BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18123_g1_i1 len=1632 path=[1:0-1631]

Length=1632
                                                                      Score     E

ref|XP_009624270.1|  PREDICTED: root phototropism protein 3-like        483   3e-163   
ref|XP_009804782.1|  PREDICTED: root phototropism protein 3-like        478   4e-161   
ref|XP_006341664.1|  PREDICTED: root phototropism protein 3-like        473   7e-159   
ref|XP_004235724.1|  PREDICTED: root phototropism protein 3-like        468   3e-157   
ref|XP_010099655.1|  Coleoptile phototropism protein 1                  461   3e-154   
gb|KHG23249.1|  Coleoptile phototropism 1                               456   1e-152   
emb|CDO98098.1|  unnamed protein product                                452   3e-151   
ref|XP_008228629.1|  PREDICTED: root phototropism protein 3-like        449   4e-150   
ref|XP_004506886.1|  PREDICTED: root phototropism protein 3-like ...    451   5e-150   
ref|XP_004486704.1|  PREDICTED: root phototropism protein 3-like        449   8e-150   
ref|XP_003531695.1|  PREDICTED: coleoptile phototropism protein 1...    449   8e-150   
ref|XP_004302948.1|  PREDICTED: root phototropism protein 3-like        448   1e-149   
ref|XP_010061951.1|  PREDICTED: coleoptile phototropism protein 1       448   2e-149   
ref|XP_011035630.1|  PREDICTED: root phototropism protein 3-like        447   5e-149   
ref|XP_007023976.1|  Phototropic-responsive NPH3 family protein         446   8e-149   
ref|XP_003529816.2|  PREDICTED: coleoptile phototropism protein 1...    446   2e-148   
ref|XP_007135723.1|  hypothetical protein PHAVU_010G152800g             446   2e-148   
ref|XP_004506887.1|  PREDICTED: root phototropism protein 3-like ...    446   2e-148   
ref|XP_006427150.1|  hypothetical protein CICLE_v10025646mg             445   2e-148   
ref|XP_006465407.1|  PREDICTED: coleoptile phototropism protein 1...    445   3e-148   
gb|KHN01356.1|  Coleoptile phototropism protein 1                       445   4e-148   
ref|XP_010254275.1|  PREDICTED: coleoptile phototropism protein 1...    444   4e-148   
gb|KDP37156.1|  hypothetical protein JCGZ_06212                         446   5e-148   
ref|XP_007215428.1|  hypothetical protein PRUPE_ppa006135mg             444   5e-148   
ref|XP_006369158.1|  hypothetical protein POPTR_0001s17540g             443   2e-147   
ref|XP_011039998.1|  PREDICTED: root phototropism protein 3             442   5e-147   
ref|XP_008377603.1|  PREDICTED: root phototropism protein 3-like        442   5e-147   
ref|XP_002517554.1|  signal transducer, putative                        441   7e-147   Ricinus communis
ref|XP_002281013.1|  PREDICTED: coleoptile phototropism protein 1       441   8e-147   Vitis vinifera
ref|XP_010249954.1|  PREDICTED: coleoptile phototropism protein 1...    441   1e-145   
ref|XP_002303269.2|  phototropic-responsive NPH3 family protein         437   6e-145   Populus trichocarpa [western balsam poplar]
gb|KEH28736.1|  phototropic-responsive NPH3 family protein              434   9e-144   
ref|XP_010542273.1|  PREDICTED: root phototropism protein 3-like        432   5e-143   
ref|XP_003597825.1|  BTB/POZ domain-containing protein                  427   1e-141   
ref|XP_004136077.1|  PREDICTED: root phototropism protein 3-like        427   7e-141   
ref|XP_008461063.1|  PREDICTED: root phototropism protein 3             426   1e-140   
gb|ACU20143.1|  unknown                                                 425   1e-140   Glycine max [soybeans]
gb|KHN44148.1|  Root phototropism protein 3                             424   3e-140   
ref|XP_003543664.1|  PREDICTED: root phototropism protein 3-like        424   3e-140   
ref|NP_175686.1|  phototropic-responsive NPH3 family protein            421   2e-138   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010479798.1|  PREDICTED: root phototropism protein 3-like        415   3e-136   
ref|XP_006392871.1|  hypothetical protein EUTSA_v10011482mg             414   3e-136   
ref|XP_006307465.1|  hypothetical protein CARUB_v10009092mg             414   9e-136   
ref|XP_010462131.1|  PREDICTED: root phototropism protein 3-like        414   1e-135   
ref|XP_002891715.1|  phototropic-responsive NPH3 family protein         412   4e-135   
ref|XP_010500893.1|  PREDICTED: coleoptile phototropism protein 1...    412   4e-135   
ref|XP_010691229.1|  PREDICTED: root phototropism protein 3             409   2e-134   
ref|XP_009147664.1|  PREDICTED: root phototropism protein 3             404   3e-132   
emb|CDY62203.1|  BnaA06g01470D                                          403   1e-131   
gb|KFK38904.1|  hypothetical protein AALP_AA3G175900                    401   5e-131   
ref|XP_007150696.1|  hypothetical protein PHAVU_005G173900g             397   7e-131   
gb|KFK35770.1|  hypothetical protein AALP_AA4G033900                    400   1e-130   
ref|XP_009146226.1|  PREDICTED: coleoptile phototropism protein 1       400   2e-130   
ref|XP_011072265.1|  PREDICTED: root phototropism protein 3             397   3e-130   
ref|XP_006406951.1|  hypothetical protein EUTSA_v10022354mg             399   5e-130   
emb|CDX75835.1|  BnaC03g39180D                                          394   3e-128   
emb|CDY26059.1|  BnaC06g05650D                                          393   8e-128   
ref|XP_010487383.1|  PREDICTED: root phototropism protein 3-like        392   2e-127   
ref|XP_006297661.1|  hypothetical protein CARUB_v10013684mg             392   4e-127   
ref|XP_010465526.1|  PREDICTED: root phototropism protein 3-like        390   1e-126   
ref|XP_002885094.1|  phototropic-responsive NPH3 family protein         390   2e-126   
ref|XP_010503149.1|  PREDICTED: root phototropism protein 3-like        388   5e-126   
ref|XP_011081061.1|  PREDICTED: root phototropism protein 3-like        386   2e-125   
ref|XP_009135448.1|  PREDICTED: coleoptile phototropism protein 1...    386   4e-125   
gb|EYU21595.1|  hypothetical protein MIMGU_mgv1a027051mg                382   3e-124   
gb|AAM61364.1|  non-phototropic hypocotyl protein, putative             381   2e-123   Arabidopsis thaliana [mouse-ear cress]
ref|NP_188176.1|  phototropic-responsive NPH3 family protein            382   3e-123   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009385805.1|  PREDICTED: root phototropism protein 3-like        352   5e-112   
ref|XP_008792131.1|  PREDICTED: root phototropism protein 3             347   5e-110   
ref|XP_008785504.1|  PREDICTED: coleoptile phototropism protein 1...    333   5e-105   
ref|XP_010925272.1|  PREDICTED: root phototropism protein 3-like        330   1e-103   
ref|XP_009381748.1|  PREDICTED: root phototropism protein 3-like        328   6e-103   
ref|XP_010914962.1|  PREDICTED: root phototropism protein 3             322   2e-100   
gb|EYU24675.1|  hypothetical protein MIMGU_mgv1a020826mg                261   2e-77    
dbj|BAJ92373.1|  predicted protein                                      258   1e-75    
emb|CDO97399.1|  unnamed protein product                                261   9e-75    
ref|XP_009393648.1|  PREDICTED: root phototropism protein 3             261   1e-74    
ref|XP_011043086.1|  PREDICTED: root phototropism protein 3-like        256   1e-73    
ref|XP_008811013.1|  PREDICTED: root phototropism protein 3 isofo...    258   1e-73    
ref|XP_009368293.1|  PREDICTED: root phototropism protein 3-like        258   1e-73    
gb|EPS59481.1|  hypothetical protein M569_15326                         258   2e-73    
ref|XP_010939734.1|  PREDICTED: root phototropism protein 3             258   3e-73    
ref|XP_010094827.1|  Root phototropism protein 3                        258   3e-73    
ref|XP_008237216.1|  PREDICTED: root phototropism protein 3             257   3e-73    
ref|XP_004169312.1|  PREDICTED: LOW QUALITY PROTEIN: root phototr...    256   4e-73    
ref|XP_007042875.1|  Phototropic-responsive NPH3 family protein i...    254   4e-73    
ref|XP_007200957.1|  hypothetical protein PRUPE_ppa002411mg             257   4e-73    
ref|XP_010266412.1|  PREDICTED: root phototropism protein 3             257   5e-73    
gb|EYU39117.1|  hypothetical protein MIMGU_mgv1a002358mg                256   9e-73    
ref|XP_003593245.1|  Root phototropism protein                          256   1e-72    
ref|XP_008811011.1|  PREDICTED: root phototropism protein 3 isofo...    258   1e-72    
ref|XP_008811012.1|  PREDICTED: root phototropism protein 3 isofo...    258   1e-72    
ref|XP_011014241.1|  PREDICTED: root phototropism protein 3-like ...    255   2e-72    
ref|XP_006841237.1|  hypothetical protein AMTR_s00135p00069650          255   2e-72    
ref|XP_009150508.1|  PREDICTED: root phototropism protein 3 isofo...    256   2e-72    
ref|XP_004137156.1|  PREDICTED: root phototropism protein 3-like        255   2e-72    
ref|XP_008358392.1|  PREDICTED: root phototropism protein 3-like        255   3e-72    
ref|XP_009150509.1|  PREDICTED: root phototropism protein 3 isofo...    254   3e-72    
ref|XP_002988207.1|  hypothetical protein SELMODRAFT_183709             253   4e-72    
ref|XP_004301628.1|  PREDICTED: root phototropism protein 3-like        254   4e-72    
ref|XP_003608415.1|  Root phototropism protein                          254   6e-72    
ref|XP_007042874.1|  Phototropic-responsive NPH3 family protein i...    253   6e-72    
ref|XP_002522618.1|  hypothetical protein RCOM_0884570                  253   7e-72    Ricinus communis
emb|CDX84515.1|  BnaC03g49850D                                          255   7e-72    
ref|XP_004230550.1|  PREDICTED: root phototropism protein 3-like        253   1e-71    
ref|XP_002963496.1|  hypothetical protein SELMODRAFT_166345             252   1e-71    
ref|XP_011012727.1|  PREDICTED: root phototropism protein 3-like        253   1e-71    
ref|XP_007159131.1|  hypothetical protein PHAVU_002G211400g             253   2e-71    
ref|XP_008373205.1|  PREDICTED: root phototropism protein 3             253   2e-71    
ref|XP_011023032.1|  PREDICTED: root phototropism protein 3-like        253   2e-71    
ref|XP_009348533.1|  PREDICTED: root phototropism protein 3-like        252   2e-71    
ref|XP_004504830.1|  PREDICTED: root phototropism protein 3-like ...    252   2e-71    
ref|XP_008462886.1|  PREDICTED: root phototropism protein 3-like ...    252   3e-71    
ref|XP_011014242.1|  PREDICTED: root phototropism protein 3-like ...    250   3e-71    
ref|XP_004504832.1|  PREDICTED: root phototropism protein 3-like ...    252   3e-71    
ref|XP_002457253.1|  hypothetical protein SORBIDRAFT_03g004120          248   3e-71    Sorghum bicolor [broomcorn]
ref|XP_007148380.1|  hypothetical protein PHAVU_006G203600g             252   3e-71    
ref|XP_006351743.1|  PREDICTED: root phototropism protein 3-like        251   3e-71    
ref|XP_002323955.2|  hypothetical protein POPTR_0017s07540g             252   3e-71    Populus trichocarpa [western balsam poplar]
ref|XP_002310495.1|  hypothetical protein POPTR_0007s03550g             252   4e-71    Populus trichocarpa [western balsam poplar]
ref|XP_004504829.1|  PREDICTED: root phototropism protein 3-like ...    252   4e-71    
ref|XP_009366303.1|  PREDICTED: root phototropism protein 3             251   4e-71    
ref|XP_003545709.1|  PREDICTED: root phototropism protein 3-like        251   6e-71    
ref|XP_004248794.1|  PREDICTED: root phototropism protein 3-like        251   7e-71    
ref|XP_006420843.1|  hypothetical protein CICLE_v10004479mg             249   8e-71    
gb|KHN46271.1|  Root phototropism protein 3                             250   1e-70    
ref|XP_009608443.1|  PREDICTED: root phototropism protein 3 isofo...    250   1e-70    
emb|CBI38224.3|  unnamed protein product                                248   1e-70    
ref|XP_009631478.1|  PREDICTED: root phototropism protein 3-like        249   2e-70    
gb|KDO42273.1|  hypothetical protein CISIN_1g005842mg                   249   2e-70    
ref|XP_009803877.1|  PREDICTED: root phototropism protein 3-like        249   3e-70    
ref|XP_006359786.1|  PREDICTED: root phototropism protein 3-like        249   3e-70    
gb|KHG29755.1|  Root phototropism 3 -like protein                       249   3e-70    
ref|XP_006420844.1|  hypothetical protein CICLE_v10004479mg             249   3e-70    
ref|XP_004952704.1|  PREDICTED: coleoptile phototropism protein 1...    250   4e-70    
ref|XP_002970451.1|  hypothetical protein SELMODRAFT_93693              248   4e-70    
emb|CAN60915.1|  hypothetical protein VITISV_002200                     248   5e-70    Vitis vinifera
ref|XP_006494598.1|  PREDICTED: root phototropism protein 3-like ...    249   5e-70    
gb|EYU18437.1|  hypothetical protein MIMGU_mgv1a002339mg                249   5e-70    
ref|XP_006584970.1|  PREDICTED: root phototropism protein 3-like        248   6e-70    
ref|XP_006594679.1|  PREDICTED: root phototropism protein 3-like        248   6e-70    
dbj|BAK05210.1|  predicted protein                                      249   1e-69    
ref|XP_010065706.1|  PREDICTED: root phototropism protein 3             248   1e-69    
ref|XP_010272952.1|  PREDICTED: root phototropism protein 3-like ...    246   1e-69    
gb|KHN19000.1|  Root phototropism protein 3                             248   1e-69    
ref|XP_011087936.1|  PREDICTED: root phototropism protein 3-like        248   1e-69    
ref|XP_002269380.1|  PREDICTED: root phototropism protein 3             247   1e-69    Vitis vinifera
ref|NP_001147552.1|  transposon protein Mutator sub-class               248   2e-69    Zea mays [maize]
ref|XP_010272951.1|  PREDICTED: root phototropism protein 3-like ...    247   2e-69    
gb|KHN33549.1|  Root phototropism protein 3                             247   2e-69    
ref|XP_006829676.1|  hypothetical protein AMTR_s00122p00139490          234   3e-69    
gb|EAY72752.1|  hypothetical protein OsI_00618                          241   6e-69    Oryza sativa Indica Group [Indian rice]
gb|AFW71924.1|  putative phototropic-responsive NPH3 family protein     247   6e-69    
ref|XP_003528390.2|  PREDICTED: root phototropism protein 3-like ...    246   2e-68    
ref|XP_004136895.1|  PREDICTED: root phototropism protein 3-like        244   3e-68    
ref|XP_008673635.1|  PREDICTED: root phototropism protein 3             238   4e-68    
gb|EAY86354.1|  hypothetical protein OsI_07731                          245   4e-68    Oryza sativa Indica Group [Indian rice]
ref|XP_004485603.1|  PREDICTED: root phototropism protein 3-like        244   4e-68    
ref|XP_009766094.1|  PREDICTED: root phototropism protein 3-like ...    243   6e-68    
ref|NP_001047181.1|  Os02g0568200                                       244   1e-67    Oryza sativa Japonica Group [Japonica rice]
gb|KHN09117.1|  Root phototropism protein 3                             241   1e-67    
ref|XP_002454038.1|  hypothetical protein SORBIDRAFT_04g023550          243   2e-67    Sorghum bicolor [broomcorn]
ref|XP_002978524.1|  hypothetical protein SELMODRAFT_108722             239   4e-67    
ref|XP_008455135.1|  PREDICTED: root phototropism protein 3 isofo...    240   7e-67    
ref|XP_010916684.1|  PREDICTED: root phototropism protein 3-like        240   7e-67    
ref|XP_008455134.1|  PREDICTED: root phototropism protein 3 isofo...    239   2e-66    
ref|XP_008795219.1|  PREDICTED: root phototropism protein 3-like        239   2e-66    
ref|XP_010691413.1|  PREDICTED: root phototropism protein 3             238   5e-66    
emb|CDY18715.1|  BnaA09g06800D                                          238   1e-65    
ref|XP_002978505.1|  hypothetical protein SELMODRAFT_443843             235   1e-65    
gb|KDP40950.1|  hypothetical protein JCGZ_24949                         236   1e-65    
dbj|BAD17765.1|  putative non-phototropic hypocotyl 3 (NPH3)            238   2e-65    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002970426.1|  hypothetical protein SELMODRAFT_231529             234   4e-65    
gb|KCW63332.1|  hypothetical protein EUGRSUZ_G00960                     233   2e-64    
ref|XP_009623089.1|  PREDICTED: putative BTB/POZ domain-containin...    228   7e-63    
gb|EAZ10750.1|  hypothetical protein OsJ_00587                          224   1e-62    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004968398.1|  PREDICTED: coleoptile phototropism protein 1...    224   2e-62    
ref|XP_001770455.1|  predicted protein                                  226   3e-62    
ref|XP_006386870.1|  hypothetical protein POPTR_0002s24380g             223   5e-62    
ref|XP_004960831.1|  PREDICTED: coleoptile phototropism protein 1...    221   1e-61    
ref|XP_004975049.1|  PREDICTED: coleoptile phototropism protein 1...    224   2e-61    
ref|XP_003566481.2|  PREDICTED: coleoptile phototropism protein 1...    222   2e-61    
ref|XP_004975050.1|  PREDICTED: coleoptile phototropism protein 1...    224   3e-61    
ref|XP_011024680.1|  PREDICTED: BTB/POZ domain-containing protein...    223   6e-61    
ref|XP_002301784.2|  hypothetical protein POPTR_0002s24380g             223   7e-61    Populus trichocarpa [western balsam poplar]
ref|XP_008776569.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...    221   2e-60    
ref|XP_001764279.1|  predicted protein                                  219   5e-60    
gb|KHN13450.1|  BTB/POZ domain-containing protein                       220   5e-60    
ref|XP_003551322.2|  PREDICTED: BTB/POZ domain-containing protein...    220   6e-60    
ref|XP_001763717.1|  predicted protein                                  219   7e-60    
ref|XP_006845260.1|  hypothetical protein AMTR_s00005p00262560          219   8e-60    
ref|XP_010264098.1|  PREDICTED: BTB/POZ domain-containing protein...    221   9e-60    
ref|XP_002521098.1|  protein binding protein, putative                  219   1e-59    Ricinus communis
ref|XP_006443605.1|  hypothetical protein CICLE_v10019330mg             219   1e-59    
emb|CAN78287.1|  hypothetical protein VITISV_008137                     218   1e-59    Vitis vinifera
ref|XP_002447461.1|  hypothetical protein SORBIDRAFT_06g001450          219   2e-59    Sorghum bicolor [broomcorn]
ref|XP_003604967.1|  BTB/POZ domain-containing protein                  219   2e-59    
ref|XP_002531260.1|  Root phototropism protein, putative                219   2e-59    Ricinus communis
emb|CBI37309.3|  unnamed protein product                                218   2e-59    
ref|XP_008669708.1|  PREDICTED: coleoptile phototropism protein 1...    219   3e-59    
ref|XP_010652501.1|  PREDICTED: BTB/POZ domain-containing protein...    217   4e-59    
ref|XP_010245990.1|  PREDICTED: BTB/POZ domain-containing protein...    216   4e-59    
ref|XP_010685004.1|  PREDICTED: BTB/POZ domain-containing protein...    218   5e-59    
ref|XP_009334929.1|  PREDICTED: BTB/POZ domain-containing protein...    219   5e-59    
ref|XP_010652500.1|  PREDICTED: BTB/POZ domain-containing protein...    217   6e-59    
ref|XP_002265786.1|  PREDICTED: BTB/POZ domain-containing protein...    217   6e-59    Vitis vinifera
ref|XP_002306309.2|  hypothetical protein POPTR_0005s07690g             216   8e-59    Populus trichocarpa [western balsam poplar]
ref|XP_007133999.1|  hypothetical protein PHAVU_010G010500g             216   1e-58    
ref|XP_010245989.1|  PREDICTED: BTB/POZ domain-containing protein...    216   1e-58    
ref|XP_008382632.1|  PREDICTED: BTB/POZ domain-containing protein...    216   1e-58    
ref|XP_006836308.1|  hypothetical protein AMTR_s00092p00041800          217   1e-58    
gb|KHG05588.1|  hypothetical protein F383_31158                         215   1e-58    
ref|XP_010245988.1|  PREDICTED: BTB/POZ domain-containing protein...    216   2e-58    
ref|XP_009802686.1|  PREDICTED: putative BTB/POZ domain-containin...    216   2e-58    
ref|XP_010909076.1|  PREDICTED: BTB/POZ domain-containing protein...    217   2e-58    
ref|XP_010109730.1|  BTB/POZ domain-containing protein                  216   3e-58    
ref|XP_004506596.1|  PREDICTED: BTB/POZ domain-containing protein...    215   3e-58    
ref|XP_003520918.1|  PREDICTED: BTB/POZ domain-containing protein...    215   4e-58    
ref|XP_007201187.1|  hypothetical protein PRUPE_ppa002993mg             214   7e-58    
ref|XP_008235484.1|  PREDICTED: BTB/POZ domain-containing protein...    214   1e-57    
ref|XP_011092443.1|  PREDICTED: root phototropism protein 3             215   1e-57    
ref|XP_009792130.1|  PREDICTED: BTB/POZ domain-containing protein...    213   2e-57    
gb|KHG00255.1|  hypothetical protein F383_19997                         213   2e-57    
ref|XP_010520803.1|  PREDICTED: root phototropism protein 3             214   3e-57    
gb|KFK28125.1|  hypothetical protein AALP_AA8G475700                    214   3e-57    
ref|XP_009371616.1|  PREDICTED: BTB/POZ domain-containing protein...    212   5e-57    
ref|XP_011089103.1|  PREDICTED: BTB/POZ domain-containing protein...    212   5e-57    
ref|XP_002989054.1|  hypothetical protein SELMODRAFT_272040             211   8e-57    
gb|KEH20837.1|  phototropic-responsive NPH3 family protein              209   8e-57    
ref|XP_001769248.1|  predicted protein                                  211   8e-57    
ref|XP_002963864.1|  hypothetical protein SELMODRAFT_141980             211   8e-57    
ref|XP_002983725.1|  hypothetical protein SELMODRAFT_228979             211   9e-57    
ref|XP_006394165.1|  hypothetical protein EUTSA_v10003710mg             213   9e-57    
gb|AFO63285.1|  bZIP6                                                   211   9e-57    
ref|XP_003613103.1|  BTB/POZ domain-containing protein                  211   1e-56    
ref|XP_007049780.1|  Phototropic-responsive NPH3 family protein         211   1e-56    
ref|XP_007159657.1|  hypothetical protein PHAVU_002G256200g             211   1e-56    
ref|XP_004240016.1|  PREDICTED: putative BTB/POZ domain-containin...    211   1e-56    
ref|XP_010484214.1|  PREDICTED: root phototropism protein 3-like ...    211   1e-56    
ref|XP_009766800.1|  PREDICTED: BTB/POZ domain-containing protein...    209   1e-56    
gb|KHG21232.1|  hypothetical protein F383_08117                         211   2e-56    
ref|XP_006356774.1|  PREDICTED: BTB/POZ domain-containing protein...    210   2e-56    
gb|KDO56565.1|  hypothetical protein CISIN_1g0070151mg                  209   2e-56    
ref|XP_010484212.1|  PREDICTED: root phototropism protein 3-like ...    212   2e-56    
ref|XP_002988267.1|  hypothetical protein SELMODRAFT_447227             211   2e-56    
ref|XP_004247086.1|  PREDICTED: BTB/POZ domain-containing protein...    210   2e-56    
gb|ADN33739.1|  phototropic-responsive NPH3 family protein              209   2e-56    
gb|KDO56564.1|  hypothetical protein CISIN_1g0070151mg                  209   3e-56    
ref|XP_004144382.1|  PREDICTED: BTB/POZ domain-containing protein...    209   3e-56    
ref|XP_009802685.1|  PREDICTED: putative BTB/POZ domain-containin...    210   3e-56    
ref|XP_009766799.1|  PREDICTED: BTB/POZ domain-containing protein...    209   3e-56    
ref|XP_010036820.1|  PREDICTED: BTB/POZ domain-containing protein...    210   3e-56    
emb|CDX81221.1|  BnaC09g06320D                                          211   4e-56    
ref|XP_008465052.1|  PREDICTED: BTB/POZ domain-containing protein...    209   4e-56    
ref|XP_010251055.1|  PREDICTED: BTB/POZ domain-containing protein...    209   4e-56    
ref|XP_004289314.1|  PREDICTED: putative BTB/POZ domain-containin...    209   4e-56    
gb|KDP26391.1|  hypothetical protein JCGZ_17549                         209   4e-56    
ref|XP_009611132.1|  PREDICTED: BTB/POZ domain-containing protein...    209   5e-56    
ref|NP_001174242.1|  Os05g0178000                                       207   5e-56    
gb|KGN58361.1|  hypothetical protein Csa_3G627720                       209   6e-56    
ref|XP_011031014.1|  PREDICTED: BTB/POZ domain-containing protein...    208   6e-56    
ref|XP_011089687.1|  PREDICTED: BTB/POZ domain-containing protein...    208   8e-56    
ref|XP_011089689.1|  PREDICTED: BTB/POZ domain-containing protein...    208   9e-56    
ref|XP_004290211.1|  PREDICTED: BTB/POZ domain-containing protein...    208   9e-56    
ref|XP_003532824.1|  PREDICTED: putative BTB/POZ domain-containin...    208   1e-55    
gb|KEH20836.1|  phototropic-responsive NPH3 family protein              209   1e-55    
ref|XP_010461680.1|  PREDICTED: root phototropism protein 3 isofo...    209   1e-55    
ref|XP_011089686.1|  PREDICTED: BTB/POZ domain-containing protein...    208   1e-55    
ref|XP_002961348.1|  hypothetical protein SELMODRAFT_74933              207   1e-55    
gb|EYU39234.1|  hypothetical protein MIMGU_mgv1a003527mg                207   1e-55    
emb|CDP01455.1|  unnamed protein product                                208   1e-55    
ref|XP_011022793.1|  PREDICTED: BTB/POZ domain-containing protein...    208   1e-55    
ref|XP_006280132.1|  hypothetical protein CARUB_v10026027mg             208   2e-55    
emb|CDP03873.1|  unnamed protein product                                207   2e-55    
ref|XP_010461672.1|  PREDICTED: root phototropism protein 3 isofo...    209   2e-55    
ref|XP_010027852.1|  PREDICTED: putative BTB/POZ domain-containin...    207   2e-55    
ref|XP_010553006.1|  PREDICTED: BTB/POZ domain-containing protein...    207   2e-55    
ref|XP_011031013.1|  PREDICTED: BTB/POZ domain-containing protein...    207   2e-55    
ref|XP_010524688.1|  PREDICTED: BTB/POZ domain-containing protein...    207   3e-55    
ref|XP_006428195.1|  hypothetical protein CICLE_v10025174mg             207   3e-55    
ref|XP_004489774.1|  PREDICTED: BTB/POZ domain-containing protein...    207   3e-55    
ref|XP_006355618.1|  PREDICTED: putative BTB/POZ domain-containin...    207   4e-55    
ref|XP_001769458.1|  predicted protein                                  206   4e-55    
ref|XP_009782405.1|  PREDICTED: BTB/POZ domain-containing protein...    207   4e-55    
ref|XP_009628088.1|  PREDICTED: BTB/POZ domain-containing protein...    206   5e-55    
ref|XP_009599429.1|  PREDICTED: BTB/POZ domain-containing protein...    206   5e-55    
ref|XP_004240632.1|  PREDICTED: BTB/POZ domain-containing protein...    206   5e-55    
ref|NP_568989.1|  root phototropism protein 3                           208   6e-55    
gb|AAF05914.1|AF180390_1  non-phototropic hypocotyl 3                   208   7e-55    
dbj|BAB09864.1|  non-phototropic hypocotyl 3                            208   7e-55    
ref|XP_006853126.1|  hypothetical protein AMTR_s00038p00155420          207   7e-55    
emb|CAN63893.1|  hypothetical protein VITISV_019664                     206   9e-55    
dbj|BAJ33928.1|  unnamed protein product                                206   9e-55    
gb|KDO56567.1|  hypothetical protein CISIN_1g0070151mg                  204   1e-54    
ref|XP_007208631.1|  hypothetical protein PRUPE_ppa018795mg             206   1e-54    
ref|XP_006380419.1|  hypothetical protein POPTR_0007s05440g             204   1e-54    
gb|EPS73600.1|  hypothetical protein M569_01153                         205   1e-54    
ref|XP_010321479.1|  PREDICTED: putative BTB/POZ domain-containin...    205   1e-54    
ref|XP_003524263.1|  PREDICTED: putative BTB/POZ domain-containin...    205   2e-54    
ref|XP_010680550.1|  PREDICTED: BTB/POZ domain-containing protein...    205   2e-54    
ref|XP_009413877.1|  PREDICTED: root phototropism protein 3-like        204   2e-54    
ref|XP_006580274.1|  PREDICTED: putative BTB/POZ domain-containin...    205   2e-54    
gb|KHN06580.1|  Putative BTB/POZ domain-containing protein DOT3         205   2e-54    
ref|XP_002282444.2|  PREDICTED: BTB/POZ domain-containing protein...    205   2e-54    
ref|XP_008243946.1|  PREDICTED: BTB/POZ domain-containing protein...    204   3e-54    
gb|AFZ78666.1|  transposase                                             204   4e-54    
ref|XP_002309978.2|  hypothetical protein POPTR_0007s05440g             204   4e-54    
ref|XP_011034060.1|  PREDICTED: BTB/POZ domain-containing protein...    204   4e-54    
ref|XP_008341358.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...    203   5e-54    
ref|XP_002311763.1|  phototropic-responsive NPH3 family protein         204   5e-54    
ref|XP_008234379.1|  PREDICTED: putative BTB/POZ domain-containin...    204   5e-54    
ref|XP_009151678.1|  PREDICTED: BTB/POZ domain-containing protein...    203   6e-54    
ref|XP_009396038.1|  PREDICTED: BTB/POZ domain-containing protein...    203   6e-54    
ref|XP_009406358.1|  PREDICTED: BTB/POZ domain-containing protein...    202   6e-54    
ref|XP_008383422.1|  PREDICTED: BTB/POZ domain-containing protein...    203   7e-54    
emb|CDX86278.1|  BnaA06g29950D                                          203   7e-54    
ref|XP_010266673.1|  PREDICTED: putative BTB/POZ domain-containin...    203   8e-54    
gb|EYU31010.1|  hypothetical protein MIMGU_mgv1a003084mg                203   8e-54    
ref|NP_199691.1|  phototropic-responsive NPH3 protein                   202   1e-53    
ref|XP_010248658.1|  PREDICTED: BTB/POZ domain-containing protein...    202   1e-53    
ref|XP_008354715.1|  PREDICTED: BTB/POZ domain-containing protein...    202   1e-53    
ref|XP_009593550.1|  PREDICTED: BTB/POZ domain-containing protein...    202   1e-53    
ref|XP_006428194.1|  hypothetical protein CICLE_v10025174mg             202   1e-53    
ref|XP_010482146.1|  PREDICTED: BTB/POZ domain-containing protein...    202   2e-53    
emb|CDX85365.1|  BnaC07g26760D                                          202   2e-53    
ref|XP_009614413.1|  PREDICTED: BTB/POZ domain-containing protein...    202   2e-53    
ref|XP_009630229.1|  PREDICTED: BTB/POZ domain-containing protein...    202   2e-53    
ref|XP_009763589.1|  PREDICTED: BTB/POZ domain-containing protein...    202   2e-53    
ref|XP_010905600.1|  PREDICTED: BTB/POZ domain-containing protein...    202   2e-53    
gb|KDP26695.1|  hypothetical protein JCGZ_17853                         202   2e-53    
ref|XP_009112128.1|  PREDICTED: root phototropism protein 3-like ...    203   2e-53    
ref|XP_002863924.1|  phototropic-responsive NPH3 family protein         202   2e-53    
ref|XP_003519715.1|  PREDICTED: BTB/POZ domain-containing protein...    202   2e-53    
ref|XP_011012052.1|  PREDICTED: BTB/POZ domain-containing protein...    200   2e-53    
ref|XP_011006800.1|  PREDICTED: BTB/POZ domain-containing protein...    200   2e-53    
ref|XP_009344395.1|  PREDICTED: BTB/POZ domain-containing protein...    202   3e-53    
ref|XP_010439675.1|  PREDICTED: BTB/POZ domain-containing protein...    201   3e-53    
ref|XP_009342516.1|  PREDICTED: putative BTB/POZ domain-containin...    201   4e-53    
ref|XP_010051973.1|  PREDICTED: BTB/POZ domain-containing protein...    201   4e-53    
ref|XP_006380639.1|  hypothetical protein POPTR_0007s10060g             201   4e-53    
ref|XP_004288469.1|  PREDICTED: BTB/POZ domain-containing protein...    201   4e-53    
ref|XP_007009861.1|  Phototropic-responsive NPH3 family protein         201   5e-53    
ref|XP_011012051.1|  PREDICTED: BTB/POZ domain-containing protein...    201   5e-53    
ref|XP_010275834.1|  PREDICTED: BTB/POZ domain-containing protein...    201   6e-53    
ref|XP_011045253.1|  PREDICTED: BTB/POZ domain-containing protein...    201   6e-53    
ref|XP_011006799.1|  PREDICTED: BTB/POZ domain-containing protein...    200   6e-53    
gb|KHN00400.1|  BTB/POZ domain-containing protein                       201   6e-53    
ref|XP_009770852.1|  PREDICTED: BTB/POZ domain-containing protein...    201   7e-53    
ref|XP_007153783.1|  hypothetical protein PHAVU_003G064600g             201   7e-53    
ref|XP_010905276.1|  PREDICTED: BTB/POZ domain-containing protein...    200   7e-53    
ref|XP_006286691.1|  hypothetical protein CARUB_v10002705mg             200   7e-53    
ref|XP_009379312.1|  PREDICTED: BTB/POZ domain-containing protein...    198   7e-53    
ref|XP_011045254.1|  PREDICTED: BTB/POZ domain-containing protein...    200   8e-53    
ref|XP_006380638.1|  hypothetical protein POPTR_0007s10060g             201   9e-53    
gb|KEH27511.1|  phototropic-responsive NPH3 family protein              198   9e-53    
ref|XP_011076969.1|  PREDICTED: BTB/POZ domain-containing protein...    200   1e-52    
ref|XP_009112129.1|  PREDICTED: root phototropism protein 3-like ...    200   1e-52    
ref|XP_011099322.1|  PREDICTED: BTB/POZ domain-containing protein...    200   1e-52    
ref|XP_006281736.1|  hypothetical protein CARUB_v10027892mg             200   1e-52    
ref|XP_010272171.1|  PREDICTED: BTB/POZ domain-containing protein...    200   1e-52    
ref|XP_004231910.1|  PREDICTED: BTB/POZ domain-containing protein...    199   2e-52    
ref|XP_004956843.1|  PREDICTED: BTB/POZ domain-containing protein...    198   2e-52    
ref|XP_011090549.1|  PREDICTED: BTB/POZ domain-containing protein...    199   2e-52    
ref|XP_009342777.1|  PREDICTED: BTB/POZ domain-containing protein...    199   2e-52    
ref|XP_009411058.1|  PREDICTED: BTB/POZ domain-containing protein...    199   2e-52    
ref|XP_010263826.1|  PREDICTED: BTB/POZ domain-containing protein...    200   2e-52    
ref|XP_006579934.1|  PREDICTED: BTB/POZ domain-containing protein...    199   2e-52    
ref|XP_009780159.1|  PREDICTED: BTB/POZ domain-containing protein...    199   2e-52    
ref|XP_007207903.1|  hypothetical protein PRUPE_ppa020832mg             197   2e-52    
ref|XP_007047478.1|  Phototropic-responsive NPH3 family protein         199   2e-52    
ref|XP_010086959.1|  BTB/POZ domain-containing protein                  199   2e-52    
ref|XP_008652721.1|  PREDICTED: BTB/POZ domain-containing protein...    199   2e-52    
gb|KHN14527.1|  BTB/POZ domain-containing protein                       199   2e-52    
emb|CDX70320.1|  BnaA10g26690D                                          198   2e-52    
ref|XP_010087591.1|  Putative BTB/POZ domain-containing protein DOT3    199   2e-52    
ref|XP_009414871.1|  PREDICTED: BTB/POZ domain-containing protein...    198   3e-52    
ref|XP_009344771.1|  PREDICTED: BTB/POZ domain-containing protein...    199   3e-52    
ref|XP_010942829.1|  PREDICTED: BTB/POZ domain-containing protein...    199   3e-52    
gb|EEE59569.1|  hypothetical protein OsJ_11863                          197   3e-52    
ref|XP_004511862.1|  PREDICTED: BTB/POZ domain-containing protein...    199   3e-52    
ref|XP_010942827.1|  PREDICTED: BTB/POZ domain-containing protein...    199   3e-52    
ref|XP_010530706.1|  PREDICTED: BTB/POZ domain-containing protein...    199   3e-52    
ref|XP_004511860.1|  PREDICTED: BTB/POZ domain-containing protein...    199   3e-52    
ref|XP_002530034.1|  signal transducer, putative                        199   3e-52    
ref|XP_004509199.1|  PREDICTED: BTB/POZ domain-containing protein...    199   4e-52    
ref|XP_002534145.1|  protein binding protein, putative                  199   4e-52    
ref|XP_009362255.1|  PREDICTED: BTB/POZ domain-containing protein...    199   4e-52    
ref|XP_004511859.1|  PREDICTED: BTB/POZ domain-containing protein...    199   4e-52    
ref|XP_009373528.1|  PREDICTED: BTB/POZ domain-containing protein...    198   4e-52    
ref|XP_011086648.1|  PREDICTED: BTB/POZ domain-containing protein...    198   4e-52    
ref|XP_006398770.1|  hypothetical protein EUTSA_v10013087mg             197   4e-52    
ref|XP_002526612.1|  Root phototropism protein, putative                198   5e-52    
ref|XP_007015158.1|  BZIP domain class transcription factor             198   5e-52    
ref|XP_003597110.1|  Root phototropism protein                          198   6e-52    
ref|XP_010519572.1|  PREDICTED: BTB/POZ domain-containing protein...    198   6e-52    
ref|XP_004511857.1|  PREDICTED: BTB/POZ domain-containing protein...    199   6e-52    
ref|XP_001758126.1|  predicted protein                                  195   6e-52    
gb|EPS64717.1|  hypothetical protein M569_10065                         196   6e-52    
gb|KHG15697.1|  hypothetical protein F383_22812                         198   7e-52    
ref|XP_009414870.1|  PREDICTED: BTB/POZ domain-containing protein...    198   7e-52    
ref|XP_006650337.1|  PREDICTED: BTB/POZ domain-containing protein...    198   7e-52    
ref|XP_010056964.1|  PREDICTED: BTB/POZ domain-containing protein...    198   7e-52    
ref|NP_001280859.1|  BTB/POZ domain-containing protein At1g30440-...    198   7e-52    
gb|KFK31290.1|  hypothetical protein AALP_AA6G093300                    197   7e-52    
ref|XP_010238175.1|  PREDICTED: BTB/POZ domain-containing protein...    196   8e-52    
ref|XP_010028108.1|  PREDICTED: BTB/POZ domain-containing protein...    197   8e-52    
gb|ABR17518.1|  unknown                                                 198   9e-52    
ref|XP_010028107.1|  PREDICTED: BTB/POZ domain-containing protein...    197   9e-52    
ref|XP_006481239.1|  PREDICTED: BTB/POZ domain-containing protein...    197   9e-52    
ref|XP_009379310.1|  PREDICTED: BTB/POZ domain-containing protein...    197   9e-52    
ref|XP_003517336.1|  PREDICTED: BTB/POZ domain-containing protein...    197   1e-51    
ref|XP_006339816.1|  PREDICTED: BTB/POZ domain-containing protein...    197   1e-51    
gb|ABF97836.1|  transposon protein, putative, Mutator sub-class, ...    197   1e-51    
gb|KHN36285.1|  BTB/POZ domain-containing protein                       197   1e-51    
ref|XP_002973958.1|  hypothetical protein SELMODRAFT_51551              194   1e-51    
ref|XP_010028106.1|  PREDICTED: BTB/POZ domain-containing protein...    197   1e-51    
ref|XP_011015340.1|  PREDICTED: BTB/POZ domain-containing protein...    197   1e-51    
ref|XP_008800153.1|  PREDICTED: BTB/POZ domain-containing protein...    197   1e-51    
emb|CDP05630.1|  unnamed protein product                                197   1e-51    
ref|XP_010048297.1|  PREDICTED: BTB/POZ domain-containing protein...    197   1e-51    
gb|KHG12565.1|  BTB/POZ domain-containing NPY2 -like protein            197   1e-51    
ref|XP_002462390.1|  hypothetical protein SORBIDRAFT_02g024890          197   1e-51    
gb|ABF97835.1|  transposon protein, putative, Mutator sub-class, ...    197   1e-51    
ref|XP_010652068.1|  PREDICTED: BTB/POZ domain-containing protein...    195   1e-51    
ref|XP_006429637.1|  hypothetical protein CICLE_v10011315mg             196   2e-51    
ref|XP_008238282.1|  PREDICTED: BTB/POZ domain-containing protein...    197   2e-51    
gb|EPS70222.1|  hypothetical protein M569_04539                         186   2e-51    
ref|XP_009775884.1|  PREDICTED: BTB/POZ domain-containing protein...    197   2e-51    
ref|XP_008369258.1|  PREDICTED: BTB/POZ domain-containing protein...    199   2e-51    
ref|XP_009802565.1|  PREDICTED: putative BTB/POZ domain-containin...    196   2e-51    
ref|XP_002317350.2|  hypothetical protein POPTR_0011s09340g             196   2e-51    
ref|XP_003561994.1|  PREDICTED: BTB/POZ domain-containing protein...    196   2e-51    
ref|XP_007158393.1|  hypothetical protein PHAVU_002G149400g             197   2e-51    
gb|AAT85278.1|  NPH3 family protein                                     197   2e-51    
ref|XP_007208165.1|  hypothetical protein PRUPE_ppa002888mg             196   2e-51    
ref|XP_004970185.1|  PREDICTED: BTB/POZ domain-containing protein...    196   2e-51    
emb|CDP02432.1|  unnamed protein product                                197   3e-51    
ref|XP_006826702.1|  hypothetical protein AMTR_s00137p00096710          197   3e-51    
ref|XP_004137826.1|  PREDICTED: BTB/POZ domain-containing protein...    196   3e-51    
ref|XP_010490795.1|  PREDICTED: BTB/POZ domain-containing protein...    196   3e-51    
ref|XP_003552044.1|  PREDICTED: BTB/POZ domain-containing protein...    196   3e-51    
ref|XP_003577427.1|  PREDICTED: BTB/POZ domain-containing protein...    196   3e-51    
ref|XP_006846819.1|  hypothetical protein AMTR_s00148p00085230          196   3e-51    
ref|XP_007047953.1|  Root phototropism protein, putative                196   3e-51    
gb|EAZ09128.1|  hypothetical protein OsI_31397                          196   3e-51    
gb|KDP34960.1|  hypothetical protein JCGZ_09248                         196   4e-51    
ref|NP_001063200.1|  Os09g0420900                                       196   4e-51    
gb|KFK24776.1|  hypothetical protein AALP_AA8G023400                    195   4e-51    
ref|XP_002468311.1|  hypothetical protein SORBIDRAFT_01g043540          195   4e-51    
ref|XP_002969106.1|  hypothetical protein SELMODRAFT_90150              195   4e-51    
ref|XP_010921839.1|  PREDICTED: BTB/POZ domain-containing protein...    197   4e-51    
ref|XP_007155848.1|  hypothetical protein PHAVU_003G236800g             195   4e-51    
ref|XP_010558762.1|  PREDICTED: putative BTB/POZ domain-containin...    195   4e-51    
ref|XP_003578134.1|  PREDICTED: BTB/POZ domain-containing protein...    195   4e-51    
ref|XP_006359095.1|  PREDICTED: BTB/POZ domain-containing protein...    196   5e-51    
ref|XP_002464177.1|  hypothetical protein SORBIDRAFT_01g013680          196   5e-51    
gb|KHF98556.1|  hypothetical protein F383_12747                         196   5e-51    
ref|XP_011046734.1|  PREDICTED: BTB/POZ domain-containing protein...    196   5e-51    
ref|XP_010652067.1|  PREDICTED: BTB/POZ domain-containing protein...    194   5e-51    
ref|NP_001266239.1|  Hop-interacting protein THI063                     195   5e-51    
ref|XP_010652066.1|  PREDICTED: BTB/POZ domain-containing protein...    195   5e-51    
ref|XP_004137290.1|  PREDICTED: putative BTB/POZ domain-containin...    195   6e-51    
ref|XP_010424798.1|  PREDICTED: BTB/POZ domain-containing protein...    195   6e-51    
ref|XP_003536583.1|  PREDICTED: BTB/POZ domain-containing protein...    195   6e-51    
gb|EEC71596.1|  hypothetical protein OsI_03980                          196   6e-51    
ref|XP_004156559.1|  PREDICTED: putative BTB/POZ domain-containin...    195   6e-51    
ref|XP_002533158.1|  Root phototropism protein, putative                195   6e-51    
ref|XP_009340510.1|  PREDICTED: putative BTB/POZ domain-containin...    195   6e-51    
ref|XP_006857240.1|  hypothetical protein AMTR_s00065p00211770          195   6e-51    
ref|XP_001774594.1|  predicted protein                                  194   6e-51    
gb|KCW49991.1|  hypothetical protein EUGRSUZ_K03448                     195   6e-51    
ref|XP_002315306.2|  hypothetical protein POPTR_0010s23040g             195   7e-51    
ref|XP_004134651.1|  PREDICTED: BTB/POZ domain-containing protein...    195   7e-51    
gb|KDP44378.1|  hypothetical protein JCGZ_20058                         195   7e-51    
ref|XP_009405608.1|  PREDICTED: BTB/POZ domain-containing protein...    195   7e-51    
ref|XP_004164379.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...    195   7e-51    
ref|XP_010265570.1|  PREDICTED: BTB/POZ domain-containing protein...    194   7e-51    
ref|XP_010931398.1|  PREDICTED: BTB/POZ domain-containing protein...    194   8e-51    
ref|XP_010038175.1|  PREDICTED: BTB/POZ domain-containing protein...    195   8e-51    
gb|ACA64834.1|  SKIP interacting protein 17                             195   8e-51    
gb|KHG04804.1|  hypothetical protein F383_28791                         195   8e-51    
ref|XP_002281182.1|  PREDICTED: BTB/POZ domain-containing protein...    195   8e-51    
gb|ABA99392.2|  transposon protein, putative, Mutator sub-class, ...    195   9e-51    
ref|XP_003518074.1|  PREDICTED: BTB/POZ domain-containing protein...    195   9e-51    
ref|XP_008777297.1|  PREDICTED: BTB/POZ domain-containing protein...    194   9e-51    
dbj|BAD52854.1|  putative non-phototropic hypocotyl 3                   195   1e-50    
ref|NP_001130370.1|  putative phototropic-resoponsive NPH3 family...    194   1e-50    
ref|XP_010038174.1|  PREDICTED: BTB/POZ domain-containing protein...    194   1e-50    
ref|XP_008439559.1|  PREDICTED: BTB/POZ domain-containing protein...    194   1e-50    
ref|XP_004308784.1|  PREDICTED: BTB/POZ domain-containing protein...    194   1e-50    
ref|XP_011031728.1|  PREDICTED: BTB/POZ domain-containing protein...    194   1e-50    
ref|XP_010317782.1|  PREDICTED: BTB/POZ domain-containing protein...    194   1e-50    
ref|XP_002298828.2|  phototropic-responsive NPH3 family protein         194   1e-50    
ref|XP_002267241.2|  PREDICTED: BTB/POZ domain-containing protein...    194   1e-50    
ref|NP_195945.1|  phototropic-responsive NPH3 family protein            194   1e-50    
ref|XP_007156731.1|  hypothetical protein PHAVU_002G012500g             194   1e-50    
emb|CDX80858.1|  BnaC03g01120D                                          193   1e-50    
ref|XP_007033472.1|  Phototropic-responsive NPH3 family protein i...    194   1e-50    
ref|XP_010317781.1|  PREDICTED: BTB/POZ domain-containing protein...    194   1e-50    
ref|XP_010923665.1|  PREDICTED: BTB/POZ domain-containing protein...    194   2e-50    



