BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18132_g3_i1 len=535 path=[4365:0-534]

Length=535
                                                                      Score     E

ref|XP_003635381.1|  PREDICTED: stress-associated endoplasmic ret...  54.3    5e-07   
ref|XP_010252730.1|  PREDICTED: stress-associated endoplasmic ret...  53.1    1e-06   
ref|XP_002307905.2|  hypothetical protein POPTR_0006s01810g           52.4    4e-06   Populus trichocarpa [western balsam poplar]
ref|XP_010236372.1|  PREDICTED: stress-associated endoplasmic ret...  51.6    5e-06   
ref|XP_008800612.1|  PREDICTED: stress-associated endoplasmic ret...  50.8    9e-06   
ref|XP_006415776.1|  hypothetical protein EUTSA_v10009274mg           50.8    9e-06   
gb|AAT38818.1|  membrane protein                                      50.8    1e-05   Brassica juncea [brown mustard]
ref|XP_006415774.1|  hypothetical protein EUTSA_v10009276mg           50.8    1e-05   
ref|XP_009396884.1|  PREDICTED: probable stress-associated endopl...  50.4    1e-05   
emb|CDX84931.1|  BnaC05g21240D                                        50.8    1e-05   
emb|CDY66149.1|  BnaAnng21710D                                        51.2    1e-05   
ref|XP_003524899.1|  PREDICTED: stress-associated endoplasmic ret...  50.1    2e-05   
gb|AFK48951.1|  unknown                                               50.1    2e-05   
gb|AFW60273.1|  hypothetical protein ZEAMMB73_043156                  50.4    2e-05   
ref|XP_011086815.1|  PREDICTED: probable stress-associated endopl...  49.7    3e-05   
gb|ABK96527.1|  unknown                                               49.7    3e-05   Populus trichocarpa x Populus deltoides
emb|CDX84929.1|  BnaC05g21260D                                        50.1    3e-05   
ref|XP_007223937.1|  hypothetical protein PRUPE_ppa014280mg           49.3    3e-05   
emb|CDY03912.1|  BnaC07g11370D                                        50.8    3e-05   
gb|AAQ09002.1|  hypothetical protein                                  49.3    3e-05   Phaseolus vulgaris [French bean]
ref|XP_007043980.1|  Ribosome associated membrane protein RAMP4       49.3    3e-05   
ref|XP_007158676.1|  hypothetical protein PHAVU_002G173100g           49.3    3e-05   
ref|XP_009394373.1|  PREDICTED: stress-associated endoplasmic ret...  49.3    4e-05   
ref|XP_002277156.1|  PREDICTED: stress-associated endoplasmic ret...  48.9    4e-05   Vitis vinifera
gb|ADB02897.1|  membrane protein                                      48.9    4e-05   
ref|XP_009372267.1|  PREDICTED: stress-associated endoplasmic ret...  48.9    4e-05   
ref|XP_006387613.1|  hypothetical protein POPTR_0777s00200g           48.9    4e-05   
ref|XP_009797098.1|  PREDICTED: stress-associated endoplasmic ret...  48.9    5e-05   
ref|XP_009626182.1|  PREDICTED: stress-associated endoplasmic ret...  48.9    5e-05   
ref|XP_009418158.1|  PREDICTED: probable stress-associated endopl...  48.5    6e-05   
emb|CDY15714.1|  BnaA07g08850D                                        48.9    6e-05   
ref|NP_564277.1|  ribosome associated membrane protein RAMP4          48.5    6e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010695368.1|  PREDICTED: probable stress-associated endopl...  48.5    7e-05   
ref|XP_004239223.1|  PREDICTED: stress-associated endoplasmic ret...  48.5    7e-05   
emb|CDY27609.1|  BnaA09g27980D                                        48.5    8e-05   
emb|CBI38439.3|  unnamed protein product                              50.8    8e-05   
ref|XP_006352178.1|  PREDICTED: stress-associated endoplasmic ret...  48.1    8e-05   
ref|XP_008389884.1|  PREDICTED: stress-associated endoplasmic ret...  48.1    8e-05   
gb|EYU33448.1|  hypothetical protein MIMGU_mgv11b017274mg             49.3    8e-05   
ref|XP_009411018.1|  PREDICTED: probable stress-associated endopl...  48.1    9e-05   
ref|XP_002514902.1|  stress associated endoplasmic reticulum prot...  48.1    9e-05   Ricinus communis
ref|XP_009343159.1|  PREDICTED: uncharacterized protein LOC103935127  49.7    9e-05   
ref|NP_001060113.1|  Os07g0583000                                     48.1    1e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010052950.1|  PREDICTED: probable stress-associated endopl...  47.8    1e-04   
ref|XP_002463089.1|  hypothetical protein SORBIDRAFT_02g037610        47.8    1e-04   Sorghum bicolor [broomcorn]
gb|ACG27218.1|  membrane protein                                      47.8    1e-04   Zea mays [maize]
ref|XP_010090636.1|  hypothetical protein L484_017436                 48.1    1e-04   
gb|KHN12384.1|  Stress-associated endoplasmic reticulum protein 2     48.1    1e-04   
ref|XP_010237508.1|  PREDICTED: stress-associated endoplasmic ret...  47.4    1e-04   
gb|ACG35007.1|  hypothetical protein                                  47.4    2e-04   Zea mays [maize]
tpg|DAA63332.1|  TPA: membrane protein                                48.1    2e-04   
ref|NP_001150243.1|  LOC100283873                                     47.4    2e-04   Zea mays [maize]
emb|CDY11821.1|  BnaC03g57570D                                        48.1    2e-04   
ref|XP_004310090.1|  PREDICTED: stress-associated endoplasmic ret...  47.4    2e-04   
ref|XP_004140593.1|  PREDICTED: stress-associated endoplasmic ret...  47.4    2e-04   
tpg|DAA63331.1|  TPA: hypothetical protein ZEAMMB73_928287            47.8    2e-04   
ref|XP_010250694.1|  PREDICTED: stress-associated endoplasmic ret...  47.4    2e-04   
gb|EEC82336.1|  hypothetical protein OsI_26633                        50.4    2e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_008353049.1|  PREDICTED: stress-associated endoplasmic ret...  47.0    2e-04   
ref|XP_008460008.1|  PREDICTED: stress-associated endoplasmic ret...  47.0    2e-04   
emb|CDY27607.1|  BnaA09g28000D                                        48.1    2e-04   
ref|XP_004958140.1|  PREDICTED: stress-associated endoplasmic ret...  47.0    2e-04   
emb|CDP13351.1|  unnamed protein product                              47.8    2e-04   
dbj|BAK03678.1|  predicted protein                                    47.0    2e-04   
ref|NP_001066879.1|  Os12g0514100                                     47.0    2e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004962894.1|  PREDICTED: stress-associated endoplasmic ret...  47.0    3e-04   
ref|XP_002443260.1|  hypothetical protein SORBIDRAFT_08g016540        46.6    3e-04   Sorghum bicolor [broomcorn]
gb|AFW74647.1|  membrane protein                                      46.6    3e-04   
gb|EEC68513.1|  hypothetical protein OsI_36788                        50.1    3e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_002451175.1|  hypothetical protein SORBIDRAFT_05g025380        46.6    4e-04   Sorghum bicolor [broomcorn]
ref|XP_004979802.1|  PREDICTED: stress-associated endoplasmic ret...  46.2    4e-04   
ref|NP_001152618.1|  LOC100286259                                     46.2    4e-04   Zea mays [maize]
ref|NP_001167775.1|  hypothetical protein                             47.0    5e-04   Zea mays [maize]
gb|KHG11523.1|  Serp2                                                 45.8    6e-04   
gb|AAF99731.1|AC004557_10  F17L21.12                                  46.2    6e-04   Arabidopsis thaliana [mouse-ear cress]
gb|EYU42087.1|  hypothetical protein MIMGU_mgv1a024060mg              45.4    6e-04   
ref|XP_007223936.1|  hypothetical protein PRUPE_ppa014280mg           45.8    6e-04   
gb|KCW86931.1|  hypothetical protein EUGRSUZ_B03504                   46.6    6e-04   
gb|ABK21006.1|  unknown                                               45.8    7e-04   Picea sitchensis
gb|AFK38169.1|  unknown                                               45.8    7e-04   
ref|XP_003576008.1|  PREDICTED: probable stress-associated endopl...  45.4    8e-04   
ref|XP_010044821.1|  PREDICTED: stress-associated endoplasmic ret...  45.4    8e-04   
ref|XP_006848257.1|  hypothetical protein AMTR_s00013p00052990        45.8    8e-04   



