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 216/300 (72%), Positives = 258/300 (86%), Gaps = 2/300 (1%)
 Frame = +2

Query  332   DLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAG  511
             +LQ  YY++SCP+AE+IIK+QV++LY +HGNTAVSW+RNLFHDC VK+CDAS+LL++V G
Sbjct  32    ELQFNYYAQSCPKAEEIIKQQVVQLYYKHGNTAVSWVRNLFHDCAVKSCDASLLLETVTG  91

Query  512   VESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKT  691
             V SE+ S R+FGMRNFKY+ TIKAALE ECP  VSCADIVALSAR+G VML GPR  +KT
Sbjct  92    VASEQASERSFGMRNFKYVSTIKAALEAECPLKVSCADIVALSAREGIVMLGGPRIPIKT  151

Query  692   GRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVH  871
             GRRDS+ +YLAEVE FIPNHNDS+   LS F SIG+D EG VAL GAHSVGRVHC+N+VH
Sbjct  152   GRRDSRVSYLAEVEKFIPNHNDSIATALSVFNSIGIDDEGVVALYGAHSVGRVHCVNLVH  211

Query  872   RLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKG  1051
             RLYPTVDPTLDP YA+YLK RCP+ +PDP AV   Y+RNDR TPMILDN YYKNI+ HKG
Sbjct  212   RLYPTVDPTLDPVYAEYLKGRCPTPDPDPDAV--VYARNDRETPMILDNNYYKNIINHKG  269

Query  1052  LLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             LL+VD+ LA+ P T PFV+KMAA+N YFH+QF+RA+ ++SENNPLTGDQGE+RK+CRYVN
Sbjct  270   LLIVDQQLASDPRTTPFVQKMAANNSYFHEQFSRAIALLSENNPLTGDQGEVRKDCRYVN  329



>ref|XP_010528140.1| PREDICTED: peroxidase 21 [Tarenaya hassleriana]
Length=324

 Score =   473 bits (1217),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 221/303 (73%), Positives = 259/303 (85%), Gaps = 5/303 (2%)
 Frame = +2

Query  323   AKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDS  502
             A+G+LQM YY ESCP+AE+II++QV  LY +HGNTAVSWLRNLFHDC VK+CDAS+LL++
Sbjct  26    ARGELQMNYYGESCPKAEEIIRQQVETLYYKHGNTAVSWLRNLFHDCAVKSCDASLLLET  85

Query  503   VAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAE  682
             V   ESE++S R+FGMRNFKY++TIK ALE ECP+TVSCADIVALSAR+G VMLKGPR E
Sbjct  86    V---ESEQKSVRSFGMRNFKYVKTIKDALERECPSTVSCADIVALSAREGIVMLKGPRIE  142

Query  683   MKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCIN  862
             MKTGRRDS+E+YL EVE  IPNHNDS+  VLS F S+G+D E TVALLGAHSVGRVHC+N
Sbjct  143   MKTGRRDSRESYLGEVERLIPNHNDSLSSVLSTFDSMGIDLEATVALLGAHSVGRVHCVN  202

Query  863   IVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILE  1042
             +VHRLYPTVDPTLDP YA YLK RCP+  PDP AV   YSRNDR TPM++DN Y+KNILE
Sbjct  203   LVHRLYPTVDPTLDPNYAQYLKGRCPTPNPDPNAV--LYSRNDRETPMVIDNFYFKNILE  260

Query  1043  HKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCR  1222
             HKGLL VDE LAT P TAP+V KMAADN YF+ QF+R + ++SE NPLTGDQGEIR++CR
Sbjct  261   HKGLLTVDEELATDPRTAPYVTKMAADNGYFYAQFSRGVRLLSETNPLTGDQGEIRRDCR  320

Query  1223  YVN  1231
             +VN
Sbjct  321   FVN  323



>ref|XP_010264743.1| PREDICTED: peroxidase 21-like [Nelumbo nucifera]
Length=328

 Score =   473 bits (1217),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 215/300 (72%), Positives = 261/300 (87%), Gaps = 3/300 (1%)
 Frame = +2

Query  332   DLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAG  511
             DLQ+ YYS+SCP+AE+I+KE+V+KLYE+HGNTAVSW+RNLFHDCM ++CDAS+LL++  G
Sbjct  32    DLQLNYYSKSCPKAEEIVKEEVMKLYEKHGNTAVSWVRNLFHDCM-ESCDASLLLETANG  90

Query  512   VESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKT  691
             + SE+ S R+FGMRNFKY+ TIK ALE +CP TVSCADIVALSAR+G VML GP   MKT
Sbjct  91    IVSEKTSQRSFGMRNFKYVNTIKQALETQCPMTVSCADIVALSAREGVVMLGGPHIAMKT  150

Query  692   GRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVH  871
             GRRD++E+++A + +FIPNHNDSM LVLSRFQSIG+D EGTVALLGAHSVGRVHC+N+V 
Sbjct  151   GRRDARESHVAVINDFIPNHNDSMSLVLSRFQSIGIDAEGTVALLGAHSVGRVHCVNLVD  210

Query  872   RLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKG  1051
             RLYP VDPTL+P Y++YLK RC S +PDP AV   Y+RNDR TPMILDNMYYKN+L HKG
Sbjct  211   RLYPNVDPTLNPNYSEYLKGRCQSPQPDPEAV--IYARNDRETPMILDNMYYKNLLSHKG  268

Query  1052  LLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             LL+VD+ L + P T PFVEKMA+DN YFHDQF+RAL+++SENNPL GDQGEIRK+CR+VN
Sbjct  269   LLLVDQQLVSDPVTLPFVEKMASDNGYFHDQFSRALLLLSENNPLAGDQGEIRKDCRFVN  328



>gb|KFK36603.1| hypothetical protein AALP_AA4G145000 [Arabis alpina]
Length=327

 Score =   473 bits (1216),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 219/308 (71%), Positives = 262/308 (85%), Gaps = 3/308 (1%)
 Frame = +2

Query  311   HIRCAKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASI  490
             + +   G+L+M YY ESCP+AE+II++QV  LY +HGNTAVSWLRNLFHDC+VK+CDAS+
Sbjct  22    NFQIGNGELEMNYYRESCPKAEEIIRQQVETLYYKHGNTAVSWLRNLFHDCVVKSCDASL  81

Query  491   LLDSVAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKG  670
             LL++  GVESE++S R+FGMRNFKY++ IK ALE+ECP+TVSCADIVALSARDG VMLKG
Sbjct  82    LLETARGVESEQKSVRSFGMRNFKYVKIIKDALEKECPSTVSCADIVALSARDGIVMLKG  141

Query  671   PRAEM-KTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGR  847
             P+ EM KTGRRDS+ +YL +VE  IPNHNDS+  VLS F S+G+D E TVALLGAHSVGR
Sbjct  142   PKIEMIKTGRRDSRGSYLGDVETLIPNHNDSLSSVLSTFNSLGIDVEATVALLGAHSVGR  201

Query  848   VHCINIVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYY  1027
             VHC+N+VHRLYPT+DPTLDP+YA YLK RCPS  PDP AV   YSRNDR TPM++DNMYY
Sbjct  202   VHCVNLVHRLYPTIDPTLDPSYALYLKKRCPSPTPDPNAV--LYSRNDRETPMVVDNMYY  259

Query  1028  KNILEHKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEI  1207
             KNI+ HKGLLV+D+ LAT   TAPFV KMAADN YFH+QF+R + ++SE NPLTGDQGEI
Sbjct  260   KNIMAHKGLLVIDDELATDSRTAPFVAKMAADNGYFHEQFSRGVRLLSETNPLTGDQGEI  319

Query  1208  RKNCRYVN  1231
             RK+CRYVN
Sbjct  320   RKDCRYVN  327



>ref|XP_009133118.1| PREDICTED: peroxidase 21 isoform X1 [Brassica rapa]
 ref|XP_009133119.1| PREDICTED: peroxidase 21 isoform X2 [Brassica rapa]
 emb|CDY46756.1| BnaA03g17000D [Brassica napus]
Length=330

 Score =   473 bits (1217),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 218/306 (71%), Positives = 262/306 (86%), Gaps = 3/306 (1%)
 Frame = +2

Query  323   AKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDS  502
                +L+M YY ESCPRAE+II++QV  LY +HGNTAVSWLRNLFHDC+VK+CDAS+LL++
Sbjct  27    GNAELEMNYYRESCPRAEEIIRQQVETLYYKHGNTAVSWLRNLFHDCVVKSCDASLLLET  86

Query  503   VAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAE  682
               GVESE++S R+FGMRNFKY++ IK ALE+ECP+TVSCADIVALSARDG VMLKGP+ +
Sbjct  87    ARGVESEQKSTRSFGMRNFKYVKVIKDALEKECPSTVSCADIVALSARDGIVMLKGPKID  146

Query  683   M-KTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCI  859
             M KTGRRDS+ +YL++VE  +PNHNDS+  VLS F S+G+D E TVALLGAHSVGRVHC+
Sbjct  147   MIKTGRRDSRGSYLSDVETLVPNHNDSLSSVLSNFNSMGIDVEATVALLGAHSVGRVHCV  206

Query  860   NIVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNIL  1039
             N+VHRLYPT+DPTLDP YA YLK RCPS  PDP AV   YSRNDR TPM++DNMYYKNI+
Sbjct  207   NLVHRLYPTIDPTLDPDYALYLKNRCPSPNPDPNAV--LYSRNDRETPMVVDNMYYKNIM  264

Query  1040  EHKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNC  1219
              HKGLLV+D+ LA+ P TAPFV KMAADN YFH+QF+R + ++SE NPLTGDQGEIRK+C
Sbjct  265   AHKGLLVIDDELASDPRTAPFVAKMAADNGYFHEQFSRGVRLLSETNPLTGDQGEIRKDC  324

Query  1220  RYVNTK  1237
             RYVN+K
Sbjct  325   RYVNSK  330



>ref|NP_001118461.1| peroxidase [Arabidopsis thaliana]
 gb|AEC09355.1| peroxidase [Arabidopsis thaliana]
Length=296

 Score =   471 bits (1212),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 218/298 (73%), Positives = 257/298 (86%), Gaps = 3/298 (1%)
 Frame = +2

Query  341   MGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGVES  520
             M YY ESCP+AE+II++QV  LY +HGNTAVSWLRNLFHDC+VK+CDAS+LL++  GVES
Sbjct  1     MNYYKESCPKAEEIIRQQVETLYYKHGNTAVSWLRNLFHDCVVKSCDASLLLETARGVES  60

Query  521   ERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEM-KTGR  697
             E++S R+FGMRNFKY++ IK ALE+ECP+TVSCADIVALSARDG VMLKGP+ EM KTGR
Sbjct  61    EQKSKRSFGMRNFKYVKIIKDALEKECPSTVSCADIVALSARDGIVMLKGPKIEMIKTGR  120

Query  698   RDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHRL  877
             RDS+ +YL +VE  IPNHNDS+  V+S F SIG+D E TVALLGAHSVGRVHC+N+VHRL
Sbjct  121   RDSRGSYLGDVETLIPNHNDSLSSVISTFNSIGIDVEATVALLGAHSVGRVHCVNLVHRL  180

Query  878   YPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGLL  1057
             YPT+DPTLDP+YA YLK RCPS  PDP AV   YSRNDR TPM++DNMYYKNI+ HKGLL
Sbjct  181   YPTIDPTLDPSYALYLKKRCPSPTPDPNAV--LYSRNDRETPMVVDNMYYKNIMAHKGLL  238

Query  1058  VVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             V+D+ LAT P TAPFV KMAADN YFH+QF+R + ++SE NPLTGDQGEIRK+CRYVN
Sbjct  239   VIDDELATDPRTAPFVAKMAADNNYFHEQFSRGVRLLSETNPLTGDQGEIRKDCRYVN  296



>ref|XP_006466081.1| PREDICTED: peroxidase 21-like [Citrus sinensis]
Length=334

 Score =   472 bits (1214),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 215/304 (71%), Positives = 255/304 (84%), Gaps = 2/304 (1%)
 Frame = +2

Query  323   AKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDS  502
              +  LQ  YY+++CP+AEDIIK+QVI LY +HGNTAVSW+RNLFHDC+VK+CDAS+LL  
Sbjct  27    GESQLQFNYYAQNCPKAEDIIKQQVINLYNKHGNTAVSWVRNLFHDCIVKSCDASLLLKK  86

Query  503   VAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAE  682
               G+ESE+ S R+FGMRNF+Y+ TIK ALEEECP TVSCADIVALSAR+G VML GPR E
Sbjct  87    AGGIESEQASERSFGMRNFRYVDTIKEALEEECPVTVSCADIVALSAREGIVMLGGPRIE  146

Query  683   MKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCIN  862
             MKTGRRDSKE+Y  EV+  IPNHNDS+  VLS FQS G+D EGTVALLGAHSVGRVHC+N
Sbjct  147   MKTGRRDSKESYFTEVDKLIPNHNDSLSTVLSAFQSTGIDVEGTVALLGAHSVGRVHCVN  206

Query  863   IVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILE  1042
             +VHRLYPTVDP+L+P Y +YLK RCP+  PDP+AV   Y+RND  TPMI+DN YYKN+L 
Sbjct  207   LVHRLYPTVDPSLNPEYGEYLKRRCPTPNPDPKAV--LYARNDPETPMIIDNNYYKNLLN  264

Query  1043  HKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCR  1222
              KGLL+VD+ LA+ P TAPFVEKMAADN YFH QF+RA+ ++SENNPLT DQGEIRK+CR
Sbjct  265   QKGLLIVDQQLASDPRTAPFVEKMAADNGYFHQQFSRAVGLLSENNPLTEDQGEIRKDCR  324

Query  1223  YVNT  1234
             Y N+
Sbjct  325   YANS  328



>emb|CDX79717.1| BnaC03g20530D [Brassica napus]
Length=330

 Score =   472 bits (1214),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 217/306 (71%), Positives = 262/306 (86%), Gaps = 3/306 (1%)
 Frame = +2

Query  323   AKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDS  502
                +L+M YY ESCPRAE+II++QV  LY +HGNTAVSWLRNLFHDC+VK+CDAS+LL++
Sbjct  27    GNAELEMNYYRESCPRAEEIIRQQVETLYYKHGNTAVSWLRNLFHDCVVKSCDASLLLET  86

Query  503   VAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAE  682
               GVESE++S R+FGMRNFKY++ IK ALE+ECP+TVSCADIVALSARDG VMLKGP+ +
Sbjct  87    ARGVESEQKSTRSFGMRNFKYVKVIKDALEKECPSTVSCADIVALSARDGIVMLKGPKID  146

Query  683   M-KTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCI  859
             M KTGRRDS+ +YL++VE  +PNHNDS+  VLS F S+G+D E TVALLGAHSVGRVHC+
Sbjct  147   MIKTGRRDSRGSYLSDVETLVPNHNDSLSSVLSNFNSMGIDVEATVALLGAHSVGRVHCV  206

Query  860   NIVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNIL  1039
             N+VHRLYPT+DPTLDP YA YLK RCPS  PDP AV   YSRNDR TPM++DNMYYKNI+
Sbjct  207   NLVHRLYPTIDPTLDPDYALYLKNRCPSPNPDPNAV--LYSRNDRETPMVVDNMYYKNIM  264

Query  1040  EHKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNC  1219
              H+GLLV+D+ LA+ P TAPFV KMAADN YFH+QF+R + ++SE NPLTGDQGEIRK+C
Sbjct  265   AHRGLLVIDDELASDPRTAPFVAKMAADNGYFHEQFSRGVRLLSETNPLTGDQGEIRKDC  324

Query  1220  RYVNTK  1237
             RYVN+K
Sbjct  325   RYVNSK  330



>gb|KDO58640.1| hypothetical protein CISIN_1g045164mg [Citrus sinensis]
Length=334

 Score =   471 bits (1212),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 216/304 (71%), Positives = 254/304 (84%), Gaps = 2/304 (1%)
 Frame = +2

Query  323   AKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDS  502
              +  LQ  YY+ESCP+AEDIIK+QVI LY +HGNTAVSW+RNLFHDC+VK+CDAS+LL  
Sbjct  27    GESQLQFNYYAESCPKAEDIIKQQVINLYNKHGNTAVSWVRNLFHDCIVKSCDASLLLKK  86

Query  503   VAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAE  682
               G+ SE+ S R+FGMRNF+Y+ TIK ALEEECP TVSCADIVALSAR+G VML GPR E
Sbjct  87    AGGIVSEQASERSFGMRNFRYVDTIKEALEEECPVTVSCADIVALSAREGIVMLGGPRIE  146

Query  683   MKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCIN  862
             MKTGRRDSKE+Y  EV+  IPNHNDS+  VLS FQS G+D EGTVALLGAHSVGRVHC+N
Sbjct  147   MKTGRRDSKESYFTEVDKLIPNHNDSLSTVLSAFQSTGIDVEGTVALLGAHSVGRVHCVN  206

Query  863   IVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILE  1042
             +VHRLYPTVDP+L+P Y +YLK RCP+  PDP+AV   Y+RND  TPMI+DN YYKN+L 
Sbjct  207   LVHRLYPTVDPSLNPEYGEYLKRRCPTPNPDPKAV--LYARNDPETPMIIDNNYYKNLLN  264

Query  1043  HKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCR  1222
              KGLL+VD+ LA+ P TAPFVEKMAADN YFH QF+RA+ ++SENNPLT DQGEIRK+CR
Sbjct  265   QKGLLIVDQQLASDPRTAPFVEKMAADNGYFHQQFSRAVGLLSENNPLTEDQGEIRKDCR  324

Query  1223  YVNT  1234
             Y N+
Sbjct  325   YANS  328



>ref|XP_002881491.1| peroxidase 21 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57750.1| peroxidase 21 [Arabidopsis lyrata subsp. lyrata]
Length=327

 Score =   471 bits (1212),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 218/304 (72%), Positives = 259/304 (85%), Gaps = 3/304 (1%)
 Frame = +2

Query  323   AKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDS  502
               G+L+M YY ESCP+AE+II++QV  LY +HGNTAVSWLRNLFHDC+VK+CDAS+LL++
Sbjct  26    GNGELEMNYYRESCPKAEEIIRQQVETLYYKHGNTAVSWLRNLFHDCVVKSCDASLLLET  85

Query  503   VAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAE  682
               GVESE++S R+FGMRNFKY++ IK ALE+ECP+TVSCADIVALSARDG VMLKGP+ E
Sbjct  86    ARGVESEQKSKRSFGMRNFKYVKIIKDALEKECPSTVSCADIVALSARDGIVMLKGPKIE  145

Query  683   M-KTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCI  859
             M KTGRRDS+ +YL +VE  IPNHNDS+  V+S F SIG+D E TVALLGAHSVGRVHC+
Sbjct  146   MIKTGRRDSRGSYLGDVETLIPNHNDSLSSVISTFNSIGIDVEATVALLGAHSVGRVHCV  205

Query  860   NIVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNIL  1039
             N+VHRLYPT+DPTLDP+YA YLK RCPS  PDP AV   YSRNDR TPM++DNMYYKNI+
Sbjct  206   NLVHRLYPTIDPTLDPSYALYLKKRCPSPTPDPNAV--LYSRNDRETPMVVDNMYYKNIM  263

Query  1040  EHKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNC  1219
              HKGLLV+D+ LAT P TAPFV KMA DN YF +QF+R + ++SE NPLTGDQGEIRK+C
Sbjct  264   AHKGLLVIDDELATDPRTAPFVAKMATDNGYFQEQFSRGVRLLSETNPLTGDQGEIRKDC  323

Query  1220  RYVN  1231
             RYVN
Sbjct  324   RYVN  327



>ref|XP_004304410.1| PREDICTED: peroxidase 21-like [Fragaria vesca subsp. vesca]
Length=334

 Score =   471 bits (1212),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 215/307 (70%), Positives = 259/307 (84%), Gaps = 2/307 (1%)
 Frame = +2

Query  311   HIRCAKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASI  490
               +    +LQ  YYS+SCP+AE+IIK++V  LY EHGNTAVSW+RNLFHDC+V+ CDAS+
Sbjct  25    QFQVGTSELQQNYYSQSCPKAEEIIKQEVTNLYNEHGNTAVSWIRNLFHDCIVEGCDASL  84

Query  491   LLDSVAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKG  670
             LL++  G+ESE+ S R+FGMRNFKY+ TIK ALE+ECP TVSCAD+V LSARDG VML G
Sbjct  85    LLEAADGIESEKASDRSFGMRNFKYVNTIKEALEKECPLTVSCADVVTLSARDGIVMLGG  144

Query  671   PRAEMKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRV  850
             PR EMKTGRRDSKE++   V+  IPNHNDS+  VLSRFQSIG+DTEGTVALLGAHSVGRV
Sbjct  145   PRIEMKTGRRDSKESHAKVVDESIPNHNDSISSVLSRFQSIGIDTEGTVALLGAHSVGRV  204

Query  851   HCINIVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYK  1030
             HC+N+VHRLYP VDPTLDP +A YLK RCP+  PDP+AVE  YSR D +TPMILDNMYYK
Sbjct  205   HCVNLVHRLYPAVDPTLDPDHAAYLKNRCPTPNPDPKAVE--YSRFDLKTPMILDNMYYK  262

Query  1031  NILEHKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIR  1210
             N+L HKGLL++D+ L++   T PFVEKMA+DN YF++Q +RA+V++SENNPLTGDQGEIR
Sbjct  263   NVLNHKGLLIIDQQLSSDADTLPFVEKMASDNGYFYEQISRAIVLLSENNPLTGDQGEIR  322

Query  1211  KNCRYVN  1231
             K+CRYVN
Sbjct  323   KDCRYVN  329



>ref|XP_008442669.1| PREDICTED: peroxidase 21-like [Cucumis melo]
Length=325

 Score =   471 bits (1211),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 213/303 (70%), Positives = 260/303 (86%), Gaps = 2/303 (1%)
 Frame = +2

Query  323   AKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDS  502
              +G L+M YY++SCP+AE+IIK+QV+ LY EHGNTAVSWLRNLFHDC+VK+CDAS+LL++
Sbjct  24    GRGQLEMNYYAKSCPKAEEIIKQQVVDLYYEHGNTAVSWLRNLFHDCIVKSCDASLLLET  83

Query  503   VAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAE  682
             V GVESE++S R+FGMRNFKY+  IKAA+E+ECP TVSCADIVALSARDG VMLKGP  +
Sbjct  84    VVGVESEKDSSRSFGMRNFKYVNKIKAAVEKECPLTVSCADIVALSARDGIVMLKGPHID  143

Query  683   MKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCIN  862
             +KTGR+DSK +Y   VE  +P HN+S+  VLSRF SIG+DTE TVALLGAHSVGRVHC+N
Sbjct  144   LKTGRKDSKMSYSNMVEELVPQHNESLVNVLSRFNSIGIDTEATVALLGAHSVGRVHCVN  203

Query  863   IVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILE  1042
             +V RLYPT DPT+DP YA YLK+RCP+  PDP AV   YSRNDR+TPM+LDNMYY NIL+
Sbjct  204   LVERLYPTADPTIDPEYAKYLKMRCPTPTPDPNAV--LYSRNDRKTPMVLDNMYYSNILK  261

Query  1043  HKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCR  1222
             HKGLL+VD+ LA++P T P+V+K AADN YFH QF+R + ++SENNPLTGDQGEIRK+CR
Sbjct  262   HKGLLIVDQELASNPLTLPYVKKFAADNVYFHAQFSRGIRLLSENNPLTGDQGEIRKDCR  321

Query  1223  YVN  1231
             +VN
Sbjct  322   FVN  324



>gb|AGX27515.1| POD21 [Populus tomentosa]
Length=339

 Score =   471 bits (1211),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 220/312 (71%), Positives = 263/312 (84%), Gaps = 10/312 (3%)
 Frame = +2

Query  323   AKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDS  502
              K +LQ  YY++ CPRAE+IIKEQVIKLY +H NTAVSW+RNLFH C+VK+CDAS+LL++
Sbjct  29    GKSELQFNYYAQGCPRAEEIIKEQVIKLYNKHRNTAVSWVRNLFHVCIVKSCDASLLLET  88

Query  503   VAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAE  682
             V G+ESE+ S R+ GMRNFKY+ TIKAA+E ECP TVSCADIVALSARDG VML GPR E
Sbjct  89    VNGIESEKASQRSLGMRNFKYVNTIKAAVESECPVTVSCADIVALSARDGIVMLGGPRVE  148

Query  683   MKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALL--------GAHS  838
             MKTGRRDS  +Y A VE+FIPNHNDS+ LVLSRFQSIGVD EGTVALL        G+HS
Sbjct  149   MKTGRRDSTVSYGAVVEDFIPNHNDSISLVLSRFQSIGVDVEGTVALLASFVLFLPGSHS  208

Query  839   VGRVHCINIVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDN  1018
             VGRVHC+N+VHR+YPTVDP++DP YA+YLK RCP  +PDP+AV   Y+RNDR TPMILD+
Sbjct  209   VGRVHCVNLVHRIYPTVDPSMDPDYAEYLKGRCPPPDPDPQAV--LYARNDRETPMILDS  266

Query  1019  MYYKNILEHKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQ  1198
              YYKN+L HKGLL+VD+ L + P T+P+VEKMAADN +FHDQ +RA+V+ SENNPLTG+Q
Sbjct  267   YYYKNLLGHKGLLMVDQQLTSDPLTSPYVEKMAADNGFFHDQVSRAVVLWSENNPLTGNQ  326

Query  1199  GEIRKNCRYVNT  1234
             GEIRK+CRYVN+
Sbjct  327   GEIRKDCRYVNS  338



>ref|XP_010253603.1| PREDICTED: peroxidase 21-like isoform X1 [Nelumbo nucifera]
Length=334

 Score =   470 bits (1210),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 217/306 (71%), Positives = 266/306 (87%), Gaps = 6/306 (2%)
 Frame = +2

Query  332   DLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAG  511
             DL + +YSESCPRAE+I+KEQV KLY++HGNTAVSW+RNLFHDCMVK+CDAS+LLD+ + 
Sbjct  31    DLGLNFYSESCPRAEEIVKEQVTKLYQKHGNTAVSWVRNLFHDCMVKSCDASVLLDTTSR  90

Query  512   VESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPR-AEMK  688
             + SE++S R+FGMRNFKYI TIK ALE ECP TVSCADIVALSAR+  VML GP  A MK
Sbjct  91    IVSEKKSQRSFGMRNFKYINTIKEALERECPMTVSCADIVALSAREAIVMLGGPYIAGMK  150

Query  689   TGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALL---GAHSVGRVHCI  859
             TGRRDS+E++++ V++FIPNHND++ LVLSRFQS+G+D EGTVALL   GAHSVGRVHC+
Sbjct  151   TGRRDSRESHISVVDDFIPNHNDTISLVLSRFQSVGIDVEGTVALLERTGAHSVGRVHCL  210

Query  860   NIVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNIL  1039
             NIV RLYP VDPTLDP Y++YLK RCPS +PDP+AV+  Y+RNDR TPM+LDNMYYKN+ 
Sbjct  211   NIVGRLYPNVDPTLDPEYSEYLKRRCPSPQPDPQAVQ--YARNDRETPMVLDNMYYKNLR  268

Query  1040  EHKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNC  1219
               +GLL+VD+ L + P T+PFVEKMA+DN YFH QF+RAL+++SENNPLTGDQGEIRK+C
Sbjct  269   TQRGLLLVDQQLVSDPNTSPFVEKMASDNAYFHHQFSRALLLLSENNPLTGDQGEIRKDC  328

Query  1220  RYVNTK  1237
             R+VNT+
Sbjct  329   RFVNTQ  334



>ref|XP_009141629.1| PREDICTED: peroxidase 21-like [Brassica rapa]
Length=328

 Score =   469 bits (1207),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 219/304 (72%), Positives = 260/304 (86%), Gaps = 3/304 (1%)
 Frame = +2

Query  323   AKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDS  502
                +L+M YY ESCPRAE+II++QV  LY +HGNTAVSWLRNLFHDC+VK+CDAS+LL++
Sbjct  27    GNAELEMNYYRESCPRAEEIIRQQVETLYYKHGNTAVSWLRNLFHDCVVKSCDASLLLET  86

Query  503   VAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAE  682
               GVESE++S R+FGMRNFKYI+TIK ALE+ECP TVSCADIVALSARDG VMLKGP+ +
Sbjct  87    ARGVESEQKSTRSFGMRNFKYIKTIKDALEKECPGTVSCADIVALSARDGIVMLKGPKID  146

Query  683   M-KTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCI  859
             M KTGRRDS+ +YL +VE  +PNHNDS+  VLS F SIG+D E TVALLGAHSVGRVHC+
Sbjct  147   MIKTGRRDSRGSYLRDVEALVPNHNDSLSSVLSNFNSIGIDVEATVALLGAHSVGRVHCV  206

Query  860   NIVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNIL  1039
             N+VHRLYPT+DPTLDPTYA YLK RCP+  P+P+ V   YSRND  TPMI+DNMYYKNI+
Sbjct  207   NLVHRLYPTIDPTLDPTYALYLKKRCPTPNPNPKEV--LYSRNDPETPMIVDNMYYKNIM  264

Query  1040  EHKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNC  1219
              HKGLLV+D+ +AT P TAPFV KMAADN YFH+QF+RA+ ++SE NPLTGDQGEIRK+C
Sbjct  265   AHKGLLVIDDEIATDPRTAPFVAKMAADNGYFHEQFSRAIRLLSETNPLTGDQGEIRKDC  324

Query  1220  RYVN  1231
             RYVN
Sbjct  325   RYVN  328



>emb|CDY55434.1| BnaA04g29190D [Brassica napus]
Length=328

 Score =   469 bits (1206),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 218/304 (72%), Positives = 260/304 (86%), Gaps = 3/304 (1%)
 Frame = +2

Query  323   AKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDS  502
                +L+M YY ESCPRAE+II++QV  LY +HGNTAVSWLRNLFHDC+VK+CDAS+LL++
Sbjct  27    GNAELKMNYYRESCPRAEEIIRQQVETLYYKHGNTAVSWLRNLFHDCVVKSCDASLLLET  86

Query  503   VAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAE  682
               GVESE++S R+FGMRNFKYI+TIK ALE+ECP TVSCADIVALSARDG VMLKGP+ +
Sbjct  87    ARGVESEQKSTRSFGMRNFKYIKTIKDALEKECPGTVSCADIVALSARDGIVMLKGPKID  146

Query  683   M-KTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCI  859
             M KTGRRDS+ +YL +VE  +PNHNDS+  VLS F SIG+D E TVALLGAHSVGRVHC+
Sbjct  147   MIKTGRRDSRGSYLRDVEALVPNHNDSLSSVLSNFNSIGIDVEATVALLGAHSVGRVHCV  206

Query  860   NIVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNIL  1039
             N+VHRLYPT+DPTLDPTYA YLK RCP+  P+P+ V   YSRND  TPM++DNMYYKNI+
Sbjct  207   NLVHRLYPTIDPTLDPTYALYLKKRCPTPNPNPKEV--LYSRNDPETPMVVDNMYYKNIM  264

Query  1040  EHKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNC  1219
              HKGLLV+D+ +AT P TAPFV KMAADN YFH+QF+RA+ ++SE NPLTGDQGEIRK+C
Sbjct  265   AHKGLLVIDDEIATDPRTAPFVAKMAADNGYFHEQFSRAIRLLSETNPLTGDQGEIRKDC  324

Query  1220  RYVN  1231
             RYVN
Sbjct  325   RYVN  328



>ref|XP_006426476.1| hypothetical protein CICLE_v10026035mg [Citrus clementina]
 gb|ESR39716.1| hypothetical protein CICLE_v10026035mg [Citrus clementina]
Length=334

 Score =   469 bits (1206),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 214/304 (70%), Positives = 254/304 (84%), Gaps = 2/304 (1%)
 Frame = +2

Query  323   AKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDS  502
              +  LQ  YY+ESCP+AEDIIK+QVI LY +HGNTAVSW+RNLFHDC+VK+CDAS+LL  
Sbjct  27    GESQLQFNYYAESCPKAEDIIKQQVINLYNKHGNTAVSWVRNLFHDCIVKSCDASLLLKK  86

Query  503   VAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAE  682
               G+ SE+ S R+FGMRNF+Y+ TIK ALEEECP TVSCADIVALSAR+G VML GPR E
Sbjct  87    AGGIVSEQASERSFGMRNFRYVDTIKEALEEECPVTVSCADIVALSAREGIVMLGGPRIE  146

Query  683   MKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCIN  862
             MKTGR+DS+E+Y  EV+  IPNHNDS+  VLS FQS G+D EGTVALLGAHSVGRVHC+N
Sbjct  147   MKTGRKDSRESYFTEVDKLIPNHNDSLSTVLSAFQSTGIDVEGTVALLGAHSVGRVHCVN  206

Query  863   IVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILE  1042
             +VHRLYPTVDP+L+P Y +YLK RCP+  PDP+AV   Y+RND  TPMI+DN YYKN+L 
Sbjct  207   LVHRLYPTVDPSLNPEYGEYLKRRCPTPNPDPKAV--LYARNDPETPMIIDNNYYKNLLN  264

Query  1043  HKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCR  1222
              KGLL+VD+ LA+ P TAPFVEKMAADN YFH QF+RA+ ++SENNPLT DQGEIRK+CR
Sbjct  265   QKGLLIVDQQLASDPRTAPFVEKMAADNGYFHQQFSRAVGLLSENNPLTEDQGEIRKDCR  324

Query  1223  YVNT  1234
             Y N+
Sbjct  325   YANS  328



>ref|XP_007143853.1| hypothetical protein PHAVU_007G107400g [Phaseolus vulgaris]
 gb|ESW15847.1| hypothetical protein PHAVU_007G107400g [Phaseolus vulgaris]
Length=329

 Score =   468 bits (1203),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 216/309 (70%), Positives = 261/309 (84%), Gaps = 4/309 (1%)
 Frame = +2

Query  311   HIRCAKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASI  490
             H    K  LQ+ YYS+SCP+AEDIIK+QV +LY++HGNTAVSW+RNLFHDC+V++CDAS+
Sbjct  21    HFNLGKSQLQLNYYSKSCPKAEDIIKQQVTQLYQKHGNTAVSWVRNLFHDCVVQSCDASL  80

Query  491   LLDSV--AGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVML  664
             LL++     + SE+ S R+FGMRNFKY+ TIKAA+EEECP TVSCADIVALSARDG  +L
Sbjct  81    LLETPRHGTLVSEQTSERSFGMRNFKYVNTIKAAVEEECPLTVSCADIVALSARDGISLL  140

Query  665   KGPRAEMKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVG  844
              GP  EMKTGRRDSKE+Y  EV++ IPNHNDS+ +VLSRFQ+IG+D E TVALLGAHSVG
Sbjct  141   GGPSIEMKTGRRDSKESYAKEVKDLIPNHNDSISVVLSRFQAIGIDIEATVALLGAHSVG  200

Query  845   RVHCINIVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMY  1024
             RVHC+N+VHRLYPTVD TLDP +A+YLK RCP+  PDP+AV   YSRND +TPMI+DN Y
Sbjct  201   RVHCVNLVHRLYPTVDTTLDPAHAEYLKRRCPTPNPDPKAV--LYSRNDLKTPMIIDNNY  258

Query  1025  YKNILEHKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGE  1204
             YKNIL+HKGLL VDE LAT   TAP+V+KMA DN+YFH QF+RA+ ++SE NPLTGDQGE
Sbjct  259   YKNILQHKGLLTVDEELATDSRTAPYVQKMANDNEYFHQQFSRAIQLLSETNPLTGDQGE  318

Query  1205  IRKNCRYVN  1231
             IRK+CRY+N
Sbjct  319   IRKDCRYLN  327



>gb|KHN39097.1| Peroxidase 21 [Glycine soja]
Length=327

 Score =   467 bits (1202),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 214/307 (70%), Positives = 260/307 (85%), Gaps = 2/307 (1%)
 Frame = +2

Query  311   HIRCAKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASI  490
             H    +  +++ YYS+SCP+AE+IIKEQV +LY +HGNTAVSW+RNLFHDC+VK+CDAS+
Sbjct  21    HFHLGQSQVELNYYSKSCPKAEEIIKEQVTQLYNKHGNTAVSWVRNLFHDCVVKSCDASL  80

Query  491   LLDSVAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKG  670
             LL +V+ V SE+ S R+FGMRNFKY+ TIKAA+E+ECP TVSCADIVALSARDG  +L G
Sbjct  81    LLATVSDVVSEQASDRSFGMRNFKYVNTIKAAVEKECPLTVSCADIVALSARDGIALLGG  140

Query  671   PRAEMKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRV  850
             P  EMKTGR+DSKE+Y  EVE  IPNHNDSM  VLSRFQ+IG+D E TVALLGAHSVGRV
Sbjct  141   PSIEMKTGRKDSKESYATEVEALIPNHNDSMSSVLSRFQAIGIDVEATVALLGAHSVGRV  200

Query  851   HCINIVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYK  1030
             HC N+VHRLYPTVD TL+P +A+YLK RCP+  PDP+AV   YSRND +TPMI+DN YYK
Sbjct  201   HCKNLVHRLYPTVDSTLNPAHAEYLKRRCPTPNPDPKAV--LYSRNDLKTPMIIDNNYYK  258

Query  1031  NILEHKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIR  1210
             NIL+HKGLL+VDE LAT P TAP+V+KMA DN YF+ QF+RA++++SE NPLTGD+GEIR
Sbjct  259   NILQHKGLLIVDEELATDPITAPYVQKMANDNDYFNQQFSRAILLLSETNPLTGDEGEIR  318

Query  1211  KNCRYVN  1231
             K+CRY+N
Sbjct  319   KDCRYLN  325



>ref|XP_003590492.1| Peroxidase [Medicago truncatula]
 gb|AES60743.1| cationic peroxidase [Medicago truncatula]
Length=325

 Score =   467 bits (1202),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 215/299 (72%), Positives = 260/299 (87%), Gaps = 2/299 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             LQ+ YYS+SCP+AE+IIK+QV +LY +HGNTA+SW+RNLFHDC+VK+CDAS+LL++V GV
Sbjct  27    LQVNYYSKSCPKAEEIIKQQVNELYNKHGNTAISWVRNLFHDCIVKSCDASLLLETVHGV  86

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE+ + R+FGMRNFKY+ TIKAALE+ECP TVSCADIVALSARDG   L GP  EMK+G
Sbjct  87    VSEQTAERSFGMRNFKYVSTIKAALEKECPLTVSCADIVALSARDGIARLGGPNFEMKSG  146

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             R+DSKE+Y+  VE FIPNHNDS+  VLS FQ+IG+D E TVALLGAHSVGRVHC+N+VHR
Sbjct  147   RKDSKESYVKVVEQFIPNHNDSISSVLSSFQAIGIDVEATVALLGAHSVGRVHCMNLVHR  206

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYPTVDPTLDPT+A YLK RCP+  PDP+AV+  Y RND +TPMI+DN YYKNIL+HKGL
Sbjct  207   LYPTVDPTLDPTHAAYLKRRCPTPNPDPKAVQ--YVRNDLKTPMIIDNNYYKNILQHKGL  264

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             L VDE LAT P T+P+V+KMAADN YF++QF+RA+ ++SENNPL GDQGEIRK+CRYVN
Sbjct  265   LTVDEELATDPRTSPYVKKMAADNGYFNEQFSRAVQLLSENNPLIGDQGEIRKDCRYVN  323



>ref|XP_003537275.1| PREDICTED: peroxidase 21 [Glycine max]
Length=327

 Score =   467 bits (1201),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 214/307 (70%), Positives = 260/307 (85%), Gaps = 2/307 (1%)
 Frame = +2

Query  311   HIRCAKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASI  490
             H    +  +++ YYS+SCP+AE+IIKEQV +LY +HGNTAVSW+RNLFHDC+VK+CDAS+
Sbjct  21    HFHLGESQVELNYYSKSCPKAEEIIKEQVTQLYNKHGNTAVSWVRNLFHDCVVKSCDASL  80

Query  491   LLDSVAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKG  670
             LL +V+ V SE+ S R+FGMRNFKY+ TIKAA+E+ECP TVSCADIVALSARDG  +L G
Sbjct  81    LLATVSDVVSEQASDRSFGMRNFKYVNTIKAAVEKECPLTVSCADIVALSARDGIALLGG  140

Query  671   PRAEMKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRV  850
             P  EMKTGR+DSKE+Y  EVE  IPNHNDSM  VLSRFQ+IG+D E TVALLGAHSVGRV
Sbjct  141   PSIEMKTGRKDSKESYATEVEALIPNHNDSMSSVLSRFQAIGIDVEATVALLGAHSVGRV  200

Query  851   HCINIVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYK  1030
             HC N+VHRLYPTVD TL+P +A+YLK RCP+  PDP+AV   YSRND +TPMI+DN YYK
Sbjct  201   HCKNLVHRLYPTVDSTLNPAHAEYLKRRCPTPNPDPKAV--LYSRNDLKTPMIIDNNYYK  258

Query  1031  NILEHKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIR  1210
             NIL+HKGLL+VDE LAT P TAP+V+KMA DN YF+ QF+RA++++SE NPLTGD+GEIR
Sbjct  259   NILQHKGLLIVDEELATDPITAPYVQKMANDNDYFNQQFSRAILLLSETNPLTGDEGEIR  318

Query  1211  KNCRYVN  1231
             K+CRY+N
Sbjct  319   KDCRYLN  325



>ref|XP_006850686.1| hypothetical protein AMTR_s00034p00235030 [Amborella trichopoda]
 gb|ERN12267.1| hypothetical protein AMTR_s00034p00235030 [Amborella trichopoda]
Length=321

 Score =   466 bits (1198),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 219/308 (71%), Positives = 259/308 (84%), Gaps = 4/308 (1%)
 Frame = +2

Query  314   IRCAKGD--LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDAS  487
             +R A G+  L + YY ESCPRAE+I+KE+V +LY +HGNTAVSWLRNLFHDCMVK+CDAS
Sbjct  13    MRGASGEEGLVLNYYKESCPRAEEIVKEKVQELYNKHGNTAVSWLRNLFHDCMVKSCDAS  72

Query  488   ILLDSVAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLK  667
             +LLDSV  V SE+ S R+FGMRNFKY+ TIK ALE+ECP TVSCADIVALSAR+GA+ML 
Sbjct  73    LLLDSVGSVSSEKGSARSFGMRNFKYVNTIKDALEKECPKTVSCADIVALSAREGALMLG  132

Query  668   GPRAEMKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGR  847
             GP   MKTGRRDS+E+ +  VE  IPNHNDS+  VLSRFQSIG++TEGTVALLGAHSVGR
Sbjct  133   GPNVPMKTGRRDSRESEVDVVEQHIPNHNDSIPFVLSRFQSIGINTEGTVALLGAHSVGR  192

Query  848   VHCINIVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYY  1027
             VHC N+V RLYP +DP+LDP YA YLK RCPS  PDPR+V   Y+RNDR TPMILDN YY
Sbjct  193   VHCKNLVGRLYPEIDPSLDPNYAIYLKGRCPSPNPDPRSV--AYARNDRVTPMILDNEYY  250

Query  1028  KNILEHKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEI  1207
             KN+L HKGLL+VD+ L +HP TAPFVEKMA+DN+YFH +F+ AL+++SENNPLTGDQGE+
Sbjct  251   KNVLAHKGLLLVDQQLISHPETAPFVEKMASDNEYFHGRFSTALLVLSENNPLTGDQGEV  310

Query  1208  RKNCRYVN  1231
             R +CR VN
Sbjct  311   RVDCRLVN  318



>ref|XP_004137814.1| PREDICTED: peroxidase 21-like [Cucumis sativus]
 ref|XP_004165144.1| PREDICTED: peroxidase 21-like [Cucumis sativus]
 gb|KGN58950.1| hypothetical protein Csa_3G736970 [Cucumis sativus]
Length=323

 Score =   464 bits (1193),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 210/303 (69%), Positives = 256/303 (84%), Gaps = 2/303 (1%)
 Frame = +2

Query  323   AKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDS  502
              +G LQ+ YY++SCP+AE+IIK+QVI LY EHGNTAVSWLRNLFHDC+VK+CDAS+LL++
Sbjct  22    GRGQLQLNYYAKSCPKAEEIIKQQVIDLYYEHGNTAVSWLRNLFHDCIVKSCDASLLLET  81

Query  503   VAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAE  682
             V GVESE++S R+FGMRNFKY+  IKAA+E+ECP TVSCADIVALSARDG VMLKGP  +
Sbjct  82    VVGVESEKDSSRSFGMRNFKYVNKIKAAVEKECPLTVSCADIVALSARDGIVMLKGPHID  141

Query  683   MKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCIN  862
             +KTGR+DSK +Y   VE  +P HN S+  VLSRF SIG+DTE TVALLG+HSVGRVHC+N
Sbjct  142   LKTGRKDSKMSYSNMVEELVPQHNASLVNVLSRFNSIGIDTEATVALLGSHSVGRVHCVN  201

Query  863   IVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILE  1042
             +V RLYPTVDPT+DP YA YLK+RCP+  PDP  V   YSRNDR T MILDNMYY N+L+
Sbjct  202   LVERLYPTVDPTIDPEYAKYLKMRCPTPTPDPNGV--LYSRNDRETTMILDNMYYSNVLK  259

Query  1043  HKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCR  1222
             HKGLL+VD+ L ++P T P+V+K AADN YFH QF+R + ++SENNPLTGDQGE+RK+CR
Sbjct  260   HKGLLIVDQELVSNPLTLPYVKKFAADNLYFHAQFSRGIRLLSENNPLTGDQGEVRKDCR  319

Query  1223  YVN  1231
             +VN
Sbjct  320   FVN  322



>ref|XP_010046754.1| PREDICTED: peroxidase 21 [Eucalyptus grandis]
Length=333

 Score =   463 bits (1192),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 213/305 (70%), Positives = 258/305 (85%), Gaps = 4/305 (1%)
 Frame = +2

Query  323   AKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDS  502
                +LQ  YY+ESCP AE+IIK++V KLY+EHGNTA+SW+RNLFHDCMV++CDAS+LL+S
Sbjct  29    GSSELQSNYYAESCPNAEEIIKQEVAKLYDEHGNTAISWIRNLFHDCMVQSCDASLLLES  88

Query  503   V--AGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPR  676
                 G+ SE+ S R+FGMRNFKY+  IK ALE+ECP TVSCADI+ALSARDG V+L GPR
Sbjct  89    KHGNGIVSEQASSRSFGMRNFKYVTKIKEALEKECPATVSCADIIALSARDGTVLLGGPR  148

Query  677   AEMKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHC  856
              EM++GRRD +E++ + VE FIPNHNDSM LVLSRF+S+G+D EGTVALLGAHSVGRVHC
Sbjct  149   IEMRSGRRDGRESHASVVEEFIPNHNDSMALVLSRFESVGIDAEGTVALLGAHSVGRVHC  208

Query  857   INIVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNI  1036
             +N+  RLYPTVDPTLD  YA+YLK RCP  +P+P  V   YSRNDR TPM+LDNMYYK++
Sbjct  209   VNLYDRLYPTVDPTLDSDYAEYLKGRCPMPDPNPEKVR--YSRNDRETPMVLDNMYYKHL  266

Query  1037  LEHKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKN  1216
             L HKGLL+VD+ LA+ P TAPFVEKMAADN YF DQFARA++ +SENNPLTGD+GEIRK+
Sbjct  267   LAHKGLLLVDQQLASDPTTAPFVEKMAADNGYFQDQFARAMLALSENNPLTGDEGEIRKD  326

Query  1217  CRYVN  1231
             CRY+N
Sbjct  327   CRYIN  331



>gb|KCW88828.1| hypothetical protein EUGRSUZ_A01166 [Eucalyptus grandis]
Length=352

 Score =   464 bits (1193),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 213/305 (70%), Positives = 258/305 (85%), Gaps = 4/305 (1%)
 Frame = +2