>ref|XP_009624270.1| PREDICTED: root phototropism protein 3-like [Nicotiana tomentosiformis]
Length=431

 Score =   483 bits (1244),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 294/498 (59%), Positives = 333/498 (67%), Gaps = 75/498 (15%)
 Frame = -3

Query  1594  ALPESGTL--SSCKPMGECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKW  1421
             ALPE       S     ECWFDD CILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKW
Sbjct  5     ALPEPINFPGKSTHFSAECWFDDTCILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKW  64

Query  1420  LPELTggggseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDS  1241
             LP+L+ G GSE                +     ESV+A WMKKRFFVETL+GILPPEKDS
Sbjct  65    LPDLSTGEGSEV-----------LSPKNFEDSPESVTALWMKKRFFVETLVGILPPEKDS  113

Query  1240  IPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELV  1061
             IPCNFLLRLLRI NMV VE +YRAELEKRISWQL+QATL+ELMIPSFSHTCGT+LDVELV
Sbjct  114   IPCNFLLRLLRIANMVSVEPSYRAELEKRISWQLDQATLKELMIPSFSHTCGTLLDVELV  173

Query  1060  LRLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMS  881
             LRLVKRF+    D+A     SG++            LIKVAKLVD+YLAEAAVD+N T+S
Sbjct  174   LRLVKRFVNF--DEAVR---SGTA------------LIKVAKLVDNYLAEAAVDANFTLS  216

Query  880   QFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAA  701
             +FIALA   P HAR TDD LYR+IDTYLKAHPGV+K+ERK +C+LIDSRKLS EAS+HAA
Sbjct  217   EFIALAGAFPEHARATDDGLYRAIDTYLKAHPGVTKQERKSLCRLIDSRKLSPEASLHAA  276

Query  700   QNERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapgaq  521
             QNERLPVR VIQVLLSEQTKL+    +Q++WSG                     P  G  
Sbjct  277   QNERLPVRAVIQVLLSEQTKLNNN-KQQIDWSGSFIS-------------GTRSPNAGII  322

Query  520   qqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLEIssrkrgsss  341
               Q   RCMSKR+M   N+Q +EIK+LKE+VLRLQ+QC+ MQAQIEKLLE        S 
Sbjct  323   NDQPPARCMSKREM---NVQQMEIKRLKEDVLRLQSQCMTMQAQIEKLLEKKRGSSFFSW  379

Query  340   sgygffsswkkfGQLNKGIIITT--SSSKLGSEVegeggggniaaigggfGRQTPTPMDT  167
                             K II+ +     K+G          +     G  GRQ  TP+D 
Sbjct  380   ----------------KKIIVPSLVKHDKIGE--------VDRETDVGFIGRQ--TPVDM  413

Query  166   KARLVRGRTSTKWRKSLS  113
             K RLVRGRT  KWRKSLS
Sbjct  414   KTRLVRGRTPNKWRKSLS  431



>ref|XP_009804782.1| PREDICTED: root phototropism protein 3-like [Nicotiana sylvestris]
Length=430

 Score =   478 bits (1230),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 288/497 (58%), Positives = 330/497 (66%), Gaps = 76/497 (15%)
 Frame = -3

Query  1591  LPESGTL--SSCKPMGECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWL  1418
             LPES      S     ECWFDD CILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWL
Sbjct  6     LPESINFPGKSTHFSAECWFDDTCILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWL  65

Query  1417  PELTggggseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSI  1238
             P+L+ G GSE                +     ESV+A WMKKRFFVETL+GILPPEKDSI
Sbjct  66    PDLSTGEGSEV-----------LSPKNFEDSPESVTALWMKKRFFVETLVGILPPEKDSI  114

Query  1237  PCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVL  1058
             PCNFLLRLLR+ NMV VE +YRAELEKRISWQL+QATL+ELMIPSFSHTCGT+LDVELVL
Sbjct  115   PCNFLLRLLRVANMVQVEPSYRAELEKRISWQLDQATLKELMIPSFSHTCGTLLDVELVL  174

Query  1057  RLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQ  878
             RLVKRF+ +L++       SG++             IKVAKLVD+YLAEAAVD+NLT+S+
Sbjct  175   RLVKRFM-NLDEAVR----SGTAQ------------IKVAKLVDNYLAEAAVDANLTLSE  217

Query  877   FIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQ  698
             F+ALA   P HAR TDD LYR+IDTYLKAHPGV+K+ERK +C+LIDSRKLS EAS+HAAQ
Sbjct  218   FVALAGAFPEHARATDDGLYRAIDTYLKAHPGVTKQERKGLCRLIDSRKLSPEASLHAAQ  277

Query  697   NERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapgaqq  518
             NERLPVR VIQVLLSEQTKL+    +Q++WSG                 S          
Sbjct  278   NERLPVRAVIQVLLSEQTKLNNN-KQQIDWSGSFI--------------SGTRSPNAGIN  322

Query  517   qqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLEIssrkrgssss  338
              Q   RCMSKR+M   N+Q +EIK+LKE+VLRLQ+QC+ MQAQIEKL E        S  
Sbjct  323   DQPPARCMSKREM---NVQQMEIKRLKEDVLRLQSQCMAMQAQIEKLQEKKRGSSFFSW-  378

Query  337   gygffsswkkfGQLNKGIIITT--SSSKLGSEVegeggggniaaigggfGRQTPTPMDTK  164
                            K II+ +     K G          +     G  GRQ  TP+D K
Sbjct  379   ---------------KKIIVPSLVKHDKFGE--------VDRETDVGFIGRQ--TPVDMK  413

Query  163   ARLVRGRTSTKWRKSLS  113
              RLVRGR   KWRKSLS
Sbjct  414   TRLVRGRAPNKWRKSLS  430



>ref|XP_006341664.1| PREDICTED: root phototropism protein 3-like [Solanum tuberosum]
Length=436

 Score =   473 bits (1216),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 281/500 (56%), Positives = 326/500 (65%), Gaps = 72/500 (14%)
 Frame = -3

Query  1606  KMATALPESGTLS--SCKPMGECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHY  1433
             KM    PES  L+  S     ECWFDD CILDMDYFVKTLSGIKAKGVRPELIGSIITHY
Sbjct  7     KMMKLSPESVNLTGKSTHFSAECWFDDTCILDMDYFVKTLSGIKAKGVRPELIGSIITHY  66

Query  1432  ASKWLPELTggggseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPP  1253
             ASKWLP+L+   GSE          +           ESV+A WMKKRFFVETL+GILPP
Sbjct  67    ASKWLPDLSNDEGSE----------VFMGPKDFEDSPESVTAIWMKKRFFVETLVGILPP  116

Query  1252  EKDSIPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLD  1073
             EKDSIPCNFLLRLLR+ NMV VE +YR +LEKRISWQL+QA+L+EL+IPSF HTCGT+LD
Sbjct  117   EKDSIPCNFLLRLLRVANMVRVEPSYRVDLEKRISWQLDQASLKELLIPSFVHTCGTLLD  176

Query  1072  VELVLRLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSN  893
             VELVLRLVKRF          M    S  SG+        LIKVAKLVD+YLAEAAVD+N
Sbjct  177   VELVLRLVKRF----------MNLDESVRSGSA-------LIKVAKLVDNYLAEAAVDAN  219

Query  892   LTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEAS  713
             LT+++F  LA  +P HAR TDD LYR+IDTYLK HPGVSK+ERK +C+LIDSRKLS EAS
Sbjct  220   LTLTEFFGLADALPAHARYTDDGLYRAIDTYLKTHPGVSKQERKTLCRLIDSRKLSPEAS  279

Query  712   IHAAQNERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppa  533
             +HAAQNERLPVR +IQVLLSEQTK++K    Q++WSG                 S     
Sbjct  280   LHAAQNERLPVRAIIQVLLSEQTKVNKH---QIDWSGSFI--------------SGTRSP  322

Query  532   pgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLEIssrkr  353
                   +   RCMSKR+M   N+Q +EIK+LKE+VLRLQ+QC+ MQ+QIEKLLE      
Sbjct  323   NQLGLIEPPARCMSKREM---NVQQMEIKRLKEDVLRLQSQCMTMQSQIEKLLEKKRGSG  379

Query  352   gssssgygffsswkkfGQLNKGIIITTSSSKLGSEVegeggggniaaigggfGRQTPTPM  173
                                 K II+ +  +K+        G  +     G   RQTP   
Sbjct  380   LFGW----------------KKIIVPSLVNKVDK-----IGEIDRETDVGYVARQTPG--  416

Query  172   DTKARLVRGRTSTKWRKSLS  113
             D K RLVRGRT  KWRKSLS
Sbjct  417   DMKTRLVRGRTPNKWRKSLS  436



>ref|XP_004235724.1| PREDICTED: root phototropism protein 3-like [Solanum lycopersicum]
Length=429

 Score =   468 bits (1204),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 279/494 (56%), Positives = 322/494 (65%), Gaps = 72/494 (15%)
 Frame = -3

Query  1588  PESGTLS--SCKPMGECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLP  1415
             PES  L+  S     ECWFDD CILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLP
Sbjct  6     PESVNLTGKSTHFSAECWFDDTCILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLP  65

Query  1414  ELTggggseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIP  1235
             +L+   GS+    +                 ESV+A WMKKRFFVETL+GILPPEKDSIP
Sbjct  66    DLSNDEGSDVFTSQKDF----------EDSPESVTAIWMKKRFFVETLVGILPPEKDSIP  115

Query  1234  CNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLR  1055
             CNFLLRLLR+ NMV VE +YR +LEKRISWQL+QATL+EL+IPSF HTCGT+LDVELVLR
Sbjct  116   CNFLLRLLRVANMVRVEPSYRVDLEKRISWQLDQATLKELLIPSFVHTCGTLLDVELVLR  175

Query  1054  LVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQF  875
             LVKRF          M    S  SG+        LIKVAKL+D+YLAEAAVD+NLT S+F
Sbjct  176   LVKRF----------MNLDESVRSGSA-------LIKVAKLIDNYLAEAAVDANLTWSEF  218

Query  874   IALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQN  695
               L   +P HAR TDD LYR+IDTYLK HPGVSK+ERK +C+LIDSRKLS EAS+HAAQN
Sbjct  219   FGLVDALPAHARSTDDGLYRAIDTYLKTHPGVSKQERKTLCRLIDSRKLSLEASLHAAQN  278

Query  694   ERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapgaqqq  515
             ERLPVR VIQVLLSEQTK+++    Q++WSG                 S           
Sbjct  279   ERLPVRAVIQVLLSEQTKVNRH---QIDWSGSFV--------------SGARSPNQLGLI  321

Query  514   qqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLEIssrkrgssssg  335
             +   RCMSKR+MN    Q +EIK+LKE+VLRLQ+QC+ MQ+QIEKLLE            
Sbjct  322   EPPARCMSKREMNA---QQMEIKRLKEDVLRLQSQCMTMQSQIEKLLEKKRGSGLFGW--  376

Query  334   ygffsswkkfGQLNKGIIITTSSSKLGSEVegeggggniaaigggfGRQTPTPMDTKARL  155
                           K II+ +  +K+        G  +     G  GRQTP   D K RL
Sbjct  377   --------------KKIIVPSLVNKVDK-----IGEIDRETDVGYVGRQTPG--DMKTRL  415

Query  154   VRGRTSTKWRKSLS  113
             VRGRT  KWRKSLS
Sbjct  416   VRGRTPNKWRKSLS  429



>ref|XP_010099655.1| Coleoptile phototropism protein 1 [Morus notabilis]
 gb|EXB80176.1| Coleoptile phototropism protein 1 [Morus notabilis]
Length=461

 Score =   461 bits (1187),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 267/503 (53%), Positives = 334/503 (66%), Gaps = 59/503 (12%)
 Frame = -3

Query  1603  MATALPESGTLSSCKPMG------ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSII  1442
             +A    +S T     P+G      ECWFDDACILDMDYFVKTLSGIKAKGVRP+LIGSII
Sbjct  12    LAVVHEDSVTFPGKPPVGPHHFASECWFDDACILDMDYFVKTLSGIKAKGVRPDLIGSII  71

Query  1441  THYASKWLPELTggggseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGI  1262
             THYA KWLP+L+G   +  +          FEESS  SV       WM+KRFFVETL+G+
Sbjct  72    THYACKWLPDLSGDSSAFTTSSDKASAAAVFEESSPESVTAL----WMRKRFFVETLVGV  127

Query  1261  LPPEKDSIPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGT  1082
             LPPEKDSIPCNFLLRLLR  NMVGVE  YRAELE+RISWQL+QA+L+ELMIPSFSHTCGT
Sbjct  128   LPPEKDSIPCNFLLRLLRTANMVGVEPTYRAELERRISWQLDQASLKELMIPSFSHTCGT  187

Query  1081  VLDVELVLRLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAV  902
             +LD+ELV+RLVKRF V+L+D         ++ SGA        L+KVAKLVD YL+EAAV
Sbjct  188   LLDMELVIRLVKRF-VTLDD---------ATKSGAA-------LVKVAKLVDSYLSEAAV  230

Query  901   DSNLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSA  722
             D+NLTM++F+ALA  +P++AR  DD LYR++DTYLKAHP  SK ERK +C+LIDSRKLS 
Sbjct  231   DANLTMTEFVALAGALPSYARAMDDGLYRAVDTYLKAHPSASKHERKSLCRLIDSRKLSP  290

Query  721   EASIHAAQNERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpn  542
             EAS+HAAQNERLPVR VIQVL SEQ+KLS+ +    +W                   S +
Sbjct  291   EASLHAAQNERLPVRAVIQVLFSEQSKLSRNIN---DW-------------------SGS  328

Query  541   ppapgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLEIss  362
                  +     +PRCMSKR+M   ++Q +EI++LKE+VLRLQ+QC NMQ Q+E++ E   
Sbjct  329   FSGTRSPNLGLEPRCMSKREM---SVQQMEIRRLKEDVLRLQSQCNNMQVQMERMQE---  382

Query  361   rkrgssssgygffsswkkfGQLNKGIIITTSSSKLGSEVegeggggniaaigggfGRQTP  182
               +      +  +  +        G  ++   +K+  E   EG   +      GF RQ P
Sbjct  383   --KKQGGGYFFKWRRFGLLPSFKSGTAVSVVGNKI-DESHDEGDNDHEHHHVVGFERQAP  439

Query  181   TPMDTKARLVRGRTSTKWRKSLS  113
               M+ K +LVRGRT  KWR+S+S
Sbjct  440   M-MNMKTKLVRGRTPPKWRRSMS  461



>gb|KHG23249.1| Coleoptile phototropism 1 [Gossypium arboreum]
Length=421

 Score =   456 bits (1172),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 251/411 (61%), Positives = 299/411 (73%), Gaps = 56/411 (14%)
 Frame = -3

Query  1594  ALPESGTLSSCKPM---GECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASK  1424
             ALPES T    KPM    ECWFDDACILDMDYFVKT+SGIKAKGVRP+L+GSII HYASK
Sbjct  6     ALPESSTFPG-KPMPPTAECWFDDACILDMDYFVKTISGIKAKGVRPDLVGSIIAHYASK  64

Query  1423  WLPELTggggseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKD  1244
             WLP+L+G                K   S   S  ESV+ SWMKKRFFVETL+GILPPE+D
Sbjct  65    WLPDLSGNDTE------------KGPMSLQESSPESVTVSWMKKRFFVETLVGILPPERD  112

Query  1243  SIPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVEL  1064
             SIPCNFLLRLLR  NMVGVE +Y+AELEKRISWQL+QA+L+ELMIPSFSHTCGT+LDVEL
Sbjct  113   SIPCNFLLRLLRTANMVGVEPSYKAELEKRISWQLDQASLKELMIPSFSHTCGTLLDVEL  172

Query  1063  VLRLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTM  884
             V+RLVKRF  SL++        G+ S         + ++KVAKLVD YLAEAA+D+NL++
Sbjct  173   VIRLVKRF-ASLDE--------GTRS--------GIAVVKVAKLVDSYLAEAALDTNLSL  215

Query  883   SQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHA  704
               FIAL A +P+HAR  DD LYR+IDTYLKAHPGVSK++RK +C+LIDSRKLS EAS+HA
Sbjct  216   EDFIALGAALPSHARAMDDGLYRAIDTYLKAHPGVSKQDRKVLCRLIDSRKLSPEASLHA  275

Query  703   AQNERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapga  524
             AQNERLPVR VIQVL  EQ+KL+    R ++WSG    + S   +G   P          
Sbjct  276   AQNERLPVRAVIQVLFCEQSKLN----RHVDWSGSFNGTRSPNPAGLEAP----------  321

Query  523   qqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLE  371
                    RCMSKR+MN    Q +EIKKLKEE+LR+Q+QC+ MQ Q+EKL++
Sbjct  322   ------VRCMSKREMNA---QQMEIKKLKEELLRVQSQCVAMQMQMEKLVD  363



>emb|CDO98098.1| unnamed protein product [Coffea canephora]
Length=421

 Score =   452 bits (1163),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 271/497 (55%), Positives = 325/497 (65%), Gaps = 85/497 (17%)
 Frame = -3

Query  1594  ALPESGTLSSCKPM---GECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASK  1424
             ALPES T  + +      +CWFDDACILDMDYFVKT+SGIKAKGVRPELIGSII HY+SK
Sbjct  7     ALPESITTFAGRTTQFGADCWFDDACILDMDYFVKTVSGIKAKGVRPELIGSIIAHYSSK  66

Query  1423  WLPELTggggseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKD  1244
             WLP+L+G G             ++    +     +SV++SWMKKRFFVETL+GILPPEKD
Sbjct  67    WLPDLSGSGDE-----------VEKGLINLEESPDSVTSSWMKKRFFVETLVGILPPEKD  115

Query  1243  SIPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVEL  1064
             S+PC+FLLRLLR   MVGVE  +R ELEKRISWQL+QA+L++ MIPSFSHT GT+LDVEL
Sbjct  116   SVPCSFLLRLLRTACMVGVEPTFRVELEKRISWQLDQASLKDFMIPSFSHTSGTLLDVEL  175

Query  1063  VLRLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTM  884
              LRLVKRF+ +L++         +  SGA        L+KVAKLVD YLAEAAVDSNL +
Sbjct  176   ALRLVKRFL-NLDE---------TFRSGAA-------LMKVAKLVDSYLAEAAVDSNLAL  218

Query  883   SQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHA  704
             S FIALA  +P HAR  DD LYR+IDTYLKAH GVSK+ERK +C+LIDSRKLSAEAS+HA
Sbjct  219   SDFIALAGALPAHARSIDDGLYRAIDTYLKAHRGVSKQERKNLCRLIDSRKLSAEASLHA  278

Query  703   AQNERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapga  524
             AQNERLPVR VIQVL SEQTKL+K    Q++WSG                 S +      
Sbjct  279   AQNERLPVRAVIQVLFSEQTKLNK----QIDWSG-----------------SFSGTRSPN  317

Query  523   qqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLEIssrkrgss  344
                    RCMSKR+MN    Q LEIKKL+E+VLRLQ+ C+NMQ QIE+LLE         
Sbjct  318   MGLDPPARCMSKREMNA---QQLEIKKLREDVLRLQSHCMNMQGQIERLLE---------  365

Query  343   ssgygffsswkkfGQLNKGIIITTSSSKLGSEVegeggggniaaigggfGRQTPTPMDTK  164
                       K      K ++ +  ++KL +               G FGRQ  TP+D K
Sbjct  366   --------KKKGLFSWKKIVMPSFRANKLTN-----------VEGEGDFGRQ--TPVDVK  404

Query  163   ARLVRGRTSTKWRKSLS  113
              RLV+G+   KWR SLS
Sbjct  405   TRLVKGKKPPKWRNSLS  421



>ref|XP_008228629.1| PREDICTED: root phototropism protein 3-like [Prunus mume]
Length=426

 Score =   449 bits (1156),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 261/480 (54%), Positives = 309/480 (64%), Gaps = 75/480 (16%)
 Frame = -3

Query  1552  GECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiek  1373
              ECWFDDACILDMDYFVKTL+GIKAKGVRP+LIGSIITHYASKWLP+L+G          
Sbjct  22    AECWFDDACILDMDYFVKTLAGIKAKGVRPDLIGSIITHYASKWLPDLSGEA--------  73

Query  1372  gGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMV  1193
                L  +    S  S  ESV+A WM+KRFFVETL+G+LPPEKDSIPCNFLLRLLR  NMV
Sbjct  74    ---LSDQRSLISLQSSPESVTALWMRKRFFVETLVGVLPPEKDSIPCNFLLRLLRTANMV  130

Query  1192  GVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAA  1013
              VEA YRAELEKRISW+L+QA L+ELMIPSFSHTC T+LDVELV+RLVKRF V+L++ A 
Sbjct  131   AVEATYRAELEKRISWELDQALLKELMIPSFSHTCSTLLDVELVIRLVKRF-VNLDETA-  188

Query  1012  VMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPT  833
                      SGA        ++KVAKLVD YLAEAA+D+ L++++F ALA  +P+HAR T
Sbjct  189   --------KSGAA-------MVKVAKLVDCYLAEAAMDACLSLNEFAALAGAVPSHARAT  233

Query  832   DDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLS  653
             DD LYR+IDTYLKAHPGVSK++RK +C+LID RKLS EAS+HAAQNERLPVR VIQVL S
Sbjct  234   DDGLYRAIDTYLKAHPGVSKQDRKSLCRLIDCRKLSPEASLHAAQNERLPVRAVIQVLFS  293

Query  652   EQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapgaqqqqqdPRCMSKRDMNT  473
             EQ KL     RQ++WSG    S  +       P                 RC+SKR+MN 
Sbjct  294   EQNKLH----RQIDWSGSFSTSTRSPNPFLDAP----------------ARCLSKREMNA  333

Query  472   INIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLEIssrkrgssssgygffsswkkfGQLN  293
             +    +EI+KLKEEVLRLQ+QC +MQ Q E+                          +  
Sbjct  334   M---QMEIRKLKEEVLRLQSQCSSMQVQAER------------------------KEKKK  366

Query  292   KGIIITTSSSKLGSEVegeggggniaaigggfGRQTPTPMDTKARLVRGRTSTKWRKSLS  113
              GI   T +  +       G         G       TPMD K RLVR R + KWR SLS
Sbjct  367   AGIFKWTRNLGIMPSFRTTGVVKINEGGDGDVEYGKQTPMDMKTRLVRARATPKWRNSLS  426



>ref|XP_004506886.1| PREDICTED: root phototropism protein 3-like isoform X1 [Cicer 
arietinum]
Length=467

 Score =   451 bits (1160),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 265/482 (55%), Positives = 319/482 (66%), Gaps = 62/482 (13%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             ECWFDDACILDMDYFVKTLSGIKAKGVR +LIGSIITHYASKWLP+L+            
Sbjct  45    ECWFDDACILDMDYFVKTLSGIKAKGVRADLIGSIITHYASKWLPDLSTE----------  94

Query  1369  GHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMVG  1190
                  K       S  ESV+ASWMKKRFFVETL+ +LPPEKDSIPCNFLLRLLR  NMV 
Sbjct  95    -----KGLTQFEESSPESVTASWMKKRFFVETLVNVLPPEKDSIPCNFLLRLLRTANMVN  149

Query  1189  VEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAAV  1010
             V+  Y+ ELEKR+SWQL+QA+L+EL+IPSFSHTCGT+LDVELV+RLVKRF VSL+++ A 
Sbjct  150   VDVTYKQELEKRVSWQLDQASLKELVIPSFSHTCGTLLDVELVIRLVKRF-VSLDNEGA-  207

Query  1009  MRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPTD  830
                     SGA        L+KVAKLVD YLAEAAVD+NL++S+F+ LA  +P+HAR TD
Sbjct  208   -------KSGAA-------LVKVAKLVDCYLAEAAVDANLSLSEFVTLAGVLPSHARATD  253

Query  829   DALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLSE  650
             D LYR+IDTYLKAH  VSK+ERK +C+LID RKL+ EAS+HAAQNER PVR VIQVLLSE
Sbjct  254   DGLYRAIDTYLKAHSNVSKQERKGLCRLIDCRKLTQEASLHAAQNERFPVRAVIQVLLSE  313

Query  649   QTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapgaqqqqqdPRCMSKRDMNTI  470
             QTKL++    Q++WSG                 + +P      +     RC+SKR+M   
Sbjct  314   QTKLNRHNNHQMDWSGSIMSI------------TRSPTNGFGLEAVPTARCLSKREM---  358

Query  469   NIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLEIssrkrgssssgygffsswkkfGQLNK  290
             NIQ +EIKKLKE+V RLQ+QC  MQ Q+E+++E           G+  +S         K
Sbjct  359   NIQQMEIKKLKEDVHRLQSQCNTMQVQMERMVE--------KKKGFFKWSKRFSVNGFGK  410

Query  289   GIIITTSSSKLGSEVegeggggniaaigggfGRQTP-TPMDTKARL--VRGRTSTKWRKS  119
             G      +  +     G G  G         GRQTP T  D K RL  V+GRT  KWRKS
Sbjct  411   G-----DAGVVVERRGGGGEEGEDGDHVEFGGRQTPATTSDMKTRLVNVKGRTPNKWRKS  465

Query  118   LS  113
             +S
Sbjct  466   MS  467



>ref|XP_004486704.1| PREDICTED: root phototropism protein 3-like [Cicer arietinum]
Length=421

 Score =   449 bits (1154),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 255/478 (53%), Positives = 305/478 (64%), Gaps = 79/478 (17%)
 Frame = -3

Query  1546  CWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekgG  1367
             CWFDDACILDMDYFVKTLSGIKAKGVR +LIGSIITHYASKWLP+L+             
Sbjct  23    CWFDDACILDMDYFVKTLSGIKAKGVRADLIGSIITHYASKWLPDLSTE-----------  71

Query  1366  HLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMVGV  1187
                 K       S  ESV+ASWMKKRFFVETL+ +LPPEKDSIPCNFLLRLLR  NMV V
Sbjct  72    ----KGLTQFEESSPESVTASWMKKRFFVETLVNVLPPEKDSIPCNFLLRLLRTANMVNV  127

Query  1186  EAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAAVM  1007
             ++ Y+ +LE RISWQL+QA+L+ELMIPSFSHTCGT+LDVELV+RLVKRF V L+ +  + 
Sbjct  128   DSNYKTDLENRISWQLDQASLKELMIPSFSHTCGTLLDVELVIRLVKRF-VCLDHEGGIT  186

Query  1006  RCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPTDD  827
               +               L+KVAKLVD YLAE A+D+NL++SQF+ LAA +P+HARPTDD
Sbjct  187   TAA---------------LVKVAKLVDSYLAEVALDANLSLSQFVTLAASLPSHARPTDD  231

Query  826   ALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLSEQ  647
              LYR+IDTYLKAHP VSK+ERK +C+LIDSRKL+ EAS+HAAQNERLPVR VIQVL SEQ
Sbjct  232   CLYRAIDTYLKAHPSVSKQERKGLCRLIDSRKLTPEASLHAAQNERLPVRAVIQVLFSEQ  291

Query  646   TKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapgaqqqqqdPRCMSKRDMNTIN  467
             TKL+    R ++W               +        +          RC+SKR+MNT  
Sbjct  292   TKLN----RHIDW---------------SASFGSLRSSSVNGVFDTPARCLSKREMNT--  330

Query  466   IQHLEIKKLKEEVLRLQTQCINMQAQIEKLLEIssrkrgssssgygffsswkkfGQLNKG  287
              Q +EIKKLKE+V  LQ+QC  +QAQ+EK+ E   R       G+G             G
Sbjct  331   -QQMEIKKLKEDVYMLQSQCNALQAQMEKMAEKKKRFFKWKKLGFGKSV----------G  379

Query  286   IIITTSSSKLGSEVegeggggniaaigggfGRQTPTPMDTKARLVRGRTSTKWRKSLS  113
              I      ++ SE                      TPMD KA L +GRT  KW KSLS
Sbjct  380   EIENVEQQEVESEFGFGKQ----------------TPMDMKASLSKGRTPQKWGKSLS  421



>ref|XP_003531695.1| PREDICTED: coleoptile phototropism protein 1-like [Glycine max]
 gb|KHN47791.1| Coleoptile phototropism protein 1 [Glycine soja]
Length=445

 Score =   449 bits (1156),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 247/411 (60%), Positives = 293/411 (71%), Gaps = 55/411 (13%)
 Frame = -3

Query  1594  ALPESGTLSSCKPM---GECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASK  1424
             + PES T  +  P     ECWFDDACILDMDYFVKTLSGIKAKGVR +LIGSIITHYASK
Sbjct  29    SYPESLTFQAKSPSQFSSECWFDDACILDMDYFVKTLSGIKAKGVRADLIGSIITHYASK  88

Query  1423  WLPELTggggseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKD  1244
             WLP+L+ G  +E         + +FEES  S  A      WMKKRFFVETL+G+LPPEKD
Sbjct  89    WLPDLSAGDMAERG-------LTQFEESPESVTAS-----WMKKRFFVETLVGVLPPEKD  136

Query  1243  SIPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVEL  1064
             +IPCNFLLRLLR  NMVGVE  YR ELEKRISWQL+QA+L+EL+IPSFSHTCGT+LDVEL
Sbjct  137   AIPCNFLLRLLRTANMVGVEGTYRQELEKRISWQLDQASLKELVIPSFSHTCGTLLDVEL  196

Query  1063  VLRLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTM  884
             V+RLVKRF VSL+ + A         SGA       +L+KVAKLVD YLAEAAVD+NL++
Sbjct  197   VIRLVKRF-VSLDSEGA--------KSGA-------SLVKVAKLVDSYLAEAAVDANLSL  240

Query  883   SQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHA  704
             + F  LAA +P+HAR TDD LYR+IDTYLKAH GVSK+ERK +C+LIDSRKL+ EAS+HA
Sbjct  241   NDFFTLAAALPSHARATDDGLYRAIDTYLKAHSGVSKQERKGLCRLIDSRKLTPEASLHA  300

Query  703   AQNERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapga  524
             AQNER PVR VIQVLLSEQ+KL+    R ++WSG                 S        
Sbjct  301   AQNERFPVRAVIQVLLSEQSKLN----RHVDWSG-----------------SLVSGTRSP  339

Query  523   qqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLE  371
                    RC+SKR+ N    Q LEIK+LKE+V RLQ+QC  M AQ+E+++E
Sbjct  340   GGLDLPTRCLSKREANA---QQLEIKRLKEDVYRLQSQCSAMHAQMERMVE  387



>ref|XP_004302948.1| PREDICTED: root phototropism protein 3-like [Fragaria vesca subsp. 
vesca]
Length=431

 Score =   448 bits (1153),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 271/500 (54%), Positives = 329/500 (66%), Gaps = 84/500 (17%)
 Frame = -3

Query  1591  LPESGTLSSCKP---MGECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKW  1421
             LP+S +    KP     ECWFDDACILDMDYFVKTL+GIKAKGVRP+LIGSIITHYASKW
Sbjct  9     LPDSVSFPG-KPSPFAAECWFDDACILDMDYFVKTLAGIKAKGVRPDLIGSIITHYASKW  67

Query  1420  LPELTggggseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDS  1241
             LP+L+G   S++          K   ++  S  ESV+A WM+KRFFVETL+G+LPPEKD 
Sbjct  68    LPDLSGDVFSDQ----------KSSLTNFDSSPESVTALWMRKRFFVETLVGVLPPEKDC  117

Query  1240  IPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELV  1061
             IPCNFLLRLLR  NMVGVE +YRAELEKRISWQL+QA+L+ELMIPSFSHTCGT+LDVELV
Sbjct  118   IPCNFLLRLLRTANMVGVEPSYRAELEKRISWQLDQASLKELMIPSFSHTCGTLLDVELV  177

Query  1060  LRLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMS  881
             +RLVKRF V+L++ AA         SGA        ++KV KLVD YLAEAAVD NL++ 
Sbjct  178   IRLVKRF-VNLDESAA--------KSGAA-------MVKVGKLVDCYLAEAAVDVNLSLP  221

Query  880   QFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAA  701
             +F ALA  +P+HAR TDD LYR+IDTYLKAHPGVSK +RK +C+LIDSRKLS EAS+HAA
Sbjct  222   EFAALAGALPSHARATDDGLYRAIDTYLKAHPGVSKHDRKSLCRLIDSRKLSPEASLHAA  281

Query  700   QNERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapgaq  521
             QNERLPVR VIQVL SEQTKL     R ++WSG                 S +  +P   
Sbjct  282   QNERLPVRAVIQVLFSEQTKLH----RNIDWSGSF---------------SGSARSPNPL  322

Query  520   qqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLEIssrkrgsss  341
                   RC SKRDM+ +   H +I+ LK+EVLRLQ QC +MQ Q+E+             
Sbjct  323   ADPGATRCHSKRDMSNL---HTQIRSLKDEVLRLQIQCNSMQMQMER-------------  366

Query  340   sgygffsswkkfGQLNKGI----IITTSSSKLGSEVegeggggniaaigggfGRQTPTPM  173
                       K  +  KGI    +    S K G+ +       N +    G+G+QTP   
Sbjct  367   ----------KSREKKKGIFKWNVFGIPSLKSGNGL----VRLNESGEEVGYGKQTPA-T  411

Query  172   DTKARLVRGRTSTKWRKSLS  113
             D K +LV+GR + KWR S+S
Sbjct  412   DMKTKLVKGRVTPKWRNSMS  431



>ref|XP_010061951.1| PREDICTED: coleoptile phototropism protein 1 [Eucalyptus grandis]
 gb|KCW69000.1| hypothetical protein EUGRSUZ_F02560 [Eucalyptus grandis]
Length=437

 Score =   448 bits (1152),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 252/480 (53%), Positives = 320/480 (67%), Gaps = 66/480 (14%)
 Frame = -3

Query  1552  GECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiek  1373
              +CWFDDACILDMDYFVKT++ IKAKGVRP+L+GSII+HYASKWLPEL      +     
Sbjct  24    ADCWFDDACILDMDYFVKTVTAIKAKGVRPDLVGSIISHYASKWLPELAEDFPEKGGAA-  82