>ref|XP_003635381.1| PREDICTED: stress-associated endoplasmic reticulum protein 2-like 
isoform X1 [Vitis vinifera]
 ref|XP_003635382.1| PREDICTED: stress-associated endoplasmic reticulum protein 2-like 
isoform X2 [Vitis vinifera]
Length=68

 Score = 54.3 bits (129),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 50/66 (76%), Gaps = 3/66 (5%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNP-LSSRKGFE-PTR-iiiilfavlviaSFVFQVVR  339
            MTTSKRLADRK+AKF+KNITKRG  P  S++KG++ P   I++  F  +V+ S +FQ++R
Sbjct  1    MTTSKRLADRKVAKFQKNITKRGSVPETSTKKGYDYPVGPILLGFFVFVVVGSSLFQIIR  60

Query  340  LALSGG  357
             A SGG
Sbjct  61   TATSGG  66



>ref|XP_010252730.1| PREDICTED: stress-associated endoplasmic reticulum protein 2-like 
[Nelumbo nucifera]
Length=68

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 50/66 (76%), Gaps = 3/66 (5%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNPLSS-RKGFE-PTR-iiiilfavlviaSFVFQVVR  339
            MTTS+RLADRK+AKF+KNITKRG  P +S +KG++ P   I++  F  +VI S +FQ++R
Sbjct  1    MTTSRRLADRKVAKFQKNITKRGAVPETSVKKGYDYPVGPIVLGFFVFVVIGSSLFQIIR  60

Query  340  LALSGG  357
             A SGG
Sbjct  61   TATSGG  66



>ref|XP_002307905.2| hypothetical protein POPTR_0006s01810g, partial [Populus trichocarpa]
 gb|EEE91428.2| hypothetical protein POPTR_0006s01810g, partial [Populus trichocarpa]
Length=102

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 53/73 (73%), Gaps = 4/73 (5%)
 Frame = +1

Query  148  HTETKAKMTTSKRLADRKIAKFEKNITKRGLNP-LSSRKGFE-PTR-iiiilfavlviaS  318
            H ETK  MTTSKRL++RK+AKF KNITKRG  P  S++KG++ P   I++  F  +VI S
Sbjct  29   HRETKT-MTTSKRLSERKVAKFHKNITKRGSVPETSTKKGYDYPVGPILLGFFVFVVIGS  87

Query  319  FVFQVVRLALSGG  357
             +FQ++R A SGG
Sbjct  88   SLFQIIRTASSGG  100



>ref|XP_010236372.1| PREDICTED: stress-associated endoplasmic reticulum protein 2-like 
[Brachypodium distachyon]
Length=67

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 47/65 (72%), Gaps = 2/65 (3%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNPLSSRKG--FEPTRiiiilfavlviaSFVFQVVRL  342
            MTTS+R+ADRKIA+F+KNITKRG  P + +KG  +    I++  F  +V+ S +FQ++R 
Sbjct  1    MTTSRRVADRKIARFDKNITKRGSVPETVKKGNDYPVGPIVLGFFVFVVVGSSLFQIIRT  60

Query  343  ALSGG  357
            A SGG
Sbjct  61   ASSGG  65



>ref|XP_008800612.1| PREDICTED: stress-associated endoplasmic reticulum protein 2-like 
[Phoenix dactylifera]
Length=68

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 48/66 (73%), Gaps = 3/66 (5%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNPLSS-RKG--FEPTRiiiilfavlviaSFVFQVVR  339
            MTTS+RLADRKIAKF+KNITKRG  P ++ +KG  +    I++  F  +VI S +FQ++R
Sbjct  1    MTTSRRLADRKIAKFQKNITKRGSVPETAVKKGNDYPVGPIVLGFFVFVVIGSSIFQIIR  60

Query  340  LALSGG  357
             A SGG
Sbjct  61   TATSGG  66



>ref|XP_006415776.1| hypothetical protein EUTSA_v10009274mg [Eutrema salsugineum]
 ref|XP_009102988.1| PREDICTED: stress-associated endoplasmic reticulum protein 2 
[Brassica rapa]
 ref|XP_009109822.1| PREDICTED: stress-associated endoplasmic reticulum protein 2-like 
[Brassica rapa]
 ref|XP_009113776.1| PREDICTED: stress-associated endoplasmic reticulum protein 2-like 
[Brassica rapa]
 ref|XP_009113778.1| PREDICTED: stress-associated endoplasmic reticulum protein 2-like 
[Brassica rapa]
 gb|ESQ34129.1| hypothetical protein EUTSA_v10009274mg [Eutrema salsugineum]
 gb|KFK34890.1| hypothetical protein AALP_AA5G206800 [Arabis alpina]
Length=68

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 47/66 (71%), Gaps = 3/66 (5%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNP-LSSRKG--FEPTRiiiilfavlviaSFVFQVVR  339
            MTTSKRLADRKI KF+KNITKRG  P  +++KG  +    I++  F  +VI S +FQ++R
Sbjct  1    MTTSKRLADRKIEKFDKNITKRGFVPETTTKKGKDYPVGPILLGFFVFVVIGSSLFQIIR  60

Query  340  LALSGG  357
             A SGG
Sbjct  61   TATSGG  66



>gb|AAT38818.1| membrane protein [Brassica juncea]
 gb|ADM86710.1| putative RAMP4 family protein [Brassica juncea]
Length=68

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 47/66 (71%), Gaps = 3/66 (5%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNP-LSSRKG--FEPTRiiiilfavlviaSFVFQVVR  339
            MTTSKRLADRKI KF+KNITKRG  P  +++KG  +    I++  F  +VI S +FQ++R
Sbjct  1    MTTSKRLADRKIEKFDKNITKRGFVPETTTKKGKDYPVGPILLGFFVFVVIGSSLFQIIR  60

Query  340  LALSGG  357
             A SGG
Sbjct  61   TATSGG  66



>ref|XP_006415774.1| hypothetical protein EUTSA_v10009276mg [Eutrema salsugineum]
 gb|ESQ34127.1| hypothetical protein EUTSA_v10009276mg [Eutrema salsugineum]
Length=68

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 47/66 (71%), Gaps = 3/66 (5%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNP-LSSRKG--FEPTRiiiilfavlviaSFVFQVVR  339
            MTTSKRLADRKI KF+KNITKRG  P  +++KG  +    I++  F  +VI S +FQ++R
Sbjct  1    MTTSKRLADRKIEKFDKNITKRGFVPETTTKKGKDYPVGPILLGFFIFVVIGSSLFQIIR  60

Query  340  LALSGG  357
             A SGG
Sbjct  61   TATSGG  66



>ref|XP_009396884.1| PREDICTED: probable stress-associated endoplasmic reticulum protein 
[Musa acuminata subsp. malaccensis]
Length=68

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 49/66 (74%), Gaps = 3/66 (5%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNP-LSSRKG--FEPTRiiiilfavlviaSFVFQVVR  339
            MTTS+RLADRKIAKF+KN+TKRG  P  +++KG  +    I++  F  +V+ S +FQ++R
Sbjct  1    MTTSRRLADRKIAKFQKNVTKRGSVPEKTAKKGDNYPVGPILLGFFIFVVVGSSLFQIIR  60

Query  340  LALSGG  357
             A+SGG
Sbjct  61   TAMSGG  66



>emb|CDX84931.1| BnaC05g21240D [Brassica napus]
Length=101

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 47/66 (71%), Gaps = 3/66 (5%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNP-LSSRKG--FEPTRiiiilfavlviaSFVFQVVR  339
            MTTSKRLADRKI KF+KNITKRG  P  +++KG  +    I++  F  +VI S +FQ++R
Sbjct  34   MTTSKRLADRKIEKFDKNITKRGFVPETTTKKGKDYPVGPILLGFFVFVVIGSSLFQIIR  93