Query  323   AKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDS  502
                +LQ  YY+ESCP AE+IIK++V KLY+EHGNTA+SW+RNLFHDCMV++CDAS+LL+S
Sbjct  48    GSSELQSNYYAESCPNAEEIIKQEVAKLYDEHGNTAISWIRNLFHDCMVQSCDASLLLES  107

Query  503   V--AGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPR  676
                 G+ SE+ S R+FGMRNFKY+  IK ALE+ECP TVSCADI+ALSARDG V+L GPR
Sbjct  108   KHGNGIVSEQASSRSFGMRNFKYVTKIKEALEKECPATVSCADIIALSARDGTVLLGGPR  167

Query  677   AEMKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHC  856
              EM++GRRD +E++ + VE FIPNHNDSM LVLSRF+S+G+D EGTVALLGAHSVGRVHC
Sbjct  168   IEMRSGRRDGRESHASVVEEFIPNHNDSMALVLSRFESVGIDAEGTVALLGAHSVGRVHC  227

Query  857   INIVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNI  1036
             +N+  RLYPTVDPTLD  YA+YLK RCP  +P+P  V   YSRNDR TPM+LDNMYYK++
Sbjct  228   VNLYDRLYPTVDPTLDSDYAEYLKGRCPMPDPNPEKVR--YSRNDRETPMVLDNMYYKHL  285

Query  1037  LEHKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKN  1216
             L HKGLL+VD+ LA+ P TAPFVEKMAADN YF DQFARA++ +SENNPLTGD+GEIRK+
Sbjct  286   LAHKGLLLVDQQLASDPTTAPFVEKMAADNGYFQDQFARAMLALSENNPLTGDEGEIRKD  345

Query  1217  CRYVN  1231
             CRY+N
Sbjct  346   CRYIN  350



>ref|XP_008793497.1| PREDICTED: peroxidase 21 [Phoenix dactylifera]
Length=326

 Score =   462 bits (1190),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 208/303 (69%), Positives = 260/303 (86%), Gaps = 2/303 (1%)
 Frame = +2

Query  323   AKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDS  502
              +GDL + YYSESCPRAEDI+KE+V KLY +HGNTA+SW+RNLFHDCMVK+CDAS+LL++
Sbjct  24    GEGDLSLNYYSESCPRAEDIVKEEVAKLYHKHGNTAISWVRNLFHDCMVKSCDASLLLET  83

Query  503   VAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAE  682
                + SE+ S R+FGMRNFKYI TIK ALE ECP+TVSCAD+VALSAR+G + L GP   
Sbjct  84    TNSIISEQTSQRSFGMRNFKYITTIKDALERECPDTVSCADVVALSAREGVLWLGGPYIP  143

Query  683   MKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCIN  862
             MKTGRRDSKE+++  VE+ IPNHNDS  LVLSRFQS+G+DTEGTVALLGAHSVGRVHC+N
Sbjct  144   MKTGRRDSKESHVEMVEDSIPNHNDSSSLVLSRFQSVGIDTEGTVALLGAHSVGRVHCVN  203

Query  863   IVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILE  1042
             +V RLYPT+DPT+ P Y +YL++RCP+  PDP+ V  +YSRNDR TPM++DNMYYKN+L+
Sbjct  204   LVGRLYPTIDPTIAPEYGEYLRVRCPTPNPDPKKV--SYSRNDRETPMVIDNMYYKNLLK  261

Query  1043  HKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCR  1222
             H+GLL++D+ LA+ P T+ FVE MAA+N YFH++FA AL+++SENNPLT DQGEIRK+CR
Sbjct  262   HRGLLLIDQQLASDPTTSSFVELMAANNSYFHERFAGALLLLSENNPLTIDQGEIRKDCR  321

Query  1223  YVN  1231
             +VN
Sbjct  322   FVN  324



>gb|KHN48312.1| Peroxidase 21 [Glycine soja]
Length=329

 Score =   462 bits (1189),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 212/307 (69%), Positives = 257/307 (84%), Gaps = 2/307 (1%)
 Frame = +2

Query  311   HIRCAKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASI  490
             H       L++ YYS+SCP+AE+IIKEQV +LY +HGNTAVSW+RNLFHDC+VK+CDAS+
Sbjct  23    HFNLGISQLELNYYSKSCPKAEEIIKEQVTQLYNKHGNTAVSWVRNLFHDCVVKSCDASL  82

Query  491   LLDSVAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKG  670
             LL +V  V SE+ S R+FGMRNFKY+ TIKAA+E+ECP TVSCADIVALSARD   +L G
Sbjct  83    LLATVRDVVSEQTSDRSFGMRNFKYVNTIKAAVEKECPFTVSCADIVALSARDAIALLGG  142

Query  671   PRAEMKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRV  850
             P  EMKTGR+DSKE+Y  EVE+ IPNHNDSM  VLSRFQ+IG+D E TVALLGAHSVGRV
Sbjct  143   PSIEMKTGRKDSKESYAMEVEDLIPNHNDSMSSVLSRFQAIGIDVEATVALLGAHSVGRV  202

Query  851   HCINIVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYK  1030
             HC N+VHRLYPT+D TLDP +A+YL+ RCP+  PDP+AV   YSRND +TPMI+DN YYK
Sbjct  203   HCKNLVHRLYPTIDSTLDPAHAEYLRRRCPTPNPDPKAV--LYSRNDLKTPMIIDNNYYK  260

Query  1031  NILEHKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIR  1210
             NIL+HKGLL VDE LAT P TA +V+KMA DN+YF+ QF+RA++++SE NPLTGD+GEIR
Sbjct  261   NILQHKGLLTVDEELATDPRTASYVQKMANDNEYFNQQFSRAIILLSETNPLTGDEGEIR  320

Query  1211  KNCRYVN  1231
             K+CRY+N
Sbjct  321   KDCRYLN  327



>ref|XP_003542507.1| PREDICTED: peroxidase 21 [Glycine max]
Length=329

 Score =   462 bits (1189),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 211/299 (71%), Positives = 257/299 (86%), Gaps = 2/299 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L++ YYS+SCP+AE+IIKEQV +LY +HGNTAVSW+RNLFHDC+VK+CDAS+LL +V+ V
Sbjct  31    LELNYYSKSCPKAEEIIKEQVTQLYNKHGNTAVSWVRNLFHDCVVKSCDASLLLATVSDV  90

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE+ S R+FGMRNFKY+ TIKAA+E+ECP TVSCADIVALSARD   +L GP  EMKTG
Sbjct  91    VSEQTSDRSFGMRNFKYVNTIKAAVEKECPFTVSCADIVALSARDAIALLGGPSIEMKTG  150

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             R+DSKE+Y  EVE+ IPNHNDSM  VLSRFQ+IG+D E TVALLGAHSVGRVHC N+VHR
Sbjct  151   RKDSKESYAMEVEDLIPNHNDSMSSVLSRFQAIGIDVEATVALLGAHSVGRVHCKNLVHR  210

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYPT+D TLDP +A+YL+ RCP+  PDP+AV   YSRND +TPMI+DN YYKNIL+HKGL
Sbjct  211   LYPTIDSTLDPAHAEYLRRRCPTPNPDPKAV--LYSRNDLKTPMIIDNNYYKNILQHKGL  268

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             L VDE LAT P TA +V+KMA DN+YF+ QF+RA++++SE NPLTGD+GEIRK+CRY+N
Sbjct  269   LTVDEELATDPRTASYVQKMANDNEYFNQQFSRAIILLSETNPLTGDEGEIRKDCRYLN  327



>ref|XP_010920894.1| PREDICTED: peroxidase 21 isoform X2 [Elaeis guineensis]
Length=310

 Score =   458 bits (1179),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 209/302 (69%), Positives = 257/302 (85%), Gaps = 2/302 (1%)
 Frame = +2

Query  326   KGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSV  505
             +GDL + YYSESCPRAEDI+KE+V KLY +HGNTAVSW+RNLFHDCMVK+CDAS+LL + 
Sbjct  9     EGDLSLNYYSESCPRAEDIVKEEVAKLYHKHGNTAVSWVRNLFHDCMVKSCDASLLLKTT  68

Query  506   AGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEM  685
               + SE+ S R+FGMRNFKYI TIK ALE ECP TVSCADIVALSAR+G + L GP   M
Sbjct  69    NSIISEQTSQRSFGMRNFKYITTIKDALERECPKTVSCADIVALSAREGVLWLGGPYIPM  128

Query  686   KTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINI  865
             KTGRRDSKE+++  VEN IPNHN+S+ LVLSRFQS+G+DTEGTVALLGAHSVGRVHC+N+
Sbjct  129   KTGRRDSKESHVDMVENSIPNHNESISLVLSRFQSVGIDTEGTVALLGAHSVGRVHCVNL  188

Query  866   VHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEH  1045
             V RLYPT+DPT+DP   +YL+ RCP+  PDP  V  +YSRNDR TPM++DNMYY+N+L++
Sbjct  189   VGRLYPTIDPTIDPACGEYLRGRCPTPNPDPNEV--SYSRNDRETPMVIDNMYYQNLLKN  246

Query  1046  KGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRY  1225
             +GLL+VD+ L + P T+PFVE MAA+N YFH++FA AL+++SENNPLT DQGEIRK+CR+
Sbjct  247   RGLLLVDQQLTSDPTTSPFVELMAANNSYFHERFASALLLLSENNPLTIDQGEIRKDCRF  306

Query  1226  VN  1231
             VN
Sbjct  307   VN  308



>ref|XP_010920892.1| PREDICTED: peroxidase 21 isoform X1 [Elaeis guineensis]
Length=326

 Score =   458 bits (1178),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 209/302 (69%), Positives = 257/302 (85%), Gaps = 2/302 (1%)
 Frame = +2

Query  326   KGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSV  505
             +GDL + YYSESCPRAEDI+KE+V KLY +HGNTAVSW+RNLFHDCMVK+CDAS+LL + 
Sbjct  25    EGDLSLNYYSESCPRAEDIVKEEVAKLYHKHGNTAVSWVRNLFHDCMVKSCDASLLLKTT  84

Query  506   AGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEM  685
               + SE+ S R+FGMRNFKYI TIK ALE ECP TVSCADIVALSAR+G + L GP   M
Sbjct  85    NSIISEQTSQRSFGMRNFKYITTIKDALERECPKTVSCADIVALSAREGVLWLGGPYIPM  144

Query  686   KTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINI  865
             KTGRRDSKE+++  VEN IPNHN+S+ LVLSRFQS+G+DTEGTVALLGAHSVGRVHC+N+
Sbjct  145   KTGRRDSKESHVDMVENSIPNHNESISLVLSRFQSVGIDTEGTVALLGAHSVGRVHCVNL  204

Query  866   VHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEH  1045
             V RLYPT+DPT+DP   +YL+ RCP+  PDP  V  +YSRNDR TPM++DNMYY+N+L++
Sbjct  205   VGRLYPTIDPTIDPACGEYLRGRCPTPNPDPNEV--SYSRNDRETPMVIDNMYYQNLLKN  262

Query  1046  KGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRY  1225
             +GLL+VD+ L + P T+PFVE MAA+N YFH++FA AL+++SENNPLT DQGEIRK+CR+
Sbjct  263   RGLLLVDQQLTSDPTTSPFVELMAANNSYFHERFASALLLLSENNPLTIDQGEIRKDCRF  322

Query  1226  VN  1231
             VN
Sbjct  323   VN  324



>ref|XP_007207867.1| hypothetical protein PRUPE_ppa022386mg, partial [Prunus persica]
 gb|EMJ09066.1| hypothetical protein PRUPE_ppa022386mg, partial [Prunus persica]
Length=307

 Score =   454 bits (1168),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 208/287 (72%), Positives = 248/287 (86%), Gaps = 2/287 (1%)
 Frame = +2

Query  311   HIRCAKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASI  490
               +  K +LQ+ YYSESCP+AE+IIK++V KLY EHGNTAVSWLRNLFHDC V+ CDAS+
Sbjct  23    QFQFGKSELQLNYYSESCPKAEEIIKQEVTKLYYEHGNTAVSWLRNLFHDCFVQGCDASL  82

Query  491   LLDSVAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKG  670
             LL+SV G+ESE+ES R+FGMRNFKY+ TIK ALE ECP+TVSCAD+VALSARDG VML G
Sbjct  83    LLESVNGIESEKESGRSFGMRNFKYVNTIKKALENECPSTVSCADVVALSARDGIVMLGG  142

Query  671   PRAEMKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRV  850
             P  EMKTGRRDSKE+Y   VE FIPNHNDS+  VLSRFQS+G+D EGTVALLGAHSVGRV
Sbjct  143   PHIEMKTGRRDSKESYAKIVEEFIPNHNDSLSSVLSRFQSVGIDVEGTVALLGAHSVGRV  202

Query  851   HCINIVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYK  1030
             HC+N+VHRLYPTVDPTLDP YA+YLK RCP+  PDP+AV+  YSRNDR TPMILDN YYK
Sbjct  203   HCVNLVHRLYPTVDPTLDPDYAEYLKGRCPTPIPDPKAVQ--YSRNDRETPMILDNNYYK  260

Query  1031  NILEHKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMS  1171
             N+L++KGLL+VD+ LA+ PAT PFV+KMA+DN YF++QF+RA +++S
Sbjct  261   NLLKNKGLLIVDQELASDPATLPFVQKMASDNDYFNEQFSRAALLLS  307



>gb|KEH42266.1| cationic peroxidase [Medicago truncatula]
Length=324

 Score =   449 bits (1156),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 212/303 (70%), Positives = 251/303 (83%), Gaps = 3/303 (1%)
 Frame = +2

Query  323   AKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDS  502
              K  LQ+ YYS SCPRAE+IIK+QV +LY + G+TA+SWLRNLFHDCMV +CDAS LL +
Sbjct  23    GKSQLQLNYYSTSCPRAEEIIKQQVTELYNQ-GSTAISWLRNLFHDCMVNSCDASFLLAT  81

Query  503   VAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAE  682
               GV SE+ S R+FGMRNFKY+ TIKAA+E+ECP TVSCADIVALSARDG  ML  P  E
Sbjct  82    WRGVVSEQTSVRSFGMRNFKYVNTIKAAVEKECPLTVSCADIVALSARDGIAMLGIPNIE  141

Query  683   MKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCIN  862
             MK+GRRDSKE+Y+  VE  IP+HN SM LVL+RFQ+IGVD E TVALLGAHSVGRVHCIN
Sbjct  142   MKSGRRDSKESYVTVVEESIPSHNASMSLVLTRFQAIGVDVEATVALLGAHSVGRVHCIN  201

Query  863   IVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILE  1042
             +VHRLYP VDPTLDPTY  YLK RCP  +P+P+A    Y RND +TP+I+DN YYKNIL+
Sbjct  202   MVHRLYPIVDPTLDPTYVVYLKRRCP--KPNPKAKAVQYVRNDLKTPLIIDNNYYKNILQ  259

Query  1043  HKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCR  1222
             HKGLL VDE LAT P T+P+V+KMA DN YF+DQF+RA++++SENNPL GDQGEIRK+CR
Sbjct  260   HKGLLTVDEELATDPITSPYVQKMADDNGYFNDQFSRAVLLLSENNPLIGDQGEIRKDCR  319

Query  1223  YVN  1231
             +VN
Sbjct  320   FVN  322



>ref|XP_009392193.1| PREDICTED: peroxidase 21 [Musa acuminata subsp. malaccensis]
Length=326

 Score =   448 bits (1153),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 206/306 (67%), Positives = 257/306 (84%), Gaps = 2/306 (1%)
 Frame = +2

Query  314   IRCAKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASIL  493
             +R   G L++ YYS+SCPRAE+I+K +V+KLY EHGNTAVSW+RNLFHDCMV++CDAS+L
Sbjct  21    LRGEGGGLKLNYYSKSCPRAEEIVKREVVKLYNEHGNTAVSWVRNLFHDCMVESCDASLL  80

Query  494   LDSVAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGP  673
             L++   + SE+ + R+FGMRNFKY+  IK ALE+ECP TVSCADI+ALSAR+G VML GP
Sbjct  81    LETTDSLISEQSADRSFGMRNFKYVAPIKEALEKECPATVSCADIIALSAREGVVMLGGP  140

Query  674   RAEMKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVH  853
                M+TGRRDSKE++   ++  IPNHNDS+ LVLSRF+SIG+D E TVALLGAHSVGRVH
Sbjct  141   FIPMRTGRRDSKESHADVIDKDIPNHNDSISLVLSRFRSIGIDAERTVALLGAHSVGRVH  200

Query  854   CINIVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKN  1033
             C+N+V RLYPTVDPT+DP YA YL  RCPS  PDP AV   YSRNDR TPMI+DN+YYKN
Sbjct  201   CVNLVGRLYPTVDPTIDPEYAKYLLGRCPSPNPDPEAV--LYSRNDRETPMIIDNVYYKN  258

Query  1034  ILEHKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRK  1213
             +L HKGLL VD+ L ++P+TA FV+ MAADN YF+DQF++AL+++SENNPLTG++GE+RK
Sbjct  259   LLHHKGLLKVDQQLVSYPSTAQFVKLMAADNSYFYDQFSKALLLLSENNPLTGNKGEVRK  318

Query  1214  NCRYVN  1231
             +CRYVN
Sbjct  319   DCRYVN  324



>ref|XP_004143352.1| PREDICTED: peroxidase 21-like [Cucumis sativus]
 gb|KGN48136.1| hypothetical protein Csa_6G445010 [Cucumis sativus]
Length=328

 Score =   430 bits (1106),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 196/303 (65%), Positives = 250/303 (83%), Gaps = 5/303 (2%)
 Frame = +2

Query  332   DLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLD---S  502
             +L + YY++SCP+AE+IIK+QV  LY++HGN+A+SW+RNLFHDCMVK+CDAS+LL+    
Sbjct  27    ELVVNYYNQSCPQAEEIIKQQVFSLYQKHGNSAISWIRNLFHDCMVKSCDASLLLEMKNE  86

Query  503   VAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAE  682
                V SE +SPR+FG+RN KY+  IK  LE ECPNTVSCADI+AL+ARD  V+L G   E
Sbjct  87    EGVVISEMKSPRSFGIRNLKYVNKIKQVLENECPNTVSCADIMALAARDAIVLLGGLEME  146

Query  683   MKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCIN  862
             MKTGRRDSKE+Y   VE FIPNHNDS+ LVLSRFQ IG+D E TVALLGAHS+GRVHC+N
Sbjct  147   MKTGRRDSKESYGEMVEEFIPNHNDSLSLVLSRFQDIGIDAEATVALLGAHSIGRVHCVN  206

Query  863   IVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILE  1042
             +V+RLYPTVDPTLDP +A YL+ RCP+ +PDP+AV+  Y+RND  +PM++DN YY+N+L+
Sbjct  207   LVNRLYPTVDPTLDPNHALYLQKRCPNPDPDPKAVQ--YARNDLESPMVVDNNYYRNVLD  264

Query  1043  HKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCR  1222
             HK LL+VD+ L + P T P+V++MA++N YF  QFARAL+++SENNPLT DQGEIRK+CR
Sbjct  265   HKALLLVDQQLGSSPITLPYVQQMASNNTYFLAQFARALLLLSENNPLTDDQGEIRKDCR  324

Query  1223  YVN  1231
              VN
Sbjct  325   RVN  327



>ref|XP_002439661.1| hypothetical protein SORBIDRAFT_09g018150 [Sorghum bicolor]
 gb|EES18091.1| hypothetical protein SORBIDRAFT_09g018150 [Sorghum bicolor]
Length=341

 Score =   428 bits (1100),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 204/307 (66%), Positives = 246/307 (80%), Gaps = 9/307 (3%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVA--  508
             L++GYYS SCPRAEDI+KEQV +LY +HGNTAVSWLR LFHDC V++CDAS+LLD  A  
Sbjct  34    LRLGYYSGSCPRAEDIVKEQVTQLYHKHGNTAVSWLRALFHDCFVRSCDASLLLDPTAAT  93

Query  509   GVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRA-EM  685
             G  SE+ SPR+FGMRNFKY+  IKAA+E ECP TVSCAD++AL+ARDGA +L GPRA  M
Sbjct  94    GGASEKASPRSFGMRNFKYVDVIKAAVERECPGTVSCADVLALAARDGAAILGGPRAVRM  153

Query  686   KTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINI  865
             +TGRRDS E++ AEVE  IPNHNDS+  VL+RF ++GVD EG VALLGAHSVGRVHC N+
Sbjct  154   RTGRRDSLESHYAEVERDIPNHNDSVSAVLARFAAVGVDAEGAVALLGAHSVGRVHCSNL  213

Query  866   VHRLYPTVDPTLDPTYADYLKLRCPSA----EPDPRAVEPTYSRNDRRTPMILDNMYYKN  1033
             V RLYPTVD  +DP Y +YL+ RCP+A    E D R V   Y+RNDR TPM+LDNMYYKN
Sbjct  214   VARLYPTVDAGVDPGYGEYLRGRCPTADAGEEEDTRDV--AYARNDRATPMVLDNMYYKN  271

Query  1034  ILEHKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRK  1213
             +L  +GLL+VD+ LA  P TAPFV +MAADN YFHD+FA AL+ MSE NPL   +GEIR+
Sbjct  272   LLARRGLLLVDQRLADDPRTAPFVARMAADNAYFHDRFAAALLTMSEYNPLGDGEGEIRR  331

Query  1214  NCRYVNT  1234
             +CR+VN+
Sbjct  332   HCRFVNS  338



>ref|XP_004156341.1| PREDICTED: peroxidase 21-like [Cucumis sativus]
Length=328

 Score =   426 bits (1096),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 194/303 (64%), Positives = 250/303 (83%), Gaps = 5/303 (2%)
 Frame = +2

Query  332   DLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLD---S  502
             +L + YY++SCP+AE+IIK+QV  LYE+HGN+A+SW+RNLFHDCMVK+CDAS+LL+    
Sbjct  27    ELVVNYYNQSCPQAEEIIKQQVFSLYEKHGNSAISWIRNLFHDCMVKSCDASLLLEMKNE  86

Query  503   VAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAE  682
                V SE +SPR+FG+RN KY+  IK  +E ECPNTVSCADI+AL+ARD  V+L G   E
Sbjct  87    EGVVISEMKSPRSFGIRNLKYVNKIKQVIENECPNTVSCADIMALAARDAIVLLGGLEME  146

Query  683   MKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCIN  862
             MKTGRRDSKE+Y   VE FIPNHNDS+ LVLSRFQ IG+D E TVALLGAHS+GRVHC+N
Sbjct  147   MKTGRRDSKESYGEMVEEFIPNHNDSLSLVLSRFQDIGIDAEATVALLGAHSIGRVHCVN  206

Query  863   IVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILE  1042
             +V+RLYPTVDPTLDP +A YL+ RCP+ +PDP+AV+  Y+RND  +PM++DN YY+N+L+
Sbjct  207   LVNRLYPTVDPTLDPNHALYLQKRCPNPDPDPKAVQ--YARNDLESPMVVDNNYYRNVLD  264

Query  1043  HKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCR  1222
             +K LL+VD+ L + P T P+V++MA++N YF  QFARAL+++S+NNPLT DQGEIRK+CR
Sbjct  265   NKALLLVDQQLGSSPITLPYVQQMASNNTYFLAQFARALLLLSDNNPLTDDQGEIRKDCR  324

Query  1223  YVN  1231
              VN
Sbjct  325   RVN  327



>ref|XP_006658177.1| PREDICTED: peroxidase 21-like [Oryza brachyantha]
Length=312

 Score =   425 bits (1093),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 194/307 (63%), Positives = 244/307 (79%), Gaps = 2/307 (1%)
 Frame = +2

Query  323   AKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDS  502
              +G L++ +YSESCPRAE++++EQV +LYEEHGNTAVSW+R LFHDCMVK+CDAS+LL++
Sbjct  6     GEGQLRLNFYSESCPRAEEVVREQVQRLYEEHGNTAVSWVRALFHDCMVKSCDASLLLET  65

Query  503   V-AGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPR-  676
                G  SE+ S R+FGMRNFKYI  IKAA+E ECP TVSCADI+AL+ARDG  ML GP  
Sbjct  66    TPTGAISEQASHRSFGMRNFKYITAIKAAVERECPGTVSCADILALAARDGVAMLGGPAP  125

Query  677   AEMKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHC  856
               M+TGRRDS+E+Y   VE +IPNHNDS+  VL+RF  +GVDTEG VALLGAHSVGRVHC
Sbjct  126   VGMRTGRRDSRESYYGVVERYIPNHNDSVSTVLARFAGMGVDTEGAVALLGAHSVGRVHC  185

Query  857   INIVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNI  1036
              N+V RLYP VD +++  Y +YL+ RCP+AE      E  Y+RNDR TPM+LDNMYY+N+
Sbjct  186   FNLVGRLYPEVDGSMEAAYGEYLRGRCPTAEAAEDTGEVVYARNDRATPMLLDNMYYRNL  245

Query  1037  LEHKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKN  1216
             L  +GLL+VD+ LA+ P T+P+V +MAADN YFH +FA  L+ MSEN PLTG QGE+RK+
Sbjct  246   LAGRGLLLVDQQLASDPRTSPYVRRMAADNAYFHQRFAATLLTMSENAPLTGAQGEVRKD  305

Query  1217  CRYVNTK  1237
             CR+VN+ 
Sbjct  306   CRFVNSS  312



>gb|ACT35471.1| peroxidase 21, partial [Brassica rapa]
Length=266

 Score =   421 bits (1083),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 194/268 (72%), Positives = 232/268 (87%), Gaps = 3/268 (1%)
 Frame = +2

Query  437   WLRNLFHDCMVKACDASILLDSVAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVS  616
             WLRNLFHDC+VK+CDAS+LL++  GVESE++S R+FGMRNFKY++ IK ALE+ECP+TVS
Sbjct  1     WLRNLFHDCVVKSCDASLLLETARGVESEQKSTRSFGMRNFKYVKVIKDALEKECPSTVS  60

Query  617   CADIVALSARDGAVMLKGPRAEM-KTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSI  793
             CADIVALSARDG VMLKGP+ +M KTGRRDS+ +YL++VE  +PNHNDS+  VLS F S+
Sbjct  61    CADIVALSARDGIVMLKGPKIDMIKTGRRDSRGSYLSDVETLVPNHNDSLSSVLSNFNSM  120

Query  794   GVDTEGTVALLGAHSVGRVHCINIVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEP  973
             G+D E TVALLGAHSVGRVHC+N+VHRLYPT+DPTLDP YA YLK RCPS  PDP AV  
Sbjct  121   GIDVEATVALLGAHSVGRVHCVNLVHRLYPTIDPTLDPDYALYLKNRCPSPNPDPNAV--  178

Query  974   TYSRNDRRTPMILDNMYYKNILEHKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFAR  1153
              YSRNDR TPM++DNMYYKNI+ HKGLLV+D+ LA+ P TAPFV KMAADN YFH+QF+R
Sbjct  179   LYSRNDRETPMVVDNMYYKNIMAHKGLLVIDDELASDPRTAPFVAKMAADNGYFHEQFSR  238

Query  1154  ALVIMSENNPLTGDQGEIRKNCRYVNTK  1237
              + ++SE NPLTGDQGEIRK+CRYVN+K
Sbjct  239   GVRLLSETNPLTGDQGEIRKDCRYVNSK  266



>ref|XP_008449266.1| PREDICTED: peroxidase 21-like [Cucumis melo]
Length=326

 Score =   421 bits (1082),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 193/303 (64%), Positives = 249/303 (82%), Gaps = 7/303 (2%)
 Frame = +2

Query  332   DLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLD---S  502
             +L + YY++SCP+AE+IIK+QV  LY++HGN+A+SW+RNLFHDCMVK+CDAS+LL+    
Sbjct  27    ELVVNYYNQSCPQAEEIIKQQVFSLYQKHGNSAISWIRNLFHDCMVKSCDASLLLEMKNE  86

Query  503   VAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAE  682
                V SE +SPR+FG+RN KY+  IK  LE ECPNTVSCADI+AL+ARD  V++   + E
Sbjct  87    EGVVISEMKSPRSFGIRNLKYVNKIKQVLENECPNTVSCADIMALAARDAIVLVI--KME  144

Query  683   MKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCIN  862
             MKTGRRDSKE+Y   VE FIPNHNDS+ LVLSRFQ IG+D E TVALLGAHS+GRVHC+N
Sbjct  145   MKTGRRDSKESYGEMVEEFIPNHNDSLSLVLSRFQDIGIDAEATVALLGAHSMGRVHCVN  204

Query  863   IVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILE  1042
             +V+RLYPTVDPTLDP +A YLK RCP+  PDP+AV+  Y+RND  +P+++DN YY+N+L+
Sbjct  205   LVNRLYPTVDPTLDPNHALYLKKRCPNPNPDPKAVQ--YARNDLESPLVVDNNYYRNVLD  262

Query  1043  HKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCR  1222
             HK LL+VD+ L + P T P+V++MA++N YF  QFARAL+++SENNPLT DQGEIRK+CR
Sbjct  263   HKALLLVDQQLGSSPITLPYVQQMASNNTYFLAQFARALLLLSENNPLTDDQGEIRKDCR  322

Query  1223  YVN  1231
              +N
Sbjct  323   RIN  325



>gb|EMT14452.1| Peroxidase 21 [Aegilops tauschii]
Length=341

 Score =   421 bits (1083),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 196/304 (64%), Positives = 241/304 (79%), Gaps = 3/304 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILL--DSVA  508
             L++ YYSESCPRAE+I+KEQV +LYEEHGNTAVSWLR LFHDC VK+CDAS+LL  D+  
Sbjct  38    LRLNYYSESCPRAEEIVKEQVRRLYEEHGNTAVSWLRALFHDCTVKSCDASLLLETDAAT  97

Query  509   GVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRA-EM  685
             G+ SE+ SPR+FGMRNFKY+  IK+ALE ECP TVSCADI+AL+ARDGA ML GP A  M
Sbjct  98    GLVSEQASPRSFGMRNFKYVGAIKSALERECPGTVSCADILALAARDGAAMLGGPAAIPM  157

Query  686   KTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINI  865
             +TGRRD+ E+   EVE ++PNHND++  VLSRF ++G   E  VALLGAHSVGRVHC N+
Sbjct  158   RTGRRDATESQYGEVERYVPNHNDTVSAVLSRFAAVGRGAEAVVALLGAHSVGRVHCSNL  217

Query  866   VHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEH  1045
             V RLYP VD  ++P Y  YL+ RCP+A+      +  Y+RNDR TPM+LDNMY+KN+L+ 
Sbjct  218   VARLYPAVDAGMEPAYGAYLRGRCPTADAREDTRDVAYARNDRATPMVLDNMYHKNLLKG  277

Query  1046  KGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRY  1225
             +GLL+VD+ LA+ P TAPFV +MAADN YF + FA ALV MSEN PLTG QGE+RK+CR+
Sbjct  278   RGLLLVDQRLASDPRTAPFVRRMAADNGYFGETFAAALVRMSENGPLTGGQGEVRKDCRF  337

Query  1226  VNTK  1237
             VN K
Sbjct  338   VNAK  341



>dbj|BAJ87808.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=337

 Score =   421 bits (1082),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 200/310 (65%), Positives = 242/310 (78%), Gaps = 7/310 (2%)
 Frame = +2

Query  323   AKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILL--  496
             A G L++ YYSESCPRAE I+KEQV  LYEEHGNTAVSWLR LFHDC VK+CDAS+LL  
Sbjct  30    ASGGLRLNYYSESCPRAEQIVKEQVRSLYEEHGNTAVSWLRALFHDCTVKSCDASLLLET  89

Query  497   DSVAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPR  676
             D+  G+ SE+ SPR+FGMRNFKY+  IKAALE ECP TVSCAD++AL+ARDGA ML GP 
Sbjct  90    DAATGLVSEQASPRSFGMRNFKYVGAIKAALERECPGTVSCADLLALAARDGAAMLGGPA  149

Query  677   -AEMKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVH  853
                M+TGRRD+ E++  EVE +IPNHN ++  VLSRF S+G+  E  VALLGAHSVGRVH
Sbjct  150   PIAMRTGRRDATESHYGEVERYIPNHNGTVSAVLSRFGSMGLGAEAVVALLGAHSVGRVH  209

Query  854   CINIVHRLYPTVDPTLDPTYADYLKLRCPSAEP--DPRAVEPTYSRNDRRTPMILDNMYY  1027
             C N+V RLYP VD  ++P Y  YL+ RCP+A+   D R VE  Y+RNDR TPM+LDNMY+
Sbjct  210   CSNLVGRLYPAVDGGIEPAYGAYLRGRCPTADAREDTRDVE--YARNDRATPMVLDNMYH  267

Query  1028  KNILEHKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEI  1207
             +N+L+ +GLL+VD+ LA+ P TAPFV KMA DN YF + FA ALV MSEN PLTG QGE+
Sbjct  268   RNLLKGRGLLLVDQRLASDPRTAPFVRKMAGDNGYFREAFAAALVRMSENGPLTGGQGEV  327

Query  1208  RKNCRYVNTK  1237
             R +CR+VN K
Sbjct  328   RTDCRFVNAK  337



>dbj|BAJ86378.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=337

 Score =   421 bits (1082),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 200/310 (65%), Positives = 242/310 (78%), Gaps = 7/310 (2%)
 Frame = +2

Query  323   AKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILL--  496
             A G L++ YYSESCPRAE I+KEQV  LYEEHGNTAVSWLR LFHDC VK+CDAS+LL  
Sbjct  30    ASGGLRLNYYSESCPRAEQIVKEQVRSLYEEHGNTAVSWLRALFHDCTVKSCDASLLLET  89

Query  497   DSVAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPR  676
             D+  G+ SE+ SPR+FGMRNFKY+  IKAALE ECP TVSCAD++AL+ARDGA ML GP 
Sbjct  90    DAATGLVSEQASPRSFGMRNFKYVGAIKAALERECPGTVSCADLLALAARDGAAMLGGPA  149

Query  677   -AEMKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVH  853
                M+TGRRD+ E++  EVE +IPNHN ++  VLSRF S+G+  E  VALLGAHSVGRVH
Sbjct  150   PIAMRTGRRDATESHYGEVERYIPNHNGTVSAVLSRFGSMGLGAEAVVALLGAHSVGRVH  209

Query  854   CINIVHRLYPTVDPTLDPTYADYLKLRCPSAEP--DPRAVEPTYSRNDRRTPMILDNMYY  1027
             C N+V RLYP VD  ++P Y  YL+ RCP+A+   D R VE  Y+RNDR TPM+LDNMY+
Sbjct  210   CSNLVGRLYPAVDGGIEPAYGAYLRGRCPTADAREDTRDVE--YARNDRATPMVLDNMYH  267

Query  1028  KNILEHKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEI  1207
             +N+L+ +GLL+VD+ LA+ P TAPFV KMA DN YF + FA ALV MSEN PLTG QGE+
Sbjct  268   RNLLKGRGLLLVDQRLASDPRTAPFVRKMAGDNGYFREAFAAALVRMSENGPLTGGQGEV  327

Query  1208  RKNCRYVNTK  1237
             R +CR+VN K
Sbjct  328   RTDCRFVNAK  337



>dbj|BAC84057.1| putative peroxidase [Oryza sativa Japonica Group]
 tpe|CAH69358.1| TPA: class III peroxidase 116 precursor [Oryza sativa Japonica 
Group]
Length=330

 Score =   402 bits (1034),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 194/305 (64%), Positives = 241/305 (79%), Gaps = 5/305 (2%)
 Frame = +2

Query  335   LQMGYYSES--CPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILL--DS  502
             L++ +YSES  CPRAE++++E+V +LYEEHGNTAVSWLR LFHDCMV +CDAS+LL   +
Sbjct  27    LKLNFYSESERCPRAEEVVREEVRRLYEEHGNTAVSWLRALFHDCMVYSCDASLLLHTTT  86

Query  503   VAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAE  682
               GV SE+ S R+FGMRNFKYI  IKAA+E ECP TVSCADI+AL+ARDG  ML GP   
Sbjct  87    TTGV-SEQSSHRSFGMRNFKYITAIKAAVERECPATVSCADILALAARDGVAMLGGPSVA  145

Query  683   MKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCIN  862
             M+TGRRDS+E+Y   VE +IPNHNDS+  VLSRF +IGVDTEG VALLGAHSVGRVHC N
Sbjct  146   MRTGRRDSRESYYGVVEQYIPNHNDSVSTVLSRFAAIGVDTEGAVALLGAHSVGRVHCFN  205

Query  863   IVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILE  1042
             +V RLYP VD +++  Y +YL+ RCP+A       E  Y+RNDR TPM++DNMYY+N+L 
Sbjct  206   LVGRLYPQVDGSMEAAYGEYLRGRCPTAAATEDTREVVYARNDRVTPMLIDNMYYRNLLA  265

Query  1043  HKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCR  1222
              +GLL+VD+ LA+   TAP+V +MAADN YFH +FA AL+ MSEN PLTG QGE+RK+CR
Sbjct  266   GRGLLLVDQQLASDARTAPYVRRMAADNDYFHQRFAAALLTMSENAPLTGAQGEVRKDCR  325

Query  1223  YVNTK  1237
             +VN+ 
Sbjct  326   FVNSS  330



>gb|AHN05533.1| peroxidase [Pinus thunbergii]
Length=326

 Score =   401 bits (1030),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 184/299 (62%), Positives = 230/299 (77%), Gaps = 2/299 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             LQ  YY+ SCPRAE+I+KEQV  LY+EHGNTAVSW+R +FHDC+V++CDASILLDS   V
Sbjct  28    LQENYYATSCPRAEEIVKEQVYNLYQEHGNTAVSWIRLIFHDCIVQSCDASILLDSSGDV  87

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
             ++E++S RNFGMRNFKY+ TIK A+E ECP  VSCADI+ L+A++ A ML GPR  +KTG
Sbjct  88    QTEKQSDRNFGMRNFKYVDTIKEAIEVECPGVVSCADIIVLAAKEAAAMLGGPRIAVKTG  147

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRDS+++  A V+ +IP HN S+  +LS F S+G+D EG VALLG HSVGR HC+N+V R
Sbjct  148   RRDSRKSSAAVVDKYIPLHNGSISSLLSAFASVGIDAEGAVALLGGHSVGRTHCVNLVER  207

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP VDP  DP YA YLK RCP+  PDP  V   Y+RNDR TPM LDN Y+KN+++ KGL
Sbjct  208   LYPEVDPNFDPDYAVYLKGRCPTPNPDPNEV--LYARNDRVTPMKLDNNYFKNLIKDKGL  265

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             L+VD+ L +   T P+V +MA DN YF  QF+RA  I+SENNPLTG  GEIR +CR+VN
Sbjct  266   LLVDQGLLSDSRTTPYVTQMAQDNNYFFAQFSRAFAILSENNPLTGGDGEIRNHCRFVN  324



>ref|XP_003590493.1| Peroxidase [Medicago truncatula]
 gb|AES60744.1| cationic peroxidase [Medicago truncatula]
Length=257

 Score =   390 bits (1002),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 182/255 (71%), Positives = 219/255 (86%), Gaps = 2/255 (1%)
 Frame = +2

Query  467   VKACDASILLDSVAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSAR  646
             +++CDAS+LL++V GV SE+ + R+FGMRNFKY+ TIKAALE+ECP TVSCADIVALSAR
Sbjct  3     LQSCDASLLLETVHGVVSEQTAERSFGMRNFKYVSTIKAALEKECPLTVSCADIVALSAR  62

Query  647   DGAVMLKGPRAEMKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALL  826
             DG   L GP  EMK+GR+DSKE+Y+  VE FIPNHNDS+  VLS FQ+IG+D E TVALL
Sbjct  63    DGIARLGGPNFEMKSGRKDSKESYVKVVEQFIPNHNDSISSVLSSFQAIGIDVEATVALL  122

Query  827   GAHSVGRVHCINIVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPM  1006
             GAHSVGRVHC+N+VHRLYPTVDPTLDPT+A YLK RCP+  PDP+AV+  Y RND +TPM
Sbjct  123   GAHSVGRVHCMNLVHRLYPTVDPTLDPTHAAYLKRRCPTPNPDPKAVQ--YVRNDLKTPM  180

Query  1007  ILDNMYYKNILEHKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPL  1186
             I+DN YYKNIL+HKGLL VDE LAT P T+P+V+KMAADN YF++QF+RA+ ++SENNPL
Sbjct  181   IIDNNYYKNILQHKGLLTVDEELATDPRTSPYVKKMAADNGYFNEQFSRAVQLLSENNPL  240

Query  1187  TGDQGEIRKNCRYVN  1231
              GDQGEIRK+CRYVN
Sbjct  241   IGDQGEIRKDCRYVN  255



>ref|XP_011086187.1| PREDICTED: peroxidase 42-like [Sesamum indicum]
Length=330

 Score =   391 bits (1004),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 182/299 (61%), Positives = 228/299 (76%), Gaps = 2/299 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M YY +SCP+AEDIIKEQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS   +
Sbjct  31    LVMNYYRDSCPQAEDIIKEQVKLLYKRHKNTAFSWLRNIFHDCFVESCDASLLLDSTRRM  90

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE+E+ R+FGMRNF+YI+TIK ALE ECP  VSCADI+ LSARDG V L GP   +KTG
Sbjct  91    LSEKETDRSFGMRNFRYIETIKEALERECPGVVSCADILVLSARDGIVALGGPYIPLKTG  150

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD +++    +E  +P+HN+SM +VL RF +IG+DT G VALLGAHSVGR HC+ +VHR
Sbjct  151   RRDGRKSRADILEQHLPDHNESMSVVLERFANIGIDTPGVVALLGAHSVGRTHCVKLVHR  210

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP VDP L+PT+ +++  +CP A PDP+AV+  Y RNDR TPM LDN YY+NIL++KGL
Sbjct  211   LYPEVDPALNPTHVEHMLHKCPDAIPDPKAVQ--YVRNDRGTPMKLDNNYYRNILDNKGL  268

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             L+VD  LAT   T P+V+KMA    YF  +F RA+ I+SENNPLTG +GE+RK C   N
Sbjct  269   LIVDHQLATDKRTKPYVKKMAKSQDYFFREFGRAITILSENNPLTGTKGEVRKQCNLAN  327



>ref|XP_004962309.1| PREDICTED: peroxidase 21-like [Setaria italica]
Length=337

 Score =   390 bits (1002),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 197/305 (65%), Positives = 242/305 (79%), Gaps = 3/305 (1%)
 Frame = +2

Query  323   AKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDS  502
             A G L++GYYS +CP AEDI++EQV +LY +HGNTAVSWLR LFHDCMV +CDAS+LLD+
Sbjct  32    ANGGLRLGYYSSTCPPAEDIVREQVAQLYHKHGNTAVSWLRALFHDCMVGSCDASLLLDT  91

Query  503   --VAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPR  676
                AGV SE+ +PR+FGMRNFKYI  IKAALE ECP TVSCAD++AL+ARDGA  L GPR
Sbjct  92    SPAAGV-SEKSAPRSFGMRNFKYIDVIKAALERECPGTVSCADVLALAARDGAAALGGPR  150

Query  677   AEMKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHC  856
             A M+TGRRD++ +  A+V   IPNHND++  VL+RF + GVD EG VALLGAHSVGRVHC
Sbjct  151   AAMRTGRRDARASRYADVGRDIPNHNDTVAAVLARFAAAGVDAEGAVALLGAHSVGRVHC  210

Query  857   INIVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNI  1036
              N+V RLYP VD  LDP Y +YL+ RCP+A+      +  Y+RNDR TPM LDNMYYKN+
Sbjct  211   FNLVGRLYPAVDAGLDPAYGEYLRGRCPTADAREDTRDVAYARNDRATPMALDNMYYKNL  270

Query  1037  LEHKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKN  1216
             L  +GLL+VD+ LA  P TAPFV +MAADN YFHD+FA AL+ +SENNPL  D+GE+R++
Sbjct  271   LARRGLLLVDQRLADDPRTAPFVARMAADNGYFHDRFAAALLTLSENNPLGADEGEVRRD  330

Query  1217  CRYVN  1231
             CR+VN
Sbjct  331   CRFVN  335



>gb|ADD54644.1| peroxidase [Bruguiera gymnorhiza]
Length=332

 Score =   390 bits (1001),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 179/299 (60%), Positives = 231/299 (77%), Gaps = 2/299 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M +Y ++CP+AEDIIKEQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS   V
Sbjct  33    LIMNFYKDTCPQAEDIIKEQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRRV  92

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE+E+ R+FGMRNF+Y++TIK A+E ECP  VSCADI+ LSARDG V L GP   +KTG
Sbjct  93    LSEKETDRSFGMRNFRYVETIKEAVERECPGVVSCADILVLSARDGIVALGGPFIPLKTG  152

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD +++    +E ++P+HN+S+ +VL RF S+G+DT G VALLGAHSVGR HC+ +VHR
Sbjct  153   RRDGRKSRADVLEEYLPDHNESISVVLDRFASMGIDTPGVVALLGAHSVGRTHCVKLVHR  212

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP VDP L+P + +++  +CP A PDP+AV+  Y RNDR TPMILDN YY+NIL++KGL
Sbjct  213   LYPEVDPVLNPDHVEHMLHKCPDALPDPKAVQ--YVRNDRGTPMILDNNYYRNILDNKGL  270

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             L+VD  LAT   T P+V+KMA    YF  +F+RA+ I+SENNPLTG++GEIRK C   N
Sbjct  271   LIVDHQLATDKRTKPYVKKMAKSQGYFFKEFSRAITILSENNPLTGNKGEIRKQCNVAN  329



>gb|EYU27791.1| hypothetical protein MIMGU_mgv1a007622mg [Erythranthe guttata]
Length=401

 Score =   392 bits (1007),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 180/299 (60%), Positives = 228/299 (76%), Gaps = 2/299 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M YY +SCP+AE+IIKEQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS   V
Sbjct  102   LVMNYYQDSCPQAEEIIKEQVQLLYKRHKNTAFSWLRNIFHDCFVESCDASLLLDSTRRV  161

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE+E+ R+FGMRNF+YI+TIK ALE ECP  VSCADI+ LSARDG  ++ GP   +KTG
Sbjct  162   LSEKETDRSFGMRNFRYIETIKEALERECPGVVSCADILVLSARDGISLVGGPNIPLKTG  221

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD + +    +E  +P+HN+SM +VL RF SIG+DT G VALLGAHSVGR HC+ +VHR
Sbjct  222   RRDGRRSRADILEQHLPDHNESMSVVLQRFASIGIDTPGVVALLGAHSVGRTHCVKLVHR  281

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP VDP L+P++ +++  +CP A PDP+AV+  Y RNDR TPM LDN YY+NIL++KGL
Sbjct  282   LYPEVDPALNPSHVEHMLYKCPDAIPDPKAVQ--YVRNDRGTPMKLDNNYYRNILDNKGL  339

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             L+VD  LAT   T PFV+KMA    YF  +F++A+ ++SENNPLTG +GEIRK C   N
Sbjct  340   LIVDHQLATDKRTKPFVKKMAKSQDYFFSEFSKAITVLSENNPLTGTKGEIRKQCNLAN  398



>ref|XP_011096066.1| PREDICTED: peroxidase 42-like [Sesamum indicum]
Length=330

 Score =   389 bits (1000),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 181/299 (61%), Positives = 227/299 (76%), Gaps = 2/299 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M YY +SCP+AEDIIKEQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS   +
Sbjct  31    LVMNYYRDSCPQAEDIIKEQVQLLYKRHKNTAFSWLRNIFHDCFVESCDASLLLDSTRRM  90

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE+E+ R+FGMRNF+YI+TIK ALE ECP  VSC+DI+ LSARDG V L GP   +KTG
Sbjct  91    LSEKETDRSFGMRNFRYIETIKEALERECPGVVSCSDILVLSARDGIVALGGPYIPLKTG  150