Query  1372  gGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMV  1193
                ++ +FE S  S+ A      WMKKRFFVETL+ ILPPE++SIPCNFLLRLLR  NMV
Sbjct  83    ---VLAEFEGSPESATAS-----WMKKRFFVETLVAILPPERNSIPCNFLLRLLRTANMV  134

Query  1192  GVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAA  1013
             G EA+YR ELE R+SWQLEQA+L+ELMIPSFSHTCGT+LD+EL+LRLV+RF VSLE +  
Sbjct  135   GAEASYRLELETRVSWQLEQASLKELMIPSFSHTCGTLLDIELILRLVERF-VSLEFEGG  193

Query  1012  VMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPT  833
                 SG++            LIKVAKLVD YLAEAAVDSNL++++F+ALA+ +P+ AR +
Sbjct  194   SGIKSGTA------------LIKVAKLVDCYLAEAAVDSNLSVAEFMALASVLPSQARSS  241

Query  832   DDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLS  653
             DD LYR+IDTYLKAHP  SK+ERKR+C L+DSRKLS EAS+HAAQNERLPVR+VIQVL S
Sbjct  242   DDGLYRAIDTYLKAHPNASKQERKRLCGLMDSRKLSPEASLHAAQNERLPVRSVIQVLFS  301

Query  652   EQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapgaqqqqqdPRCMSKRDMNT  473
             EQTKL+    R ++WSG    + S   +G   P                 RC+SKR+   
Sbjct  302   EQTKLN----RHVDWSGSFSSARSPNTAGLEPP----------------ARCLSKREAGA  341

Query  472   INIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLEIssrkrgssssgygffsswkkfGQLN  293
                Q  E++KL+EEV RLQ+QC +MQAQI+++LE  S+                      
Sbjct  342   ---QQGEVRKLREEVARLQSQCSSMQAQIDRMLEKKSKGFFRWKKI--------------  384

Query  292   KGIIITTSSSKLGSEVegeggggniaaigggfGRQTPTPMDTKARLVRGRTSTKWRKSLS  113
              G++ +++ + +G             +        T TP++ K RLV+GRT  KWRKS+S
Sbjct  385   -GLVPSSAKNSVG------VAERVDESDQVEASFGTFTPVNMKTRLVKGRTPPKWRKSMS  437



>ref|XP_011035630.1| PREDICTED: root phototropism protein 3-like [Populus euphratica]
Length=437

 Score =   447 bits (1150),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 245/413 (59%), Positives = 296/413 (72%), Gaps = 55/413 (13%)
 Frame = -3

Query  1600  ATALPES---GTLSSCKPMGECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYA  1430
             A + PES     L + +   ECWFDDACILDMDYF KTL+GIKAKGVRP+ IGSII HYA
Sbjct  3     AASFPESVLSSGLKTSQFAAECWFDDACILDMDYFAKTLAGIKAKGVRPDFIGSIIAHYA  62

Query  1429  SKWLPELTggggseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPE  1250
             SKWLP+L+G            HL      ++     ESV+A WMKKRFFVETL+GILPPE
Sbjct  63    SKWLPDLSGD-----------HLSSNKGLANYEESPESVTALWMKKRFFVETLVGILPPE  111

Query  1249  KDSIPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDV  1070
             KDSIPC+FLLRLLRI NMV VE AYRAELEKRISWQL+QA+L+EL+IPSFSHTCGT+LDV
Sbjct  112   KDSIPCSFLLRLLRIANMVSVEPAYRAELEKRISWQLDQASLKELLIPSFSHTCGTLLDV  171

Query  1069  ELVLRLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNL  890
             EL++RLV RF VSL++ A          SGA        LIKVAKLVD YLAEAAVDSNL
Sbjct  172   ELIIRLVGRF-VSLDEVA---------KSGAA-------LIKVAKLVDSYLAEAAVDSNL  214

Query  889   TMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASI  710
             ++S+F+ALA  +P+HAR TDD LYR++DTYLKAHPG+SK+ERK + +LIDSRKLS EAS+
Sbjct  215   SLSEFVALAGALPSHARATDDGLYRAVDTYLKAHPGLSKQERKALFRLIDSRKLSQEASL  274

Query  709   HAAQNERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppap  530
             HAAQNERLPVR VIQVL SEQTKL+    RQ++WSG                 S +    
Sbjct  275   HAAQNERLPVRAVIQVLYSEQTKLN----RQIDWSG-----------------SFSGARS  313

Query  529   gaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLE  371
              +   +   R +SKR  +    Q +EI+KL+E+VLRL++QC  MQ Q+E++LE
Sbjct  314   PSLGFEAPARLLSKRGTSD---QQMEIRKLREDVLRLESQCYVMQMQMERMLE  363



>ref|XP_007023976.1| Phototropic-responsive NPH3 family protein [Theobroma cacao]
 gb|EOY26598.1| Phototropic-responsive NPH3 family protein [Theobroma cacao]
Length=423

 Score =   446 bits (1147),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 245/408 (60%), Positives = 294/408 (72%), Gaps = 54/408 (13%)
 Frame = -3

Query  1594  ALPESGTLSSCKPMGECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLP  1415
             AL ES T  + +   +CWFDDACILDMDYFVKT+SGIKAKGVRP+LIGSII HYASKWLP
Sbjct  6     ALQESITFPT-QSAPDCWFDDACILDMDYFVKTISGIKAKGVRPDLIGSIIAHYASKWLP  64

Query  1414  ELTggggseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIP  1235
             +L+                 K   +   S  ESV+ASWMKKRFFVETL+GILPPE+DS+P
Sbjct  65    DLSSNNTE------------KGLTNFEESSPESVTASWMKKRFFVETLVGILPPERDSVP  112

Query  1234  CNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLR  1055
             CNFLLRLLR  NMVGVE +YRAELEKRISWQL+QA+L+ELMIPSFSHTCGT+LDVELV+R
Sbjct  113   CNFLLRLLRTANMVGVEPSYRAELEKRISWQLDQASLKELMIPSFSHTCGTLLDVELVIR  172

Query  1054  LVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQF  875
             LVKRF  SL++ A          SGA        L+K AKLVD YLAEAA+D+NL++ +F
Sbjct  173   LVKRF-ASLDEGA---------RSGA-------ALVKAAKLVDCYLAEAALDTNLSLDEF  215

Query  874   IALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQN  695
             IAL   +P+HAR  DD LYR+IDTYLKAHPGV K++RK +C+LIDSRKLS EAS+HAAQN
Sbjct  216   IALGGALPSHARAMDDGLYRAIDTYLKAHPGVPKQDRKVLCRLIDSRKLSPEASLHAAQN  275

Query  694   ERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapgaqqq  515
             ERLPVR VIQVL SEQTKLS    R ++WSG                 S +         
Sbjct  276   ERLPVRAVIQVLFSEQTKLS----RHIDWSG-----------------SFSGTRSPNPGL  314

Query  514   qqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLE  371
             +   RC+SKR+MN    Q +EIKKLKE++L++Q+QCI MQ Q+EK+L+
Sbjct  315   EAPARCLSKREMNA---QQMEIKKLKEDLLKVQSQCIAMQMQMEKMLD  359



>ref|XP_003529816.2| PREDICTED: coleoptile phototropism protein 1-like [Glycine max]
Length=446

 Score =   446 bits (1148),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 244/408 (60%), Positives = 291/408 (71%), Gaps = 55/408 (13%)
 Frame = -3

Query  1588  PESGTLSSCKPM---GECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWL  1418
             PES  L +  P     ECWFDDACILDMDYFVKTLSGIKAKGVR +LIG IITHYASKWL
Sbjct  30    PESLILQAKSPSQFSSECWFDDACILDMDYFVKTLSGIKAKGVRADLIGFIITHYASKWL  89

Query  1417  PELTggggseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSI  1238
             P+L+ G  +E+        + +FEES  S  A      WMKKRFFVETL+G+LPPEKD+I
Sbjct  90    PDLSAGDMAEKG-------LTQFEESPESVTAS-----WMKKRFFVETLVGVLPPEKDAI  137

Query  1237  PCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVL  1058
             PCNFLLRLLR  NMVGVE  YR ELEKRISWQL+QA+L+EL+IPSFSHTCGT+LDVELV+
Sbjct  138   PCNFLLRLLRTANMVGVEGTYRQELEKRISWQLDQASLKELVIPSFSHTCGTLLDVELVI  197

Query  1057  RLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQ  878
             RLVKRF VSL+ + A    S               L+KVAKLVD YLAEAAVD+NL+ + 
Sbjct  198   RLVKRF-VSLDSEGAKSVAS---------------LVKVAKLVDSYLAEAAVDANLSFND  241

Query  877   FIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQ  698
             F+ LAA +P+HAR TDD LYR+IDTYLKAHPGVSK+ERK +C+LIDSRKL+AEAS+HAAQ
Sbjct  242   FVTLAAALPSHARATDDGLYRAIDTYLKAHPGVSKQERKGLCRLIDSRKLTAEASLHAAQ  301

Query  697   NERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapgaqq  518
             NER PVR VIQVLLSEQ+KL+    R ++WSG                 S          
Sbjct  302   NERFPVRAVIQVLLSEQSKLN----RHVDWSG-----------------SLVSVTRSPGG  340

Query  517   qqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKLL  374
                  RC+SKR+   +N Q LEI++LKE+V RLQ+ C  MQAQ+E+++
Sbjct  341   LDLPTRCLSKRE---VNAQQLEIRRLKEDVYRLQSHCNAMQAQMERMV  385



>ref|XP_007135723.1| hypothetical protein PHAVU_010G152800g [Phaseolus vulgaris]
 gb|ESW07717.1| hypothetical protein PHAVU_010G152800g [Phaseolus vulgaris]
Length=444

 Score =   446 bits (1147),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 240/409 (59%), Positives = 291/409 (71%), Gaps = 55/409 (13%)
 Frame = -3

Query  1588  PESGTLSSCKPM---GECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWL  1418
             PES TL +  P     ECWFDDACILDMDYFVKTLSGIKAKGVR +LIGSIITHYASKWL
Sbjct  29    PESLTLQAKSPSQYSSECWFDDACILDMDYFVKTLSGIKAKGVRADLIGSIITHYASKWL  88

Query  1417  PELTggggseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSI  1238
             P+L+ G             +++   +      ESV+ASWMKKRFFVETL+G+LPPEKD+I
Sbjct  89    PDLSAGD------------MVEKGLTQFEESQESVTASWMKKRFFVETLVGVLPPEKDAI  136

Query  1237  PCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVL  1058
             PCNFLLRLLR  NMVGVE  YR ELE RISWQL+QA+L+EL+IPSFSHTCGT+LDVELV+
Sbjct  137   PCNFLLRLLRTANMVGVEGTYRQELENRISWQLDQASLKELVIPSFSHTCGTLLDVELVI  196

Query  1057  RLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQ  878
             RLV+RF VSL+ + A    S               +IKVAKLVD YLAEAAVD+NL+++ 
Sbjct  197   RLVQRF-VSLDSEGAKSVAS---------------MIKVAKLVDSYLAEAAVDANLSLND  240

Query  877   FIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQ  698
             F+ LAA +P+H+R TDD LYR+IDTYLKAHP VSK+ERK +C+LIDSRKL+ EAS+HAAQ
Sbjct  241   FVTLAAALPSHSRATDDGLYRAIDTYLKAHPAVSKQERKGLCRLIDSRKLTPEASLHAAQ  300

Query  697   NERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapgaqq  518
             NER PVR VIQVLLSEQ+KL+    R ++WSG                 S          
Sbjct  301   NERFPVRAVIQVLLSEQSKLT----RHVDWSG-----------------SLVSGTRSPSA  339

Query  517   qqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLE  371
                  RC+SKR+   +N Q  EI+KLK++V RLQ+QC  MQAQ+E+++E
Sbjct  340   LDLPTRCLSKRE---VNAQQHEIRKLKDDVYRLQSQCNAMQAQMERMVE  385



>ref|XP_004506887.1| PREDICTED: root phototropism protein 3-like isoform X2 [Cicer 
arietinum]
Length=457

 Score =   446 bits (1148),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 238/393 (61%), Positives = 286/393 (73%), Gaps = 46/393 (12%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             ECWFDDACILDMDYFVKTLSGIKAKGVR +LIGSIITHYASKWLP+L+            
Sbjct  45    ECWFDDACILDMDYFVKTLSGIKAKGVRADLIGSIITHYASKWLPDLSTE----------  94

Query  1369  GHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMVG  1190
                  K       S  ESV+ASWMKKRFFVETL+ +LPPEKDSIPCNFLLRLLR  NMV 
Sbjct  95    -----KGLTQFEESSPESVTASWMKKRFFVETLVNVLPPEKDSIPCNFLLRLLRTANMVN  149

Query  1189  VEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAAV  1010
             V+  Y+ ELEKR+SWQL+QA+L+EL+IPSFSHTCGT+LDVELV+RLVKRF VSL+++ A 
Sbjct  150   VDVTYKQELEKRVSWQLDQASLKELVIPSFSHTCGTLLDVELVIRLVKRF-VSLDNEGA-  207

Query  1009  MRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPTD  830
                     SGA        L+KVAKLVD YLAEAAVD+NL++S+F+ LA  +P+HAR TD
Sbjct  208   -------KSGAA-------LVKVAKLVDCYLAEAAVDANLSLSEFVTLAGVLPSHARATD  253

Query  829   DALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLSE  650
             D LYR+IDTYLKAH  VSK+ERK +C+LID RKL+ EAS+HAAQNER PVR VIQVLLSE
Sbjct  254   DGLYRAIDTYLKAHSNVSKQERKGLCRLIDCRKLTQEASLHAAQNERFPVRAVIQVLLSE  313

Query  649   QTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapgaqqqqqdPRCMSKRDMNTI  470
             QTKL++    Q++WSG                 + +P      +     RC+SKR+M   
Sbjct  314   QTKLNRHNNHQMDWSGSIMSI------------TRSPTNGFGLEAVPTARCLSKREM---  358

Query  469   NIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLE  371
             NIQ +EIKKLKE+V RLQ+QC  MQ Q+E+++E
Sbjct  359   NIQQMEIKKLKEDVHRLQSQCNTMQVQMERMVE  391



>ref|XP_006427150.1| hypothetical protein CICLE_v10025646mg [Citrus clementina]
 gb|ESR40390.1| hypothetical protein CICLE_v10025646mg [Citrus clementina]
 gb|KDO58238.1| hypothetical protein CISIN_1g013895mg [Citrus sinensis]
Length=434

 Score =   445 bits (1145),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 264/484 (55%), Positives = 310/484 (64%), Gaps = 77/484 (16%)
 Frame = -3

Query  1552  GECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiek  1373
              ECWFDDACILDMDYFVKT+SGIKAKGVRP+LIGSII HYASKWLP+L     ++     
Sbjct  21    AECWFDDACILDMDYFVKTISGIKAKGVRPDLIGSIIAHYASKWLPDLAYEDANKG----  76

Query  1372  gGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMV  1193
                 +  FEES  S  A      WMKKRFFVETL+GILPPEKDS+PCNF LRLLR  NMV
Sbjct  77    ----LTNFEESPESVTAS-----WMKKRFFVETLVGILPPEKDSLPCNFFLRLLRTANMV  127

Query  1192  GVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAA  1013
              VE AYR ELEKRISWQL+QA+L+ELMIPSFSHTCGT+LDVELV RLVK+F+        
Sbjct  128   NVEPAYREELEKRISWQLDQASLKELMIPSFSHTCGTLLDVELVSRLVKKFVH-------  180

Query  1012  VMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPT  833
              +   G+ S  A        L+KVAKLVD YLAEAA+DSNL++S+F+ALA  +P+HAR T
Sbjct  181   -LDIEGAKSGAA--------LVKVAKLVDCYLAEAAMDSNLSLSEFVALAGALPSHARAT  231

Query  832   DDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLS  653
             DD LYR+IDTYLKAHP V+K+ERK +C+LIDSRKLS EAS+HAAQN+RLPVR VIQVL S
Sbjct  232   DDGLYRAIDTYLKAHPEVTKQERKSLCRLIDSRKLSPEASLHAAQNDRLPVRAVIQVLFS  291

Query  652   EQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapgaqqqqqdPRCMSKRDMNT  473
             EQ KL+K    QL+WSG      S                          RC+SKR+   
Sbjct  292   EQAKLNK----QLDWSGSFSGIRSPNIGFDPS----------------AARCLSKRE---  328

Query  472   INIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLEIssrkrgssssgygffsswkkfGQLN  293
             +  Q +EI+KL+EEVLRLQ+QC  MQ QIEKL+E                          
Sbjct  329   VGAQQMEIRKLREEVLRLQSQCNAMQVQIEKLVEKKKGTFFRWKKL--------------  374

Query  292   KGIIITTSSSKLGSEVegeggggniaaigggfGRQTPTPMDTKARLVRGRTST-----KW  128
              GII    S K GS    +            FGRQ  TP+D K +LVRG+ S      +W
Sbjct  375   -GII---PSIKSGSISVVDRIVEGDREGEAAFGRQ--TPIDLKTKLVRGKNSNTPKHRQW  428

Query  127   RKSL  116
             RKSL
Sbjct  429   RKSL  432



>ref|XP_006465407.1| PREDICTED: coleoptile phototropism protein 1-like [Citrus sinensis]
Length=434

 Score =   445 bits (1145),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 268/499 (54%), Positives = 316/499 (63%), Gaps = 81/499 (16%)
 Frame = -3

Query  1588  PESGTLSSCKPM---GECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWL  1418
             P+S T    KP     ECWFDDACILDMDYFVKT+SGIKAKGVRP+LIGSII HYASKWL
Sbjct  7     PDSVTFPG-KPTQFSAECWFDDACILDMDYFVKTISGIKAKGVRPDLIGSIIAHYASKWL  65

Query  1417  PELTggggseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSI  1238
             P+L     ++         +  FEES  S  A      WMKKRFFVETL+GILPPEKDS+
Sbjct  66    PDLAYEDANKG--------LTNFEESPESVTAS-----WMKKRFFVETLVGILPPEKDSL  112

Query  1237  PCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVL  1058
             PCNF LRLLR  NMV VE AYR ELEKRISWQL+QA+L+ELMIPSFSHTCGT+LDVELV 
Sbjct  113   PCNFFLRLLRTANMVNVEPAYREELEKRISWQLDQASLKELMIPSFSHTCGTLLDVELVS  172

Query  1057  RLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQ  878
             RLVK+F+         +   G+ S  A        L+KVAKLVD YLAEAA+DSNL++S+
Sbjct  173   RLVKKFVH--------LDIEGAKSGAA--------LVKVAKLVDCYLAEAAMDSNLSLSE  216

Query  877   FIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQ  698
             F+ALA  +P+HAR TDD LYR+IDTYLKAHP V+K+ERK +C+LIDSRKLS EAS+HAAQ
Sbjct  217   FVALAGALPSHARATDDGLYRAIDTYLKAHPEVTKQERKSLCRLIDSRKLSPEASLHAAQ  276

Query  697   NERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapgaqq  518
             N+RLPVR VIQVL SEQ KL+K    QL+WSG      S                     
Sbjct  277   NDRLPVRAVIQVLFSEQAKLNK----QLDWSGSFSGIRSPNVGFDPS-------------  319

Query  517   qqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLEIssrkrgssss  338
                  RC+SKR+   +  Q +EI+KL+EEVLRLQ+QC  MQ QIEKL+E           
Sbjct  320   ---AARCLSKRE---VGAQQMEIRKLREEVLRLQSQCNAMQVQIEKLVEKKKGAFFRWKK  373

Query  337   gygffsswkkfGQLNKGIIITTSSSKLGSEVegeggggniaaigggfGRQTPTPMDTKAR  158
                             GII    S K G+    +            FGRQ  TP+D K +
Sbjct  374   L---------------GII---PSIKSGAISVVDRIEEGDREGEAAFGRQ--TPIDLKTK  413

Query  157   LVRGRTST-----KWRKSL  116
             LVRG+ S      +WRKSL
Sbjct  414   LVRGKNSNTPKHRQWRKSL  432



>gb|KHN01356.1| Coleoptile phototropism protein 1 [Glycine soja]
Length=446

 Score =   445 bits (1145),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 244/408 (60%), Positives = 291/408 (71%), Gaps = 55/408 (13%)
 Frame = -3

Query  1588  PESGTLSSCKPM---GECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWL  1418
             PES  L +  P     ECWFDDACILDMDYFVKTLSGIKAKGVR +LIG IITHYASKWL
Sbjct  30    PESLILQAKSPSQFSSECWFDDACILDMDYFVKTLSGIKAKGVRADLIGFIITHYASKWL  89

Query  1417  PELTggggseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSI  1238
             P+L+ G  +E+        + +FEES  S  A      WMKKRFFVETL+G+LPPEKD+I
Sbjct  90    PDLSAGDMAEKG-------LTQFEESPESVTAS-----WMKKRFFVETLVGVLPPEKDAI  137

Query  1237  PCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVL  1058
             PCNFLLRLLR  NMVGVE  YR ELEKRISWQL+QA+L+EL+IPSFSHTCGT+LDVELV+
Sbjct  138   PCNFLLRLLRTANMVGVEGTYRQELEKRISWQLDQASLKELVIPSFSHTCGTLLDVELVI  197

Query  1057  RLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQ  878
             RLVKRF VSL+ + A    S               L+KVAKLVD YLAEAAVD+NL+ + 
Sbjct  198   RLVKRF-VSLDSEGAKSVAS---------------LVKVAKLVDSYLAEAAVDANLSFND  241

Query  877   FIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQ  698
             F+ LAA +P+HAR TDD LYR+IDTYLKAHPGVSK+ERK +C+LIDSRKL+AEAS+HAAQ
Sbjct  242   FVTLAAALPSHARATDDGLYRAIDTYLKAHPGVSKQERKGLCRLIDSRKLTAEASLHAAQ  301

Query  697   NERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapgaqq  518
             NER PVR VIQVLLSEQ+KL+    R ++WSG                 S          
Sbjct  302   NERFPVRAVIQVLLSEQSKLN----RHVDWSG-----------------SLVCVTRSPGG  340

Query  517   qqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKLL  374
                  RC+SKR+   +N Q LEI++LKE+V RLQ+ C  MQAQ+E+++
Sbjct  341   LDLPTRCLSKRE---VNAQQLEIRRLKEDVYRLQSHCNAMQAQMERMV  385



>ref|XP_010254275.1| PREDICTED: coleoptile phototropism protein 1-like [Nelumbo nucifera]
Length=424

 Score =   444 bits (1143),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 266/479 (56%), Positives = 319/479 (67%), Gaps = 77/479 (16%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             E WFDDACILDMDYFVKTLSGIKAKGVRP+LIGSII HYASKWLP+L+G   + + +   
Sbjct  23    EYWFDDACILDMDYFVKTLSGIKAKGVRPDLIGSIIAHYASKWLPDLSGDDANSKGLT--  80

Query  1369  GHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMVG  1190
              H              ESV+ASWMKKRFFVETL GILPPEKDS+PCNFLLRLLRIGNMVG
Sbjct  81    -HF---------EESPESVTASWMKKRFFVETLAGILPPEKDSVPCNFLLRLLRIGNMVG  130

Query  1189  VEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAAV  1010
             +E AYRAELEKRIS QL+QA+L+ELMIP+FSHTCGT+LDVELVLRLV R  V+L++ A  
Sbjct  131   IEPAYRAELEKRISCQLDQASLKELMIPAFSHTCGTLLDVELVLRLV-RLFVNLDEAA--  187

Query  1009  MRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPTD  830
                     SGA        L+KVAKLVD YLAEAAVD+NLT+ +F ALA  +P+HAR  D
Sbjct  188   -------KSGA-------ALVKVAKLVDSYLAEAAVDANLTLPEFTALAGALPSHARAMD  233

Query  829   DALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLSE  650
             D LYR++DTYL+AHP +SK+ERK +C+LIDSRKLS +AS+HAAQN+RLPVR VIQVL SE
Sbjct  234   DGLYRAVDTYLRAHPSLSKQERKSLCRLIDSRKLSPDASLHAAQNDRLPVRAVIQVLFSE  293

Query  649   QTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapgaqqqqqdPRCMSKRDMNTI  470
              TK++    R L+W           +S  + PRS           +   RCMSKRDM   
Sbjct  294   HTKIN----RHLDW-----------SSSFSGPRS------PNPAVEPPARCMSKRDMTA-  331

Query  469   NIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLEIssrkrgssssgygffsswkkfGQLNK  290
               Q +EIK+L+E+VLRLQ QC +MQAQI++L+E                    K     K
Sbjct  332   --QQIEIKRLREDVLRLQRQCNSMQAQIDRLME--------------------KKKSFFK  369

Query  289   GIIITTSSSKLGSEVegeggggniaaigggfGRQTPTPMDTKARLVRGRTSTKWRKSLS  113
                +     K GS   GE           GF R+TP  MD K +LV+GR + KWRKS+S
Sbjct  370   WRKLGMPLFKPGS--VGEKDEEVEGEGEVGFERRTP--MDMKTKLVQGRITPKWRKSMS  424



>gb|KDP37156.1| hypothetical protein JCGZ_06212 [Jatropha curcas]
Length=461

 Score =   446 bits (1146),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 275/514 (54%), Positives = 335/514 (65%), Gaps = 91/514 (18%)
 Frame = -3

Query  1612  ELKMATALPESGTLSSCKP---MGECWFDD-ACILDMDYFVKTLSGIKAKGVRPELIGSI  1445
             ++K  +  P+S T    KP     ECWFDD ACIL+MDYFVKTL+GIKAKGVRP+LIGSI
Sbjct  25    QMKKVSTQPDSVTFPG-KPSQFAAECWFDDDACILNMDYFVKTLAGIKAKGVRPDLIGSI  83

Query  1444  ITHYASKWLPELTggggseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIG  1265
             I HYASKWLPEL+   G           +  FEES  S  A      WMKKRFFVETL+ 
Sbjct  84    IAHYASKWLPELSSETGERG--------LTNFEESPESVTAS-----WMKKRFFVETLVS  130

Query  1264  ILPPEKDSIPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCG  1085
             +LPPEKD+IPCNFLLRLLR  NMVG+E  YRAELEKRISWQL+QA+L+ELMIPSFSHTCG
Sbjct  131   VLPPEKDAIPCNFLLRLLRTANMVGIEPTYRAELEKRISWQLDQASLKELMIPSFSHTCG  190

Query  1084  TVLDVELVLRLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAA  905
             T+LDVELV RLVKRF+ +L++ A   + +G++S           LIKVAKLVD YLAEAA
Sbjct  191   TLLDVELVTRLVKRFL-NLDEAA---KSTGAAS-----------LIKVAKLVDCYLAEAA  235

Query  904   VDSNLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLS  725
             VD+NL++S+F  LA+ +P+HAR TDD LYR+IDTYLKAHPG SK+ERK +C+LIDSRKLS
Sbjct  236   VDANLSLSEFDDLASALPSHARATDDGLYRAIDTYLKAHPGTSKQERKSICRLIDSRKLS  295

Query  724   AEASIHAAQNERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSp  545
              EAS+HAAQNERLPVR VIQVL SEQ+ LS    R ++WSG                 S 
Sbjct  296   PEASLHAAQNERLPVRAVIQVLFSEQSNLS----RHVDWSG-----------------SF  334

Query  544   nppapgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLEIs  365
                       +Q    +SKR+   IN Q +EIKKLKE+VLRLQ QC+ MQ Q+E+++E  
Sbjct  335   IGTRSPNLGFEQPGGSISKRE---INAQQMEIKKLKEDVLRLQGQCLAMQMQMERMIE--  389

Query  364   srkrgssssgygffsswkkfGQLNKGI-----IITTSSSKLGSEVegeggggniaaiggg  200
                                  + NKG      +   SSSK G+ V  +G  G     G  
Sbjct  390   ---------------------RKNKGFFRWKKLGIMSSSKNGNTVAEKGEEGGGDNGGEV  428

Query  199   f---GRQTPTPMDTKARLVRGRTST--KWRKSLS  113
                 GRQ+ TP+D K RLV+GR +   KWR+S+S
Sbjct  429   EIGFGRQS-TPVDMKTRLVKGRPTPHHKWRRSMS  461



>ref|XP_007215428.1| hypothetical protein PRUPE_ppa006135mg [Prunus persica]
 gb|EMJ16627.1| hypothetical protein PRUPE_ppa006135mg [Prunus persica]
Length=426

 Score =   444 bits (1142),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 265/496 (53%), Positives = 312/496 (63%), Gaps = 79/496 (16%)
 Frame = -3

Query  1591  LPESGTLSSCKP---MGECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKW  1421
             L ES TL   KP     ECWFDD CILDMDYFVKTL+GIKAKGVRP+LIGSIITHYASKW
Sbjct  7     LQESVTLPG-KPSPFAAECWFDDTCILDMDYFVKTLAGIKAKGVRPDLIGSIITHYASKW  65

Query  1420  LPELTggggseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDS  1241
             LP+L+G             L  +    S  S  ESV+A WM+KRFFVETL+G+LPPEKDS
Sbjct  66    LPDLSGEA-----------LSDQRSLISLESSPESVTALWMRKRFFVETLVGVLPPEKDS  114

Query  1240  IPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELV  1061
             IPCNFLLRLLR  NMVGVE  YRAELEKRISWQL+QA L+ELMIPSFSHTCGT+LDVELV
Sbjct  115   IPCNFLLRLLRTANMVGVEPTYRAELEKRISWQLDQALLKELMIPSFSHTCGTLLDVELV  174

Query  1060  LRLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMS  881
             +RLVKRF V+L++ A          SGA        ++KVAKLVD YLAEAA D+ L+++
Sbjct  175   IRLVKRF-VNLDETA---------KSGAA-------MVKVAKLVDCYLAEAATDAYLSLN  217

Query  880   QFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAA  701
             +F ALA  +P+HAR  DD LYR+IDTYLKAHPGVSK++RK +C+LID RKLS EAS+HAA
Sbjct  218   EFAALAGAVPSHARAMDDGLYRAIDTYLKAHPGVSKQDRKSLCRLIDCRKLSPEASLHAA  277

Query  700   QNERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapgaq  521
             QNERLPVR VIQVL SEQ KL     R ++WSG    S  +       P           
Sbjct  278   QNERLPVRAVIQVLFSEQNKLH----RHIDWSGSFSASTRSPNPFLDAP-----------  322

Query  520   qqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLEIssrkrgsss  341
                   R +SKR+MN +    +EI+KLKEEVLRLQ+QC +MQ Q E+             
Sbjct  323   -----ARSLSKREMNAM---QMEIRKLKEEVLRLQSQCSSMQVQAER-------------  361

Query  340   sgygffsswkkfGQLNKGIIITTSSSKLGSEVegeggggniaaigggfGRQTPTPMDTKA  161
                          +   GI   + +  +       G         G       TPMD K 
Sbjct  362   -----------KEKKKAGIFKWSRNLGIMPSFRSAGVVKINEGGDGNVEYGKQTPMDMKT  410

Query  160   RLVRGRTSTKWRKSLS  113
             RLVR R + KWR SLS
Sbjct  411   RLVRARATPKWRNSLS  426



>ref|XP_006369158.1| hypothetical protein POPTR_0001s17540g [Populus trichocarpa]
 gb|ERP65727.1| hypothetical protein POPTR_0001s17540g [Populus trichocarpa]
Length=438

 Score =   443 bits (1139),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 262/500 (52%), Positives = 325/500 (65%), Gaps = 75/500 (15%)
 Frame = -3

Query  1600  ATALPES---GTLSSCKPMGECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYA  1430
             A + PES     L + +   ECWFDDACILDMDYF KTL+GIKAKGVRP+ IGSII HYA
Sbjct  3     AASFPESVLSSGLKTSQFAAECWFDDACILDMDYFAKTLAGIKAKGVRPDFIGSIIAHYA  62

Query  1429  SKWLPELTggggseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPE  1250
             SKWLP+L+G            HL      ++     ESV+A WMKKRFFVETL+GILPPE
Sbjct  63    SKWLPDLSGD-----------HLSSNKGLANFEESPESVTALWMKKRFFVETLVGILPPE  111

Query  1249  KDSIPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDV  1070
             KDSIPC+FLLRLLRI NMV VE AYRAELEKRISWQL+QA+L+E+MIPSFSHTCGT+LDV
Sbjct  112   KDSIPCSFLLRLLRIANMVSVEPAYRAELEKRISWQLDQASLKEIMIPSFSHTCGTLLDV  171

Query  1069  ELVLRLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNL  890
             EL++RLV+ F V+L++ A     SGS+            LIKVAKLVD YLAEAAVD+NL
Sbjct  172   ELIIRLVRSF-VNLDEVAK----SGSA------------LIKVAKLVDSYLAEAAVDANL  214

Query  889   TMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASI  710
              +S+FIALA  +P+HAR TDD LYR++DTYLKAHPG+ K+ERK + +LIDSRKLS EAS+
Sbjct  215   NLSEFIALAGALPSHARATDDGLYRAVDTYLKAHPGLPKQERKALFRLIDSRKLSQEASL  274

Query  709   HAAQNERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppap  530
             HAAQNERLPVR VIQVL SEQTKL+    RQ++WSG                 S +    
Sbjct  275   HAAQNERLPVRAVIQVLYSEQTKLN----RQIDWSG-----------------SFSGARS  313

Query  529   gaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLEIssrkrg  350
              +   +   R +SKR+ +    Q +EI+KL+E+VLRL++QC  MQ Q+E++LE       
Sbjct  314   PSLGFEAPARLLSKRETSD---QQMEIRKLREDVLRLESQCYVMQMQMERMLEKKKGFFR  370

Query  349   ssssgygffsswkkfGQLNKGIIITTSSSKLGSEVegeggggniaaigggfGRQTPTPMD  170
                                K + I  +S +  + V          A  G  G    TP+D
Sbjct  371   W------------------KKLGIMPNSLRSSNNVSIVEKIEGKNAGEGDVGSGIQTPVD  412

Query  169   TKARLVR--GRTSTKWRKSL  116
              K +LVR  G+TS + RKS+
Sbjct  413   LKTKLVRGKGKTSPRRRKSM  432



>ref|XP_011039998.1| PREDICTED: root phototropism protein 3 [Populus euphratica]
Length=441

 Score =   442 bits (1137),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 247/417 (59%), Positives = 294/417 (71%), Gaps = 52/417 (12%)
 Frame = -3

Query  1621  KMEELKMATALPESGTLSSCKPMGECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSII  1442
             KM++      L  SG+ +S +   E WFDDACILDMDYFVKTL+GIKAKGVRP+LIGSII
Sbjct  8     KMKKASFPEFLLFSGSKTS-QLAAESWFDDACILDMDYFVKTLAGIKAKGVRPDLIGSII  66

Query  1441  THYASKWLPELTggggseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGI  1262
              HYASKWLPEL+               I  F ES  S         WMKKRFFVETL+GI
Sbjct  67    AHYASKWLPELSDDHQPSTDKG-----IANFPESPESVTTS-----WMKKRFFVETLVGI  116

Query  1261  LPPEKDSIPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGT  1082
             LPPEKDSIPC+FLLRLLRI NMV VE AYRAELEKRISWQL+QA+L+EL+IPSFSHTCGT
Sbjct  117   LPPEKDSIPCSFLLRLLRIANMVSVEPAYRAELEKRISWQLDQASLKELLIPSFSHTCGT  176

Query  1081  VLDVELVLRLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAV  902
             +LDVEL++RLV RF VSL++ A          SGA        LIKVAKLVD YLAEAAV
Sbjct  177   LLDVELIIRLVGRF-VSLDEVA---------KSGAA-------LIKVAKLVDSYLAEAAV  219

Query  901   DSNLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSA  722
             DSNL++S+F+ALA  +P+HAR TDD LYR+IDTYLKAHPGVSK+ERK + +LIDSRKLS 
Sbjct  220   DSNLSLSEFVALAGALPSHARATDDGLYRAIDTYLKAHPGVSKQERKVLFRLIDSRKLSQ  279

Query  721   EASIHAAQNERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpn  542
             EAS+HAAQNERLPVR VIQVL SE TKL+    RQ++WSG                 S +
Sbjct  280   EASLHAAQNERLPVRAVIQVLFSEHTKLN----RQMDWSG-----------------SFS  318

Query  541   ppapgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLE  371
                      +   RC+SKR++   ++Q  E++KL+E+V RLQ+QC  MQAQ+E+  E
Sbjct  319   GTRSPYIGLEAPARCLSKREL---SMQQTEVRKLREDVHRLQSQCYAMQAQMERSWE  372



>ref|XP_008377603.1| PREDICTED: root phototropism protein 3-like [Malus domestica]
Length=427

 Score =   442 bits (1136),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 255/480 (53%), Positives = 314/480 (65%), Gaps = 74/480 (15%)
 Frame = -3

Query  1552  GECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiek  1373
              ECWFDDACILDMDYFVKTL+GIKAKGVRP+LIGSIITHYASKWLP+L+G          
Sbjct  22    AECWFDDACILDMDYFVKTLAGIKAKGVRPDLIGSIITHYASKWLPDLSGDS--------  73

Query  1372  gGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMV  1193
               ++  +   ++ SS  ES++  WM+KRFFVETL+G+LPPEKDSIPCNFLLRLLR  NMV
Sbjct  74    --NISDQKNLTNFSSSPESITGLWMRKRFFVETLVGVLPPEKDSIPCNFLLRLLRTANMV  131

Query  1192  GVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAA  1013
              VE AYRAELEKRISWQL+QA+L+ELMIPSFSHTCGT+LDVELV RLVKRF V+L++ A 
Sbjct  132   AVEPAYRAELEKRISWQLDQASLKELMIPSFSHTCGTLLDVELVTRLVKRF-VNLDEAA-  189

Query  1012  VMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPT  833
                      SGA        ++KVAKLVD YLAEAA+D+NL++++F ALA  +P+H+R T
Sbjct  190   --------KSGAA-------MVKVAKLVDCYLAEAALDANLSLNEFGALAGALPSHSRAT  234

Query  832   DDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLS  653
             DD LYR+IDTYLKAHPGVSK++RK +C+LIDSRKLS EAS+HAAQN+RLPVR VIQVL S
Sbjct  235   DDGLYRAIDTYLKAHPGVSKQDRKILCRLIDSRKLSPEASLHAAQNDRLPVRAVIQVLFS  294

Query  652   EQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapgaqqqqqdPRCMSKRDMNT  473
             EQ+KL     R ++WSG    SA +       P                 RC SKR+M+ 
Sbjct  295   EQSKLH----RNIDWSGSFSGSARSPNPFLDQP----------------ARCFSKREMSA  334

Query  472   INIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLEIssrkrgssssgygffsswkkfGQLN  293
             +    +EI+ LKE+VLRLQ QC +MQ Q E+      + +      +          + N
Sbjct  335   M---QMEIRNLKEDVLRLQNQCNSMQVQAER------KDKKKGLFKWTRNLGILTSFRGN  385

Query  292   KGIIITTSSSKLGSEVegeggggniaaigggfGRQTPTPMDTKARLVRGRTSTKWRKSLS  113
              G++          EV                     TPMD K  LVR R + KWRKS+S
Sbjct  386   VGVVKINEGGD--GEVGYGKQ----------------TPMDMKTMLVRARATPKWRKSVS  427



>ref|XP_002517554.1| signal transducer, putative [Ricinus communis]
 gb|EEF44718.1| signal transducer, putative [Ricinus communis]
Length=428

 Score =   441 bits (1135),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 263/480 (55%), Positives = 315/480 (66%), Gaps = 72/480 (15%)
 Frame = -3

Query  1552  GECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiek  1373
             GECWFDDACIL+MDYFVKTL+GIKAKGVRP+LIGSII HYASKWLPEL+G G + E    
Sbjct  21    GECWFDDACILNMDYFVKTLAGIKAKGVRPDLIGSIIAHYASKWLPELSGDGTATERG--  78

Query  1372  gGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMV  1193
                 +  FEES     A      WMKKRFFVETL+G+LPPEKDSIPCNFLLRLLR  NMV
Sbjct  79    ----LTNFEESPECVTAS-----WMKKRFFVETLVGVLPPEKDSIPCNFLLRLLRTANMV  129

Query  1192  GVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAA  1013
             GVE  YRAELEKRISWQL+QA+L+ELMIPSFSHTCGT+LDVEL++RLV+RF V+L++ A 
Sbjct  130   GVEPTYRAELEKRISWQLDQASLKELMIPSFSHTCGTLLDVELMIRLVRRF-VNLDEAAK  188

Query  1012  VMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPT  833
                                 L+KVAKLVD YLAEAAVD++L++S+F  LA+ +P HAR  
Sbjct  189   SG-------------GGGAALVKVAKLVDCYLAEAAVDASLSLSEFDDLASALPGHARAN  235

Query  832   DDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLS  653
             DD LYR+IDTYLKAHP  SK+ERK +C+LIDSRKLS EAS+HAAQNERLPVR VIQVL+S
Sbjct  236   DDGLYRAIDTYLKAHPAASKQERKMLCRLIDSRKLSPEASLHAAQNERLPVRAVIQVLIS  295

Query  652   EQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapgaqqqqqdPRCMSKRDMNT  473
             EQ KL+    RQ++W                   S +             RC SKR+MN 
Sbjct  296   EQNKLN----RQIDW-------------------SGSFSRSPNPGFDPPGRCYSKREMNA  332

Query  472   INIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLEIssrkrgssssgygffsswkkfGQLN  293
                Q +EIKKL+E+VLRLQ QC  MQ Q+E+++E                   K F +  
Sbjct  333   ---QQMEIKKLREDVLRLQGQCHAMQMQMERMVE-----------------KKKGFFRWK  372