Query  340  LALSGG  357
             A SGG
Sbjct  94   TATSGG  99



>emb|CDY66149.1| BnaAnng21710D [Brassica napus]
Length=115

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 47/66 (71%), Gaps = 3/66 (5%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNP-LSSRKG--FEPTRiiiilfavlviaSFVFQVVR  339
            MTTSKRLADRKI KF+KNITKRG  P  +++KG  +    I++  F  +VI S +FQ++R
Sbjct  48   MTTSKRLADRKIEKFDKNITKRGFVPETTTKKGKDYPVGPILLGFFVFVVIGSSLFQIIR  107

Query  340  LALSGG  357
             A SGG
Sbjct  108  TATSGG  113



>ref|XP_003524899.1| PREDICTED: stress-associated endoplasmic reticulum protein 2-like 
[Glycine max]
 ref|XP_003531200.1| PREDICTED: stress-associated endoplasmic reticulum protein 2 
[Glycine max]
 gb|ACU16910.1| unknown [Glycine max]
 gb|ACU24191.1| unknown [Glycine max]
 gb|KHN34824.1| Stress-associated endoplasmic reticulum protein 2 [Glycine soja]
Length=68

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 47/66 (71%), Gaps = 3/66 (5%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNP-LSSRKG--FEPTRiiiilfavlviaSFVFQVVR  339
            MTTS+RLADRK+ KFEKNITKRG  P  +++KG  +    +++  F  +VI S +FQ++R
Sbjct  1    MTTSRRLADRKVEKFEKNITKRGFVPDTTTKKGKDYPVGPVLLGFFVFVVIGSSLFQIIR  60

Query  340  LALSGG  357
             A SGG
Sbjct  61   TATSGG  66



>gb|AFK48951.1| unknown [Lotus japonicus]
Length=68

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 47/66 (71%), Gaps = 3/66 (5%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNP-LSSRKG--FEPTRiiiilfavlviaSFVFQVVR  339
            MTTS+RLADRK+ KFEKNITKRG  P  +++KG  +    +++  F  +VI S +FQ++R
Sbjct  1    MTTSRRLADRKVEKFEKNITKRGFVPETTAKKGKDYPVGPVLLGFFVFVVIGSSLFQIIR  60

Query  340  LALSGG  357
             A SGG
Sbjct  61   TATSGG  66



>gb|AFW60273.1| hypothetical protein ZEAMMB73_043156, partial [Zea mays]
Length=113

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 46/68 (68%), Gaps = 5/68 (7%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNPLSSRK-----GFEPTRiiiilfavlviaSFVFQV  333
            MTTS+RLADRK AKF+KNIT+RG  P ++ K     G+    +++  F  +VI S +FQ+
Sbjct  44   MTTSRRLADRKTAKFQKNITRRGSVPETAVKKGKGNGYAAGPVVLGFFVFVVIGSSLFQI  103

Query  334  VRLALSGG  357
            +R A SGG
Sbjct  104  IRTATSGG  111



>ref|XP_011086815.1| PREDICTED: probable stress-associated endoplasmic reticulum protein 
[Sesamum indicum]
Length=68

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 46/66 (70%), Gaps = 3/66 (5%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNP-LSSRKG--FEPTRiiiilfavlviaSFVFQVVR  339
            MTTS+RLADRK+ KFEKNITKRG  P  S++KG       I++  F  +VI S +FQ++R
Sbjct  1    MTTSRRLADRKVQKFEKNITKRGAVPETSTKKGNNLSVGPILLGFFIFVVIGSSLFQIIR  60

Query  340  LALSGG  357
             A SGG
Sbjct  61   TATSGG  66



>gb|ABK96527.1| unknown [Populus trichocarpa x Populus deltoides]
Length=68

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 49/66 (74%), Gaps = 3/66 (5%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNP-LSSRKGFE-PTR-iiiilfavlviaSFVFQVVR  339
            MTTSKRL++RK+AKF KNITKRG  P  S++KG++ P   I++  F  +VI S +FQ++R
Sbjct  1    MTTSKRLSERKVAKFHKNITKRGSVPETSTKKGYDYPVGPILLGFFVFVVIGSSLFQIIR  60

Query  340  LALSGG  357
             A SGG
Sbjct  61   TASSGG  66



>emb|CDX84929.1| BnaC05g21260D [Brassica napus]
Length=105

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 47/66 (71%), Gaps = 3/66 (5%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNP-LSSRKG--FEPTRiiiilfavlviaSFVFQVVR  339
            MTTSKRLADRKI KF+KNITKRG  P  +++KG  +    I++  F  +VI S +FQ++R
Sbjct  38   MTTSKRLADRKIEKFDKNITKRGFVPETTTKKGKDYPVGPILLGFFVFVVIGSSLFQIIR  97

Query  340  LALSGG  357
             A SGG
Sbjct  98   TATSGG  103



>ref|XP_007223937.1| hypothetical protein PRUPE_ppa014280mg [Prunus persica]
 ref|XP_008222180.1| PREDICTED: stress-associated endoplasmic reticulum protein 2 
[Prunus mume]
 gb|EMJ25136.1| hypothetical protein PRUPE_ppa014280mg [Prunus persica]
Length=68

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 47/66 (71%), Gaps = 3/66 (5%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNP-LSSRKG--FEPTRiiiilfavlviaSFVFQVVR  339
            MTTS+RLADRK+ KFEKNITKRG  P  +++KG  +    I++  F  +VI S +FQ++R
Sbjct  1    MTTSRRLADRKVEKFEKNITKRGAVPETTAKKGKDYPVGPILLGFFVFVVIGSSLFQIIR  60

Query  340  LALSGG  357
             A SGG
Sbjct  61   TATSGG  66



>emb|CDY03912.1| BnaC07g11370D [Brassica napus]
Length=143

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 47/66 (71%), Gaps = 3/66 (5%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNP-LSSRKG--FEPTRiiiilfavlviaSFVFQVVR  339
            MTTSKRLADRKI KF+KNITKRG  P  +++KG  +    I++  F  +VI S +FQ++R
Sbjct  76   MTTSKRLADRKIEKFDKNITKRGFVPETTTKKGKDYPVGPILLGFFVFVVIGSSLFQIIR  135

Query  340  LALSGG  357
             A SGG
Sbjct  136  TATSGG  141



>gb|AAQ09002.1| hypothetical protein [Phaseolus vulgaris]
Length=68

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 46/66 (70%), Gaps = 3/66 (5%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNP-LSSRKG--FEPTRiiiilfavlviaSFVFQVVR  339
            MTTS+R ADRK+ KFEKNITKRG  P  +S+KG  +    +++  F  +VI S +FQ++R
Sbjct  1    MTTSRRFADRKVEKFEKNITKRGFVPDTTSKKGKDYPVGPLLLGFFVFVVIGSSLFQIIR  60

Query  340  LALSGG  357
             A SGG
Sbjct  61   TATSGG  66



>ref|XP_007043980.1| Ribosome associated membrane protein RAMP4 [Theobroma cacao]
 gb|EOX99811.1| Ribosome associated membrane protein RAMP4 [Theobroma cacao]
Length=68

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 47/66 (71%), Gaps = 3/66 (5%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNP-LSSRKG--FEPTRiiiilfavlviaSFVFQVVR  339
            MTTS+RLADRK+ KFEKNITKRG  P  +++KG  +    +++  F  +VI S +FQ++R
Sbjct  1    MTTSRRLADRKVEKFEKNITKRGTVPETTTKKGKDYPVGPLLLGFFIFVVIGSSLFQIIR  60

Query  340  LALSGG  357
             A SGG
Sbjct  61   TATSGG  66



>ref|XP_007158676.1| hypothetical protein PHAVU_002G173100g [Phaseolus vulgaris]
 gb|ESW30670.1| hypothetical protein PHAVU_002G173100g [Phaseolus vulgaris]
Length=68

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 46/66 (70%), Gaps = 3/66 (5%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNP-LSSRKG--FEPTRiiiilfavlviaSFVFQVVR  339
            MTTS+R ADRK+ KFEKNITKRG  P  +S+KG  +    +++  F  +VI S +FQ++R
Sbjct  1    MTTSRRFADRKVEKFEKNITKRGFVPDTTSKKGKDYPIGPLLLGFFVFVVIGSSLFQIIR  60