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD +++    +E  +P+HN+SM +VL RF +IG++T G VALLGAHSVGR HC+ +VHR
Sbjct  151   RRDGRKSRADILEQHLPDHNESMSVVLERFANIGINTAGVVALLGAHSVGRTHCVKLVHR  210

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP VDP L+P + +++  +CP A PDP+AV+  Y RNDR TPM LDN YY+NIL++KGL
Sbjct  211   LYPEVDPALNPAHVEHMLYKCPDAIPDPKAVQ--YVRNDRGTPMKLDNNYYRNILDNKGL  268

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             L+VD  LAT   T PFV+KMA    YF  +FARA+  +SENNPLTG +GEIRK C   N
Sbjct  269   LIVDHQLATDKRTKPFVKKMAKSQDYFFKEFARAITTLSENNPLTGTKGEIRKQCNLAN  327



>ref|XP_010052841.1| PREDICTED: peroxidase 42-like [Eucalyptus grandis]
 gb|KCW76962.1| hypothetical protein EUGRSUZ_D01322 [Eucalyptus grandis]
Length=333

 Score =   389 bits (999),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 179/302 (59%), Positives = 230/302 (76%), Gaps = 2/302 (1%)
 Frame = +2

Query  326   KGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSV  505
             K  L M +Y ++CP+AEDIIKEQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS 
Sbjct  31    KPGLVMNFYKDTCPQAEDIIKEQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDST  90

Query  506   AGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEM  685
                 SE+E+ R+FG+RNF+Y+ TIK A+E ECP  VSCADI+ LSARDG V L GP   +
Sbjct  91    RRSLSEKETDRSFGLRNFRYLDTIKEAVERECPGVVSCADILVLSARDGIVALGGPHFPL  150

Query  686   KTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINI  865
             KTGRRD +++    VE ++P+HN+S+ +VL RF ++G++T G VALLGAHSVGR HC+ +
Sbjct  151   KTGRRDGRKSRADVVEQYLPDHNESISVVLDRFAAMGINTPGVVALLGAHSVGRTHCVKL  210

Query  866   VHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEH  1045
             VHRLYP VDP L+P + +++  +CP A PDP+AV+  Y RNDR TPM+LDN YY+NIL++
Sbjct  211   VHRLYPEVDPALNPDHIEHMLHKCPDAIPDPKAVQ--YVRNDRGTPMVLDNNYYRNILDN  268

Query  1046  KGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRY  1225
             KGLL+VD  LAT   T P+V+KMA    YF  +FARA+ I+SENNPLTGDQGEIRK C  
Sbjct  269   KGLLIVDHQLATDKRTKPYVKKMAKSQDYFFKEFARAITILSENNPLTGDQGEIRKQCNV  328

Query  1226  VN  1231
              N
Sbjct  329   AN  330



>ref|XP_008441087.1| PREDICTED: peroxidase 42 [Cucumis melo]
 gb|ADN34050.1| peroxidase [Cucumis melo subsp. melo]
Length=331

 Score =   387 bits (995),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 177/299 (59%), Positives = 229/299 (77%), Gaps = 2/299 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M +Y ++CP+AEDIIKEQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS    
Sbjct  32    LVMNFYKDTCPQAEDIIKEQVRLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRRT  91

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE+E+ R+FG+RNF+YI+TIK A+E ECP  VSCADI+ LSARDG V L GP   ++TG
Sbjct  92    LSEKETDRSFGLRNFRYIETIKEAVERECPGVVSCADILVLSARDGIVSLGGPYIPLRTG  151

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD +++    +EN++P+HN+SM +VL RF ++G+DT G VALLGAHSVGR HC+ +VHR
Sbjct  152   RRDGRKSRADILENYLPDHNESMSVVLERFAAMGIDTPGVVALLGAHSVGRTHCVKLVHR  211

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP VDP L+P + +++  +CP   PDP+AV+  Y RNDR TPMILDN YY+NIL++KGL
Sbjct  212   LYPQVDPVLNPGHVEHMLYKCPDEIPDPKAVQ--YVRNDRGTPMILDNNYYRNILDNKGL  269

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             L+VD  LAT   T P+V+KMA    YF  +F+RA+ I+SENNPLTG +GEIRK C   N
Sbjct  270   LIVDHQLATDKRTKPYVKKMAKKQDYFFKEFSRAITILSENNPLTGTKGEIRKQCNVAN  328



>gb|AHW98115.1| peroxidase [Carica papaya]
Length=328

 Score =   387 bits (994),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 193/305 (63%), Positives = 238/305 (78%), Gaps = 4/305 (1%)
 Frame = +2

Query  323   AKGDLQMGYY-SESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLD  499
              K DL++ YY  ES  RAE+IIK++VIKLY +HGNTAVSW+R  FHDC+VK+CDAS+LL+
Sbjct  26    GKSDLELVYYVRESFHRAEEIIKQEVIKLYYKHGNTAVSWVRRSFHDCVVKSCDASLLLE  85

Query  500   SVAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRA  679
             ++ G+ SE+ES R+FGMRNFKY++TIK ALE+ECP TVSCAD+VALSARD    L GPR 
Sbjct  86    TMNGIRSEQESERSFGMRNFKYVETIKDALEKECPLTVSCADVVALSARDIPNHLGGPRI  145

Query  680   EMKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCI  859
             EMKT R+DSKE+Y++EVE    N      + L RF+SIG+D EGTVALLGAHSVG V   
Sbjct  146   EMKTFRKDSKESYISEVELSAHNVGRVHCVNLVRFKSIGIDVEGTVALLGAHSVGCVTFD  205

Query  860   NIVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNIL  1039
              +  RLYPTV+PT DP YA+Y+K RCP+ +PDP  +   Y+RNDR TPMILDNMYYKNIL
Sbjct  206   PLPRRLYPTVNPTWDPEYAEYIKGRCPTFDPDPFFI--LYARNDRETPMILDNMYYKNIL  263

Query  1040  EHKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNC  1219
              H+GL  +D+ LA  P T PFVEKMAADN YFHDQF RA+ ++ E NPLT DQGE+RK+ 
Sbjct  264   NHEGLFFIDQQLAFDPTTTPFVEKMAADNGYFHDQFVRAIQLLFEINPLTNDQGEVRKS-  322

Query  1220  RYVNT  1234
             R+VN+
Sbjct  323   RFVNS  327



>ref|XP_004145112.1| PREDICTED: peroxidase 42-like [Cucumis sativus]
 ref|XP_004153037.1| PREDICTED: peroxidase 42-like [Cucumis sativus]
 gb|KGN64521.1| Peroxidase [Cucumis sativus]
Length=331

 Score =   386 bits (992),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 177/299 (59%), Positives = 228/299 (76%), Gaps = 2/299 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M +Y ++CP+AEDIIKEQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS    
Sbjct  32    LVMNFYKDTCPQAEDIIKEQVRLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRRT  91

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE+E+ R+FG+RNF+YI+TIK A+E ECP  VSCADI+ LSARDG V L GP   +KTG
Sbjct  92    LSEKETDRSFGLRNFRYIETIKEAVERECPGVVSCADILVLSARDGIVSLGGPYIPLKTG  151

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD +++    +E ++P+HN+SM +VL RF ++G+DT G VALLGAHSVGR HC+ +VHR
Sbjct  152   RRDGRKSRADILEEYLPDHNESMSVVLERFGAMGIDTSGVVALLGAHSVGRTHCVKLVHR  211

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP VDP L+P + +++  +CP   PDP+AV+  Y RNDR TPMILDN YY+NIL++KGL
Sbjct  212   LYPEVDPVLNPGHVEHMLYKCPDEIPDPKAVQ--YVRNDRGTPMILDNNYYRNILDNKGL  269

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             L+VD  LAT   T P+V+KMA    YF  +F+RA+ I+SENNPLTG +GEIRK C   N
Sbjct  270   LIVDHQLATDKRTKPYVKKMAKKQDYFFKEFSRAITILSENNPLTGTKGEIRKQCNVAN  328



>ref|XP_004165387.1| PREDICTED: LOW QUALITY PROTEIN: peroxidase 42-like [Cucumis sativus]
Length=331

 Score =   386 bits (992),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 177/299 (59%), Positives = 228/299 (76%), Gaps = 2/299 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M +Y ++CP+AEDIIKEQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS    
Sbjct  32    LVMNFYKDTCPQAEDIIKEQVRLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRRT  91

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE+E+ R+FG+RNF+YI+TIK A+E ECP  VSCADI+ LSARDG V L GP   +KTG
Sbjct  92    LSEKETDRSFGLRNFRYIETIKEAVERECPGVVSCADILVLSARDGIVSLGGPYIPLKTG  151

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD +++    +E ++P+HN+SM +VL RF ++G+DT G VALLGAHSVGR HC+ +VHR
Sbjct  152   RRDGRKSRADILEEYLPDHNESMSVVLERFGAMGIDTSGVVALLGAHSVGRTHCVKLVHR  211

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP VDP L+P + +++  +CP   PDP+AV+  Y RNDR TPMILDN YY+NIL++KGL
Sbjct  212   LYPEVDPVLNPGHVEHMLYKCPDEIPDPKAVQ--YVRNDRGTPMILDNNYYRNILDNKGL  269

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             L+VD  LAT   T P+V+KMA    YF  +F+RA+ I+SENNPLTG +GEIRK C   N
Sbjct  270   LIVDHQLATDKRTKPYVKKMAQKQDYFFKEFSRAITILSENNPLTGTKGEIRKQCNVAN  328



>ref|NP_001237601.1| cationic peroxidase 2 precursor [Glycine max]
 gb|AAC83463.1| cationic peroxidase 2 [Glycine max]
 gb|ACU24564.1| unknown [Glycine max]
 gb|KHN03474.1| Peroxidase 42 [Glycine soja]
Length=331

 Score =   385 bits (990),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 181/307 (59%), Positives = 228/307 (74%), Gaps = 4/307 (1%)
 Frame = +2

Query  317   RCAKGD--LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASI  490
             RC   D  L M +Y ESCP+AEDIIKEQV  LY+ H NTA SWLRN+FHDC V++CDAS+
Sbjct  21    RCLAEDNGLVMNFYKESCPQAEDIIKEQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASL  80

Query  491   LLDSVAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKG  670
             LLDS     SE+E+ R+FG+RNF+YI+TIK ALE ECP  VSCADI+ LSARDG V L G
Sbjct  81    LLDSTRRSLSEKETDRSFGLRNFRYIETIKEALERECPGVVSCADILVLSARDGIVSLGG  140

Query  671   PRAEMKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRV  850
             P   +KTGRRD + +    VE F+P+HN+S+  VL +F ++G+DT G VALLGAHSVGR 
Sbjct  141   PHIPLKTGRRDGRRSRADVVEQFLPDHNESISAVLDKFGAMGIDTPGVVALLGAHSVGRT  200

Query  851   HCINIVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYK  1030
             HC+ +VHRLYP +DP L+P +  ++  +CP A PDP+AV+  Y RNDR TPMILDN YY+
Sbjct  201   HCVKLVHRLYPEIDPALNPDHVPHILKKCPDAIPDPKAVQ--YVRNDRGTPMILDNNYYR  258

Query  1031  NILEHKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIR  1210
             NIL++KGLL+VD  LA    T P+V+KMA    YF  +F+RA+ ++SENNPLTG +GEIR
Sbjct  259   NILDNKGLLIVDHQLANDKRTKPYVKKMAKSQDYFFKEFSRAITLLSENNPLTGTKGEIR  318

Query  1211  KNCRYVN  1231
             K C   N
Sbjct  319   KQCNAAN  325



>ref|XP_010092206.1| Peroxidase 42 [Morus notabilis]
 gb|EXB50432.1| Peroxidase 42 [Morus notabilis]
Length=330

 Score =   385 bits (989),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 178/299 (60%), Positives = 226/299 (76%), Gaps = 2/299 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M +Y ++CP+AEDIIKEQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLD+    
Sbjct  31    LVMNFYKDTCPQAEDIIKEQVRLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDTTRRQ  90

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE++  R+FGMRNF+Y++TIK ALE ECP  VSCADI+ LSARDG V L GP   +KTG
Sbjct  91    LSEKDMDRSFGMRNFRYMETIKEALERECPGVVSCADILVLSARDGIVALGGPYIPLKTG  150

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD +++    +E ++P+HNDSM +VL RF  IG+DT G VALLGAHSVGR HC+ +VHR
Sbjct  151   RRDGRKSRAEILEQYLPDHNDSMPVVLERFAGIGIDTPGVVALLGAHSVGRTHCVKLVHR  210

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP VDP L+P + +++  +CP A PDP+AV+  Y RNDR TPMILDN YY+NIL++KGL
Sbjct  211   LYPEVDPALNPDHVEHMLYKCPDAIPDPKAVQ--YVRNDRGTPMILDNNYYRNILDNKGL  268

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             ++VD  LA    T P+V+KMA    YF  +FARA+ I+SENNPLTG +GEIRK C   N
Sbjct  269   MMVDHQLAEDKRTKPYVKKMAKSQNYFFKEFARAITILSENNPLTGTKGEIRKQCNLAN  327



>gb|KDP20749.1| hypothetical protein JCGZ_21220 [Jatropha curcas]
Length=331

 Score =   385 bits (988),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 174/299 (58%), Positives = 228/299 (76%), Gaps = 2/299 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M +Y ++CP+AEDII+EQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS    
Sbjct  32    LIMNFYRDTCPQAEDIIREQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRRT  91

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE+E+ R+FG+RNF+Y+ TIK A+E ECP  VSCADI+ LSARDG V L GP   +KTG
Sbjct  92    LSEKETDRSFGLRNFRYLDTIKEAVERECPGVVSCADILVLSARDGIVALGGPHIPLKTG  151

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD +++    VE ++P+HN+S+ +VL RF ++G+DT G V+LLGAHSVGR HC+ +VHR
Sbjct  152   RRDGRKSKADVVEQYLPDHNESISVVLERFAAMGIDTPGVVSLLGAHSVGRTHCVKLVHR  211

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP VDP L+P + +++  +CP A PDP+AV+  Y RNDR TPM+LDN YY+NIL++KGL
Sbjct  212   LYPEVDPVLNPDHVEHMLYKCPDAIPDPKAVQ--YVRNDRGTPMVLDNNYYRNILDNKGL  269

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             L+VD  LAT   T P+V+KMA    YF  +F+RA+ I+SENNPLTG +GEIRK C   N
Sbjct  270   LIVDHQLATDKRTKPYVKKMAKSQDYFFKEFSRAITILSENNPLTGSKGEIRKQCNVAN  328



>gb|AFY26877.1| basic peroxidase swpb6 [Ipomoea batatas]
Length=333

 Score =   384 bits (987),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 179/299 (60%), Positives = 226/299 (76%), Gaps = 2/299 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M YY +SCP+AEDIIKEQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS   V
Sbjct  30    LAMNYYKDSCPQAEDIIKEQVKLLYKRHKNTAFSWLRNIFHDCFVESCDASLLLDSTRRV  89

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE+E+ R+FGMRNF+YI+TIK A+E ECP  VSCADI+ LSARDG V L GP   +K+G
Sbjct  90    LSEKEADRSFGMRNFRYIETIKEAVERECPGVVSCADILVLSARDGIVALGGPYIPLKSG  149

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD +++    +E ++P+HNDSM LVL RF +IG++T G VALLGAHSVG  HC+ +VHR
Sbjct  150   RRDGRKSRANILEQYLPDHNDSMSLVLERFSNIGINTPGVVALLGAHSVGSTHCVKLVHR  209

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP VDP L+P +  ++  +CP   PDP+AV+  Y RNDR TPM LDN YY+NIL++KGL
Sbjct  210   LYPEVDPQLNPDHVPHMLKKCPDPIPDPKAVQ--YVRNDRGTPMKLDNNYYRNILDNKGL  267

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             ++VD  LAT   T P V+KMA +  YF  +F+RA+ I+SENNPLTG +GEIRK C   N
Sbjct  268   MLVDHQLATDKRTKPHVKKMAKNQDYFFKEFSRAITILSENNPLTGPKGEIRKQCNLAN  326



>gb|EAZ05247.1| hypothetical protein OsI_27449 [Oryza sativa Indica Group]
Length=553

 Score =   392 bits (1007),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 191/299 (64%), Positives = 236/299 (79%), Gaps = 5/299 (2%)
 Frame = +2

Query  335   LQMGYYSES--CPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILL--DS  502
             L++ +YSES  CPRAE++++E+V +LYEEHGNTAVSWLR LFHDCMV +CDAS+LL   +
Sbjct  29    LKLNFYSESERCPRAEEVVREEVRRLYEEHGNTAVSWLRALFHDCMVYSCDASLLLHTTT  88

Query  503   VAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAE  682
               GV SE+ S R+FGMRNFKYI  IKAA+E ECP TVSCADI+AL+ARDG  ML GP   
Sbjct  89    TTGV-SEQSSHRSFGMRNFKYITAIKAAVERECPATVSCADILALAARDGVAMLGGPSVA  147

Query  683   MKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCIN  862
             M+TGRRDS+E+Y   VE +IPNHNDS+  VLSRF +IGVDTEG VALLGAHSVGRVHC N
Sbjct  148   MRTGRRDSRESYYGVVEQYIPNHNDSVSTVLSRFAAIGVDTEGAVALLGAHSVGRVHCFN  207

Query  863   IVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILE  1042
             +V RLYP VD +++  Y +YL+ RCP+A       E  Y+RNDR TPM++DNMYY+N+L 
Sbjct  208   LVGRLYPQVDGSMEAAYGEYLRGRCPTAAATEDTREVVYARNDRVTPMLIDNMYYRNLLA  267

Query  1043  HKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNC  1219
              +GLL+VD+ LA+   TAP+V +MAADN YFH +FA AL+ MSEN PLTG QGE+RK+C
Sbjct  268   GRGLLLVDQQLASDARTAPYVRRMAADNDYFHQRFAAALLTMSENAPLTGAQGEVRKDC  326



>dbj|BAB16317.1| secretory peroxidase [Avicennia marina]
Length=331

 Score =   384 bits (985),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 177/299 (59%), Positives = 226/299 (76%), Gaps = 2/299 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M YY +SCP+AE+IIKEQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS   +
Sbjct  32    LAMNYYRDSCPQAEEIIKEQVQLLYKRHKNTAFSWLRNIFHDCFVESCDASLLLDSTRRM  91

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE+E+ R+FGMRNF+YI+TIK ALE ECP  VSCADI+ LSARDG V L GP   +KTG
Sbjct  92    LSEKETDRSFGMRNFRYIETIKEALERECPGVVSCADILVLSARDGIVSLGGPYIPLKTG  151

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD +++    +E  +P+HN+S+ +VL RF ++G+D  G VALLGAHSVGR HC+ +VHR
Sbjct  152   RRDGRKSRAEILEQHLPDHNESLSVVLDRFANMGIDAPGVVALLGAHSVGRTHCVKLVHR  211

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP VDP L+P++ +++  +CP   PDP+AV+  Y RNDR TPM LDN YY+NIL++KGL
Sbjct  212   LYPEVDPALNPSHVEHMLHKCPDPIPDPKAVQ--YVRNDRGTPMKLDNNYYRNILDNKGL  269

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             L+VD  LAT   T PFV+KMA    YF  +F RA+ ++SENNPLTG +GEIRK C   N
Sbjct  270   LIVDHQLATDKRTKPFVKKMAKSQDYFFKEFGRAITVLSENNPLTGTKGEIRKQCYLAN  328



>gb|EAZ27428.1| hypothetical protein OsJ_11374 [Oryza sativa Japonica Group]
Length=392

 Score =   385 bits (989),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 188/294 (64%), Positives = 231/294 (79%), Gaps = 5/294 (2%)
 Frame = +2

Query  335   LQMGYYSES--CPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILL--DS  502
             L++ +YSES  CPRAE++++E+V +LYEEHGNTAVSWLR LFHDCMV +CDAS+LL   +
Sbjct  27    LKLNFYSESERCPRAEEVVREEVRRLYEEHGNTAVSWLRALFHDCMVYSCDASLLLHTTT  86

Query  503   VAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAE  682
               GV SE+ S R+FGMRNFKYI  IKAA+E ECP TVSCADI+AL+ARDG  ML GP   
Sbjct  87    TTGV-SEQSSHRSFGMRNFKYITAIKAAVERECPATVSCADILALAARDGVAMLGGPSVA  145

Query  683   MKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCIN  862
             M+TGRRDS+E+Y   VE +IPNHNDS+  VLSRF +IGVDTEG VALLGAHSVGRVHC N
Sbjct  146   MRTGRRDSRESYYGVVEQYIPNHNDSVSTVLSRFAAIGVDTEGAVALLGAHSVGRVHCFN  205

Query  863   IVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILE  1042
             +V RLYP VD +++  Y +YL+ RCP+A       E  Y+RNDR TPM++DNMYY+N+L 
Sbjct  206   LVGRLYPQVDGSMEAAYGEYLRGRCPTAAATEDTREVVYARNDRVTPMLIDNMYYRNLLA  265

Query  1043  HKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGE  1204
              +GLL+VD+ LA+   TAP+V +MAADN YFH +FA AL+ MSEN PLTG QGE
Sbjct  266   GRGLLLVDQQLASDARTAPYVRRMAADNDYFHQRFAAALLTMSENAPLTGAQGE  319



>gb|AEK87128.1| class III peroxidase [Hevea brasiliensis]
Length=338

 Score =   383 bits (984),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 175/295 (59%), Positives = 227/295 (77%), Gaps = 2/295 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M +Y ++CP+AEDII+EQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS    
Sbjct  32    LIMNFYRDTCPQAEDIIREQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRRT  91

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE+E+ R+FG+RNF+Y+ TIK A+E ECP  VSCADI+ LSARDG V L GP   +KTG
Sbjct  92    LSEKETDRSFGLRNFRYLDTIKEAVERECPGVVSCADILVLSARDGIVALGGPHIPLKTG  151

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD +++    +E ++P+HN+S+ +VL RF +IG+DT G VALLGAHSVGR HC+ +VHR
Sbjct  152   RRDGRKSRADVIEQYLPDHNESITVVLERFAAIGIDTPGGVALLGAHSVGRTHCVKLVHR  211

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP VDP L+P + +++  +CP + PDP+AV+  Y RNDR TPMILDN YY+NIL++KGL
Sbjct  212   LYPEVDPVLNPDHVEHMLHKCPDSIPDPKAVQ--YVRNDRGTPMILDNNYYRNILDNKGL  269

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNC  1219
             L+VD  LAT   T P+V+KMA    YF  +FARA+ I+SENNPLTG +GEIRK C
Sbjct  270   LIVDHQLATDKRTKPYVKKMAKSQDYFFKEFARAITILSENNPLTGTKGEIRKQC  324



>gb|ADR70870.1| secretory peroxidase [Hevea brasiliensis]
Length=331

 Score =   383 bits (983),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 175/299 (59%), Positives = 227/299 (76%), Gaps = 2/299 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M +Y ++CP+AEDII+EQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS    
Sbjct  32    LIMNFYRDTCPQAEDIIREQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRRT  91

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE+E+ R+FG+RNF+Y+ TIK A+E ECP  VSCADI+ LSARDG V L GP   +KTG
Sbjct  92    LSEKETDRSFGLRNFRYLDTIKEAVERECPGVVSCADILVLSARDGIVALGGPHIPLKTG  151

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD +++    +E ++P+HN+S+ +VL RF +IG+DT G VALLGAHSVGR HC+ +VHR
Sbjct  152   RRDGRKSRADVIEQYLPDHNESITVVLERFAAIGIDTAGGVALLGAHSVGRTHCVKLVHR  211

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP VDP L+P + +++  +CP + PDP+AV+  Y RNDR TPMILDN YY+NIL++KGL
Sbjct  212   LYPEVDPVLNPDHVEHMLHKCPDSIPDPKAVQ--YVRNDRCTPMILDNNYYRNILDNKGL  269

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             L+VD  LAT   T P+ +KMA    YF  +FARA+ I+SENNPLTG +GEIRK C   N
Sbjct  270   LIVDHQLATDKRTKPYAKKMAKSQDYFFKEFARAITILSENNPLTGTKGEIRKQCNVAN  328



>gb|ABK22252.1| unknown [Picea sitchensis]
 gb|ACN40605.1| unknown [Picea sitchensis]
Length=342

 Score =   383 bits (984),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 177/299 (59%), Positives = 227/299 (76%), Gaps = 2/299 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M YY +SCP+AE+II EQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS    
Sbjct  38    LVMNYYGDSCPQAEEIIAEQVRLLYKRHKNTAFSWLRNIFHDCAVESCDASLLLDSTRKS  97

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE+E+ R+FG+RNF+Y+ TIK A+E ECP  VSCADI+ LSARDG V L GP   +KTG
Sbjct  98    ISEKETDRSFGLRNFRYLDTIKEAVERECPGVVSCADILVLSARDGVVSLGGPYTPLKTG  157

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD +++    VEN++P+HN+S+  VLSRF+++G+DT G VALLGAHSVGR HC+ +VHR
Sbjct  158   RRDGRKSRADVVENYLPDHNESISTVLSRFKAMGIDTRGVVALLGAHSVGRTHCVKLVHR  217

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP VDPTLDP + +++K +CP A P+P+AV+  Y RNDR TPM LDN YY N++ +KGL
Sbjct  218   LYPEVDPTLDPGHVEHMKHKCPDAIPNPKAVQ--YVRNDRGTPMKLDNNYYVNLMNNKGL  275

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             L+VD+ L     T P+V+KMA    YF   FARAL I+SENNPLTG++GEIR+ C   N
Sbjct  276   LIVDQQLYADSRTRPYVKKMAKSQDYFFKYFARALTILSENNPLTGNRGEIRRQCSLRN  334



>ref|NP_001238183.1| peroxidase precursor [Glycine max]
 gb|AAD37374.1|AF145348_1 peroxidase [Glycine max]
 gb|ACU24453.1| unknown [Glycine max]
 gb|KHN35742.1| Peroxidase 42 [Glycine soja]
Length=336

 Score =   382 bits (982),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 176/299 (59%), Positives = 223/299 (75%), Gaps = 2/299 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M +Y ESCP+AEDII EQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS    
Sbjct  33    LVMNFYKESCPQAEDIITEQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRRS  92

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE+E+ R+FG+RNF+YI+TIK ALE ECP  VSCADI+ LSARDG V L GP   +KTG
Sbjct  93    LSEKETDRSFGLRNFRYIETIKEALERECPGVVSCADILVLSARDGIVSLGGPHIPLKTG  152

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD + +    VE F+P+HN+S+  VL +F ++G+DT G VALLGAHSVGR HC+ +VHR
Sbjct  153   RRDGRRSRADVVEQFLPDHNESISAVLDKFGAMGIDTPGVVALLGAHSVGRTHCVKLVHR  212

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP +DP L+P +  ++  +CP A PDP+AV+  Y RNDR TPMILDN YY+NIL+ KGL
Sbjct  213   LYPEIDPALNPDHVPHILKKCPDAIPDPKAVQ--YVRNDRGTPMILDNNYYRNILDSKGL  270

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             L+VD  LA    T P+V+KMA    YF  +F+RA+ ++SENNPLTG +GE+RK C   N
Sbjct  271   LIVDHQLANDKRTKPYVKKMAKSQDYFFKEFSRAITLLSENNPLTGTKGEVRKQCNVAN  329



>ref|XP_002304909.1| Peroxidase 42 precursor family protein [Populus trichocarpa]
 gb|ABK95753.1| unknown [Populus trichocarpa]
 gb|EEE85420.1| Peroxidase 42 precursor family protein [Populus trichocarpa]
 gb|ACN97180.1| peroxidase [Populus trichocarpa]
 gb|AHL39129.1| class III peroxidase [Populus trichocarpa]
Length=331

 Score =   382 bits (981),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 173/299 (58%), Positives = 227/299 (76%), Gaps = 2/299 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M +Y ++CP+AEDI+KEQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS    
Sbjct  32    LVMNFYKDTCPQAEDIVKEQVRLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRRT  91

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE+E+ R+FG+RNF+Y   IK A+E ECP  VSCADI+ LSARDG V L GP   +KTG
Sbjct  92    LSEKETDRSFGLRNFRYFDDIKEAVERECPGVVSCADILVLSARDGIVSLGGPHIPLKTG  151

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD +++    +E+++P+HN+S+ +VL RF S+G+DT G VALLGAHSVGR HC+ +VHR
Sbjct  152   RRDGRKSRADVIEDYLPDHNESISVVLDRFASMGIDTPGLVALLGAHSVGRTHCVKLVHR  211

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP VDP L+P + +++  +CP + PDP+AV+  Y RNDR TPM+LDN YY+NIL++KGL
Sbjct  212   LYPEVDPALNPDHVEHMLYKCPDSIPDPKAVQ--YVRNDRGTPMVLDNNYYRNILDNKGL  269

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             L+VD  LAT   T P+V+KMA    YF  +F+RA+ I+SENNPLTG +GEIRK C   N
Sbjct  270   LIVDHQLATDKRTKPYVKKMAKSQDYFFKEFSRAITILSENNPLTGTKGEIRKQCTVAN  328



>gb|EPS68822.1| secretory peroxidase [Genlisea aurea]
Length=334

 Score =   382 bits (981),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 177/301 (59%), Positives = 225/301 (75%), Gaps = 2/301 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L + YY +SCP+AED+I+EQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS   V
Sbjct  33    LSLNYYRDSCPQAEDVIREQVQLLYKRHKNTAFSWLRNIFHDCFVESCDASLLLDSTRRV  92

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE+E+ R+FGMRNF+YI+TIK A+E ECP  VSCADIV LSARD  V L GP   +KTG
Sbjct  93    LSEKENDRSFGMRNFRYIETIKEAIERECPGVVSCADIVVLSARDAIVSLGGPYIPLKTG  152

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD +++ +  V++F+P+HN+SM  VL RF  IG+D  G VALLGAHSVGR HC  +VHR
Sbjct  153   RRDGRKSRVDVVQHFLPDHNESMNAVLQRFAGIGIDAPGVVALLGAHSVGRTHCAKLVHR  212

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP VDP LDP +  ++  +CP   PDP+AV+  Y RNDR TPM LDN YYKN+L+++GL
Sbjct  213   LYPEVDPALDPLHVHHMLRKCPDPIPDPKAVQ--YVRNDRGTPMKLDNNYYKNLLQNRGL  270

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVNT  1234
             L+VD  L T   T   V+KMA   +YF ++FA+A+ I+SENNPLTGD+GEIR+ C   N 
Sbjct  271   LIVDHQLVTDKRTKGIVKKMAKSEKYFFEEFAKAITILSENNPLTGDKGEIREQCNVANK  330

Query  1235  K  1237
             K
Sbjct  331   K  331



>gb|ACT21094.1| peroxidase [Camellia oleifera]
Length=337

 Score =   382 bits (980),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 175/299 (59%), Positives = 225/299 (75%), Gaps = 2/299 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M +Y ++CP+AE++I+EQV  LY+ H NTA SWLRN+FHDC V +CDAS+LLDS    
Sbjct  38    LVMNFYKDTCPQAEEVIREQVKLLYKRHKNTAFSWLRNIFHDCAVTSCDASLLLDSTRRS  97

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE+E+ R+FG+RNF+Y+ TIK A+E ECP  VSC+DI+ LSARDG V L GP   +KTG
Sbjct  98    LSEKETDRSFGLRNFRYLDTIKEAVERECPGVVSCSDILVLSARDGIVALGGPYIPLKTG  157

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD +++    +E ++P+HN+SM +VL RF SIG+DT G VALLGAHSVGR HC+ +VHR
Sbjct  158   RRDGRKSRAEVLEQYLPDHNESMSVVLERFASIGIDTPGVVALLGAHSVGRTHCVKLVHR  217

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP VDP L+P + +++  +CP   PDP+AV+  Y RNDR TPM LDN YY+NIL++KGL
Sbjct  218   LYPEVDPVLNPDHVEHMLHKCPDPIPDPKAVQ--YVRNDRGTPMKLDNNYYRNILDNKGL  275

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             L+VD  LAT   T PFV+KMA    YF  +FARA+ I+SENNPLTG +GEIRK C   N
Sbjct  276   LIVDHQLATDKRTKPFVKKMAKSQDYFFKEFARAITILSENNPLTGTKGEIRKQCNVAN  334



>ref|XP_011037651.1| PREDICTED: peroxidase 42 [Populus euphratica]
Length=331

 Score =   381 bits (979),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 172/299 (58%), Positives = 227/299 (76%), Gaps = 2/299 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M +Y ++CP+AEDI+KEQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS    
Sbjct  32    LVMNFYKDTCPQAEDIVKEQVRLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRRT  91

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE+E+ R+FG+RNF+Y+  IK A+E ECP  VSCADI+ LSARDG V L GP   +KTG
Sbjct  92    LSEKETDRSFGLRNFRYLDDIKEAVERECPGVVSCADILVLSARDGIVSLGGPHIPLKTG  151

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD +++    +E+++P+HN+S+ +VL RF S+G+DT G VALLGAHSVGR HC+ +VHR
Sbjct  152   RRDGRKSRADVIEDYLPDHNESISVVLDRFASMGIDTPGVVALLGAHSVGRTHCVKLVHR  211

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP VDP L+P + +++  +CP + PDP+AV+  Y RNDR TPM+LDN YY+NIL++KGL
Sbjct  212   LYPEVDPALNPDHVEHMLYKCPDSIPDPKAVQ--YVRNDRGTPMVLDNNYYRNILDNKGL  269

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             L+VD  LA    T P+V+KMA    YF  +F+RA+ I+SENNPLTG +GEIRK C   N
Sbjct  270   LIVDHQLANDKRTKPYVKKMAKSQDYFFKEFSRAITILSENNPLTGTKGEIRKQCTVAN  328



>ref|XP_002274769.1| PREDICTED: peroxidase 42 [Vitis vinifera]
 emb|CAN60224.1| hypothetical protein VITISV_039918 [Vitis vinifera]
Length=334

 Score =   381 bits (978),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 175/299 (59%), Positives = 226/299 (76%), Gaps = 2/299 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M +Y ++CP+AED+I+EQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS    
Sbjct  35    LVMNFYKDTCPQAEDVIREQVRLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRRS  94

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE+E+ R+FG+RNF+Y+ TIK A+E ECP  VSCADI+ LSARDG V L GP   +KTG
Sbjct  95    LSEKETDRSFGLRNFRYLDTIKEAVERECPGVVSCADILVLSARDGIVSLGGPHISLKTG  154

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD +++    +E ++P+HN+SM +VL RF +IG+DT G VALLGAHSVGR HC+ +VHR
Sbjct  155   RRDGRKSRAEILEEYLPDHNESMSVVLDRFAAIGIDTPGLVALLGAHSVGRTHCVKLVHR  214

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP VDP L+  + +++  +CP A PDP+AV+  Y RNDR TPM LDN YY+NIL++KGL
Sbjct  215   LYPEVDPVLNTDHVEHMLHKCPDAIPDPKAVQ--YVRNDRGTPMKLDNNYYRNILDNKGL  272

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             L+VD  LAT   T P+V+KMA    YF  +FARA+ I+SENNPLTG +GEIRK C   N
Sbjct  273   LIVDHQLATDKRTKPYVKKMAKSQDYFFKEFARAITILSENNPLTGTKGEIRKQCSVAN  331



>ref|XP_006449726.1| hypothetical protein CICLE_v10015870mg [Citrus clementina]
 gb|ESR62966.1| hypothetical protein CICLE_v10015870mg [Citrus clementina]
Length=335

 Score =   380 bits (977),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 175/299 (59%), Positives = 223/299 (75%), Gaps = 2/299 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M +Y ++CP+AEDIIKEQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS    
Sbjct  33    LVMNFYKDTCPQAEDIIKEQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRKT  92

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE+E  R+FGMRNF+YI+ IK A+E ECP  VSCADI+ LS RDG V L GP   +KTG
Sbjct  93    LSEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTG  152

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD +++    +E ++P+HNDSM +VL RF +IG+D  G VALLG+HSVGR HC+ +VHR
Sbjct  153   RRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHR  212

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP VDP L+P +  ++  +CP A PDP+AV+  Y RNDR TPM+LDN YY+NIL+ KGL
Sbjct  213   LYPEVDPALNPDHVPHMLHKCPDAIPDPKAVQ--YVRNDRGTPMVLDNNYYRNILDSKGL  270

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             ++VD  LAT   T P+V+KMA    YF  +F+RA+ I+SENNPLTG +GEIRK C   N
Sbjct  271   MMVDHQLATDKRTRPYVKKMAKSQDYFFKEFSRAITILSENNPLTGTKGEIRKVCNLAN  329



>ref|XP_010686841.1| PREDICTED: peroxidase 42 [Beta vulgaris subsp. vulgaris]
Length=335

 Score =   380 bits (976),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 174/299 (58%), Positives = 225/299 (75%), Gaps = 2/299 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M YY ++CP+AEDIIKEQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS   +
Sbjct  36    LVMNYYKDTCPQAEDIIKEQVKLLYKRHKNTAFSWLRNIFHDCAVESCDASLLLDSTRRI  95

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE+E  R+FG+RNF+Y++TIK A+E ECP  VSC+DI+ +SARDG V L GP   +KTG
Sbjct  96    MSEKEMDRSFGLRNFRYLETIKEAVERECPGVVSCSDILVISARDGVVQLGGPYIPLKTG  155

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD + +    +E ++P+HN+SM +VL RF+ IG+DT+G VALLGAHSVGR HC  +VHR
Sbjct  156   RRDGRRSRAEMLEQYLPDHNESMSMVLDRFKGIGIDTKGVVALLGAHSVGRTHCTKLVHR  215

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP VDP L+P +  ++  +C    PDP+AV+  Y RNDR TPMI DN YY+NIL++KGL
Sbjct  216   LYPEVDPALNPEHVPHMLKKCYDPIPDPKAVQ--YVRNDRGTPMIFDNNYYRNILDNKGL  273

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             L+VD  LAT   T P+V KMA +  YF  +F+RA+ I+SENNPLTG +GEIR+ C  VN
Sbjct  274   LIVDHQLATDKRTRPYVVKMAKNQDYFFKEFSRAITILSENNPLTGTKGEIRRQCNVVN  332



>ref|XP_007153945.1| hypothetical protein PHAVU_003G078600g [Phaseolus vulgaris]
 gb|AHA84293.1| cationic peroxidase 2 precursor [Phaseolus vulgaris]
 gb|ESW25939.1| hypothetical protein PHAVU_003G078600g [Phaseolus vulgaris]
Length=335

 Score =   380 bits (975),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 175/299 (59%), Positives = 224/299 (75%), Gaps = 2/299 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M +Y E+CP+AEDIIKEQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS    
Sbjct  33    LVMNFYKETCPQAEDIIKEQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRRS  92

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE+E+ R+FG+RNF+YI+TIK A+E ECP  VSCADI+ LSARDG V L GP   +KTG
Sbjct  93    LSEKETDRSFGLRNFRYIETIKEAVERECPGVVSCADILVLSARDGIVSLGGPHIPLKTG  152

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD + +    VE F+P+HN+S+  VL +F ++G+DT G VALLGAHSVGR HC+ +VHR
Sbjct  153   RRDGRRSRADVVEEFLPDHNESISSVLDKFGAMGIDTPGVVALLGAHSVGRTHCVKLVHR  212

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP +D  L+P +  ++  +CP A PDP+AV+  Y RNDR TPMILDN YY+NIL++KGL
Sbjct  213   LYPEIDSALNPDHVPHMLKKCPDAIPDPKAVQ--YVRNDRGTPMILDNNYYRNILDNKGL  270

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             L+VD  LA    T P+V+KMA    YF  +F+RA+ ++SENNPLTG +GEIRK C   N
Sbjct  271   LIVDHQLANDKRTKPYVKKMAKSQDYFFKEFSRAIALLSENNPLTGTKGEIRKQCNVAN  329



>ref|NP_001289781.1| ceruloplasmin precursor [Nelumbo nucifera]
 gb|ABN46984.1| cationic peroxidase [Nelumbo nucifera]
Length=331

 Score =   379 bits (973),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 175/299 (59%), Positives = 224/299 (75%), Gaps = 2/299 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M +Y +SCP+AEDIIKEQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS    
Sbjct  32    LVMTFYKDSCPQAEDIIKEQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRRD  91

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE+E+ R+FG+RNF+Y+ TIK A+E ECP  VSCADI+ LSARDG V L GP   +KTG
Sbjct  92    LSEKETDRSFGLRNFRYLDTIKEAVERECPGVVSCADILVLSARDGIVALGGPYIPLKTG  151

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD + +    +E F+P+HN+S+ +VL RF ++G+DT G VALLGAHSVGR HC+ +VHR
Sbjct  152   RRDGRRSRADVIEQFLPDHNESISVVLDRFAAMGIDTPGVVALLGAHSVGRTHCVKLVHR  211

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP VDP L+P + +++  +CP   PDP+AV+  Y RNDR TPM LDN YY+NI+++KGL
Sbjct  212   LYPEVDPALNPDHVEHMFKKCPDPIPDPKAVQ--YVRNDRGTPMKLDNNYYRNIMDNKGL  269

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             L+VD  LA    T P+V+KMA    YF  +FARA+ I+SENNPLTG +GEIRK C   N
Sbjct  270   LIVDHQLANDKRTKPYVKKMAKSQDYFFKEFARAITILSENNPLTGTKGEIRKQCSVAN  328



>ref|XP_009779064.1| PREDICTED: peroxidase 42-like [Nicotiana sylvestris]
 gb|AAD33072.1|AF149251_1 secretory peroxidase [Nicotiana tabacum]
Length=326

 Score =   379 bits (972),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 175/299 (59%), Positives = 224/299 (75%), Gaps = 2/299 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M YY +SCP+AEDII+EQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS   +
Sbjct  27    LVMDYYKDSCPQAEDIIREQVKLLYKRHKNTAFSWLRNIFHDCFVESCDASLLLDSTRRM  86

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE+E+ R+FGMRNF+YI+TIK A+E ECP  VSCADI+ LS RDG V L GP   +KTG
Sbjct  87    LSEKETDRSFGMRNFRYIETIKEAVERECPGVVSCADILVLSGRDGIVALGGPYVPLKTG  146

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD +++    +E  +P+HN+SM +VL RF ++G++  G VALLGAHSVGR HC+ +VHR
Sbjct  147   RRDGRKSRADILEQHLPDHNESMSVVLERFANVGINAPGVVALLGAHSVGRTHCVKLVHR  206

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP VDP L+P +  ++  +CP   PDP+AV+  Y RNDR TPM LDN YY+NILE+KGL
Sbjct  207   LYPEVDPQLNPDHVPHMLKKCPDPIPDPKAVQ--YVRNDRGTPMKLDNNYYRNILENKGL  264

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             ++VD  LAT   T P+V+KMA    YF  +FARA+ I++ENNPLTG +GEIRK C   N
Sbjct  265   MLVDHQLATDKRTKPYVKKMAKSQDYFFKEFARAITILTENNPLTGTKGEIRKQCNLAN  323



>gb|AAY26520.1| secretory peroxidase [Catharanthus roseus]
 gb|ABF47518.1| putative secretory peroxidase [Catharanthus roseus]
Length=330

 Score =   379 bits (972),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 178/299 (60%), Positives = 222/299 (74%), Gaps = 2/299 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M YY +SCP+AEDII+EQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS   V
Sbjct  31    LVMNYYKDSCPQAEDIIREQVKLLYKRHKNTAFSWLRNIFHDCFVESCDASLLLDSTRRV  90

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE+E+ R+FGMRNF+Y++ IK ALE ECP  VSCADI+ LSARDG V L GP   +KTG
Sbjct  91    LSEKETDRSFGMRNFRYLEDIKEALERECPGVVSCADILVLSARDGIVSLGGPFIPLKTG  150

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD + +    +E  +P+HN+S+ +VL RF SIG++T G VALLGAHSVGR HC+ +VHR
Sbjct  151   RRDGRRSRAEILEQHLPDHNESLTVVLERFGSIGINTPGLVALLGAHSVGRTHCVKLVHR  210

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP VDP    ++  ++  +CP   PDP+AV+  Y RNDR TPM LDN YY+NIL++KGL
Sbjct  211   LYPEVDPAFPESHVQHMLKKCPDPIPDPKAVQ--YVRNDRGTPMKLDNNYYRNILDNKGL  268

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             L+VD  LAT   T PFV+KMA    YF  +FARA+ I+SENNPLTG +GEIRK C   N
Sbjct  269   LLVDHQLATDKRTKPFVKKMAKSQDYFFKEFARAITILSENNPLTGTKGEIRKQCNVAN  327



>ref|XP_004232712.1| PREDICTED: peroxidase 42-like [Solanum lycopersicum]
Length=326

 Score =   379 bits (972),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 174/299 (58%), Positives = 225/299 (75%), Gaps = 2/299 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M YY ++CP+AE+IIKEQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS   +
Sbjct  27    LVMDYYKDTCPQAEEIIKEQVKLLYKRHKNTAFSWLRNIFHDCFVESCDASLLLDSTRRM  86

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE+E+ R+FGMRNF+YI+TIK A+E ECP  VSCADI+ LS RDG V L GP   +KTG
Sbjct  87    LSEKETDRSFGMRNFRYIETIKEAVERECPGVVSCADILVLSGRDGIVALGGPHIPLKTG  146

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD +++    +E  +P+HN+SM +VL RF +IG++T G VALLG+HSVGR HC+ +VHR
Sbjct  147   RRDGRKSRADILEQHLPDHNESMSVVLERFANIGINTPGVVALLGSHSVGRTHCVKLVHR  206

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP VDP L+P +  ++  +CP   PDP+AV+  Y RNDR TPM+LDN YY+NIL++KGL
Sbjct  207   LYPEVDPQLNPEHVPHMLKKCPDPIPDPKAVQ--YVRNDRGTPMVLDNNYYRNILDNKGL  264

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             ++VD  LA    T P+V+KMA    YF  +FARA+ I+SENNPLTG +GEIRK C   N
Sbjct  265   MLVDHQLAMDKRTKPYVKKMAKSQNYFFKEFARAITILSENNPLTGTKGEIRKQCNLAN  323



>ref|XP_006467438.1| PREDICTED: peroxidase 42-like [Citrus sinensis]
 gb|KDO78225.1| hypothetical protein CISIN_1g019129mg [Citrus sinensis]
Length=335

 Score =   379 bits (972),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 173/299 (58%), Positives = 224/299 (75%), Gaps = 2/299 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M +Y ++CP+AEDII+EQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS    
Sbjct  33    LVMNFYKDTCPQAEDIIREQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRKT  92

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE+E  R+FGMRNF+YI+ IK A+E ECP  VSCADI+ LS RDG V L GP   +KTG
Sbjct  93    LSEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTG  152

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD +++    +E ++P+HNDSM +VL RF +IG+D  G VALLG+HSVGR HC+ +VHR
Sbjct  153   RRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHR  212

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP VDP L+P +  ++  +CP A PDP+AV+  Y RNDR TPM+LDN YY+NIL++KGL
Sbjct  213   LYPEVDPALNPDHVPHMLHKCPDAIPDPKAVQ--YVRNDRGTPMVLDNNYYRNILDNKGL  270

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             ++VD  LAT   T P+V+KMA    YF  +F+RA+ ++SENNPLTG +GEIRK C   N
Sbjct  271   MMVDHQLATDKRTRPYVKKMAKSQDYFFKEFSRAITLLSENNPLTGTKGEIRKVCNLAN  329



>gb|KDO78221.1| hypothetical protein CISIN_1g019129mg [Citrus sinensis]
Length=311

 Score =   378 bits (970),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 173/299 (58%), Positives = 224/299 (75%), Gaps = 2/299 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M +Y ++CP+AEDII+EQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS    
Sbjct  9     LVMNFYKDTCPQAEDIIREQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRKT  68

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE+E  R+FGMRNF+YI+ IK A+E ECP  VSCADI+ LS RDG V L GP   +KTG
Sbjct  69    LSEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTG  128