Query  292   KGIIITTSSSKLGSEVegeggggniaaigggfGRQTPTPMDTKARLVRGRTSTKWRKSLS  113
             K  II+T  S +   V  +           GFGRQTP  M TK  L++ RT  +WRKS+S
Sbjct  373   KFGIISTFKSTVS--VVDQKIEEGDGEGEIGFGRQTPVDMKTK--LMKRRTPPRWRKSMS  428



>ref|XP_002281013.1| PREDICTED: coleoptile phototropism protein 1 [Vitis vinifera]
 emb|CBI36235.3| unnamed protein product [Vitis vinifera]
Length=433

 Score =   441 bits (1135),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 271/499 (54%), Positives = 318/499 (64%), Gaps = 75/499 (15%)
 Frame = -3

Query  1594  ALPESGTLSSCKPM--GECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKW  1421
             ALPES TL+  +P+   ECW DDACILDMDYFVKTLSGIKAKGVRP+LIGSII HYASKW
Sbjct  5     ALPESITLAGKRPIFAAECWLDDACILDMDYFVKTLSGIKAKGVRPDLIGSIIAHYASKW  64

Query  1420  LPELTggggseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDS  1241
             LPEL          +    L I           ES + SWMKKRFFVETL+GILPPEKDS
Sbjct  65    LPEL--------LTDDEKGLTI------FEESPESATTSWMKKRFFVETLVGILPPEKDS  110

Query  1240  IPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELV  1061
             IPCNFLLRLLR  NMVGVE  YRAELE RISWQL+QA+L+ELMIPSF HTC T+LDVELV
Sbjct  111   IPCNFLLRLLRTANMVGVEPTYRAELESRISWQLDQASLKELMIPSFCHTCATLLDVELV  170

Query  1060  LRLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMS  881
             +RLVKRF+              ++ SGA        LIKVAKL+D YLAEAAVDSNLT+ 
Sbjct  171   MRLVKRFV----------NMDAAAKSGA-------ALIKVAKLIDSYLAEAAVDSNLTLQ  213

Query  880   QFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAA  701
             +F +LA  +P+HAR TDD LYR+IDTYLKAHPGVSK++RK +C++IDSRKLS EAS HAA
Sbjct  214   EFASLAGALPSHARSTDDGLYRAIDTYLKAHPGVSKQDRKVLCRIIDSRKLSPEASFHAA  273

Query  700   QNERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapgaq  521
              NERLPVR VIQVLLSEQTKL+    RQL+WSG    + S        P           
Sbjct  274   HNERLPVRAVIQVLLSEQTKLT----RQLDWSGSFSGTRSPKPGVLEHP-----------  318

Query  520   qqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLEIssrkrgsss  341
                   RC SKR++++   Q  EI++L+EEV RLQ QC  MQ QIE+LLE          
Sbjct  319   -----SRCPSKREISS---QQTEIRRLREEVRRLQGQCSAMQGQIERLLEKKKGLFKWKK  370

Query  340   sgygffsswkkfGQLNKGIIITTSSSKLGSEVegeggggniaaigggfGRQTPTPMD---  170
                  F         + G+     +  +G +++    G        G      TP+D   
Sbjct  371   LVMPSFR--------STGV----DAGSIGEKIQEREEGEGEGEAAFGQQ----TPLDFKI  414

Query  169   TKARLVRGRTSTKWRKSLS  113
             TK RLVRG+T  KWR SLS
Sbjct  415   TKTRLVRGKTPPKWRNSLS  433



>ref|XP_010249954.1| PREDICTED: coleoptile phototropism protein 1-like [Nelumbo nucifera]
Length=489

 Score =   441 bits (1133),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 266/497 (54%), Positives = 322/497 (65%), Gaps = 84/497 (17%)
 Frame = -3

Query  1591  LPESGTLSSCKPM----GECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASK  1424
             LP+S  ++S KP      ECWFDDACILDMDYFVKTLS IKAKGVRP+LIGSII H+ASK
Sbjct  73    LPDSDAMTS-KPTTQLGAECWFDDACILDMDYFVKTLSSIKAKGVRPDLIGSIIAHHASK  131

Query  1423  WLPELTggggseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKD  1244
             WLP+L+G   +        HL              SV++ WMKKRFF+ETL+GILPPEKD
Sbjct  132   WLPDLSGDAVNRVLT----HL---------EESPGSVTSLWMKKRFFIETLVGILPPEKD  178

Query  1243  SIPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVEL  1064
             S+PCNFLLRLLR GNMVGVE AYRAELEKRI+ QL+QA+L+E+MIP+FSHTCGT+LDVEL
Sbjct  179   SVPCNFLLRLLRTGNMVGVEPAYRAELEKRIACQLDQASLKEIMIPAFSHTCGTLLDVEL  238

Query  1063  VLRLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTM  884
             VLR+VKRFI              ++ SGA        L KVAKLVD YLAEA++D+NLT+
Sbjct  239   VLRVVKRFI----------NLDHTAKSGAA-------LSKVAKLVDSYLAEASLDANLTL  281

Query  883   SQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHA  704
               F+ALA   P+HAR  DD LYR+IDTYLKAHPG+SK+ERK +C LIDSRKLSAEAS+HA
Sbjct  282   PHFVALAGAFPSHARAMDDGLYRAIDTYLKAHPGLSKQERKSLCGLIDSRKLSAEASLHA  341

Query  703   AQNERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapga  524
             A NERLPVR VIQVL S+   L+     QL+WSG                 S +      
Sbjct  342   AHNERLPVRAVIQVLFSKHVNLNN----QLDWSG-----------------SLSESRSPN  380

Query  523   qqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLEIssrkrgss  344
                +   RCMSKR+M    IQ  EIK+L+E+VLRLQ QC +MQ+QI++L+E         
Sbjct  381   PVAEPPVRCMSKREM---TIQQSEIKRLREDVLRLQRQCNSMQSQIDRLME---------  428

Query  343   ssgygffsswkkfGQLNKGIIITTSSSKLGSEVegeggggniaaigggfGRQTPTPMDTK  164
                     S+ K+ +L   +    S   +G  V              GFGRQ  TPMD K
Sbjct  429   -----KKKSFFKWRKLGGPLFKPLS---VGDRV------EEAEGEHLGFGRQ--TPMDMK  472

Query  163   ARLVRGRTSTKWRKSLS  113
              +LV+GRT  KWRKS+S
Sbjct  473   TKLVQGRTPPKWRKSMS  489



>ref|XP_002303269.2| phototropic-responsive NPH3 family protein [Populus trichocarpa]
 gb|EEE78248.2| phototropic-responsive NPH3 family protein [Populus trichocarpa]
Length=441

 Score =   437 bits (1123),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 241/412 (58%), Positives = 288/412 (70%), Gaps = 54/412 (13%)
 Frame = -3

Query  1597  TALPESGTLSSCKP---MGECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYAS  1427
              + PE    S  K      E WFDDACILDMDYFVKTL+GIKAKGVRP+LIGSII HYAS
Sbjct  12    ASFPEFVLFSGSKTSHLAAERWFDDACILDMDYFVKTLAGIKAKGVRPDLIGSIIAHYAS  71

Query  1426  KWLPELTggggseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEK  1247
             KWLP+L+ G           H       ++ +   ESV+ SWMKKRFFVETL+GILPPEK
Sbjct  72    KWLPDLSDGH----------HPSTDKGIANFAESPESVTTSWMKKRFFVETLVGILPPEK  121

Query  1246  DSIPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVE  1067
             DSIPCNFLLRLLRI NMVGVE  YRAELEK ISWQL+QA+L+ELMIPSFSHTCGT+LDVE
Sbjct  122   DSIPCNFLLRLLRIANMVGVEPTYRAELEKMISWQLDQASLKELMIPSFSHTCGTLLDVE  181

Query  1066  LVLRLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLT  887
             L++RLV RF V+L++ A                  +  LIKVAKLVD YLAEAAVDSNL 
Sbjct  182   LIIRLVGRF-VNLDEVAKS----------------DAALIKVAKLVDSYLAEAAVDSNLN  224

Query  886   MSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIH  707
             +++F+ALA  +P+H+R TDD LYR+IDTYLKAHPGVSK ERK + +LIDSRKLS EAS+H
Sbjct  225   LAEFVALAGALPSHSRATDDGLYRAIDTYLKAHPGVSKHERKVLFRLIDSRKLSQEASLH  284

Query  706   AAQNERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapg  527
             AAQNERLPVR VIQVL SE TKL+    RQ++WSG                 S +     
Sbjct  285   AAQNERLPVRAVIQVLFSEHTKLN----RQMDWSG-----------------SFSGTRSP  323

Query  526   aqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLE  371
                 +   RC+SKR+M   ++Q  E++KL+E+V RLQ+QC  MQAQ+E+  E
Sbjct  324   YIGLEAPARCLSKREM---SVQQTEVRKLREDVHRLQSQCYAMQAQMERSWE  372



>gb|KEH28736.1| phototropic-responsive NPH3 family protein [Medicago truncatula]
Length=449

 Score =   434 bits (1116),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 234/394 (59%), Positives = 281/394 (71%), Gaps = 49/394 (12%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             ECWFDDA ILDMDYFVKTLSGIKAKGVR +LIGSIITHYASKWLP++   G         
Sbjct  44    ECWFDDATILDMDYFVKTLSGIKAKGVRADLIGSIITHYASKWLPDVAEKG---------  94

Query  1369  GHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMVG  1190
                I +FEES  S         WMKKRFFVETL+ +LPPEKDSIPCNFLLRLLR  NMVG
Sbjct  95    ---ITQFEESPESVTTS-----WMKKRFFVETLVNVLPPEKDSIPCNFLLRLLRTANMVG  146

Query  1189  VEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAAV  1010
             V+ +YR ELEKRISWQL+QA L+EL+IPSFSHTCGT+LD ELV+RLVKRF VSL+++ A 
Sbjct  147   VDGSYRQELEKRISWQLDQACLKELVIPSFSHTCGTLLDFELVIRLVKRF-VSLDNEGA-  204

Query  1009  MRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPTD  830
                     SGA        L+KVAKLVD YL EAAVD+NL + +F+ LA  +P+HAR TD
Sbjct  205   -------KSGAA-------LVKVAKLVDSYLCEAAVDANLRLDEFVTLAGALPSHARATD  250

Query  829   DALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLSE  650
             D LYR+IDTYLKAHP VSK+ERK +C+LID RKL+ EAS+HAAQNER PVR VIQVLLSE
Sbjct  251   DGLYRAIDTYLKAHPSVSKQERKGLCRLIDCRKLTQEASLHAAQNERFPVRAVIQVLLSE  310

Query  649   QTKLSKQ-LMRQLEWsggsfisasagasgGTCPRSpnppapgaqqqqqdPRCMSKRDMNT  473
             QTKL++  +   ++WSG                 + +P      +     RC+SKR+MN 
Sbjct  311   QTKLNRHNINHNMDWSGSIMSI------------TRSPTNGFGLEAVPTARCLSKREMNA  358

Query  472   INIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLE  371
                Q +EIKKL+E+V RLQ+QC  MQ Q+E+++E
Sbjct  359   ---QQIEIKKLREDVHRLQSQCNAMQVQMERMVE  389



>ref|XP_010542273.1| PREDICTED: root phototropism protein 3-like [Tarenaya hassleriana]
Length=445

 Score =   432 bits (1111),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 265/504 (53%), Positives = 322/504 (64%), Gaps = 71/504 (14%)
 Frame = -3

Query  1597  TALPESGTLSSCKP-----MGECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHY  1433
             T LPES T+S   P     +   WFDDACILDMDYFVKT+SGIKAKGVRP+LIGSII HY
Sbjct  4     TILPESVTVSGISPPHTAVVDYPWFDDACILDMDYFVKTISGIKAKGVRPDLIGSIIAHY  63

Query  1432  ASKWLPELTggggseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPP  1253
             ASKWLP+L+G G S          +I  +       +ESV+AS MKKRFFVETL+GILPP
Sbjct  64    ASKWLPDLSGAGKS----------VISDDPLPPPPQSESVTASLMKKRFFVETLVGILPP  113

Query  1252  EKDSIPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLD  1073
             EKDS+PCNFLLRLLR  NMVG E +YR++LE RISWQL+QA+L+ELMIPSFSHTCGT+LD
Sbjct  114   EKDSVPCNFLLRLLRTANMVGAEPSYRSDLETRISWQLDQASLKELMIPSFSHTCGTLLD  173

Query  1072  VELVLRLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSN  893
             VELV RLVK+F        A +   G  S  A        L+KVAKLVD YLAEAAVD  
Sbjct  174   VELVTRLVKKF--------AGLDSEGVKSGAA--------LVKVAKLVDSYLAEAAVDGG  217

Query  892   LTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEAS  713
             L++ +FIALA  +P+HAR T+D LYR+IDTYLKAHP VSK ERK +C+LIDS KLS EAS
Sbjct  218   LSLPEFIALAGALPSHARATEDGLYRAIDTYLKAHPQVSKRERKVLCRLIDSPKLSTEAS  277

Query  712   IHAAQNERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppa  533
             +HAAQNERLPVR +IQVL +EQTKLS    R +EW           +   T  RS   P 
Sbjct  278   LHAAQNERLPVRAIIQVLFTEQTKLS----RHVEW-----------SGSFTSARS-PNPT  321

Query  532   pgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLEIssrkr  353
                  +    RC SKR+   IN Q  EI++LKE+V RLQ++   MQAQ+E+L+E      
Sbjct  322   SSQYSEPGPARCTSKRE---INFQQAEIRRLKEDVARLQSEYGAMQAQLERLMEKKGSSN  378

Query  352   gssssgygff---sswkkfGQLNKGIIITTSSSKLGSEVegeggggniaaigggfGRQTP  182
              +S+ G   F           +  GI ++    + G   EG                   
Sbjct  379   SNSNGGSKGFFRWRRLGIMPSIRSGISVSVEKIENGGNEEGFE-----------------  421

Query  181   TPMDTKARLVRGRTS-TKWRKSLS  113
             TP + K RLV+GRT+ ++WRKSLS
Sbjct  422   TPGNMKTRLVKGRTTPSRWRKSLS  445



>ref|XP_003597825.1| BTB/POZ domain-containing protein [Medicago truncatula]
 gb|AES68076.1| phototropic-responsive NPH3 family protein [Medicago truncatula]
Length=423

 Score =   427 bits (1099),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 245/478 (51%), Positives = 302/478 (63%), Gaps = 77/478 (16%)
 Frame = -3

Query  1546  CWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekgG  1367
             CWF+DACILDMD F+KTLS IK KGVR +LIGSIITHYASKWLP+L     +  +     
Sbjct  23    CWFEDACILDMDCFIKTLSNIKQKGVRSDLIGSIITHYASKWLPDLESSNSNSNANANSP  82

Query  1366  HLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMVGV  1187
               +                 SWMKKRFFVETL+ +LPP+KDSIPCNFLLRLL+  NMV V
Sbjct  83    ESVT---------------TSWMKKRFFVETLVSVLPPDKDSIPCNFLLRLLKTANMVLV  127

Query  1186  EAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAAVM  1007
             E+ YR +LE RISWQL+QA+L+ELMIPSFSHTCGT+LDVELV+RLVKRFI SL+      
Sbjct  128   ESTYRTDLENRISWQLDQASLKELMIPSFSHTCGTLLDVELVIRLVKRFI-SLDHDGV--  184

Query  1006  RCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPTDD  827
                    +GA        L+KVAKLVD YLAEA +D+NL++SQF+ALA  +P HAR TDD
Sbjct  185   ------KTGAA-------LVKVAKLVDCYLAEAGLDANLSLSQFVALAGALPNHARATDD  231

Query  826   ALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLSEQ  647
              LYR+IDTYLKAHP VSK+ERK +C+LIDSRKL+ EAS+HAAQNERLPVR VIQVL SEQ
Sbjct  232   GLYRAIDTYLKAHPSVSKQERKSLCRLIDSRKLTPEASLHAAQNERLPVRAVIQVLFSEQ  291

Query  646   TKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapgaqqqqqdPRCMSKRDMNTIN  467
             TKL+    R ++WS                  S   P+          RC+SKR+MNT  
Sbjct  292   TKLN----RHVDWSASFS--------------SLRSPSGYGGVLDPQARCLSKREMNT--  331

Query  466   IQHLEIKKLKEEVLRLQTQCINMQAQIEKLLEIssrkrgssssgygffsswkkfGQLNKG  287
              Q +EIKKLKE+V RLQ+QC  MQAQ++K+ E            +       +  + ++ 
Sbjct  332   -QQMEIKKLKEDVYRLQSQCNVMQAQMDKMAEKKKSFFKWKKLAFSKSIGEMENVEQDE-  389

Query  286   IIITTSSSKLGSEVegeggggniaaigggfGRQTPTPMDTKARLVRGRTSTKWRKSLS  113
                  + ++ G                  FGRQTP  M T + +V+ RT  KWRKS+S
Sbjct  390   -----AETEFG------------------FGRQTPMDMKT-STVVKSRTPHKWRKSMS  423



>ref|XP_004136077.1| PREDICTED: root phototropism protein 3-like [Cucumis sativus]
 ref|XP_004158805.1| PREDICTED: root phototropism protein 3-like [Cucumis sativus]
 gb|KGN45312.1| hypothetical protein Csa_7G433900 [Cucumis sativus]
Length=459

 Score =   427 bits (1098),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 263/480 (55%), Positives = 315/480 (66%), Gaps = 53/480 (11%)
 Frame = -3

Query  1543  WFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekgGH  1364
             WFDD+ ILD+DYFVKTL+GIKAKGVR +LIGS+ITHYASKWLP+L+    +        +
Sbjct  30    WFDDSTILDIDYFVKTLAGIKAKGVRSDLIGSVITHYASKWLPDLSDEALNNHHQRNNNN  89

Query  1363  LIIKFeesssssvae--svsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMVG  1190
                     ++S      SV+ SWMKKRFFVETL+G+LPPE+D IPCNFLLRLLR  NMVG
Sbjct  90    NGGGVNLMNNSFQESPESVTNSWMKKRFFVETLVGVLPPERDLIPCNFLLRLLRTANMVG  149

Query  1189  VEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAAV  1010
             VEA Y+AELEKRI+WQL+QA+L+E+MIPSFSHTCGTVLDVELV+RLVKRF VSLED    
Sbjct  150   VEAPYKAELEKRITWQLDQASLKEVMIPSFSHTCGTVLDVELVIRLVKRF-VSLED----  204

Query  1009  MRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPTD  830
                 G   SGA        L+KVAKLVD YLAEAA+DSNL +++F+ LA  +P HAR +D
Sbjct  205   ---GGGVRSGAA-------LVKVAKLVDCYLAEAAMDSNLGLTEFVELAGALPNHARASD  254

Query  829   DALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLSE  650
             D LYR+IDTYLKAHP VSK+ERK +CKL+DSRKLS EAS+HAAQNERLPVR VIQVL SE
Sbjct  255   DGLYRAIDTYLKAHPNVSKQERKSICKLMDSRKLSTEASLHAAQNERLPVRAVIQVLFSE  314

Query  649   QTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapgaqqqqqdPRCMSKRDMNTI  470
             QTKL+    R L+WSG                      +P A       RC SKR+   I
Sbjct  315   QTKLN---YRHLDWSGSIG--------------GGGGRSPSAALDHLPTRCQSKRE---I  354

Query  469   NIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLEIssrkrgssssgygffsswkkfGQLNK  290
               Q +EIK+LK+ V+RLQ QC  MQAQ+E+L E            +GF +          
Sbjct  355   TAQQMEIKRLKDTVVRLQNQCNLMQAQMERLSEKKRSGSFFKWRKFGFKN----------  404

Query  289   GIIITTSSSKLGSEVegeggggniaaigggfGRQTPTPMDTKARLVRGRTSTK-WRKSLS  113
                      K+     G GGGG       GFGRQT  P+D K +LV+ RT TK WRKS+S
Sbjct  405   ---YVGDLEKVDDGGGGGGGGGGGEMEEEGFGRQT--PVDIKTKLVKRRTPTKTWRKSVS  459



>ref|XP_008461063.1| PREDICTED: root phototropism protein 3 [Cucumis melo]
Length=455

 Score =   426 bits (1096),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 240/411 (58%), Positives = 289/411 (70%), Gaps = 42/411 (10%)
 Frame = -3

Query  1582  SGTLSSCKPMGE------CWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKW  1421
             SG +S     G+       WFDD+ ILD+DYFVKTL+GIKAKGVR +LIGSIITHYASKW
Sbjct  12    SGKISPGPQFGDNNSDQSYWFDDSTILDIDYFVKTLAGIKAKGVRSDLIGSIITHYASKW  71

Query  1420  LPELTggggseesiekgGHLIIKFeesssssva-esvsaSWMKKRFFVETLIGILPPEKD  1244
             LP+L+    +        +  +    ++S   + ESV+ SWMKKRFFVETL+G+LPPE+D
Sbjct  72    LPDLSDEALNNHQGNNNNNGGVNLMNNNSFQESPESVTNSWMKKRFFVETLVGVLPPERD  131

Query  1243  SIPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVEL  1064
              IPCNFLLRLLR  NMVGVEA Y+AELEKRI+WQL+QA+L+E+MIPSFSHTCGTVLDVEL
Sbjct  132   LIPCNFLLRLLRTANMVGVEAPYKAELEKRITWQLDQASLKEVMIPSFSHTCGTVLDVEL  191

Query  1063  VLRLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTM  884
             V+RLVKRF VSLED        G   SGA        L+KVAK+VD YLAEAA+DSNL +
Sbjct  192   VIRLVKRF-VSLED-------GGGVRSGAA-------LVKVAKMVDCYLAEAAMDSNLGL  236

Query  883   SQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHA  704
             ++F+ LA  +P HAR +DD LYR+IDTYLKAHP VSK+ERK +CKL+DSRKLS EAS+HA
Sbjct  237   TEFVELAGALPNHARGSDDGLYRAIDTYLKAHPNVSKQERKSICKLMDSRKLSTEASLHA  296

Query  703   AQNERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapga  524
             AQNERLPVR VIQVL SEQTKL+    R L+WSG                      +P A
Sbjct  297   AQNERLPVRAVIQVLFSEQTKLN---YRHLDWSGSIG--------------GGGGRSPSA  339

Query  523   qqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLE  371
                    RC SKR+   I  Q +EIK+LK+ V+RLQ QC  MQAQ+E+L E
Sbjct  340   ALDHLPTRCQSKRE---ITAQQMEIKRLKDTVVRLQNQCNLMQAQMERLSE  387



>gb|ACU20143.1| unknown [Glycine max]
Length=419

 Score =   425 bits (1092),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 257/479 (54%), Positives = 306/479 (64%), Gaps = 78/479 (16%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             ECWFDDACI+DMDYFVKTLS IK KGVR +LIGSIITHYAS WLP+L+    +  +    
Sbjct  19    ECWFDDACIVDMDYFVKTLSSIKQKGVRADLIGSIITHYASIWLPDLSSSAENGVTT---  75

Query  1369  GHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMVG  1190
              H              ESV+ SWMKKRFFVETL+ +LPPEKDS+PCNFLLRLLR  NMV 
Sbjct  76    -HF----------QSPESVTNSWMKKRFFVETLVSVLPPEKDSVPCNFLLRLLRTANMVR  124

Query  1189  VEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAAV  1010
             V+A YR ELE RISWQL+QA+L+ELMIPSFSHTCGT+LDVELVLRLVKRF+    D AA 
Sbjct  125   VDATYRGELENRISWQLDQASLKELMIPSFSHTCGTLLDVELVLRLVKRFMSLDRDGAA-  183

Query  1009  MRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPTD  830
                                L+KVAKLVD YLAEAAVD+NLT+S+FIALA  +P+H+R TD
Sbjct  184   -------------------LVKVAKLVDCYLAEAAVDANLTLSEFIALAGALPSHSRATD  224

Query  829   DALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLSE  650
             D LYR+IDTYLKAHP VSK+ERK +C+L+DSRKL+ EAS+HAAQNERLPVR VIQVL SE
Sbjct  225   DGLYRAIDTYLKAHPDVSKQERKGLCRLLDSRKLTTEASLHAAQNERLPVRAVIQVLFSE  284

Query  649   QTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapgaqqqqqdPRCMSKRDMNTI  470
             QTKL+    R ++WSG                 S +             RC+SKR+ N  
Sbjct  285   QTKLN----RHIDWSG-----------------SFSSLRSPNGGLDPPGRCLSKRETNA-  322

Query  469   NIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLEIssrkrgssssgygffsswkkfGQLNK  290
               Q +EI+KLKE+V RLQ+Q   MQ Q+E++                  +  K   +  K
Sbjct  323   --QQMEIRKLKEDVYRLQSQFNAMQGQMERM-----------------AAKKKGLFKWRK  363

Query  289   GIIITTSSSKLGSEVegeggggniaaigggfGRQTPTPMDTKARLVRGRTSTKWRKSLS  113
               + T S +    E   E  G   A    GFGRQ  TPMD K  LV+ RT  KWRKS+S
Sbjct  364   FGMPTFSRNVGEVEKIEEEEGEEEAEREVGFGRQ--TPMDMKTSLVK-RTPHKWRKSMS  419



>gb|KHN44148.1| Root phototropism protein 3 [Glycine soja]
Length=417

 Score =   424 bits (1090),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 256/479 (53%), Positives = 305/479 (64%), Gaps = 78/479 (16%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             ECWFDDACI+DMDYFVKTLS IK KGVR +LIGSIITHYAS WLP+L+    +  +    
Sbjct  17    ECWFDDACIVDMDYFVKTLSSIKQKGVRADLIGSIITHYASIWLPDLSSSAENGVTT---  73

Query  1369  GHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMVG  1190
              H              ESV+ SWMKKRFFVETL+ +LPPEKDS+PCNFLLRLLR  NMV 
Sbjct  74    -HF----------QSPESVTNSWMKKRFFVETLVSVLPPEKDSVPCNFLLRLLRTANMVR  122

Query  1189  VEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAAV  1010
             V+A YR ELE RISWQL+QA+L+ELMIPSFSHTCGT+LDVELVLRLVKRF+    D AA 
Sbjct  123   VDATYRGELENRISWQLDQASLKELMIPSFSHTCGTLLDVELVLRLVKRFMSLDRDGAA-  181

Query  1009  MRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPTD  830
                                L+KVAKLVD YLAEAAVD+NLT+S+FIALA  +P+H+R TD
Sbjct  182   -------------------LVKVAKLVDCYLAEAAVDANLTLSEFIALAGALPSHSRATD  222

Query  829   DALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLSE  650
             D LYR+IDTYLKAHP VSK+ERK +C+L+DSRKL+ EAS+HAAQNERLPVR VIQVL SE
Sbjct  223   DGLYRAIDTYLKAHPDVSKQERKGLCRLLDSRKLTTEASLHAAQNERLPVRAVIQVLFSE  282

Query  649   QTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapgaqqqqqdPRCMSKRDMNTI  470
             QTKL+    R ++WSG                 S +             RC+SKR+ N  
Sbjct  283   QTKLN----RHIDWSG-----------------SFSSLRSPNGGLDPPGRCLSKRETNA-  320

Query  469   NIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLEIssrkrgssssgygffsswkkfGQLNK  290
               Q +EI+KLKE+V RLQ+Q   MQ Q+E++                  +  K   +  K
Sbjct  321   --QQMEIRKLKEDVYRLQSQFNAMQGQMERM-----------------AAKKKGLFKWRK  361

Query  289   GIIITTSSSKLGSEVegeggggniaaigggfGRQTPTPMDTKARLVRGRTSTKWRKSLS  113
               + T S +    E   E      A    GFGRQ  TPMD K  LV+ RT  KWRKS+S
Sbjct  362   FGMPTFSRNVGEVEKIEEEEEEEEAEREVGFGRQ--TPMDMKTSLVK-RTPHKWRKSMS  417



>ref|XP_003543664.1| PREDICTED: root phototropism protein 3-like [Glycine max]
Length=419

 Score =   424 bits (1090),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 256/479 (53%), Positives = 305/479 (64%), Gaps = 78/479 (16%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             ECWFDDACI+DMDYFVKTLS IK KGVR +LIGSIITHYAS WLP+L+    +  +    
Sbjct  19    ECWFDDACIVDMDYFVKTLSSIKQKGVRADLIGSIITHYASIWLPDLSSSAENGVTT---  75

Query  1369  GHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMVG  1190
              H              ESV+ SWMKKRFFVETL+ +LPPEKDS+PCNFLLRLLR  NMV 
Sbjct  76    -HF----------QSPESVTNSWMKKRFFVETLVSVLPPEKDSVPCNFLLRLLRTANMVR  124

Query  1189  VEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAAV  1010
             V+A YR ELE RISWQL+QA+L+ELMIPSFSHTCGT+LDVELVLRLVKRF+    D AA 
Sbjct  125   VDATYRGELENRISWQLDQASLKELMIPSFSHTCGTLLDVELVLRLVKRFMSLDRDGAA-  183

Query  1009  MRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPTD  830
                                L+KVAKLVD YLAEAAVD+NLT+S+FIALA  +P+H+R TD
Sbjct  184   -------------------LVKVAKLVDCYLAEAAVDANLTLSEFIALAGALPSHSRATD  224

Query  829   DALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLSE  650
             D LYR+IDTYLKAHP VSK+ERK +C+L+DSRKL+ EAS+HAAQNERLPVR VIQVL SE
Sbjct  225   DGLYRAIDTYLKAHPDVSKQERKGLCRLLDSRKLTTEASLHAAQNERLPVRAVIQVLFSE  284

Query  649   QTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapgaqqqqqdPRCMSKRDMNTI  470
             QTKL+    R ++WSG                 S +             RC+SKR+ N  
Sbjct  285   QTKLN----RHIDWSG-----------------SFSSLRSPNGGLDPPGRCLSKRETNA-  322

Query  469   NIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLEIssrkrgssssgygffsswkkfGQLNK  290
               Q +EI+KLKE+V RLQ+Q   MQ Q+E++                  +  K   +  K
Sbjct  323   --QQMEIRKLKEDVYRLQSQFNAMQGQMERM-----------------AAKKKGLFKWRK  363

Query  289   GIIITTSSSKLGSEVegeggggniaaigggfGRQTPTPMDTKARLVRGRTSTKWRKSLS  113
               + T S +    E   E      A    GFGRQ  TPMD K  LV+ RT  KWRKS+S
Sbjct  364   FGMPTFSRNVGEVEKIEEEEEEEEAEREVGFGRQ--TPMDMKTSLVK-RTPHKWRKSMS  419



>ref|NP_175686.1| phototropic-responsive NPH3 family protein [Arabidopsis thaliana]
 gb|AAG52282.1|AC019018_19 putative non-phototropic hypocotyl; 25081-26618 [Arabidopsis 
thaliana]
 gb|AAO00852.1| putative non-phototropic hypocotyl [Arabidopsis thaliana]
 gb|AAP49519.1| At1g52770 [Arabidopsis thaliana]
 gb|AEE32850.1| phototropic-responsive NPH3-like protein [Arabidopsis thaliana]
Length=454

 Score =   421 bits (1081),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 244/501 (49%), Positives = 320/501 (64%), Gaps = 56/501 (11%)
 Frame = -3

Query  1597  TALPESGTLSSCKPMG-----EC-WFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITH  1436
             T+ PES T+S+  P       EC WFDD CIL +DYFVKT++GIK+KGVRP+LIGSII H
Sbjct  4     TSSPESATISTKSPSTSTGKMECSWFDDGCILGIDYFVKTIAGIKSKGVRPDLIGSIIVH  63

Query  1435  YASKWLPELTggggseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILP  1256
             YAS+WLP+L+    + +  +       +    ++           MKKR FVETLIGI+P
Sbjct  64    YASQWLPDLSDIVLNSDDQQPQPQQQSESFSVTAFV---------MKKRSFVETLIGIIP  114

Query  1255  PEKDSIPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVL  1076
             PE+DS+PC+FLLRLLR  NMVG +A Y+AELE RISWQL+QA+L+ELMIPSFSHTCGT+L
Sbjct  115   PERDSVPCDFLLRLLRTANMVGADANYKAELEARISWQLDQASLKELMIPSFSHTCGTLL  174

Query  1075  DVELVLRLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDS  896
             DVEL+ RLVK+F   L+++           SGA       +LIKVAKLVD YLAEAA+D 
Sbjct  175   DVELMTRLVKKF-AGLDNEGV--------KSGA-------SLIKVAKLVDSYLAEAALDG  218

Query  895   NLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEA  716
             +LT+S+FI+L   +P HAR T+D LYR+IDTYLKAHP V+K+ERKR+C LIDS KLS EA
Sbjct  219   DLTLSEFISLVEALPNHARVTEDGLYRAIDTYLKAHPNVTKQERKRLCGLIDSNKLSMEA  278

Query  715   SIHAAQNERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnpp  536
             S+HAAQN+RLPVRT+IQVL SEQ KLS +    +EWSG SF             RS   P
Sbjct  279   SLHAAQNDRLPVRTIIQVLFSEQAKLSHRSHNNIEWSGSSFSGV----------RSSPNP  328

Query  535   apgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLEIssrk  356
             +          RC SKR+   IN+Q  EI++L+E++ +L+ +C  MQ Q+ KL+E     
Sbjct  329   SGSHYSDSGPARCTSKRE---INVQQAEIRRLREDMAKLKCECEAMQTQLHKLVE-KKGT  384

Query  355   rgssssgygffsswkkfGQLNKGIIITTSSSKLGSEVegeggggniaaigggfGRQTPTP  176
               S + G+  +        L+  ++  T+  + G+                 +  QTP  
Sbjct  385   CTSGNKGFFRWKKLGFRSGLSVSVVENTNGEEFGNN---------GEGENFEYVTQTPGN  435

Query  175   MDTKARLVRGRTSTKWRKSLS  113
             M TK  LV+GRT ++WRKS+S
Sbjct  436   MMTK--LVKGRTPSRWRKSMS  454



>ref|XP_010479798.1| PREDICTED: root phototropism protein 3-like [Camelina sativa]
Length=454

 Score =   415 bits (1067),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 241/501 (48%), Positives = 320/501 (64%), Gaps = 57/501 (11%)
 Frame = -3

Query  1597  TALPESGTLSSCKPMG-----EC-WFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITH  1436
             T+ PES T+S+  P       EC  FDD CILD+DYFV T++GIK+KGVRP+LIGSII H
Sbjct  5     TSSPESATISTKSPSNSTGKIECSLFDDGCILDIDYFVNTIAGIKSKGVRPDLIGSIIVH  64

Query  1435  YASKWLPELTggggseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILP  1256
             YAS WLP+L+    + +  +               S + SV+A  MKKRF VETLIGI+P
Sbjct  65    YASTWLPDLSDVVQNPDDPQPQQQ-----------SESFSVTAFVMKKRFLVETLIGIIP  113

Query  1255  PEKDSIPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVL  1076
             PEKDS+PCNFLLRLLR  NMVG ++ Y+ ELE +ISWQL+QA+L+ELMIPSFSHTCGT+L
Sbjct  114   PEKDSVPCNFLLRLLRTANMVGADSNYKTELEAKISWQLDQASLKELMIPSFSHTCGTLL  173

Query  1075  DVELVLRLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDS  896
             DVELV RLVK+F   L+ +           SGA       +L+KVAKLVD YLAEAA+D 
Sbjct  174   DVELVTRLVKKF-TGLDYEGV--------KSGA-------SLVKVAKLVDSYLAEAALDG  217

Query  895   NLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEA  716
             +L++ +F++LA  +P HAR  +D LYR+IDTYLKAHP V+K+ERKR+C LIDS+KLS EA
Sbjct  218   DLSLPEFMSLAEALPYHARANEDGLYRAIDTYLKAHPKVTKQERKRLCGLIDSKKLSMEA  277

Query  715   SIHAAQNERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnpp  536
             S+HAAQN+RLPVRT++QVL SEQTKLS +    ++WSG SF             RS   P
Sbjct  278   SLHAAQNDRLPVRTILQVLFSEQTKLSHRSNNNIDWSGSSFSGV----------RSSPNP  327

Query  535   apgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLEIssrk  356
             +     +    RCMSKR+   IN+QH EI++L+E++  L++QC  MQ Q+ KL+E     
Sbjct  328   SGSHYSESGPARCMSKRE---INVQHAEIRRLREDMANLKSQCEAMQTQLHKLIE-----  379

Query  355   rgssssgygffsswkkfGQLNKGIIITTSSSKLGSEVegeggggniaaigggfGRQTPTP  176
             +  + +                G+ ++   +  G +  G  G  +           T TP
Sbjct  380   KKGTCTSGKKGFFRWTKLGFRSGLSVSVVENTNGDQEFGGNGEDDEFEYV------TQTP  433

Query  175   MDTKARLVRGRTSTKWRKSLS  113
              + K +LV+GRT ++WR S+S
Sbjct  434   GNMKTKLVKGRTPSRWRNSMS  454



>ref|XP_006392871.1| hypothetical protein EUTSA_v10011482mg [Eutrema salsugineum]
 gb|ESQ30157.1| hypothetical protein EUTSA_v10011482mg [Eutrema salsugineum]
Length=443

 Score =   414 bits (1065),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 245/499 (49%), Positives = 314/499 (63%), Gaps = 63/499 (13%)
 Frame = -3

Query  1597  TALPESGTLS-SCKPMGE---CWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYA  1430
             T+ PES   S S    GE     FDD CILDMDYFVKT++GIKAKGVRP+LIGSII HYA
Sbjct  4     TSSPESSAKSPSTTVTGELEHSLFDDGCILDMDYFVKTIAGIKAKGVRPDLIGSIIAHYA  63

Query  1429  SKWLPELTggggseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPE  1250
             S WLPEL+    +     +              S + SV+A  MKKRFFVETLIGI+PPE
Sbjct  64    STWLPELSNTVINPNDPNQQQQ-----------SESFSVTAFVMKKRFFVETLIGIIPPE  112

Query  1249  KDSIPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDV  1070
             KDS+PCNFLLRLLR  NMVG +++Y+AELE RISWQL+QA+L+ELMIPSFSHTC T+LDV
Sbjct  113   KDSVPCNFLLRLLRTANMVGADSSYKAELEARISWQLDQASLKELMIPSFSHTCETLLDV  172

Query  1069  ELVLRLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNL  890
             ELV RLVK+F   L+++           SGA       +L+KVAKLVD YLAE AVD +L
Sbjct  173   ELVTRLVKKF-AGLDNEGI--------KSGA-------SLVKVAKLVDSYLAEVAVDGDL  216

Query  889   TMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASI  710
             ++ +FI+LA  +P HAR T+D LYR+IDTYLKAHP + K+ERKR+C LIDS+KLS EAS 
Sbjct  217   SIPEFISLAEALPNHARVTEDGLYRAIDTYLKAHPKMDKQERKRLCGLIDSKKLSMEASC  276

Query  709   HAAQNERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppap  530
             HAAQN+RLPVRT+IQVL +EQ KLS+     ++WSG S                   P+ 
Sbjct  277   HAAQNDRLPVRTIIQVLFTEQAKLSRSHHSNIDWSGSS---------------FSPNPSS  321

Query  529   gaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLEIssrkrg  350
                 +    RCMSKR+M   N+Q +EIK+L+E++ +L+++C  MQ Q+EK++E       
Sbjct  322   SHYSESGPARCMSKREM---NVQQMEIKRLREDMAKLKSECEAMQTQLEKMVEKKCSSSS  378

Query  349   ssssgygffsswkkfGQLNKGIIITTSSSKLGSEVegeggggniaaigggfGRQTPTPMD  170
              S   + +          + G+ ++      G E                +  QTP  M 
Sbjct  379   GSKGFFRWKRLG-----FSSGVSVSVLDKTNGEEF-------GNNGEEFEYANQTPGNMK  426

Query  169   TKARLVRGRTSTKWRKSLS  113
             TK  LV+GRT ++WRKS S
Sbjct  427   TK--LVKGRTPSRWRKSTS  443



>ref|XP_006307465.1| hypothetical protein CARUB_v10009092mg [Capsella rubella]
 gb|EOA40363.1| hypothetical protein CARUB_v10009092mg [Capsella rubella]
Length=456

 Score =   414 bits (1064),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 242/504 (48%), Positives = 322/504 (64%), Gaps = 61/504 (12%)
 Frame = -3

Query  1597  TALPESGTLSSCKPMG-----EC-WFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITH  1436
             ++ PES T+S+  P       +C WFDD CILD+D FV T++GIK+KGVRP+LIGSII H
Sbjct  5     SSSPESVTISTKSPSNPTGNLDCSWFDDGCILDIDCFVNTIAGIKSKGVRPDLIGSIIVH  64

Query  1435  YASKWLPELTggggseesiekgGHLII---KFeesssssvaesvsaSWMKKRFFVETLIG  1265
             YAS WLP+L+             H+I       +    S + SV+A  MKKRF VETLIG
Sbjct  65    YASTWLPDLSD------------HVIDPNDPQPQPQQQSESFSVTAFVMKKRFLVETLIG  112

Query  1264  ILPPEKDSIPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCG  1085
             I+PPEKDS+PCNFLLRLLR  +MVG ++ Y+AELE +ISWQL+QA+L+ELMIPSFSHTCG
Sbjct  113   IIPPEKDSVPCNFLLRLLRTASMVGADSNYKAELEAKISWQLDQASLKELMIPSFSHTCG  172