Query  340  LALSGG  357
             A SGG
Sbjct  61   TATSGG  66



>ref|XP_009394373.1| PREDICTED: stress-associated endoplasmic reticulum protein 2-like 
[Musa acuminata subsp. malaccensis]
Length=68

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 47/66 (71%), Gaps = 3/66 (5%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNPLSS-RKG--FEPTRiiiilfavlviaSFVFQVVR  339
            MTTS+RLADRKI KF+KNITKRG  P ++ +KG  +    +++  F  +VI S +FQ++R
Sbjct  1    MTTSRRLADRKIQKFQKNITKRGSVPETTVKKGNDYPVGPVVLGFFVFVVIGSSLFQIIR  60

Query  340  LALSGG  357
             A SGG
Sbjct  61   TATSGG  66



>ref|XP_002277156.1| PREDICTED: stress-associated endoplasmic reticulum protein 2-like 
[Vitis vinifera]
Length=68

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 47/66 (71%), Gaps = 3/66 (5%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNP-LSSRKG--FEPTRiiiilfavlviaSFVFQVVR  339
            MTTS+RLADRK+ KFEKNITKRG  P  +++KG  +    +++  F  +VI S +FQ++R
Sbjct  1    MTTSRRLADRKVEKFEKNITKRGSVPETTTKKGSDYPVGPVLLGFFVFVVIGSSLFQIIR  60

Query  340  LALSGG  357
             A SGG
Sbjct  61   TATSGG  66



>gb|ADB02897.1| membrane protein [Jatropha curcas]
 gb|KDP26816.1| hypothetical protein JCGZ_17974 [Jatropha curcas]
Length=68

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 45/66 (68%), Gaps = 3/66 (5%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNPLSSR---KGFEPTRiiiilfavlviaSFVFQVVR  339
            MTTS+RLADRK+ KFEKNITKRG  P ++    K +    +++  F  +VI S +FQ++R
Sbjct  1    MTTSRRLADRKVEKFEKNITKRGAVPETTTKKAKDYPVGPVLLGFFIFVVIGSSLFQIIR  60

Query  340  LALSGG  357
             A SGG
Sbjct  61   TATSGG  66



>ref|XP_009372267.1| PREDICTED: stress-associated endoplasmic reticulum protein 2 
[Pyrus x bretschneideri]
Length=68

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 45/66 (68%), Gaps = 3/66 (5%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNPLSS---RKGFEPTRiiiilfavlviaSFVFQVVR  339
            MTTS+RLADRK+ KFEKNITKRG  P ++    K +    I++  F  +VI S +FQ++R
Sbjct  1    MTTSRRLADRKVEKFEKNITKRGAVPETTAKKAKDYPVGPILLGFFIFVVIGSSLFQIIR  60

Query  340  LALSGG  357
             A SGG
Sbjct  61   TATSGG  66



>ref|XP_006387613.1| hypothetical protein POPTR_0777s00200g, partial [Populus trichocarpa]
 gb|ERP46527.1| hypothetical protein POPTR_0777s00200g, partial [Populus trichocarpa]
Length=67

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 49/65 (75%), Gaps = 3/65 (5%)
 Frame = +1

Query  172  TTSKRLADRKIAKFEKNITKRG-LNPLSSRKGFE-PTR-iiiilfavlviaSFVFQVVRL  342
            TTSKRL++RK+AKF+KNIT+RG ++  S++KG++ P   +++     +VI SF FQ++R 
Sbjct  1    TTSKRLSERKVAKFQKNITRRGSVHETSTKKGYDYPVGPVLLGFLVFVVIGSFPFQIIRA  60

Query  343  ALSGG  357
            A SGG
Sbjct  61   ATSGG  65



>ref|XP_009797098.1| PREDICTED: stress-associated endoplasmic reticulum protein 2-like 
[Nicotiana sylvestris]
Length=68

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 47/66 (71%), Gaps = 3/66 (5%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNP-LSSRKG--FEPTRiiiilfavlviaSFVFQVVR  339
            MTTS+RLADRKI +FEKNITKRG  P  +++KG  +    I++  F  +VI S +FQ++R
Sbjct  1    MTTSRRLADRKIERFEKNITKRGAVPETTAKKGNQYPVGPILLGFFVFVVIGSSLFQIIR  60

Query  340  LALSGG  357
             A SGG
Sbjct  61   TATSGG  66



>ref|XP_009626182.1| PREDICTED: stress-associated endoplasmic reticulum protein 2-like 
[Nicotiana tomentosiformis]
Length=68

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 47/66 (71%), Gaps = 3/66 (5%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNP-LSSRKG--FEPTRiiiilfavlviaSFVFQVVR  339
            MTTS+RLADRKI +FEKNITKRG  P  +++KG  +    I++  F  +VI S +FQ++R
Sbjct  1    MTTSRRLADRKIERFEKNITKRGAVPETTAKKGNQYPVGPILLGFFVFVVIGSSLFQIIR  60

Query  340  LALSGG  357
             A SGG
Sbjct  61   TATSGG  66



>ref|XP_009418158.1| PREDICTED: probable stress-associated endoplasmic reticulum protein 
[Musa acuminata subsp. malaccensis]
Length=68

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 49/66 (74%), Gaps = 3/66 (5%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRG-LNPLSSRKG--FEPTRiiiilfavlviaSFVFQVVR  339
            MTTS+RLADRK+AKF+KNITKRG ++  +++KG  +    I++  F  +VI S +FQ++R
Sbjct  1    MTTSRRLADRKVAKFQKNITKRGSVSESTAKKGNDYPVGPIVLGFFIFVVIGSSLFQIIR  60

Query  340  LALSGG  357
             A SGG
Sbjct  61   TATSGG  66



>emb|CDY15714.1| BnaA07g08850D [Brassica napus]
Length=80

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 47/66 (71%), Gaps = 3/66 (5%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNP-LSSRKG--FEPTRiiiilfavlviaSFVFQVVR  339
            +TTSKRLADRKI KF+KNITKRG  P  +++KG  +    I++  F  +VI S +FQ++R
Sbjct  13   VTTSKRLADRKIEKFDKNITKRGFVPETTTKKGKDYPVGPILLGFFVFVVIGSSLFQIIR  72

Query  340  LALSGG  357
             A SGG
Sbjct  73   TATSGG  78



>ref|NP_564277.1| ribosome associated membrane protein RAMP4 [Arabidopsis thaliana]
 ref|NP_564279.1| ribosome associated membrane protein RAMP4 [Arabidopsis thaliana]
 ref|XP_002890722.1| hypothetical protein ARALYDRAFT_472929 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_002893461.1| hypothetical protein ARALYDRAFT_472931 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_006303492.1| hypothetical protein CARUB_v10010819mg [Capsella rubella]
 gb|AAO22732.1| unknown protein [Arabidopsis thaliana]
 gb|AAO42345.1| unknown protein [Arabidopsis thaliana]
 gb|AAO42817.1| At1g27330 [Arabidopsis thaliana]
 dbj|BAE99499.1| hypothetical protein [Arabidopsis thaliana]
 gb|EFH66981.1| hypothetical protein ARALYDRAFT_472929 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69720.1| hypothetical protein ARALYDRAFT_472931 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEE30807.1| ribosome associated membrane protein RAMP4 [Arabidopsis thaliana]
 gb|AEE30809.1| ribosome associated membrane protein RAMP4 [Arabidopsis thaliana]
 gb|EOA36390.1| hypothetical protein CARUB_v10010819mg [Capsella rubella]
Length=68

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 46/66 (70%), Gaps = 3/66 (5%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNP-LSSRKG--FEPTRiiiilfavlviaSFVFQVVR  339
            MTTSKRLADRKI KF+KNI KRG  P  +++KG  +    I++  F  +VI S +FQ++R
Sbjct  1    MTTSKRLADRKIEKFDKNILKRGFVPETTTKKGKDYPVGPILLGFFVFVVIGSSLFQIIR  60

Query  340  LALSGG  357
             A SGG
Sbjct  61   TATSGG  66



>ref|XP_010695368.1| PREDICTED: probable stress-associated endoplasmic reticulum protein 
[Beta vulgaris subsp. vulgaris]
Length=67