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD +++    +E ++P+HNDSM +VL RF +IG+D  G VALLG+HSVGR HC+ +VHR
Sbjct  129   RRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHR  188

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP VDP L+P +  ++  +CP A PDP+AV+  Y RNDR TPM+LDN YY+NIL++KGL
Sbjct  189   LYPEVDPALNPDHVPHMLHKCPDAIPDPKAVQ--YVRNDRGTPMVLDNNYYRNILDNKGL  246

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             ++VD  LAT   T P+V+KMA    YF  +F+RA+ ++SENNPLTG +GEIRK C   N
Sbjct  247   MMVDHQLATDKRTRPYVKKMAKSQDYFFKEFSRAITLLSENNPLTGTKGEIRKVCNLAN  305



>emb|CDP04398.1| unnamed protein product [Coffea canephora]
Length=329

 Score =   378 bits (971),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 176/299 (59%), Positives = 222/299 (74%), Gaps = 2/299 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M +Y +SCP+AEDII+EQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS   V
Sbjct  30    LLMNFYKDSCPQAEDIIREQVKLLYKRHKNTAFSWLRNIFHDCFVESCDASLLLDSTRRV  89

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE+E+ R+FGMRNF+YI+ IK A+E ECP  VSCADI+ LSARDG V L GP   +KTG
Sbjct  90    LSEKETDRSFGMRNFRYIEDIKDAVERECPGVVSCADILVLSARDGIVALGGPYIPLKTG  149

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD + +    +E  +P+HN+SM +VL RF SIG+D  G VALLGAHSVGR HC+ +VHR
Sbjct  150   RRDGRRSRAEILEQHLPDHNESMTVVLDRFGSIGIDAPGVVALLGAHSVGRTHCVKLVHR  209

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP VDP    ++ +++  +CP   PDP+AV+  Y RNDR TPMILDN YY+NIL++KGL
Sbjct  210   LYPEVDPAFPASHVEHMLKKCPDTIPDPKAVQ--YVRNDRGTPMILDNNYYRNILDNKGL  267

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             L+VD  LA    T P+V+KMA    YF  +F+RA+ I+SENNPLTG +GEIRK C   N
Sbjct  268   LLVDHQLANDKRTKPYVKKMAKSQDYFFKEFSRAITILSENNPLTGSKGEIRKQCNLAN  326



>ref|XP_006348116.1| PREDICTED: peroxidase 42-like [Solanum tuberosum]
Length=326

 Score =   378 bits (971),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 174/299 (58%), Positives = 225/299 (75%), Gaps = 2/299 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M YY ++CP+AE+IIKEQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS   +
Sbjct  27    LVMDYYKDTCPQAEEIIKEQVKLLYKRHKNTAFSWLRNIFHDCFVESCDASLLLDSTRRM  86

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE+E+ R+FGMRNF+YI+TIK A+E ECP  VSCADI+ LS RDG V L GP   +KTG
Sbjct  87    LSEKETDRSFGMRNFRYIETIKEAVERECPGVVSCADILVLSGRDGIVALGGPHIPLKTG  146

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD +++    +E  +P+HN+SM +VL RF +IG++T G VALLG+HSVGR HC+ +VHR
Sbjct  147   RRDGRKSRADILEQHLPDHNESMSVVLERFANIGINTPGVVALLGSHSVGRTHCVKLVHR  206

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP VDP L+P +  ++  +CP   PDP+AV+  Y RNDR TPM+LDN YY+NIL++KGL
Sbjct  207   LYPEVDPQLNPEHVPHMLKKCPDPIPDPKAVQ--YVRNDRGTPMVLDNNYYRNILDNKGL  264

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             ++VD  LA    T P+V+KMA    YF  +FARA+ I+SENNPLTG +GEIRK C   N
Sbjct  265   MLVDHQLAMDKRTKPYVKKMAKSQNYFFKEFARAITILSENNPLTGTKGEIRKQCNLSN  323



>ref|XP_007026071.1| Peroxidase superfamily protein [Theobroma cacao]
 gb|EOY28693.1| Peroxidase superfamily protein [Theobroma cacao]
Length=329

 Score =   377 bits (969),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 174/299 (58%), Positives = 224/299 (75%), Gaps = 2/299 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M +Y ++CP+AE+II+EQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS    
Sbjct  30    LVMSFYKDTCPQAEEIIREQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRRT  89

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE+E+ R+FG+RNF+YI+TIK A+E ECP  VSCADI+ LSARDG V L GP   +KTG
Sbjct  90    LSEKETDRSFGLRNFRYIETIKEAVERECPGVVSCADILVLSARDGIVSLGGPYIPLKTG  149

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD + +    VE ++P+HN+++  VL RF ++G+DT G VALLGAHSVGR HC+ +VHR
Sbjct  150   RRDGRRSRADVVEEYLPDHNETISAVLDRFSAMGIDTPGVVALLGAHSVGRTHCVKLVHR  209

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP VDP L+P +  ++  +CP   PDP+AV+  Y RNDR TPMILDN YY+NIL++KGL
Sbjct  210   LYPDVDPALNPDHVPHMLHKCPDQIPDPKAVQ--YVRNDRGTPMILDNNYYRNILDNKGL  267

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             L+VD  LA    T P+V+KMA    YF  +FARA+ I+SENNPLTG +GEIRK C   N
Sbjct  268   LIVDHQLAYDKRTKPYVKKMAKSQDYFFKEFARAITILSENNPLTGTKGEIRKQCNVAN  326



>ref|XP_010057924.1| PREDICTED: peroxidase 42-like [Eucalyptus grandis]
 gb|KCW75308.1| hypothetical protein EUGRSUZ_E04056 [Eucalyptus grandis]
Length=337

 Score =   377 bits (969),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 174/299 (58%), Positives = 222/299 (74%), Gaps = 2/299 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L + +Y ++CP+AEDIIKEQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS    
Sbjct  38    LVIDFYKDTCPQAEDIIKEQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRRD  97

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE+E+ R+FGMRNF+Y+ TIK A+E ECP  VSCADI+ LSARDG V L GP+  +KTG
Sbjct  98    LSEKETDRSFGMRNFRYLDTIKEAVERECPGVVSCADILVLSARDGVVALGGPQIPLKTG  157

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD + +    +E  +P+HN+SM +VL RF  +G+DT G VALLGAHSVGR HC+ +V R
Sbjct  158   RRDGRRSRADVIEEHLPDHNESMSVVLERFAKMGIDTPGVVALLGAHSVGRTHCVKLVQR  217

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP VDP L+P + +++  +CP   PDP+AV+  Y RNDR TPMI DN YY+NIL++KGL
Sbjct  218   LYPEVDPALNPDHVEHMLYKCPDPIPDPKAVQ--YVRNDRGTPMIFDNNYYRNILDNKGL  275

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             L+VD  LA    T P+V+KMA    YF  +FARAL  +SENNPLTGD+GEIR+ C   N
Sbjct  276   LLVDHQLAVDKRTKPYVKKMAKSQNYFFKEFARALTTLSENNPLTGDKGEIRRQCNVAN  334



>ref|XP_009613011.1| PREDICTED: peroxidase 42-like [Nicotiana tomentosiformis]
Length=326

 Score =   377 bits (968),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 174/299 (58%), Positives = 224/299 (75%), Gaps = 2/299 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M YY ++CP+AEDII+EQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS   +
Sbjct  27    LVMDYYKDTCPQAEDIIREQVKLLYKRHKNTAFSWLRNIFHDCFVESCDASLLLDSTRRM  86

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE+E+ R+FGMRNF+YI+TIK A+E ECP  VSCADI+ LS RDG V L GP   +KTG
Sbjct  87    LSEKETDRSFGMRNFRYIETIKEAVERECPGVVSCADILVLSGRDGIVALGGPYVPLKTG  146

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD +++    +E  +P+HN+SM +VL RF ++G++T G VALLGAHSVGR HC+ +VHR
Sbjct  147   RRDGRKSRADILEQHLPDHNESMSVVLERFANVGINTPGVVALLGAHSVGRTHCVKLVHR  206

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP VDP L+P +  ++  +CP   PDP+AV+  Y RNDR TPM LDN YY+NILE+KGL
Sbjct  207   LYPEVDPQLNPDHVPHMLKKCPDPIPDPKAVQ--YVRNDRGTPMKLDNNYYRNILENKGL  264

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             ++VD  LA    T P+V+KMA    YF  +FARA+ I++ENNPLTG +GEIRK C   N
Sbjct  265   MLVDHQLAMDKRTKPYVKKMAKSQDYFFKEFARAITILTENNPLTGTKGEIRKQCNLAN  323



>gb|AGV54491.1| cationic peroxidase [Phaseolus vulgaris]
Length=335

 Score =   377 bits (968),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 174/299 (58%), Positives = 223/299 (75%), Gaps = 2/299 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M +Y E+CP+AEDIIKEQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS    
Sbjct  33    LVMNFYKETCPQAEDIIKEQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRRS  92

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE+E+ R+FG+RNF+YI+TIK A+E ECP  VSCADI+ LSARDG V L  P   +KTG
Sbjct  93    LSEKETDRSFGLRNFRYIETIKEAVERECPGVVSCADILVLSARDGIVSLGSPHIPLKTG  152

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD + +    VE F+P+HN+S+  VL +F ++G+DT G VALLGAHSVGR HC+ +VHR
Sbjct  153   RRDGRRSRADVVEEFLPDHNESISSVLDKFGAMGIDTPGVVALLGAHSVGRTHCVKLVHR  212

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP +D  L+P +  ++  +CP A PDP+AV+  Y RNDR TPMILDN YY+NIL++KGL
Sbjct  213   LYPEIDSALNPDHVPHMLKKCPDAIPDPKAVQ--YVRNDRGTPMILDNNYYRNILDNKGL  270

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             L+VD  LA    T P+V+KMA    YF  +F+RA+ ++SENNPLTG +GEIRK C   N
Sbjct  271   LIVDHQLANDKRTKPYVKKMAKSQDYFFKEFSRAIALLSENNPLTGTKGEIRKQCNVAN  329



>ref|XP_004293288.1| PREDICTED: peroxidase 42-like [Fragaria vesca subsp. vesca]
 gb|AFQ36035.1| peroxidase [Fragaria x ananassa]
Length=330

 Score =   377 bits (968),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 173/299 (58%), Positives = 223/299 (75%), Gaps = 2/299 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M +YS+SCP+AE+I++EQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS    
Sbjct  31    LVMNFYSDSCPQAEEIVREQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRRS  90

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE+E  R+FGMRNF+YI+ IK ALE ECP  VSC+DI+ LSAR+G V L GP   +KTG
Sbjct  91    LSEKEMDRSFGMRNFRYIEEIKEALERECPGVVSCSDILVLSAREGVVRLGGPFIPLKTG  150

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD + +    +E ++P+HN+SM  VL +F ++G+DT G VALLGAHSVGR HC+ +VHR
Sbjct  151   RRDGRRSRAEILEEYLPDHNESMSTVLEKFSAMGIDTPGVVALLGAHSVGRTHCVKLVHR  210

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP VDP L+P +  ++  +CP A PDP+AV+  Y RNDR TPMI DN YY+NIL++KGL
Sbjct  211   LYPEVDPALNPDHVPHMLKKCPDAIPDPKAVQ--YVRNDRGTPMIFDNNYYRNILDNKGL  268

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             ++VD  LAT   T P+V+KMA    YF  +F RA  I+SENNPLTGD+GEIR+ C   N
Sbjct  269   MMVDHQLATDKRTKPYVKKMAKSQDYFFKEFTRAFTILSENNPLTGDKGEIRQQCNVAN  327



>gb|AHA84196.1| cationic peroxidase 2 precursor [Phaseolus vulgaris]
Length=335

 Score =   377 bits (968),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 174/299 (58%), Positives = 223/299 (75%), Gaps = 2/299 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M +Y E+CP+AEDIIKEQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS    
Sbjct  33    LVMNFYKETCPQAEDIIKEQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRRS  92

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE+E+ R+FG+RNF+YI+TIK A+E ECP  VSCADI+ LSARDG V L GP   +KTG
Sbjct  93    LSEKETDRSFGLRNFRYIETIKEAVERECPGVVSCADILVLSARDGIVSLGGPHIPLKTG  152

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD + +    VE F+P+HN+S+  VL +F ++G+DT G VALLGAHSVGR HC+ +VHR
Sbjct  153   RRDGRRSRADVVEEFLPDHNESISSVLDKFGAMGIDTPGVVALLGAHSVGRTHCVKLVHR  212

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP +D  L+P +  ++  +CP A PDP+AV+  Y RNDR TPMILDN YY+NIL++KGL
Sbjct  213   LYPEIDSALNPDHVPHMLKKCPDAIPDPKAVQ--YVRNDRGTPMILDNNYYRNILDNKGL  270

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             L+VD  LA    T P+V+KMA    YF  +F+RA+ ++ ENNPLTG +GEIRK C   N
Sbjct  271   LIVDHQLANDKRTKPYVKKMAKSQDYFFKEFSRAIALLFENNPLTGTKGEIRKQCNVAN  329



>gb|AGV54649.1| cationic peroxidase 2 [Phaseolus vulgaris]
Length=335

 Score =   377 bits (967),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 174/299 (58%), Positives = 223/299 (75%), Gaps = 2/299 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M +Y E+CP+AEDIIKEQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS    
Sbjct  33    LVMNFYKETCPQAEDIIKEQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRRS  92

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE+E+ R+FG+RNF+YI+TIK A+E ECP  VSCADI+ LSARDG V L GP   +KTG
Sbjct  93    LSEKETDRSFGLRNFRYIETIKEAVERECPGVVSCADILVLSARDGIVSLGGPHIPLKTG  152

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             R D + +    VE F+P+HN+S+  VL +F ++G+DT G VALLGAHSVGR HC+ +VHR
Sbjct  153   RWDGRRSRADVVEEFLPDHNESISSVLDKFGAMGIDTPGVVALLGAHSVGRTHCVKLVHR  212

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP +D  L+P +  ++  +CP A PDP+AV+  Y RNDR TPMILDN YY+NIL++KGL
Sbjct  213   LYPEIDSALNPDHVPHMLKKCPDAIPDPKAVQ--YVRNDRGTPMILDNNYYRNILDNKGL  270

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             L+VD  LA    T P+V+KMA    YF  +F+RA+ ++SENNPLTG +GEIRK C   N
Sbjct  271   LIVDHQLANDKRTKPYVKKMAKSQDYFFKEFSRAIALLSENNPLTGTKGEIRKQCNVAN  329



>ref|XP_010538938.1| PREDICTED: peroxidase 42 [Tarenaya hassleriana]
Length=330

 Score =   376 bits (966),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 173/299 (58%), Positives = 228/299 (76%), Gaps = 2/299 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M +Y ++CP+AEDII+EQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS    
Sbjct  31    LMMNFYKDTCPQAEDIIREQVRLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRRE  90

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE+E+ R+FG+RNF+YI+TIK ALE ECP  VSCADI+ LSARDG   + GP   +KTG
Sbjct  91    LSEKETDRSFGLRNFRYIETIKEALERECPGVVSCADILVLSARDGIEAVGGPHIPLKTG  150

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD +++    +E ++P+HN+S+ +VL +F++IGVDT G VALLGAHSVGR HC+ +VHR
Sbjct  151   RRDGRKSRAELLEEYLPDHNESISVVLDKFKAIGVDTPGLVALLGAHSVGRTHCVKLVHR  210

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP VDP+L+P +  ++  +CP + PDP+AV+  Y RNDR TPM LDN YY+NIL++KGL
Sbjct  211   LYPEVDPSLNPDHVPHMLHKCPDSIPDPKAVQ--YVRNDRGTPMKLDNNYYRNILDNKGL  268

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             L+VD  LA    T P+V+KMA D  YF  +F+RA+ ++SENNPLTG +GEIRK C   N
Sbjct  269   LLVDHQLAYDKRTRPYVKKMAKDEDYFFKEFSRAIQVLSENNPLTGSKGEIRKQCNVAN  327



>gb|AAA99868.1| peroxidase [Gossypium hirsutum]
Length=332

 Score =   375 bits (964),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 173/299 (58%), Positives = 223/299 (75%), Gaps = 2/299 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M +Y +SCP+AEDIIKEQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS    
Sbjct  33    LVMNFYKDSCPQAEDIIKEQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRRS  92

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE+E+ R+FG+RNF+YI+TIK A+E ECP  VSCADI+ LSAR+G V L GP   +KTG
Sbjct  93    LSEKETDRSFGLRNFRYIETIKEAVERECPGVVSCADILVLSAREGIVSLGGPYIPLKTG  152

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD + +    VE ++P+HN+++  VL RF ++G+DT G VALLGAHSVGR HC+ +VHR
Sbjct  153   RRDGRRSRADVVEEYLPDHNETISGVLDRFAAMGIDTPGVVALLGAHSVGRTHCVKLVHR  212

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP VDP L P +  ++  +CP   PDP+AV+  Y RNDR TPM+LDN YY+NIL++KGL
Sbjct  213   LYPEVDPALSPDHVPHMLHKCPDQIPDPKAVQ--YVRNDRGTPMVLDNNYYRNILDNKGL  270

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             L+VD  LA    T P+V+KMA    YF  +F+RA+ ++SENNPLTG +GEIRK C   N
Sbjct  271   LIVDHQLAYDKRTRPYVKKMAKSQDYFFKEFSRAITLLSENNPLTGSKGEIRKQCNLAN  329



>ref|XP_010278692.1| PREDICTED: peroxidase 42-like [Nelumbo nucifera]
Length=331

 Score =   374 bits (959),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 172/299 (58%), Positives = 222/299 (74%), Gaps = 2/299 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M +Y ++CP+AEDII+EQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS    
Sbjct  32    LVMNFYKDACPQAEDIIREQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRRD  91

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE+E+ R+FG+RNF+Y+ TIK A+E ECP  VSCADI+ LSARDG V L GP   +KTG
Sbjct  92    LSEKETDRSFGLRNFRYLDTIKEAVERECPGVVSCADILVLSARDGIVSLGGPYIPLKTG  151

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD + +    +E ++P+HN+S+ +VL RF ++G+DT G VALLGAHSVGR HCI +VHR
Sbjct  152   RRDGRRSRADVIEQYLPDHNESISVVLDRFAAMGIDTPGVVALLGAHSVGRTHCIKLVHR  211

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP VDP  +  + +++  +CP   PDP+AV+  Y RNDR TPM LDN YY+NIL++KGL
Sbjct  212   LYPEVDPAFNSNHVEHMLKKCPDPIPDPKAVQ--YVRNDRGTPMKLDNNYYRNILDNKGL  269

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             L+VD  LA    T P+V+KMA    YF  +FARA+ I+SENNPLTG +GEIRK C   N
Sbjct  270   LIVDHQLANDKRTKPYVKKMAKSQDYFFKEFARAITILSENNPLTGTKGEIRKQCSVAN  328



>ref|NP_001266136.1| peroxidase 42-like precursor [Cicer arietinum]
 emb|CAB71128.2| cationic peroxidase [Cicer arietinum]
Length=336

 Score =   373 bits (958),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 173/301 (57%), Positives = 224/301 (74%), Gaps = 2/301 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M YY ESCP+AE+IIKEQV  LY+ H NTA SWLRN+FHDC V++CDAS+LL S    
Sbjct  32    LLMNYYKESCPQAEEIIKEQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLTSTRRS  91

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE+E  R+FG+RNF+YI TIK A+E ECP  VSC+DI+ LSARDG V L GP   +KTG
Sbjct  92    LSEQEHDRSFGLRNFRYIDTIKEAVERECPGVVSCSDILVLSARDGIVSLGGPYIPLKTG  151

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD +++ +  +E ++P+HN+S+  VL +F ++G+DT G VALLGAHSVGR HC+ +VHR
Sbjct  152   RRDGRKSRVDLLEEYLPDHNESISAVLDKFGAMGIDTSGVVALLGAHSVGRTHCVKLVHR  211

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP VDP L+P +  ++  +CP + PDP+AV+  Y RNDR TPMILDN YY+NIL++KGL
Sbjct  212   LYPEVDPALNPEHIPHMLKKCPDSIPDPKAVQ--YVRNDRGTPMILDNNYYRNILDNKGL  269

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVNT  1234
             L VD  LA    T P+V+KMA    YF  +F+RA+ ++SENNPLTG +GEIRK C   N 
Sbjct  270   LSVDHQLAHDKRTKPYVKKMAKSQDYFFKEFSRAITLLSENNPLTGTKGEIRKQCSVANK  329

Query  1235  K  1237
             +
Sbjct  330   Q  330



>ref|XP_007211579.1| hypothetical protein PRUPE_ppa008503mg [Prunus persica]
 gb|EMJ12778.1| hypothetical protein PRUPE_ppa008503mg [Prunus persica]
Length=329

 Score =   372 bits (956),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 171/299 (57%), Positives = 221/299 (74%), Gaps = 2/299 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M +Y +SCP+AED+I+EQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS    
Sbjct  29    LVMDFYKDSCPQAEDVIREQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRRS  88

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE+E  R+FGMRNF+YI+ IK ALE ECP  VSC+DI+ LSAR+G V L GP   +KTG
Sbjct  89    LSEKEMDRSFGMRNFRYIEEIKEALERECPGVVSCSDILVLSAREGVVRLGGPFIPLKTG  148

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD + +    +E ++P+HN+SM  VL +F  +G+DT G VALLGAHSVGR HC+ +VHR
Sbjct  149   RRDGRRSRAEILEQYLPDHNESMSTVLEKFADMGIDTPGLVALLGAHSVGRTHCVKLVHR  208

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP VDP L+P +  ++  +CP A PDP+AV+  Y RNDR TPMI DN YY+NIL++KGL
Sbjct  209   LYPEVDPQLNPDHVGHMLKKCPDAIPDPKAVQ--YVRNDRGTPMIFDNNYYRNILDNKGL  266

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             ++VD  LAT   T P+V+KMA    YF  +F++A  I+SENNPLTG +GEIR+ C   N
Sbjct  267   MMVDHQLATDKRTKPYVKKMAKSQDYFFKEFSKAFTILSENNPLTGTKGEIRQQCNVAN  325



>ref|XP_008224830.1| PREDICTED: peroxidase 42 [Prunus mume]
Length=329

 Score =   372 bits (955),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 170/299 (57%), Positives = 221/299 (74%), Gaps = 2/299 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M +Y +SCP+AED+I+EQV  LY+ H NTA SWLRN+FHDC +++CDAS+LLDS    
Sbjct  29    LVMDFYKDSCPQAEDVIREQVKLLYKRHKNTAFSWLRNIFHDCALQSCDASLLLDSTRRS  88

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE+E  R+FGMRNF+YI+ IK ALE ECP  VSC+D++ LSAR+G V L GP   +KTG
Sbjct  89    LSEKEMDRSFGMRNFRYIEEIKEALERECPGVVSCSDVLVLSAREGVVRLGGPFIPLKTG  148

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD + +    +E ++P+HN+SM  VL +F  +G+DT G VALLGAHSVGR HC+ +VHR
Sbjct  149   RRDGRRSRAEILEQYLPDHNESMSTVLEKFADMGIDTPGLVALLGAHSVGRTHCVKLVHR  208

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP VDP L+P +  ++  +CP A PDP+AV+  Y RNDR TPMI DN YY+NIL++KGL
Sbjct  209   LYPEVDPQLNPDHVGHMLKKCPDAIPDPKAVQ--YVRNDRGTPMIFDNNYYRNILDNKGL  266

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             ++VD  LAT   T P+V+KMA    YF  +F+RA  I+SENNPLTG +GEIR+ C   N
Sbjct  267   MMVDHQLATDKRTKPYVKKMAKSQDYFFKEFSRAFTILSENNPLTGTKGEIRQQCNVAN  325



>ref|XP_009360637.1| PREDICTED: peroxidase 42-like [Pyrus x bretschneideri]
Length=341

 Score =   372 bits (956),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 170/299 (57%), Positives = 223/299 (75%), Gaps = 2/299 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M +Y ++CP+AE++I+EQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS    
Sbjct  41    LVMDFYRDTCPQAEEVIREQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRRS  100

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE+E  R+FGMRNF+YI+ IK ALE ECP  VSC+DI+ LSAR+G V L GP   +KTG
Sbjct  101   LSEKEMDRSFGMRNFRYIEEIKEALERECPGVVSCSDILVLSAREGVVRLGGPFIPLKTG  160

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD + +    +E ++P+HN+SM +VL +F  +G+DT G VALLGAHSVGR HC+ +VHR
Sbjct  161   RRDGRRSRAEILEQYLPDHNESMSVVLEKFADMGIDTPGVVALLGAHSVGRTHCVKLVHR  220

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP VDP L+P +  ++  +CP A PDP+AV+  Y RNDR TPMI DN YY+NIL++KGL
Sbjct  221   LYPEVDPQLNPDHVPHMLKKCPDAIPDPKAVQ--YVRNDRGTPMIFDNNYYRNILDNKGL  278

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             ++VD  LAT   T P+V+KMA    YF  +F+RA  I+SENNPLTG++GEIR+ C   N
Sbjct  279   MMVDHQLATDKRTKPYVKKMAKSQDYFFKEFSRAFTILSENNPLTGNKGEIRQQCNVAN  337



>gb|AFY97687.1| peroxidase 4 [Pyrus pyrifolia]
Length=336

 Score =   372 bits (954),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 170/299 (57%), Positives = 223/299 (75%), Gaps = 2/299 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M +Y ++CP+AE++I+EQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS    
Sbjct  36    LVMDFYRDTCPQAEEVIREQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRRS  95

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE+E  R+FGMRNF+YI+ IK ALE ECP  VSC+DI+ LSAR+G V L GP   +KTG
Sbjct  96    LSEKEMDRSFGMRNFRYIEEIKEALERECPGVVSCSDILVLSAREGVVRLGGPFIPLKTG  155

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD + +    +E ++P+HN+SM +VL +F  +G+DT G VALLGAHSVGR HC+ +VHR
Sbjct  156   RRDGRRSRAEILEQYLPDHNESMSVVLEKFADMGIDTPGLVALLGAHSVGRTHCVKLVHR  215

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP VDP L+P +  ++  +CP A PDP+AV+  Y RNDR TPMI DN YY+NIL++KGL
Sbjct  216   LYPEVDPQLNPDHVPHMLKKCPDAIPDPKAVQ--YVRNDRGTPMIFDNNYYRNILDNKGL  273

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             ++VD  LAT   T P+V+KMA    YF  +F+RA  I+SENNPLTG++GEIR+ C   N
Sbjct  274   MMVDHQLATDKRTKPYVKKMAKSQDYFFKEFSRAFTILSENNPLTGNKGEIRQQCNVAN  332



>ref|XP_006413703.1| hypothetical protein EUTSA_v10025680mg [Eutrema salsugineum]
 dbj|BAJ34150.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ55156.1| hypothetical protein EUTSA_v10025680mg [Eutrema salsugineum]
Length=331

 Score =   371 bits (953),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 170/299 (57%), Positives = 225/299 (75%), Gaps = 2/299 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M +Y ++CP+AEDII+EQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS    
Sbjct  32    LMMNFYKDTCPQAEDIIREQVKLLYKRHKNTAFSWLRNIFHDCAVESCDASLLLDSTRRE  91

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
               E+E  R+FG+RNF+YI+ IK ALE ECP  VSC+DI+ LSAR+G   + GP   MKTG
Sbjct  92    LGEKEHDRSFGLRNFRYIEEIKEALERECPGVVSCSDILVLSAREGIEAVGGPHIPMKTG  151

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD +++    +E+++P+HN+S+ +VL +F+SIG+DT G VALLG+HSVGR HC+ +VHR
Sbjct  152   RRDGRKSRTDMLESYLPDHNESISVVLEKFKSIGIDTPGLVALLGSHSVGRTHCVKLVHR  211

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP VDP+L+P +  ++  +CP + PDP+AV+  Y RNDR TPM+LDN YY+NIL++KGL
Sbjct  212   LYPEVDPSLNPDHVPHMLHKCPDSIPDPKAVQ--YVRNDRGTPMVLDNNYYRNILDNKGL  269

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             L+VD  LA    T P V+KMA D  YF  +F RA+ I+SENNPLTG +GEIRK C   N
Sbjct  270   LLVDHQLAHDKRTRPIVKKMAKDQAYFFKEFTRAIQILSENNPLTGSKGEIRKQCNLAN  328



>ref|XP_008345825.1| PREDICTED: peroxidase 42-like [Malus domestica]
Length=335

 Score =   371 bits (953),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 169/299 (57%), Positives = 223/299 (75%), Gaps = 2/299 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L + +Y ++CP+AE++I+EQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS    
Sbjct  35    LVVDFYRDTCPQAEEVIREQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRRS  94

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE+E  R+FGMRNF+YI+ IK ALE ECP  VSC+DI+ LSAR+G V L GP   +KTG
Sbjct  95    LSEKEMDRSFGMRNFRYIEEIKEALERECPGVVSCSDILVLSAREGVVRLGGPFIPLKTG  154

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD + +    +E ++P+HN+SM +VL +F  +G+DT G VALLGAHSVGR HC+ +VHR
Sbjct  155   RRDGRRSRAEILEQYLPDHNESMSVVLEKFADMGIDTPGVVALLGAHSVGRTHCVKLVHR  214

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP VDP L+P +  ++  +CP A PDP+AV+  Y RNDR TPMI DN YY+NIL++KGL
Sbjct  215   LYPEVDPQLNPDHVPHMLKKCPDAIPDPKAVQ--YVRNDRGTPMIFDNNYYRNILDNKGL  272

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             ++VD  LAT   T P+V+KMA    YF  +F+RA  I+SENNPLTG++GEIR+ C   N
Sbjct  273   MMVDHQLATDKRTKPYVKKMAKSQDYFFKEFSRAFTILSENNPLTGNKGEIRQQCNXAN  331



>gb|ABU54828.1| peroxidase [Eutrema halophilum]
Length=331

 Score =   370 bits (950),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 169/299 (57%), Positives = 225/299 (75%), Gaps = 2/299 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M +Y ++CP+AEDII+EQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS    
Sbjct  32    LMMNFYKDTCPQAEDIIREQVKLLYKRHKNTAFSWLRNIFHDCAVESCDASLLLDSTRRE  91

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
               E+E  R+FG+RNF+YI+ IK ALE ECP  VSC+DI+ LSAR+G   + GP   +KTG
Sbjct  92    LGEKEHDRSFGLRNFRYIEEIKEALERECPGVVSCSDILVLSAREGIEAVGGPHIPLKTG  151

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD +++    +E+++P+HN+S+ +VL +F+SIG+DT G VALLG+HSVGR HC+ +VHR
Sbjct  152   RRDGRKSRTDMLESYLPDHNESISVVLEKFKSIGIDTPGLVALLGSHSVGRTHCVKLVHR  211

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP VDP+L+P +  ++  +CP + PDP+AV+  Y RNDR TPM+LDN YY+NIL++KGL
Sbjct  212   LYPEVDPSLNPDHVPHMLHKCPDSIPDPKAVQ--YVRNDRGTPMVLDNNYYRNILDNKGL  269

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             L+VD  LA    T P V+KMA D  YF  +F RA+ I+SENNPLTG +GEIRK C   N
Sbjct  270   LLVDHQLAHDKRTRPIVKKMAKDQAYFFKEFTRAIQILSENNPLTGSKGEIRKQCNLAN  328



>ref|XP_009135472.1| PREDICTED: peroxidase 42 [Brassica rapa]
 emb|CDX82887.1| BnaC01g13370D [Brassica napus]
 emb|CDX79113.1| BnaA01g11800D [Brassica napus]
Length=331

 Score =   370 bits (949),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 169/299 (57%), Positives = 225/299 (75%), Gaps = 2/299 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M +Y ++CP+AEDII+EQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS    
Sbjct  32    LMMNFYKDTCPQAEDIIREQVKLLYKRHKNTAFSWLRNIFHDCAVESCDASLLLDSTRRE  91

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
               E+E  R+FG+RNF+YI+ IK ALE ECP  VSC+DI+ LSAR+G   + GP   +KTG
Sbjct  92    LGEKEHDRSFGLRNFRYIEEIKEALERECPGVVSCSDILVLSAREGIEAVGGPHIPLKTG  151

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD +++    +E+++P+HN+S+ +VL +F+SIG+DT G VALLG+HSVGR HC+ +VHR
Sbjct  152   RRDGRKSRTDMLESYLPDHNESISVVLEKFKSIGIDTPGLVALLGSHSVGRTHCVKLVHR  211

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP VDP+L+P +  ++  +CP + PDP+AV+  Y RNDR TPM+LDN YY+NIL++KGL
Sbjct  212   LYPEVDPSLNPDHVPHMLHKCPDSIPDPKAVQ--YVRNDRGTPMVLDNNYYRNILDNKGL  269

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             L+VD  LA    T P V+KMA D  YF  +F RA+ I+SENNPLTG +GEIRK C   N
Sbjct  270   LLVDHQLAHDKRTRPIVKKMAKDQAYFFKEFTRAIQILSENNPLTGSKGEIRKQCNLAN  328



>ref|XP_003610431.1| Peroxidase [Medicago truncatula]
 gb|AES92628.1| cationic peroxidase [Medicago truncatula]
Length=335

 Score =   370 bits (949),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 171/301 (57%), Positives = 225/301 (75%), Gaps = 2/301 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M YY E+CP+AE+IIKEQV  LY+ H NTA SWLRN+FHDC V++CDAS+LL S    
Sbjct  32    LVMNYYKEACPQAEEIIKEQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLTSTRRS  91

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE+E  R+FG+RNF+YI TIK A+E ECP  VSC+DI+ LSAR+G V L GP   +KTG
Sbjct  92    LSEQEHDRSFGLRNFRYIDTIKEAVERECPGVVSCSDILVLSAREGIVSLGGPYIPLKTG  151

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD +++ +  +E ++P+HN+S+  VL +F ++G+DT G VALLGAHSVGR HC  +VHR
Sbjct  152   RRDGRKSRVDLLEAYLPDHNESISAVLDKFGAMGIDTPGVVALLGAHSVGRTHCTKLVHR  211

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP VDP L+P +  ++  +CP + PDP+AV+  Y RNDR TPMILDN YY+NIL++KGL
Sbjct  212   LYPEVDPALNPEHIPHMLKKCPDSIPDPKAVQ--YVRNDRGTPMILDNNYYRNILDNKGL  269

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVNT  1234
             L+VD  LA    T P+V+KMA   +YF  +F+RA+ ++SENNPLTG +GEIRK C   N 
Sbjct  270   LIVDHQLAHDKRTKPYVKKMAKSQEYFFKEFSRAITLLSENNPLTGTKGEIRKQCSVSNK  329

Query  1235  K  1237
             +
Sbjct  330   Q  330



>gb|KDO78226.1| hypothetical protein CISIN_1g019129mg [Citrus sinensis]
Length=346

 Score =   370 bits (950),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 173/310 (56%), Positives = 224/310 (72%), Gaps = 13/310 (4%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M +Y ++CP+AEDII+EQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS    
Sbjct  33    LVMNFYKDTCPQAEDIIREQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRKT  92

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE+E  R+FGMRNF+YI+ IK A+E ECP  VSCADI+ LS RDG V L GP   +KTG
Sbjct  93    LSEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTG  152

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALL-----------GAHSV  841
             RRD +++    +E ++P+HNDSM +VL RF +IG+D  G VALL           G+HSV
Sbjct  153   RRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGLSYYYWSISSGSHSV  212

Query  842   GRVHCINIVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNM  1021
             GR HC+ +VHRLYP VDP L+P +  ++  +CP A PDP+AV+  Y RNDR TPM+LDN 
Sbjct  213   GRTHCVKLVHRLYPEVDPALNPDHVPHMLHKCPDAIPDPKAVQ--YVRNDRGTPMVLDNN  270

Query  1022  YYKNILEHKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQG  1201
             YY+NIL++KGL++VD  LAT   T P+V+KMA    YF  +F+RA+ ++SENNPLTG +G
Sbjct  271   YYRNILDNKGLMMVDHQLATDKRTRPYVKKMAKSQDYFFKEFSRAITLLSENNPLTGTKG  330

Query  1202  EIRKNCRYVN  1231
             EIRK C   N
Sbjct  331   EIRKVCNLAN  340



>ref|XP_008358754.1| PREDICTED: peroxidase 42-like [Malus domestica]
Length=337

 Score =   369 bits (948),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 169/299 (57%), Positives = 222/299 (74%), Gaps = 2/299 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M +Y ++CP+AE++I+EQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS    
Sbjct  37    LVMDFYRDTCPQAEEVIREQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRRS  96

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE+E  R+FGMRNF+YI+ IK ALE ECP  VSC+DI+ LSAR+G V L GP   +KTG
Sbjct  97    LSEKEMDRSFGMRNFRYIEEIKEALERECPGVVSCSDILVLSAREGVVRLGGPFIPLKTG  156

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD + +    +E ++P+HN+SM +VL +F  +G+DT G VALLGAHSVGR HC+ +VHR
Sbjct  157   RRDGRRSRADILEQYLPDHNESMSVVLEKFADMGIDTPGLVALLGAHSVGRTHCVKLVHR  216

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP  DP L+P +  ++  +CP A PDP+AV+  Y RNDR TPMI DN YY+NIL++KGL
Sbjct  217   LYPEXDPQLNPDHVPHMLKKCPDAIPDPKAVQ--YVRNDRGTPMIFDNNYYRNILDNKGL  274

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             ++VD  LAT   T P+V+KMA    YF  +F+RA  I+SENNPLTG++GEIR+ C   N
Sbjct  275   MMVDHQLATDKRTKPYVKKMAKSQDYFFKEFSRAFTILSENNPLTGNKGEIRQQCNVAN  333



>ref|XP_006841743.1| hypothetical protein AMTR_s00003p00260700 [Amborella trichopoda]
 gb|ERN03418.1| hypothetical protein AMTR_s00003p00260700 [Amborella trichopoda]
Length=336

 Score =   369 bits (948),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 172/303 (57%), Positives = 223/303 (74%), Gaps = 2/303 (1%)
 Frame = +2

Query  323   AKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDS  502
             A   L M YY++SCP+AED+I+EQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS
Sbjct  32    ADTGLMMNYYTDSCPQAEDVIREQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDS  91

Query  503   VAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAE  682
                  SE+E+ R+FG+RNF+Y+ TIK A+E ECP  VSCADI+ LSARDG V L GP   
Sbjct  92    TRRSLSEKETDRSFGLRNFRYLDTIKEAVERECPGVVSCADILVLSARDGIVALGGPYIP  151

Query  683   MKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCIN  862
             +KTGRRD + +    +E ++P+HN+S+  VL++F++IG+DT G VALLGAHSVGR HC+ 
Sbjct  152   LKTGRRDGRRSRAEVLEEYLPDHNESISGVLAKFEAIGIDTPGVVALLGAHSVGRTHCVK  211

Query  863   IVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILE  1042
             +VHRLYP VDP L+P + +++  +CP   P+P+AV+  Y RNDR TPMILDN YY+N++E
Sbjct  212   LVHRLYPEVDPALNPDHVEHMLHKCPDPIPNPKAVQ--YVRNDRGTPMILDNNYYRNVME  269

Query  1043  HKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCR  1222
              KGLL VD  L     T  FV+KMA    YF  +FARA+ I+SENNPLTG +GEIR  C 
Sbjct  270   GKGLLQVDHQLYEDKRTRFFVKKMAKSQDYFFKEFARAITILSENNPLTGTKGEIRAVCN  329

Query  1223  YVN  1231
               N
Sbjct  330   VAN  332



>ref|XP_006282667.1| hypothetical protein CARUB_v10005223mg [Capsella rubella]
 ref|XP_010434099.1| PREDICTED: peroxidase 42 [Camelina sativa]
 ref|XP_010439393.1| PREDICTED: peroxidase 42 [Camelina sativa]
 ref|XP_010448958.1| PREDICTED: peroxidase 42 [Camelina sativa]
 gb|EOA15565.1| hypothetical protein CARUB_v10005223mg [Capsella rubella]
Length=330

 Score =   368 bits (945),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 169/299 (57%), Positives = 224/299 (75%), Gaps = 2/299 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M +Y ++CP+AEDII+EQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS    
Sbjct  31    LMMNFYKDTCPQAEDIIREQVKLLYKRHKNTAFSWLRNIFHDCAVESCDASLLLDSTRRE  90

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
               E+E  R+FG+RNF+YI+ IK ALE ECP  VSC+DI+ LSAR+G   + GP   +KTG
Sbjct  91    LGEKEHDRSFGLRNFRYIEEIKEALERECPGVVSCSDILVLSAREGIEAVGGPHIPLKTG  150

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD  ++    +E+++P+HN+S+ +VL +F+SIG+DT G VALLG+HSVGR HC+ +VHR
Sbjct  151   RRDGLKSRTDMLESYLPDHNESISVVLDKFKSIGIDTPGLVALLGSHSVGRTHCVKLVHR  210

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP VDP+L+P +  ++  +CP + PDP+AV+  Y RNDR TPM+LDN YY+NIL++KGL
Sbjct  211   LYPEVDPSLNPDHVPHMLHKCPDSIPDPKAVQ--YVRNDRGTPMVLDNNYYRNILDNKGL  268

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             L+VD  LA    T P V+KMA D  YF  +F RA+ I+SENNPLTG +GEIRK C   N
Sbjct  269   LLVDHQLAHDKRTRPIVKKMAKDQAYFFKEFTRAIQILSENNPLTGSKGEIRKQCNLAN  327



>emb|CAA66862.1| peroxidase ATP1a [Arabidopsis thaliana]
Length=330

 Score =   368 bits (944),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 169/299 (57%), Positives = 224/299 (75%), Gaps = 2/299 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M +Y ++CP+AEDII+EQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS    
Sbjct  31    LMMNFYKDTCPQAEDIIREQVKLLYKRHKNTAFSWLRNIFHDCAVESCDASLLLDSTRRE  90

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
               E+E  R+FG+RNF+YI+ IK ALE ECP  VSC+DI+ LSAR+G   + GP   +KTG
Sbjct  91    LGEKEHDRSFGLRNFRYIEEIKEALERECPGVVSCSDILVLSAREGIEAVGGPYIPLKTG  150

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD  ++    +E+++P+HN+S+ +VL +F+SIG+DT G VALLG+HSVGR HC+ +VHR
Sbjct  151   RRDGLKSRTDMLESYLPDHNESISVVLEKFKSIGIDTPGLVALLGSHSVGRTHCVKLVHR  210

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP VDP+L+P +  ++  +CP + PDP+AV+  Y RNDR TPM+LDN YY+NIL++KGL
Sbjct  211   LYPEVDPSLNPDHVPHMLHKCPDSIPDPKAVQ--YVRNDRGTPMVLDNNYYRNILDNKGL  268

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             L+VD  LA    T P V+KMA D  YF  +F RA+ I+SENNPLTG +GEIRK C   N
Sbjct  269   LLVDHQLAHDKRTRPIVKKMAKDQAYFFKEFTRAIQILSENNPLTGSKGEIRKQCNLAN  327



>emb|CAA17163.1| peroxidase prxr1 [Arabidopsis thaliana]
 emb|CAB79151.1| peroxidase prxr1 [Arabidopsis thaliana]
Length=323

 Score =   367 bits (943),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 169/303 (56%), Positives = 226/303 (75%), Gaps = 2/303 (1%)
 Frame = +2

Query  323   AKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDS  502
             A+  L M +Y ++CP+AEDI++EQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS
Sbjct  20    AEPGLMMNFYKDTCPQAEDIVREQVKLLYKRHKNTAFSWLRNIFHDCAVESCDASLLLDS  79

Query  503   VAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAE  682
                   E+E  R+FG+RNF+YI+ IK ALE ECP  VSC+DI+ LSAR+G   + GP   
Sbjct  80    TRRELGEKEHDRSFGLRNFRYIEEIKEALERECPGVVSCSDILVLSAREGIEAVGGPYIP  139

Query  683   MKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCIN  862
             +KTGRRD  ++    +E+++P+HN+S+ +VL +F+SIG+DT G VALLG+HSVGR HC+ 
Sbjct  140   LKTGRRDGLKSRTDMLESYLPDHNESISVVLEKFKSIGIDTPGLVALLGSHSVGRTHCVK  199

Query  863   IVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILE  1042
             +VHRLYP VDP+L+P +  ++  +CP + PDP+AV+  Y RNDR TPM+LDN YY+NIL+
Sbjct  200   LVHRLYPEVDPSLNPDHVPHMLHKCPDSIPDPKAVQ--YVRNDRGTPMVLDNNYYRNILD  257

Query  1043  HKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCR  1222
             +KGLL+VD  LA    T P V+KMA D  YF  +F RA+ I+SENNPLTG +GEIRK C 
Sbjct  258   NKGLLLVDHQLAHDKRTRPIVKKMAKDQAYFFKEFTRAIQILSENNPLTGSKGEIRKQCN  317

Query  1223  YVN  1231
               N
Sbjct  318   LAN  320



>ref|XP_002867801.1| hypothetical protein ARALYDRAFT_492673 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44060.1| hypothetical protein ARALYDRAFT_492673 [Arabidopsis lyrata subsp. 
lyrata]
Length=330

 Score =   367 bits (943),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 169/299 (57%), Positives = 224/299 (75%), Gaps = 2/299 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M +Y ++CP+AEDII+EQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS    
Sbjct  31    LMMNFYKDTCPQAEDIIREQVKLLYKRHKNTAFSWLRNIFHDCAVESCDASLLLDSTRRE  90

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
               E+E  R+FG+RNF+YI+ IK ALE ECP  VSC+DI+ LSAR+G   + GP   +KTG
Sbjct  91    LGEKEHDRSFGLRNFRYIEEIKEALERECPGVVSCSDILVLSAREGIEAVGGPYIPLKTG  150

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD  ++    +E+++P+HN+S+ +VL +F+SIG+DT G VALLG+HSVGR HC+ +VHR
Sbjct  151   RRDGLKSRTDMLESYLPDHNESISVVLDKFKSIGIDTPGLVALLGSHSVGRTHCVKLVHR  210

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP VDP+L+P +  ++  +CP + PDP+AV+  Y RNDR TPM+LDN YY+NIL++KGL
Sbjct  211   LYPEVDPSLNPDHVPHMLHKCPDSIPDPKAVQ--YVRNDRGTPMVLDNNYYRNILDNKGL  268

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             L+VD  LA    T P V+KMA D  YF  +F RA+ I+SENNPLTG +GEIRK C   N
Sbjct  269   LLVDHQLAHDKRTRPIVKKMAKDQAYFFKEFTRAIQILSENNPLTGSKGEIRKQCNLAN  327



>gb|AAL24415.1| putative peroxidase ATP2a [Arabidopsis thaliana]
 gb|AAM10150.1| putative peroxidase ATP2a [Arabidopsis thaliana]
Length=227

 Score =   363 bits (932),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 170/229 (74%), Positives = 196/229 (86%), Gaps = 3/229 (1%)
 Frame = +2

Query  548   MRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEM-KTGRRDSKETYLA  724
             MRNFKY++ IK ALE+ECP+TVSCADIVALSARDG VMLKGP+ EM KTGRRDS+ +YL 
Sbjct  1     MRNFKYVKIIKDALEKECPSTVSCADIVALSARDGIVMLKGPKIEMIKTGRRDSRGSYLG  60

Query  725   EVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHRLYPTVDPTLD  904
             +VE  IPNHNDS+  V+S F SIG+D E TVALLGAHSVGRVHC+N+VHRLYPT+DPTLD
Sbjct  61    DVETLIPNHNDSLSSVISTFNSIGIDVEATVALLGAHSVGRVHCVNLVHRLYPTIDPTLD  120

Query  905   PTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGLLVVDELLATH  1084
             P+YA YLK RCPS  PDP AV   YSRNDR TPM++DNMYYKNI+ HKGLLV+D+ LAT 
Sbjct  121   PSYALYLKKRCPSPTPDPNAV--LYSRNDRETPMVVDNMYYKNIMAHKGLLVIDDELATD  178