Query  1084  TVLDVELVLRLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAA  905
             T+LDVELV RLVK+F   L+++           SGA       +L+KVAKLVD YLAEAA
Sbjct  173   TLLDVELVTRLVKKF-TGLDNEGV--------KSGA-------SLVKVAKLVDSYLAEAA  216

Query  904   VDSNLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLS  725
             +DS+L++ +FI LA  +P HAR  +D LYR+IDTYLKAHP V+K+ERKRVC LIDS+KLS
Sbjct  217   LDSDLSLPEFITLAEALPNHARVCEDGLYRAIDTYLKAHPKVTKQERKRVCGLIDSKKLS  276

Query  724   AEASIHAAQNERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSp  545
              EAS+HAAQN+RLPVR +IQVL SEQTKLS +  + ++W            S  +  RS 
Sbjct  277   MEASLHAAQNDRLPVRNIIQVLFSEQTKLSHR-SQNIDW----------SGSSFSGARSS  325

Query  544   nppapgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLEIs  365
               P      +    RCMSKR+   IN+QH EI++L+E++ +L+++C  MQ Q+ KL+E  
Sbjct  326   PNPYGSHYSESGPTRCMSKRE---INVQHAEIRRLREDMAKLKSECEAMQTQLHKLIEKK  382

Query  364   srkrgssssgygffsswkkfGQLNKGIIITTSSSKLGSEVegeggggniaaigggfGRQT  185
                  SS  G+  +        L+  ++  T+  +             +          T
Sbjct  383   GTCTSSSHKGFFRWKKLGFRSGLSVSVVENTNGEQEFGGNGEGEEFEYV----------T  432

Query  184   PTPMDTKARLVRGRTSTKWRKSLS  113
              TP + K +LV+GRT ++WRKS+S
Sbjct  433   QTPGNMKTKLVKGRTPSRWRKSMS  456



>ref|XP_010462131.1| PREDICTED: root phototropism protein 3-like [Camelina sativa]
Length=454

 Score =   414 bits (1063),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 239/501 (48%), Positives = 321/501 (64%), Gaps = 57/501 (11%)
 Frame = -3

Query  1597  TALPESGTLSSCKPMG-----EC-WFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITH  1436
             T+ PES T+S+  P       EC  FDD CILD+DYFV T++GIK+KGVRP+LIGSII H
Sbjct  5     TSSPESATISTKSPSNSTGKIECSLFDDGCILDIDYFVNTIAGIKSKGVRPDLIGSIIVH  64

Query  1435  YASKWLPELTggggseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILP  1256
             YAS WLP+L+    + +  +               S + SV+A  MKKRF VETLIGI+P
Sbjct  65    YASTWLPDLSDVVQNPDDPQPQQQ-----------SESFSVTAFMMKKRFLVETLIGIIP  113

Query  1255  PEKDSIPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVL  1076
             PEKDS+PCNFLLRLLR  NMVG ++ Y++ELE +ISWQL+QA+L+ELMIPSFSHTCGT+L
Sbjct  114   PEKDSVPCNFLLRLLRTANMVGADSNYKSELEAKISWQLDQASLKELMIPSFSHTCGTLL  173

Query  1075  DVELVLRLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDS  896
             DVELV RLVK+F   L+++           SGA       +L+KVAKLVD YLAEAA+D 
Sbjct  174   DVELVTRLVKKF-TGLDNEGV--------KSGA-------SLVKVAKLVDSYLAEAALDG  217

Query  895   NLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEA  716
             +L++ +F++LA  +P HAR  +D LYR+IDTYLKAH  V+K+E+KR+C LID++KLS EA
Sbjct  218   DLSLPEFMSLAEALPYHARVNEDGLYRAIDTYLKAHSKVTKQEKKRLCGLIDNKKLSMEA  277

Query  715   SIHAAQNERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnpp  536
             S+HAAQN+RLPVRT++QVL SEQTKLS +    ++WSG SF             RS   P
Sbjct  278   SLHAAQNDRLPVRTILQVLFSEQTKLSNRSHNNIDWSGSSFSGV----------RSSPNP  327

Query  535   apgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLEIssrk  356
             +     +    RCMSKR+   IN+QH EI++L+E++  L++QC  MQ  + KL+E     
Sbjct  328   SGSHYSESGPARCMSKRE---INVQHAEIRRLREDMANLKSQCEAMQTHLHKLIE-----  379

Query  355   rgssssgygffsswkkfGQLNKGIIITTSSSKLGSEVegeggggniaaigggfGRQTPTP  176
             +  + +                G+ ++   +  G +  G  G G            T TP
Sbjct  380   KKGTCTSGKKGFFRWTKLGFRSGLSVSVVENTNGDQEFGGNGEGEEFEYV------TQTP  433

Query  175   MDTKARLVRGRTSTKWRKSLS  113
              +TK +LV+GRT ++WR S+S
Sbjct  434   GNTKTKLVKGRTPSRWRNSMS  454



>ref|XP_002891715.1| phototropic-responsive NPH3 family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH67974.1| phototropic-responsive NPH3 family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=456

 Score =   412 bits (1060),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 234/501 (47%), Positives = 321/501 (64%), Gaps = 54/501 (11%)
 Frame = -3

Query  1597  TALPESGTLSSCKPMG-----EC-WFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITH  1436
             T+ PES T+S+  P       EC WFDD CILD+D F+K+++GIK+KGVRP++IGSII H
Sbjct  4     TSSPESATISTKSPSTSTGKMECSWFDDGCILDIDNFIKSIAGIKSKGVRPDIIGSIIVH  63

Query  1435  YASKWLPELTggggseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILP  1256
             YASKWLP+L+             +      +    S + SV+A  MKKRFFVETL+GI+P
Sbjct  64    YASKWLPDLSDVVI---------NPEEPQLQPQQQSESFSVTAFVMKKRFFVETLLGIIP  114

Query  1255  PEKDSIPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVL  1076
             PEKDS+PC+FLLRLLR  NMVG ++ Y+ ELE+R+SWQL+QA+L+ELMIPSFSH CGT+L
Sbjct  115   PEKDSVPCDFLLRLLRTANMVGADSNYKKELEERVSWQLDQASLKELMIPSFSHLCGTLL  174

Query  1075  DVELVLRLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDS  896
             DVELV RLVK+F   L+++           SGA       +L+KVAKLVD YLAEAA+D 
Sbjct  175   DVELVTRLVKKF-ARLDNEGV--------KSGA-------SLVKVAKLVDSYLAEAALDG  218

Query  895   NLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEA  716
             +L++++FI+LA  +P HAR T+D LYR+IDTYLKAHP V+K+ERKR+C LIDS+KLS EA
Sbjct  219   DLSLAEFISLAEALPNHARVTEDGLYRAIDTYLKAHPKVTKQERKRLCGLIDSKKLSMEA  278

Query  715   SIHAAQNERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnpp  536
             S+HAAQN+RLPVRT+IQVL SE+ KL  +    +EW            S  +  RS   P
Sbjct  279   SLHAAQNDRLPVRTIIQVLFSEKVKLIHRSHNNIEW----------SGSSFSGARSSPNP  328

Query  535   apgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLEIssrk  356
             +     +    RCMSKR+   IN+Q  EI++L+E++ +L+++C  MQ Q+ K   I   +
Sbjct  329   SGSHYSESGPARCMSKRE---INVQQAEIRRLREDMAKLKSECEAMQTQLHKDKVI---E  382

Query  355   rgssssgygffsswkkfGQLNKGIIITTSSSKLGSEVegeggggniaaigggfGRQTPTP  176
             +  + +         K      G+ ++   + +G +      G             T TP
Sbjct  383   KKGTCTSGNKGFFRWKKLGFRSGLSVSVVENTIGEDFGDNREGEEYEYA-------TQTP  435

Query  175   MDTKARLVRGRTSTKWRKSLS  113
              + K +LV+GRT ++WRKS+S
Sbjct  436   GNMKTKLVKGRTPSRWRKSMS  456



>ref|XP_010500893.1| PREDICTED: coleoptile phototropism protein 1-like [Camelina sativa]
Length=452

 Score =   412 bits (1059),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 242/501 (48%), Positives = 321/501 (64%), Gaps = 59/501 (12%)
 Frame = -3

Query  1597  TALPESGTLSSCKPMG-----EC-WFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITH  1436
             T+ PES T+S+  P       EC  FDD CILD+DYFV T++GIK+KGVRP+LIGSII H
Sbjct  5     TSSPESATISTKSPSNSTGKIECSLFDDGCILDIDYFVNTIAGIKSKGVRPDLIGSIIVH  64

Query  1435  YASKWLPELTggggseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILP  1256
             YAS WLP+L+    + +  +               S + SV+A  MKKRF VETLIGI+P
Sbjct  65    YASTWLPDLSDVVQNPDESQPQQQ-----------SESFSVTAFVMKKRFLVETLIGIIP  113

Query  1255  PEKDSIPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVL  1076
             PEKDS+PCNFLLRLLR  NMVG ++ Y++ELE +ISWQL+QA+L+ELMIPSFSHTCGT+L
Sbjct  114   PEKDSVPCNFLLRLLRTANMVGADSNYKSELEAKISWQLDQASLKELMIPSFSHTCGTLL  173

Query  1075  DVELVLRLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDS  896
             DVELV RLVK+F   L+++           SGA       +L+KVAKLVD YLAEAA+D 
Sbjct  174   DVELVTRLVKKF-TGLDNEGV--------KSGA-------SLVKVAKLVDSYLAEAALDG  217

Query  895   NLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEA  716
             +L++ +FI+LA  +P HAR  +D LYR+IDTYLKAHP V+K+ERK +C LIDS+KLS EA
Sbjct  218   DLSLPEFISLAEALPYHARVNEDGLYRAIDTYLKAHPKVTKQERKILCGLIDSKKLSMEA  277

Query  715   SIHAAQNERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnpp  536
             S+HAAQN+RLPVRT++QVL SEQTKLS +    ++WSG SF             RS   P
Sbjct  278   SLHAAQNDRLPVRTILQVLFSEQTKLSHR--NNIDWSGSSFSGV----------RSSPNP  325

Query  535   apgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLEIssrk  356
             +     +    RCMSKR+   IN+QH EI++L+E++  L++QC  MQ Q+ KL+E     
Sbjct  326   SGSHYSESGPARCMSKRE---INVQHAEIRRLREDMANLKSQCEAMQTQLHKLIE-----  377

Query  355   rgssssgygffsswkkfGQLNKGIIITTSSSKLGSEVegeggggniaaigggfGRQTPTP  176
             +  + +                G+ ++   +  G +  G  G G            T TP
Sbjct  378   KKGTCTSGKKGFFRWTKLGFRSGLSVSVVENTNGDQEFGGNGEGEEFEYV------TQTP  431

Query  175   MDTKARLVRGRTSTKWRKSLS  113
              + K +LV+GRT ++WR S+S
Sbjct  432   GNIKTKLVKGRTPSRWRNSMS  452



>ref|XP_010691229.1| PREDICTED: root phototropism protein 3 [Beta vulgaris subsp. 
vulgaris]
Length=419

 Score =   409 bits (1051),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 226/418 (54%), Positives = 283/418 (68%), Gaps = 54/418 (13%)
 Frame = -3

Query  1618  MEELKMATALPESGTLSSCKPM--GECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSI  1445
             M+++++   +P S T +   P    E W DDACILDMDYFVKTLSGIK+KGVRP+L+GSI
Sbjct  1     MDKVQVMNRIPLSKTSAGQAPQWASEHWLDDACILDMDYFVKTLSGIKSKGVRPDLVGSI  60

Query  1444  ITHYASKWLPELTggggseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIG  1265
             I HYASKW+PEL+                +   E       E+V+++W KKRFFVETL+G
Sbjct  61    IAHYASKWVPELSESRD------------VTGLEGDDPVSPETVTSAWRKKRFFVETLVG  108

Query  1264  ILPPEKDSIPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCG  1085
             ILPPE D++PCNFLLRLLR+ NMVGVE +Y+ ELEKR+SWQL+QATL+ELMIPSFSHTCG
Sbjct  109   ILPPENDTVPCNFLLRLLRVANMVGVEISYKEELEKRVSWQLDQATLKELMIPSFSHTCG  168

Query  1084  TVLDVELVLRLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAA  905
             T+LDVELV+RLVKRF          M        GA        LIKVAKLVD YLAE A
Sbjct  169   TLLDVELVMRLVKRF----------MGLDEGVRGGAA-------LIKVAKLVDSYLAEIA  211

Query  904   VDSNLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLS  725
             +D+NL +  FI LA  +P HAR  DD LYR++DTYLKAH GV+K+ER+ +C+LID RKLS
Sbjct  212   MDTNLKLEDFIQLAGALPAHARAIDDGLYRAVDTYLKAHHGVTKQERRLLCRLIDCRKLS  271

Query  724   AEASIHAAQNERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSp  545
              EA +HA+QNERLPVR V+QVL SEQ+K++    RQL+WSG    S S  ++G   P   
Sbjct  272   PEACLHASQNERLPVRAVVQVLFSEQSKIT----RQLDWSGPLSTSRSPNSNGLDVP---  324

Query  544   nppapgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLE  371
                           RC SKR+   ++ Q  EIK+LKE+V+RLQ Q   +Q Q+EK+LE
Sbjct  325   -------------ARCHSKRE---VSAQQTEIKRLKEDVVRLQNQINILQNQLEKVLE  366



>ref|XP_009147664.1| PREDICTED: root phototropism protein 3 [Brassica rapa]
Length=451

 Score =   404 bits (1039),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 241/501 (48%), Positives = 313/501 (62%), Gaps = 59/501 (12%)
 Frame = -3

Query  1597  TALPESGTLSSCKP---MGE---CWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITH  1436
             T+ PES T+S   P   +GE      D++ I D+DYFVKT++ IKAKGVRP+LIGSIITH
Sbjct  4     TSSPESATVSVKSPATTVGEMECSLLDESSIHDIDYFVKTIAQIKAKGVRPDLIGSIITH  63

Query  1435  YASKWLPELTggggseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILP  1256
             YASKWLP+L+    +            + +  S S  A       MKKRF+VETLIGI+P
Sbjct  64    YASKWLPDLSDIFTTSPDGPNQQPQPQQVQSESFSVTAFV-----MKKRFYVETLIGIIP  118

Query  1255  PEKDSIPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVL  1076
             PEKDS+ C+FLLRLLR  N+VG + +YRAELE R+SWQL+QA+L+ELMIPSFSHTCGT+L
Sbjct  119   PEKDSVSCDFLLRLLRTANLVGADDSYRAELEGRVSWQLDQASLKELMIPSFSHTCGTLL  178

Query  1075  DVELVLRLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDS  896
             DVELV RLVK+F             +G  S G   +    +L+KVAKLVD YLAE AVD 
Sbjct  179   DVELVTRLVKKF-------------AGLDSEG---VKSGASLVKVAKLVDSYLAEVAVDG  222

Query  895   NLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEA  716
             +L++S+FI+LA  +P HAR T+D LYR+IDTYLKAHP V+K+ERKR+C LIDS+KLS EA
Sbjct  223   DLSLSEFISLAEALPNHARGTEDGLYRAIDTYLKAHPKVTKQERKRLCGLIDSKKLSVEA  282

Query  715   SIHAAQNERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnpp  536
             S+H AQN+RLPVRTVIQVLL+EQ K+S+      +WSG +F            P S    
Sbjct  283   SLHVAQNDRLPVRTVIQVLLTEQAKMSRSRHNNNDWSGLTFSPN---------PSS----  329

Query  535   apgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLEIssrk  356
                   +    RCMSKR+M   N+Q +EIK+LKE++ +L+++   MQ Q+EKL+E     
Sbjct  330   --SHYSESGPARCMSKREM---NVQQMEIKRLKEDMAKLKSEFEAMQTQLEKLVE-----  379

Query  355   rgssssgygffsswkkfGQLNKGIIITTSSSKLGSEVegeggggniaaigggfGRQTPTP  176
                  S         K      G  ++    K G E    G              +T TP
Sbjct  380   --KKCSSGSKGFFRWKKLGFRSGFSVSV-LDKNGEEFGENGEREEYFGY------ETQTP  430

Query  175   MDTKARLVRGRTSTKWRKSLS  113
              + K +LV+GRT ++WRKS+S
Sbjct  431   SNMKTKLVKGRTPSRWRKSMS  451



>emb|CDY62203.1| BnaA06g01470D [Brassica napus]
Length=451

 Score =   403 bits (1036),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 241/501 (48%), Positives = 315/501 (63%), Gaps = 59/501 (12%)
 Frame = -3

Query  1597  TALPESGTLSSCKP---MGE---CWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITH  1436
             T+ PES  +S   P   +GE     FD++ I D+DYFVKT++ IKAKGVRP+LIGSIITH
Sbjct  4     TSSPESAPVSVKSPATTVGEMECSLFDESSIHDIDYFVKTIAQIKAKGVRPDLIGSIITH  63

Query  1435  YASKWLPELTggggseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILP  1256
             YASKWLP+L+    +            + +  S S  A       MKKRF+VETLIGI+P
Sbjct  64    YASKWLPDLSDIFTTSPDGPNQQSQPQQVQSESFSVTAFV-----MKKRFYVETLIGIIP  118

Query  1255  PEKDSIPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVL  1076
             PEKDS+ C+FLLRLLR  N+VG + +YRAELE R+SWQL+QA+L+ELMIPSFSHTCGT+L
Sbjct  119   PEKDSVSCDFLLRLLRTANLVGADDSYRAELEGRVSWQLDQASLKELMIPSFSHTCGTLL  178

Query  1075  DVELVLRLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDS  896
             DVELV R+VK+F   L+++           SGA       +L+KVAKLVD YLAE AVD 
Sbjct  179   DVELVTRVVKKF-AGLDNEGV--------KSGA-------SLVKVAKLVDSYLAEVAVDG  222

Query  895   NLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEA  716
             +L++S+FI+LA  +P HAR T+D LYR+IDTYLKAHP V+K+ERKR+C LIDS+KLS EA
Sbjct  223   DLSLSEFISLAEALPNHARGTEDGLYRAIDTYLKAHPKVTKQERKRLCGLIDSKKLSVEA  282

Query  715   SIHAAQNERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnpp  536
             S+H AQN+RLPVRTVIQVLL+EQ K+S+      +WSG +F            P S    
Sbjct  283   SLHVAQNDRLPVRTVIQVLLTEQAKMSRSRHNNNDWSGLTFSPN---------PSS----  329

Query  535   apgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLEIssrk  356
                   +    RCMSKR+M   N+Q +EIK+LKE++ +L+++   MQ Q+EKL+E     
Sbjct  330   --SHYSESGPARCMSKREM---NVQQMEIKRLKEDMAKLKSEFEAMQTQLEKLVE-----  379

Query  355   rgssssgygffsswkkfGQLNKGIIITTSSSKLGSEVegeggggniaaigggfGRQTPTP  176
                  S         K      G  ++    K G E    G              +T TP
Sbjct  380   --KKCSSGSKGFFRWKKLGFRSGFSVSV-LDKNGEEFGENGEREEYFGY------ETQTP  430

Query  175   MDTKARLVRGRTSTKWRKSLS  113
              + K +LV+GRT ++WRKS+S
Sbjct  431   SNMKTKLVKGRTPSRWRKSMS  451



>gb|KFK38904.1| hypothetical protein AALP_AA3G175900 [Arabis alpina]
Length=448

 Score =   401 bits (1031),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 245/507 (48%), Positives = 315/507 (62%), Gaps = 74/507 (15%)
 Frame = -3

Query  1597  TALPESGTLSS---CKPMGE----CWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIIT  1439
             T  PES T+S        G+     WFDDACI DM+YFVKT++GIK KG+RP+LIGSII 
Sbjct  4     TPSPESTTISGKQHSSVAGDMEYYSWFDDACIQDMNYFVKTIAGIKTKGIRPDLIGSIIA  63

Query  1438  HYASKWLPELTggggseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGIL  1259
             HYASKWLP+L+G   S           I   +++ +   ESV+AS MKKRFFVETL+GIL
Sbjct  64    HYASKWLPDLSGNVSS-----------ITDSKNNRNDPPESVTASLMKKRFFVETLVGIL  112

Query  1258  PPEKDSIPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTV  1079
             PPEKDS+PCNFLLRLLR   MVG    Y  ELE R+SWQL+QA+L+ELMIPSFSHTCGT+
Sbjct  113   PPEKDSVPCNFLLRLLRTAKMVGANPNYLTELETRVSWQLDQASLKELMIPSFSHTCGTL  172

Query  1078  LDVELVLRLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVD  899
             LDVELV RLVK+F        + +   G  +  A        L+KVAKLVD YLAEAA+D
Sbjct  173   LDVELVTRLVKKF--------SGLDIEGVKTGAA--------LVKVAKLVDSYLAEAAID  216

Query  898   SNLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAE  719
               LT+ +FI+L   +P+HAR T+D LYR+IDTYLKAHP V K+ERK +C+LIDSRKLS E
Sbjct  217   GGLTLPEFISLVEALPSHARTTEDGLYRAIDTYLKAHPTVLKQERKEICRLIDSRKLSPE  276

Query  718   ASIHAAQNERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnp  539
             A++HAAQN+RLPVR +I+VL +EQTKLS    R ++W        S  +   T     NP
Sbjct  277   AALHAAQNDRLPVRAIIRVLFNEQTKLS----RHMDW--------SGSSICSTTRSPTNP  324

Query  538   papgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLEIssr  359
                         RC+SKR+M   N+Q  EI++L+E+V+RLQ++C  M  Q+E+L+E    
Sbjct  325   SGSHYFDAGSGARCLSKREM---NVQQAEIRRLREDVVRLQSECGAMHLQLERLME----  377

Query  358   krgssssgygffsswkkfGQLNKGII----ITTSSSKLGSEVegeggggniaaigggfGR  191
                             K    +KG      +    S  GS    +   G   +   G G 
Sbjct  378   ----------------KKSSGSKGFFRWKRLGLVPSIRGSVNVEKMTNGEEESGDNGEGF  421

Query  190   QTPTPMDTKARLVRGRTS-TKWRKSLS  113
             +  TP + K RLV+GRT+ ++WRKS+S
Sbjct  422   EPRTPGNMKTRLVKGRTTPSRWRKSMS  448



>ref|XP_007150696.1| hypothetical protein PHAVU_005G173900g [Phaseolus vulgaris]
 gb|ESW22690.1| hypothetical protein PHAVU_005G173900g [Phaseolus vulgaris]
Length=351

 Score =   397 bits (1021),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 221/399 (55%), Positives = 267/399 (67%), Gaps = 66/399 (17%)
 Frame = -3

Query  1576  TLSSCKPMGECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggg  1397
             T+ SC    ECW DDACI+DMD FVKTLS IK KG+R +LIGSIITHYAS WLP+L+   
Sbjct  12    TVGSC----ECWLDDACIVDMDCFVKTLSSIKQKGIRADLIGSIITHYASIWLPDLS---  64

Query  1396  gseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLR  1217
                           +   ++     +S++ SWMKKRFFVETL+ +LPPEKDS+PCNFLLR
Sbjct  65    --------------EHGVTTQFQSPQSITNSWMKKRFFVETLVNVLPPEKDSVPCNFLLR  110

Query  1216  LLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFI  1037
             LLR   MV V+AAYRAE+E RIS QL+QA+L+ELMIPSFSHTCGT+LDVELVLRLVK F+
Sbjct  111   LLRTAIMVRVDAAYRAEIENRISSQLDQASLKELMIPSFSHTCGTLLDVELVLRLVKTFL  170

Query  1036  VSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAP  857
                 D AA                    L+KVAKLVD YLAEAAVD+ L++S+F ALA  
Sbjct  171   SMDRDGAA--------------------LVKVAKLVDCYLAEAAVDAGLSLSEFRALAGV  210

Query  856   IPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVR  677
             +P+HAR +DD LYR+IDTYLKAH GVSK+ERK +C+L+DSRKL+ EAS+HAAQNERLPVR
Sbjct  211   LPSHARASDDGLYRAIDTYLKAHQGVSKQERKGLCRLLDSRKLTPEASLHAAQNERLPVR  270

Query  676   TVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapgaqqqqqdPRC  497
              VIQVL SEQ KL+    RQ++WS                                  RC
Sbjct  271   AVIQVLFSEQAKLN----RQVDWS------------------GSFSLRSPNGGLDPLGRC  308

Query  496   MSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEK  380
             +SKR+MN    Q LEI+KLKE+V RLQ Q   M+ Q+EK
Sbjct  309   LSKREMNA---QQLEIRKLKEDVNRLQNQLNAMKVQMEK  344



>gb|KFK35770.1| hypothetical protein AALP_AA4G033900 [Arabis alpina]
Length=427

 Score =   400 bits (1027),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 231/480 (48%), Positives = 297/480 (62%), Gaps = 63/480 (13%)
 Frame = -3

Query  1549  EC-WFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiek  1373
             EC WFDD CILDMDYFVKT++GIKAKGVR +LIGSII+HYAS WLP+L+    + +  ++
Sbjct  10    ECSWFDDGCILDMDYFVKTIAGIKAKGVRSDLIGSIISHYASTWLPDLSDATINPDEPQE  69

Query  1372  gGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMV  1193
                +                    MKKRFFVETLIGI+PPEKDS+PCNFLLRLLR  NM 
Sbjct  70    SESVTAYV----------------MKKRFFVETLIGIIPPEKDSVPCNFLLRLLRAANMF  113

Query  1192  GVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAA  1013
             G +  Y  ELE RI+WQL+QA+L+ELMIPSFSHTCGT+LDVELV RLVK+F V L+++  
Sbjct  114   GADRTYTVELEARIAWQLDQASLKELMIPSFSHTCGTLLDVELVTRLVKKF-VGLDNEGV  172

Query  1012  VMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPT  833
                      SGA       +L+KVAKLVD YL EAA+D +L++ +FI LA  +P H R  
Sbjct  173   --------KSGA-------SLVKVAKLVDSYLTEAAIDGDLSLLEFITLAEALPNHTRVI  217

Query  832   DDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLS  653
             +D LYR+IDTYLKAHP + K+ERK +C+LIDS+KLS EAS+HAAQN RLPVR +IQVL +
Sbjct  218   EDGLYRAIDTYLKAHPKLEKQERKTLCELIDSKKLSTEASLHAAQNNRLPVRAIIQVLFT  277

Query  652   EQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapgaqqqqqdPRCMSKRDMNT  473
             EQTKLS +    + WSG  F    + +       +               RCMSKR+M  
Sbjct  278   EQTKLSHRRNNNINWSGSPFSPTPSSSHYSESGPA---------------RCMSKREM--  320

Query  472   INIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLEIssrkrgssssgygffsswkkfGQLN  293
              N+Q  EIK+L+E++ +LQ+    MQ Q+EKL E   +K   S+ G        K     
Sbjct  321   -NVQQTEIKRLREDMAKLQSDFEAMQTQLEKLNE---KKGSYSNHGGSRGFFRWKKLGFR  376

Query  292   KGIIITTSSSKLGSEVegeggggniaaigggfGRQTPTPMDTKARLVRGRTSTKWRKSLS  113
              G  ++      G E                +  QTP+ M TK  +V+GRT ++WRKS+S
Sbjct  377   SGFSVSVLDKTNGEEF-------GDHGEEFEYVNQTPSNMKTK--IVKGRTPSRWRKSMS  427



>ref|XP_009146226.1| PREDICTED: coleoptile phototropism protein 1 [Brassica rapa]
 emb|CDX97684.1| BnaA05g23950D [Brassica napus]
Length=439

 Score =   400 bits (1027),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 230/479 (48%), Positives = 298/479 (62%), Gaps = 75/479 (16%)
 Frame = -3

Query  1543  WFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekgGH  1364
             WFD+ACI DM+YFVKT++GIK+KG+RP+LIGSII HYASKWLP+L+G   +  +      
Sbjct  34    WFDEACIQDMNYFVKTITGIKSKGIRPDLIGSIIAHYASKWLPDLSGNVSAIATPPPTES  93

Query  1363  LIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMVGVE  1184
             +                    MKKRFFVETLIGILPPEKDS+PCNFLLRLLR   MVG  
Sbjct  94    VTASV----------------MKKRFFVETLIGILPPEKDSVPCNFLLRLLRTAKMVGAN  137

Query  1183  AAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAAVMR  1004
             A Y  ELE R++WQL+QA+L+ELMIPSFSHT GT+LDVELV RLVK+F+           
Sbjct  138   ANYLTELENRVAWQLDQASLKELMIPSFSHTSGTLLDVELVTRLVKKFV-----------  186

Query  1003  CSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPTDDA  824
               G  S G   +     L+KVAKLVD YLAEAA+D  LT+ +FI+L   +P++AR T+D 
Sbjct  187   --GLDSEG---VKTGAALVKVAKLVDSYLAEAALDGGLTLREFISLIEALPSYARTTEDG  241

Query  823   LYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLSEQT  644
             LYR+IDTYLKAHP V K+ERK +C+LIDSRKLS EA++HAAQN+RLPVR++I+VL +EQT
Sbjct  242   LYRAIDTYLKAHPQVLKQERKELCRLIDSRKLSPEAALHAAQNDRLPVRSIIRVLFTEQT  301

Query  643   KLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapgaqqqqqdPRCMSKRDMNTINI  464
             KLS    R ++W       + +     T P      +   +Q     RC+SKR+M   N+
Sbjct  302   KLS----RHVDW-------SGSLTRSPTNPSG----SHYFEQGGSGARCLSKREM---NV  343

Query  463   QHLEIKKLKEEVLRLQTQCINMQAQIEKLLEIssrkrgssssgygffsswkkfGQLNKGI  284
             Q  EIK+L+E+V RLQ++C  M  Q+E+LLE  S                      +KG 
Sbjct  344   QQAEIKRLREDVARLQSECSAMHLQVERLLEKKSGG--------------------SKGF  383

Query  283   IITTSSSKLG--SEVegeggggniaaigggfGRQTPTPMDTKARLVRGRTSTKWRKSLS  113
                    +LG    + G      +     G G +  TP + K RLV+GRT ++WRKS+S
Sbjct  384   F---RWKRLGLVPSIRGSVSVEEMTNCENGEGFEPQTPGNMKTRLVKGRTPSRWRKSMS  439



>ref|XP_011072265.1| PREDICTED: root phototropism protein 3 [Sesamum indicum]
Length=393

 Score =   397 bits (1021),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 229/414 (55%), Positives = 283/414 (68%), Gaps = 57/414 (14%)
 Frame = -3

Query  1603  MATALPESGTLSSC---KPMGECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHY  1433
             M  + PES TLS+     P  + W DDA ILDMD F+KTL GI+ KGVRP+LIGSIITHY
Sbjct  1     MQNSSPESVTLSNKLARSPSDQRWSDDADILDMDGFIKTLLGIQGKGVRPDLIGSIITHY  60

Query  1432  ASKWLPELTggggseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPP  1253
             ASKW+P+L G                K   SS     ES++ SWMK++  +ETL+GILP 
Sbjct  61    ASKWIPDLAGDEP-------------KSAVSSFQDSPESITVSWMKQKLLIETLVGILPS  107

Query  1252  EKDSIPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLD  1073
             EKDS+PCNFLLRLLR+ NMVGVEA   A+LEKR+SWQL++A+L+ELMIP FSHTC T+LD
Sbjct  108   EKDSVPCNFLLRLLRLANMVGVEAKCLAKLEKRVSWQLDRASLKELMIPCFSHTCATLLD  167

Query  1072  VELVLRLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSN  893
              ELVLRLV+ F+ S E          +  SGA        L KVAKLVD YLAEAAVDS+
Sbjct  168   CELVLRLVRGFLSSEE----------TVRSGAA-------LAKVAKLVDCYLAEAAVDSH  210

Query  892   LTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEAS  713
             LT+ +F ALA  +P+HAR TDD LYR++D YLKAHPG+ K++RKR+C LIDSRKLSAEAS
Sbjct  211   LTLPEFFALACAVPSHARSTDDGLYRAVDIYLKAHPGLPKQDRKRLCTLIDSRKLSAEAS  270

Query  712   IHAAQNERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppa  533
             +HA +NERLPVR VIQVLLSEQTKLSK    Q++W               + P S     
Sbjct  271   LHATRNERLPVRAVIQVLLSEQTKLSK----QVDW---------------SGPLS--SGR  309

Query  532   pgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLE  371
               A   +   RCMS+R+M T   Q +E+K+LKE+VLRLQ+QC+ M+  IE++LE
Sbjct  310   SPAVGPEGPARCMSRREMFT---QQMEMKRLKEDVLRLQSQCMKMEGVIEQMLE  360



>ref|XP_006406951.1| hypothetical protein EUTSA_v10022354mg [Eutrema salsugineum]
 gb|ESQ48404.1| hypothetical protein EUTSA_v10022354mg [Eutrema salsugineum]
Length=452

 Score =   399 bits (1025),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 240/482 (50%), Positives = 307/482 (64%), Gaps = 68/482 (14%)
 Frame = -3

Query  1543  WFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekgGH  1364
             WFDDACI DM+YFVKT++GIK+KG+RP+LIGSII HYASKWLP+L+G             
Sbjct  34    WFDDACIQDMNYFVKTIAGIKSKGIRPDLIGSIIAHYASKWLPDLSGN------------  81

Query  1363  LIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMVGVE  1184
              I    ES +    ESV+AS MKKRFFVETLIGILPPEKDS+PCNFLLRLLR   MVG  
Sbjct  82    -ISSVTESRNPPQTESVTASVMKKRFFVETLIGILPPEKDSVPCNFLLRLLRTAKMVGAN  140

Query  1183  AAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAAVMR  1004
               Y  ELE R+SWQL+QA+L+ELMIPSFSHTCGT+LDVELV RLVK+F        A + 
Sbjct  141   PNYLTELENRVSWQLDQASLKELMIPSFSHTCGTLLDVELVTRLVKKF--------AGLD  192

Query  1003  CSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPTDDA  824
               G        +    +L+KVAKLVD YLAEAA+D  LT+ +F++L   +P+HAR T+D 
Sbjct  193   IEG--------VKTGASLVKVAKLVDSYLAEAAIDGGLTLPEFVSLIEALPSHARTTEDG  244

Query  823   LYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLSEQT  644
             LYR+IDTYLKAHP + K+ERK +C+LIDSRKLS EA++HAAQN+RLPVR +I+VL +EQT
Sbjct  245   LYRAIDTYLKAHPLLLKQERKELCRLIDSRKLSPEAALHAAQNDRLPVRAIIRVLFTEQT  304

Query  643   KLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapgaqqqqqdPRCMSKRDMNTINI  464
             KLS    R ++W   S  S S+     T P           +     RC+SKR+M   N+
Sbjct  305   KLS----RHIDW---SGSSISSTMRSPTNPSG-----SHYLESGSAARCLSKREM---NV  349

Query  463   QHLEIKKLKEEVLRLQTQCINMQAQIEKLLEIssrkrgssssgygffsswkkfGQLNKGI  284
             Q  EI++L+E+V RLQ++C  M  Q+E+L+E                   KK    +KG 
Sbjct  350   QQAEIRRLREDVARLQSECGAMHLQLERLME-------------------KKSSSGSKGF  390

Query  283   I----ITTSSSKLGSEVegeggggniaaigggfGRQTPTPMDTKARLVRGRTS-TKWRKS  119
                  +    S  GS    +   G   +   G G +  TP + K RLV+GRT+ ++WRKS
Sbjct  391   FRWKRLGLVPSIRGSVSVEKMANGEEESGENGEGFEPRTPGNMKTRLVKGRTTPSRWRKS  450

Query  118   LS  113
             +S
Sbjct  451   MS  452



>emb|CDX75835.1| BnaC03g39180D [Brassica napus]
Length=439

 Score =   394 bits (1012),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 237/479 (49%), Positives = 304/479 (63%), Gaps = 73/479 (15%)
 Frame = -3

Query  1546  CWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekgG  1367
              WFD+A I DM+YFVKT++GIK+KG+RP+LIGSII HYASKWLP+L+G            
Sbjct  33    SWFDEASIQDMNYFVKTITGIKSKGIRPDLIGSIIAHYASKWLPDLSGN-----------  81

Query  1366  HLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMVGV  1187
                +     +     ESV+AS MKKRFFVETL GILPPEKDS+PCNFLLRLLR   MVG 
Sbjct  82    ---VSAATVTPPPPTESVTASVMKKRFFVETLTGILPPEKDSVPCNFLLRLLRTAKMVGA  138

Query  1186  EAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAAVM  1007
                Y  ELE R+SWQL+QA+L+ELMIPSFSHTCGT+LDVELV RLVK+F           
Sbjct  139   NQNYLTELENRVSWQLDQASLKELMIPSFSHTCGTLLDVELVTRLVKKF-----------  187

Query  1006  RCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPTDD  827
               +G  S G   +     L+KVAKLVD YLAEAA+D  LT+ + I+LA  +P+HAR T+D
Sbjct  188   --AGLDSEG---VKTGAALVKVAKLVDSYLAEAAIDGGLTLPELISLAEALPSHARTTED  242

Query  826   ALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLSEQ  647
              LYR+IDTYLKAHP V K+ERK +C+LIDSRKLS EA++HAAQN+RLPVR++I+VL +EQ
Sbjct  243   GLYRAIDTYLKAHPQVMKQERKELCRLIDSRKLSPEAALHAAQNDRLPVRSIIRVLFTEQ  302

Query  646   TKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapgaqqqqqdPRCMSKRDMNTIN  467
             TKLS    R ++WS     S+         P S              P+C+SKR+M   N
Sbjct  303   TKLS----RHVDWSPSGSHSSE--------PGS-------------GPQCLSKREM---N  334

Query  466   IQHLEIKKLKEEVLRLQTQCINMQAQIEKLLEIssrkrgssssgygffsswkkfGQLNKG  287
             +Q  EIK+L+++VLRLQ++C  M  Q+E+L+E          S  G    + ++ +L  G
Sbjct  335   VQQAEIKRLRDDVLRLQSECGAMHMQMERLMEK--------KSSGGGSKGFFRWKRLGLG  386

Query  286   IIITTSSSKLGSEVegeggggniaaigggfGRQTPTPMDTKARLVRGRTS-TKWRKSLS  113
               I  S   +G E    G             R   TP + K RLV+GRT+ ++WRKS+S
Sbjct  387   PSIRGS---VGVEKMMNGEEEVGDNGEELEPR---TPGNMKTRLVKGRTTPSRWRKSMS  439



>emb|CDY26059.1| BnaC06g05650D [Brassica napus]
Length=451

 Score =   393 bits (1010),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 238/501 (48%), Positives = 311/501 (62%), Gaps = 59/501 (12%)
 Frame = -3

Query  1597  TALPESGTLSSCKP---MGE---CWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITH  1436
             T+ PES T+S   P   +GE      D++ I D+DYFVKT++ IKAKGVR +LIGSIITH
Sbjct  4     TSSPESATISVKSPETTVGEMECSLLDESSIHDIDYFVKTIAQIKAKGVRADLIGSIITH  63

Query  1435  YASKWLPELTggggseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILP  1256
             YASKWLP+L+    +            + +  S S  A       MKKRF+VETLIGI+P
Sbjct  64    YASKWLPDLSDIFTTSPDGPNQQSQPQQLQSESFSVTAFV-----MKKRFYVETLIGIIP  118

Query  1255  PEKDSIPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVL  1076
             PEKDS+ C+FLLRLLR  N+VG +  Y+AELE R+SWQL+QA+L+ELMIPSFSHTCGT+L
Sbjct  119   PEKDSVSCDFLLRLLRTANLVGADDNYKAELEGRVSWQLDQASLKELMIPSFSHTCGTLL  178

Query  1075  DVELVLRLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDS  896
             DVELV RLVK+F   L+ +           SGA       +L+KVAKLVD YLAE AVD 
Sbjct  179   DVELVTRLVKKF-AGLDSEGV--------KSGA-------SLVKVAKLVDSYLAEVAVDG  222

Query  895   NLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEA  716
             +L++ +F++LA  +P HAR T+D LYR+IDTYLKAHP V+K+ERKR+C LIDS+KLS EA
Sbjct  223   DLSLVEFVSLAEALPNHARGTEDGLYRAIDTYLKAHPKVTKQERKRLCGLIDSKKLSVEA  282

Query  715   SIHAAQNERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnpp  536
             S+H AQN+RLPVRTVIQVLL+EQ K+S+      +WSG +F            P S    
Sbjct  283   SLHVAQNDRLPVRTVIQVLLTEQAKMSRSRHNNNDWSGLTFSPN---------PSS----  329

Query  535   apgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLEIssrk  356
                   +    RCMSKR+M   N+Q +EIK+LK ++ +L+++   MQ Q+EKL+E     
Sbjct  330   --SHYSESGPARCMSKREM---NVQQMEIKRLKGDMAKLKSEFEAMQTQLEKLVE-----  379

Query  355   rgssssgygffsswkkfGQLNKGIIITTSSSKLGSEVegeggggniaaigggfGRQTPTP  176
                  S         K      G  ++    K G E    G  G           +T TP
Sbjct  380   --KKCSSGSKGFFRWKKLGFRSGFSVSV-LDKNGEEFGENGETGEYFGY------ETQTP  430

Query  175   MDTKARLVRGRTSTKWRKSLS  113
              + K +LV+GRT ++WRKS+S
Sbjct  431   SNMKTKLVKGRTPSRWRKSMS  451



>ref|XP_010487383.1| PREDICTED: root phototropism protein 3-like [Camelina sativa]
Length=452

 Score =   392 bits (1007),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 233/479 (49%), Positives = 301/479 (63%), Gaps = 56/479 (12%)
 Frame = -3