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 45/65 (69%), Gaps = 2/65 (3%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNPLSSRKG--FEPTRiiiilfavlviaSFVFQVVRL  342
            MTTS+RLADRK+ KFEKN+ KRGL   + +KG  +    +++  F  +VI S +FQ++R 
Sbjct  1    MTTSRRLADRKVEKFEKNVKKRGLVESAPKKGNSYPVGPVLLGFFVFVVIGSSLFQIIRT  60

Query  343  ALSGG  357
            A SGG
Sbjct  61   ATSGG  65



>ref|XP_004239223.1| PREDICTED: stress-associated endoplasmic reticulum protein 2 
[Solanum lycopersicum]
Length=68

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 47/66 (71%), Gaps = 3/66 (5%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNP-LSSRKG--FEPTRiiiilfavlviaSFVFQVVR  339
            MTTS+RLADRK+ +FEKNITKRG  P  +++KG  +    I++  F  +VI S +FQ++R
Sbjct  1    MTTSRRLADRKVERFEKNITKRGAVPETTAKKGSQYPVGPILLGFFVFVVIGSSLFQIIR  60

Query  340  LALSGG  357
             A SGG
Sbjct  61   TATSGG  66



>emb|CDY27609.1| BnaA09g27980D [Brassica napus]
Length=81

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 46/65 (71%), Gaps = 3/65 (5%)
 Frame = +1

Query  172  TTSKRLADRKIAKFEKNITKRGLNP-LSSRKG--FEPTRiiiilfavlviaSFVFQVVRL  342
            TTSKRLADRKI KF+KNITKRG  P  +++KG  +    I++  F  +VI S +FQ++R 
Sbjct  15   TTSKRLADRKIEKFDKNITKRGFVPETTTKKGKDYPVGPILLGFFVFVVIGSSLFQIIRT  74

Query  343  ALSGG  357
            A SGG
Sbjct  75   ATSGG  79



>emb|CBI38439.3| unnamed protein product [Vitis vinifera]
Length=219

 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 1/35 (3%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNP-LSSRKGFE  270
            MTTSKRLADRK+AKF+KNITKRG  P  S++KG++
Sbjct  101  MTTSKRLADRKVAKFQKNITKRGSVPETSTKKGYD  135



>ref|XP_006352178.1| PREDICTED: stress-associated endoplasmic reticulum protein 2-like 
[Solanum tuberosum]
Length=69

 Score = 48.1 bits (113),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 47/66 (71%), Gaps = 3/66 (5%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNP-LSSRKG--FEPTRiiiilfavlviaSFVFQVVR  339
            MTTS+RLADRK+ +FEKNITKRG  P  +++KG  +    I++  F  +VI S +FQ++R
Sbjct  1    MTTSRRLADRKVERFEKNITKRGAVPETTAKKGSQYPVGPILLGFFVFVVIGSSLFQIIR  60

Query  340  LALSGG  357
             A SGG
Sbjct  61   TATSGG  66



>ref|XP_008389884.1| PREDICTED: stress-associated endoplasmic reticulum protein 2-like 
[Malus domestica]
Length=68

 Score = 48.1 bits (113),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 47/66 (71%), Gaps = 3/66 (5%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNP-LSSRKG--FEPTRiiiilfavlviaSFVFQVVR  339
            MTTS+RLADRK+ +FEKNITKRG  P  +++KG  +    I++  F  +VI S +FQ++R
Sbjct  1    MTTSRRLADRKVERFEKNITKRGAVPETTAKKGKDYPVGPILLGFFVFVVIGSSLFQIIR  60

Query  340  LALSGG  357
             A SGG
Sbjct  61   TATSGG  66



>gb|EYU33448.1| hypothetical protein MIMGU_mgv11b017274mg, partial [Erythranthe 
guttata]
Length=139

 Score = 49.3 bits (116),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 52/77 (68%), Gaps = 4/77 (5%)
 Frame = +1

Query  139  FRFHTE-TKAKMTTSKRLADRKIAKFEKNITKRGLNP-LSSRKG--FEPTRiiiilfavl  306
            FR HT   K + TTS+RLADRK+ +FEKNITKRG  P  +++KG  F    +++  F  +
Sbjct  61   FRKHTPFQKQEETTSRRLADRKVERFEKNITKRGAVPETTTKKGNDFPVGPVLLGFFIFV  120

Query  307  viaSFVFQVVRLALSGG  357
            VI S +FQ++R A SGG
Sbjct  121  VIGSSLFQIIRTATSGG  137



>ref|XP_009411018.1| PREDICTED: probable stress-associated endoplasmic reticulum protein 
[Musa acuminata subsp. malaccensis]
Length=68

 Score = 48.1 bits (113),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 45/66 (68%), Gaps = 3/66 (5%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNPLSSRK---GFEPTRiiiilfavlviaSFVFQVVR  339
            MTTS+RLADRK  KF+KNITKRG  P ++ K   G+    +++  F  +VI S +FQ++R
Sbjct  1    MTTSRRLADRKTEKFQKNITKRGSVPETTVKKGNGYPVGPVVLGFFIFVVIGSSLFQIIR  60

Query  340  LALSGG  357
             A SGG
Sbjct  61   TATSGG  66



>ref|XP_002514902.1| stress associated endoplasmic reticulum protein, putative [Ricinus 
communis]
 gb|EEF47456.1| stress associated endoplasmic reticulum protein, putative [Ricinus 
communis]
Length=68

 Score = 48.1 bits (113),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 47/66 (71%), Gaps = 3/66 (5%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNP-LSSRKG--FEPTRiiiilfavlviaSFVFQVVR  339
            MTTS+RLADRK+ +FEKNITKRG  P  +++KG  +    +++  F  +VI S +FQ++R
Sbjct  1    MTTSRRLADRKVERFEKNITKRGTVPETTTKKGKDYPVGPLLLGFFIFVVIGSSLFQIIR  60

Query  340  LALSGG  357
             A SGG
Sbjct  61   TATSGG  66



>ref|XP_009343159.1| PREDICTED: uncharacterized protein LOC103935127, partial [Pyrus 
x bretschneideri]
Length=150

 Score = 49.7 bits (117),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 47/70 (67%), Gaps = 3/70 (4%)
 Frame = +1

Query  157  TKAKMTTSKRLADRKIAKFEKNITKRGLNPLSS---RKGFEPTRiiiilfavlviaSFVF  327
            T A MTTS+RLADRK+ +FEKNITKRG  P ++    K +    I++  F  +VI S +F
Sbjct  79   TPATMTTSRRLADRKVERFEKNITKRGAVPETTAKKSKDYPVGPILLGFFVFVVIGSSLF  138

Query  328  QVVRLALSGG  357
            Q++R A SGG
Sbjct  139  QIIRTATSGG  148



>ref|NP_001060113.1| Os07g0583000 [Oryza sativa Japonica Group]
 dbj|BAC55602.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD30501.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF22027.1| Os07g0583000 [Oryza sativa Japonica Group]
Length=67

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 46/65 (71%), Gaps = 2/65 (3%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNPLSSRKG--FEPTRiiiilfavlviaSFVFQVVRL  342
            MTTS+RL+DRK+A+FEKN+TKRG  P + +KG  +    I++  F  +V+ S +FQ++R 
Sbjct  1    MTTSRRLSDRKVARFEKNVTKRGSVPETVKKGNDYPVGPIVLGFFVFVVVGSSLFQIIRT  60

Query  343  ALSGG  357
            A + G
Sbjct  61   AQNAG  65



>ref|XP_010052950.1| PREDICTED: probable stress-associated endoplasmic reticulum protein 
[Eucalyptus grandis]
 gb|KCW77103.1| hypothetical protein EUGRSUZ_D01442 [Eucalyptus grandis]
Length=68

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 48/66 (73%), Gaps = 3/66 (5%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNP-LSSRKGFE-PT-RiiiilfavlviaSFVFQVVR  339
            MTTSKR A+RK+AKF+KNIT+RG  P  SS+KG + P  RI++  F  +V+ S +FQ++R
Sbjct  1    MTTSKRFAERKVAKFQKNITRRGSVPETSSKKGNDLPVGRIVLGFFVFVVVGSSLFQIIR  60