Query  1085  PATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             P TAPFV KMAADN YFH+QF+R + ++SE NPLTGDQGEIRK+CRYVN
Sbjct  179   PRTAPFVAKMAADNNYFHEQFSRGVRLLSETNPLTGDQGEIRKDCRYVN  227



>ref|NP_567641.1| peroxidase 42 [Arabidopsis thaliana]
 sp|Q9SB81.2|PER42_ARATH RecName: Full=Peroxidase 42; Short=Atperox P42; AltName: Full=ATP1a/ATP1b; 
AltName: Full=PRXR1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG40367.1|AF325015_1 AT4g21960 [Arabidopsis thaliana]
 gb|AAL16147.1|AF428379_1 AT4g21960/T8O5_170 [Arabidopsis thaliana]
 emb|CAA66957.1| peroxidase [Arabidopsis thaliana]
 gb|AAL10500.1| AT4g21960/T8O5_170 [Arabidopsis thaliana]
 gb|AAL24179.1| AT4g21960/T8O5_170 [Arabidopsis thaliana]
 gb|AAL24292.1| peroxidase prxr1 [Arabidopsis thaliana]
 gb|AAM91042.1| AT4g21960/T8O5_170 [Arabidopsis thaliana]
 gb|AEE84535.1| peroxidase 42 [Arabidopsis thaliana]
Length=330

 Score =   367 bits (942),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 169/303 (56%), Positives = 226/303 (75%), Gaps = 2/303 (1%)
 Frame = +2

Query  323   AKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDS  502
             A+  L M +Y ++CP+AEDI++EQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS
Sbjct  27    AEPGLMMNFYKDTCPQAEDIVREQVKLLYKRHKNTAFSWLRNIFHDCAVESCDASLLLDS  86

Query  503   VAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAE  682
                   E+E  R+FG+RNF+YI+ IK ALE ECP  VSC+DI+ LSAR+G   + GP   
Sbjct  87    TRRELGEKEHDRSFGLRNFRYIEEIKEALERECPGVVSCSDILVLSAREGIEAVGGPYIP  146

Query  683   MKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCIN  862
             +KTGRRD  ++    +E+++P+HN+S+ +VL +F+SIG+DT G VALLG+HSVGR HC+ 
Sbjct  147   LKTGRRDGLKSRTDMLESYLPDHNESISVVLEKFKSIGIDTPGLVALLGSHSVGRTHCVK  206

Query  863   IVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILE  1042
             +VHRLYP VDP+L+P +  ++  +CP + PDP+AV+  Y RNDR TPM+LDN YY+NIL+
Sbjct  207   LVHRLYPEVDPSLNPDHVPHMLHKCPDSIPDPKAVQ--YVRNDRGTPMVLDNNYYRNILD  264

Query  1043  HKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCR  1222
             +KGLL+VD  LA    T P V+KMA D  YF  +F RA+ I+SENNPLTG +GEIRK C 
Sbjct  265   NKGLLLVDHQLAHDKRTRPIVKKMAKDQAYFFKEFTRAIQILSENNPLTGSKGEIRKQCN  324

Query  1223  YVN  1231
               N
Sbjct  325   LAN  327



>gb|KFK28780.1| hypothetical protein AALP_AA7G046800 [Arabis alpina]
Length=332

 Score =   366 bits (940),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 168/299 (56%), Positives = 225/299 (75%), Gaps = 2/299 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M +Y ++CP+AEDII+EQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS    
Sbjct  33    LMMHFYKDTCPQAEDIIREQVKLLYKRHKNTAFSWLRNIFHDCAVESCDASLLLDSTRRE  92

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
               E+E  R+FG+RNF+YI+ IK ALE ECP  VSC+DI+ LSAR+G  ++ GP   +KTG
Sbjct  93    LGEKEHDRSFGLRNFRYIEEIKEALERECPGVVSCSDILVLSAREGIEVVGGPYIPLKTG  152

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD  ++    +E+++P+HN+S+ +V+ +F+SIG+DT G VALLG+HSVGR HC+ +VHR
Sbjct  153   RRDGLKSRTDMLESYLPDHNESISVVIDKFKSIGIDTPGFVALLGSHSVGRTHCVKLVHR  212

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP VDP+L+P +  ++  +CP + PDP+AV+  Y RNDR TPM+LDN YY+NIL++KGL
Sbjct  213   LYPEVDPSLNPDHVPHMLHKCPDSIPDPKAVQ--YVRNDRGTPMVLDNNYYRNILDNKGL  270

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             L+VD  LA    T P V+KMA D  YF  +F RA+ I+SENNPLTG +GEIRK C   N
Sbjct  271   LLVDHQLAHDKRTRPIVKKMAKDQAYFFKEFTRAIQILSENNPLTGSKGEIRKQCNLAN  329



>gb|ABC02343.1| class III peroxidase [Oncidium hybrid cultivar]
Length=332

 Score =   366 bits (939),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 168/299 (56%), Positives = 220/299 (74%), Gaps = 2/299 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M +Y ESCP+AEDII+EQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS    
Sbjct  30    LIMDFYKESCPQAEDIIREQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTKKT  89

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE+E+ R+FGMRNF+Y++ IK A+E ECP  VSCADI+ LS RDG V + GP   +KTG
Sbjct  90    ISEKETDRSFGMRNFRYLEEIKDAVERECPGVVSCADILVLSGRDGIVSVGGPFIPLKTG  149

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD +++    VE ++P+HN+S+  VL +F ++G+D  G VALLG+HSVGR HC+ +VHR
Sbjct  150   RRDGRKSRAEVVEQYLPDHNESISSVLDKFAAMGIDAPGVVALLGSHSVGRTHCVKLVHR  209

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP VD  L+P +  ++  +C  + PDP+AV+  Y RNDR TPM  DN YY+NIL++KGL
Sbjct  210   LYPEVDSKLNPDHVPHMLKKCYDSIPDPKAVQ--YVRNDRGTPMKFDNNYYRNILDNKGL  267

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             L+VD  LA  P T P+V+KMA    YF   F RA+ I++ENNPLTGDQGEIR++C   N
Sbjct  268   LMVDHELAYDPRTRPYVKKMAKSQDYFFQHFGRAITILTENNPLTGDQGEIRRHCNVAN  326



>ref|XP_003610432.1| Peroxidase [Medicago truncatula]
 gb|AES92629.1| cationic peroxidase [Medicago truncatula]
Length=340

 Score =   366 bits (940),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 172/306 (56%), Positives = 226/306 (74%), Gaps = 7/306 (2%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M YY E+CP+AE+IIKEQV  LY+ H NTA SWLRN+FHDC V++CDAS+LL S    
Sbjct  32    LVMNYYKEACPQAEEIIKEQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLTSTRRS  91

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLK-----GPRA  679
              SE+E  R+FG+RNF+YI TIK A+E ECP  VSC+DI+ LSAR+G V LK     GP  
Sbjct  92    LSEQEHDRSFGLRNFRYIDTIKEAVERECPGVVSCSDILVLSAREGIVSLKLMQLGGPYI  151

Query  680   EMKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCI  859
              +KTGRRD +++ +  +E ++P+HN+S+  VL +F ++G+DT G VALLGAHSVGR HC 
Sbjct  152   PLKTGRRDGRKSRVDLLEAYLPDHNESISAVLDKFGAMGIDTPGVVALLGAHSVGRTHCT  211

Query  860   NIVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNIL  1039
              +VHRLYP VDP L+P +  ++  +CP + PDP+AV+  Y RNDR TPMILDN YY+NIL
Sbjct  212   KLVHRLYPEVDPALNPEHIPHMLKKCPDSIPDPKAVQ--YVRNDRGTPMILDNNYYRNIL  269

Query  1040  EHKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNC  1219
             ++KGLL+VD  LA    T P+V+KMA   +YF  +F+RA+ ++SENNPLTG +GEIRK C
Sbjct  270   DNKGLLIVDHQLAHDKRTKPYVKKMAKSQEYFFKEFSRAITLLSENNPLTGTKGEIRKQC  329

Query  1220  RYVNTK  1237
                N +
Sbjct  330   SVSNKQ  335



>ref|NP_001289235.1| uncharacterized protein LOC103948174 precursor [Pyrus x bretschneideri]
 gb|AFP66233.1| peroxidase [Pyrus x bretschneideri]
Length=336

 Score =   365 bits (938),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 167/294 (57%), Positives = 220/294 (75%), Gaps = 2/294 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M +Y ++CP+AE++I+EQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS    
Sbjct  36    LVMDFYRDTCPQAEEVIREQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRRS  95

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE+E  R+FGMRNF+YI+ IK ALE ECP  VSC+DI+ LSAR+G V L GP   +KTG
Sbjct  96    LSEKEMDRSFGMRNFRYIEEIKEALERECPGVVSCSDILVLSAREGVVRLGGPFIPLKTG  155

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD + +    +E ++P+HN+SM +VL +F  +G+DT G VALLGAHSVGR HC+ +VHR
Sbjct  156   RRDGRRSRAEILEQYLPDHNESMSVVLEKFADMGIDTPGLVALLGAHSVGRTHCVKLVHR  215

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP VDP L+P +  ++  +CP A PDP+AV+  Y RNDR TPMI D  YY+NIL++KGL
Sbjct  216   LYPEVDPQLNPDHVPHMLKKCPDAIPDPKAVQ--YVRNDRGTPMIFDTNYYRNILDNKGL  273

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKN  1216
             ++VD  LAT   T P+V+KMA    YF  +F+RA  I+SENNPLTG++GEIR+ 
Sbjct  274   MMVDHQLATDKRTKPYVKKMAKSQDYFFKEFSRAFTILSENNPLTGNKGEIRQQ  327



>gb|KHG03947.1| Peroxidase 42 -like protein [Gossypium arboreum]
Length=330

 Score =   360 bits (924),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 166/286 (58%), Positives = 216/286 (76%), Gaps = 2/286 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M +Y +SCP+AEDIIKEQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS    
Sbjct  33    LVMNFYKDSCPQAEDIIKEQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRRS  92

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE+E+ R+FG+RNF+YI+TIK A+E ECP  VSCADI+ LSAR+G V L GP   +KTG
Sbjct  93    LSEKETDRSFGLRNFRYIETIKEAVERECPGVVSCADILVLSAREGIVSLGGPYIPLKTG  152

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD + +    VE ++P+HN+++  VL RF ++G+DT G VALLGAHSVGR HC+ +VHR
Sbjct  153   RRDGRRSRADVVEEYLPDHNETISGVLDRFAAMGIDTPGVVALLGAHSVGRTHCVKLVHR  212

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP VDP L+P +  ++  +CP   PDP+AV+  Y RNDR TPM+LDN YY+NIL++KGL
Sbjct  213   LYPEVDPALNPDHVPHILHKCPDQIPDPKAVQ--YVRNDRGTPMVLDNNYYRNILDNKGL  270

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTG  1192
             L+VD  LA    T P+V+KMA    YF  +F+RA+ ++SENNPLTG
Sbjct  271   LIVDHQLAYDKRTRPYVKKMAKSQDYFFKEFSRAITLLSENNPLTG  316



>gb|KDO78222.1| hypothetical protein CISIN_1g019129mg [Citrus sinensis]
Length=322

 Score =   354 bits (908),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 165/299 (55%), Positives = 214/299 (72%), Gaps = 15/299 (5%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M +Y ++CP+AEDII+EQV  LY+ H NTA SWLRN+FHDC V+              
Sbjct  33    LVMNFYKDTCPQAEDIIREQVKLLYKRHKNTAFSWLRNIFHDCAVQTL------------  80

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE+E  R+FGMRNF+YI+ IK A+E ECP  VSCADI+ LS RDG V L GP   +KTG
Sbjct  81    -SEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTG  139

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD +++    +E ++P+HNDSM +VL RF +IG+D  G VALLG+HSVGR HC+ +VHR
Sbjct  140   RRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHR  199

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP VDP L+P +  ++  +CP A PDP+AV+  Y RNDR TPM+LDN YY+NIL++KGL
Sbjct  200   LYPEVDPALNPDHVPHMLHKCPDAIPDPKAVQ--YVRNDRGTPMVLDNNYYRNILDNKGL  257

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             ++VD  LAT   T P+V+KMA    YF  +F+RA+ ++SENNPLTG +GEIRK C   N
Sbjct  258   MMVDHQLATDKRTRPYVKKMAKSQDYFFKEFSRAITLLSENNPLTGTKGEIRKVCNLAN  316



>ref|NP_001060737.2| Os07g0694300 [Oryza sativa Japonica Group]
 dbj|BAF22651.2| Os07g0694300 [Oryza sativa Japonica Group]
Length=259

 Score =   346 bits (887),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 163/260 (63%), Positives = 201/260 (77%), Gaps = 3/260 (1%)
 Frame = +2

Query  464   MVKACDASILL--DSVAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVAL  637
             MV +CDAS+LL   +  GV SE+ S R+FGMRNFKYI  IKAA+E ECP TVSCADI+AL
Sbjct  1     MVYSCDASLLLHTTTTTGV-SEQSSHRSFGMRNFKYITAIKAAVERECPATVSCADILAL  59

Query  638   SARDGAVMLKGPRAEMKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTV  817
             +ARDG  ML GP   M+TGRRDS+E+Y   VE +IPNHNDS+  VLSRF +IGVDTEG V
Sbjct  60    AARDGVAMLGGPSVAMRTGRRDSRESYYGVVEQYIPNHNDSVSTVLSRFAAIGVDTEGAV  119

Query  818   ALLGAHSVGRVHCINIVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRR  997
             ALLGAHSVGRVHC N+V RLYP VD +++  Y +YL+ RCP+A       E  Y+RNDR 
Sbjct  120   ALLGAHSVGRVHCFNLVGRLYPQVDGSMEAAYGEYLRGRCPTAAATEDTREVVYARNDRV  179

Query  998   TPMILDNMYYKNILEHKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSEN  1177
             TPM++DNMYY+N+L  +GLL+VD+ LA+   TAP+V +MAADN YFH +FA AL+ MSEN
Sbjct  180   TPMLIDNMYYRNLLAGRGLLLVDQQLASDARTAPYVRRMAADNDYFHQRFAAALLTMSEN  239

Query  1178  NPLTGDQGEIRKNCRYVNTK  1237
              PLTG QGE+RK+CR+VN+ 
Sbjct  240   APLTGAQGEVRKDCRFVNSS  259



>gb|AAT07453.1| peroxidase [Mirabilis jalapa]
Length=222

 Score =   343 bits (879),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 161/222 (73%), Positives = 188/222 (85%), Gaps = 2/222 (1%)
 Frame = +2

Query  566   IQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTGRRDSKETYLAEVENFIP  745
             I TIKAALE ECP TVSCADI+ALSARDGA +L GP  EM+TGRRDSK +Y A V++FIP
Sbjct  1     INTIKAALEVECPLTVSCADIIALSARDGAQLLGGPVIEMRTGRRDSKVSYAAMVQDFIP  60

Query  746   NHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHRLYPTVDPTLDPTYADYL  925
             NHN SM LVLSRF SIG+D EGTVA+L AHSVGRVHC+N+V RLYPTVDPTLDP YA YL
Sbjct  61    NHNSSMSLVLSRFGSIGIDVEGTVAVLCAHSVGRVHCVNLVGRLYPTVDPTLDPDYATYL  120

Query  926   KLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGLLVVDELLATHPATAPFV  1105
             K RCP+ +PDP AV   YSRNDR TPMILDNMYYKN+L HKGLL++D+ L +  +T P+V
Sbjct  121   KHRCPTPDPDPEAV--VYSRNDRETPMILDNMYYKNLLAHKGLLLIDQELVSDTSTLPYV  178

Query  1106  EKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             +KMAADN YFH QF+RA++ +SENNPLTG+QGEIRK+CR+VN
Sbjct  179   QKMAADNDYFHQQFSRAMIFLSENNPLTGNQGEIRKDCRFVN  220



>ref|XP_002519557.1| Peroxidase 21 precursor, putative [Ricinus communis]
 gb|EEF42971.1| Peroxidase 21 precursor, putative [Ricinus communis]
Length=221

 Score =   339 bits (869),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 157/209 (75%), Positives = 183/209 (88%), Gaps = 2/209 (1%)
 Frame = +2

Query  608   TVSCADIVALSARDGAVMLKGPRAEMKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQ  787
             TVSCADIVALSARDG VML GPR EMKTGRRDSKE+Y A +E+FIPNHND+M LVL RFQ
Sbjct  14    TVSCADIVALSARDGIVMLGGPRIEMKTGRRDSKESYAAVLESFIPNHNDTMSLVLDRFQ  73

Query  788   SIGVDTEGTVALLGAHSVGRVHCINIVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAV  967
             S+G+D EGTVALLG HSVGRVHC N+V RLYPTVDPTLDP YA+YLK RCP+ +PDP AV
Sbjct  74    SVGIDAEGTVALLGGHSVGRVHCANLVQRLYPTVDPTLDPDYAEYLKGRCPTPDPDPEAV  133

Query  968   EPTYSRNDRRTPMILDNMYYKNILEHKGLLVVDELLATHPATAPFVEKMAADNQYFHDQF  1147
                Y+RNDR TPMILDN YYKN+L+HKGLL VD+ LA+ P T+PFVE+MAADN YF DQF
Sbjct  134   --LYARNDRETPMILDNFYYKNLLKHKGLLSVDQQLASDPITSPFVERMAADNGYFQDQF  191

Query  1148  ARALVIMSENNPLTGDQGEIRKNCRYVNT  1234
             +RA++++SENNPLTG++GEIRK+CRYVN+
Sbjct  192   SRAVLLLSENNPLTGEEGEIRKDCRYVNS  220



>gb|ACM45784.1| peroxidase [Cucumis sativus]
Length=229

 Score =   330 bits (845),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 148/207 (71%), Positives = 179/207 (86%), Gaps = 0/207 (0%)
 Frame = +2

Query  323  AKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDS  502
             +G LQ+ YY++SCP+AE+IIK+QVI LY EHGNTAVSWLRNLFHDC+VK+CDAS+LL++
Sbjct  22   GRGQLQLNYYAKSCPKAEEIIKQQVIDLYYEHGNTAVSWLRNLFHDCIVKSCDASLLLET  81

Query  503  VAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAE  682
            V GVESE++S R+FGMRNFKY+  IKAA+E+ECP TVSCADIVALSARDG VMLKGP  +
Sbjct  82   VVGVESEKDSSRSFGMRNFKYVNKIKAAVEKECPLTVSCADIVALSARDGIVMLKGPHID  141

Query  683  MKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCIN  862
            +KTGR+DSK +Y   VE  +P HN S+  VLSRF SIG+DTE TVALLG+HSVGRVHC+N
Sbjct  142  LKTGRKDSKMSYSNMVEELVPQHNASLVNVLSRFNSIGIDTEATVALLGSHSVGRVHCVN  201

Query  863  IVHRLYPTVDPTLDPTYADYLKLRCPS  943
            +V RLYPTVDPT+DP YA YLK+RCP+
Sbjct  202  LVERLYPTVDPTIDPEYAKYLKMRCPT  228



>gb|KDO78224.1| hypothetical protein CISIN_1g019129mg [Citrus sinensis]
Length=316

 Score =   332 bits (850),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 159/299 (53%), Positives = 207/299 (69%), Gaps = 21/299 (7%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M +Y ++CP+AEDII+EQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS    
Sbjct  33    LVMNFYKDTCPQAEDIIREQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRKT  92

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE+E  R+FGMRNF+YI+ IK A+E ECP  VSCADI+ LS RDG V L GP   +KTG
Sbjct  93    LSEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTG  152

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD +++    +E ++P+HNDSM +VL RF +IG+D  G VALL                
Sbjct  153   RRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALL----------------  196

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
                 VDP L+P +  ++  +CP A PDP+AV+  Y RNDR TPM+LDN YY+NIL++KGL
Sbjct  197   ---EVDPALNPDHVPHMLHKCPDAIPDPKAVQ--YVRNDRGTPMVLDNNYYRNILDNKGL  251

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             ++VD  LAT   T P+V+KMA    YF  +F+RA+ ++SENNPLTG +GEIRK C   N
Sbjct  252   MMVDHQLATDKRTRPYVKKMAKSQDYFFKEFSRAITLLSENNPLTGTKGEIRKVCNLAN  310



>gb|KDO78223.1| hypothetical protein CISIN_1g019129mg [Citrus sinensis]
Length=307

 Score =   327 bits (838),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 156/299 (52%), Positives = 203/299 (68%), Gaps = 30/299 (10%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M +Y ++CP+AEDII+EQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS    
Sbjct  33    LVMNFYKDTCPQAEDIIREQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRKT  92

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE+E  R+FGMRNF                            RDG V L GP   +KTG
Sbjct  93    LSEKEMDRSFGMRNF----------------------------RDGVVALGGPYIPLKTG  124

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD +++    +E ++P+HNDSM +VL RF +IG+D  G VALLG+HSVGR HC+ +VHR
Sbjct  125   RRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHR  184

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP VDP L+P +  ++  +CP A PDP+AV+  Y RNDR TPM+LDN YY+NIL++KGL
Sbjct  185   LYPEVDPALNPDHVPHMLHKCPDAIPDPKAVQ--YVRNDRGTPMVLDNNYYRNILDNKGL  242

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             ++VD  LAT   T P+V+KMA    YF  +F+RA+ ++SENNPLTG +GEIRK C   N
Sbjct  243   MMVDHQLATDKRTRPYVKKMAKSQDYFFKEFSRAITLLSENNPLTGTKGEIRKVCNLAN  301



>gb|AID69227.1| peroxidase, partial [Garcinia mangostana]
Length=207

 Score =   311 bits (798),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 143/208 (69%), Positives = 174/208 (84%), Gaps = 2/208 (1%)
 Frame = +2

Query  611   VSCADIVALSARDGAVMLKGPRAEMKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQS  790
             VSCADI+ALSARDG V+L GP+ EMKTGR+DS+E+Y   VE++IPNHNDS+ LVLS FQS
Sbjct  1     VSCADILALSARDGIVLLGGPKVEMKTGRKDSRESYYKVVEDYIPNHNDSISLVLSLFQS  60

Query  791   IGVDTEGTVALLGAHSVGRVHCINIVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVE  970
              G+D E  VALLGAHSVGRVHC+N+V RLYPT+DPTLDP+YA+YLK RCPS  PDP+AVE
Sbjct  61    TGIDVEAAVALLGAHSVGRVHCVNLVQRLYPTIDPTLDPSYAEYLKTRCPSPNPDPKAVE  120

Query  971   PTYSRNDRRTPMILDNMYYKNILEHKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFA  1150
               Y+RNDR TPMI+DN YYKN+L  KGLL +D+ L + P T+ +V KMAADN YF  QFA
Sbjct  121   --YARNDRETPMIIDNNYYKNLLNKKGLLSIDQQLTSDPITSLYVTKMAADNAYFRAQFA  178

Query  1151  RALVIMSENNPLTGDQGEIRKNCRYVNT  1234
             RA++++SENNPLT  QGEIR++CRYVN+
Sbjct  179   RAVLLLSENNPLTEIQGEIREDCRYVNS  206



>ref|XP_001768671.1| predicted protein [Physcomitrella patens]
 gb|EDQ66609.1| predicted protein [Physcomitrella patens]
Length=323

 Score =   301 bits (770),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 142/293 (48%), Positives = 192/293 (66%), Gaps = 1/293 (0%)
 Frame = +2

Query  347   YYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGVESER  526
             YY+ SCP AE II + V KLYE+ GN A S +R +FHDC   +CDAS+LL+S  GV +E+
Sbjct  30    YYANSCPNAEKIIHDTVYKLYEKKGNIATSLIRYVFHDCF-DSCDASVLLESSKGVPAEK  88

Query  527   ESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTGRRDS  706
             ES    GMRN K+I  IK A+E+ CP  VSCAD++AL    GA +L GP  ++KTGR+DS
Sbjct  89    ESHSQVGMRNGKWINNIKKAVEDSCPGVVSCADVLALGGAAGAQVLGGPAIKLKTGRKDS  148

Query  707   KETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHRLYPT  886
             + +  +  +  IP    ++  VL  F  +G++TE TVALLGAH++GR HC++   R+YPT
Sbjct  149   RVSLKSVADTGIPTPQSNVSFVLDYFSKMGINTEETVALLGAHTIGRAHCVSFEERIYPT  208

Query  887   VDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGLLVVD  1066
             VDP +DP +A  LK RCP  +     V  TY RND ++PM  DN YY N++ ++GLL +D
Sbjct  209   VDPKMDPVFASMLKYRCPQQKTGAEPVHFTYFRNDEQSPMAFDNHYYVNLMANQGLLHID  268

Query  1067  ELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRY  1225
               +A    T  FV + A DN  +H  FA A   +SE+NPLTG QGE+RK+C Y
Sbjct  269   SEIAWDSRTKLFVVEYAKDNALWHKNFATAFTKLSEHNPLTGTQGEVRKHCSY  321



>gb|ACJ84264.1| unknown [Medicago truncatula]
Length=264

 Score =   296 bits (759),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 137/235 (58%), Positives = 178/235 (76%), Gaps = 2/235 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M YY E+CP+AE+IIKEQV  LY+ H NTA SWLRN+FHDC V++CDAS+LL S    
Sbjct  32    LVMNYYKEACPQAEEIIKEQVRLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLTSTRRS  91

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
              SE+E  R+FG+RNF+YI TIK A+E ECP  VSC+DI+ LSAR+G V L GP   +KTG
Sbjct  92    LSEQEHDRSFGLRNFRYIDTIKEAVERECPGVVSCSDILVLSAREGIVSLGGPYIPLKTG  151

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             RRD +++ +  +E ++P+HN+S+  VL +F ++G+DT G VALLGAHSVGR HC  +VHR
Sbjct  152   RRDGRKSRVDLLEAYLPDHNESISAVLDKFGAMGIDTPGVVALLGAHSVGRTHCTKLVHR  211

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNIL  1039
             LYP VDP L+P +  ++  +CP + PDP+AV+  Y RNDR TPMILDN YY+NIL
Sbjct  212   LYPEVDPALNPEHIPHMLKKCPDSIPDPKAVQ--YVRNDRGTPMILDNNYYRNIL  264



>dbj|BAD94372.1| putative peroxidase ATP2a [Arabidopsis thaliana]
Length=182

 Score =   290 bits (743),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 133/183 (73%), Positives = 155/183 (85%), Gaps = 2/183 (1%)
 Frame = +2

Query  683   MKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCIN  862
             +KTGRRDS+ +YL +VE  IPNHNDS+  V+S F SIG+D E TVALLGAHSVGRVHC+N
Sbjct  2     IKTGRRDSRGSYLGDVETLIPNHNDSLSSVISTFNSIGIDVEATVALLGAHSVGRVHCVN  61

Query  863   IVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILE  1042
             +VHRLYPT+DPTLDP+YA YLK RCPS  PDP AV   YSRNDR TPM++DNMYYKNI+ 
Sbjct  62    LVHRLYPTIDPTLDPSYALYLKKRCPSPTPDPNAV--LYSRNDRETPMVVDNMYYKNIMA  119

Query  1043  HKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCR  1222
             HKGLLV+D+ LAT P TAPFV KMAADN YFH+QF+R + ++SE NPLTGDQGEIRK+CR
Sbjct  120   HKGLLVIDDELATDPRTAPFVAKMAADNNYFHEQFSRGVRLLSETNPLTGDQGEIRKDCR  179

Query  1223  YVN  1231
             YVN
Sbjct  180   YVN  182



>ref|XP_006449725.1| hypothetical protein CICLE_v10015870mg [Citrus clementina]
 gb|ESR62965.1| hypothetical protein CICLE_v10015870mg [Citrus clementina]
Length=238

 Score =   291 bits (745),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 134/232 (58%), Positives = 172/232 (74%), Gaps = 2/232 (1%)
 Frame = +2

Query  536   RNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTGRRDSKET  715
             R+FGMRNF+YI+ IK A+E ECP  VSCADI+ LS RDG V L GP   +KTGRRD +++
Sbjct  3     RSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKS  62

Query  716   YLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHRLYPTVDP  895
                 +E ++P+HNDSM +VL RF +IG+D  G VALLG+HSVGR HC+ +VHRLYP VDP
Sbjct  63    RAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYPEVDP  122

Query  896   TLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGLLVVDELL  1075
              L+P +  ++  +CP A PDP+AV+  Y RNDR TPM+LDN YY+NIL+ KGL++VD  L
Sbjct  123   ALNPDHVPHMLHKCPDAIPDPKAVQ--YVRNDRGTPMVLDNNYYRNILDSKGLMMVDHQL  180

Query  1076  ATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             AT   T P+V+KMA    YF  +F+RA+ I+SENNPLTG +GEIRK C   N
Sbjct  181   ATDKRTRPYVKKMAKSQDYFFKEFSRAITILSENNPLTGTKGEIRKVCNLAN  232



>gb|ACN60164.1| cationic peroxidase [Tamarix hispida]
Length=244

 Score =   291 bits (745),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 136/238 (57%), Positives = 177/238 (74%), Gaps = 2/238 (1%)
 Frame = +2

Query  518   SERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTGR  697
             SE+E  R+FG+RNF+Y++TIK ALE ECP  VSCADI+ LSARDG V + GP   +KTGR
Sbjct  6     SEKEMDRSFGLRNFRYLETIKEALERECPGVVSCADILVLSARDGIVEVGGPHIPLKTGR  65

Query  698   RDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHRL  877
             RD + +    +E ++P+HN+SM +VL RF++IG+DT G VALLGAHSVGR HC+ +VHRL
Sbjct  66    RDGRRSRAEMLEQYLPDHNESMSIVLDRFKAIGIDTPGLVALLGAHSVGRTHCVKLVHRL  125

Query  878   YPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGLL  1057
             YP VDP L+P +  ++  +C    PDP+AV+  Y RNDR TPM  DN YY+NIL++KGLL
Sbjct  126   YPEVDPVLNPDHVPHMLKKCHDPIPDPKAVQ--YVRNDRGTPMKFDNNYYRNILDNKGLL  183

Query  1058  VVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             +VD  LA    T P+V KMA +  YF  +F+RA+ I+SENNPLTG++GEIRK C  VN
Sbjct  184   LVDHQLANDKRTRPYVLKMAKNEGYFFREFSRAITILSENNPLTGNKGEIRKQCNLVN  241



>gb|KDO78227.1| hypothetical protein CISIN_1g019129mg [Citrus sinensis]
Length=238

 Score =   291 bits (744),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 133/232 (57%), Positives = 173/232 (75%), Gaps = 2/232 (1%)
 Frame = +2

Query  536   RNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTGRRDSKET  715
             R+FGMRNF+YI+ IK A+E ECP  VSCADI+ LS RDG V L GP   +KTGRRD +++
Sbjct  3     RSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKS  62

Query  716   YLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHRLYPTVDP  895
                 +E ++P+HNDSM +VL RF +IG+D  G VALLG+HSVGR HC+ +VHRLYP VDP
Sbjct  63    RAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYPEVDP  122

Query  896   TLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGLLVVDELL  1075
              L+P +  ++  +CP A PDP+AV+  Y RNDR TPM+LDN YY+NIL++KGL++VD  L
Sbjct  123   ALNPDHVPHMLHKCPDAIPDPKAVQ--YVRNDRGTPMVLDNNYYRNILDNKGLMMVDHQL  180

Query  1076  ATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             AT   T P+V+KMA    YF  +F+RA+ ++SENNPLTG +GEIRK C   N
Sbjct  181   ATDKRTRPYVKKMAKSQDYFFKEFSRAITLLSENNPLTGTKGEIRKVCNLAN  232



>ref|XP_002518482.1| Peroxidase 63 precursor, putative [Ricinus communis]
 gb|EEF43869.1| Peroxidase 63 precursor, putative [Ricinus communis]
Length=269

 Score =   259 bits (663),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 136/299 (45%), Positives = 175/299 (59%), Gaps = 65/299 (22%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L M +Y ++CP+AED+IKEQV  LY+ H NTA SWLRN+FHDC V+     I L +    
Sbjct  33    LVMNFYKDTCPQAEDVIKEQVRLLYKRHKNTAFSWLRNIFHDCAVELGGPYIPLKT----  88

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
                                                        RDG           +  
Sbjct  89    -----------------------------------------GRRDG-----------RKS  96

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             R D  E YL       P+HN+S+ +VL RF ++G+DT G VALLGAHSVGR HC+ +VHR
Sbjct  97    RADVLEQYL-------PDHNESISVVLERFSAMGIDTPGVVALLGAHSVGRTHCVKLVHR  149

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP VDP L+P + +++  +CP A PDP+AV+  Y RNDR TPMILDN YY+NIL++KGL
Sbjct  150   LYPEVDPVLNPNHVEHMLYKCPDAIPDPKAVQ--YVRNDRGTPMILDNNYYRNILDNKGL  207

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             L+VD  LAT   T P+V+KMA   +YF  +F+RA+ I+SENNPLTG +GEIRK C   N
Sbjct  208   LIVDHQLATDKRTKPYVKKMAKSQEYFFKEFSRAITILSENNPLTGTKGEIRKQCNVAN  266



>gb|KDO48108.1| hypothetical protein CISIN_1g0200841mg, partial [Citrus sinensis]
 gb|KDO48109.1| hypothetical protein CISIN_1g0200841mg, partial [Citrus sinensis]
Length=196

 Score =   254 bits (650),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = +2

Query  332  DLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAG  511
            +LQ  YY++SCP+AE+IIK+QV++LY +HGNTAVSW+RNLFHDC VK+CDAS+LL++V G
Sbjct  32   ELQFNYYAQSCPKAEEIIKQQVVQLYYKHGNTAVSWVRNLFHDCAVKSCDASLLLETVTG  91

Query  512  VESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKT  691
            V SE+ S R+FGMRNFKY+ TIKAALE ECP  VSCADIVALSAR+G VML GPR  +KT
Sbjct  92   VASEQASERSFGMRNFKYVSTIKAALEAECPLKVSCADIVALSAREGIVMLGGPRIPIKT  151

Query  692  GRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVAL  823
            GRRDS+ +YLAEVE FIPNHNDS+   LS F SIG+D EG VAL
Sbjct  152  GRRDSRVSYLAEVEKFIPNHNDSIATALSVFNSIGIDDEGVVAL  195



>ref|XP_010254703.1| PREDICTED: peroxidase 72-like [Nelumbo nucifera]
Length=328

 Score =   252 bits (644),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 137/310 (44%), Positives = 184/310 (59%), Gaps = 12/310 (4%)
 Frame = +2

Query  323   AKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDS  502
             + G L   +Y  SCP+ ++I+K  V K   +    A S LR  FHDC VK CDASILLDS
Sbjct  24    SNGGLSPQFYDHSCPKVQEIVKSVVAKAVAKEARMAASLLRLHFHDCFVKGCDASILLDS  83

Query  503   VAGVESE-RESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRA  679
               G+ SE R +P     R F+ I  IK+A+E+ECP TVSCADI+ L+ARD  V+  GP  
Sbjct  84    SGGIISEKRANPNRNSARGFEVIDEIKSAVEKECPQTVSCADILTLAARDSTVLAGGPSW  143

Query  680   EMKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCI  859
             E+  GRRD+K   L+   N IP  N++ + +L++F+  G+D    VAL G+H++G   C 
Sbjct  144   EVPLGRRDAKSASLSGSNNNIPAPNNTFQTILTKFKLKGLDVVDLVALSGSHTIGNARCT  203

Query  860   NIVHRLYPTV-----DPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMY  1024
             +   RLY        D +LD +YA  LK RCP +  D           D  +P   DN Y
Sbjct  204   SFRQRLYNQTGNGQPDYSLDQSYAAQLKTRCPRSGGDQNLFFL-----DFVSPTKFDNNY  258

Query  1025  YKNILEHKGLLVVDELLAT-HPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQG  1201
             YKNIL  KGLL  D++L T + A+   V+K A ++Q F +QFA+++V M   +PLTG QG
Sbjct  259   YKNILVSKGLLNSDQVLLTKNEASMDLVKKYAENSQIFFEQFAKSMVKMGNISPLTGSQG  318

Query  1202  EIRKNCRYVN  1231
             EIRKNCR VN
Sbjct  319   EIRKNCRKVN  328



>ref|XP_004146491.1| PREDICTED: peroxidase 72-like [Cucumis sativus]
 ref|XP_004167640.1| PREDICTED: peroxidase 72-like [Cucumis sativus]
 gb|KGN53286.1| hypothetical protein Csa_4G045010 [Cucumis sativus]
Length=342

 Score =   251 bits (641),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 134/304 (44%), Positives = 184/304 (61%), Gaps = 12/304 (4%)
 Frame = +2

Query  347   YYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGVESER  526
             +Y  SCPRA++I+K  V K + +    A S LR  FHDC VK CD SILLDS   + SE+
Sbjct  44    FYDHSCPRAQEIVKYVVAKAFAKEARIAASLLRLHFHDCFVKGCDGSILLDSSGTLASEK  103

Query  527   ES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTGRRD  703
              S P     R F+ I  IK+ALE+ECP TVSCADI+A++ARD  V+  GP  E+  GRRD
Sbjct  104   RSNPNRNSARGFEVIDEIKSALEKECPQTVSCADILAIAARDSTVITGGPSWEVPLGRRD  163

Query  704   SKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHRLY-  880
             S+   L+   N IP  N++ + +L++F+  G+D    VAL G+H++G   C +   RLY 
Sbjct  164   SRGASLSGSNNDIPAPNNTFQTILTKFKRQGLDIVDLVALSGSHTIGNSRCTSFRQRLYN  223

Query  881   ----PTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHK  1048
                    DP+LDP+YA  L+ RCP +  D           D  +P+  DN Y+KN+L  K
Sbjct  224   QSGNAQPDPSLDPSYAAELRKRCPRSGGDQNLFFL-----DFVSPIKFDNYYFKNLLAAK  278

Query  1049  GLLVVDELLAT-HPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRY  1225
             GLL  DE+L T +  +A  V+  A +++ F +QFA+++V M    PLTG +GEIRKNCR 
Sbjct  279   GLLNSDEVLLTKNLQSAELVKTYAENSELFFEQFAKSMVKMGNITPLTGSRGEIRKNCRK  338

Query  1226  VNTK  1237
             VN K
Sbjct  339   VNRK  342



>ref|XP_008452113.1| PREDICTED: peroxidase 72-like [Cucumis melo]
Length=343

 Score =   251 bits (640),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 134/302 (44%), Positives = 182/302 (60%), Gaps = 12/302 (4%)
 Frame = +2

Query  347   YYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGVESER  526
             +Y  SCPRA++I+K  V K + +    A S LR  FHDC VK CD SILLDS   + SE+
Sbjct  45    FYDHSCPRAQEIVKSIVAKAFAKEARIAASLLRLHFHDCFVKGCDGSILLDSSGTIASEK  104

Query  527   ES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTGRRD  703
              S P     R F+ I  IK+ALE+ECP TVSCADI+A++ARD  V+  GP  E+  GRRD
Sbjct  105   RSNPNRNSARGFEVIDEIKSALEKECPQTVSCADILAIAARDSTVITGGPSWEVPLGRRD  164

Query  704   SKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHRLY-  880
             S+   L+   N IP  N++ + +L++F+  G+D    VAL G+H++G   C +   RLY 
Sbjct  165   SRGASLSGSNNDIPAPNNTFQTILTKFKRQGLDIVDLVALSGSHTIGNSRCTSFRQRLYN  224

Query  881   ----PTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHK  1048
                    DP+LDP+YA  L+ RCP +  D           D  +P   DN Y+KNIL  K
Sbjct  225   QSGNAQPDPSLDPSYAAELRKRCPRSGGDQNLFFL-----DFVSPTKFDNYYFKNILAAK  279

Query  1049  GLLVVDELLAT-HPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRY  1225
             GLL  DE+L T +  +A  V   A +++ F +QFA+++V M   +PLTG +GEIRKNCR 
Sbjct  280   GLLNSDEVLLTKNLQSAELVRAYAENSELFFEQFAKSMVKMGNISPLTGSRGEIRKNCRK  339

Query  1226  VN  1231
             VN
Sbjct  340   VN  341



>ref|XP_009591264.1| PREDICTED: peroxidase 72-like [Nicotiana tomentosiformis]
Length=330

 Score =   248 bits (633),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 134/308 (44%), Positives = 184/308 (60%), Gaps = 12/308 (4%)
 Frame = +2

Query  329   GDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVA  508
             G+L   YY  SCP+A++I+K  V K   +    A S LR  FHDC VK CDAS+LLDS  
Sbjct  28    GNLYPQYYYRSCPKAQEIVKSIVAKAVAKEARMAASLLRLHFHDCFVKGCDASLLLDSSR  87

Query  509   GVESERES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEM  685
             G+ +E+ S P     R F+ +  IK+ALE+ECP TVSCADI+AL+ARD  V+  GP  E+
Sbjct  88    GIVTEKGSNPNRNSARGFEVLDEIKSALEKECPQTVSCADILALAARDSTVLAGGPNWEV  147

Query  686   KTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINI  865
               GRRDS+   L+   N IP  N++   +LS+F+  G+D    VAL G+H++G   C + 
Sbjct  148   PLGRRDSRSASLSGSNNNIPAPNNTFSTILSKFKRQGLDLVDLVALSGSHTIGNSRCTSF  207

Query  866   VHRLY-----PTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYK  1030
               RLY        D TLD +YA  L+ RCP +  D           D  +P   DN Y+K
Sbjct  208   RQRLYNQSGNSQPDSTLDQSYAAQLRNRCPKSGGDQNLFFL-----DFVSPTKFDNSYFK  262

Query  1031  NILEHKGLLVVDELLATHP-ATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEI  1207
             N+L  KGLL  D++LAT   A+   V++ A +N+ F + FA+++V M   +PLTG +GEI
Sbjct  263   NLLASKGLLNSDQVLATKSQASLALVKQYAENNRLFFEHFAKSMVKMGNISPLTGSRGEI  322

Query  1208  RKNCRYVN  1231
             RKNCR +N
Sbjct  323   RKNCRKMN  330



>ref|XP_001784989.1| predicted protein [Physcomitrella patens]
 gb|EDQ50210.1| predicted protein [Physcomitrella patens]
Length=321

 Score =   246 bits (629),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 121/295 (41%), Positives = 180/295 (61%), Gaps = 5/295 (2%)
 Frame = +2

Query  347   YYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGVESER  526
             +Y +SCP AE II++ + ++YE+ GN A S++R  FHD      DAS  L S  G  SE+
Sbjct  32    FYRKSCPNAEKIIRDSIYRMYEKKGNIATSFIRFGFHD-FFNGADASFFLLSAPGKTSEK  90

Query  527   ESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTGRRDS  706
             +S    GMRN KY+  IKA +E+ CP  VSCADI+A+ +     +L GP   +KTGR+D+
Sbjct  91    DSHSMVGMRNEKYVNNIKAEVEKVCPGVVSCADILAVGSAAAVQVLGGPYIHVKTGRKDT  150

Query  707   KETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHRLYPT  886
             + +  +  +  IP   D +  VL+ +++IG++    VAL+GAH++GR HC + + R++P 
Sbjct  151   RNSMKSSADT-IPRPQDGVTKVLTFYKNIGINPREAVALMGAHTIGRAHCTSFIERIFPK  209

Query  887   VDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGLLVVD  1066
             VDP +DP +A+ LK RCP+    P +V  TY RND  +PM  DN Y+KN++  +GL+ +D
Sbjct  210   VDPKMDPVFAEKLKRRCPA---KPTSVHFTYFRNDEPSPMAFDNNYFKNLVTKQGLMGID  266

Query  1067  ELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
               L     T  +V + + +   + + F  A   +SE   LTG QGEIRK C YVN
Sbjct  267   SALYWDGRTQKYVIEFSQNEAAWREVFTVAFKKLSEYKVLTGRQGEIRKRCMYVN  321



>ref|XP_010059581.1| PREDICTED: peroxidase 29 [Eucalyptus grandis]
Length=311

 Score =   246 bits (628),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 123/307 (40%), Positives = 187/307 (61%), Gaps = 6/307 (2%)
 Frame = +2

Query  314   IRCAKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASIL  493
             I  + G L   YY  +CP AEDI++ +++           ++LR +FHDC V+ CDASIL
Sbjct  10    IGVSDGQLAYDYYKTTCPNAEDIVRREMLSFAFLDATAPAAFLRLMFHDCQVQGCDASIL  69

Query  494   LDSVAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGP  673
             LD++ G +SE +S RNFG+R    I+ +K+ALE ECP  VSCADI+AL+AR+   +  GP
Sbjct  70    LDAI-GSKSEIKSSRNFGIRKLDAIEYVKSALEAECPGQVSCADIIALAARESVALSGGP  128

Query  674   RAEMKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVH  853
                +  GR+DS+ +   + +  +P+ + S++  L  F + G++ E +VA+LGAH++G  H
Sbjct  129   HIAIPLGRKDSRASNYQQADAHLPSPSISVDAFLHIFMTKGLNLEESVAILGAHTLGAGH  188

Query  854   CINIVHRLY-PTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYK  1030
             C+NI+ RLY P  D  ++P +   L+L+CP+  P    +  T + ND  TP I DN YY+
Sbjct  189   CLNIIDRLYNPKPDDLMNPVFEARLRLQCPTLNP---LMNLTATSND-ITPTIFDNQYYR  244

Query  1031  NILEHKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIR  1210
             +IL  KGL  +D  ++  P T+  V++ A D  YF   F+ A V +S  N L+  +GE+R
Sbjct  245   DILLGKGLFFIDSSISRDPRTSDIVKQFAIDQDYFFRAFSSAFVKLSSANTLSKTKGEVR  304

Query  1211  KNCRYVN  1231
             K C  VN
Sbjct  305   KQCSRVN  311



>ref|XP_009621858.1| PREDICTED: peroxidase 72-like [Nicotiana tomentosiformis]
Length=330

 Score =   246 bits (628),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 133/312 (43%), Positives = 184/312 (59%), Gaps = 12/312 (4%)
 Frame = +2

Query  317   RCAKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILL  496
             + + G L   YY  SCP+A++I+K  V K   +    A S LR  FHDC VK CDAS+LL
Sbjct  24    KTSGGSLYPQYYYRSCPKAQEIVKSVVAKAVAKEARMAASLLRLHFHDCFVKGCDASLLL  83

Query  497   DSVAGVESERES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGP  673
             DS  G+ +E+ S P     R F+ I  IK+ALE+ECP TVSCADI+AL+ARD  V+  GP
Sbjct  84    DSSRGIVTEKRSNPNRNSARGFEVIDEIKSALEKECPQTVSCADILALAARDSTVLAGGP  143

Query  674   RAEMKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVH  853
               E+  GRRDS+   L+   N IP  N++   +L++F+  G+D    VAL G+H++G   
Sbjct  144   NWEVPLGRRDSRGASLSGSNNDIPAPNNTFNTILTKFKRQGLDLVDLVALSGSHTIGNSR  203

Query  854   CINIVHRLY-----PTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDN  1018
             C +   RLY        D TLD +YA  L+ RCP +  D           D  +P   DN
Sbjct  204   CTSFRQRLYNQSGNSQPDSTLDQSYAAQLRNRCPKSGGDQNLFFL-----DFVSPTKFDN  258

Query  1019  MYYKNILEHKGLLVVDELLATHP-ATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGD  1195
              Y+KN+L  KGLL  D++L T   A+   V++ A +N+ F + FA+++V M   +PLTG 
Sbjct  259   SYFKNLLASKGLLNSDQVLTTKSQASLALVKQYAENNELFFEHFAKSMVKMGNISPLTGS  318

Query  1196  QGEIRKNCRYVN  1231
             +GEIRKNCR +N
Sbjct  319   RGEIRKNCRKMN  330



>ref|XP_006425607.1| hypothetical protein CICLE_v10026054mg [Citrus clementina]
 gb|ESR38847.1| hypothetical protein CICLE_v10026054mg [Citrus clementina]
Length=330