Query  1546  CWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekgG  1367
              +FDD+CI DM+YFVKT++GIK+KG+RP+LIGSII HYASKWLP+L+G   +  S     
Sbjct  29    SYFDDSCIQDMNYFVKTIAGIKSKGIRPDLIGSIIAHYASKWLPDLSGNVSAIISTSVES  88

Query  1366  HLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMVGV  1187
                        +   ESV+AS MKKRFFVETLIGILPPEKDS+PCNFLLRLLR   MVG 
Sbjct  89    K-----NHPFDTQQPESVTASVMKKRFFVETLIGILPPEKDSVPCNFLLRLLRTAKMVGA  143

Query  1186  EAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAAVM  1007
                Y  E+E R+SWQL+QA+L+ELMIPSFS+T GT+LDV+LV RLVKRF           
Sbjct  144   NPNYLNEIETRVSWQLDQASLKELMIPSFSYTSGTLLDVDLVTRLVKRF-----------  192

Query  1006  RCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPTDD  827
               +G  S G   +     L+KVAKLVD YLAEAAVDS LT+ +FI+L   +P+HAR T+D
Sbjct  193   --TGLDSEG---VKTGAALVKVAKLVDSYLAEAAVDSGLTLPEFISLIEALPSHARTTED  247

Query  826   ALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLSEQ  647
              LYR+IDTYLKAHP V K+ERK +C+LIDSRKLS EA++HAAQN+RLPVR +I+VL +EQ
Sbjct  248   GLYRAIDTYLKAHPQVLKQERKELCRLIDSRKLSPEAALHAAQNDRLPVRAIIRVLFTEQ  307

Query  646   TKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapgaqqqqqdPRCMSKRDMNTIN  467
             TKLS    R ++W        +  +   T     NP      +     RC+SKR+   IN
Sbjct  308   TKLS----RHIDW--------NGSSISSTTRSPTNPSGSHYFEGGAAARCLSKRE---IN  352

Query  466   IQHLEIKKLKEEVLRLQTQCINMQAQIEKLLEIssrkrgssssgygffsswkkfGQLNKG  287
             +Q  EI++L+E+V RLQ++C +M  Q+E+L+E                   KK    +KG
Sbjct  353   VQQTEIRRLREDVARLQSECSSMHLQLERLME-------------------KKSSSGSKG  393

Query  286   IIITTSSSKLGSEVegeggggniaaigggfGRQTPTPMDTKARLVRGRTS-TKWRKSLS  113
                      + S              G   G +  TP + K RLV+GRT+ ++WRKS+S
Sbjct  394   FFRWKRLGLVPSIRGSVSVEKGEEESGDNEGFEPRTPGNMKTRLVKGRTTPSRWRKSMS  452



>ref|XP_006297661.1| hypothetical protein CARUB_v10013684mg [Capsella rubella]
 gb|EOA30559.1| hypothetical protein CARUB_v10013684mg [Capsella rubella]
Length=453

 Score =   392 bits (1006),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 236/481 (49%), Positives = 303/481 (63%), Gaps = 60/481 (12%)
 Frame = -3

Query  1546  CWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesi--ek  1373
              +FDD+CI DM+YFVKT++GIK+KG+RP+LIGSII HYASKWLP+L+G   +  S   E 
Sbjct  30    SYFDDSCIQDMNYFVKTIAGIKSKGIRPDLIGSIIAHYASKWLPDLSGNVSAIVSTPIES  89

Query  1372  gGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMV  1193
               H I        +   ESV+AS MKKRFFVETLIGILPPEKDS+PCNFLLRLLR   MV
Sbjct  90    KNHPI-------DTQQPESVTASVMKKRFFVETLIGILPPEKDSVPCNFLLRLLRTAKMV  142

Query  1192  GVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAA  1013
             G    Y  E+E R+SWQL+QA+L+ELMIPSFS+T GT+LDVELV RLVKRF         
Sbjct  143   GANPNYLTEIETRVSWQLDQASLKELMIPSFSYTSGTLLDVELVTRLVKRF---------  193

Query  1012  VMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPT  833
                 +G  S G   +     L+KVAKLVD YLAEAAVD  L++ +FI+L   +P+HAR T
Sbjct  194   ----AGLDSEG---VKTGAALVKVAKLVDSYLAEAAVDGGLSLPEFISLIEALPSHARTT  246

Query  832   DDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLS  653
             +D LYR++DTYLKAHP V K+ERK +C+LIDSRKLS EA++HAAQN+RLPVR +I+VL +
Sbjct  247   EDGLYRAVDTYLKAHPQVLKQERKELCRLIDSRKLSPEAALHAAQNDRLPVRAIIRVLFT  306

Query  652   EQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapgaqqqqqdPRCMSKRDMNT  473
             EQTKLS    R ++W        +  +   T     NP A    +     RC+SKR+M  
Sbjct  307   EQTKLS----RHIDW--------NGSSISSTTRSPTNPSASHYFEAGSAARCLSKREM--  352

Query  472   INIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLEIssrkrgssssgygffsswkkfGQLN  293
              N+Q  EI++L+E+V RLQ++C  M  Q+E+L+E                   KK    +
Sbjct  353   -NVQQAEIRRLREDVARLQSECSAMHLQLERLME-------------------KKSSGGS  392

Query  292   KGIIITTSSSKLGSEVegeggggniaaigggfGRQTPTPMDTKARLVRGRTS-TKWRKSL  116
             KG         + S              G   G +  TP + K RLV+GRT+ ++WRKSL
Sbjct  393   KGFFRWKRLGLVPSIRGSVSVDKGEEESGDNEGFEPRTPGNMKTRLVKGRTTPSRWRKSL  452

Query  115   S  113
             S
Sbjct  453   S  453



>ref|XP_010465526.1| PREDICTED: root phototropism protein 3-like [Camelina sativa]
Length=445

 Score =   390 bits (1002),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 230/479 (48%), Positives = 298/479 (62%), Gaps = 63/479 (13%)
 Frame = -3

Query  1546  CWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekgG  1367
              +FDD+CI DM+YFVKT++GIK+KG+RP+LIGSII HYASKWLP+L+G   +        
Sbjct  29    SYFDDSCIQDMNYFVKTIAGIKSKGIRPDLIGSIIAHYASKWLPDLSGNVSA--------  80

Query  1366  HLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMVGV  1187
               II     +    + + S   MKKRFFVETLIGILPPEKDS+PCNFLLRLLR   MVG 
Sbjct  81    --IISTSSDTQQPESVTASV--MKKRFFVETLIGILPPEKDSVPCNFLLRLLRTAKMVGA  136

Query  1186  EAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAAVM  1007
                Y  E+E R+SWQL+QA+L+ELMIPSFS+T GT+LDVELV RLVKRF           
Sbjct  137   NPNYLTEIETRVSWQLDQASLKELMIPSFSYTSGTLLDVELVTRLVKRF-----------  185

Query  1006  RCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPTDD  827
               +G  S G   +     L+KVAKLVD YLAEAAVD +LT+ +F +L   +P+HAR T+D
Sbjct  186   --AGLDSEG---VKTGAALVKVAKLVDSYLAEAAVDGDLTLPEFSSLIEALPSHARTTED  240

Query  826   ALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLSEQ  647
              LYR+IDTYLKAHP V K+ERK +C+LIDSRKLS EA++HAAQN+RLPVR +I+VL +EQ
Sbjct  241   GLYRAIDTYLKAHPQVLKQERKELCRLIDSRKLSPEAALHAAQNDRLPVRAIIRVLFTEQ  300

Query  646   TKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapgaqqqqqdPRCMSKRDMNTIN  467
             TKLS    R ++W        +  +   T     NP      +     RC+SKR+   IN
Sbjct  301   TKLS----RHIDW--------NGSSISSTTRSPTNPSGSHYFEGGAAARCLSKRE---IN  345

Query  466   IQHLEIKKLKEEVLRLQTQCINMQAQIEKLLEIssrkrgssssgygffsswkkfGQLNKG  287
             +Q  EI++L+E+V RLQ++C  M  Q+E+L+E                   KK    +KG
Sbjct  346   VQQAEIRRLREDVARLQSECGAMHLQLERLME-------------------KKSSSGSKG  386

Query  286   IIITTSSSKLGSEVegeggggniaaigggfGRQTPTPMDTKARLVRGRTS-TKWRKSLS  113
                      + S     G        G   G +  TP + K RLV+GRT+ ++WRKS+S
Sbjct  387   FFRWKRLGLVPSIRGSVGVDKGEEESGDNEGFEPRTPGNMKTRLVKGRTTPSRWRKSMS  445



>ref|XP_002885094.1| phototropic-responsive NPH3 family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH61353.1| phototropic-responsive NPH3 family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=450

 Score =   390 bits (1002),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 211/392 (54%), Positives = 273/392 (70%), Gaps = 37/392 (9%)
 Frame = -3

Query  1546  CWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekgG  1367
              +FD++CI DM+YFVKT++GIK+KG+RP+LIGSII HYASKWLP+L+G   +  S     
Sbjct  28    TYFDESCIQDMNYFVKTITGIKSKGIRPDLIGSIIAHYASKWLPDLSGNVSAIISTS---  84

Query  1366  HLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMVGV  1187
                ++ +   + +  ESV+AS MKKRFFVETLIGILPPEKDS+PCNFLLRLLR   MVG 
Sbjct  85    ---VESKNHLNDTQPESVTASVMKKRFFVETLIGILPPEKDSVPCNFLLRLLRTAKMVGA  141

Query  1186  EAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAAVM  1007
                Y  ELE R+SWQL+QA+L+ELMIPSFS+T GT+LDVELV RLV +F           
Sbjct  142   NTNYLTELETRVSWQLDQASLKELMIPSFSYTSGTLLDVELVTRLVNKF-----------  190

Query  1006  RCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPTDD  827
               SG  S G   +  +  L+KVAKLVD YLAEAAVD  L + +FI+L   +P+HAR T+D
Sbjct  191   --SGLDSEG---VKTSAALVKVAKLVDSYLAEAAVDGALALPEFISLITALPSHARTTED  245

Query  826   ALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLSEQ  647
              LYR+IDTYLKAHP V K+ERK +C+LIDSRKLS EA++HAAQN+RLPVR +I+VL +EQ
Sbjct  246   GLYRAIDTYLKAHPQVLKQERKELCRLIDSRKLSPEAALHAAQNDRLPVRAIIRVLFTEQ  305

Query  646   TKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapgaqqqqqdPRCMSKRDMNTIN  467
             TKLS    R ++W        +  +   T     NP      +     RC+SKR+M   N
Sbjct  306   TKLS----RHIDW--------NGSSISSTTKSPTNPSGSHYLEGGSAARCLSKREM---N  350

Query  466   IQHLEIKKLKEEVLRLQTQCINMQAQIEKLLE  371
             +Q  EI++L+E+V+RLQ+QC  M  Q+E+L+E
Sbjct  351   VQQAEIRRLREDVVRLQSQCSAMHLQVERLME  382



>ref|XP_010503149.1| PREDICTED: root phototropism protein 3-like [Camelina sativa]
Length=445

 Score =   388 bits (997),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 232/479 (48%), Positives = 301/479 (63%), Gaps = 63/479 (13%)
 Frame = -3

Query  1546  CWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekgG  1367
              +FDD+CI D++YFVKT++GIK+KG+RP+LIGSII HYASKWLP+L+G   +        
Sbjct  29    SYFDDSCIQDINYFVKTIAGIKSKGIRPDLIGSIIAHYASKWLPDLSGNVSAI-------  81

Query  1366  HLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMVGV  1187
                     SS +   ESV+AS MKKRFFVETLIGILPPEKDS+PCNFLLRLLR   MVG 
Sbjct  82    -----ISTSSDTQQPESVTASVMKKRFFVETLIGILPPEKDSVPCNFLLRLLRTAKMVGA  136

Query  1186  EAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAAVM  1007
                Y  E+E R+SWQL+QA+L+ELMIPSFS+T GT+LDV+LV RLVK+F           
Sbjct  137   NPNYLTEIETRVSWQLDQASLKELMIPSFSYTSGTLLDVDLVTRLVKKF-----------  185

Query  1006  RCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPTDD  827
               +G  S G   +     L+KVAKLVD YLAEAAVD  LT+ +FI+L   +P+HAR T+D
Sbjct  186   --AGLDSEG---VKTGAALVKVAKLVDSYLAEAAVDGGLTLPEFISLIEALPSHARTTED  240

Query  826   ALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLSEQ  647
              LYR+IDTYLKAHP V K+ERK +C+LIDSRKLS EA++HAAQN+RLPVR +I+VL +EQ
Sbjct  241   GLYRAIDTYLKAHPQVLKQERKELCRLIDSRKLSPEAALHAAQNDRLPVRAIIRVLFTEQ  300

Query  646   TKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapgaqqqqqdPRCMSKRDMNTIN  467
             TKLS    R ++W        +  +   T     NP      +     RC+SKR+   IN
Sbjct  301   TKLS----RHIDW--------NGSSISSTTRSPTNPSGSHYFEGGAAARCLSKRE---IN  345

Query  466   IQHLEIKKLKEEVLRLQTQCINMQAQIEKLLEIssrkrgssssgygffsswkkfGQLNKG  287
             +Q  EI++L+E+V RLQ++C  M  Q+E+L+E                   KK    +KG
Sbjct  346   VQQAEIRRLREDVARLQSECSAMHLQLERLME-------------------KKSSGGSKG  386

Query  286   IIITTSSSKLGSEVegeggggniaaigggfGRQTPTPMDTKARLVRGRTS-TKWRKSLS  113
                      + S     G        G   G +  TP + K RLV+GRT+ ++WRKS+S
Sbjct  387   FFRWKRLGLVSSIRGSVGVDKGEEESGDNEGFEPRTPGNMKTRLVKGRTTPSRWRKSMS  445



>ref|XP_011081061.1| PREDICTED: root phototropism protein 3-like [Sesamum indicum]
Length=416

 Score =   386 bits (991),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 238/469 (51%), Positives = 293/469 (62%), Gaps = 81/469 (17%)
 Frame = -3

Query  1519  DMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekgGHLIIKFees  1340
             DMDYF+ TLS IK K  +P+LI S ITHYASKWLPEL    G                  
Sbjct  29    DMDYFINTLSDIKVKETKPDLIASTITHYASKWLPELADDEGDRAVAHYED---------  79

Query  1339  ssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMVGVEAAYRAELE  1160
                   ESV+ASW KKRFF++ L+ ILPPEK+SIPCNFLLRLLR+ NMV V  +YRAELE
Sbjct  80    ----SQESVTASWTKKRFFIQALVAILPPEKESIPCNFLLRLLRVANMVHVGPSYRAELE  135

Query  1159  KRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAAVMRCSGSSSSG  980
             KR+SWQL+QA+L+ELMIPSFSHT   +LD ELVLRLVKRF  S+ED A          SG
Sbjct  136   KRVSWQLDQASLKELMIPSFSHTSTALLDFELVLRLVKRF-ASMEDVA---------RSG  185

Query  979   APPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPTDDALYRSIDTY  800
             A        ++KVAKLVD YLAEAAVDS+L++  F+ LA+ +P+HAR +DD LYR+IDTY
Sbjct  186   AA-------VMKVAKLVDSYLAEAAVDSHLSLPDFVDLASALPSHARSSDDGLYRAIDTY  238

Query  799   LKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLSEQTKLSKQLMR  620
             LKAHP +SK+ERK +C LIDSRKLS EAS+HAAQNERLPVR VIQVLLSEQTKL    ++
Sbjct  239   LKAHPSLSKQERKTLCSLIDSRKLSQEASVHAAQNERLPVRAVIQVLLSEQTKL----IK  294

Query  619   QLEWsggsfisasagasgGTCPRSpnppapgaqqqqqdPRCMSKRDMNTINIQHLEIKKL  440
              ++WSG    + S    G   P                 RC SKR+    ++Q +EIK+L
Sbjct  295   HVDWSGSLSGARSPAGVGLELP----------------GRCFSKRE---TSVQQMEIKRL  335

Query  439   KEEVLRLQTQCINMQAQIEKLLEIssrkrgssssgygffsswkkfGQLNKGIIITTSSSK  260
             KE+VLRLQ+QC+ M+ QIEKL+E                       + + G     S  K
Sbjct  336   KEDVLRLQSQCMAMERQIEKLVE----------------------KKRSAGSYF--SWKK  371

Query  259   LGSEVegeggggniaaigggfGRQTPTPMDTKARLVRGRTSTKWRKSLS  113
             LG +    G  G    +G G      +P++ K RL+RGR S+  RKSLS
Sbjct  372   LGFKANRVGEVGGENEVGLGLK----SPLEIKTRLLRGRNSSNRRKSLS  416



>ref|XP_009135448.1| PREDICTED: coleoptile phototropism protein 1-like [Brassica rapa]
Length=440

 Score =   386 bits (992),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 232/479 (48%), Positives = 301/479 (63%), Gaps = 73/479 (15%)
 Frame = -3

Query  1546  CWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekgG  1367
              WFD+A I DM+YFVKT++GIK+KG+RP+LIGSII HYASKWLP+L+G            
Sbjct  34    SWFDEASIQDMNYFVKTITGIKSKGIRPDLIGSIIAHYASKWLPDLSGN-----------  82

Query  1366  HLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMVGV  1187
                +    +      ESV+AS MKKRFFVETL GILPPEKDS+PCNFLLRLLR   MVG 
Sbjct  83    ---VSAVTAPPPPPTESVTASVMKKRFFVETLTGILPPEKDSVPCNFLLRLLRTAKMVGA  139

Query  1186  EAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAAVM  1007
                Y  ELE R++WQL+QA+++ELMIPSFSHTC T+LDVELV RLVK+F           
Sbjct  140   NQNYLTELENRVAWQLDQASIKELMIPSFSHTCETLLDVELVTRLVKKF-----------  188

Query  1006  RCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPTDD  827
               +G  S G   +     L+KVAKLVD YLAE+A+DS LT+ + I+LA  +P+HAR T+D
Sbjct  189   --AGLDSEG---VKTGAALVKVAKLVDSYLAESAIDSGLTLPELISLAEALPSHARTTED  243

Query  826   ALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLSEQ  647
              LYR+IDTYLKAHP V K+ERK +C+LIDSRKLS EA++HAAQN+RLPVR++I+VL +EQ
Sbjct  244   GLYRAIDTYLKAHPQVMKQERKELCRLIDSRKLSPEAALHAAQNDRLPVRSIIRVLFTEQ  303

Query  646   TKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapgaqqqqqdPRCMSKRDMNTIN  467
             TKLS       +WS      +         P S              P+C+SKR+M   N
Sbjct  304   TKLSP----HTDWSPSGSHYSE--------PGS-------------GPQCLSKREM---N  335

Query  466   IQHLEIKKLKEEVLRLQTQCINMQAQIEKLLEIssrkrgssssgygffsswkkfGQLNKG  287
             +Q  EIK+L+++VLRLQ++C  M  Q+E+L+E          S  G    + ++ +L  G
Sbjct  336   VQQAEIKRLRDDVLRLQSECGAMHMQMERLMEK--------KSSGGGSKGFFRWKRLGLG  387

Query  286   IIITTSSSKLGSEVegeggggniaaigggfGRQTPTPMDTKARLVRGRTS-TKWRKSLS  113
               I  S   +G E              G   R   TP + K RLV+GRT+ ++WRKS+S
Sbjct  388   PSIRGS---VGVEKMMNDEEEVGDNGEGFEPR---TPGNMKTRLVKGRTTPSRWRKSMS  440



>gb|EYU21595.1| hypothetical protein MIMGU_mgv1a027051mg [Erythranthe guttata]
Length=381

 Score =   382 bits (980),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 221/405 (55%), Positives = 273/405 (67%), Gaps = 53/405 (13%)
 Frame = -3

Query  1594  ALPESGTLSS--CKPMGECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKW  1421
              LPES  LS        ECWF+DAC+ D DYF+K LSG++ KGVRP+LIGSII HYASK 
Sbjct  6     GLPESVALSGKLTSFAAECWFNDACVSDTDYFIKILSGLQGKGVRPDLIGSIIAHYASKR  65

Query  1420  LPELTggggseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDS  1241
             LP+L+G   +          +      +     ES++ASW+KK+ F+ETLIGILPPEKDS
Sbjct  66    LPDLSGDRAA----------LTGPVGPTGDDSPESLTASWVKKKLFIETLIGILPPEKDS  115

Query  1240  IPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELV  1061
             IPCNFLLR+LR+ NM GV  A+R++LE R+S QL+ ATL ELMIPSFSHT  T+LD ELV
Sbjct  116   IPCNFLLRVLRVANMAGVGPAFRSDLESRVSRQLDGATLEELMIPSFSHTSTTLLDFELV  175

Query  1060  LRLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMS  881
             +RLV  F+ S ED          S  GA        L+KVAKLVD YLAEAAVDSNL ++
Sbjct  176   VRLVNGFVNS-ED---------VSRGGAA-------LMKVAKLVDLYLAEAAVDSNLGLT  218

Query  880   QFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAA  701
             +F+ LA  +P+HAR TDD +YR+IDTYLKAHPG++K+ERKRV  LI+SRKLSAEAS HAA
Sbjct  219   EFVDLAGALPSHARSTDDGIYRAIDTYLKAHPGLTKQERKRVWGLIESRKLSAEASHHAA  278

Query  700   QNERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapgaq  521
             QNERLPVR VIQVLLSEQ K    +++ ++WSG    + S G  G   P           
Sbjct  279   QNERLPVRAVIQVLLSEQNK----IVKNIDWSGSLIGARSPGMFGLDGP-----------  323

Query  520   qqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQI  386
                   RC+SKR+     I  +EIK+LKE+VL LQ QC+NM+ QI
Sbjct  324   -----ARCVSKRE----TITQMEIKRLKEDVLVLQCQCMNMEKQI  359



>gb|AAM61364.1| non-phototropic hypocotyl protein, putative [Arabidopsis thaliana]
Length=429

 Score =   381 bits (979),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 231/478 (48%), Positives = 304/478 (64%), Gaps = 55/478 (12%)
 Frame = -3

Query  1543  WFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekgGH  1364
             +FD++CI DM+YFVKT++GIK+KG+RP+LIGSII HYASKWLP+L+G   +  S      
Sbjct  6     YFDESCIQDMNYFVKTITGIKSKGIRPDLIGSIIAHYASKWLPDLSGNVSAIISSTS---  62

Query  1363  LIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMVGVE  1184
               ++ + + + +  ESV+AS MKKRFFVETLIGILPPEKDS+PCNFLLRLLR   MVG  
Sbjct  63    --LESKNNHNDTQPESVTASVMKKRFFVETLIGILPPEKDSVPCNFLLRLLRTAKMVGAN  120

Query  1183  AAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAAVMR  1004
               Y  ELE R+SWQL+QA+L+ELMIPSFS+T GT+LD+ELV RLV +F            
Sbjct  121   PNYLTELETRVSWQLDQASLKELMIPSFSYTSGTLLDIELVTRLVNKF------------  168

Query  1003  CSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPTDDA  824
              SG  S G   +     L+KVAKLVD YLAEAAVD  L + +FI+L   +P+HAR T+D 
Sbjct  169   -SGLDSEG---VKTAAALVKVAKLVDSYLAEAAVDGGLALPEFISLITALPSHARTTEDG  224

Query  823   LYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLSEQT  644
             LYR+IDTYLKAHP V K+ERK +C+LIDSRKLS EA++HAAQN+RLPVR +I VL +EQT
Sbjct  225   LYRAIDTYLKAHPQVLKQERKELCRLIDSRKLSPEAALHAAQNDRLPVRAIIGVLFTEQT  284

Query  643   KLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapgaqqqqqdPRCMSKRDMNTINI  464
             KLS+ +              ++ +   T     N       +     RC+SKR+M   N+
Sbjct  285   KLSRHI------------DCNSSSISSTTRSPTNASGSHYLEGGSAARCLSKREM---NV  329

Query  463   QHLEIKKLKEEVLRLQTQCINMQAQIEKLLEIssrkrgssssgygffsswkkfGQLNKGI  284
             Q  EI++L+E+V+RLQ+QC  M  Q+E+L+E  S         +              G+
Sbjct  330   QQAEIRRLREDVVRLQSQCGAMHFQLERLMEKKSSGGSKGFFRWKRL-----------GL  378

Query  283   IITTSSSKLGSEVegeggggniaaigggfGRQTPTPMDTKARLVRGRTS-TKWRKSLS  113
             + +   S     V  E G       G GF  +TP  M  K RLV+GRT+ ++WRKS+S
Sbjct  379   VPSIRGS-----VSVEKGEEESGDNGEGFEPRTPGNM--KTRLVKGRTTPSRWRKSMS  429



>ref|NP_188176.1| phototropic-responsive NPH3 family protein [Arabidopsis thaliana]
 dbj|BAB01346.1| non-phototropic hypocotyl-like protein [Arabidopsis thaliana]
 dbj|BAD42923.1| putative non-phototropic hypocotyl protein [Arabidopsis thaliana]
 dbj|BAD42939.1| putative non-phototropic hypocotyl protein [Arabidopsis thaliana]
 dbj|BAD43236.1| putative non-phototropic hypocotyl protein [Arabidopsis thaliana]
 dbj|BAD43307.1| putative non-phototropic hypocotyl protein [Arabidopsis thaliana]
 gb|AEE75693.1| phototropic-responsive NPH3 family protein [Arabidopsis thaliana]
Length=452

 Score =   382 bits (980),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 231/478 (48%), Positives = 304/478 (64%), Gaps = 55/478 (12%)
 Frame = -3

Query  1543  WFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekgGH  1364
             +FD++CI DM+YFVKT++GIK+KG+RP+LIGSII HYASKWLP+L+G   +  S      
Sbjct  29    YFDESCIQDMNYFVKTITGIKSKGIRPDLIGSIIAHYASKWLPDLSGNVSAIISSTS---  85

Query  1363  LIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMVGVE  1184
               ++ + + + +  ESV+AS MKKRFFVETLIGILPPEKDS+PCNFLLRLLR   MVG  
Sbjct  86    --LESKNNHNDTQPESVTASVMKKRFFVETLIGILPPEKDSVPCNFLLRLLRTAKMVGAN  143

Query  1183  AAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAAVMR  1004
               Y  ELE R+SWQL+QA+L+ELMIPSFS+T GT+LD+ELV RLV +F            
Sbjct  144   PNYLTELETRVSWQLDQASLKELMIPSFSYTSGTLLDIELVTRLVNKF------------  191

Query  1003  CSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPTDDA  824
              SG  S G   +     L+KVAKLVD YLAEAAVD  L + +FI+L   +P+HAR T+D 
Sbjct  192   -SGLDSEG---VKTAAALVKVAKLVDSYLAEAAVDGGLALPEFISLITALPSHARTTEDG  247

Query  823   LYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLSEQT  644
             LYR+IDTYLKAHP V K+ERK +C+LIDSRKLS EA++HAAQN+RLPVR +I VL +EQT
Sbjct  248   LYRAIDTYLKAHPQVLKQERKELCRLIDSRKLSPEAALHAAQNDRLPVRAIIGVLFTEQT  307

Query  643   KLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapgaqqqqqdPRCMSKRDMNTINI  464
             KLS+ +              ++ +   T     N       +     RC+SKR+M   N+
Sbjct  308   KLSRHI------------DCNSSSISSTTRSPTNASGSHYLEGGSAARCLSKREM---NV  352

Query  463   QHLEIKKLKEEVLRLQTQCINMQAQIEKLLEIssrkrgssssgygffsswkkfGQLNKGI  284
             Q  EI++L+E+V+RLQ+QC  M  Q+E+L+E  S         +              G+
Sbjct  353   QQAEIRRLREDVVRLQSQCGAMHFQLERLMEKKSSGGSKGFFRWKRL-----------GL  401

Query  283   IITTSSSKLGSEVegeggggniaaigggfGRQTPTPMDTKARLVRGRTS-TKWRKSLS  113
             + +   S     V  E G       G GF  +TP  M  K RLV+GRT+ ++WRKS+S
Sbjct  402   VPSIRGS-----VSVEKGEEESGDNGEGFEPRTPGNM--KTRLVKGRTTPSRWRKSMS  452



>ref|XP_009385805.1| PREDICTED: root phototropism protein 3-like [Musa acuminata subsp. 
malaccensis]
Length=436

 Score =   352 bits (903),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 220/479 (46%), Positives = 293/479 (61%), Gaps = 84/479 (18%)
 Frame = -3

Query  1543  WFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekgGH  1364
             W D++C+ D+D+F KTL+GIKAKGVRPEL+GSI++HYAS+WLPEL               
Sbjct  40    WLDNSCVQDLDHFAKTLTGIKAKGVRPELLGSILSHYASRWLPEL---------------  84

Query  1363  LIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMVGVE  1184
                 F  +S+    ES +A+W+KKRFF+ETL  +LP EK SIPC+FLL+LLR  +MVG E
Sbjct  85    ----FGRASAGPTPESPTAAWLKKRFFIETLASVLPTEKGSIPCDFLLKLLRTASMVGAE  140

Query  1183  AAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAAVMR  1004
              +   ELE R + QL++A+L+ELMIP+FSHTCGT+LDV LVLRLV+RF    +D  A   
Sbjct  141   PSCVRELEARAAAQLDEASLKELMIPAFSHTCGTLLDVGLVLRLVQRF-AGTDDGGAAA-  198

Query  1003  CSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPTDDA  824
                              L +VAKLVD YLAE A+D+ LT+++F  LA+ +P HAR  DD 
Sbjct  199   ------------KSGAALARVAKLVDSYLAEVALDAGLTVAEFEELASSLPAHARAMDDG  246

Query  823   LYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLSEQT  644
             LYR+IDTY+KAHP  SK+ERK +C+LID+RKLSAEAS+HAAQNERLPVR+VIQVL SE T
Sbjct  247   LYRAIDTYIKAHPSTSKQERKTLCRLIDARKLSAEASLHAAQNERLPVRSVIQVLFSEHT  306

Query  643   KLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapgaqqqqqdPRCMSKRDMNTINI  464
             K++    R  +WSG             + PRSPNP A          RC SKR+   + +
Sbjct  307   KVN----RLTDWSGSF-----------SGPRSPNPAALEPPG-----RCPSKRE---VLV  343

Query  463   QHLEIKKLKEEVLRLQTQCINMQAQIEKLLEIssrkrgssssgygffsswkkfGQLNKGI  284
             Q  E+++L+++V RLQ  C  +QAQI+KL  +          G+  ++S+    +    +
Sbjct  344   QQQEMRRLRDDVARLQVHCHALQAQIDKLTCV------KKKRGFFRWASFLLLFRTTSDV  397

Query  283   IITTSSSKLGSEVegeggggniaaigggfGRQTPTPMDT-KARLVRGR-TSTKWRKSLS  113
             +      +LG+E                     PTPM T K RL +G+ T  KWR SLS
Sbjct  398   VEKVEEYELGAE--------------------RPTPMRTKKGRLAQGKGTPAKWRNSLS  436



>ref|XP_008792131.1| PREDICTED: root phototropism protein 3 [Phoenix dactylifera]
Length=430

 Score =   347 bits (889),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 190/391 (49%), Positives = 252/391 (64%), Gaps = 53/391 (14%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             E W DD    D D   +TL+GIKAKG+RP+L+GSII+ YAS+WLPEL  G  ++ S    
Sbjct  32    EPWLDDVGTFDADQLARTLAGIKAKGLRPDLLGSIISRYASRWLPELATGRAADPSPATE  91

Query  1369  GHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMVG  1190
                                +A+W++KRF VETL+ +LPPE+D++PC+FLLRLLR  +M G
Sbjct  92    S-----------------PTAAWLQKRFLVETLVSVLPPERDAVPCDFLLRLLRTASMAG  134

Query  1189  VEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAAV  1010
              EA   +ELE R   QL+QATLRE+MIP+F+HTCGT+LDV L+LRLVKRF+ + E  A V
Sbjct  135   AEAGCISELEARAGRQLDQATLREVMIPAFTHTCGTLLDVGLMLRLVKRFLGAEEGPAVV  194

Query  1009  MRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPTD  830
              R      SGA        L KVAKL D YLAEAA+D+ LT+++F  LA  +P +AR TD
Sbjct  195   AR------SGA------AGLAKVAKLADAYLAEAALDAGLTVAEFEELARAVPGYARATD  242

Query  829   DALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLSE  650
             D LYR+IDTY+KAHP   K+ERK +C+LID+RKLS+EAS+HAAQNERLPVR+VIQVL SE
Sbjct  243   DGLYRAIDTYIKAHPNAGKQERKALCRLIDARKLSSEASVHAAQNERLPVRSVIQVLFSE  302

Query  649   QTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapgaqqqqqdPRCMSKRDMNTI  470
              +KL++  + +  W                   S           +   R  SKR++  +
Sbjct  303   HSKLNR--ISEGSW-------------------SFAGLRSPNPALEPPLRVPSKREV--L  339

Query  469   NIQHLEIKKLKEEVLRLQTQCINMQAQIEKL  377
               QH E++KL+E+V RLQ QC  +QAQ+++L
Sbjct  340   AQQH-EVRKLREDVARLQVQCHALQAQVDRL  369



>ref|XP_008785504.1| PREDICTED: coleoptile phototropism protein 1-like [Phoenix dactylifera]
Length=428

 Score =   333 bits (855),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 185/393 (47%), Positives = 247/393 (63%), Gaps = 53/393 (13%)
 Frame = -3

Query  1552  GECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiek  1373
              E W DDA  LD D   +TL+GIKAKG+RP+L+GSI++HYAS+WLPE+  G  +E S   
Sbjct  29    AELWIDDAGALDADRLARTLAGIKAKGLRPDLLGSIVSHYASRWLPEMATGRAAEPSPAP  88

Query  1372  gGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMV  1193
                                 +A+W+KKRF VETL+G+LPPEKD++PC+FLLRLLR  +MV
Sbjct  89    ES-----------------PTAAWLKKRFLVETLVGVLPPEKDAVPCDFLLRLLRTASMV  131

Query  1192  GVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAA  1013
             G  A    ELE R   QL+QA+LRE+MIP+FSHTC T+LDV L+LRLV++F+ + E    
Sbjct  132   GAAAGCIGELEARAGRQLDQASLREVMIPAFSHTCRTLLDVGLMLRLVRQFVGAEE----  187

Query  1012  VMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPT  833
                C  + +      +    + KVAKL D YLAEAA+D+ L +++F  LA  +P HAR T
Sbjct  188   ---CPAAVAR-----SGAAAMAKVAKLADAYLAEAALDAGLAVAEFEELARAVPAHARAT  239

Query  832   DDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLS  653
             DD LYR++DTY+KAHP   K+ERK +C+LID+RKLS+EAS+HAAQNERLPVR+VIQVL S
Sbjct  240   DDGLYRAVDTYIKAHPNTIKQERKALCRLIDARKLSSEASLHAAQNERLPVRSVIQVLFS  299

Query  652   EQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapgaqqqqqdPRCMSKRDMNT  473
             E  KL+       EWS                  S           +   R  S+R+   
Sbjct  300   EHCKLNG----LAEWSA-----------------SFAGLRSPNPALELPGRVPSRRE---  335

Query  472   INIQHLEIKKLKEEVLRLQTQCINMQAQIEKLL  374
             +  Q  E++KL+E+V RLQ QC  +QAQ+++L 
Sbjct  336   VLAQQHEMRKLREDVARLQVQCHALQAQVDRLF  368



>ref|XP_010925272.1| PREDICTED: root phototropism protein 3-like [Elaeis guineensis]
Length=428

 Score =   330 bits (847),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 196/406 (48%), Positives = 261/406 (64%), Gaps = 58/406 (14%)
 Frame = -3

Query  1591  LPESGTLSSCKPMGECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPE  1412
             LP S  L +     E W DDA  LD D+  +TL+GIKAKG+RP+L+GS+++HYAS+WLPE
Sbjct  21    LPSSDLLPA-----EPWIDDAGALDADHLARTLAGIKAKGLRPDLLGSVVSHYASRWLPE  75

Query  1411  LTggggseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPC  1232
             +  G  +E S                       +A+W+KKRF VETL+G+LPPEKD++PC
Sbjct  76    MATGRAAEPSPPPES-----------------PTAAWLKKRFLVETLVGVLPPEKDAVPC  118

Query  1231  NFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRL  1052
             +FLLRLLR  +MVG  A    ELE R   QL+QA+LRE+MIP+FSHTCGT+LDV L+LRL
Sbjct  119   DFLLRLLRTASMVGAAAGCIGELEARAGRQLDQASLREVMIPAFSHTCGTLLDVGLMLRL  178

Query  1051  VKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFI  872
             V+ F+ + E  AAV              +    L KVAKLVD YLAEAA+D+ L +++F 
Sbjct  179   VRWFVGAEEGPAAVA------------RSGAAALAKVAKLVDAYLAEAALDAGLAVAEFE  226

Query  871   ALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNE  692
              LA  +P HAR TDD LYR+IDTYLKAHP  +K+++K +C++ID+RKLS+EAS+HAAQNE
Sbjct  227   ELARAVPAHARATDDGLYRAIDTYLKAHPNTTKQDKKALCRVIDARKLSSEASVHAAQNE  286

Query  691   RLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapgaqqqq  512
             RLPVR+VIQVL SE+ KL     R  EW           ++  T PRS           +
Sbjct  287   RLPVRSVIQVLFSERCKLH----RLTEW-----------SASFTGPRS------PNPALE  325

Query  511   qdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKLL  374
                R  SKR+   +  Q  E++KL+E+V RLQ QC  +QAQ+++L+
Sbjct  326   PPMRVPSKRE---VLAQQHEMRKLREDVARLQVQCHALQAQVDRLV  368



>ref|XP_009381748.1| PREDICTED: root phototropism protein 3-like [Musa acuminata subsp. 
malaccensis]
Length=427

 Score =   328 bits (841),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 189/389 (49%), Positives = 245/389 (63%), Gaps = 56/389 (14%)
 Frame = -3

Query  1543  WFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekgGH  1364
             W DD CI ++D+F KTL+GI+AKG RPEL+  I++HY+S+WLPEL+G    + S E    
Sbjct  41    WLDDPCIQELDHFSKTLTGIEAKGDRPELLSFILSHYSSRWLPELSGRAADDPSPESPT-  99

Query  1363  LIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMVGVE  1184
                               A+W+KKRFF+ETL  ILP EK S+ C+ LL LLR  +MVG  
Sbjct  100   ------------------AAWLKKRFFIETLASILPTEKRSVSCDVLLTLLRTASMVGAA  141

Query  1183  AAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAAVMR  1004
             A+   ELE R + QL++A+L ELMIP+FSHTCGT+LDV LVLRLV+RF  + +D  A +R
Sbjct  142   ASCVRELEARAAAQLDEASLEELMIPAFSHTCGTLLDVGLVLRLVRRFAGNNDDGGAAVR  201

Query  1003  CSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPTDDA  824
                   SGA        L +VAKLVD YLAEAA+D+ LT+++F  LA  +P HAR  DD 
Sbjct  202   ------SGA-------ALARVAKLVDSYLAEAALDAGLTVAEFEELANSLPAHARAMDDG  248

Query  823   LYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLSEQT  644
             LYR++DT++KAHP  SK+ERK +C+LID+RKLSAEAS+HAAQNERLPVR+ IQVL SE T
Sbjct  249   LYRAVDTFIKAHPSTSKQERKTLCRLIDARKLSAEASLHAAQNERLPVRSAIQVLFSEHT  308

Query  643   KLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapgaqqqqqdPRCMSKRDMNTINI  464
             KL +       WSG               PRS          +    RC SKR+   +  
Sbjct  309   KLHRLTE---HWSGSFGG-----------PRS-------PNPEAAAARCPSKRE---VLA  344

Query  463   QHLEIKKLKEEVLRLQTQCINMQAQIEKL  377
                EI  L+++V RL+  C  +QAQI+KL
Sbjct  345   HQQEICGLRDDVARLRVHCQGLQAQIDKL  373



>ref|XP_010914962.1| PREDICTED: root phototropism protein 3 [Elaeis guineensis]
Length=428

 Score =   322 bits (825),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 190/392 (48%), Positives = 254/392 (65%), Gaps = 53/392 (14%)
 Frame = -3

Query  1552  GECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiek  1373
              E W DD   LD D+  +TL+GIKAKG+RP+L+GSII+ YAS+WLPEL  G  ++ S   
Sbjct  29    AEPWLDDVGTLDPDHLARTLAGIKAKGLRPDLLGSIISQYASRWLPELATGRAADPSRVP  88

Query  1372  gGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMV  1193
                                 +A+W++KRF VETL+ +LP E+D++PC+FLLRLLR  +MV
Sbjct  89    ES-----------------PTAAWLQKRFLVETLVCVLPQERDAVPCDFLLRLLRTASMV  131

Query  1192  GVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAA  1013
             G  A   +ELE R   QL+QATLRE+MIP+FSHTCGT+LDV L+LRLV+RF+ + E  A 
Sbjct  132   GAAAGCISELEARAGRQLDQATLREVMIPAFSHTCGTLLDVGLMLRLVRRFVGAEEGPAV  191

Query  1012  VMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPT  833
             V R SG+++             KVAKLVD YLAEAA+D+ L +++F  LA  +P +AR T
Sbjct  192   VAR-SGAAAL-----------AKVAKLVDAYLAEAALDAGLAVAEFEELARAVPGYARAT  239

Query  832   DDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLS  653
             DD LYR+IDTY+KAHP  SK+ERK +  LID+RKL++EAS+HAAQNERLPVR+V+QVL S
Sbjct  240   DDGLYRAIDTYIKAHPNTSKQERKVLFSLIDARKLTSEASLHAAQNERLPVRSVMQVLFS  299