Query  340  LALSGG  357
             A S G
Sbjct  61   TATSKG  66



>ref|XP_002463089.1| hypothetical protein SORBIDRAFT_02g037610 [Sorghum bicolor]
 gb|EER99610.1| hypothetical protein SORBIDRAFT_02g037610 [Sorghum bicolor]
Length=67

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNPLSSRKG  264
            MTTS+RLADRKIA+FEKNITKRG  P + +K 
Sbjct  1    MTTSRRLADRKIARFEKNITKRGSVPETVKKA  32



>gb|ACG27218.1| membrane protein [Zea mays]
 gb|ACG47320.1| membrane protein [Zea mays]
Length=67

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNPLSSRKG  264
            MTTS+RLADRKIA+FEKNITKRG  P + +K 
Sbjct  1    MTTSRRLADRKIARFEKNITKRGSVPETVKKA  32



>ref|XP_010090636.1| hypothetical protein L484_017436 [Morus notabilis]
 gb|EXB40300.1| hypothetical protein L484_017436 [Morus notabilis]
Length=104

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 48/68 (71%), Gaps = 3/68 (4%)
 Frame = +1

Query  163  AKMTTSKRLADRKIAKFEKNITKRG-LNPLSSRKG--FEPTRiiiilfavlviaSFVFQV  333
            A MTTS+RLADRK+ +FEKNITKRG +   S++KG  +    +I+  F  +VI S +FQ+
Sbjct  35   ATMTTSRRLADRKVERFEKNITKRGAVAETSTKKGKDYPVGPLILGFFIFVVIGSSLFQI  94

Query  334  VRLALSGG  357
            +R A SGG
Sbjct  95   IRTATSGG  102



>gb|KHN12384.1| Stress-associated endoplasmic reticulum protein 2 [Glycine soja]
Length=100

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 47/66 (71%), Gaps = 3/66 (5%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNP-LSSRKG--FEPTRiiiilfavlviaSFVFQVVR  339
            +TTS+RLADRK+ KFEKNITKRG  P  +++KG  +    +++  F  +VI S +FQ++R
Sbjct  33   VTTSRRLADRKVEKFEKNITKRGFVPDTTTKKGKDYPVGPVLLGFFVFVVIGSSLFQIIR  92

Query  340  LALSGG  357
             A SGG
Sbjct  93   TATSGG  98



>ref|XP_010237508.1| PREDICTED: stress-associated endoplasmic reticulum protein 2-like 
[Brachypodium distachyon]
Length=68

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 47/66 (71%), Gaps = 3/66 (5%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNPLSS-RKG--FEPTRiiiilfavlviaSFVFQVVR  339
            MTTS+RLADRK AKF+KNITKRG  P ++ +KG  +    I++  F  +VI S +FQ++R
Sbjct  1    MTTSRRLADRKTAKFQKNITKRGSVPETTVKKGNDYPVGPIVLGFFIFVVIGSSLFQIIR  60

Query  340  LALSGG  357
             A SGG
Sbjct  61   TATSGG  66



>gb|ACG35007.1| hypothetical protein [Zea mays]
Length=58

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNPLSSRKG  264
            MTTS+RLADRKIA+FEKNITKRG  P + +K 
Sbjct  1    MTTSRRLADRKIARFEKNITKRGSVPETVKKA  32



>tpg|DAA63332.1| TPA: membrane protein, partial [Zea mays]
Length=118

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNPLSSRKG  264
            MTTS+RLADRKIA+FEKNITKRG  P + +K 
Sbjct  52   MTTSRRLADRKIARFEKNITKRGSVPETVKKA  83



>ref|NP_001150243.1| LOC100283873 [Zea mays]
 gb|ACG38351.1| membrane protein [Zea mays]
 gb|ACN29199.1| unknown [Zea mays]
 tpg|DAA41239.1| TPA: hypothetical protein ZEAMMB73_376301 [Zea mays]
Length=67

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNPLSSRKG  264
            MTTS+RLADRKI++FEKNITKRG  P +++K 
Sbjct  1    MTTSRRLADRKISRFEKNITKRGSVPETAKKA  32



>emb|CDY11821.1| BnaC03g57570D [Brassica napus]
Length=122

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 46/65 (71%), Gaps = 3/65 (5%)
 Frame = +1

Query  172  TTSKRLADRKIAKFEKNITKRGLNP-LSSRKG--FEPTRiiiilfavlviaSFVFQVVRL  342
            TTSKRLADRKI KF+KNITKRG  P  +++KG  +    I++  F  +VI S +FQ++R 
Sbjct  56   TTSKRLADRKIEKFDKNITKRGFVPETTTKKGKDYPVGPILLGFFVFVVIGSSLFQIIRT  115

Query  343  ALSGG  357
            A SGG
Sbjct  116  ATSGG  120



>ref|XP_004310090.1| PREDICTED: stress-associated endoplasmic reticulum protein 2-like 
isoform 2 [Fragaria vesca subsp. vesca]
Length=68

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 47/66 (71%), Gaps = 3/66 (5%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNP-LSSRKG--FEPTRiiiilfavlviaSFVFQVVR  339
            MTTS+RLADRK+ +FEKNITKRG  P  +++KG  +    I++  F  +VI S +FQ++R
Sbjct  1    MTTSRRLADRKVERFEKNITKRGAVPETTAKKGKDYPVGPILLGFFIFVVIGSSLFQIIR  60

Query  340  LALSGG  357
             A +GG
Sbjct  61   TATTGG  66



>ref|XP_004140593.1| PREDICTED: stress-associated endoplasmic reticulum protein 2-like 
[Cucumis sativus]
 ref|XP_004167911.1| PREDICTED: stress-associated endoplasmic reticulum protein 2-like 
[Cucumis sativus]
 gb|KGN46342.1| Stress associated endoplasmic reticulum protein [Cucumis sativus]
Length=68

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 47/66 (71%), Gaps = 3/66 (5%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNPLSS-RKGFE-PTR-iiiilfavlviaSFVFQVVR  339
            MTTS+RLADRK+ KFE+NITKRG  P +S +KG E P   +++  F  +VI S +FQ++R
Sbjct  1    MTTSRRLADRKVGKFERNITKRGSVPETSVKKGKEYPVGPLLLGFFVFVVIGSSLFQIIR  60

Query  340  LALSGG  357
             A  GG
Sbjct  61   TATGGG  66



>tpg|DAA63331.1| TPA: hypothetical protein ZEAMMB73_928287, partial [Zea mays]
Length=109

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNPLSSRKG  264
            MTTS+RLADRKIA+FEKNITKRG  P + +K 
Sbjct  52   MTTSRRLADRKIARFEKNITKRGSVPETVKKA  83



>ref|XP_010250694.1| PREDICTED: stress-associated endoplasmic reticulum protein 2-like 
[Nelumbo nucifera]
Length=68

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 47/66 (71%), Gaps = 3/66 (5%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNP-LSSRKG--FEPTRiiiilfavlviaSFVFQVVR  339
            MTTS+RLAD+K+ +FEKNITKRG  P  +++KG  +    I++  F  +VI S +FQ++R
Sbjct  1    MTTSRRLADKKVERFEKNITKRGAVPETTTKKGSNYPVGPIVLGFFVFVVIGSSLFQIIR  60

Query  340  LALSGG  357
             A SGG
Sbjct  61   TATSGG  66



>gb|EEC82336.1| hypothetical protein OsI_26633 [Oryza sativa Indica Group]
Length=550

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNPLSSRKG  264
            MTTS+RL+DRK+A+FEKN+TKRG  P + +KG
Sbjct  1    MTTSRRLSDRKVARFEKNVTKRGSVPETVKKG  32



>ref|XP_008353049.1| PREDICTED: stress-associated endoplasmic reticulum protein 2-like 
[Malus domestica]
Length=68

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 45/66 (68%), Gaps = 3/66 (5%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNP-LSSRKG--FEPTRiiiilfavlviaSFVFQVVR  339
            MTTS+R ADRK+ KFEKNITKRG  P  +++KG  +    I +  F  +VI S +FQ++R
Sbjct  1    MTTSRRXADRKVEKFEKNITKRGAVPETTAKKGKDYPVGPIJLGFFIFVVIGSSLFQIIR  60