 Score =   246 bits (628),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 135/312 (43%), Positives = 186/312 (60%), Gaps = 12/312 (4%)
 Frame = +2

Query  317   RCAKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILL  496
             + + G L   +Y  SCP+A++I+K  V K   +    A S LR  FHDC VK CDASILL
Sbjct  24    KSSSGYLYPQFYDHSCPKAQEIVKCIVAKAVAKETRMAASLLRLHFHDCFVKGCDASILL  83

Query  497   DSVAGVESERES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGP  673
             DS   + SE+ S P     R F+ I  IK+ALE+ECP TVSCADI+AL+ARD  V+  GP
Sbjct  84    DSSGSIISEKRSNPNRNSARGFEVIDEIKSALEKECPQTVSCADILALAARDSTVLTGGP  143

Query  674   RAEMKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVH  853
               E+  GRRDSK   L+   N IP  N++ + +L++F+  G+D    VAL G+H++G   
Sbjct  144   SWEVPLGRRDSKGASLSGSNNDIPAPNNTFQTILTKFKLQGLDIVDLVALSGSHTIGNAR  203

Query  854   CINIVHRLYPTV-----DPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDN  1018
             C +   RLY        D TLD +YA  L++ CP +  D           D  +P   DN
Sbjct  204   CTSFRQRLYNQSGNGQPDNTLDQSYAAQLRIGCPRSGGDQNLFFL-----DFVSPTKFDN  258

Query  1019  MYYKNILEHKGLLVVDELLAT-HPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGD  1195
              Y+KNIL  KGLL  D++L+T + A+   V+K A +N  F  QFA+++V M   +PLTG+
Sbjct  259   SYFKNILASKGLLNSDQVLSTKNEASMELVKKYAENNDLFFQQFAKSMVKMGNISPLTGN  318

Query  1196  QGEIRKNCRYVN  1231
             +GEIR+NCR +N
Sbjct  319   RGEIRRNCRRIN  330



>gb|EYU31175.1| hypothetical protein MIMGU_mgv1a009720mg [Erythranthe guttata]
Length=333

 Score =   245 bits (625),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 132/314 (42%), Positives = 183/314 (58%), Gaps = 12/314 (4%)
 Frame = +2

Query  311   HIRCAKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASI  490
             H+    G L   +Y  SCP+A+ I+   V K        A S +R  FHDC VK CDASI
Sbjct  24    HVNTFGGYLYPQFYDRSCPQAQQIVNSVVSKAVAREARMAASLVRLHFHDCFVKGCDASI  83

Query  491   LLDSVAGVESERES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLK  667
             LLDS +G+ SE+ S P    +R  + I  IK+ LE++CP+TVSCADI+AL+ARD  V+  
Sbjct  84    LLDSASGIISEKGSKPNKNSIRGLEVIDEIKSELEKQCPHTVSCADIMALAARDSTVLAG  143

Query  668   GPRAEMKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGR  847
             GP   +  GRRDSK   L+   N IP  N++ + +L++F+  G+D    VAL G+H++G 
Sbjct  144   GPSWVVPLGRRDSKGASLSGSNNNIPAPNNTFQTILTKFKLQGLDIVDLVALSGSHTIGN  203

Query  848   VHCINIVHRLY-----PTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMIL  1012
               C++   RLY        DPTLD +YA  L+ RCP    D        S  D  +P   
Sbjct  204   ARCVSFRQRLYNQSGNSKPDPTLDQSYAATLRTRCPKFGGD-----QNLSFLDLVSPTKF  258

Query  1013  DNMYYKNILEHKGLLVVDELLAT-HPATAPFVEKMAADNQYFHDQFARALVIMSENNPLT  1189
             DN Y+KN+L  KGLL  D++L T +  +   V+K A  N+ F +QFA+++V M   +PLT
Sbjct  259   DNSYFKNLLSFKGLLSSDQILVTKNQVSFELVKKYAESNEVFFEQFAKSMVKMGNISPLT  318

Query  1190  GDQGEIRKNCRYVN  1231
             G +GEIR NCR +N
Sbjct  319   GFKGEIRSNCRKIN  332



>gb|KDO71031.1| hypothetical protein CISIN_1g020149mg [Citrus sinensis]
Length=330

 Score =   244 bits (624),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 134/312 (43%), Positives = 186/312 (60%), Gaps = 12/312 (4%)
 Frame = +2

Query  317   RCAKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILL  496
             + + G L   +Y  SCP+A++I++  V K   +    A S LR  FHDC VK CDASILL
Sbjct  24    KSSSGYLYPQFYDHSCPKAQEIVQCIVAKAVAKETRMAASLLRLHFHDCFVKGCDASILL  83

Query  497   DSVAGVESERES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGP  673
             DS   + SE+ S P     R F+ I  IK+ALE+ECP TVSCADI+AL+ARD  V+  GP
Sbjct  84    DSSGSIISEKRSNPNRNSARGFEVIDEIKSALEKECPQTVSCADILALAARDSTVLTGGP  143

Query  674   RAEMKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVH  853
               E+  GRRDSK   L+   N IP  N++ + +L++F+  G+D    VAL G+H++G   
Sbjct  144   SWEVPLGRRDSKGASLSGSNNDIPAPNNTFQTILTKFKLQGLDIVDLVALSGSHTIGNAR  203

Query  854   CINIVHRLYPTV-----DPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDN  1018
             C +   RLY        D TLD +YA  L++ CP +  D           D  +P   DN
Sbjct  204   CTSFRQRLYNQSGNGQPDNTLDESYAAQLRMGCPRSGGDQNLFFL-----DFVSPTKFDN  258

Query  1019  MYYKNILEHKGLLVVDELLAT-HPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGD  1195
              Y+KNIL  KGLL  D++L+T + A+   V+K A +N  F  QFA+++V M   +PLTG+
Sbjct  259   SYFKNILASKGLLNSDQVLSTKNEASMELVKKYAENNDLFFQQFAKSMVKMGNISPLTGN  318

Query  1196  QGEIRKNCRYVN  1231
             +GEIR+NCR +N
Sbjct  319   RGEIRRNCRRIN  330



>ref|XP_009771827.1| PREDICTED: peroxidase 72-like [Nicotiana sylvestris]
Length=330

 Score =   244 bits (624),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 132/302 (44%), Positives = 181/302 (60%), Gaps = 12/302 (4%)
 Frame = +2

Query  347   YYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGVESER  526
             YY  SCP+A++I+K  V K   +    A S LR  FHDC VK CDAS+LLDS  G+ +E+
Sbjct  34    YYYRSCPKAQEIVKSVVAKAVAKEARMAASLLRLHFHDCFVKGCDASLLLDSSRGIVTEK  93

Query  527   ESPRNF-GMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTGRRD  703
              S  N    R F+ +  IK+ALE+ECP TVSCADI+AL+ARD  V+  GP  E+  GRRD
Sbjct  94    GSNANRNSARGFEVLDEIKSALEKECPQTVSCADILALAARDSTVLAGGPNWEVPLGRRD  153

Query  704   SKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHRLYP  883
             S+   L+   N IP  N++ + +LS+F+  G+D    VAL G+H++G   C +   RLY 
Sbjct  154   SRSASLSGSNNNIPAPNNTFDTILSKFKRQGLDLVDLVALSGSHTIGNSRCTSFRQRLYN  213

Query  884   TV-----DPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHK  1048
                    D TLD +YA  L+ RCP +  D           D  +P   DN Y+KN+L  K
Sbjct  214   QSGNNQPDSTLDQSYAAQLRNRCPKSGGDQNLFFL-----DFVSPTKFDNSYFKNLLASK  268

Query  1049  GLLVVDELLATHP-ATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRY  1225
             GLL  D++LAT   A+   V++ A +N  F + FA+++V M   +PLTG +GEIRKNCR 
Sbjct  269   GLLNSDQVLATKSQASLALVKQYAENNALFFEHFAKSMVKMGNISPLTGSRGEIRKNCRK  328

Query  1226  VN  1231
             +N
Sbjct  329   MN  330



>ref|XP_006466861.1| PREDICTED: peroxidase 72-like [Citrus sinensis]
Length=330

 Score =   244 bits (624),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 134/312 (43%), Positives = 186/312 (60%), Gaps = 12/312 (4%)
 Frame = +2

Query  317   RCAKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILL  496
             + + G L   +Y  SCP+A++I+K  V K   +    A S LR  FHDC VK CDASILL
Sbjct  24    KSSSGYLYPQFYDHSCPKAQEIVKCIVAKAVAKETRMAASLLRLHFHDCFVKGCDASILL  83

Query  497   DSVAGVESERES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGP  673
             D+   + SE+ S P     R F+ I  IK+ALE+ECP TVSCADI+AL+ARD  V+  GP
Sbjct  84    DNSGSIISEKRSNPNRNSARGFEVIDEIKSALEKECPQTVSCADILALAARDSTVLTGGP  143

Query  674   RAEMKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVH  853
               E+  GRRDSK   L+   N IP  N++ + +L++F+  G+D    VAL G+H++G   
Sbjct  144   SWEVPLGRRDSKGASLSGSNNDIPAPNNTFQTILTKFKLQGLDIVDLVALSGSHTIGNAR  203

Query  854   CINIVHRLYPTV-----DPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDN  1018
             C +   RLY        D TLD +YA  L++ CP +  D           D  +P   DN
Sbjct  204   CTSFRQRLYNQSGNGQPDNTLDQSYAAQLRIGCPRSGGDQNLFFL-----DFVSPTKFDN  258

Query  1019  MYYKNILEHKGLLVVDELLAT-HPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGD  1195
              Y+KNIL  KGLL  D++L+T + A+   V+K A +N  F  QFA+++V M   +PLTG+
Sbjct  259   SYFKNILASKGLLNSDQVLSTKNEASMELVKKYAENNDLFFQQFAKSMVKMGNISPLTGN  318

Query  1196  QGEIRKNCRYVN  1231
             +GEIR+NCR +N
Sbjct  319   RGEIRRNCRRIN  330



>ref|XP_004149985.1| PREDICTED: peroxidase 72-like [Cucumis sativus]
 ref|XP_004158888.1| PREDICTED: peroxidase 72-like [Cucumis sativus]
 gb|KGN48875.1| hypothetical protein Csa_6G504560 [Cucumis sativus]
Length=332

 Score =   244 bits (624),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 131/308 (43%), Positives = 181/308 (59%), Gaps = 13/308 (4%)
 Frame = +2

Query  329   GDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVA  508
             G L   YY  SCP+A++I+K  V K +      A S LR  FHDC V+ CDAS+LLDS  
Sbjct  30    GSLYPQYYDRSCPKAKEIVKSIVAKAFAREARIAASILRLHFHDCFVQGCDASLLLDSSG  89

Query  509   GVESERES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEM  685
              + SE+ S P     R F+ I  IK+ALE+ECP TVSCADI++L+ARD   +  GP  E+
Sbjct  90    NIRSEKNSNPNKNSARGFEVIDEIKSALEKECPQTVSCADILSLAARDSTFITGGPYWEV  149

Query  686   KTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINI  865
               GR+DS+   L+   N IP  N++ + +L+RFQ+ G+D    VAL G H++G   C + 
Sbjct  150   PLGRKDSRTASLSGSNNNIPAPNNTFQTILNRFQNQGLDIVDLVALSGGHTIGNSRCTSF  209

Query  866   VHRLY-----PTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYK  1030
               RLY        D TL  ++A  L+ RCP +  D       YS      P   DN Y+K
Sbjct  210   RQRLYNQNGNGQPDKTLPQSFATDLRSRCPRSGGDNNLFSLDYS------PTKFDNSYFK  263

Query  1031  NILEHKGLLVVDELLAT-HPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEI  1207
             N++  KGLL  D++L T + A+A  V+K A D++ F  QFA++++ MS  +PLTG  GEI
Sbjct  264   NLVAFKGLLNSDQVLLTGNDASAALVKKYADDSEEFFQQFAKSMIKMSNISPLTGSSGEI  323

Query  1208  RKNCRYVN  1231
             RK CR +N
Sbjct  324   RKTCRKIN  331



>ref|XP_009396319.1| PREDICTED: peroxidase 72-like [Musa acuminata subsp. malaccensis]
Length=332

 Score =   244 bits (624),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 134/302 (44%), Positives = 182/302 (60%), Gaps = 12/302 (4%)
 Frame = +2

Query  347   YYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGVESER  526
             +Y  SCP+A +I+K  V K   +    A S LR  FHDC VK CDASILLDS   + SE+
Sbjct  34    FYDRSCPKAHEIVKSIVAKAVAKEARMAASLLRLHFHDCFVKGCDASILLDSSKTIVSEK  93

Query  527   ES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTGRRD  703
              S P    +R F+ I  IK+ALE+ CP+TVSCADI+AL+ARD  V++ GP  E+  GRRD
Sbjct  94    MSVPNRNSVRGFEVIDEIKSALEKACPHTVSCADILALAARDSTVLVGGPYWEVPLGRRD  153

Query  704   SKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHRLY-  880
             S    +    N IP  N++++ ++++F+  G+D    VAL G+H++G+  C +   RLY 
Sbjct  154   SLGASIQGSNNHIPAPNNTLQTIITKFKLKGLDLVDLVALSGSHTIGQSRCTSFRQRLYN  213

Query  881   ----PTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHK  1048
                    D TLDP YA  L+ RCP +  D + + P     D  +P   DN Y+KN++  K
Sbjct  214   QTGNGLADFTLDPAYAASLRSRCPRSGGD-QNLFPL----DLVSPTKFDNHYFKNLVAKK  268

Query  1049  GLLVVDELLATH-PATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRY  1225
             GLL  DE+L T+ PAT   VE  AA+ + F   FAR++V M    PLTG  G+IRKNCR 
Sbjct  269   GLLSSDEILFTNSPATKKLVELYAANGELFFQHFARSMVKMGNIAPLTGSMGQIRKNCRK  328

Query  1226  VN  1231
             VN
Sbjct  329   VN  330



>ref|XP_011083175.1| PREDICTED: peroxidase 72-like [Sesamum indicum]
Length=331

 Score =   243 bits (621),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 133/308 (43%), Positives = 182/308 (59%), Gaps = 12/308 (4%)
 Frame = +2

Query  329   GDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVA  508
             G L   +Y  SCPRA++I++  V K   +    A S +R  FHDC VK CDASILLDS  
Sbjct  28    GYLYPQFYDRSCPRAQEIVRSVVAKSVAKEARMAASLVRLHFHDCFVKGCDASILLDSTG  87

Query  509   GVESERES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEM  685
              + SE+ S P     R F+ I  IK+ALE+ECP TVSCADI+AL+ARD  V++ GP   +
Sbjct  88    SLVSEKRSNPNRNSARGFEVIDEIKSALEKECPQTVSCADIMALAARDSTVLVGGPSWVV  147

Query  686   KTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINI  865
               GRRDSK   L+   N IP  N++ + +L++F+  G+D    VAL G+H++G   C + 
Sbjct  148   PLGRRDSKGASLSGSNNNIPAPNNTFQTILTKFKLQGLDIVDLVALSGSHTIGNSRCASF  207

Query  866   VHRLY-----PTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYK  1030
               RLY        D TLD +YA  L+ RCP +  D           D  +P   DN Y+K
Sbjct  208   RQRLYNQSGNSQPDFTLDQSYAAQLRARCPRSGGDQNLFFL-----DFVSPTKFDNSYFK  262

Query  1031  NILEHKGLLVVDELLAT-HPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEI  1207
             N+L  KGLL  D++L T + A+   V+  A  N+ F +QFA+++V M   +PLTG +GEI
Sbjct  263   NLLSFKGLLSSDQVLVTKNQASLELVKMYAESNELFFEQFAKSMVKMGNISPLTGSRGEI  322

Query  1208  RKNCRYVN  1231
             RKNCR +N
Sbjct  323   RKNCRRIN  330



>gb|KCW75248.1| hypothetical protein EUGRSUZ_E03999, partial [Eucalyptus grandis]
Length=317

 Score =   243 bits (620),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 121/303 (40%), Positives = 185/303 (61%), Gaps = 6/303 (2%)
 Frame = +2

Query  314   IRCAKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASIL  493
             I  + G L   YY  +CP AEDI++ +++           ++LR +FHDC V+ CDASIL
Sbjct  18    IGVSDGQLAYDYYKTTCPNAEDIVRREMLSFAFLDATAPAAFLRLMFHDCQVQGCDASIL  77

Query  494   LDSVAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGP  673
             LD++ G +SE +S RNFG+R    I+ +K+ALE ECP  VSCADI+AL+AR+   +  GP
Sbjct  78    LDAI-GSKSEIKSSRNFGIRKLDAIEYVKSALEAECPGQVSCADIIALAARESVALSGGP  136

Query  674   RAEMKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVH  853
                +  GR+DS+ +   + +  +P+ + S++  L  F + G++ E +VA+LGAH++G  H
Sbjct  137   HIAIPLGRKDSRASNYQQADAHLPSPSISVDAFLHIFMTKGLNLEESVAILGAHTLGAGH  196

Query  854   CINIVHRLY-PTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYK  1030
             C+NI+ RLY P  D  ++P +   L+L+CP+  P    +  T + ND  TP I DN YY+
Sbjct  197   CLNIIDRLYNPKPDDLMNPVFEARLRLQCPTLNP---LMNLTATSND-ITPTIFDNQYYR  252

Query  1031  NILEHKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIR  1210
             +IL  KGL  +D  ++  P T+  V++ A D  YF   F+ A V +S  N L+  +GE+R
Sbjct  253   DILLGKGLFFIDSSISRDPRTSDIVKQFAIDQDYFFRAFSSAFVKLSSANTLSKTKGEVR  312

Query  1211  KNC  1219
             K C
Sbjct  313   KQC  315



>dbj|BAB89258.1| putative peroxidase ATP6a [Oryza sativa Japonica Group]
 tpe|CAH69259.1| TPA: class III peroxidase 17 precursor [Oryza sativa Japonica 
Group]
Length=336

 Score =   243 bits (621),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 138/303 (46%), Positives = 177/303 (58%), Gaps = 13/303 (4%)
 Frame = +2

Query  347   YYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGVESER  526
             +Y  SCP+A+ I+   V K + +    A S LR  FHDC VK CDASILLDS A + SE+
Sbjct  36    FYDHSCPQAQQIVASIVGKAHYQDPRMAASLLRLHFHDCFVKGCDASILLDSSATIMSEK  95

Query  527   ES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTGRRD  703
              S P     R F+ I  IKAALE  CP+TVSCADI+AL+ARD  VM  GP   +  GRRD
Sbjct  96    RSNPNRDSARGFEVIDEIKAALEAACPHTVSCADILALAARDSTVMTGGPGWIVPLGRRD  155

Query  704   SKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHRLYP  883
             S+   +    N IP  N+++  ++++F+  G+D    VALLG+H++G   C +   RLY 
Sbjct  156   SRGASVQGSNNDIPAPNNTLPTIITKFKLQGLDIVDLVALLGSHTIGDSRCTSFRQRLYN  215

Query  884   TV-----DPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHK  1048
                    D TLD +YA  L+ RCP +  D           D  TP   DN YYKN+L H+
Sbjct  216   QTGNGLPDFTLDASYAAALRPRCPRSGGDQNLF-----FLDPVTPFRFDNQYYKNLLAHR  270

Query  1049  GLLVVDELLAT--HPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCR  1222
             GLL  DE+L T  +PATA  VE  AAD   F   FAR++V M   +PLTG  GE+R NCR
Sbjct  271   GLLSSDEVLLTGGNPATAELVELYAADQDIFFAHFARSMVKMGNISPLTGGNGEVRTNCR  330

Query  1223  YVN  1231
              VN
Sbjct  331   RVN  333



>dbj|BAA94962.1| peroxidase [Asparagus officinalis]
Length=329

 Score =   243 bits (620),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 133/314 (42%), Positives = 181/314 (58%), Gaps = 12/314 (4%)
 Frame = +2

Query  311   HIRCAKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASI  490
             H+  A G L   +Y  SCPRA+ I+K  V K   +    A S LR  FHDC VK CD S+
Sbjct  20    HLCFADGSLTPQFYDHSCPRAQQIVKGVVEKAVAKDRRMAASLLRLHFHDCFVKGCDGSV  79

Query  491   LLDSVAGVESERES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLK  667
             LLDS   + SE+ S PR    R F+ I  +K+ALE+ECP TVSCADI+A+ ARD  V+  
Sbjct  80    LLDSSGTIVSEKRSNPRRDSARGFEVIDEVKSALEKECPQTVSCADILAVVARDSTVITG  139

Query  668   GPRAEMKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGR  847
             GP  E+  GRRDS    L+     IP  N++++ ++++F+  G+D    V LLG+H++G 
Sbjct  140   GPSWEVPLGRRDSLGASLSGSNYNIPAPNNTLQTIITKFKLKGLDIVDLVTLLGSHTIGD  199

Query  848   VHCINIVHRLYPTV-----DPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMIL  1012
               C +   RLY        D TLD TYA  L+ RCP +  D       ++     T    
Sbjct  200   ARCTSFRQRLYNQSGNGLPDATLDKTYAAQLRQRCPQSGGDQNLFALDFN-----TQFKF  254

Query  1013  DNMYYKNILEHKGLLVVDELLATHPATA-PFVEKMAADNQYFHDQFARALVIMSENNPLT  1189
             DN YYKN++  +GLL  DE+L T  +T    V+K A DN  F +QFA+++V M   +PLT
Sbjct  255   DNFYYKNLVASEGLLSSDEILFTQSSTTMALVKKYAEDNGAFFEQFAKSMVKMGNVDPLT  314

Query  1190  GDQGEIRKNCRYVN  1231
             G +GEIRK CR +N
Sbjct  315   GKRGEIRKICRRIN  328



>ref|NP_001043276.1| Os01g0543100 [Oryza sativa Japonica Group]
 dbj|BAF05190.1| Os01g0543100 [Oryza sativa Japonica Group]
 dbj|BAG97211.1| unnamed protein product [Oryza sativa Japonica Group]
Length=340

 Score =   243 bits (621),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 138/305 (45%), Positives = 179/305 (59%), Gaps = 17/305 (6%)
 Frame = +2

Query  347   YYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGVESER  526
             +Y  SCP+A+ I+   V K + +    A S LR  FHDC VK CDASILLDS A + SE+
Sbjct  40    FYDHSCPQAQQIVASIVGKAHYQDPRMAASLLRLHFHDCFVKGCDASILLDSSATIMSEK  99

Query  527   ES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTGRRD  703
              S P     R F+ I  IKAALE  CP+TVSCADI+AL+ARD  VM  GP   +  GRRD
Sbjct  100   RSNPNRDSARGFEVIDEIKAALEAACPHTVSCADILALAARDSTVMTGGPGWIVPLGRRD  159

Query  704   SKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHRLYP  883
             S+   +    N IP  N+++  ++++F+  G+D    VALLG+H++G   C +   RLY 
Sbjct  160   SRGASVQGSNNDIPAPNNTLPTIITKFKLQGLDIVDLVALLGSHTIGDSRCTSFRQRLYN  219

Query  884   TV-----DPTLDPTYADYLKLRCPSAEPDPRA--VEPTYSRNDRRTPMILDNMYYKNILE  1042
                    D TLD +YA  L+ RCP +  D     ++P        TP   DN YYKN+L 
Sbjct  220   QTGNGLPDFTLDASYAAALRPRCPRSGGDQNLFFLDPV-------TPFRFDNQYYKNLLA  272

Query  1043  HKGLLVVDELLAT--HPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKN  1216
             H+GLL  DE+L T  +PATA  VE  AAD   F   FAR++V M   +PLTG  GE+R N
Sbjct  273   HRGLLSSDEVLLTGGNPATAELVELYAADQDIFFAHFARSMVKMGNISPLTGGNGEVRTN  332

Query  1217  CRYVN  1231
             CR VN
Sbjct  333   CRRVN  337



>ref|XP_010924103.1| PREDICTED: peroxidase 72-like [Elaeis guineensis]
Length=331

 Score =   243 bits (620),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 183/308 (59%), Gaps = 12/308 (4%)
 Frame = +2

Query  329   GDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVA  508
             G L   +Y  SCPRA++I+K  V K +      A S LR  FHDC VK CDAS+LLDS  
Sbjct  28    GYLYPQFYDYSCPRAQEIVKSIVAKAFAREARMAASLLRLHFHDCFVKGCDASVLLDSTG  87

Query  509   GVESERES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEM  685
                SE+ S P     R F+ I  IK+ALEEECP TVSCADI+AL+ARD  V+  GP  E+
Sbjct  88    TFLSEKRSNPNRNSARGFEVIDEIKSALEEECPLTVSCADILALAARDSTVLTGGPSWEV  147

Query  686   KTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINI  865
               GRRDS    L+   N IP  N+++  ++++F+  G+D    VAL G+H++G+  C + 
Sbjct  148   LLGRRDSLGPSLSGSNNNIPAPNNTLPTIITKFKLQGLDLVDLVALSGSHTIGQSRCTSF  207

Query  866   VHRLYPTV-----DPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYK  1030
               RLY        D TLD  YA  L+ RCP +  D + + P     D  +P+  DN YYK
Sbjct  208   RQRLYNQTGNGLPDGTLDAAYAAQLRTRCPRSGGD-QNLFPL----DFVSPIKFDNNYYK  262

Query  1031  NILEHKGLLVVDELLAT-HPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEI  1207
             N++  KGLL  DE+L T   AT   V+  A +N+ F +QFA+++V M   +PLTG  GEI
Sbjct  263   NLMAWKGLLSSDEVLFTDSAATMQLVKLYAENNELFFEQFAKSMVKMGNISPLTGLWGEI  322

Query  1208  RKNCRYVN  1231
             RKNCR +N
Sbjct  323   RKNCRKIN  330



>ref|XP_008440774.1| PREDICTED: LOW QUALITY PROTEIN: peroxidase 49 [Cucumis melo]
Length=333

 Score =   243 bits (620),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 131/309 (42%), Positives = 183/309 (59%), Gaps = 12/309 (4%)
 Frame = +2

Query  329   GDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVA  508
             G L   YY  SCP+A++I+K  + K +      A S LR  FHDC V+ CDAS+LLDS  
Sbjct  30    GSLYPQYYDHSCPKAKEIVKSIMAKAFAREARIAASILRLHFHDCFVQGCDASLLLDSSG  89

Query  509   GVESERES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEM  685
              + +E+ S P     R F+ I  IK+ALE+ECP TVSCADI+AL+ARD  V+  GP  E+
Sbjct  90    NIRTEKNSNPNRNSARGFEVIDEIKSALEKECPQTVSCADILALAARDSTVITGGPYWEV  149

Query  686   KTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINI  865
               GR+DS+   L+   N IP  N++ + +L+RFQ+ G+D    VAL G H++G   C + 
Sbjct  150   PLGRKDSRTASLSGSNNNIPAPNNTFQTILNRFQNQGLDIVDLVALSGGHTIGNSRCTSF  209

Query  866   VHRLY-----PTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYK  1030
               RLY        D TL  + A  L+ RCP +  D       Y      +P   DN Y+K
Sbjct  210   RQRLYNQNGNGQPDKTLPQSLATELRNRCPRSGGDNNLFSLDYV-----SPTKFDNSYFK  264

Query  1031  NILEHKGLLVVDELLAT-HPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEI  1207
             N++  KGLL  D++L T + A+A  V+K A D++ F +QFA++++ MS  +PLTG  GEI
Sbjct  265   NLVGFKGLLNSDQVLLTGNDASAALVKKYADDSEEFFEQFAKSMIKMSNISPLTGSSGEI  324

Query  1208  RKNCRYVNT  1234
             RK CR +NT
Sbjct  325   RKTCRKINT  333



>ref|XP_003517206.1| PREDICTED: peroxidase 72-like [Glycine max]
Length=331

 Score =   243 bits (620),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 134/308 (44%), Positives = 182/308 (59%), Gaps = 12/308 (4%)
 Frame = +2

Query  329   GDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVA  508
             G L   +Y  SCPRA++I++  V K   +    A S LR  FHDC VK CDAS+LLDS  
Sbjct  28    GYLYPQFYDGSCPRAQEIVQSIVAKAVAKEPRMAASLLRLHFHDCFVKGCDASVLLDSSG  87

Query  509   GVESERES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEM  685
              + SE+ S P     R F+ I  IK+ALE+ECP+TVSCADI+AL+ARD  V+  GP   +
Sbjct  88    TIISEKRSNPNRDSARGFEVIDEIKSALEKECPHTVSCADILALAARDSTVLTGGPSWGV  147

Query  686   KTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINI  865
               GRRDS    ++   N IP  N++ + +L++F+  G+D    VAL G+H++G   C + 
Sbjct  148   PLGRRDSLGASISGSNNNIPAPNNTFQTILTKFKLKGLDIVDLVALSGSHTIGNSRCTSF  207

Query  866   VHRLY-----PTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYK  1030
               RLY        D TLD  YA  L+ RCP +  D           D  TP+  DN YYK
Sbjct  208   RQRLYNQTGNGKADFTLDQVYAAELRTRCPRSGGDQNLFVL-----DFVTPIKFDNFYYK  262

Query  1031  NILEHKGLLVVDELLAT-HPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEI  1207
             N+L +KGLL  DE+L T +  +A  V++ A +N  F +QFA+++V M    PLTG +GEI
Sbjct  263   NLLANKGLLSSDEILLTKNKVSADLVKQYAENNDIFFEQFAKSMVKMGNITPLTGSRGEI  322

Query  1208  RKNCRYVN  1231
             RKNCR +N
Sbjct  323   RKNCRRIN  330



>ref|XP_006590700.1| PREDICTED: peroxidase 72-like [Glycine max]
Length=331

 Score =   243 bits (619),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 134/308 (44%), Positives = 182/308 (59%), Gaps = 12/308 (4%)
 Frame = +2

Query  329   GDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVA  508
             G L   +Y  SCPRA++I++  V K   +    A S LR  FHDC VK CDAS+LLDS  
Sbjct  28    GYLYPQFYDGSCPRAQEIVQSIVAKAVAKEPRMAASLLRLHFHDCFVKGCDASVLLDSSG  87

Query  509   GVESERES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEM  685
              + SE+ S P     R F+ I  IK+ALE+ECP+TVSCADI+AL+ARD  V+  GP   +
Sbjct  88    TIISEKRSNPNRDSARGFEVIDEIKSALEKECPHTVSCADILALAARDSTVLTGGPSWGV  147

Query  686   KTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINI  865
               GRRDS    ++   N IP  N++ + +L++F+  G+D    VAL G+H++G   C + 
Sbjct  148   PLGRRDSLGASISGSNNNIPAPNNTFQTILTKFKLKGLDIVDLVALSGSHTIGNSRCTSF  207

Query  866   VHRLY-----PTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYK  1030
               RLY        D TLD  YA  L+ RCP +  D           D  TP+  DN YYK
Sbjct  208   RQRLYNQTGNGKADFTLDQVYAAELRTRCPRSGGDQNLFVL-----DFVTPIKFDNFYYK  262

Query  1031  NILEHKGLLVVDELLAT-HPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEI  1207
             N+L +KGLL  DE+L T +  +A  V++ A +N  F +QFA+++V M    PLTG +GEI
Sbjct  263   NLLANKGLLSSDEILLTKNQVSADLVKQYAENNDLFFEQFAKSMVKMGNITPLTGSRGEI  322

Query  1208  RKNCRYVN  1231
             RKNCR +N
Sbjct  323   RKNCRGIN  330



>ref|XP_010252387.1| PREDICTED: peroxidase 72-like [Nelumbo nucifera]
Length=332

 Score =   243 bits (619),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 133/309 (43%), Positives = 184/309 (60%), Gaps = 12/309 (4%)
 Frame = +2

Query  329   GDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVA  508
             G L   +Y  SCPRA++I+K  V K        A S LR  FHDC VK CDAS+LLDS  
Sbjct  28    GYLYPQFYDYSCPRAQEIVKSIVAKAVAREARMAASLLRLHFHDCFVKGCDASLLLDSSG  87

Query  509   GVESERES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEM  685
              + SE+ S P    +R F+ I  IK+ALE+ECP+TVSCADI+AL+ARD  V+  GP  E+
Sbjct  88    SITSEKRSNPNRNSVRGFEVIDEIKSALEKECPHTVSCADILALAARDSTVLAGGPSWEV  147

Query  686   KTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINI  865
               GRRDS+   L+   N IP  N++ + +L++F+  G++    VAL G+H++G   C + 
Sbjct  148   PLGRRDSRGASLSGSNNNIPAPNNTFQTILTKFKLQGLNIVDLVALSGSHTIGNARCTSF  207

Query  866   VHRLYPTV-----DPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYK  1030
               RLY        D +LD +YA  L+ RCP +  D           D  TP   DN Y+K
Sbjct  208   RQRLYNQSGNGQPDYSLDQSYAMQLRSRCPRSGGDQNLFFL-----DFVTPTKFDNHYFK  262

Query  1031  NILEHKGLLVVDELLATHP-ATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEI  1207
             NIL  KGLL  D++L T   A+   V+K + +N+ F +QFA+++V M   +PLT  +GEI
Sbjct  263   NILASKGLLNSDQVLFTKSKASMELVKKYSENNELFFEQFAKSMVKMGNVSPLTDSKGEI  322

Query  1208  RKNCRYVNT  1234
             RKNCR +N+
Sbjct  323   RKNCRRINS  331



>ref|XP_010252386.1| PREDICTED: peroxidase 72-like [Nelumbo nucifera]
Length=332

 Score =   242 bits (618),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 133/313 (42%), Positives = 186/313 (59%), Gaps = 12/313 (4%)
 Frame = +2

Query  317   RCAKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILL  496
             + + G L   +Y  SCP+A++I+K  V K        A S LR  FHDC VK CDAS+LL
Sbjct  24    KTSGGYLYPQFYDYSCPKAQEIVKSIVAKAVAREARMAASLLRLHFHDCFVKGCDASLLL  83

Query  497   DSVAGVESERES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGP  673
             D+   + SE+ S P    +R F+ I  IK ALE+ECP+TVSCADI+AL+ARD  V+  GP
Sbjct  84    DNSGSIISEKRSNPNRNSVRGFEVIDEIKYALEKECPHTVSCADILALAARDSTVLAGGP  143

Query  674   RAEMKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVH  853
               E+  GRRDS+   L+   N IP  N++ + +L++F+  G++    VAL G+H++G   
Sbjct  144   SWEVPLGRRDSRGASLSGSNNNIPAPNNTFQTILTKFKLQGLNIVDLVALSGSHTIGNAR  203

Query  854   CINIVHRLYPTV-----DPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDN  1018
             C +   RLY        D +LD +YA  L+ RCP +  D           D  TP   DN
Sbjct  204   CTSFRQRLYNQSGNGQPDYSLDQSYAMQLRSRCPRSGGDQNLFFL-----DFVTPTKFDN  258

Query  1019  MYYKNILEHKGLLVVDELLATHP-ATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGD  1195
              Y+KNIL  KGLL  D++L T   A+   V+K A +N+ F +QFA+++V M   +PLTG 
Sbjct  259   HYFKNILASKGLLNSDQVLFTKSKASMELVKKYAENNELFFEQFAKSMVKMGNISPLTGS  318

Query  1196  QGEIRKNCRYVNT  1234
             +GEIRKNCR +N+
Sbjct  319   KGEIRKNCRRINS  331



>ref|XP_009395537.1| PREDICTED: peroxidase 72-like [Musa acuminata subsp. malaccensis]
Length=333

 Score =   242 bits (617),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 132/302 (44%), Positives = 182/302 (60%), Gaps = 12/302 (4%)
 Frame = +2

Query  347   YYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGVESER  526
             +Y  SCP+A++I+K  V K   +    A S LR  FHDC VK CDASILLDS   + SE+
Sbjct  35    FYDHSCPKAQEIVKSIVAKAVAKEARMAASLLRLHFHDCFVKGCDASILLDSSGTIVSEK  94

Query  527   ES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTGRRD  703
              S P    +R F+ I  IK+ALE+ECP+TVSCAD++AL+ARD  V+  GP  ++  GRRD
Sbjct  95    GSIPNRNSVRGFEVIDEIKSALEKECPHTVSCADVLALAARDSTVLAGGPYWDVPLGRRD  154

Query  704   SKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHRLYP  883
             S    +    N IP  N++ + +L++F+  G+D    VAL G+H++G   C +   RLY 
Sbjct  155   SLGASIQGSNNNIPAPNNTFQTILTKFKLKGLDLVDLVALSGSHTIGLSRCTSFRQRLYN  214

Query  884   TV-----DPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHK  1048
                    D TLDP YA +L+ RCP +  D + + P     D  +P   DN Y++N++   
Sbjct  215   QTGKGFPDFTLDPAYAAHLRTRCPRSGGD-QNLFPL----DFVSPTKFDNSYFRNLMAKT  269

Query  1049  GLLVVDELLAT-HPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRY  1225
             GLL  DE+L T +PAT   VE  AA N+ F   FAR++V M    PLTG++GEIR NCR 
Sbjct  270   GLLSSDEILFTNNPATMHLVELYAAHNELFFQHFARSMVKMGNITPLTGNKGEIRMNCRK  329

Query  1226  VN  1231
             +N
Sbjct  330   LN  331



>gb|ACK76695.1| peroxidase, partial [Pyrus x bretschneideri]
 gb|ACK76696.1| peroxidase [Pyrus pyrifolia]
Length=191

 Score =   237 bits (604),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 111/193 (58%), Positives = 144/193 (75%), Gaps = 2/193 (1%)
 Frame = +2

Query  485   SILLDSVAGVESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVML  664
             S+LLDS     SE+E  R+FGMRNF+YI+ IK ALE ECP  VSC+DI+ LSAR+G V L
Sbjct  1     SLLLDSTRRSLSEKEMDRSFGMRNFRYIEEIKEALERECPGVVSCSDILVLSAREGVVRL  60

Query  665   KGPRAEMKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVG  844
              GP   +KTGRRD + +    +E ++P+HN+SM +VL +F  +G+DT G VALLGAHSVG
Sbjct  61    GGPFIPLKTGRRDGRRSRAEILEQYLPDHNESMSVVLEKFADMGIDTPGLVALLGAHSVG  120

Query  845   RVHCINIVHRLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMY  1024
             R HC+ +VHRLYP VDP L+P +  ++  +CP A PDP+AV+  Y RNDR TPMI DN Y
Sbjct  121   RTHCVKLVHRLYPEVDPQLNPDHVPHMLKKCPDAIPDPKAVQ--YVRNDRGTPMIFDNNY  178

Query  1025  YKNILEHKGLLVV  1063
             Y+NIL++KGLL+V
Sbjct  179   YRNILDNKGLLIV  191



>ref|XP_004232442.2| PREDICTED: peroxidase 49-like [Solanum lycopersicum]
Length=361

 Score =   243 bits (619),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 131/303 (43%), Positives = 178/303 (59%), Gaps = 12/303 (4%)
 Frame = +2

Query  347   YYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGVESER  526
             YY +SCP+A+ I+K  V K   +    A S LR  FHDC VK CDAS+LLDS  G+ +E+
Sbjct  63    YYYKSCPQAQQIVKSVVAKAVAKEARMAASLLRLHFHDCFVKGCDASLLLDSSRGIVTEK  122

Query  527   ES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTGRRD  703
              S P     R F+ +  IK+ALE+ECP TVSCADI+AL+ARD  V+  GP  E+  GRRD
Sbjct  123   GSNPNKNSARGFEVLDEIKSALEKECPQTVSCADILALAARDSTVLAGGPSWEVPLGRRD  182

Query  704   SKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHRLYP  883
             S+   L+   N IP  N++ + +LS+F+  G+D    VAL G+H++G   C +   RLY 
Sbjct  183   SRSASLSGSNNNIPAPNNTFDSILSKFKRQGLDLVDLVALSGSHTIGNSRCTSFRQRLYN  242

Query  884   TV-----DPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHK  1048
                    D TLD +YA  L+ RCP +  D           D  +P   DN Y+K +L  K
Sbjct  243   QSGNNKPDSTLDQSYATQLRNRCPKSGGDQNLFFL-----DFVSPTKFDNSYFKLLLASK  297

Query  1049  GLLVVDELLATHP-ATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRY  1225
             GLL  D++L T   A+   V++ A DN  F D FA+++V M   +PLTG  GEIRK CR 
Sbjct  298   GLLNSDQVLTTKSQASLALVKQYAEDNALFFDHFAKSMVKMGNISPLTGSSGEIRKTCRK  357

Query  1226  VNT  1234
             +N+
Sbjct  358   INS  360



>gb|AHL39156.1| class III peroxidase [Populus trichocarpa]
Length=333

 Score =   242 bits (617),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 130/312 (42%), Positives = 184/312 (59%), Gaps = 12/312 (4%)
 Frame = +2

Query  317   RCAKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILL  496
             + + G L   +Y  SCP+A++I+   V K   +    A S LR  FHDC VK CDASILL
Sbjct  26    KTSGGYLYPQFYDRSCPKAQEIVNSIVAKAVAKEARMAASLLRLHFHDCFVKGCDASILL  85

Query  497   DSVAGVESERES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGP  673
             DS   + +E+ S P    +R F+ I  IK+ALE+ECP TVSCADI+AL+ARD  V+  GP
Sbjct  86    DSSGSIITEKSSNPNRNSVRGFEVIDKIKSALEKECPKTVSCADIMALAARDSTVIAGGP  145

Query  674   RAEMKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVH  853
               E+  GRRDS+   L+   N IP  N++ + +L++F+  G+D    VAL G+H++G   
Sbjct  146   SWEVPLGRRDSRGASLSGSNNNIPAPNNTFQTILTKFKLQGLDVVDLVALSGSHTIGNAR  205

Query  854   CINIVHRLYPTV-----DPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDN  1018
             C +   RLY        D TL  ++A  L+ RCP +  D           D  +P   DN
Sbjct  206   CTSFRQRLYNQSGNGQPDSTLQQSFAAQLRTRCPRSGGDQNLFFL-----DFVSPTKFDN  260

Query  1019  MYYKNILEHKGLLVVDELLAT-HPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGD  1195
              Y+ NIL  KGLL  D++L T + A+   V+K A +N+ F +QFA+++V M   +PLTG 
Sbjct  261   SYFNNILASKGLLSSDQVLLTKNEASMELVKKYAENNELFFEQFAKSMVKMGNISPLTGS  320

Query  1196  QGEIRKNCRYVN  1231
             +GEIRK+CR +N
Sbjct  321   RGEIRKSCRKIN  332



>ref|XP_002275309.1| PREDICTED: peroxidase 72 [Vitis vinifera]
Length=332

 Score =   242 bits (617),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 131/308 (43%), Positives = 187/308 (61%), Gaps = 12/308 (4%)
 Frame = +2

Query  329   GDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVA  508
             G L   +Y  SCP+A+ I+K  + K        A S +R  FHDC VK CDASILLDS  
Sbjct  28    GYLYPQFYDHSCPKAQQIVKSVMAKAVAREVRMAASIMRLHFHDCFVKGCDASILLDSSG  87

Query  509   GVESERES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEM  685
             G+ SE+ S P     R F+ I  IK+A+E+ECP+TVSC+DI+A++ARD +V+  GP  E+
Sbjct  88    GIISEKNSVPNRNSARGFEVIDDIKSAVEKECPHTVSCSDILAIAARDSSVLTGGPSWEV  147

Query  686   KTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINI  865
               GRRDS+   L+   N IP  N++ + +L++F+  G++    VAL G+H++G   C + 
Sbjct  148   PLGRRDSRGASLSGSNNNIPAPNNTFQTILTKFKLHGLNIVDLVALSGSHTIGNSRCTSF  207

Query  866   VHRLYPTV-----DPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYK  1030
               RLY        D +LD +YA  L+ RCP +  D           D  +P   DN Y+K
Sbjct  208   RQRLYNQSGNGRPDYSLDQSYAAQLRTRCPRSGGDQNLFFL-----DFVSPTKFDNSYFK  262

Query  1031  NILEHKGLLVVDELLAT-HPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEI  1207
             NIL  KGLL  D+LL T + A+   V++ AA+N+ F +QFA++++ M+  +PLTG +GEI
Sbjct  263   NILASKGLLSSDQLLFTKNQASMDLVKQYAANNKIFFEQFAQSMIKMANISPLTGSRGEI  322

Query  1208  RKNCRYVN  1231
             RKNCR VN
Sbjct  323   RKNCRRVN  330



>ref|XP_010275548.1| PREDICTED: peroxidase 72-like [Nelumbo nucifera]
Length=332

 Score =   241 bits (616),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 134/309 (43%), Positives = 184/309 (60%), Gaps = 12/309 (4%)
 Frame = +2

Query  329   GDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVA  508
             GDL   +Y  SCPRA+ I+K  V K   +    A S LR  FHDC VK CDAS+LLDS  
Sbjct  28    GDLYPQFYDHSCPRAQKIVKSIVAKAVAKELRMAASLLRLHFHDCFVKGCDASLLLDSSG  87

Query  509   GVESERES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEM  685
              + SE+ S P     R F+ I  IK+ALE+ECP+TVSCADI+AL+ARD  V+  GP  E+
Sbjct  88    TIISEKRSNPNRNSARGFEVIDEIKSALEKECPHTVSCADILALAARDSTVLAGGPSWEV  147

Query  686   KTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINI  865
               GRRD++   L+   N IP  N++ + +L++F+  G++    VAL G+H++G   C + 
Sbjct  148   PLGRRDARGASLSGSNNNIPAPNNTFQTILTKFKLKGLNVVDLVALSGSHTIGNARCTSF  207

Query  866   VHRLYPTV-----DPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYK  1030
               RLY        D +LD +YA  L+ RCP +  D           D  +P   +N YYK
Sbjct  208   RQRLYNQSGNGQPDYSLDQSYAAQLRTRCPRSGGDQNLFFL-----DFVSPTKFNNHYYK  262

Query  1031  NILEHKGLLVVDELLATHP-ATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEI  1207
             NIL+ KGLL  D++L T   A+   V++ A +NQ F +QFA ++V M   +PLT  +GEI
Sbjct  263   NILDSKGLLNSDQVLLTKSEASMELVKEYAENNQLFFEQFAISMVKMGNLSPLTRSKGEI  322

Query  1208  RKNCRYVNT  1234
             RKNCR VN+
Sbjct  323   RKNCRRVNS  331



>ref|XP_009762369.1| PREDICTED: peroxidase 72-like [Nicotiana sylvestris]
Length=330

 Score =   241 bits (615),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 132/312 (42%), Positives = 181/312 (58%), Gaps = 12/312 (4%)
 Frame = +2

Query  317   RCAKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILL  496
             + + G L   YY  SCP+A++I+K  V K   +    A S LR  FHDC VK CDAS+LL
Sbjct  24    KTSGGSLYPQYYYRSCPKAQEIVKSVVAKSVAKEARMAASLLRLHFHDCFVKGCDASLLL  83

Query  497   DSVAGVESERES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGP  673
             DS  G+ +E+ S P     R F+ I  IK+ALE+ECP TVSCADI+AL+ARD  V+  GP
Sbjct  84    DSSRGIVTEKRSNPNRNSARGFEVIDEIKSALEKECPQTVSCADILALAARDSTVLAGGP  143

Query  674   RAEMKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVH  853
               E+  GRRDS+   L+   N IP+ N++   +L++F+  G+     VAL G+H++G   
Sbjct  144   NWEVPLGRRDSRSASLSGSNNDIPSPNNTFNTILTKFKRQGLGLVDLVALSGSHTIGNSR  203

Query  854   CINIVHRLY-----PTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDN  1018
             C +   RLY        D TLD +YA  L  RCP +  D           D  +P   DN
Sbjct  204   CTSFRQRLYNQSGNSQPDSTLDQSYAAQLHNRCPRSGGDQNLFFL-----DFVSPTKFDN  258