Query  652   EQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapgaqqqqqdPRCMSKRDMNT  473
             E +KL+    R  EW           +     PRS           +   R  SKR+   
Sbjct  300   ENSKLN----RITEW-----------SWSFGGPRS------PNPALEPPGRVPSKRE---  335

Query  472   INIQHLEIKKLKEEVLRLQTQCINMQAQIEKL  377
             +  Q LE++KL+E+V RLQ QC  +QAQ+++L
Sbjct  336   VLAQQLEMRKLREDVARLQVQCHALQAQVDRL  367



>gb|EYU24675.1| hypothetical protein MIMGU_mgv1a020826mg [Erythranthe guttata]
Length=385

 Score =   261 bits (666),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 166/392 (42%), Positives = 214/392 (55%), Gaps = 84/392 (21%)
 Frame = -3

Query  1534  DACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg-GHLI  1358
             D CI DMDYF+KTLS +K K +RP+ I SIITH A+KWLPEL      E        H  
Sbjct  5     DDCISDMDYFIKTLSSLKDKAIRPDQISSIITHCATKWLPELALDQQLEPVATTTPKHDA  64

Query  1357  IKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDS-----IPCNFLLRLLRIGNMV  1193
             +                   KKR F+ETLIGILPPEK+      IPCNFLLRLLR+ N  
Sbjct  65    VSLT----------------KKRLFIETLIGILPPEKEYYINNIIPCNFLLRLLRVANTS  108

Query  1192  GVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAA  1013
                  Y +ELEKR+S QL++ +L+EL +         + D  LVLRLV+ F+        
Sbjct  109   RAGPVYVSELEKRVSLQLDRTSLKELRL---------LFDFGLVLRLVRGFV--------  151

Query  1012  VMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSN---LTMSQFIALAAPIPTHA  842
                 +G  ++G           KVA LVD YLAEAA D     + +S F+ LA  IP HA
Sbjct  152   ---SAGGDAAGG----------KVAVLVDSYLAEAASDDGSCVVAVSAFVELATAIPGHA  198

Query  841   RPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQV  662
             R  DD LYR++D YLKAHP VSK++RK +C LID+ KLS EAS+HA++NER+PVR   Q+
Sbjct  199   RLMDDGLYRAVDMYLKAHPEVSKQDRKTLCNLIDTNKLSQEASLHASRNERVPVRAAFQI  258

Query  661   LLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapgaqqqqqdPRCMSKRD  482
             LLSEQTKL       +EWSG               P S               R  S R+
Sbjct  259   LLSEQTKLKSHF---IEWSGSMSWG----------PHS-------------PARYSSNRE  292

Query  481   MNTINIQHLEIKKLKEEVLRLQTQCINMQAQI  386
                     +EI++LKE+V+ +Q++C+ M+ QI
Sbjct  293   TGP---SWIEIERLKEDVVSIQSRCMAMEMQI  321



>dbj|BAJ92373.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=455

 Score =   258 bits (658),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 167/417 (40%), Positives = 233/417 (56%), Gaps = 64/417 (15%)
 Frame = -3

Query  1600  ATALPESGTLSSCKPMGECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKW  1421
              TA       SS +P      DD C+ D++ F +T++ +K+K  RP+L+ S+++HYA+KW
Sbjct  19    GTAAAADHARSSSEPWVLACVDDTCVNDVESFARTVAAVKSK-PRPDLLPSVLSHYAAKW  77

Query  1420  LPELTggggseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPE---  1250
             LP++                  +F    S +        W+KKR  +ETL+  LPP+   
Sbjct  78    LPDVATSASG------------RFLPPESPTAT------WLKKRLLLETLVAALPPDPPN  119

Query  1249  ----KDSIPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCG-  1085
                  D I C+FLL+LLR G+MVG +AA   ELE R + +L+QATL  +MIP+F H  G 
Sbjct  120   GAAADDGITCDFLLKLLRAGSMVGADAALLRELESRAARRLDQATLAAVMIPAFGHAPGG  179

Query  1084  -TVLDVELVLRLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEA  908
              T+LDV LVLRLV+ F+      A                       +VA+LVD YLAEA
Sbjct  180   STLLDVPLVLRLVRGFLKEGGKGAGGG-----------------AGARVARLVDAYLAEA  222

Query  907   AVDSNLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKL  728
             A+++ L  ++   LA  +P HAR  DDALYR++DTYLKAHPG  KEERK + +LID+RKL
Sbjct  223   ALEAGLRPAELEELARAVPAHARAADDALYRAVDTYLKAHPGAGKEERKSLWRLIDARKL  282

Query  727   SAEASIHAAQNERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRS  548
             SAEA+ HA QN+RLPVR+V+QVL SE  KL++           + + AS   +  TC   
Sbjct  283   SAEAAAHAVQNDRLPVRSVMQVLFSEHGKLNR----------LADLGASFSGARATC---  329

Query  547   pnppapgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKL  377
                            RC SKR+      QH E+++L+E+V RLQ QC  +Q Q+E+L
Sbjct  330   ---SPAALDLHSGSGRCPSKREALA---QHQEMRRLREDVARLQVQCSALQEQVERL  380



>emb|CDO97399.1| unnamed protein product [Coffea canephora]
Length=665

 Score =   261 bits (667),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 156/410 (38%), Positives = 239/410 (58%), Gaps = 42/410 (10%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             + WF+D  IL +D+FV+ ++ IK KG+R ELIG+ I HYA+KWLP L   G +       
Sbjct  227   DWWFEDVSILRIDHFVRVITAIKVKGMRHELIGAAIMHYAAKWLPGLITEGSAAADEGSN  286

Query  1369  G--------------HLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPC  1232
                            H+I+   +    +V          +R  +E+LI ++PP+KDS+ C
Sbjct  287   YSHANDINRSWKGGLHMIVAGTKEDIPTVQAK------DQRMIIESLISLIPPQKDSVSC  340

Query  1231  NFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRL  1052
             +FLLRLLR+ N++ V AA   ELEKR+  Q EQATL +L+IPS++ +  T+ DV+LV RL
Sbjct  341   SFLLRLLRMANLLKVAAALVTELEKRVGMQFEQATLADLLIPSYNKS-ETLYDVDLVQRL  399

Query  1051  VKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNL-IKVAKLVDDYLAEAAVDSNLTMSQF  875
             ++ F+V  ++Q      S  S + AP    N N  ++VA+LVD YL E + D NL++++F
Sbjct  400   LEHFLV--QEQTESSSPSRQSFAEAPQRGTNPNAKMRVARLVDSYLTEVSRDRNLSLTKF  457

Query  874   IALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQN  695
               LA  +P  AR  DD LYR++D+YLKAHP +S+ ERKR+C+++D +KLS +A +HAAQN
Sbjct  458   QVLAEALPDSARTCDDGLYRAVDSYLKAHPTLSEHERKRLCRVMDCQKLSIDACMHAAQN  517

Query  694   ERLPVRTVIQVLLSEQTKLSKQL----MRQLEWsggsfisasagasgGTCPRSpnppapg  527
             ERLP+R V+QVL SEQ K+S  +    +++   S    + ++        P+S       
Sbjct  518   ERLPLRVVVQVLFSEQVKISNAIASSSLKEAGESHYHPMVSTRKTLLEGTPQSFQEGW--  575

Query  526   aqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKL  377
                        +K+D+NT+     E++ +K + L LQ     +Q Q +K+
Sbjct  576   ---------ATAKKDINTLK---FELETVKAKYLELQNDFETLQRQFDKM  613



>ref|XP_009393648.1| PREDICTED: root phototropism protein 3 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009393649.1| PREDICTED: root phototropism protein 3 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009393650.1| PREDICTED: root phototropism protein 3 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009393651.1| PREDICTED: root phototropism protein 3 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009393652.1| PREDICTED: root phototropism protein 3 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009393653.1| PREDICTED: root phototropism protein 3 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009393654.1| PREDICTED: root phototropism protein 3 [Musa acuminata subsp. 
malaccensis]
Length=668

 Score =   261 bits (666),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 158/407 (39%), Positives = 234/407 (57%), Gaps = 39/407 (10%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             + WF+D  IL +D+FV+ ++ IK KG+R ELIG+ I HYASKWLP LT  G         
Sbjct  227   DWWFEDVSILRIDHFVRVVTAIKVKGMRFELIGAAIMHYASKWLPGLTKEGAQGGEEPWS  286

Query  1369  GHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMVG  1190
                 +    + S S  +  S    ++R  +E+LI I+PP+KD + C+FLLRLLR+ NM+ 
Sbjct  287   HQGGLHLIVAGSGSKDDLSSGQIREQRMVIESLISIIPPQKDCVTCSFLLRLLRLANMLK  346

Query  1189  VEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAAV  1010
             V  A   ELEKR+  QLEQATL +L+IPSF H   T+ DV+LV RL++ F+V  + +   
Sbjct  347   VAPALVTELEKRVGMQLEQATLPDLLIPSF-HKSETLYDVDLVQRLLEHFLVQEQTE---  402

Query  1009  MRCSGSSSSGAPPLNLNLNL------------IKVAKLVDDYLAEAAVDSNLTMSQFIAL  866
                  SSS G  P     +              +VA+L+D YL E + D NL++++F  L
Sbjct  403   -----SSSPGREPYPDKHSYEANQRASGPNAKTRVARLLDSYLTEVSRDRNLSLTKFQVL  457

Query  865   AAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERL  686
             A  +P   R  DD LYR++D+YLKAHP +++ ERKR+C+++D +KLS +A +HAAQNERL
Sbjct  458   AEALPESTRTCDDGLYRAVDSYLKAHPTLTEHERKRLCRVMDCQKLSIDACMHAAQNERL  517

Query  685   PVRTVIQVLLSEQTKLSKQL----MRQLEWsggsfisasagasgGTCPRSpnppapgaqq  518
             P+R V+QVL SEQ K+S  +    +++   S    + ++        P+S          
Sbjct  518   PLRVVVQVLFSEQVKISNAIASSSLKEAVESHYQPVISARRQLLEGTPQSFQEGW-----  572

Query  517   qqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKL  377
                     +K+D+NT+     E++ +K + L LQ    N+Q Q EK+
Sbjct  573   ------AAAKKDINTLK---FELESMKAKYLELQNDMDNLQRQFEKM  610



>ref|XP_011043086.1| PREDICTED: root phototropism protein 3-like [Populus euphratica]
Length=599

 Score =   256 bits (655),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 142/322 (44%), Positives = 199/322 (62%), Gaps = 21/322 (7%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             + WF+D  IL +D+FV+ ++ IK KG+R ELIG+ I HYA KWLP L   GG        
Sbjct  158   DWWFEDVSILRIDHFVRVITAIKVKGMRFELIGAAIMHYAGKWLPGLIKDGGGSIDEAGN  217

Query  1369  G----------HLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLL  1220
                        H+I+   +    +           +R  VE+LI I+PP+KDS+ C+FLL
Sbjct  218   SSGCSSWKGGLHMIVAGTKDDIPTAETK------DQRMIVESLISIIPPQKDSVSCSFLL  271

Query  1219  RLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRF  1040
             RLLR+ NM+ V  A   ELEKR+  Q EQATL +L+IPS++    T  DV+LV RL++ F
Sbjct  272   RLLRMANMLKVAPALVTELEKRVGMQFEQATLADLLIPSYNKN-ETSYDVDLVQRLLEHF  330

Query  1039  IVSLEDQAAVMRCSGSSS----SGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFI  872
             +V  + +++       S      GAP        I+VA+LVD YL E + D NL++++F 
Sbjct  331   LVQEQIESSSPTTQSFSDKHMYDGAPRCANPSAKIRVARLVDSYLTEVSRDRNLSLTKFQ  390

Query  871   ALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNE  692
              LA  +P  AR  DD LYR++D+YLKAHP +S+ ERKR+C+++D +KLS +A +HAAQNE
Sbjct  391   VLAEALPDSARTCDDGLYRAVDSYLKAHPTLSEHERKRLCRVMDCQKLSIDACMHAAQNE  450

Query  691   RLPVRTVIQVLLSEQTKLSKQL  626
             RLP+R V+QVL SEQ K+S  L
Sbjct  451   RLPLRVVVQVLFSEQVKISNAL  472



>ref|XP_008811013.1| PREDICTED: root phototropism protein 3 isoform X3 [Phoenix dactylifera]
Length=675

 Score =   258 bits (659),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 154/399 (39%), Positives = 237/399 (59%), Gaps = 28/399 (7%)
 Frame = -3

Query  1543  WFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggsees---iek  1373
             WF+D  IL +D+FV+ ++ IK KG+R +LIG+ I HYASKWLP L   G         + 
Sbjct  236   WFEDVSILRIDHFVRVVTAIKVKGMRFDLIGAAIMHYASKWLPGLAKEGARGSDDAWNQG  295

Query  1372  gGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMV  1193
             G HL +    +     +  +     ++R  +E+LI I+PP+KDS+ C FLLR+LR+ N++
Sbjct  296   GLHLTVAGSANKEDLSSSQIR----EQRMVIESLISIIPPQKDSVSCCFLLRMLRLANIL  351

Query  1192  GVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAA  1013
              V  A   ELEKR+  QLEQATL++L+IPS++    T  DV+LV RL++ F+V  + +A+
Sbjct  352   KVAPALGTELEKRVGMQLEQATLQDLLIPSYNRG-ETSYDVDLVHRLLEHFLVQEQTEAS  410

Query  1012  V-------MRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPI  854
                      +C G  ++  P  ++ +  ++VAKL+D YL E + D NL++++F  LA  +
Sbjct  411   SPGREPYPEKC-GYDANSRP--SVPIAKLRVAKLLDSYLTEVSRDRNLSLTKFQVLAEAL  467

Query  853   PTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRT  674
             P  AR  DD LYR++D+YLKAHP +++ ERKR+C+++D +KLS +A  HAAQNERLP+R 
Sbjct  468   PDSARTCDDGLYRAVDSYLKAHPTLTEHERKRLCRVMDCQKLSIDACTHAAQNERLPLRV  527

Query  673   VIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapgaqqqqqdPRCM  494
             V+QVL SEQ K+S  +            +  +      C R           Q+      
Sbjct  528   VVQVLFSEQLKISNAIAN-----ASLKEAGESHLQPMMCTRRQLLEGTPQSFQEGW--AT  580

Query  493   SKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKL  377
             +K+D+NT+     E++ +K + L LQ+   N+Q Q EK+
Sbjct  581   AKKDINTLK---FEMESMKAKYLELQSDMDNLQRQFEKM  616



>ref|XP_009368293.1| PREDICTED: root phototropism protein 3-like [Pyrus x bretschneideri]
 ref|XP_009368294.1| PREDICTED: root phototropism protein 3-like [Pyrus x bretschneideri]
Length=673

 Score =   258 bits (659),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 160/415 (39%), Positives = 238/415 (57%), Gaps = 47/415 (11%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             + WF+D  IL +D+FV+ ++ IK KG+R ELIG+ I HYASKWLP L   G         
Sbjct  228   DWWFEDVSILRIDHFVRVITAIKVKGMRFELIGASIMHYASKWLPGLINEGTGAADEGSN  287

Query  1369  G---------------HLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIP  1235
                             H+I+   +   S+V          +R  +E+LI I+PP+KDS+ 
Sbjct  288   SSNSTSNSGSSWKGGLHMIVAGNKDEPSNVLAK------NQRMIIESLISIIPPQKDSVS  341

Query  1234  CNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLR  1055
             C+FLLRLLR+ NM+ V  A   ELEKR+  Q EQATL +L+IPS+ + C T+ DV+LV R
Sbjct  342   CSFLLRLLRMANMLKVAPALVTELEKRVGMQFEQATLADLLIPSY-NKCETMYDVDLVQR  400

Query  1054  LVKRFIVSLEDQAAVMRCSGSSSSGA----PPLNLNLNL-IKVAKLVDDYLAEAAVDSNL  890
             L++ F++  ++Q  +   S  S  G     P      N  ++VA+LVD YL E + D +L
Sbjct  401   LLEHFLI--QEQTEISSPSPQSFPGKHYDDPQRGTGPNAKMRVARLVDSYLTEVSRDRSL  458

Query  889   TMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASI  710
             ++++F  LA  +P  AR  DD LYR+ID+YLKAHP +S+ ERKR+C+++D +KLS +A +
Sbjct  459   SLTKFQVLAEALPESARICDDGLYRAIDSYLKAHPTLSEHERKRLCRVMDCQKLSIDACM  518

Query  709   HAAQNERLPVRTVIQVLLSEQTKLSKQL----MRQLEWsggsfisasagasgGTCPRSpn  542
             HAAQNERLP+R V+QVL SEQ K+S  L    +++   S    + ++        P+S  
Sbjct  519   HAAQNERLPLRVVVQVLFSEQVKISNALATNSLKEAGDSQYQPMVSNRKTLLEGTPQSFQ  578

Query  541   ppapgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKL  377
                             +K+D+NT+     E++ +K + L LQ    N+Q Q +K+
Sbjct  579   EGW-----------AAAKKDINTVK---FELESVKAKYLELQHDMENLQRQFDKM  619



>gb|EPS59481.1| hypothetical protein M569_15326, partial [Genlisea aurea]
Length=672

 Score =   258 bits (658),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 154/398 (39%), Positives = 235/398 (59%), Gaps = 19/398 (5%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLP------ELTggggse  1388
             + WF+DA IL +D+FV+ ++ IK KG+R ELIG++I HYA KWLP               
Sbjct  233   DWWFEDASILRIDHFVRVITAIKVKGMRHELIGAVIMHYAGKWLPFSGSAVAAAVEESDG  292

Query  1387  esiekgGHLIIKFeesssssvaesvsaSWMKK--RFFVETLIGILPPEKDSIPCNFLLRL  1214
              + + G H+I+            + + +   K  R  VE+LI I+PP+KDS+ C+FLLRL
Sbjct  293   GAWKGGLHMIVAGTREEHGQNVSAAATAANNKDQRMIVESLISIIPPQKDSVSCSFLLRL  352

Query  1213  LRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIV  1034
             LR+ +MV V  A   ELEKR+  QLEQA L +L+IPS+     T  DV+LV RL++ F+ 
Sbjct  353   LRMASMVKVAPALVTELEKRVGMQLEQAALNDLLIPSYYSKGETTYDVDLVQRLLEHFL-  411

Query  1033  SLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPI  854
              +++Q+ V    G     +    +     +VA+LVD YL E + D NL++++F  LA  +
Sbjct  412   -MQEQSEVGGSPGGGGGNSSNAKM-----RVARLVDSYLTEVSRDRNLSLTKFQVLAEAL  465

Query  853   PTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRT  674
             P  AR +DD LYR++D+YLKAHPG+++ ERKR+C+++DS+KLS +A +HAAQNERLP+R 
Sbjct  466   PESARTSDDGLYRAVDSYLKAHPGMTEHERKRLCRVMDSQKLSIDACMHAAQNERLPLRV  525

Query  673   VIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapgaqqqqqdPRCM  494
             V+QVL +E  K++  L         +  +A+  +       S      G  Q  Q+    
Sbjct  526   VVQVLFAELVKVNNSLAAATL-KDAAAAAAAGESQLQPMVSSRKTLLEGTPQSFQEGWAT  584

Query  493   SKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEK  380
             +K+D+NT+     E++ +K + L LQ +    Q Q++K
Sbjct  585   AKKDINTLK---FELETVKAKYLELQNEFETFQRQVDK  619



>ref|XP_010939734.1| PREDICTED: root phototropism protein 3 [Elaeis guineensis]
 ref|XP_010939735.1| PREDICTED: root phototropism protein 3 [Elaeis guineensis]
Length=673

 Score =   258 bits (658),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 157/403 (39%), Positives = 239/403 (59%), Gaps = 32/403 (8%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             + WF+D  IL +D+FV+ ++ IK KG+R +LIG+ I HYASKWLP L   G         
Sbjct  232   DWWFEDVSILRIDHFVRVVTAIKVKGMRLDLIGAAIMHYASKWLPGLAREGAQGSDDTWN  291

Query  1369  G---HLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGN  1199
                 HLII    +     +  +     ++R  +E+LI I+PP+KD + C FLLR+LR+ N
Sbjct  292   QGGLHLIIAGSANKEDLSSSQIR----EQRMVIESLISIIPPQKDCVSCCFLLRMLRLAN  347

Query  1198  MVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQ  1019
             M+ V  A   ELEKRI  QLEQ+TL++L+IPS++ +  T+ DV+LV RL++ F+V  + +
Sbjct  348   MLKVAPALVTELEKRIGMQLEQSTLQDLLIPSYNRS-ETLYDVDLVHRLLEHFLVQEQAE  406

Query  1018  AAV-MRCSGSSSSGAP----PLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPI  854
             A+   R   +   G      P  L+  L +VAKL+D YL E + D NL++++F  LA  +
Sbjct  407   ASSPGRDPHTEKHGYDATLRPSVLSAKL-RVAKLLDSYLTEVSRDRNLSLTKFQVLAEAL  465

Query  853   PTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRT  674
             P  AR  DD LYR++D+YLKAHP +++ ERKR+C+++D +KLS +A +HAAQNERLP+R 
Sbjct  466   PDSARTCDDGLYRAVDSYLKAHPTLTEHERKRLCRVMDCQKLSVDACMHAAQNERLPLRV  525

Query  673   VIQVLLSEQTKLSKQL----MRQLEWsggsfisasagasgGTCPRSpnppapgaqqqqqd  506
             V+QVL SEQ K+S  +    +++   S    + ++        P+S              
Sbjct  526   VVQVLFSEQLKISNAIANSSLKEAGDSHQQPMMSTRKQLLEGTPQSFQEGW---------  576

Query  505   PRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKL  377
                 +K+D+NT+     E++ +K + L LQ    N+Q Q EK+
Sbjct  577   --AAAKKDINTLK---FEMESVKAKYLELQNDMDNLQRQYEKM  614



>ref|XP_010094827.1| Root phototropism protein 3 [Morus notabilis]
 gb|EXB57313.1| Root phototropism protein 3 [Morus notabilis]
Length=683

 Score =   258 bits (658),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 159/425 (37%), Positives = 242/425 (57%), Gaps = 58/425 (14%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             + WF+DA IL +D+FV+ ++ IK KG+R ELIG++I HYA+KWLP L   G    + E  
Sbjct  229   DWWFEDASILRIDHFVRVITAIKVKGMRFELIGAVIMHYATKWLPGLINEGSVGVADEGS  288

Query  1369  G---------------------HLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPP  1253
                                   H+I+   +    +V          +R  +E+LI I+PP
Sbjct  289   NSSNSNTSGSSSAAAAAWKGGLHMILAGTKDDLPTVQAK------DQRMIIESLISIIPP  342

Query  1252  EKDSIPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLD  1073
             +KDS+ C+FLLRLLR+ NM+ V  A   ELEKR+  Q EQATL +L+IP++ +   T+ D
Sbjct  343   QKDSVSCSFLLRLLRMANMLKVAPALVTELEKRVGMQFEQATLADLLIPNY-NKGETMYD  401

Query  1072  VELVLRLVKRFIVSLEDQAAVMR---------CSGSSSSGAPPLNLNLNLIKVAKLVDDY  920
             V+LV RL++ F+V  + +++              GS  SG    N  +   +VA+LVD Y
Sbjct  402   VDLVQRLLEHFLVQEQTESSSPSSQSFSDKHMYDGSQRSGGSGPNAKM---RVARLVDSY  458

Query  919   LAEAAVDSNLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLID  740
             L E + D NL++++F  LA  +P  AR  DD LYR+ID+YLKAHP +S+ ERKR+C+++D
Sbjct  459   LTEVSRDRNLSLTKFQVLAEALPDSARTCDDGLYRAIDSYLKAHPTLSEHERKRLCRVMD  518

Query  739   SRKLSAEASIHAAQNERLPVRTVIQVLLSEQTKLSKQL----MRQLEWsggsfisasaga  572
              +KLS +A +HAAQNERLP+R V+QVL SEQ K+S  +    +++   S    +  +  +
Sbjct  519   CQKLSIDACMHAAQNERLPLRVVVQVLFSEQVKISNAMANNSLKEAGESHYQPMVTNRKS  578

Query  571   sgGTCPRSpnppapgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQA  392
                  P+S      G           +K+D+NT+     E++ +K + L LQ +  N+Q 
Sbjct  579   LLEGTPQSFQEGWTG-----------AKKDINTLK---FELETVKAKYLELQNEMENLQR  624

Query  391   QIEKL  377
             Q +K+
Sbjct  625   QFDKM  629



>ref|XP_008237216.1| PREDICTED: root phototropism protein 3 [Prunus mume]
Length=675

 Score =   257 bits (657),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 158/416 (38%), Positives = 238/416 (57%), Gaps = 48/416 (12%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             + WF+D  IL +D+FV+ ++ IK KG+R ELIG+ I HYASKWLP L   G +       
Sbjct  228   DWWFEDVSILRIDHFVRVITAIKVKGMRFELIGAAIMHYASKWLPGLINDGAAAADEGSN  287

Query  1369  G----------------HLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSI  1238
                              HLI+   +    +V          +R  +E+LI I+PP+KDS+
Sbjct  288   SSNSNTSNSGSSWKGGLHLIVAGNKDEPPTVQAK------DQRMIIESLISIIPPQKDSV  341

Query  1237  PCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVL  1058
              C+FLLRLLR+ NM+ V  A   ELEKR+  Q EQATL +L+IPS++ +  T+ DV+LV 
Sbjct  342   SCSFLLRLLRMANMLKVAPALVTELEKRVGMQFEQATLADLLIPSYNKS-ETMYDVDLVQ  400

Query  1057  RLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNL-----IKVAKLVDDYLAEAAVDSN  893
             RL++ F+V  ++Q  +   S  S  G    ++         ++VA+LVD YL E + D +
Sbjct  401   RLLEHFLV--QEQTDISSPSQQSFPGKHYDDIQRGTGPNAKMRVARLVDSYLTEVSRDRS  458

Query  892   LTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEAS  713
             L++++F  LA  +P  AR  DD LYR+ID+YLKAHP +S+ ERKR+C+++D +KLS +A 
Sbjct  459   LSLTKFQVLAEALPDSARICDDGLYRAIDSYLKAHPTLSEHERKRLCRVMDCQKLSIDAC  518

Query  712   IHAAQNERLPVRTVIQVLLSEQTKLSKQL----MRQLEWsggsfisasagasgGTCPRSp  545
             +HAAQNERLP+R V+QVL SEQ K+S  L    +++   S    + ++        P+S 
Sbjct  519   MHAAQNERLPLRVVVQVLFSEQVKISNALATSSLKEAGESQYQPMVSNRKTLLEGTPQSF  578

Query  544   nppapgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKL  377
                              +K+D+NT+     E++ +K + L LQ    N+Q Q +K+
Sbjct  579   QEGW-----------AAAKKDINTVK---FELESVKAKYLELQNDMDNLQRQFDKM  620



>ref|XP_004169312.1| PREDICTED: LOW QUALITY PROTEIN: root phototropism protein 3-like, 
partial [Cucumis sativus]
Length=613

 Score =   256 bits (653),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 156/415 (38%), Positives = 238/415 (57%), Gaps = 49/415 (12%)
 Frame = -3

Query  1543  WFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekgG-  1367
             WF+D  IL +D+FV+ ++ IK KG+R ELIGS I HY+SKWLP L     +         
Sbjct  169   WFEDVSILRIDHFVRVITAIKVKGMRFELIGSSIMHYSSKWLPGLVTDTTNAGDEGSTST  228

Query  1366  ---------------HLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPC  1232
                            H+I+   +   S++          +R  +E+LI I+PP+KD + C
Sbjct  229   TSNTSSGSNSWKGGLHMIVAGNKEDHSAIQAK------DQRMIIESLISIIPPQKDCVSC  282

Query  1231  NFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRL  1052
             +FLL+LLR+ NM+ V  A   ELEKR+  Q EQATL +L+IPS+S +  T+ DV+L+ RL
Sbjct  283   SFLLKLLRMANMLKVAPALVTELEKRVGMQFEQATLVDLLIPSYSKS-DTMYDVDLIQRL  341

Query  1051  VKRFIVSLEDQAAVMRCSGSSSS------GAPPLNLNLNLIKVAKLVDDYLAEAAVDSNL  890
             ++ F+V  ++Q  +   S  S S      G+    +    ++VA+LVD YL E A D NL
Sbjct  342   LEHFLV--QEQTEISSPSRQSFSDKHMYDGSQRGTVPNAKMRVARLVDSYLTEVARDRNL  399

Query  889   TMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASI  710
             ++++F  LA  +P  AR  DD LYR+ID+YLKAHP +++ ERKR+C+++D +KLS +A +
Sbjct  400   SLTKFQVLAEALPESARTCDDGLYRAIDSYLKAHPTLTEHERKRLCRVMDCQKLSIDACM  459

Query  709   HAAQNERLPVRTVIQVLLSEQTKLSKQL----MRQLEWsggsfisasagasgGTCPRSpn  542
             HAAQNERLP+R V+QVL SEQ K+S  +    +++   S    +  +        P+S  
Sbjct  460   HAAQNERLPLRVVVQVLFSEQVKISNAIANSSLKEANDSQFQPLVTNRKTLLEATPQSFQ  519

Query  541   ppapgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKL  377
                             +K+D+NT+     E++ +K + L LQT+  ++Q Q EK+
Sbjct  520   EGW-----------ATAKKDINTLK---FELESMKTKYLELQTEMESLQRQCEKV  560



>ref|XP_007042875.1| Phototropic-responsive NPH3 family protein isoform 2 [Theobroma 
cacao]
 gb|EOX98706.1| Phototropic-responsive NPH3 family protein isoform 2 [Theobroma 
cacao]
Length=545

 Score =   254 bits (648),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 157/414 (38%), Positives = 238/414 (57%), Gaps = 44/414 (11%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             + WF+D  IL +D+FV+ ++ IK KG+R ELIG+ I HYA+KWLP L   G  +      
Sbjct  100   DWWFEDVSILRIDHFVRVITAIKVKGMRFELIGASIMHYAAKWLPGLIKDGQGQGDDTSI  159

Query  1369  G---------------HLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIP  1235
                             H+I+   +  + S+          +R  +E+LI I+PP+KDS+ 
Sbjct  160   SSNSNSSGSSSWKGGLHMIVAGTKDDTPSIQSK------DQRMIIESLISIIPPQKDSVS  213

Query  1234  CNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLR  1055
             C+FLLRLLR+ NM+ V  A   ELEKR+  Q EQATL +L+IPS++ +  T+ DV+LV R
Sbjct  214   CSFLLRLLRMANMLKVAPALVTELEKRVGMQFEQATLADLLIPSYNKS-ETLYDVDLVQR  272

Query  1054  LVKRFIVSLEDQAAV-MRCSGSSS---SGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLT  887
             L++ F+V  + +++   R S +      GA   N     ++VA+LVD YL E + D NL+
Sbjct  273   LLEHFLVQEQTESSSPSRQSFTDKHMYEGAQRGNNPNAKMRVARLVDSYLTEVSRDRNLS  332

Query  886   MSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIH  707
             +++F  LA  +P  AR  DD LYR+ID+YLKAHP +S+ ERKR+C+++D +KLS +A +H
Sbjct  333   LTKFQVLAEALPESARTCDDGLYRAIDSYLKAHPTLSEHERKRLCRVMDCQKLSIDACMH  392

Query  706   AAQNERLPVRTVIQVLLSEQTKLSKQL----MRQLEWsggsfisasagasgGTCPRSpnp  539
             AAQNERLP+R V+QVL SEQ K+S  L    ++    +    +  +        P+S   
Sbjct  393   AAQNERLPLRVVVQVLFSEQVKISNALANTTLKDPAETQYQPLIPNRKTLLEGTPQSFQE  452

Query  538   papgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKL  377
                            +K+D+NT+     E++ +K + L LQ    N+Q Q +K+
Sbjct  453   GW-----------VAAKKDINTLK---FELESVKTKYLVLQNDMENLQRQFDKM  492



>ref|XP_007200957.1| hypothetical protein PRUPE_ppa002411mg [Prunus persica]
 gb|EMJ02156.1| hypothetical protein PRUPE_ppa002411mg [Prunus persica]
Length=675

 Score =   257 bits (656),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 159/416 (38%), Positives = 238/416 (57%), Gaps = 48/416 (12%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             + WF+D  IL +D+FV+ ++ IK KG+R ELIG+ I HYASKWLP L   G +       
Sbjct  228   DWWFEDVSILRIDHFVRVITAIKVKGMRFELIGAAIMHYASKWLPGLINDGAAAADEGSN  287

Query  1369  G----------------HLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSI  1238
                              HLI+   +    SV          +R  +E+LI I+PP+KDS+
Sbjct  288   SSNNNTSNSGSSWKGGLHLIVAGNKDEPPSVQAK------DQRMIIESLISIIPPQKDSV  341

Query  1237  PCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVL  1058
              C+FLLRLLR+ NM+ V  A   ELEKR+  Q EQATL +L+IPS++ +  T+ DV+LV 
Sbjct  342   SCSFLLRLLRMANMLKVALALVTELEKRVGMQFEQATLADLLIPSYNKS-ETMYDVDLVQ  400

Query  1057  RLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNL-----IKVAKLVDDYLAEAAVDSN  893
             RL++ F+V  ++Q  +   S  S  G    ++         ++VA+LVD YL E + D +
Sbjct  401   RLLEHFLV--QEQTDISSPSQQSFPGKHYDDIQRGTGPNAKMRVARLVDSYLTEVSRDRS  458

Query  892   LTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEAS  713
             L++++F  LA  +P  AR  DD LYR+ID+YLKAHP +S+ ERKR+C+++D +KLS +A 
Sbjct  459   LSLTKFQVLAEALPDSARICDDGLYRAIDSYLKAHPTLSEHERKRLCRVMDCQKLSIDAC  518

Query  712   IHAAQNERLPVRTVIQVLLSEQTKLSKQL----MRQLEWsggsfisasagasgGTCPRSp  545
             +HAAQNERLP+R V+QVL SEQ K+S  L    +++   S    + ++        P+S 
Sbjct  519   MHAAQNERLPLRVVVQVLFSEQVKISNALATSSLKEAGESQYQPMVSNRKTLLEGTPQSF  578

Query  544   nppapgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKL  377
                              +K+D+NT+     E++ +K + L LQ    N+Q Q +K+
Sbjct  579   QEGW-----------AAAKKDINTVK---FELESVKAKYLELQNDMDNLQRQFDKM  620



>ref|XP_010266412.1| PREDICTED: root phototropism protein 3 [Nelumbo nucifera]
Length=678

 Score =   257 bits (656),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 155/410 (38%), Positives = 233/410 (57%), Gaps = 32/410 (8%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             + WF+D  IL +D+FV+ ++ IK KG+R ELIG+ I HYASKWLP L+            
Sbjct  229   DWWFEDVSILRIDHFVRVITAIKVKGMRFELIGAAIMHYASKWLPGLSLTKEGTGEEGSS  288

Query  1369  G----------------HLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSI  1238
             G                H+++          ++       ++R  VE+LI ++PP+KDS+
Sbjct  289   GKDSNSSSSISSWIGGLHMVVSAGTKEEQRNSQIK-----EQRLIVESLISVIPPQKDSV  343

Query  1237  PCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVL  1058
              C+FLL+LLR+ NM+ V  A   ELEKR+  Q EQATL +L+IPS++    T+ DV+LV 
Sbjct  344   SCSFLLQLLRMANMLKVAPALVTELEKRVGMQFEQATLSDLLIPSYNGE--TLYDVDLVQ  401

Query  1057  RLVKRFIVSLEDQAAVMRCSGSSSSG---APPLNLNLNLIKVAKLVDDYLAEAAVDSNLT  887
             RL++ F+V  + + +    S S  +G    P  N+     +VAKLVD YL E + D NL+
Sbjct  402   RLLEHFLVQEQMEHSSPGESFSEKNGFEGMPRNNVPNAKTRVAKLVDSYLTEVSRDRNLS  461

Query  886   MSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIH  707
             +++F  LA  +P  AR  DD LYR++D+YLKAHP +S+ ERKR+C+++D +KLS +A +H
Sbjct  462   LTKFQVLAEALPESARTCDDGLYRAVDSYLKAHPTLSEHERKRLCRVMDCQKLSMDACMH  521

Query  706   AAQNERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapg  527
             AAQNERLP+R V+QVL SEQ K+S  +      +     S            +      G
Sbjct  522   AAQNERLPLRVVVQVLFSEQVKISNAIANS---TLNLKESGGEAQHYQPMVSTRKALLEG  578

Query  526   aqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKL  377
               Q  Q+     K+D+NT+     E++ +K + L LQ    ++Q Q +K+
Sbjct  579   TPQSFQEGWATEKKDINTLK---FELESMKAKYLELQNDMDSLQRQFDKM  625



>gb|EYU39117.1| hypothetical protein MIMGU_mgv1a002358mg [Erythranthe guttata]
Length=684

 Score =   256 bits (654),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 144/333 (43%), Positives = 207/333 (62%), Gaps = 32/333 (10%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggse------  1388
             + WF+D  IL +D+FV+ ++ IK KG+R ELIG++ITHYA+KWLP L   G +       
Sbjct  230   DWWFEDVTILRIDHFVRVITAIKVKGMRYELIGAVITHYAAKWLPGLIKEGATAPLDEGN  289

Query  1387  --------esiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPC  1232
                      S   G H+I+   +    +V          +R  VE+LI I+PP++DS+ C
Sbjct  290   NVSNISSSSSWNGGLHMILSGNKDDLPAVQVK------DQRMIVESLISIIPPQRDSVSC  343

Query  1231  NFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRL  1052
             +FLLRLLR+ NM+ V  A   ELEKR+  QLEQATL +L+IP ++    T  DV+LV RL
Sbjct  344   SFLLRLLRMANMLRVAPALVTELEKRVGMQLEQATLGDLLIPCYNKN-ETTYDVDLVQRL  402

Query  1051  VKRFIVSLEDQAAV-----------MRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAA  905
             ++ F+V  + + +            M   GS  +GA   N     ++VA+LVD YL E +
Sbjct  403   LEHFLVQEQSENSSPSRHSSSSDNKMYDGGSHRAGAINNNNPNAKMRVARLVDSYLTEVS  462

Query  904   VDSNLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLS  725
              D NL++++F  LA  +P  AR  DD LYR++D+YLKAHP +++ ERKR+C+++D +KLS
Sbjct  463   RDRNLSLTKFQVLAEALPESARSCDDGLYRAVDSYLKAHPTLTEHERKRLCRVMDCQKLS  522

Query  724   AEASIHAAQNERLPVRTVIQVLLSEQTKLSKQL  626
              +A +HAAQNERLP+R V+QVL SEQ K+S  L
Sbjct  523   IDACMHAAQNERLPLRVVVQVLFSEQVKISNAL  555



>ref|XP_003593245.1| Root phototropism protein [Medicago truncatula]
 gb|AES63496.1| phototropic-responsive NPH3 family protein [Medicago truncatula]
Length=685

 Score =   256 bits (654),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 155/418 (37%), Positives = 236/418 (56%), Gaps = 46/418 (11%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             + WF+D  IL +D+FV+ ++ IK KG+R ELIG+ I HYA+KWL EL             
Sbjct  231   DWWFEDVSILRIDHFVRVITAIKVKGMRFELIGAAIMHYATKWLQELVSETSITFDETSN  290

Query  1369  G--------------------HLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPE  1250
                                  H+I+       +S  ++      ++R  +E+LI I+PP+
Sbjct  291   CGNSNSSSSGSGSWIKGGGGLHMIVAGGTRDETSSLQAK-----EQRMIIESLISIIPPQ  345

Query  1249  KDSIPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDV  1070
             KD++ C FLLRLLR+  M+ V  A   ELEKR+  Q EQATL +L+IP ++     + DV
Sbjct  346   KDTVSCTFLLRLLRMAIMLKVAPALVTELEKRVGMQFEQATLADLLIPCYNKGETMMYDV  405

Query  1069  ELVLRLVKRFIV-SLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSN  893
             +LV+RL++ F+V  + + ++  R S S        NLN    +VA+LVD YL E + D N
Sbjct  406   DLVMRLLEHFLVQEVTENSSPKRQSFSEKHMGLGCNLNAK-ARVARLVDSYLTEVSRDRN  464

Query  892   LTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEAS  713
             L++++F  LA  +P  AR  DD LYR+ID+YLKAHP +S+ ERKR+C+++D +KLS +A 
Sbjct  465   LSLTKFQVLAEALPESARTCDDGLYRAIDSYLKAHPTLSEHERKRLCRVMDCQKLSIDAC  524

Query  712   IHAAQNERLPVRTVIQVLLSEQTKLSKQL----MRQLEWsggsfisasagasgGTCPRSp  545
             +HAAQNERLP+R V+QVL +EQ K+S  L    ++ +E      ++        T P+S 
Sbjct  525   MHAAQNERLPLRVVVQVLFAEQVKISTALSNPSLKDVESFTQPMVTNRKTLLEAT-PQSF  583

Query  544   nppapgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLE  371
                              +K+D+NT+     E++ +K + L LQ    N+Q Q +K+L+
Sbjct  584   QEGWTT-----------AKKDVNTLK---FELESVKAKYLELQNDMENLQKQFDKMLK  627



>ref|XP_008811011.1| PREDICTED: root phototropism protein 3 isoform X1 [Phoenix dactylifera]
Length=771