Query  340  LALSGG  357
             A SGG
Sbjct  61   TATSGG  66



>ref|XP_008460008.1| PREDICTED: stress-associated endoplasmic reticulum protein 2-like 
[Cucumis melo]
Length=68

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 47/66 (71%), Gaps = 3/66 (5%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNPLSS-RKGFE-PTR-iiiilfavlviaSFVFQVVR  339
            MTTS+RLADRK+ KFE+NITKRG  P +S +KG E P   +++  F  +VI S +FQ++R
Sbjct  1    MTTSRRLADRKVGKFERNITKRGSVPETSVKKGKEYPVGPLLLGFFIFVVIGSSLFQIIR  60

Query  340  LALSGG  357
             A  GG
Sbjct  61   TATGGG  66



>emb|CDY27607.1| BnaA09g28000D [Brassica napus]
Length=135

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 46/65 (71%), Gaps = 3/65 (5%)
 Frame = +1

Query  172  TTSKRLADRKIAKFEKNITKRGLNP-LSSRKG--FEPTRiiiilfavlviaSFVFQVVRL  342
            TTSKRLADRKI KF+KNITKRG  P  +++KG  +    I++  F  +VI S +FQ++R 
Sbjct  69   TTSKRLADRKIEKFDKNITKRGFVPETTTKKGKDYPVGPILLGFFVFVVIGSSLFQIIRT  128

Query  343  ALSGG  357
            A SGG
Sbjct  129  ATSGG  133



>ref|XP_004958140.1| PREDICTED: stress-associated endoplasmic reticulum protein 2-like 
[Setaria italica]
Length=68

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNPLSSRK  261
            MTTS+R+ADRKIA+FEKNITKRG  P + +K
Sbjct  1    MTTSRRVADRKIARFEKNITKRGAVPETIKK  31



>emb|CDP13351.1| unnamed protein product [Coffea canephora]
Length=118

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 47/68 (69%), Gaps = 3/68 (4%)
 Frame = +1

Query  163  AKMTTSKRLADRKIAKFEKNITKRGLNP-LSSRKG--FEPTRiiiilfavlviaSFVFQV  333
             + TTS+RLADRK+ KFEKNIT+RG  P  S++KG  +    I++  F  +VI S +FQ+
Sbjct  49   VRQTTSRRLADRKVEKFEKNITRRGAVPETSTKKGSNYPVGPILLGFFVFVVIGSSIFQI  108

Query  334  VRLALSGG  357
            +R A SGG
Sbjct  109  IRTATSGG  116



>dbj|BAK03678.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=68

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 47/66 (71%), Gaps = 3/66 (5%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNPLSS-RKG--FEPTRiiiilfavlviaSFVFQVVR  339
            MTTS+RLADRK AKF+KNITKRG  P ++ +KG  +    I++  F  +VI S +FQ++R
Sbjct  1    MTTSRRLADRKTAKFQKNITKRGSVPETTVKKGNDYPVGPIVLGFFIFVVIGSSLFQIIR  60

Query  340  LALSGG  357
             A SGG
Sbjct  61   TASSGG  66



>ref|NP_001066879.1| Os12g0514100 [Oryza sativa Japonica Group]
 dbj|BAF29898.1| Os12g0514100 [Oryza sativa Japonica Group]
 gb|EAY83299.1| hypothetical protein OsI_38508 [Oryza sativa Indica Group]
 dbj|BAH00358.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE53304.1| hypothetical protein OsJ_36275 [Oryza sativa Japonica Group]
Length=68

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 47/66 (71%), Gaps = 3/66 (5%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNPLSS-RKG--FEPTRiiiilfavlviaSFVFQVVR  339
            MTTS+RLADRK AKF+KNITKRG  P ++ +KG  +    +++  F  +VI S +FQ++R
Sbjct  1    MTTSRRLADRKSAKFQKNITKRGSVPETTVKKGNDYPVGPMVLGFFIFVVIGSSLFQIIR  60

Query  340  LALSGG  357
             A SGG
Sbjct  61   TATSGG  66



>ref|XP_004962894.1| PREDICTED: stress-associated endoplasmic reticulum protein 2-like 
[Setaria italica]
Length=68

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 47/66 (71%), Gaps = 3/66 (5%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNPLSS-RKG--FEPTRiiiilfavlviaSFVFQVVR  339
            MTTS+RLADRK AKF+KNITKRG  P ++ +KG  +    I++  F  +VI S +FQ++R
Sbjct  1    MTTSRRLADRKSAKFQKNITKRGSVPETTVKKGNDYPVGPIVLGFFIFVVIGSSLFQIIR  60

Query  340  LALSGG  357
             A SGG
Sbjct  61   TATSGG  66



>ref|XP_002443260.1| hypothetical protein SORBIDRAFT_08g016540 [Sorghum bicolor]
 gb|EES17098.1| hypothetical protein SORBIDRAFT_08g016540 [Sorghum bicolor]
Length=68

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 47/66 (71%), Gaps = 3/66 (5%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNPLSS-RKG--FEPTRiiiilfavlviaSFVFQVVR  339
            MTTS+RLADRK AKF+KNITKRG  P ++ +KG  +    I++  F  +VI S +FQ++R
Sbjct  1    MTTSRRLADRKSAKFQKNITKRGSVPETTVKKGNDYPVGPIVLGFFIFVVIGSSLFQIIR  60

Query  340  LALSGG  357
             A SGG
Sbjct  61   TATSGG  66



>gb|AFW74647.1| membrane protein [Zea mays]
Length=68

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 45/66 (68%), Gaps = 3/66 (5%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNPLSSRK---GFEPTRiiiilfavlviaSFVFQVVR  339
            MTTS+RLADRK AKF+KNITKRG  P ++ K    +    I++  F  +VI S +FQ++R
Sbjct  1    MTTSRRLADRKSAKFQKNITKRGSVPETTVKKSNDYPVGPIVLGFFIFVVIGSSLFQIIR  60

Query  340  LALSGG  357
             A SGG
Sbjct  61   TATSGG  66



>gb|EEC68513.1| hypothetical protein OsI_36788 [Oryza sativa Indica Group]
Length=572

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 34/66 (52%), Positives = 47/66 (71%), Gaps = 3/66 (5%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNPLSS-RKG--FEPTRiiiilfavlviaSFVFQVVR  339
            MTTS+RLADRK AKF+KNITKRG  P ++ +KG  +    +++  F  +VI S +FQ++R
Sbjct  505  MTTSRRLADRKTAKFQKNITKRGSVPETTVKKGNDYPVGPLVLGFFIFVVIGSSLFQIIR  564

Query  340  LALSGG  357
             A SGG
Sbjct  565  TATSGG  570



>ref|XP_002451175.1| hypothetical protein SORBIDRAFT_05g025380 [Sorghum bicolor]
 gb|EES10163.1| hypothetical protein SORBIDRAFT_05g025380 [Sorghum bicolor]
Length=68

 Score = 46.6 bits (109),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 47/66 (71%), Gaps = 3/66 (5%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNPLSS-RKG--FEPTRiiiilfavlviaSFVFQVVR  339
            MTTS+RLADRK AKF+KNIT+RG  P ++ +KG  +    +++  F  +VI S +FQ++R
Sbjct  1    MTTSRRLADRKTAKFQKNITRRGSVPETTVKKGNDYPVGPVVLGFFIFVVIGSSLFQIIR  60

Query  340  LALSGG  357
             A SGG
Sbjct  61   TATSGG  66



>ref|XP_004979802.1| PREDICTED: stress-associated endoplasmic reticulum protein 2-like 
[Setaria italica]
Length=68

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 47/66 (71%), Gaps = 3/66 (5%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNPLSS-RKG--FEPTRiiiilfavlviaSFVFQVVR  339
            MTTS+RLADRK AKF+KNIT+RG  P ++ +KG  +    +++  F  +VI S +FQ++R
Sbjct  1    MTTSRRLADRKTAKFQKNITRRGSVPETTIKKGNDYPVGPVVLGFFIFVVIGSSLFQIIR  60