Query  1019  MYYKNILEHKGLLVVDELLATHP-ATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGD  1195
              Y+KN+L  KGLL  D++L T   A+   V++ A +N  F + FA+++V M   +PLTG 
Sbjct  259   SYFKNLLASKGLLNSDQVLITKSQASLALVKQYAENNALFFEHFAKSMVKMGNISPLTGS  318

Query  1196  QGEIRKNCRYVN  1231
              GEIRKNCR +N
Sbjct  319   TGEIRKNCRKMN  330



>ref|XP_002310274.1| Peroxidase 49 precursor family protein [Populus trichocarpa]
 gb|EEE90724.1| Peroxidase 49 precursor family protein [Populus trichocarpa]
Length=333

 Score =   241 bits (615),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 130/312 (42%), Positives = 184/312 (59%), Gaps = 12/312 (4%)
 Frame = +2

Query  317   RCAKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILL  496
             + + G L   +Y  SCP+A++I+   V K   +    A S LR  FHDC VK CDASILL
Sbjct  26    KTSGGYLYPQFYDRSCPKAQEIVNSIVAKAVAKEARMAASLLRLHFHDCFVKGCDASILL  85

Query  497   DSVAGVESERES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGP  673
             DS   + +E+ S P    +R F+ I  IK+ALE+ECP TVSCADI+AL+ARD  V+  GP
Sbjct  86    DSSGSIITEKSSNPNRNSVRGFEVIDEIKSALEKECPKTVSCADIMALAARDSTVIAGGP  145

Query  674   RAEMKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVH  853
               E+  GRRDS+   L+   N IP  N++ + +L++F+  G+D    VAL G+H++G   
Sbjct  146   SWEVPLGRRDSRGASLSGSNNNIPAPNNTFQTILTKFKLQGLDVVDLVALSGSHTIGNAR  205

Query  854   CINIVHRLYPTV-----DPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDN  1018
             C +   RLY        D TL  ++A  L+ RCP +  D           D  +P   DN
Sbjct  206   CTSFRQRLYNQSGNGQPDSTLQQSFAAQLRTRCPRSGGDQNLFFL-----DFVSPRKFDN  260

Query  1019  MYYKNILEHKGLLVVDELLAT-HPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGD  1195
              Y+ NIL  KGLL  D++L T + A+   V+K A +N+ F +QFA+++V M   +PLTG 
Sbjct  261   SYFNNILASKGLLSSDQVLLTKNEASMELVKKYAENNELFFEQFAKSMVKMGNISPLTGS  320

Query  1196  QGEIRKNCRYVN  1231
             +GEIRK+CR +N
Sbjct  321   RGEIRKSCRKIN  332



>ref|XP_009778388.1| PREDICTED: peroxidase 72-like [Nicotiana sylvestris]
Length=332

 Score =   241 bits (614),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 133/309 (43%), Positives = 183/309 (59%), Gaps = 12/309 (4%)
 Frame = +2

Query  329   GDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVA  508
             G L   +Y  SCP+A++I+K  V K        A S LR  FHDC VK CDAS+LLDS A
Sbjct  29    GYLYPQFYDWSCPQAKEIVKSVVAKAVAREARMAASLLRLHFHDCFVKGCDASLLLDSSA  88

Query  509   GVESERESPRNF-GMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEM  685
              + SE+ S  N   +R F+ I  IK+ALE+ECP TVSCADI+AL+ARD  V+  GP  E+
Sbjct  89    TLISEKRSNTNRNSVRGFEVIDEIKSALEKECPQTVSCADILALAARDSTVLAGGPNWEV  148

Query  686   KTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINI  865
               GRRDS++  L+   N IP  N++   +L++F+  G+D    V L G+H++G   C + 
Sbjct  149   PLGRRDSRDASLSGSNNNIPAPNNTFNTILTKFKLKGLDLVDLVTLSGSHTIGNARCTSF  208

Query  866   VHRLYPTV-----DPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYK  1030
               RLY        D TLD TYA  L+ RCP +  D           D  +P   DN Y+K
Sbjct  209   RQRLYNQSGNSLPDYTLDQTYAAQLRTRCPKSGGDQNLFVM-----DFVSPTKFDNSYFK  263

Query  1031  NILEHKGLLVVDELLAT-HPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEI  1207
             N+L  +GL   D++L T + AT   V+  A +N+ F +QFA+++V M   +PLTG +GEI
Sbjct  264   NLLASRGLFNSDQVLVTKNQATLALVKLYAENNEIFFEQFAKSMVKMGNISPLTGYRGEI  323

Query  1208  RKNCRYVNT  1234
             RKNCR +N+
Sbjct  324   RKNCRMMNS  332



>ref|XP_006340673.1| PREDICTED: peroxidase 49-like [Solanum tuberosum]
Length=332

 Score =   241 bits (614),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 131/303 (43%), Positives = 178/303 (59%), Gaps = 12/303 (4%)
 Frame = +2

Query  347   YYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGVESER  526
             YY +SCP+A +I+K  V K   +    A S LR  FHDC VK CDAS+LLDS  G+ +E+
Sbjct  34    YYYKSCPQALEIVKSVVAKAVAKEARMAASLLRLHFHDCFVKGCDASLLLDSSNGIVTEK  93

Query  527   ES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTGRRD  703
              S P     R F+ +  IK+ALE+ECP TVSCADI+AL+ARD  V+  GP  E+  GRRD
Sbjct  94    GSNPNKNSARGFEVLDEIKSALEKECPQTVSCADILALAARDSTVLSGGPNWEVPLGRRD  153

Query  704   SKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHRLYP  883
             S+   L+   N IP  N++ + +LS+F+  G+D    VAL G+H++G   C +   RLY 
Sbjct  154   SRSASLSGSNNNIPAPNNTFDSILSKFKRQGLDLVDLVALSGSHTIGNSRCTSFRQRLYN  213

Query  884   TV-----DPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHK  1048
                    D TLD +YA  L+ RCP +  D           D  +P   DN Y+K +L  K
Sbjct  214   QSGNNKPDSTLDQSYAAQLRNRCPKSGGDQNLFFL-----DFVSPTKFDNSYFKLLLASK  268

Query  1049  GLLVVDELLATHP-ATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRY  1225
             GLL  D++L T   A+   V++ A DN  F D FA+++V M   +PLTG  GEIRK CR 
Sbjct  269   GLLNSDQVLTTKSQASLALVKQYAEDNALFFDHFAKSMVKMGNISPLTGSSGEIRKTCRK  328

Query  1226  VNT  1234
             +N+
Sbjct  329   INS  331



>ref|XP_004232440.1| PREDICTED: peroxidase 72-like [Solanum lycopersicum]
Length=332

 Score =   241 bits (614),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 129/303 (43%), Positives = 178/303 (59%), Gaps = 12/303 (4%)
 Frame = +2

Query  347   YYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGVESER  526
             YY +SCP+A++I+K  V K   +    A S LR  FHDC VK CDAS+LLDS   + +E+
Sbjct  34    YYYKSCPKAQEIVKSVVAKAVAKEARMAASLLRLHFHDCFVKGCDASLLLDSRGSIVTEK  93

Query  527   ES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTGRRD  703
              S P     R F  I  IK+ALE+ECP TVSCADI+AL+ARD  V+  GP  E+  GRRD
Sbjct  94    RSNPNRNSARGFDVIDDIKSALEKECPQTVSCADILALAARDSTVLAGGPNWEVPLGRRD  153

Query  704   SKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHRLY-  880
             S+   L+   N IP  N++   +L++F+  G+D    VAL G+H++G   C++   RLY 
Sbjct  154   SRSASLSGSNNDIPAPNNTFNTILTKFKRQGLDLVDLVALSGSHTIGNSRCVSFRQRLYN  213

Query  881   ----PTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHK  1048
                    D TLD +YA  L+ RCP +  D           D  +P   DN Y+K +L  K
Sbjct  214   QSGNSKPDTTLDESYAAQLRSRCPKSGGDQNLFFL-----DFVSPTKFDNSYFKLLLASK  268

Query  1049  GLLVVDELLATHP-ATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRY  1225
             GLL  D++L T   A+   V++ A +N  F D FA+++V M   +PLTG +GEIRK CR 
Sbjct  269   GLLNSDQVLTTKSQASLALVKQYAENNALFFDHFAKSMVKMGNISPLTGSRGEIRKTCRK  328

Query  1226  VNT  1234
             +N+
Sbjct  329   INS  331



>dbj|BAJ98142.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=337

 Score =   241 bits (614),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 135/302 (45%), Positives = 174/302 (58%), Gaps = 12/302 (4%)
 Frame = +2

Query  347   YYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGVESE-  523
             +Y  SCP+A+ I+   V K + +    A S LR  FHDC VK CDASILLDS A V SE 
Sbjct  39    FYDHSCPQAQQIVASIVGKAHSQDPRMAASLLRLHFHDCFVKGCDASILLDSSASVVSEK  98

Query  524   RESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTGRRD  703
             R +P     R F+ +  IKAALE  CP TVSCAD++AL+ARD  VM  GP   +  GRRD
Sbjct  99    RSTPNKDSARGFEVVDEIKAALEAACPRTVSCADVLALAARDSTVMTGGPGWIVPLGRRD  158

Query  704   SKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHRLYP  883
             S    +    N IP  N+++  ++++F+  G+D    VALLG+H++G   C +   RLY 
Sbjct  159   SLGASIQGSNNDIPAPNNTLPTIITKFKLQGLDIVDLVALLGSHTIGNSRCTSFRQRLYN  218

Query  884   TV-----DPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHK  1048
                    D TLDP  A  L+ RCP +  D           DR TP   DN YYKN+L ++
Sbjct  219   QTGKGLPDSTLDPAAAAVLRPRCPRSGGDQNLFF-----LDRVTPFKFDNQYYKNLLVYQ  273

Query  1049  GLLVVDELLAT-HPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRY  1225
             GLL  DE+L T  PATA  V+  AA+   F   FAR++V M   +P+TG  GEIR NCR 
Sbjct  274   GLLSSDEVLFTGSPATAELVKLYAANQDIFFQHFARSMVKMGNISPITGRNGEIRSNCRR  333

Query  1226  VN  1231
             VN
Sbjct  334   VN  335



>ref|XP_002961515.1| hypothetical protein SELMODRAFT_77725, partial [Selaginella moellendorffii]
 ref|XP_002971292.1| hypothetical protein SELMODRAFT_95196, partial [Selaginella moellendorffii]
 gb|EFJ27890.1| hypothetical protein SELMODRAFT_95196, partial [Selaginella moellendorffii]
 gb|EFJ36775.1| hypothetical protein SELMODRAFT_77725, partial [Selaginella moellendorffii]
Length=293

 Score =   239 bits (610),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 115/295 (39%), Positives = 172/295 (58%), Gaps = 2/295 (1%)
 Frame = +2

Query  347   YYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGVESER  526
             +YS SCP AE I++      +        + LR  FHDC V  CDASILLDS   ++SER
Sbjct  1     FYSSSCPNAESIVRAAFSGNFITDPTAPAALLRLAFHDCQVGGCDASILLDSKGSIKSER  60

Query  527   ESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTGRRDS  706
             +S +NFG+R   +I  IK+ LE  CP  VSCADI+ L AR+  V   GP   + TGRRD 
Sbjct  61    DSDKNFGIRRLDFIDRIKSMLEAACPGVVSCADIIVLVARESIVFTGGPTIPVLTGRRDG  120

Query  707   KETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHRLYPT  886
                  A  +  +P    S++  +S F S G+  + +VA++GAH++G  HC+NIV+RLYP 
Sbjct  121   TAASNAAADRLLPPATVSVDNFISLFASKGLSLDESVAIIGAHTIGVGHCVNIVNRLYPN  180

Query  887   VDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGLLVVD  1066
              D  +   +A  L+++CP+A  +PR +      N+  T ++ DN Y+++++  +GL  +D
Sbjct  181   QDSKIGLLFASRLRVQCPTA--NPRMLNNITVINNDMTNLVFDNQYFRDLMNGQGLFTID  238

Query  1067  ELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
               LA    T+P V + + + Q F D F+ A V ++ +N LTG  G++RK C  VN
Sbjct  239   SELALDSRTSPVVARFSTNQQLFLDTFSSAFVKLTSSNVLTGQSGQVRKYCHSVN  293



>emb|CCJ34840.1| horseradish peroxidase isoenzyme HRP_6117 [Armoracia rusticana]
Length=335

 Score =   241 bits (614),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 128/311 (41%), Positives = 181/311 (58%), Gaps = 12/311 (4%)
 Frame = +2

Query  323   AKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDS  502
              +G L  G+YS SCP+AE+I++  V K        A S +R  FHDC V+ CD S+LLDS
Sbjct  30    GQGKLFPGFYSSSCPKAEEIVRSVVAKAVARETRMAASLMRLHFHDCFVQGCDGSLLLDS  89

Query  503   VAGVESERES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRA  679
                + +E+ S P +   R F+ +  IKAALE ECPNTVSCAD + L+ARD +V+  GP  
Sbjct  90    SGSIVTEKNSNPNSRSARGFEVVDEIKAALENECPNTVSCADALTLAARDSSVLTGGPSW  149

Query  680   EMKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCI  859
              +  GRRDS    L+   N IP  N++   +LSRF S G+D    VAL G+H++G   C 
Sbjct  150   MVPLGRRDSTSASLSGSNNNIPAPNNTFNTILSRFNSQGLDLTNVVALSGSHTIGFSRCT  209

Query  860   NIVHRLY-----PTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMY  1024
             +   RLY      + D TL+ +YA  L+ RCP +  D    E   +   R      DN Y
Sbjct  210   SFRQRLYNQSGNGSPDTTLEQSYAANLRHRCPRSGGDQNLSELDINSAGR-----FDNSY  264

Query  1025  YKNILEHKGLLVVDE-LLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQG  1201
             +KN++E+ GLL  D+ L +++  +   V+K A D + F +QFA ++V M   +PLTG  G
Sbjct  265   FKNLIENMGLLNSDQVLFSSNDESRELVKKYAEDQEEFFEQFAESMVKMGNISPLTGSSG  324

Query  1202  EIRKNCRYVNT  1234
             +IRKNCR +N+
Sbjct  325   QIRKNCRKINS  335



>ref|XP_009346064.1| PREDICTED: peroxidase 72-like [Pyrus x bretschneideri]
Length=331

 Score =   240 bits (613),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 130/309 (42%), Positives = 181/309 (59%), Gaps = 12/309 (4%)
 Frame = +2

Query  329   GDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVA  508
             G L   +Y  SCPRA++I+K  V K        A S LR  FHDC VK CDAS+LLDS  
Sbjct  28    GYLYPQFYDRSCPRAKEIVKSVVAKAVAREARMAASLLRLHFHDCFVKGCDASLLLDSSQ  87

Query  509   GVESERES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEM  685
              + +E+ S P     R F+ I  IK+ALE+ECP+TVSCADI+AL+ARD  V+  GP  E+
Sbjct  88    NIITEKRSVPNQNSARGFEVIDEIKSALEKECPSTVSCADILALAARDSTVLTGGPNWEV  147

Query  686   KTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINI  865
               GRRDS+   L+   N IP  N++ + +L++F+   +D    VAL G+H++G   C + 
Sbjct  148   PLGRRDSRGASLSGSNNNIPAPNNTFQTILTKFKLKKLDIVDLVALSGSHTIGNARCTSF  207

Query  866   VHRLY-----PTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYK  1030
               RLY        D TLD +YA  L+ RCP +  D       +      +P   DN Y+K
Sbjct  208   RQRLYNQSGNGLADFTLDQSYAAQLRTRCPRSGGDQNLFVMDFV-----SPTKFDNNYFK  262

Query  1031  NILEHKGLLVVDELLATHPATAP-FVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEI  1207
             N+L  KGLL  DE+L T    +   V++ A +N+ F  QFA+++V M   +P+TG +GEI
Sbjct  263   NLLASKGLLNSDEVLVTKSQVSKQLVQQYAENNELFFKQFAKSMVKMGNISPITGSRGEI  322

Query  1208  RKNCRYVNT  1234
             RK+CR VN+
Sbjct  323   RKSCRKVNS  331



>ref|XP_003612078.1| Peroxidase [Medicago truncatula]
 gb|AES95036.1| peroxidase family protein [Medicago truncatula]
Length=331

 Score =   240 bits (613),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 134/315 (43%), Positives = 183/315 (58%), Gaps = 13/315 (4%)
 Frame = +2

Query  311   HIRCAKGD-LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDAS  487
             H +   GD L   +Y ESCP+ E+I+K  V K   +    A S LR  FHDC VK CDAS
Sbjct  21    HCKTKLGDYLYPQFYDESCPKVEEIVKSVVAKAVTKEPRMAASLLRLHFHDCFVKGCDAS  80

Query  488   ILLDSVAGVESERES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVML  664
             +LLDS   + SE+ S P     R F+ I+ IK+A+E+ECP TVSCADI+ L+ARD  V+ 
Sbjct  81    VLLDSSGTIISEKRSNPNRNSARGFEVIEEIKSAVEKECPQTVSCADILTLAARDSTVLT  140

Query  665   KGPRAEMKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVG  844
              GP  ++  GRRDS    ++   N IP  N++ + +L++F+  G++    VAL G+H++G
Sbjct  141   GGPSWDVPLGRRDSLGASISGSNNNIPAPNNTFQTILTKFKLKGLNIVDLVALSGSHTIG  200

Query  845   RVHCINIVHRLYPTV-----DPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMI  1009
                C +   RLY        D TLD  YA  L+ RCP +  D           D  TP+ 
Sbjct  201   DSRCTSFRQRLYNQTGNGKSDFTLDQNYAAQLRTRCPRSGGDQNLFVL-----DFVTPVK  255

Query  1010  LDNMYYKNILEHKGLLVVDELLAT-HPATAPFVEKMAADNQYFHDQFARALVIMSENNPL  1186
              DN YYKN+L +KGLL  DE+L T +  +A  V+K A  N  F +QFA+++V M    PL
Sbjct  256   FDNNYYKNLLANKGLLSSDEILLTKNQVSADLVKKYAESNDLFFEQFAKSMVKMGNITPL  315

Query  1187  TGDQGEIRKNCRYVN  1231
             TG +GEIRK CR +N
Sbjct  316   TGSRGEIRKRCRKIN  330



>ref|XP_009587109.1| PREDICTED: peroxidase 72 [Nicotiana tomentosiformis]
Length=331

 Score =   240 bits (612),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 131/314 (42%), Positives = 187/314 (60%), Gaps = 12/314 (4%)
 Frame = +2

Query  314   IRCAKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASIL  493
             I+   G L   YY +SCP+A++IIK  V K   +    A S LR  FHDC+VK CDAS+L
Sbjct  23    IKTYGGYLFPQYYDQSCPQAKEIIKFIVAKAVAKEARMAASLLRLHFHDCLVKGCDASLL  82

Query  494   LDSVAGVESERES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKG  670
             LDS   + SE+ S P     R F+ I  IK ALE+ECP TVSCADI+AL+ARD  V+  G
Sbjct  83    LDSSGSIISEKRSNPNRNSARGFEVIDEIKKALEKECPQTVSCADILALAARDSTVLAGG  142

Query  671   PRAEMKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRV  850
             P  E+  GRRDS+   L+   N IP  N++   +L++F+  G++    VAL G+H++G  
Sbjct  143   PNWEVPLGRRDSRGASLSGSNNNIPAPNNTFNTILTKFKLKGLNIVDLVALSGSHTIGNA  202

Query  851   HCINIVHRLYPTV-----DPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILD  1015
              C +   RLY        D TL+ +YA  L+ +CP +  D           D  +P   D
Sbjct  203   RCTSFRQRLYNQSGNNKPDFTLEESYAAQLRTKCPRSGGDQNLFFL-----DFVSPTKFD  257

Query  1016  NMYYKNILEHKGLLVVDELLAT-HPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTG  1192
             N Y+KN+L  KGLL  D++L T +  +   V++ A +N++F +QFA+++V M   +PLTG
Sbjct  258   NSYFKNLLASKGLLNSDQVLVTKNQESLNLVKQYAENNEFFFEQFAKSMVKMGNISPLTG  317

Query  1193  DQGEIRKNCRYVNT  1234
              +GEIRK+CR +N+
Sbjct  318   SRGEIRKSCRKINS  331



>ref|XP_007202348.1| hypothetical protein PRUPE_ppa008349mg [Prunus persica]
 gb|EMJ03547.1| hypothetical protein PRUPE_ppa008349mg [Prunus persica]
Length=336

 Score =   240 bits (612),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 133/309 (43%), Positives = 179/309 (58%), Gaps = 12/309 (4%)
 Frame = +2

Query  329   GDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVA  508
             G L   +Y  SCPRA +I+K  V K        A S LR  FHDC V+ CDASILLDS  
Sbjct  28    GYLYPQFYDHSCPRATEIVKSVVAKAVAREARMAASLLRLHFHDCFVQGCDASILLDSSK  87

Query  509   GVESERES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEM  685
              + +E+ S P     R F+ I  IK+ALE+ECPN VSCADI+AL+ARD  V+  GP  E+
Sbjct  88    NIITEKRSVPNQNSARGFEVIDEIKSALEKECPNRVSCADILALAARDSTVLSGGPNWEV  147

Query  686   KTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINI  865
               GRRDSK   L+   N IP  N++ + VL++F+   ++    VAL G+H++G   C + 
Sbjct  148   PLGRRDSKGASLSGSNNNIPAPNNTFQTVLTKFKRQKLNIVDLVALSGSHTIGNARCTSF  207

Query  866   VHRLY-----PTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYK  1030
               RLY        D TLD +YA  L+ RCP +  D      T    D  +P   DN Y+K
Sbjct  208   RQRLYNQSGNGLADFTLDQSYAAQLRTRCPRSGGD-----QTLFFLDFVSPTKFDNSYFK  262

Query  1031  NILEHKGLLVVDELLATHP-ATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEI  1207
             N+L  KGLL  DE+L T    T   V++ A + + F +QFA+++V M   +PLTG +GEI
Sbjct  263   NLLASKGLLNSDEILITKSEVTKQLVQQYAENTELFFEQFAKSMVKMGNISPLTGSRGEI  322

Query  1208  RKNCRYVNT  1234
             RK CR +N+
Sbjct  323   RKRCRKINS  331



>gb|ACI22425.1| pericarp peroxidase 3 [Litchi chinensis]
Length=332

 Score =   239 bits (611),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 130/303 (43%), Positives = 179/303 (59%), Gaps = 12/303 (4%)
 Frame = +2

Query  347   YYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGVESER  526
             +Y  SCP+A  I+K  V K   +    A S LR  FHDC VK CDAS+LLDS   + SE+
Sbjct  35    FYDHSCPKALQIVKSVVAKAVAKEARMAASLLRLHFHDCFVKGCDASLLLDSSGTIISEK  94

Query  527   ES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTGRRD  703
              S P     R F+ +  IK+ALE+ECP+TVSCADI+AL+ARD  V+  GP  E+  GRRD
Sbjct  95    RSNPNRNSARGFEVLDEIKSALEKECPHTVSCADILALAARDSTVLAGGPSWEVPLGRRD  154

Query  704   SKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHRLYP  883
             S+   L+   N IP  N++ + +L++F+  G+D    VAL G+H++G   C +   RLY 
Sbjct  155   SRGASLSGSNNNIPAPNNTFQTILTKFKLQGLDIVDLVALSGSHTIGNSRCTSFRQRLYN  214

Query  884   TV-----DPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHK  1048
                    D TLD +YA  L+ RCP +  D           D  +P   DN Y++N+L  K
Sbjct  215   QSGNGQPDLTLDQSYAAQLRTRCPRSGGD-----QILFFLDFVSPTKFDNSYFENLLASK  269

Query  1049  GLLVVDELLATHPA-TAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRY  1225
             GLL  D++L T    +   V+K AA N+ F  QFA+++V M   +PLTG +GEIRKNCR 
Sbjct  270   GLLNSDQVLVTKSKESMDLVKKYAAHNELFFQQFAKSMVKMGNISPLTGSKGEIRKNCRK  329

Query  1226  VNT  1234
             +N+
Sbjct  330   INS  332



>ref|XP_006340671.1| PREDICTED: peroxidase 72-like [Solanum tuberosum]
Length=332

 Score =   239 bits (611),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 129/303 (43%), Positives = 177/303 (58%), Gaps = 12/303 (4%)
 Frame = +2

Query  347   YYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGVESER  526
             YY +SCP+A++I+K  V K   +    A S LR  FHDC VK CDAS+LLDS   + +E+
Sbjct  34    YYYKSCPQAQEIVKSVVAKAVAKEARMAASLLRLHFHDCFVKGCDASLLLDSRGSIVTEK  93

Query  527   ES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTGRRD  703
              S P     R F  I  IK+ALE+ECP TVSCADI+AL+ARD  V+  GP  E+  GRRD
Sbjct  94    RSNPNRNSARGFDVIDDIKSALEKECPQTVSCADILALAARDSTVLAGGPNWEVPLGRRD  153

Query  704   SKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHRLY-  880
             S+   L+   N IP  N++   +L++F+  G+D    VAL G+H++G   C++   RLY 
Sbjct  154   SRSASLSGSNNDIPAPNNTFNTILTKFKRQGLDVVDLVALSGSHTIGNSRCVSFRQRLYN  213

Query  881   ----PTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHK  1048
                    D TLD +YA  L+ RCP +  D           D  +P   DN Y+K +L  K
Sbjct  214   QSGNSKPDTTLDESYAAQLRNRCPKSGGDQNLFFL-----DFVSPTKFDNSYFKLLLASK  268

Query  1049  GLLVVDELLATHP-ATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRY  1225
             GLL  D++L T   A+   V++ A +N  F D FA+++V M   +PLTG  GEIRK CR 
Sbjct  269   GLLNSDQVLTTKSEASLALVKQYAENNALFFDHFAKSMVKMGNISPLTGSSGEIRKTCRK  328

Query  1226  VNT  1234
             +N+
Sbjct  329   INS  331



>ref|XP_010938174.1| PREDICTED: peroxidase 5-like [Elaeis guineensis]
Length=329

 Score =   239 bits (611),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 125/300 (42%), Positives = 175/300 (58%), Gaps = 3/300 (1%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L++G+Y ESCP AEDI++  V +   ++   A   +R  FHDC V+ CDAS+LL+S  G 
Sbjct  31    LEVGFYKESCPSAEDIVRNTVSQAVAQNPGIAAGLIRMHFHDCFVRGCDASVLLNSTPGN  90

Query  515   ESERESP-RNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKT  691
              +E+++P  N  +R F+ I   KAA+E  CP  VSCADI+A +ARDGA +  G   ++  
Sbjct  91    TAEKDAPPNNPSLRGFQVIDAAKAAVEACCPRKVSCADILAFAARDGAYLTGGIDYQVPA  150

Query  692   GRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVH  871
             GRRD + +  +E    IP+ N + E +   F + G+  +  V L GAHS+GR HC +  +
Sbjct  151   GRRDGRISRESEALANIPSPNSNAEQLKENFTNKGLSLDEMVTLSGAHSIGRSHCSSFTN  210

Query  872   RLYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKG  1051
             RLY   DP++DP +A  LK  CP +   P   +PT    D  TP  LDNMYY N+L+H+G
Sbjct  211   RLYGVQDPSMDPAFAAQLKATCPPSTASPS--DPTTVVLDAVTPDRLDNMYYWNLLKHRG  268

Query  1052  LLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVN  1231
             +L  D+ L     TA  V   A D   +  +FA A+V M     LTG QGEIR+ C  VN
Sbjct  269   VLTSDQTLEESSETAKLVWYYAEDQSTWAAKFAAAMVKMGSIEVLTGSQGEIREKCWVVN  328



>ref|XP_008338047.1| PREDICTED: peroxidase 72-like [Malus domestica]
Length=331

 Score =   239 bits (610),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 133/309 (43%), Positives = 176/309 (57%), Gaps = 12/309 (4%)
 Frame = +2

Query  329   GDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVA  508
             G L   +Y  SCPRA+ I+K  V K        A S LR  FHDC VK CDASILLDS  
Sbjct  28    GYLYAQFYDHSCPRAKQIVKSVVAKAVAREARMAASLLRLHFHDCFVKGCDASILLDSSQ  87

Query  509   GVESERES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEM  685
              + SE+ S P     R F+ I  IK+ALE+ECP+TVSCADI+AL+ARD  V+  GP  E+
Sbjct  88    NIISEKRSVPNQNSARGFEVIDEIKSALEKECPSTVSCADILALAARDSTVLTGGPSWEV  147

Query  686   KTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINI  865
               GRRDS    L+   N IP  N++ + +L++F+   ++    VAL G+H++G   C   
Sbjct  148   PLGRRDSIGASLSGSNNNIPAPNNTFQTILTKFKLKKLNIIDLVALSGSHTIGNARCTTF  207

Query  866   VHRLY-----PTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYK  1030
               RLY        D TLD +YA  L+ RCP +  D           D  +P   DN Y+K
Sbjct  208   RQRLYNQSGNGLADSTLDQSYAAQLRTRCPRSGGDQNLFFL-----DFVSPTKFDNSYFK  262

Query  1031  NILEHKGLLVVDELLATHP-ATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEI  1207
             N+L  KGLL  DE+L T    +   V + A +N+ F +QFA+++V M   +PLTG  GEI
Sbjct  263   NLLASKGLLNSDEVLVTKSEVSKKLVRQYAENNELFFEQFAKSMVKMGNLSPLTGSTGEI  322

Query  1208  RKNCRYVNT  1234
             RK CR VN+
Sbjct  323   RKRCRKVNS  331



>ref|XP_006409192.1| hypothetical protein EUTSA_v10022774mg [Eutrema salsugineum]
 gb|ESQ50645.1| hypothetical protein EUTSA_v10022774mg [Eutrema salsugineum]
Length=336

 Score =   239 bits (610),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 126/310 (41%), Positives = 183/310 (59%), Gaps = 12/310 (4%)
 Frame = +2

Query  326   KGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSV  505
             +G+L  G+YS SCP+AE+I+K  V +        A S +R  FHDC V+ CD S+LLD+ 
Sbjct  32    RGNLSPGFYSSSCPKAEEIVKSVVAQAVARETRMAASLMRLHFHDCFVQGCDGSLLLDTS  91

Query  506   AGVESERES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAE  682
               + +E+ S P +   R F+ +  IKAALE ECP TVSCAD++ L+ARD +V+  GP   
Sbjct  92    GSIVTEKSSNPNSRSARGFEVVDQIKAALENECPGTVSCADVLTLAARDSSVLTGGPSWM  151

Query  683   MKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCIN  862
             +  GRRDS    L+   N IP  N++   +LSRF + G+D    VAL G+H++G   C +
Sbjct  152   VPLGRRDSTTASLSGSNNNIPAPNNTFNTILSRFTNQGLDLTDLVALSGSHTIGFSRCTS  211

Query  863   IVHRLY-----PTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYY  1027
                RLY      + D TL+ +YA  L+  CP +  D    E   +   R      DN Y+
Sbjct  212   FRQRLYNQSGNGSPDSTLEQSYAANLRQMCPRSGGDQNLSELDINSAGR-----FDNSYF  266

Query  1028  KNILEHKGLLVVDELL-ATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGE  1204
             KN++E+ GLL  D++L +++  ++  V+K A D + F +QFA ++V M   +PLTG  GE
Sbjct  267   KNLIENMGLLNSDQVLFSSNEESSELVKKYAEDQEEFFEQFAESMVKMGNISPLTGSSGE  326

Query  1205  IRKNCRYVNT  1234
             IRKNCR VN+
Sbjct  327   IRKNCRKVNS  336



>ref|XP_008241745.1| PREDICTED: peroxidase 72-like [Prunus mume]
Length=336

 Score =   239 bits (610),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 131/309 (42%), Positives = 179/309 (58%), Gaps = 12/309 (4%)
 Frame = +2

Query  329   GDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVA  508
             G L   +Y  SCPRA +I+K  V K        A S LR  FHDC V+ CDAS+LLDS  
Sbjct  28    GYLYPQFYDHSCPRATEIVKSVVAKAVAREARMAASLLRLHFHDCFVQGCDASVLLDSSK  87

Query  509   GVESERES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEM  685
              + +E+ S P     R F+ I  IK+ALE+ECPNTVSCADI+AL+ARD   +  GP  E+
Sbjct  88    SIITEKRSVPNQNSARGFEVIDEIKSALEKECPNTVSCADILALAARDSTELSGGPNWEV  147

Query  686   KTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINI  865
               GRRDSK   L+   N IP  N++ + +L++F+   ++    VAL G+H++G   C + 
Sbjct  148   PLGRRDSKGASLSGSNNNIPAPNNTFQTILTKFKRQNLNIVDLVALSGSHTIGNARCTSF  207

Query  866   VHRLY-----PTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYK  1030
               RLY        D TLD +YA  L+ RCP +  D      T    D  +P   DN Y+K
Sbjct  208   RQRLYNQSGNGLADFTLDQSYAAQLRTRCPRSGGD-----QTLFFLDFVSPTKFDNSYFK  262

Query  1031  NILEHKGLLVVDELLATHP-ATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEI  1207
             N+L  KGLL  DE+L T    T   V++ A + + F +QFA+++V M   +PLTG +GEI
Sbjct  263   NLLASKGLLNSDEILITKSQVTKQLVQQYAENTELFFEQFAKSMVKMGNISPLTGSRGEI  322

Query  1208  RKNCRYVNT  1234
             RK CR +N+
Sbjct  323   RKRCRKINS  331



>ref|XP_002886150.1| hypothetical protein ARALYDRAFT_480719 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62409.1| hypothetical protein ARALYDRAFT_480719 [Arabidopsis lyrata subsp. 
lyrata]
Length=339

 Score =   239 bits (610),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 126/309 (41%), Positives = 180/309 (58%), Gaps = 12/309 (4%)
 Frame = +2

Query  326   KGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSV  505
             KG+L  G+Y  SCPRAE+I++  V K        A S +R  FHDC V+ CD S+LLD+ 
Sbjct  34    KGNLFPGFYRSSCPRAEEIVRSVVAKAVARETRMAASLMRLHFHDCFVQGCDGSLLLDTS  93

Query  506   AGVESERES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAE  682
               + +E+ S P +   R F+ +  IKAALE ECPNTVSCAD + L+ARD +++  GP   
Sbjct  94    GSIVTEKNSNPNSRSARGFEVVDEIKAALENECPNTVSCADALTLAARDSSILTGGPSWM  153

Query  683   MKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCIN  862
             +  GRRDS+   L+   N IP  N++   ++SRF + G+D    VAL G+H++G   C +
Sbjct  154   VPLGRRDSRSASLSGSNNNIPAPNNTFNTIVSRFNNQGLDLTDVVALSGSHTIGFSRCTS  213

Query  863   IVHRLY-----PTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYY  1027
                RLY      + D TL+ +YA  L+ RCP +  D    E   +   R      DN Y+
Sbjct  214   FRQRLYNQFGNGSPDSTLEQSYAANLRQRCPRSGGDQNLSELDINSAGR-----FDNSYF  268

Query  1028  KNILEHKGLLVVDE-LLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGE  1204
             KN++E  GLL  DE L +++  +   V+K A D + F +QFA +++ M   +PLTG  GE
Sbjct  269   KNLIEKMGLLNSDEVLFSSNEQSRELVKKYAEDQEEFFEQFAESMIKMGNISPLTGSSGE  328

Query  1205  IRKNCRYVN  1231
             IRKNCR +N
Sbjct  329   IRKNCRKIN  337



>ref|XP_010029741.1| PREDICTED: peroxidase 72 [Eucalyptus grandis]
Length=336

 Score =   239 bits (609),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 132/315 (42%), Positives = 180/315 (57%), Gaps = 16/315 (5%)
 Frame = +2

Query  320   CAK----GDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDAS  487
             CAK    G L   +Y  SCP+A++I+K  V K   +      S LR  FHDC VK CDAS
Sbjct  26    CAKAGYGGYLYPQFYDHSCPKAQEIVKSVVAKAVAKDPRMGASLLRLHFHDCFVKGCDAS  85

Query  488   ILLDSVAGVESERES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVML  664
             +LLDS   + SE+ S P     R F+ +  IK+ALE+ECP TVSCAD++AL+ARD  V+ 
Sbjct  86    LLLDSSGTIISEKRSVPNTNSARGFEVLDEIKSALEKECPQTVSCADLLALAARDSTVLT  145

Query  665   KGPRAEMKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVG  844
              GP   +  GRRDS    L+   N IP  N++ + +L++F+  G+D    VAL G+H++G
Sbjct  146   GGPSWVVPLGRRDSTGASLSGSNNNIPAPNNTFQTILTKFKLKGLDIVDLVALSGSHTIG  205

Query  845   RVHCINIVHRLYPTV-----DPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMI  1009
                C     RLY        D TLD +YA  L+ RCP +  D           D  +P+ 
Sbjct  206   NARCTTFRQRLYNQTGNGQPDFTLDQSYAAQLRTRCPRSGGDQNLFFL-----DFVSPIK  260

Query  1010  LDNMYYKNILEHKGLLVVDELLATHP-ATAPFVEKMAADNQYFHDQFARALVIMSENNPL  1186
              DN Y+KN+L  KGLL  DE+L T   AT   V++ A + + F +QFA+++V M    PL
Sbjct  261   FDNSYFKNLLAKKGLLSSDEVLVTQSQATLQLVKQYAGNQELFFEQFAKSMVKMGNITPL  320

Query  1187  TGDQGEIRKNCRYVN  1231
             TG +G+IRK CR VN
Sbjct  321   TGSKGQIRKRCRQVN  335



>ref|XP_009102275.1| PREDICTED: peroxidase 15 [Brassica rapa]
Length=336

 Score =   239 bits (609),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 125/311 (40%), Positives = 181/311 (58%), Gaps = 12/311 (4%)
 Frame = +2

Query  323   AKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDS  502
              +G+L  G+Y  SCPRAE+I++  V +        A S +R  FHDC V+ CD S+LLDS
Sbjct  31    GEGNLFPGFYRSSCPRAEEIVRSVVAQAVAREARMAASLMRLHFHDCFVQGCDGSLLLDS  90

Query  503   VAGVESERES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRA  679
                + +E+ S P +   R F  +  IKAALE ECP TVSCAD++ L+ARD +V+  GP  
Sbjct  91    SGSIITEKGSNPNSNSARGFDVVDQIKAALENECPGTVSCADLLTLAARDSSVLTGGPSW  150

Query  680   EMKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCI  859
              +  GRRDS+   L+   N IP  N++   +LSRF + G+D    VAL G+H++G   C 
Sbjct  151   MVPLGRRDSRSASLSGSNNNIPAPNNTFNTILSRFTNQGLDLTDLVALSGSHTIGFSRCT  210

Query  860   NIVHRLY-----PTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMY  1024
             +   RLY      + D TL+ +YA  L+ RCP     P   +   S  D  +    DN Y
Sbjct  211   SFRQRLYNQSGNGSPDITLEQSYATNLRQRCP-----PSGGDQNLSELDINSAGKFDNSY  265

Query  1025  YKNILEHKGLLVVDE-LLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQG  1201
             +KN++E+ GLL  D+ L ++   ++  V+K A D + F +QFA +++ M   +PLTG  G
Sbjct  266   FKNLIENMGLLNSDQVLFSSKEESSELVKKYAEDQEEFFEQFAESMIKMGNLSPLTGSSG  325

Query  1202  EIRKNCRYVNT  1234
             EIRKNCR +N+
Sbjct  326   EIRKNCRKINS  336



>ref|XP_008352450.1| PREDICTED: peroxidase 72-like [Malus domestica]
Length=358

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 133/309 (43%), Positives = 176/309 (57%), Gaps = 12/309 (4%)
 Frame = +2

Query  329   GDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVA  508
             G L   +Y  SCPRA+ I+K  V K        A S LR  FHDC VK CDASILLDS  
Sbjct  55    GYLYAQFYDHSCPRAKQIVKSVVAKAVAREARMAASLLRLHFHDCFVKGCDASILLDSSQ  114

Query  509   GVESERES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEM  685
              + SE+ S P     R F+ I  IK+ALE+ECP+TVSCADI+AL+ARD  V+  GP  E+
Sbjct  115   NIISEKRSVPNQNSARGFEVIDEIKSALEKECPSTVSCADILALAARDSTVLTGGPSWEV  174

Query  686   KTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINI  865
               GRRDS    L+   N IP  N++ + +L++F+   ++    VAL G+H++G   C   
Sbjct  175   PLGRRDSIGASLSGSNNNIPAPNNTFQTILTKFKLKKLNIIDLVALSGSHTIGNARCTTF  234

Query  866   VHRLY-----PTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYK  1030
               RLY        D TLD +YA  L+ RCP +  D           D  +P   DN Y+K
Sbjct  235   RQRLYNQSGNGLADSTLDQSYAAQLRTRCPRSGGDQNLFFL-----DFVSPTKFDNSYFK  289

Query  1031  NILEHKGLLVVDELLATHP-ATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEI  1207
             N+L  KGLL  DE+L T    +   V + A +N+ F +QFA+++V M   +PLTG  GEI
Sbjct  290   NLLASKGLLNSDEVLVTKSEVSKKLVRQYAENNELFFEQFAKSMVKMGNLSPLTGSTGEI  349

Query  1208  RKNCRYVNT  1234
             RK CR VN+
Sbjct  350   RKRCRKVNS  358



>ref|XP_010548306.1| PREDICTED: peroxidase 49 [Tarenaya hassleriana]
Length=332

 Score =   238 bits (608),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 128/309 (41%), Positives = 180/309 (58%), Gaps = 12/309 (4%)
 Frame = +2

Query  329   GDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVA  508
             G L  G+Y  SCP+AE+I++  V K        A S +R  FHDC V+ CD S+LLDS  
Sbjct  29    GKLYPGFYDHSCPKAEEIVRSIVAKAVARETRMAASLMRLHFHDCFVQGCDGSVLLDSSG  88

Query  509   GVESERES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEM  685
              + SE+ S P     R F+ +  IKAALE+ECPNTVSCAD + L+ARD +V+  GP  ++
Sbjct  89    RITSEKNSNPNRRSARGFEVVDEIKAALEKECPNTVSCADALTLAARDSSVLTGGPTWKV  148

Query  686   KTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINI  865
               GRRDS+   L+   N IP  N++ + +LS+F   G+DT   VAL G+H++G   C + 
Sbjct  149   PLGRRDSRGASLSGSNNNIPAPNNTFQTILSKFNRQGLDTTDLVALSGSHTIGFSRCTSF  208

Query  866   VHRLYPTV-----DPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYK  1030
               RLY        D TLD ++A  L+ RCP +  D           D  +    DN Y+K
Sbjct  209   RQRLYNQSGNARPDSTLDQSFAASLRPRCPRSGGDQNLFVL-----DIISAAKFDNSYFK  263

Query  1031  NILEHKGLLVVDELLATHPATA-PFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEI  1207
             N++++KGLL  D++L +    A   V+K A D + F +QFA ++V M   +PLTG  GEI
Sbjct  264   NLIDNKGLLNSDQVLFSSSQQARELVKKYAEDQEEFFEQFAESMVKMGNISPLTGSNGEI  323

Query  1208  RKNCRYVNT  1234
             RKNCR +N+
Sbjct  324   RKNCRKINS  332



>ref|XP_007158602.1| hypothetical protein PHAVU_002G166300g [Phaseolus vulgaris]
 gb|ESW30596.1| hypothetical protein PHAVU_002G166300g [Phaseolus vulgaris]
Length=331

 Score =   238 bits (608),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 132/309 (43%), Positives = 180/309 (58%), Gaps = 12/309 (4%)
 Frame = +2

Query  326   KGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSV  505
             +G L   +Y  SCPRA++I++  V K   +    A S LR  FHDC VK CDAS+LLDS 
Sbjct  27    EGYLYPQFYDGSCPRAQEIVQSVVAKAVAKEPRMAASLLRLHFHDCFVKGCDASVLLDSS  86

Query  506   AGVESERES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAE  682
               + SE+ S P     R F+ I  IK+A+E+EC +TVSCADI+AL+ARD  V+  GP  E
Sbjct  87    GTIISEKRSNPNRDSARGFEVIDEIKSAIEKECSHTVSCADILALAARDSTVLAGGPNWE  146

Query  683   MKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCIN  862
             +  GRRDS    ++   N IP  N++ + +L++F+  G+D    VAL G+H++G   C +
Sbjct  147   VPLGRRDSLGASISGSNNNIPAPNNTFQTILTKFKLKGLDIVDLVALSGSHTIGDSRCTS  206

Query  863   IVHRLY-----PTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYY  1027
                RLY        D TLD  YA  L+  CP +  D       +      TP+  DN YY
Sbjct  207   FRQRLYNQTGNGKADFTLDQQYAAVLRTSCPRSGGDQNLFVLDFV-----TPLKFDNFYY  261

Query  1028  KNILEHKGLLVVDELLAT-HPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGE  1204
             KN+L +KGLL  DE+L T +  +A  V K A  N  F +QFA+++V M    PLTG +GE
Sbjct  262   KNLLANKGLLSSDEILLTKNQESADLVRKYAERNDLFFEQFAKSMVKMGNITPLTGSRGE  321

Query  1205  IRKNCRYVN  1231
             IRKNCR +N
Sbjct  322   IRKNCRKIN  330



>gb|KHG08031.1| Peroxidase 72 -like protein [Gossypium arboreum]
 gb|KHG19534.1| Peroxidase 72 -like protein [Gossypium arboreum]
Length=334

 Score =   238 bits (608),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 133/313 (42%), Positives = 184/313 (59%), Gaps = 12/313 (4%)
 Frame = +2

Query  314   IRCAKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASIL  493
             I    G L   +Y  SCP+A++I+K  V K   E    A S LR  FHDC VK CDASIL
Sbjct  25    IYGGGGYLYPQFYDHSCPKAQEIVKHFVAKAVAEDPRMAASLLRLHFHDCFVKGCDASIL  84

Query  494   LDSVAGVESERES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKG  670
             LDS   + SE+ S P     R F+ I  IKAA+E+ECP+TVSCADI+AL+ARD  V+  G
Sbjct  85    LDSSGTIISEKRSNPNRDSARGFEVIDEIKAAIEKECPHTVSCADIMALAARDSTVLTGG  144

Query  671   PRAEMKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRV  850
             P  ++  GRRDS++  L+   N IP  N++ + +L++F+  G+D    VAL G+H++G  
Sbjct  145   PNWDVPLGRRDSRDASLSGSNNNIPAPNNTFQTILTKFKLQGLDIVDLVALSGSHTIGNA  204

Query  851   HCINIVHRLYPTV-----DPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILD  1015
              C +   RLY        D TLD +YA +L+  CP +  D           D  +P+  D
Sbjct  205   RCTSFRQRLYNQAGNGKPDYTLDQSYAAHLRTHCPKSGGDQNLFFL-----DFVSPVKFD  259

Query  1016  NMYYKNILEHKGLLVVDELLATHPATA-PFVEKMAADNQYFHDQFARALVIMSENNPLTG  1192
             N Y+KN+L +KGLL  DE+L T  A +   V+  A + + F  QFA++++ M   +PLTG
Sbjct  260   NSYFKNLLAYKGLLSSDEVLFTKNAESRELVKTYAYNQELFFQQFAKSMIKMGNISPLTG  319

Query  1193  DQGEIRKNCRYVN  1231
              +GEIRK CR VN
Sbjct  320   YKGEIRKYCRKVN  332



>ref|XP_006299700.1| hypothetical protein CARUB_v10015891mg [Capsella rubella]
 gb|EOA32598.1| hypothetical protein CARUB_v10015891mg [Capsella rubella]
Length=338

 Score =   238 bits (608),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 126/309 (41%), Positives = 180/309 (58%), Gaps = 12/309 (4%)
 Frame = +2

Query  326   KGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSV  505
             +G+L  G+Y  SCPRAE+I++  V K        A S +R  FHDC V+ CD S+LLD+ 
Sbjct  33    RGNLFPGFYRSSCPRAEEIVRSVVAKAVSRETRMAASLMRLHFHDCFVQGCDGSLLLDTS  92