Query  340  LALSGG  357
             A SGG
Sbjct  61   TATSGG  66



>ref|NP_001152618.1| LOC100286259 [Zea mays]
 gb|ACG37267.1| membrane protein [Zea mays]
 gb|ACG48583.1| membrane protein [Zea mays]
 gb|ACN29053.1| unknown [Zea mays]
 tpg|DAA42321.1| TPA: hypothetical protein ZEAMMB73_764372 [Zea mays]
Length=68

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 47/66 (71%), Gaps = 3/66 (5%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNPLSS-RKG--FEPTRiiiilfavlviaSFVFQVVR  339
            MTTS+RLADRK AKF+KNIT+RG  P ++ +KG  +    +++  F  +VI S +FQ++R
Sbjct  1    MTTSRRLADRKTAKFQKNITRRGSVPETTVKKGNDYPVGPLVLGFFIFVVIGSSLFQIIR  60

Query  340  LALSGG  357
             A SGG
Sbjct  61   TATSGG  66



>ref|NP_001167775.1| hypothetical protein [Zea mays]
 gb|ACN26028.1| unknown [Zea mays]
 tpg|DAA63330.1| TPA: hypothetical protein ZEAMMB73_928287 [Zea mays]
Length=109

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  160  KAKMTTSKRLADRKIAKFEKNITKRGLNPLSSRKG  264
             ++ TTS+RLADRKIA+FEKNITKRG  P + +K 
Sbjct  40   DSEQTTSRRLADRKIARFEKNITKRGSVPETVKKA  74



>gb|KHG11523.1| Serp2 [Gossypium arboreum]
Length=68

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 47/66 (71%), Gaps = 3/66 (5%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNP-LSSRKG--FEPTRiiiilfavlviaSFVFQVVR  339
            MTTS+RLA+RK+ KF+KNITKRG  P  +++KG  +    +++  F  +VI S +FQ++R
Sbjct  1    MTTSRRLAERKVEKFQKNITKRGAVPETTTKKGKDYPVGPLLLGFFIFVVIGSSLFQIIR  60

Query  340  LALSGG  357
             A SGG
Sbjct  61   TATSGG  66



>gb|AAF99731.1|AC004557_10 F17L21.12 [Arabidopsis thaliana]
Length=77

 Score = 46.2 bits (108),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 45/65 (69%), Gaps = 3/65 (5%)
 Frame = +1

Query  172  TTSKRLADRKIAKFEKNITKRGLNP-LSSRKG--FEPTRiiiilfavlviaSFVFQVVRL  342
            TTSKRLADRKI KF+KNI KRG  P  +++KG  +    I++  F  +VI S +FQ++R 
Sbjct  11   TTSKRLADRKIEKFDKNILKRGFVPETTTKKGKDYPVGPILLGFFVFVVIGSSLFQIIRT  70

Query  343  ALSGG  357
            A SGG
Sbjct  71   ATSGG  75



>gb|EYU42087.1| hypothetical protein MIMGU_mgv1a024060mg [Erythranthe guttata]
Length=50

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 37/63 (59%), Gaps = 16/63 (25%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNPLSSRKGFEPTRiiiilfavlviaSFVFQVVRLAL  348
            MTTS+R+A+RK+ +FEKNITKRG  P ++     PT               +FQ++R A 
Sbjct  1    MTTSRRVAERKVERFEKNITKRGSVPETT-TDLIPT---------------LFQIIRTAT  44

Query  349  SGG  357
            SGG
Sbjct  45   SGG  47



>ref|XP_007223936.1| hypothetical protein PRUPE_ppa014280mg [Prunus persica]
 gb|EMJ25135.1| hypothetical protein PRUPE_ppa014280mg [Prunus persica]
Length=76

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNPLSSRK  261
            MTTS+RLADRK+ KFEKNITKRG  P ++ K
Sbjct  1    MTTSRRLADRKVEKFEKNITKRGAVPETTAK  31



>gb|KCW86931.1| hypothetical protein EUGRSUZ_B03504, partial [Eucalyptus grandis]
Length=108

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 47/68 (69%), Gaps = 3/68 (4%)
 Frame = +1

Query  163  AKMTTSKRLADRKIAKFEKNITKRGLNP-LSSRKG--FEPTRiiiilfavlviaSFVFQV  333
            A MTTS+R ADRK+ +FEKNITKRG  P  +++KG  +    I++  F  +VI S +FQ+
Sbjct  39   ATMTTSRRFADRKVDRFEKNITKRGAVPETTAKKGKDYPVGPILLGFFVFVVIGSSLFQI  98

Query  334  VRLALSGG  357
            +R A +GG
Sbjct  99   IRTATTGG  106



>gb|ABK21006.1| unknown [Picea sitchensis]
 gb|ABK23293.1| unknown [Picea sitchensis]
 gb|ABK25369.1| unknown [Picea sitchensis]
 gb|ACN40951.1| unknown [Picea sitchensis]
Length=68

 Score = 45.8 bits (107),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 44/66 (67%), Gaps = 3/66 (5%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNPLSSRK---GFEPTRiiiilfavlviaSFVFQVVR  339
            MTTS+RLADRK AKF+KNI KRG  P ++ K    +    I++  F  +VI S +FQ++R
Sbjct  1    MTTSRRLADRKSAKFQKNILKRGAVPETTVKKASSYPVGPIVLGFFVFVVIGSSIFQIIR  60

Query  340  LALSGG  357
             A SGG
Sbjct  61   TASSGG  66



>gb|AFK38169.1| unknown [Medicago truncatula]
Length=68

 Score = 45.8 bits (107),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 46/66 (70%), Gaps = 3/66 (5%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNPLSS-RKG--FEPTRiiiilfavlviaSFVFQVVR  339
            MTTSKRLA RK+ KFEKNITKRG  P ++ +KG  +    +++  F  +VI S +FQ++R
Sbjct  1    MTTSKRLAVRKVEKFEKNITKRGSVPETTVKKGNDYPVGPVLLGFFVFVVIGSSLFQIIR  60

Query  340  LALSGG  357
             A SGG
Sbjct  61   TATSGG  66



>ref|XP_003576008.1| PREDICTED: probable stress-associated endoplasmic reticulum protein 
[Brachypodium distachyon]
Length=68

 Score = 45.4 bits (106),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 47/66 (71%), Gaps = 3/66 (5%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNPLSS-RKG--FEPTRiiiilfavlviaSFVFQVVR  339
            MTTS+RLAD+K AKF+KNITKRG  P ++ +KG  +    I++  F  +VI S +FQ++R
Sbjct  1    MTTSRRLADKKSAKFQKNITKRGSVPETTVKKGNDYPVGPIVLGFFIFVVIGSSLFQIIR  60

Query  340  LALSGG  357
             A SGG
Sbjct  61   TATSGG  66



>ref|XP_010044821.1| PREDICTED: stress-associated endoplasmic reticulum protein 2-like 
[Eucalyptus grandis]
Length=68

 Score = 45.4 bits (106),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 46/66 (70%), Gaps = 3/66 (5%)
 Frame = +1

Query  169  MTTSKRLADRKIAKFEKNITKRGLNP-LSSRKG--FEPTRiiiilfavlviaSFVFQVVR  339
            MTTS+R ADRK+ +FEKNITKRG  P  +++KG  +    I++  F  +VI S +FQ++R
Sbjct  1    MTTSRRFADRKVDRFEKNITKRGAVPETTAKKGKDYPVGPILLGFFVFVVIGSSLFQIIR  60

Query  340  LALSGG  357
             A +GG
Sbjct  61   TATTGG  66



>ref|XP_006848257.1| hypothetical protein AMTR_s00013p00052990 [Amborella trichopoda]
 gb|ERN09838.1| hypothetical protein AMTR_s00013p00052990 [Amborella trichopoda]
Length=94

 Score = 45.8 bits (107),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 28/35 (80%), Gaps = 1/35 (3%)
 Frame = +1

Query  163  AKMTTSKRLADRKIAKFEKNITKRGLNP-LSSRKG  264
            A MTTS+RLADRK AKF+ NITKRG  P  SS+KG
Sbjct  39   ANMTTSRRLADRKSAKFQSNITKRGAIPETSSKKG  73



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 510262503360