Query  506   AGVESERES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAE  682
               + +E+ S P +   R ++ +  IKAALE ECPNTVSCAD + L+ARD +V+  GP   
Sbjct  93    GNIVTEKNSNPNSRSARGYEVVDEIKAALESECPNTVSCADALTLAARDSSVLTGGPSWT  152

Query  683   MKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCIN  862
             +  GRRDS    L+   N IP  N++   ++SRF + G+D    VAL G+H++G   C +
Sbjct  153   VPLGRRDSTSASLSGSNNNIPAPNNTFNTIVSRFNNQGLDLTDVVALSGSHTIGFSRCTS  212

Query  863   IVHRLY-----PTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYY  1027
                RLY      + D TL+ +YA  L+ RCP +  D    E   +   R      DN Y+
Sbjct  213   FRQRLYNQSGNGSPDTTLEQSYAANLRQRCPKSGGDQNLSELDINSAGR-----FDNSYF  267

Query  1028  KNILEHKGLLVVDE-LLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGE  1204
             KN++E+ GLL  DE L +++  +   V+K A D + F +QFA ++V M   +PLTG  GE
Sbjct  268   KNLIENMGLLNSDEVLFSSNEQSRELVKKYAEDQEEFFEQFAESMVKMGNISPLTGSSGE  327

Query  1205  IRKNCRYVN  1231
             IRKNCR +N
Sbjct  328   IRKNCRKIN  336



>ref|XP_002455760.1| hypothetical protein SORBIDRAFT_03g024460 [Sorghum bicolor]
 gb|EES00880.1| hypothetical protein SORBIDRAFT_03g024460 [Sorghum bicolor]
Length=343

 Score =   238 bits (608),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 176/308 (57%), Gaps = 12/308 (4%)
 Frame = +2

Query  329   GDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVA  508
             G L   +Y +SCP A+ I+   V K + +    A S LR  FHDC VK CDAS+LLDS  
Sbjct  39    GKLDPHFYDQSCPHAQHIVASIVGKAHYQDPRMAASLLRLHFHDCFVKGCDASLLLDSSG  98

Query  509   GVESERES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEM  685
              + SE+ S P     R F+ I  IKAALE  CP TVSCADI+AL+ARD  VM  GP   +
Sbjct  99    SIVSEKRSNPNKDSARGFEVIDEIKAALEAACPGTVSCADILALAARDSTVMTGGPGWIV  158

Query  686   KTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINI  865
               GRRDS+   +    N IP  N+++  ++++F+  G+D    VALLG+H++G   C + 
Sbjct  159   PLGRRDSRGASVQGSNNDIPAPNNTLPTIITKFKLQGLDIVDLVALLGSHTIGDSRCTSF  218

Query  866   VHRLYPTV-----DPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYK  1030
               RLY        D TLD +YA  L+ RCP +  D           D  TP   DN YYK
Sbjct  219   RQRLYNQTGNGLPDFTLDASYAATLRPRCPRSGGDQNLFFL-----DPITPFKFDNQYYK  273

Query  1031  NILEHKGLLVVDELLAT-HPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEI  1207
             NIL + GLL  DE+L T  PATA  V+  AA+   F   FA+++V M   +PLTG  GEI
Sbjct  274   NILAYHGLLSSDEVLLTGSPATADLVKLYAANQDIFFQHFAQSMVKMGNISPLTGANGEI  333

Query  1208  RKNCRYVN  1231
             RKNCR VN
Sbjct  334   RKNCRRVN  341



>ref|XP_006383152.1| hypothetical protein POPTR_0005s12070g [Populus trichocarpa]
 gb|ERP60949.1| hypothetical protein POPTR_0005s12070g [Populus trichocarpa]
 gb|AHL39138.1| class III peroxidase [Populus trichocarpa]
Length=333

 Score =   238 bits (607),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 130/313 (42%), Positives = 183/313 (58%), Gaps = 12/313 (4%)
 Frame = +2

Query  317   RCAKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILL  496
             + A G L   +Y  SCP+A +I+   V K   +    A S LR  FHDC VK CDASILL
Sbjct  26    KTAGGYLYPQFYDRSCPKAREIVNSIVAKAVAKEARMAASLLRLHFHDCFVKGCDASILL  85

Query  497   DSVAGVESERES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGP  673
             DS   + SE+ S P     R F+ I  IK+ALE+ECP TVSCADI+ALSARD  V+  GP
Sbjct  86    DSTGSIISEKGSNPNRNSARGFEVIDEIKSALEKECPKTVSCADIMALSARDSTVLTGGP  145

Query  674   RAEMKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVH  853
               E+  GRRDS+   L+   N IP  N++ + +L++F+  G++    VAL G+H++G   
Sbjct  146   SWEVPLGRRDSRSASLSGSNNNIPAPNNTFQTILTKFKLQGLNVVDLVALSGSHTIGNAR  205

Query  854   CINIVHRLYPTV-----DPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDN  1018
             C +   RLY        D +L  + A  L+ RCP +  D       ++     +P   DN
Sbjct  206   CTSFRQRLYNQSGNGKPDYSLQQSLAAQLRNRCPRSGGDQNLFFLDFA-----SPKKFDN  260

Query  1019  MYYKNILEHKGLLVVDELLAT-HPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGD  1195
              Y+KNIL  KGLL  D++L T + A+   V+K A  N+ F +QF++++V M   +PLTG 
Sbjct  261   SYFKNILASKGLLNSDQVLLTKNEASMELVKKYAESNELFFEQFSKSMVKMGNISPLTGS  320

Query  1196  QGEIRKNCRYVNT  1234
             +GEIRK+CR +N+
Sbjct  321   RGEIRKSCRKINS  333



>emb|CDY46313.1| BnaA07g01880D [Brassica napus]
Length=336

 Score =   238 bits (607),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 124/311 (40%), Positives = 182/311 (59%), Gaps = 12/311 (4%)
 Frame = +2

Query  323   AKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDS  502
              +G+L  G+Y  SCP+AE+I++  V +   +    A S +R  FHDC V+ CD S+LLDS
Sbjct  31    GEGNLFPGFYRSSCPKAEEIVRSVVAQAVAKEARMAASLMRLHFHDCFVQGCDGSLLLDS  90

Query  503   VAGVESERES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRA  679
                + +E+ S P +   R F  +  IKAALE ECP TVSCAD++ L+ARD +V+  GP  
Sbjct  91    SGSIITEKGSNPNSNSARGFDVVDQIKAALENECPGTVSCADLLTLAARDSSVLTGGPSW  150

Query  680   EMKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCI  859
              +  GRRDS+   L+   N IP  N++   +LSRF + G+D    VAL G+H++G   C 
Sbjct  151   MVPLGRRDSRSASLSGSNNNIPAPNNTFNTILSRFTNQGLDLTDLVALSGSHTIGFSRCT  210

Query  860   NIVHRLY-----PTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMY  1024
             +   RLY      + D TL+ +YA  L+ RCP     P   +   S  D  +    DN Y
Sbjct  211   SFRQRLYNQSGNGSPDITLEQSYATNLRQRCP-----PSGGDQNLSELDINSAGKFDNSY  265

Query  1025  YKNILEHKGLLVVDE-LLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQG  1201
             +KN++E+ GLL  D+ L ++   ++  V+K A D + F +QFA +++ M   +PLTG  G
Sbjct  266   FKNLIENMGLLNSDQVLFSSKEESSELVKKYAEDQEEFFEQFAESMIKMGNLSPLTGSSG  325

Query  1202  EIRKNCRYVNT  1234
             EIRKNCR +N+
Sbjct  326   EIRKNCRKINS  336



>ref|XP_004232441.1| PREDICTED: peroxidase 72-like [Solanum lycopersicum]
Length=332

 Score =   238 bits (607),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 129/303 (43%), Positives = 177/303 (58%), Gaps = 12/303 (4%)
 Frame = +2

Query  347   YYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGVESER  526
             YY +SCPRA +I+K  V K   +    A S LR  FHDC VK CDAS+LLDS  G+ +E+
Sbjct  34    YYYKSCPRALEIVKSVVAKAVAKEARMAASLLRLHFHDCFVKGCDASLLLDSSNGIVTEK  93

Query  527   ES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTGRRD  703
              S P     R F+ +  IK+ALE+ECP TVSCADI+AL+ARD  V+  GP  E+  GRRD
Sbjct  94    GSNPNRNSARGFEVLDEIKSALEKECPQTVSCADILALAARDSTVLAGGPNWEVPLGRRD  153

Query  704   SKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHRLYP  883
             S+   L+   N IP  N++ + +LS+F+  G+D    +AL G+H++G   C +   RLY 
Sbjct  154   SRSASLSGSNNNIPAPNNTFDSILSKFKRQGLDLVDLIALSGSHTIGNSRCTSFRQRLYN  213

Query  884   TV-----DPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHK  1048
                    D TLD +YA  L+ RCP +  D           D  +P   DN Y+K +L  K
Sbjct  214   QSGNNKPDSTLDESYAAQLRNRCPKSGGDQNLFFL-----DFVSPTKFDNSYFKLLLASK  268

Query  1049  GLLVVDELLATHP-ATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRY  1225
             GLL  D++L T    +   V++ A +N  F D FA+++V M   +PLTG  GEIRK CR 
Sbjct  269   GLLNSDQVLTTKSRESLALVKQYAENNALFFDHFAKSMVKMGNISPLTGSSGEIRKTCRK  328

Query  1226  VNT  1234
             +N+
Sbjct  329   INS  331



>ref|XP_006340672.1| PREDICTED: peroxidase 72-like [Solanum tuberosum]
Length=332

 Score =   238 bits (606),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 128/303 (42%), Positives = 176/303 (58%), Gaps = 12/303 (4%)
 Frame = +2

Query  347   YYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGVESER  526
             YY +SCP+A++I+K  V K   +    A S LR  FHDC VK CDAS+LLDS   + +E+
Sbjct  34    YYYKSCPQAQEIVKSVVAKAVAKEARMAASLLRLHFHDCFVKGCDASLLLDSRGSIVTEK  93

Query  527   ES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTGRRD  703
              S P     R F  I  IK+ALE+ECP TVSCADI+AL+ARD  V+  GP  E+  GRRD
Sbjct  94    RSNPNRNSARGFDVIDDIKSALEKECPQTVSCADILALAARDSTVLAGGPNWEVPLGRRD  153

Query  704   SKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHRLY-  880
             S+   L+   N IP  N++   +L++F+  G+D    VAL G+H++G   C++   RLY 
Sbjct  154   SRSASLSGSNNDIPAPNNTFNTILTKFKRQGLDVVDLVALSGSHTIGNSRCVSFRQRLYN  213

Query  881   ----PTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHK  1048
                    D TLD +YA  L+ RCP +  D           D  +P   DN Y+K +L  K
Sbjct  214   QSGNSKPDSTLDQSYAAQLRNRCPKSGGDQNLFFL-----DFVSPTKFDNSYFKLLLASK  268

Query  1049  GLLVVDELLATHP-ATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRY  1225
             GLL  D++L T    +   V++ A +N  F D FA+++V M   +PLTG  GEIRK CR 
Sbjct  269   GLLNSDQVLTTKSEESLALVKQYAENNALFFDHFAKSMVKMGNISPLTGSSGEIRKTCRK  328

Query  1226  VNT  1234
             +N+
Sbjct  329   INS  331



>ref|XP_010936646.1| PREDICTED: peroxidase 72-like [Elaeis guineensis]
Length=330

 Score =   238 bits (606),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 132/309 (43%), Positives = 182/309 (59%), Gaps = 12/309 (4%)
 Frame = +2

Query  329   GDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVA  508
             G L   YY  SCP+A++I+K  V K   +    A S LR  FHDC VK CDAS+LLDS  
Sbjct  27    GYLYPQYYDHSCPKAQEIVKSVVAKAVAKETRMAASLLRLHFHDCFVKGCDASLLLDSSG  86

Query  509   GVESE-RESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEM  685
              + SE R +P     R F+ I  IKAALE+ECP TVSCADI+AL+ARD  V+  GP   +
Sbjct  87    SIISEKRANPNRNSARGFEVIDEIKAALEKECPQTVSCADILALAARDSTVLAGGPSWVV  146

Query  686   KTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINI  865
               GRRDS    L+   N IP  N+++  ++++F+  G+D    VAL G H++G+  C + 
Sbjct  147   PLGRRDSLGASLSGSNNNIPAPNNTLPTIITKFKLQGLDLADLVALSGGHTIGQSRCTSF  206

Query  866   VHRLY-----PTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYK  1030
               RLY        D TL+ ++A  L+ RCP +  D   + P     D  +P   DN YYK
Sbjct  207   RQRLYNQTGNGLADSTLEVSFASQLRSRCPRSGGD-NNLFPL----DLVSPTKFDNYYYK  261

Query  1031  NILEHKGLLVVDELLAT-HPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEI  1207
             NI+  KGLL  D++L T +P T   V+  A +++ F +QF ++++ M    PLTG +GEI
Sbjct  262   NIMASKGLLNSDQVLFTRNPQTMALVKLYAENSELFMEQFVKSMIKMGNITPLTGVRGEI  321

Query  1208  RKNCRYVNT  1234
             RKNCR VN+
Sbjct  322   RKNCRKVNS  330



>ref|XP_009778389.1| PREDICTED: peroxidase 72-like [Nicotiana sylvestris]
Length=332

 Score =   238 bits (606),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 132/309 (43%), Positives = 181/309 (59%), Gaps = 12/309 (4%)
 Frame = +2

Query  329   GDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVA  508
             G L   +Y  SCP+A++I+K  V K        A S LR  FHDC VK CDAS+LLDS  
Sbjct  29    GYLYPQFYDWSCPQAKEIVKSVVAKAVAREARMAASLLRLHFHDCFVKGCDASLLLDSSG  88

Query  509   GVESERESPRNF-GMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEM  685
              + SE+ S  N    R F+ I  IK+ALE+ECP TVSCADI+AL+ARD  V+  GP  E+
Sbjct  89    TIISEKISNTNRNSARGFEVIDEIKSALEKECPQTVSCADILALAARDSTVLAGGPNWEV  148

Query  686   KTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINI  865
               GRRDS++  L+   N IP  N++   +L++F+  G+D    VAL G+H++G   C + 
Sbjct  149   PLGRRDSRDASLSGSNNNIPAPNNTFNTILTKFKLKGLDLVDLVALSGSHTIGNARCTSF  208

Query  866   VHRLYPTV-----DPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYK  1030
               RLY        D TLD +YA  L+ RCP +  D           D  +P   DN Y+K
Sbjct  209   RQRLYNQSGNNLPDYTLDQSYAAQLRTRCPKSGGDQNLFFM-----DFVSPTKFDNYYFK  263

Query  1031  NILEHKGLLVVDELLAT-HPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEI  1207
             N+L  KGL   D++L T + A+   V   A +N+ F +QFA+++V M   +PLTG +GEI
Sbjct  264   NLLASKGLFNSDQVLVTKNQASLELVRLYAENNELFFEQFAKSMVKMGNISPLTGYRGEI  323

Query  1208  RKNCRYVNT  1234
             RKNCR +N+
Sbjct  324   RKNCRMMNS  332



>gb|EAY74439.1| hypothetical protein OsI_02330 [Oryza sativa Indica Group]
Length=336

 Score =   238 bits (607),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 134/303 (44%), Positives = 176/303 (58%), Gaps = 13/303 (4%)
 Frame = +2

Query  347   YYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGVESER  526
             +Y  SCP+A+ I+   V K + +    A S LR  FHDC VK CDASILLDS A + SE+
Sbjct  36    FYDHSCPQAQQIVASIVGKAHYQDPRMAASLLRLHFHDCFVKGCDASILLDSSATITSEK  95

Query  527   ES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTGRRD  703
              S P     R F+ I  IKA LE  CP+TVSCADI+AL+ARD  VM  GP   +  GRRD
Sbjct  96    RSNPNRDSARGFEVIDEIKATLEAACPHTVSCADILALAARDSTVMTGGPGWIVPLGRRD  155

Query  704   SKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHRLYP  883
             S+   +    N IP  N+++  ++++F+  G+D    VALLG+H++G   C +   RLY 
Sbjct  156   SRGASVQGSNNDIPAPNNTLPTIITKFKLQGLDIVDLVALLGSHTIGDSRCTSFRQRLYN  215

Query  884   TV-----DPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHK  1048
                    D TLD +YA  L+ RCP +  D           D  TP   DN YY+N+L H+
Sbjct  216   QTGNGLPDFTLDASYAAALRPRCPRSGGDQNLF-----FLDPVTPFKFDNQYYRNLLAHR  270

Query  1049  GLLVVDELLAT--HPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCR  1222
             GLL  DE+L T  +PATA  VE  AA+   F   FA+++V M   +PLTG  GE+R NCR
Sbjct  271   GLLSSDEVLLTGGNPATAELVELYAANQDIFFAHFAQSMVKMGNISPLTGGNGEVRTNCR  330

Query  1223  YVN  1231
              VN
Sbjct  331   RVN  333



>ref|XP_009793693.1| PREDICTED: peroxidase 72-like [Nicotiana sylvestris]
Length=331

 Score =   238 bits (606),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 127/303 (42%), Positives = 181/303 (60%), Gaps = 12/303 (4%)
 Frame = +2

Query  347   YYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGVESER  526
             +Y +SCP+A++I+K  V K   +    A S LR  FHDC VK CDAS+LLDS   + SE+
Sbjct  34    FYDQSCPQAKEIVKFIVAKAVAKEARMAASLLRLHFHDCFVKGCDASLLLDSSGSIISEK  93

Query  527   ES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTGRRD  703
              S P     R F+ I  IK ALE+ECP TVSCADI+AL+ARD  V++ GP  E+  GRRD
Sbjct  94    RSNPNRNSARGFEVIDEIKKALEKECPQTVSCADILALAARDSTVLVGGPNWEVPLGRRD  153

Query  704   SKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHRLY-  880
             S+   ++   N IP  N++   +L++F+  G+D    VAL G+H++G   C +   RLY 
Sbjct  154   SRGASISGSNNNIPAPNNTFNTILTQFKLKGLDIVDLVALSGSHTIGNARCTSFKQRLYN  213

Query  881   ----PTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHK  1048
                    D TL+ +YA  L+ +CP +  D           D  +P   DN Y+KN+L  K
Sbjct  214   QSGNSKPDFTLEQSYAAQLRTKCPRSGGDQNLFFL-----DFVSPTKFDNSYFKNLLASK  268

Query  1049  GLLVVDELLAT-HPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRY  1225
             GLL  D++L T +  +   V++ A +N  F +QFA+++V M   +PLTG +GEIRKNCR 
Sbjct  269   GLLNSDQVLVTKNQESLNLVKQYAENNGLFFEQFAKSMVKMGNISPLTGSRGEIRKNCRK  328

Query  1226  VNT  1234
             +N+
Sbjct  329   INS  331



>emb|CBI23244.3| unnamed protein product [Vitis vinifera]
Length=178

 Score =   232 bits (592),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 135/175 (77%), Gaps = 0/175 (0%)
 Frame = +2

Query  341  MGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGVES  520
            M +Y ++CP+AED+I+EQV  LY+ H NTA SWLRN+FHDC V++CDAS+LLDS     S
Sbjct  1    MNFYKDTCPQAEDVIREQVRLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRRSLS  60

Query  521  ERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTGRR  700
            E+E+ R+FG+RNF+Y+ TIK A+E ECP  VSCADI+ LSARDG V L GP   +KTGRR
Sbjct  61   EKETDRSFGLRNFRYLDTIKEAVERECPGVVSCADILVLSARDGIVSLGGPHISLKTGRR  120

Query  701  DSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINI  865
            D +++    +E ++P+HN+SM +VL RF +IG+DT G VALLGAHSVGR HC  I
Sbjct  121  DGRKSRAEILEEYLPDHNESMSVVLDRFAAIGIDTPGLVALLGAHSVGRTHCCAI  175



>ref|XP_009599956.1| PREDICTED: peroxidase 72-like [Nicotiana tomentosiformis]
Length=332

 Score =   238 bits (606),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 132/308 (43%), Positives = 182/308 (59%), Gaps = 12/308 (4%)
 Frame = +2

Query  329   GDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVA  508
             G L   +Y  SCP+A++I+K  V K        A S LR  FHDC VK CDAS+LLDS  
Sbjct  29    GYLYPQFYDWSCPQAKEIVKSVVAKAVAREARMAASLLRLHFHDCFVKGCDASLLLDSSG  88

Query  509   GVESERESPRNF-GMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEM  685
              + SE+ S  N    R F+ I  IK+ALE+ECP TVSCADI+AL+ARD  V++ GP  E+
Sbjct  89    TLVSEKISNTNRNSARGFEVIDEIKSALEKECPQTVSCADILALAARDSTVLVGGPNWEV  148

Query  686   KTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINI  865
               GRRDS++  L+   N IP  N++   +L++F+  G+D    VAL G+H++G   C + 
Sbjct  149   PLGRRDSRDASLSGSNNNIPAPNNTFNTILTKFKLKGLDLVDLVALSGSHTIGNARCTSF  208

Query  866   VHRLYPTV-----DPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYK  1030
               RLY        D TLD +YA  L+ RCP +  D           D  +P   DN Y+K
Sbjct  209   RQRLYNQSGNNLPDYTLDQSYAAQLRTRCPKSGGDQNLFVM-----DFVSPTKFDNNYFK  263

Query  1031  NILEHKGLLVVDELLAT-HPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEI  1207
             N+L  +GL   D++L T + AT   V+  A +N+ F +QFA+++V M   +PLTG +GEI
Sbjct  264   NLLASRGLFNSDQVLVTKNQATLELVKLYAENNEIFFEQFAKSIVKMGNISPLTGYRGEI  323

Query  1208  RKNCRYVN  1231
             RKNCR +N
Sbjct  324   RKNCRMMN  331



>ref|XP_008337703.1| PREDICTED: peroxidase 72-like [Malus domestica]
Length=331

 Score =   238 bits (606),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 131/309 (42%), Positives = 180/309 (58%), Gaps = 12/309 (4%)
 Frame = +2

Query  329   GDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVA  508
             G L   +Y  SCPRA++I+K  V K        A S LR  FHDC VK CDASILLDS  
Sbjct  28    GYLYPQFYDRSCPRAKEIVKSVVAKAVARETRMAASLLRLHFHDCFVKGCDASILLDSSQ  87

Query  509   GVESERES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEM  685
              V +E+ S P     R F+ I  IK+ALE+ECP+TVSCADI+AL+ARD  V+  GP  E+
Sbjct  88    NVITEKMSVPNQNSARGFEVIDEIKSALEKECPSTVSCADILALAARDSTVLTGGPNWEV  147

Query  686   KTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINI  865
               GRRDS+   L+   + IP  N++ + +L++F+   +D    VAL G+H++G   C   
Sbjct  148   PLGRRDSRGASLSGSNSNIPAPNNTFQTILTKFKLKKLDIVDLVALSGSHTIGNARCTTF  207

Query  866   VHRLY-----PTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYK  1030
               RLY        D TLD ++A  L+ RCP +  D           D  +P   DN Y+K
Sbjct  208   RQRLYIQSGNGLADFTLDQSFAAQLRTRCPRSGGDQNLFVM-----DFVSPTKFDNSYFK  262

Query  1031  NILEHKGLLVVDELLATHPATAP-FVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEI  1207
             N+L  KGLL  DE+L T    +   V++ A +N+ F +QFA+++V M   +P+TG  GEI
Sbjct  263   NLLASKGLLNSDEVLVTKSQVSKQLVQQYAENNELFFEQFAKSMVKMGNISPITGSSGEI  322

Query  1208  RKNCRYVNT  1234
             RK+CR VN+
Sbjct  323   RKSCRKVNS  331



>ref|NP_179407.1| peroxidase 15 [Arabidopsis thaliana]
 sp|Q9SI16.1|PER15_ARATH RecName: Full=Peroxidase 15; Short=Atperox P15; AltName: Full=ATP36; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAD31351.1| putative peroxidase [Arabidopsis thaliana]
 gb|AAL91187.1| putative peroxidase [Arabidopsis thaliana]
 gb|AAO00917.1| putative peroxidase [Arabidopsis thaliana]
 gb|AEC06731.1| peroxidase 15 [Arabidopsis thaliana]
Length=338

 Score =   238 bits (606),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 126/309 (41%), Positives = 180/309 (58%), Gaps = 12/309 (4%)
 Frame = +2

Query  326   KGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSV  505
             KG+L  G+Y  SCPRAE+I++  V K        A S +R  FHDC V+ CD S+LLD+ 
Sbjct  33    KGNLFPGFYRSSCPRAEEIVRSVVAKAVARETRMAASLMRLHFHDCFVQGCDGSLLLDTS  92

Query  506   AGVESERES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAE  682
               + +E+ S P +   R F+ +  IKAALE ECPNTVSCAD + L+ARD +V+  GP   
Sbjct  93    GSIVTEKNSNPNSRSARGFEVVDEIKAALENECPNTVSCADALTLAARDSSVLTGGPSWM  152

Query  683   MKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCIN  862
             +  GRRDS    L+   N IP  N++   +++RF + G+D    VAL G+H++G   C +
Sbjct  153   VPLGRRDSTSASLSGSNNNIPAPNNTFNTIVTRFNNQGLDLTDVVALSGSHTIGFSRCTS  212

Query  863   IVHRLY-----PTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYY  1027
                RLY      + D TL+ +YA  L+ RCP +  D    E   +   R      DN Y+
Sbjct  213   FRQRLYNQSGNGSPDRTLEQSYAANLRQRCPRSGGDQNLSELDINSAGR-----FDNSYF  267

Query  1028  KNILEHKGLLVVDE-LLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGE  1204
             KN++E+ GLL  DE L +++  +   V+K A D + F +QFA +++ M   +PLTG  GE
Sbjct  268   KNLIENMGLLNSDEVLFSSNEQSRELVKKYAEDQEEFFEQFAESMIKMGNISPLTGSSGE  327

Query  1205  IRKNCRYVN  1231
             IRKNCR +N
Sbjct  328   IRKNCRKIN  336



>gb|AAP42506.1| anionic peroxidase swpb1 [Ipomoea batatas]
Length=332

 Score =   237 bits (605),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 130/309 (42%), Positives = 180/309 (58%), Gaps = 12/309 (4%)
 Frame = +2

Query  329   GDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVA  508
             G L   YY +SCPRA +I++ +V K   +    A S +R  FHDC V+ CDASILLDS  
Sbjct  29    GSLYPQYYEKSCPRALEIVRSEVAKAVAKEARMAASLIRLSFHDCFVQGCDASILLDSGN  88

Query  509   GVESERES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEM  685
             G+ SE+ S P     R F  I  IKAALE+ECP TVSCADI+ L+ARD   +  GP  E+
Sbjct  89    GITSEKNSNPNRNSARGFDVIDDIKAALEKECPQTVSCADIMQLAARDSTHLSGGPFWEV  148

Query  686   KTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINI  865
               GR+DS+   L+   N IP  N + + +L+RF++ G+D    VAL G+H++G   C++ 
Sbjct  149   PVGRKDSRSASLSGSNNNIPAPNSTFQTILNRFKNQGLDLVDLVALSGSHTIGNSRCVSF  208

Query  866   VHRLYPTV-----DPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYK  1030
               RLY        D TLD  YA  L+ RCP +  D           D  +P   DN Y+K
Sbjct  209   RQRLYNQAGNNQPDSTLDQYYAAQLRNRCPRSGGDSNLFFL-----DFVSPTKFDNSYFK  263

Query  1031  NILEHKGLLVVDELLAT-HPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEI  1207
              +L +KGLL  D++L T + A+   V+  A +N+ F   FA +++ M+  +PLTG  GEI
Sbjct  264   LLLANKGLLNSDQVLTTKNEASLQLVKAYAENNELFLQHFASSMIKMANISPLTGSNGEI  323

Query  1208  RKNCRYVNT  1234
             RKNCR +N+
Sbjct  324   RKNCRKINS  332



>ref|XP_009393610.1| PREDICTED: peroxidase 72-like [Musa acuminata subsp. malaccensis]
Length=330

 Score =   237 bits (605),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 130/302 (43%), Positives = 174/302 (58%), Gaps = 12/302 (4%)
 Frame = +2

Query  347   YYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGVESER  526
             +Y  SCPRA+DI++  V K        A S LR  FHDC VK CDAS+LLDS   + SE+
Sbjct  34    FYQHSCPRAQDIVRSVVAKAVAMETRMAASLLRLHFHDCFVKGCDASLLLDSSGSIVSEK  93

Query  527   ES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTGRRD  703
              S P     R F+ I  IK+ALE+ECP TVSCADI+AL+ARD  V++ GP  E+  GRRD
Sbjct  94    GSNPNKNSARGFEVIDEIKSALEKECPQTVSCADILALAARDSTVLVGGPNWEVPLGRRD  153

Query  704   SKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHRLY-  880
             S    L+   + IP  N++++ + ++F+  G+D    VAL G+H++G   C +   RLY 
Sbjct  154   SLGASLSGSNHDIPAPNNTLQTITTKFKRQGLDIVDLVALSGSHTIGLSRCTSFRQRLYN  213

Query  881   ----PTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHK  1048
                    D TL+  YA  L+ RCP +  D           DR +P   DN YYKNI+  K
Sbjct  214   QTGNGVADSTLEEAYAWQLRSRCPRSGGDDNLFSL-----DRVSPTKFDNNYYKNIVAGK  268

Query  1049  GLLVVDELLATHP-ATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRY  1225
             GLL  D++L T    T   V++ A +   F D FA+++V M   +PLTG  GEIRKNCR 
Sbjct  269   GLLNSDQVLLTQSLETMALVKQYAENTDLFFDHFAKSMVKMGNISPLTGATGEIRKNCRK  328

Query  1226  VN  1231
              N
Sbjct  329   TN  330



>gb|AAM61616.1| putative peroxidase [Arabidopsis thaliana]
Length=338

 Score =   238 bits (606),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 126/309 (41%), Positives = 180/309 (58%), Gaps = 12/309 (4%)
 Frame = +2

Query  326   KGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSV  505
             KG+L  G+Y  SCPRAE+I++  V K        A S +R  FHDC V+ CD S+LLD+ 
Sbjct  33    KGNLFPGFYRSSCPRAEEIVRSVVAKAVARETRMAASLMRLHFHDCFVQGCDGSLLLDTS  92

Query  506   AGVESERES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAE  682
               + +E+ S P +   R F+ +  IKAALE ECPNTVSCAD + L+ARD +V+  GP   
Sbjct  93    GSIVTEKNSNPNSRSARGFEVVDEIKAALENECPNTVSCADALTLAARDSSVLTGGPSWM  152

Query  683   MKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCIN  862
             +  GRRDS    L+   N IP  N++   +++RF + G+D    VAL G+H++G   C +
Sbjct  153   VPLGRRDSTSASLSGSNNNIPAPNNTFNTIVTRFNNQGLDLTDVVALSGSHTIGFSRCTS  212

Query  863   IVHRLY-----PTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYY  1027
                RLY      + D TL+ +YA  L+ RCP +  D    E   +   R      DN Y+
Sbjct  213   FRQRLYNQSGNGSPDRTLEQSYAANLRQRCPRSGGDQNLSELDINSAGR-----FDNSYF  267

Query  1028  KNILEHKGLLVVDE-LLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGE  1204
             KN++E+ GLL  DE L +++  +   V+K A D + F +QFA +++ M   +PLTG  GE
Sbjct  268   KNLIENMGLLNSDEVLFSSNEQSRELVKKYAEDQEEFFEQFAESMIKMGNISPLTGSSGE  327

Query  1205  IRKNCRYVN  1231
             IRKNCR +N
Sbjct  328   IRKNCRKIN  336



>ref|XP_006840851.1| hypothetical protein AMTR_s00083p00110830 [Amborella trichopoda]
 gb|ERN02526.1| hypothetical protein AMTR_s00083p00110830 [Amborella trichopoda]
Length=330

 Score =   237 bits (605),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 132/309 (43%), Positives = 179/309 (58%), Gaps = 12/309 (4%)
 Frame = +2

Query  329   GDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVA  508
             G L   +Y +SCP+A +I+K  V K        A S LR  FHDC VK CDAS+LLDS  
Sbjct  26    GYLYPQFYDKSCPKAPEIVKSVVAKAVAREARMAASLLRLHFHDCFVKGCDASLLLDSSG  85

Query  509   GVESERESPRNF-GMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEM  685
              + SE+ S  N    R F+ I  IK+ALE+ECP TVSCADI+AL+ARD  V+  GP  E+
Sbjct  86    SIISEKRSNANRNSARGFEVIDEIKSALEKECPLTVSCADILALAARDSTVLAGGPHWEV  145

Query  686   KTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINI  865
               GRRDS+   L+     IP  N +++ ++++F+  G+DT   VAL G+H++G+  C + 
Sbjct  146   PLGRRDSRGASLSGSNRNIPAPNSTIQTLITKFKLQGLDTVDLVALSGSHTIGQSRCTSF  205

Query  866   VHRLYPTV-----DPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYK  1030
               RLY        D TLD  YA  L+ RCP +  D           D  +P + DN Y+K
Sbjct  206   RQRLYNQTGNGRPDLTLDQGYAAQLRTRCPRSGGDSNLFPL-----DFVSPTVFDNWYFK  260

Query  1031  NILEHKGLLVVDELLATHP-ATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEI  1207
             NI+  KGLL  D++L T    T   VE  A +NQ F   FA ++V M   +PLTG +GE+
Sbjct  261   NIVASKGLLNSDQVLFTRSEKTMEIVELYAKNNQLFIQHFANSMVKMGNISPLTGSRGEV  320

Query  1208  RKNCRYVNT  1234
             RKNCR +N+
Sbjct  321   RKNCRRINS  329



>gb|ABG49114.1| peroxidase [Dimocarpus longan]
Length=332

 Score =   237 bits (605),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 130/303 (43%), Positives = 179/303 (59%), Gaps = 12/303 (4%)
 Frame = +2

Query  347   YYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGVESER  526
             +Y  SCP+A+ I+K  V K   +    A S LR  FHDC VK CDAS+LLDS   + SE+
Sbjct  35    FYDHSCPKAQQIVKSVVAKAVAKEARMAASLLRLHFHDCFVKGCDASLLLDSSGSIISEK  94

Query  527   ES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTGRRD  703
              S P     R F+ +  IK+ALE+ECP+TVSCADI+AL+ARD  V+  GP  E+  GRRD
Sbjct  95    RSNPNRNSARGFEVLDDIKSALEKECPHTVSCADILALAARDSTVLTGGPSWEVPLGRRD  154

Query  704   SKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHRLYP  883
             S+   L+   N IP  N++ + +L++F+  G+D    VAL G+H++G   C +   RLY 
Sbjct  155   SRGASLSGSNNNIPAPNNTFQTILTKFKLQGLDIVDLVALSGSHTIGNSRCTSFRQRLYN  214

Query  884   TV-----DPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHK  1048
                    D TLD +YA  L+ RCP +  D      T    D  +    DN Y+K +L  K
Sbjct  215   QSGNGQPDLTLDQSYAAQLRTRCPRSGGD-----QTLFFLDFVSTTKFDNSYFKLLLASK  269

Query  1049  GLLVVDELLATHPA-TAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRY  1225
             GLL  D++L T    +   V+K AA N+ F  QFA+++V M   +PLTG +GEIRKNCR 
Sbjct  270   GLLNSDQVLVTKSKESLDLVKKYAAHNELFLPQFAKSMVKMGNISPLTGSRGEIRKNCRK  329

Query  1226  VNT  1234
             +N+
Sbjct  330   INS  332



>ref|XP_008337713.1| PREDICTED: peroxidase 72-like [Malus domestica]
Length=331

 Score =   237 bits (605),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 130/309 (42%), Positives = 180/309 (58%), Gaps = 12/309 (4%)
 Frame = +2

Query  329   GDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVA  508
             G L   +Y  SCPRA++I+K  V K        A S LR  FHDC VK CDAS+LLDS  
Sbjct  28    GYLYPQFYDRSCPRAKEIVKSVVAKAVARETRMAASLLRLHFHDCFVKGCDASLLLDSSQ  87

Query  509   GVESERES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEM  685
              + +E+ S P     R F+ I  IK+ALE ECP+TVSCADI+AL+ARD  V+  GP   +
Sbjct  88    NIITEKRSVPNQNSARGFEVIDEIKSALENECPSTVSCADILALAARDSTVLTGGPNWXV  147

Query  686   KTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINI  865
               GRRDS+   L+   N IP  N++ + +L++F+   +D    VAL G+H++G   C + 
Sbjct  148   PLGRRDSRGASLSGSNNNIPAPNNTFQTILTKFKLKKLDIVDLVALSGSHTIGNARCTSF  207

Query  866   VHRLY-----PTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYK  1030
               RLY        D TLD +YA  L+ RCP +  D           D  +P   DN Y+K
Sbjct  208   RQRLYNQSGNGLADFTLDQSYAAQLRTRCPRSGGDQNLFVM-----DFVSPTKFDNSYFK  262

Query  1031  NILEHKGLLVVDELLATHPATAP-FVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEI  1207
             N+L  KGLL  DE+L T    +   V++ A +N+ F +QFA+++V M   +P+TG +GEI
Sbjct  263   NLLAIKGLLNSDEVLVTKSQVSKQLVQQYAENNELFFEQFAKSMVKMGNISPITGSRGEI  322

Query  1208  RKNCRYVNT  1234
             RK+CR VN+
Sbjct  323   RKSCRKVNS  331



>ref|XP_007156087.1| hypothetical protein PHAVU_003G257400g [Phaseolus vulgaris]
 gb|ESW28081.1| hypothetical protein PHAVU_003G257400g [Phaseolus vulgaris]
Length=331

 Score =   237 bits (605),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 126/309 (41%), Positives = 180/309 (58%), Gaps = 12/309 (4%)
 Frame = +2

Query  326   KGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSV  505
             +G L   +Y  SCP+A+ I+K  +    E+    A S LR  FHDC VK CDAS+LLDS 
Sbjct  27    EGYLYPQFYDYSCPQAQHIVKSILATYVEQQPRLAASILRLHFHDCFVKGCDASLLLDSS  86

Query  506   AGVESERES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAE  682
               + SE+ S P     R F+ I  IKAALE ECP+TVSCADI+ L+ARD  V+  GP  E
Sbjct  87    GSIISEKGSNPNRNSARGFEVIDAIKAALERECPSTVSCADILTLAARDSVVLSGGPSWE  146

Query  683   MKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCIN  862
             +  GRRDS++  ++   N IP  N++ + +L++F+  G+     VAL G+H++G   C  
Sbjct  147   VPLGRRDSRDASISGSNNNIPAPNNTFQTILTKFKLQGLHLVDLVALSGSHTIGNARCTT  206

Query  863   IVHRLYPTV------DPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMY  1024
                RLY  +      +  LD  YA  L+ RCP +  D       Y+     TP   DN Y
Sbjct  207   FRQRLYSQISGHGKPESALDQYYATALRNRCPRSGGDQNLFFLDYA-----TPYKFDNTY  261

Query  1025  YKNILEHKGLLVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGE  1204
             +KN+L +KGLL  D++L T   +A  V+  A +N  F +QFA++++ M   +PLT  +GE
Sbjct  262   FKNLLAYKGLLSSDQILLTTQESAALVQSYAENNDIFLEQFAKSMIKMGNISPLTNSRGE  321

Query  1205  IRKNCRYVN  1231
             IR+NCR++N
Sbjct  322   IRENCRHIN  330



>ref|XP_002992254.1| hypothetical protein SELMODRAFT_134943 [Selaginella moellendorffii]
 gb|EFJ06751.1| hypothetical protein SELMODRAFT_134943 [Selaginella moellendorffii]
Length=331

 Score =   237 bits (605),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 116/300 (39%), Positives = 179/300 (60%), Gaps = 6/300 (2%)
 Frame = +2

Query  335   LQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGV  514
             L++GYY  SCP AE I+++ ++ L  +      + LR  FHDC V  CDASI+LDS A  
Sbjct  38    LRLGYYGSSCPNAETIVRQTLMTLLMQDPTAGAALLRLAFHDCDVMGCDASIILDSTAQF  97

Query  515   ESERESPRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTG  694
             +SE ESP+NFG+R   +I  IKA+LE  CP TVSCADI+AL+ARD  ++  GP   + TG
Sbjct  98    QSELESPKNFGIRRVDFIDRIKASLEGSCPRTVSCADIIALAARDSILLAGGPNIPVLTG  157

Query  695   RRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHR  874
             R+DS    LA     +     S+E +L  F S+G++ +  V+LLGAH++G  HC+++V+R
Sbjct  158   RKDSTRADLATANRKLATATSSVEEILQDFASMGINPQEAVSLLGAHTLGVGHCLSVVNR  217

Query  875   LYPTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYKNILEHKGL  1054
             LYP+VD  +D  Y+  L++ CPS    P+      +  +  T    DNM++K+    + L
Sbjct  218   LYPSVDTKMDLMYSMALRVLCPS----PKFYLNITAIPNDSTMFRFDNMFFKDAASRRVL  273

Query  1055  LVVDELLATHPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNCRYVNT  1234
               +D  + + P T+ +  K A +   F D F+RA V ++  + +  +  ++R NCR +N+
Sbjct  274   FALDAAVQSDPRTSIYTSKFAQNQGLFFDTFSRAFVKLT--SVVNSEATQVRSNCRAINS  331



>ref|XP_007046814.1| Peroxidase superfamily protein [Theobroma cacao]
 gb|EOX90971.1| Peroxidase superfamily protein [Theobroma cacao]
Length=333

 Score =   237 bits (605),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 132/310 (43%), Positives = 182/310 (59%), Gaps = 12/310 (4%)
 Frame = +2

Query  323   AKGDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDS  502
             A G L   +Y  SCP+A++I+K  V K   +    A S LR  FHDC VK CDASILLDS
Sbjct  27    AGGYLYPQFYDHSCPKAQEIVKYIVAKAVAKEARMAASLLRLHFHDCFVKGCDASILLDS  86

Query  503   VAGVESERES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRA  679
                + SE+ S P     R F+ I  IKAALE+ CP+TVSCADI+AL+ARD  V+  GP  
Sbjct  87    SRTIISEKRSNPNRDSARGFEVIDEIKAALEKACPHTVSCADIMALAARDSTVLTGGPNW  146

Query  680   EMKTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCI  859
             E+  GRRDS    L+   N IP  N++ + +L++F+  G++    VAL G+H++G   C 
Sbjct  147   EVPLGRRDSTGASLSGSNNNIPAPNNTFQTILTKFKRQGLNIVDLVALSGSHTIGNARCT  206

Query  860   NIVHRLYPTV-----DPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMY  1024
             +   RLY        D TLD +YA  L+  CP +  D           D  +P+  DN Y
Sbjct  207   SFRQRLYNQSGNGQPDYTLDQSYAAQLRTNCPRSGGDQNLFFL-----DFVSPIKFDNSY  261

Query  1025  YKNILEHKGLLVVDELLATHPATA-PFVEKMAADNQYFHDQFARALVIMSENNPLTGDQG  1201
             +KN+L +KGLL  D++L T  A +   V+K A + + F  QFA++++ M   +PLTG +G
Sbjct  262   FKNLLSYKGLLNSDQVLFTKSAVSRELVKKYAYNQELFFQQFAKSMIKMGNISPLTGYRG  321

Query  1202  EIRKNCRYVN  1231
             E+RKNCR VN
Sbjct  322   EVRKNCRKVN  331



>ref|XP_006645977.1| PREDICTED: peroxidase 72-like [Oryza brachyantha]
Length=459

 Score =   241 bits (614),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 137/304 (45%), Positives = 179/304 (59%), Gaps = 16/304 (5%)
 Frame = +2

Query  347   YYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVAGVESER  526
             +Y  SCP+A+ I+   V K++ +    A S LR  FHDC VK CDASILLDS A + SE+
Sbjct  161   FYDRSCPQAQQIVASIVGKVHYQDPRMAASLLRLHFHDCFVKGCDASILLDSSATIVSEK  220

Query  527   ES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEMKTGRRD  703
              S P     R F+ I  IKAALE  CP+TVSCADI+AL+ARD  VM  GP   +  GRRD
Sbjct  221   RSNPNRDSARGFEVIDEIKAALEAACPHTVSCADILALAARDSTVMTGGPGWIVPLGRRD  280

Query  704   SKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINIVHRLYP  883
             S+   +    N IP  N+++  ++++F+  G+D    VALLG+H++G   C +   RLY 
Sbjct  281   SRGASVQGSNNDIPAPNNTLPTIITKFKLQGLDILDLVALLGSHTIGDSRCTSFRQRLYN  340

Query  884   TV-----DPTLDPTYADYLKLRCPSAEPDPRA--VEPTYSRNDRRTPMILDNMYYKNILE  1042
                    D TLD +YA  L+ RCP +  D     ++P        TP   DN YYKN+L 
Sbjct  341   RTGTGLPDLTLDASYAAALRPRCPRSGGDQNLFFLDPV-------TPFKFDNQYYKNLLA  393

Query  1043  HKGLLVVDELLAT-HPATAPFVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEIRKNC  1219
             ++GLL  DE+L T  PATA  V+  AAD   F   FAR++V M   +PLTG  GEIR NC
Sbjct  394   YRGLLSSDEVLLTASPATAELVKLYAADQDVFFQHFARSMVKMGNISPLTGGNGEIRANC  453

Query  1220  RYVN  1231
             R VN
Sbjct  454   RKVN  457



>ref|XP_008344257.1| PREDICTED: peroxidase 72-like [Malus domestica]
Length=331

 Score =   237 bits (604),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 130/309 (42%), Positives = 180/309 (58%), Gaps = 12/309 (4%)
 Frame = +2

Query  329   GDLQMGYYSESCPRAEDIIKEQVIKLYEEHGNTAVSWLRNLFHDCMVKACDASILLDSVA  508
             G L   +Y  SCPRA++I+K  V K        A S LR  FHDC VK CDAS+LLDS  
Sbjct  28    GYLYPQFYDRSCPRAKEIVKSVVAKAVARETRMAASLLRLHFHDCFVKGCDASLLLDSSQ  87

Query  509   GVESERES-PRNFGMRNFKYIQTIKAALEEECPNTVSCADIVALSARDGAVMLKGPRAEM  685
              + +E+ S P     R F+ I  IK+ALE ECP+TVSCADI+AL+ARD  V+  GP   +
Sbjct  88    NIITEKRSVPNQNSARGFEVIDEIKSALEXECPSTVSCADILALAARDSTVLTGGPNWXV  147

Query  686   KTGRRDSKETYLAEVENFIPNHNDSMELVLSRFQSIGVDTEGTVALLGAHSVGRVHCINI  865
               GRRDS+   L+   N IP  N++ + +L++F+   +D    VAL G+H++G   C + 
Sbjct  148   PLGRRDSRGASLSGSNNNIPAPNNTFQTILTKFKLKKLDIVDLVALSGSHTIGNARCTSF  207

Query  866   VHRLY-----PTVDPTLDPTYADYLKLRCPSAEPDPRAVEPTYSRNDRRTPMILDNMYYK  1030
               RLY        D TLD +YA  L+ RCP +  D           D  +P   DN Y+K
Sbjct  208   RQRLYNQSGNGLADFTLDQSYAAQLRTRCPRSGGDQNLFVM-----DFVSPTKFDNSYFK  262

Query  1031  NILEHKGLLVVDELLATHPATAP-FVEKMAADNQYFHDQFARALVIMSENNPLTGDQGEI  1207
             N+L  KGLL  DE+L T    +   V++ A +N+ F +QFA+++V M   +P+TG +GEI
Sbjct  263   NLLAIKGLLNSDEVLVTKSQVSKQLVQQYAENNELFFEQFAKSMVKMGNISPITGSRGEI  322

Query  1208  RKNCRYVNT  1234
             RK+CR VN+
Sbjct  323   RKSCRKVNS  331



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3768748596378