 Score =   258 bits (658),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 154/399 (39%), Positives = 236/399 (59%), Gaps = 28/399 (7%)
 Frame = -3

Query  1543  WFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesie---k  1373
             WF+D  IL +D+FV+ ++ IK KG+R +LIG+ I HYASKWLP L   G           
Sbjct  332   WFEDVSILRIDHFVRVVTAIKVKGMRFDLIGAAIMHYASKWLPGLAKEGARGSDDAWNQG  391

Query  1372  gGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMV  1193
             G HL +    +     +  +     ++R  +E+LI I+PP+KDS+ C FLLR+LR+ N++
Sbjct  392   GLHLTVAGSANKEDLSSSQIR----EQRMVIESLISIIPPQKDSVSCCFLLRMLRLANIL  447

Query  1192  GVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAA  1013
              V  A   ELEKR+  QLEQATL++L+IPS++    T  DV+LV RL++ F+V  + +A+
Sbjct  448   KVAPALGTELEKRVGMQLEQATLQDLLIPSYNRG-ETSYDVDLVHRLLEHFLVQEQTEAS  506

Query  1012  V-------MRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPI  854
                      +C G  ++  P  ++ +  ++VAKL+D YL E + D NL++++F  LA  +
Sbjct  507   SPGREPYPEKC-GYDANSRP--SVPIAKLRVAKLLDSYLTEVSRDRNLSLTKFQVLAEAL  563

Query  853   PTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRT  674
             P  AR  DD LYR++D+YLKAHP +++ ERKR+C+++D +KLS +A  HAAQNERLP+R 
Sbjct  564   PDSARTCDDGLYRAVDSYLKAHPTLTEHERKRLCRVMDCQKLSIDACTHAAQNERLPLRV  623

Query  673   VIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapgaqqqqqdPRCM  494
             V+QVL SEQ K+S  +            +  +      C R           Q+      
Sbjct  624   VVQVLFSEQLKISNAIAN-----ASLKEAGESHLQPMMCTRRQLLEGTPQSFQEGW--AT  676

Query  493   SKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKL  377
             +K+D+NT+     E++ +K + L LQ+   N+Q Q EK+
Sbjct  677   AKKDINTLK---FEMESMKAKYLELQSDMDNLQRQFEKM  712



>ref|XP_008811012.1| PREDICTED: root phototropism protein 3 isoform X2 [Phoenix dactylifera]
Length=770

 Score =   258 bits (658),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 154/399 (39%), Positives = 236/399 (59%), Gaps = 28/399 (7%)
 Frame = -3

Query  1543  WFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesie---k  1373
             WF+D  IL +D+FV+ ++ IK KG+R +LIG+ I HYASKWLP L   G           
Sbjct  331   WFEDVSILRIDHFVRVVTAIKVKGMRFDLIGAAIMHYASKWLPGLAKEGARGSDDAWNQG  390

Query  1372  gGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMV  1193
             G HL +    +     +  +     ++R  +E+LI I+PP+KDS+ C FLLR+LR+ N++
Sbjct  391   GLHLTVAGSANKEDLSSSQIR----EQRMVIESLISIIPPQKDSVSCCFLLRMLRLANIL  446

Query  1192  GVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAA  1013
              V  A   ELEKR+  QLEQATL++L+IPS++    T  DV+LV RL++ F+V  + +A+
Sbjct  447   KVAPALGTELEKRVGMQLEQATLQDLLIPSYNRG-ETSYDVDLVHRLLEHFLVQEQTEAS  505

Query  1012  V-------MRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPI  854
                      +C G  ++  P  ++ +  ++VAKL+D YL E + D NL++++F  LA  +
Sbjct  506   SPGREPYPEKC-GYDANSRP--SVPIAKLRVAKLLDSYLTEVSRDRNLSLTKFQVLAEAL  562

Query  853   PTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRT  674
             P  AR  DD LYR++D+YLKAHP +++ ERKR+C+++D +KLS +A  HAAQNERLP+R 
Sbjct  563   PDSARTCDDGLYRAVDSYLKAHPTLTEHERKRLCRVMDCQKLSIDACTHAAQNERLPLRV  622

Query  673   VIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapgaqqqqqdPRCM  494
             V+QVL SEQ K+S  +            +  +      C R           Q+      
Sbjct  623   VVQVLFSEQLKISNAIAN-----ASLKEAGESHLQPMMCTRRQLLEGTPQSFQEGW--AT  675

Query  493   SKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKL  377
             +K+D+NT+     E++ +K + L LQ+   N+Q Q EK+
Sbjct  676   AKKDINTLK---FEMESMKAKYLELQSDMDNLQRQFEKM  711



>ref|XP_011014241.1| PREDICTED: root phototropism protein 3-like isoform X1 [Populus 
euphratica]
Length=669

 Score =   255 bits (652),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 142/322 (44%), Positives = 200/322 (62%), Gaps = 21/322 (7%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             + WF+D  IL +D+FV+ ++ IK KG+R ELIG+ I HYA KWLP L   GG        
Sbjct  228   DWWFEDVSILRIDHFVRVITAIKVKGMRFELIGAAIMHYAGKWLPGLIKDGGGSIDEAGN  287

Query  1369  G----------HLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLL  1220
                        H+I+   +  +  V          +R  +E+LI I+PP+KDS+ C+FLL
Sbjct  288   SSGCSSWKGGLHMIVAGTKDDTPKVQAK------DQRMIIESLISIIPPQKDSVSCSFLL  341

Query  1219  RLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRF  1040
             RLLR+ NM+ V  A   ELEKR+  Q EQATL +L+IPS++    T  DV+LV RL++ F
Sbjct  342   RLLRMANMLKVAPALVTELEKRVGMQFEQATLADLLIPSYNKN-ETSYDVDLVQRLLEHF  400

Query  1039  IVSLEDQAAVMRCSGSSS----SGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFI  872
             +V  + +++       S      GAP        I+VA+LVD YL E + D NL++++F 
Sbjct  401   LVQEQIESSSPTTQSFSDKHMYDGAPRCANPSAKIRVARLVDSYLTEVSRDRNLSLTKFQ  460

Query  871   ALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNE  692
              LA  +P  AR  DD LYR++D+YLKAHP +S+ ERKR+C+++D +KLS +A +HAAQNE
Sbjct  461   VLAEALPDSARTCDDGLYRAVDSYLKAHPTLSEHERKRLCRVMDCQKLSIDACMHAAQNE  520

Query  691   RLPVRTVIQVLLSEQTKLSKQL  626
             RLP+R V+QVL SEQ K+S  L
Sbjct  521   RLPLRVVVQVLFSEQVKISNAL  542



>ref|XP_006841237.1| hypothetical protein AMTR_s00135p00069650 [Amborella trichopoda]
 gb|ERN02912.1| hypothetical protein AMTR_s00135p00069650 [Amborella trichopoda]
Length=667

 Score =   255 bits (651),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 155/392 (40%), Positives = 235/392 (60%), Gaps = 13/392 (3%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             + WF+D  IL +D+FV+ ++ IK KG+R ELIG+ I HYASKWLP +   G  EE+    
Sbjct  228   DWWFEDVSILRIDHFVRVVTAIKVKGMRFELIGAAIMHYASKWLPGIGKEGNGEENNRDS  287

Query  1369  GHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMVG  1190
                        +    E  +    ++R  +E+LI I+PP+KD++ C+FLLRLLR+ NM+ 
Sbjct  288   NGWKGGLHIIVAGGKEELPNIQMREQRMIIESLISIIPPQKDTVSCSFLLRLLRMANMLK  347

Query  1189  VEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQ-AA  1013
             V  A   ELEKR+  Q EQA L +L+IPS+S    T+ DV+LV RL++ F+V  + + ++
Sbjct  348   VAPALVTELEKRVGMQFEQANLPDLLIPSYSKG-ETLYDVDLVQRLLEHFLVQEQTEPSS  406

Query  1012  VMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPT  833
               R S   +  + P N+    ++VA+LVD YL E + D NL++++F  LA  +P  AR  
Sbjct  407   PGRQSFPETPRSHP-NVPNAKMRVARLVDSYLTEVSRDRNLSLTKFQVLAEALPESARTC  465

Query  832   DDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLS  653
             DD LYR+ID+YLKAHP +S+ ERKR+C+++D +KLS +A +HAAQNERLP+R V+QVL S
Sbjct  466   DDGLYRAIDSYLKAHPTLSEHERKRLCRVMDCQKLSIDACMHAAQNERLPLRIVVQVLFS  525

Query  652   EQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapgaqqqqqdPRCMSKRDMNT  473
             EQ K+S  +      +  +             P +         Q  Q+    +K+D+NT
Sbjct  526   EQLKISNAI------ATNTIKDQVDPQYQPLIP-TRKALLEATPQSFQEGWSTAKKDINT  578

Query  472   INIQHLEIKKLKEEVLRLQTQCINMQAQIEKL  377
             +     E++ +K + L LQ    N+Q Q++K+
Sbjct  579   LK---FELESMKAKYLELQNDMENLQRQMDKM  607



>ref|XP_009150508.1| PREDICTED: root phototropism protein 3 isoform X1 [Brassica rapa]
Length=725

 Score =   256 bits (654),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 163/423 (39%), Positives = 236/423 (56%), Gaps = 37/423 (9%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             + WF+D  IL +D+FV+ ++ IK KG+R EL+G+ ITHYA KWLP L   G  +E     
Sbjct  250   DWWFEDVSILRIDHFVRVITAIKVKGMRFELLGASITHYAGKWLPGLIKEGTPDEMSVSH  309

Query  1369  G----------------HLIIKFeesssssvaesvsaSWM-----KKRFFVETLIGILPP  1253
             G                H+++  + +       +   +        +R  VE+LI I+PP
Sbjct  310   GSNSSGGSSGPDWRGGLHMVLSGKPNGQHQQDSAPYLAGHGISPKDQRMIVESLISIIPP  369

Query  1252  EKDSIPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLD  1073
             +KDS+ C FLLRLLR  NM+ V  A   ELEKR+  Q EQATL++L+IPS+S+   TV D
Sbjct  370   QKDSVTCTFLLRLLRAANMLKVAPALITELEKRVGMQFEQATLQDLLIPSYSNKGETVYD  429

Query  1072  VELVLRLVKRFIVSLEDQAAV-MRCSGSSSSGAPPLNLNLNL-----------IKVAKLV  929
             V+LV RL++ F+V  + + +   R S  + +G P  N                ++VA+LV
Sbjct  430   VDLVQRLLEHFLVQEQTEGSSPSRMSPYADAGIPRANSISGGGGNGGSNQNAKMRVARLV  489

Query  928   DDYLAEAAVDSNLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCK  749
             D YL E A D NL +++F  LA  +P  AR  DD LYR+ID+YLKAHP +S+ ERKR+C+
Sbjct  490   DSYLTEVARDRNLPLTKFQVLAEALPESARSCDDGLYRAIDSYLKAHPTLSEHERKRLCR  549

Query  748   LIDSRKLSAEASIHAAQNERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagas  569
             ++D +KLS +A +HAAQNERLP+R V+QVL SEQ K+S  L         +   A     
Sbjct  550   VMDCQKLSMDACMHAAQNERLPLRVVVQVLFSEQVKISNALANTSLKESTTLGEAMGTTY  609

Query  568   gGTCPRSpnppapgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQ  389
                 P +         Q  Q+    +K+D+NT+     E++ +K + + LQ +   MQ Q
Sbjct  610   QPMIP-NRKTLIEATPQSFQEGWAAAKKDINTLK---FELETVKTKYVELQNEMEVMQRQ  665

Query  388   IEK  380
              EK
Sbjct  666   FEK  668



>ref|XP_004137156.1| PREDICTED: root phototropism protein 3-like [Cucumis sativus]
 gb|KGN53732.1| hypothetical protein Csa_4G113150 [Cucumis sativus]
Length=675

 Score =   255 bits (652),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 156/417 (37%), Positives = 239/417 (57%), Gaps = 49/417 (12%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             + WF+D  IL +D+FV+ ++ IK KG+R ELIGS I HY+SKWLP L     +       
Sbjct  229   DWWFEDVSILRIDHFVRVITAIKVKGMRFELIGSSIMHYSSKWLPGLVTDTTNAGDEGST  288

Query  1369  G----------------HLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSI  1238
                              H+I+   +   S++          +R  +E+LI I+PP+KD +
Sbjct  289   STTSNTSSGSNSWKGGLHMIVAGNKEDHSAIQAK------DQRMIIESLISIIPPQKDCV  342

Query  1237  PCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVL  1058
              C+FLL+LLR+ NM+ V  A   ELEKR+  Q EQATL +L+IPS+S +  T+ DV+L+ 
Sbjct  343   SCSFLLKLLRMANMLKVAPALVTELEKRVGMQFEQATLVDLLIPSYSKS-DTMYDVDLIQ  401

Query  1057  RLVKRFIVSLEDQAAVMRCSGSSSS------GAPPLNLNLNLIKVAKLVDDYLAEAAVDS  896
             RL++ F+V  ++Q  +   S  S S      G+    +    ++VA+LVD YL E A D 
Sbjct  402   RLLEHFLV--QEQTEISSPSRQSFSDKHMYDGSQRGTVPNAKMRVARLVDSYLTEVARDR  459

Query  895   NLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEA  716
             NL++++F  LA  +P  AR  DD LYR+ID+YLKAHP +++ ERKR+C+++D +KLS +A
Sbjct  460   NLSLTKFQVLAEALPESARTCDDGLYRAIDSYLKAHPTLTEHERKRLCRVMDCQKLSIDA  519

Query  715   SIHAAQNERLPVRTVIQVLLSEQTKLSKQL----MRQLEWsggsfisasagasgGTCPRS  548
              +HAAQNERLP+R V+QVL SEQ K+S  +    +++   S    +  +        P+S
Sbjct  520   CMHAAQNERLPLRVVVQVLFSEQVKISNAIANSSLKEANDSQFQPLVTNRKTLLEATPQS  579

Query  547   pnppapgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKL  377
                               +K+D+NT+     E++ +K + L LQT+  ++Q Q EK+
Sbjct  580   FQEGW-----------ATAKKDINTLK---FELESMKTKYLELQTEMESLQRQCEKV  622



>ref|XP_008358392.1| PREDICTED: root phototropism protein 3-like [Malus domestica]
Length=673

 Score =   255 bits (651),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 156/415 (38%), Positives = 237/415 (57%), Gaps = 47/415 (11%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             + WF+D  IL +D+FV+ ++ IK KG+R ELIG+ I HYASKWLP L   G         
Sbjct  228   DWWFEDVSILRIDHFVRVITAIKVKGMRFELIGASIMHYASKWLPGLINEGTGAADEGSN  287

Query  1369  G---------------HLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIP  1235
                             H+I+   +   ++V          +R  +E+LI I+PP+KDS+ 
Sbjct  288   SSNSTSNSGXSWKGGLHMIVAGNKBEPANVQAK------NQRMXIESLISIIPPQKDSVS  341

Query  1234  CNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLR  1055
             C+FLLRLLR+ NM+ V  A   ELEKR+  Q EQATL +L+IPS+ + C T+ DV+LV R
Sbjct  342   CSFLLRLLRMANMLKVAPALVTELEKRVGMQFEQATLADLLIPSY-NKCETMYDVDLVQR  400

Query  1054  LVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNL-----IKVAKLVDDYLAEAAVDSNL  890
             L++ F++  ++Q  +      S  G    +L         ++VA+LVD YL E + D +L
Sbjct  401   LLEHFLI--QEQTEISSPRPQSFPGKHYDDLQRGTGPNAKMRVARLVDSYLTEVSRDRSL  458

Query  889   TMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASI  710
             ++++F  LA  +P  AR  DD LYR+ID+YLKAHP +S+ ERKR+C+++D +KLS +A +
Sbjct  459   SLTKFQVLAEALPESARICDDGLYRAIDSYLKAHPTLSEHERKRLCRVMDCQKLSIDACM  518

Query  709   HAAQNERLPVRTVIQVLLSEQTKLSKQL----MRQLEWsggsfisasagasgGTCPRSpn  542
             HAAQNERLP+R V+QVL SEQ K+S  L    +++   S    + ++        P+S  
Sbjct  519   HAAQNERLPLRVVVQVLFSEQVKISNALATSSLKEAGDSQFQPMVSNRKTLLEGTPQSFQ  578

Query  541   ppapgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKL  377
                             +K+D+NT+     E++ +K + + LQ    N+Q Q +K+
Sbjct  579   EGW-----------AAAKKDINTVK---FELESVKAKYVELQHDMENLQRQFDKM  619



>ref|XP_009150509.1| PREDICTED: root phototropism protein 3 isoform X2 [Brassica rapa]
Length=635

 Score =   254 bits (648),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 146/341 (43%), Positives = 206/341 (60%), Gaps = 33/341 (10%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             + WF+D  IL +D+FV+ ++ IK KG+R EL+G+ ITHYA KWLP L   G  +E     
Sbjct  250   DWWFEDVSILRIDHFVRVITAIKVKGMRFELLGASITHYAGKWLPGLIKEGTPDEMSVSH  309

Query  1369  G----------------HLIIKFeesssssvaesvsaSWM-----KKRFFVETLIGILPP  1253
             G                H+++  + +       +   +        +R  VE+LI I+PP
Sbjct  310   GSNSSGGSSGPDWRGGLHMVLSGKPNGQHQQDSAPYLAGHGISPKDQRMIVESLISIIPP  369

Query  1252  EKDSIPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLD  1073
             +KDS+ C FLLRLLR  NM+ V  A   ELEKR+  Q EQATL++L+IPS+S+   TV D
Sbjct  370   QKDSVTCTFLLRLLRAANMLKVAPALITELEKRVGMQFEQATLQDLLIPSYSNKGETVYD  429

Query  1072  VELVLRLVKRFIVSLEDQAAV-MRCSGSSSSGAPPLNLNLNL-----------IKVAKLV  929
             V+LV RL++ F+V  + + +   R S  + +G P  N                ++VA+LV
Sbjct  430   VDLVQRLLEHFLVQEQTEGSSPSRMSPYADAGIPRANSISGGGGNGGSNQNAKMRVARLV  489

Query  928   DDYLAEAAVDSNLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCK  749
             D YL E A D NL +++F  LA  +P  AR  DD LYR+ID+YLKAHP +S+ ERKR+C+
Sbjct  490   DSYLTEVARDRNLPLTKFQVLAEALPESARSCDDGLYRAIDSYLKAHPTLSEHERKRLCR  549

Query  748   LIDSRKLSAEASIHAAQNERLPVRTVIQVLLSEQTKLSKQL  626
             ++D +KLS +A +HAAQNERLP+R V+QVL SEQ K+S  L
Sbjct  550   VMDCQKLSMDACMHAAQNERLPLRVVVQVLFSEQVKISNAL  590



>ref|XP_002988207.1| hypothetical protein SELMODRAFT_183709 [Selaginella moellendorffii]
 gb|EFJ10626.1| hypothetical protein SELMODRAFT_183709 [Selaginella moellendorffii]
Length=633

 Score =   253 bits (647),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 135/327 (41%), Positives = 206/327 (63%), Gaps = 18/327 (6%)
 Frame = -3

Query  1588  PESGTLSSCKPM----GECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKW  1421
             PES  + S +       + WF+D   L +D+F+K ++ IK KG+R +L+G+++T Y  KW
Sbjct  191   PESNEMRSSEDSKSVPADWWFEDLLTLSVDHFLKVIAAIKVKGMRSDLLGAVVTSYVLKW  250

Query  1420  LPELTggggseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDS  1241
             +P L+   G   +     H+     +   + +         K +  +E ++GILP ++D+
Sbjct  251   VPGLSRDTGYFNAENNI-HMTASTGQDDFTVLQN-------KTQKLLENIVGILPLQQDT  302

Query  1240  IPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELV  1061
             + C+FLLRLLRI NM G   A RAELEKR+  QLE A+L +L++PSF HTC T+ DV+L+
Sbjct  303   VSCSFLLRLLRIANMHGTSTACRAELEKRVGMQLENASLADLLVPSFLHTCETLYDVDLM  362

Query  1060  LRLVKRFIVSLEDQAAVMRCSGSSSSGAPPLN--LNLNLIKVAKLVDDYLAEAAVDSNLT  887
              RL++ F++    Q  V + S S+       +  +    +KVAKL+D YL+E A D NL+
Sbjct  363   QRLLQYFLL----QEQVTQASPSTLEQQLGFDGAMRSAKVKVAKLLDGYLSEVARDQNLS  418

Query  886   MSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIH  707
             +++F AL    P   R +DD LY++IDTYLK HPG+++ ERKR+C+ +D ++LS++A +H
Sbjct  419   LAKFQALVEAFPDSVRTSDDGLYKAIDTYLKVHPGLTELERKRLCRGMDCQRLSSDACLH  478

Query  706   AAQNERLPVRTVIQVLLSEQTKLSKQL  626
             A+QNERLP+R V+QVL SEQ KL   L
Sbjct  479   ASQNERLPLRVVVQVLFSEQVKLKNAL  505



>ref|XP_004301628.1| PREDICTED: root phototropism protein 3-like [Fragaria vesca subsp. 
vesca]
Length=677

 Score =   254 bits (650),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 163/411 (40%), Positives = 243/411 (59%), Gaps = 41/411 (10%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             + WF+DA IL +D++V+ ++ IK KG+R ELIG+ I HYASKWLP +    GS  + ++G
Sbjct  232   DWWFEDASILRIDHYVRVITAIKVKGMRFELIGAAIMHYASKWLPNIISDHGSGLTPDEG  291

Query  1369  G--------------HLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPC  1232
                            HLI+   + + SS  ++       +R  +E+LI I+PP++DS+ C
Sbjct  292   SNSSNSSGSSWKGGLHLIVAGTKDNESSTVQAK-----DQRMIIESLISIIPPQRDSVSC  346

Query  1231  NFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRL  1052
             +FLLRLLR+ NM+ V  A   ELEKR+  Q EQATL +L+IPS++ +  T+ DV+LV RL
Sbjct  347   SFLLRLLRMANMLKVAPALVTELEKRVGMQFEQATLADLLIPSYNKS-ETMYDVDLVQRL  405

Query  1051  VKRFIVSLEDQAAVMRCSGSS------SSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNL  890
             ++ F+V  ++Q  +   S  S        G  P   N  + +VAKLVD YL E + D +L
Sbjct  406   LEHFLV--QEQTEMSSPSHQSFIEKHYERGTGP---NAKM-RVAKLVDSYLTEVSRDRSL  459

Query  889   TMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASI  710
             ++++F  LA  +P  AR  DD LYR+ID+YLKAHP +S+ ERKR+C+++D +KLS +A +
Sbjct  460   SLTKFQVLAEALPESARTCDDGLYRAIDSYLKAHPTLSEHERKRLCRVMDCQKLSIDACM  519

Query  709   HAAQNERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppap  530
             HAAQNERLP+R V+QVL SEQ K+S  L            +          P +      
Sbjct  520   HAAQNERLPLRVVVQVLFSEQVKISNALANS-----ALNEAGRDSNYQPMVP-NRKTLLE  573

Query  529   gaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKL  377
             G  Q  Q+    +K+D+NT+     E++ +K + L LQ    N+Q Q +K+
Sbjct  574   GTPQSFQEGWAAAKKDINTVK---FELESVKAKYLDLQNSMENLQRQFDKM  621



>ref|XP_003608415.1| Root phototropism protein [Medicago truncatula]
 gb|AES90612.1| phototropic-responsive NPH3 family protein [Medicago truncatula]
Length=669

 Score =   254 bits (648),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 158/417 (38%), Positives = 235/417 (56%), Gaps = 47/417 (11%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             + WF+D  IL +D+FV+ ++ IK KG+R ELIG+ I HYA+KWLP L G   + +  E  
Sbjct  228   DWWFEDVSILRIDHFVRVITAIKVKGMRFELIGAGIMHYATKWLPGLAGNDTTIQGEETS  287

Query  1369  G-------------------HLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEK  1247
                                 H+I+      +S++          ++  +E+LI I+PP+K
Sbjct  288   NNSNSSFSSGDNNSSWRGGLHMIVSGTRDETSTLQTK------DQKMVIESLISIIPPQK  341

Query  1246  DSIPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVE  1067
             DS+ C+FLLRLLR+ NM+ V  A   +LEKR+  Q EQATL +L+IP +  +  T+ DV+
Sbjct  342   DSVSCSFLLRLLRMANMLKVAYALITDLEKRVGMQFEQATLSDLLIPCYEKS-ETMYDVD  400

Query  1066  LVLRLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNL-IKVAKLVDDYLAEAAVDSNL  890
             LV RL++ F+V  ++Q      S  S S    +  NLN   +VA+LVD YL E + D NL
Sbjct  401   LVQRLLEHFLV--QEQTEGYSPSRQSLSDHKNVGSNLNAKARVARLVDSYLTEVSRDRNL  458

Query  889   TMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASI  710
             + ++F  LA  +P  AR +DD LYR+ID+YLKAHP +++ ERKR+C+++D +KLS +A +
Sbjct  459   SSTKFQVLAEALPESARVSDDGLYRAIDSYLKAHPTLTEHERKRLCRVMDCQKLSIDACM  518

Query  709   HAAQNERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGT----CPRSpn  542
             HAAQNERLP+R V+QVL SEQ K+S  L                  +  T     P+S  
Sbjct  519   HAAQNERLPLRVVVQVLFSEQVKISNALANSSLKGSVESQYQPMVTNRKTLLEGTPQSFQ  578

Query  541   ppapgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLE  371
                             +K+D+NT+     E++ +K + L LQ    N+Q   +KLL+
Sbjct  579   EGW-----------TTAKKDINTLK---FELESVKTKYLELQHDMENLQKNFDKLLK  621



>ref|XP_007042874.1| Phototropic-responsive NPH3 family protein isoform 1 [Theobroma 
cacao]
 gb|EOX98705.1| Phototropic-responsive NPH3 family protein isoform 1 [Theobroma 
cacao]
Length=642

 Score =   253 bits (646),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 157/414 (38%), Positives = 238/414 (57%), Gaps = 44/414 (11%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             + WF+D  IL +D+FV+ ++ IK KG+R ELIG+ I HYA+KWLP L   G  +      
Sbjct  197   DWWFEDVSILRIDHFVRVITAIKVKGMRFELIGASIMHYAAKWLPGLIKDGQGQGDDTSI  256

Query  1369  G---------------HLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIP  1235
                             H+I+   +  + S+          +R  +E+LI I+PP+KDS+ 
Sbjct  257   SSNSNSSGSSSWKGGLHMIVAGTKDDTPSIQSK------DQRMIIESLISIIPPQKDSVS  310

Query  1234  CNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLR  1055
             C+FLLRLLR+ NM+ V  A   ELEKR+  Q EQATL +L+IPS++ +  T+ DV+LV R
Sbjct  311   CSFLLRLLRMANMLKVAPALVTELEKRVGMQFEQATLADLLIPSYNKS-ETLYDVDLVQR  369

Query  1054  LVKRFIVSLEDQAAV-MRCSGSSS---SGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLT  887
             L++ F+V  + +++   R S +      GA   N     ++VA+LVD YL E + D NL+
Sbjct  370   LLEHFLVQEQTESSSPSRQSFTDKHMYEGAQRGNNPNAKMRVARLVDSYLTEVSRDRNLS  429

Query  886   MSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIH  707
             +++F  LA  +P  AR  DD LYR+ID+YLKAHP +S+ ERKR+C+++D +KLS +A +H
Sbjct  430   LTKFQVLAEALPESARTCDDGLYRAIDSYLKAHPTLSEHERKRLCRVMDCQKLSIDACMH  489

Query  706   AAQNERLPVRTVIQVLLSEQTKLSKQL----MRQLEWsggsfisasagasgGTCPRSpnp  539
             AAQNERLP+R V+QVL SEQ K+S  L    ++    +    +  +        P+S   
Sbjct  490   AAQNERLPLRVVVQVLFSEQVKISNALANTTLKDPAETQYQPLIPNRKTLLEGTPQSFQE  549

Query  538   papgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKL  377
                            +K+D+NT+     E++ +K + L LQ    N+Q Q +K+
Sbjct  550   GW-----------VAAKKDINTLK---FELESVKTKYLVLQNDMENLQRQFDKM  589



>ref|XP_002522618.1| hypothetical protein RCOM_0884570 [Ricinus communis]
 gb|EEF39705.1| hypothetical protein RCOM_0884570 [Ricinus communis]
Length=663

 Score =   253 bits (647),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 156/407 (38%), Positives = 235/407 (58%), Gaps = 40/407 (10%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             + WF+D  IL +D+FV+ ++ IK KG+R ELIG+ I +YA+KWLP L   G         
Sbjct  228   DWWFEDVSILRIDHFVRVITAIKVKGMRFELIGAAIMNYAAKWLPGLIKDGVGSVDEGSN  287

Query  1369  G------------HLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNF  1226
                          H+I+   +    +V          +R  +E+LI I+PP+KDS+ C+F
Sbjct  288   SSNSSTSSWKGGLHMIVAGTKDDPPTVQAK------DQRMIIESLISIIPPQKDSVSCSF  341

Query  1225  LLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVK  1046
             LLRLLR+ N++ V  A   ELEKR+  Q EQATL +L+IPS++ +  T+ DV+LV RL++
Sbjct  342   LLRLLRMANLLKVAPALVTELEKRVGMQFEQATLADLLIPSYNKS-ETLYDVDLVQRLLE  400

Query  1045  RFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIAL  866
              F+V  ++Q      S  S S     N N  + +VA+LVD YL E + D NL++++F  L
Sbjct  401   HFLV--QEQTESSSPSRQSFSDQRGTNPNAKM-RVARLVDSYLTEVSRDRNLSLTKFQVL  457

Query  865   AAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERL  686
             A  +P  AR  DD LYR+ID+YLKAHP +S+ ERKR+C+++D +KLS +A +HAAQNERL
Sbjct  458   AEALPESARTCDDGLYRAIDSYLKAHPTLSEHERKRLCRVMDCQKLSIDACMHAAQNERL  517

Query  685   PVRTVIQVLLSEQTKLSKQL----MRQLEWsggsfisasagasgGTCPRSpnppapgaqq  518
             P+R V+QVL SEQ K+S  L    +++   +    +  +        P+S          
Sbjct  518   PLRVVVQVLFSEQVKISNSLASISLKEAGEAQYQPMIPNRKTLLEGTPQSFQEGW-----  572

Query  517   qqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKL  377
                     +K+D+NT+     E++ +K + L LQ    N+Q Q +K+
Sbjct  573   ------ATAKKDINTLK---FELESVKTKYLELQNDMENLQRQFDKM  610



>emb|CDX84515.1| BnaC03g49850D [Brassica napus]
Length=726

 Score =   255 bits (651),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 162/424 (38%), Positives = 235/424 (55%), Gaps = 38/424 (9%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             + WF+D  IL +D+FV+ ++ IK KG+R EL+G+ ITHYA KWLP L   G  +E     
Sbjct  250   DWWFEDVSILRIDHFVRVITAIKVKGMRFELLGASITHYAGKWLPGLIKEGTPDEMSVSH  309

Query  1369  G----------------HLIIKFeesssssvaesvsaSWM-----KKRFFVETLIGILPP  1253
             G                H+++  + +       +   +        +R  VE+LI I+PP
Sbjct  310   GSNSSGGSSGPDWRGGLHMVLSGKPNGQHQQDSAPYLAGHGISPKDQRMIVESLISIIPP  369

Query  1252  EKDSIPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLD  1073
             +KDS+ C FLLRLLR  NM+ V  A   ELEKR+  Q EQATL++L+IPS+S+   T+ D
Sbjct  370   QKDSVTCTFLLRLLRAANMLKVAPALITELEKRVGMQFEQATLQDLLIPSYSNKGETMYD  429

Query  1072  VELVLRLVKRFIVSLEDQAAV-MRCSGSSSSGAPPLNLNLNL------------IKVAKL  932
             V+LV RL++ F+V  + + +   R S  + +G P  N                 ++VA+L
Sbjct  430   VDLVQRLLEHFLVQEQTEGSSPSRMSPYADAGIPRANSISGGGGGNGSSNQNAKMRVARL  489

Query  931   VDDYLAEAAVDSNLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVC  752
             VD YL E A D NL +++F  LA  +P  AR  DD LYR+ID+YLKAHP +S+ ERKR+C
Sbjct  490   VDSYLTEVARDRNLPLTKFQVLAEALPESARSCDDGLYRAIDSYLKAHPTLSEHERKRLC  549

Query  751   KLIDSRKLSAEASIHAAQNERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasaga  572
             +++D +KLS +A +HAAQNERLP+R V+QVL SEQ K+S  L         +   A    
Sbjct  550   RVMDCQKLSMDACMHAAQNERLPLRVVVQVLFSEQVKISNALANTSLKESTTLGEAMGTT  609

Query  571   sgGTCPRSpnppapgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQA  392
                  P +         Q  Q     +K+D+NT+     E++ +K + + LQ +   MQ 
Sbjct  610   YQPMIP-NRKTLIEATPQSFQASWAAAKKDINTLK---FELETVKTKYVELQNEMEVMQR  665

Query  391   QIEK  380
             Q EK
Sbjct  666   QFEK  669



>ref|XP_004230550.1| PREDICTED: root phototropism protein 3-like [Solanum lycopersicum]
Length=669

 Score =   253 bits (646),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 158/420 (38%), Positives = 235/420 (56%), Gaps = 58/420 (14%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesie--  1376
             + WF+D  IL +D+FV+ ++ IK KG+R ELIG+ I  YA+KWLP L   G         
Sbjct  228   DWWFEDVTILRIDHFVRVITAIKVKGMRHELIGASIMQYATKWLPGLIKEGSGLAEDGCN  287

Query  1375  -----------kgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCN  1229
                         G H+II        +V          +R  VE+LI ILP +KDS+ C+
Sbjct  288   SSNSNGSSSWRGGLHMIIAGSGEEIPTVQAK------DQRMIVESLISILPQQKDSVSCS  341

Query  1228  FLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLV  1049
             FLLRLLR+ NM+ V  A   ELEKR+  Q EQATL +L+IPS+ H   T+ D++LV RL+
Sbjct  342   FLLRLLRMANMLKVAPALITELEKRVGMQFEQATLADLLIPSY-HKSETMYDIDLVQRLL  400

Query  1048  KRFIVSLEDQAAVMRCSGSSSSGAPPLN-----------LNLNL-IKVAKLVDDYLAEAA  905
             + FI+  + +        SSS    P +            NLN  ++VA+LVD YL E +
Sbjct  401   EHFIIQEQTE--------SSSPSRYPFHDKHMQDGSQRGTNLNAKMRVARLVDSYLTEVS  452

Query  904   VDSNLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLS  725
              D NL++++F  LA  +P  AR  DD LYR+ID+YLKAHP +S+ ERKR+C+++D +KLS
Sbjct  453   RDRNLSLTKFQVLAEALPDSARTCDDGLYRAIDSYLKAHPTLSEHERKRLCRVMDCQKLS  512

Query  724   AEASIHAAQNERLPVRTVIQVLLSEQTKLSKQL----MRQLEWsggsfisasagasgGTC  557
              +A +HAAQNERLP+R V+QVL SEQ K+S  +    ++    +    + +   +     
Sbjct  513   VDACMHAAQNERLPLRVVVQVLFSEQVKISNAIANISLKDEGETHYQPLVSHHKSLLEAT  572

Query  556   PRSpnppapgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKL  377
             P+S                  +K+D+NT+     E++ +K + + LQ   +++Q Q +K+
Sbjct  573   PQSFQEGWTA-----------AKKDINTLK---FELETVKTKYVELQNDMVDLQRQFDKI  618



>ref|XP_002963496.1| hypothetical protein SELMODRAFT_166345 [Selaginella moellendorffii]
 gb|EFJ35367.1| hypothetical protein SELMODRAFT_166345 [Selaginella moellendorffii]
Length=633

 Score =   252 bits (643),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 135/327 (41%), Positives = 205/327 (63%), Gaps = 18/327 (6%)
 Frame = -3

Query  1588  PESGTLSSCKPM----GECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKW  1421
             PES  + S +       + WF+D   L +D+F+K ++ IK KG+R +L+G+++T Y  KW
Sbjct  191   PESNEMRSSEDSKSVPADWWFEDLLTLSVDHFLKVIAAIKVKGMRSDLLGAVVTSYVLKW  250

Query  1420  LPELTggggseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDS  1241
             +P L+   G   +     H+     +   + +         K +  +E ++GILP ++D+
Sbjct  251   VPGLSRDTGYFNAENNI-HMTASTGQDDFTVLQN-------KTQKLLENIVGILPLQQDT  302

Query  1240  IPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELV  1061
             + C+FLLRLLRI NM G   A RAELEKR+  QLE A+L +L++PSF HTC T+ DV+L+
Sbjct  303   VSCSFLLRLLRIANMHGTSTACRAELEKRVGMQLENASLADLLVPSFLHTCETLYDVDLM  362

Query  1060  LRLVKRFIVSLEDQAAVMRCSGSSSSGAPPLN--LNLNLIKVAKLVDDYLAEAAVDSNLT  887
              RL++ F++    Q  V + S S+       +  +    +KVAKL+D YL+E A D NL 
Sbjct  363   QRLLQYFLL----QEQVTQASPSTLEQQLGFDGAMRSAKVKVAKLLDGYLSEVARDQNLP  418

Query  886   MSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIH  707
             +++F AL    P   R +DD LY++IDTYLK HPG+++ ERKR+C+ +D ++LS++A +H
Sbjct  419   LAKFQALVEAFPDSVRTSDDGLYKAIDTYLKVHPGLTELERKRLCRGMDCQRLSSDACLH  478

Query  706   AAQNERLPVRTVIQVLLSEQTKLSKQL  626
             A+QNERLP+R V+QVL SEQ KL   L
Sbjct  479   ASQNERLPLRVVVQVLFSEQVKLKNAL  505



>ref|XP_011012727.1| PREDICTED: root phototropism protein 3-like [Populus euphratica]
Length=676

 Score =   253 bits (645),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 156/417 (37%), Positives = 231/417 (55%), Gaps = 47/417 (11%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             + WF+D  IL +D+FV+ ++ IK KG+R ELIG+ I HYA KWLP L   GG        
Sbjct  228   DWWFEDVSILRIDHFVRVITAIKVKGMRFELIGAAIMHYAGKWLPGLIQDGGGFIDEASN  287

Query  1369  G------------------HLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKD  1244
                                H+I+   +    +           +R  VE+LI I+PP+KD
Sbjct  288   SSNSNSNSSSGGISWKGGLHMIVAGTKDDIPTAETK------DQRMIVESLISIIPPQKD  341

Query  1243  SIPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVEL  1064
             S+ C+FLLRLLR+ NM+ V  A   ELEKRI  Q EQA L +L+IPS++    T+ DV+L
Sbjct  342   SVSCSFLLRLLRMANMLKVAPALVTELEKRIGMQFEQAALADLLIPSYNKN-ETLFDVDL  400

Query  1063  VLRLVKRFIVSLEDQAAV-MRCSGSSSSGAPPLNLNLNL---IKVAKLVDDYLAEAAVDS  896
             V RL++ F+V  + +++   R + S  +       + N    ++VA+LVD YL E + D 
Sbjct  401   VQRLLEHFLVQEQTESSSPSRQTFSDKNMYDGTQRSANTSSKMRVARLVDSYLTEVSRDR  460

Query  895   NLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEA  716
             NL++++F  LA  +P  AR  DD LYR+ID+YLKAHP +S+ ERKR+C+++D +KLS +A
Sbjct  461   NLSLTKFQVLAEALPESARTCDDGLYRAIDSYLKAHPSLSEHERKRLCRVMDCQKLSIDA  520

Query  715   SIHAAQNERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGT----CPRS  548
              +HAAQNERLP+R V+QVL SEQ K+S  L                 ++  T     P+S
Sbjct  521   CMHAAQNERLPLRVVVQVLFSEQVKISNSLANNTLKVSSEAQYQPMISNRKTLLEGTPQS  580

Query  547   pnppapgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKL  377
                               +K+D+NT+     E++ +K + L LQ    N+Q + +K+
Sbjct  581   FQEGW-----------ATAKKDINTLK---FELETMKAKYLELQNDMDNLQRKFDKM  623



>ref|XP_007159131.1| hypothetical protein PHAVU_002G211400g [Phaseolus vulgaris]
 gb|ESW31125.1| hypothetical protein PHAVU_002G211400g [Phaseolus vulgaris]
Length=672

 Score =   253 bits (645),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 156/408 (38%), Positives = 236/408 (58%), Gaps = 32/408 (8%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLP-----------ELTg  1403
             + WF+D  IL +D+FV+ ++ IK KG+R ELIG+ I HYA+KWLP           E + 
Sbjct  230   DWWFEDVSILRIDHFVRVITAIKVKGMRYELIGTGIMHYATKWLPGLMNDTAIAGDEGSN  289

Query  1402  gggseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFL  1223
              G S  S    G      +   S     + +     +R  +E+LI I+PP+KDS+ C+FL
Sbjct  290   SGNSSSSSGGVGSWKGGLQMIVSGPRDGTSTLQAKDQRMIIESLISIIPPQKDSVSCSFL  349

Query  1222  LRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKR  1043
             L+LLR+ NM+ V  A   ELEKR+  Q EQATL +L+IP ++    TV DV+LV RL++ 
Sbjct  350   LKLLRMANMLKVALALITELEKRVGMQFEQATLADLLIPCYNKN-DTVYDVDLVQRLLEH  408

Query  1042  FIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALA  863
             F+V  + +++           A   N+N    +VA+LVD YL E + D NL++++F  LA
Sbjct  409   FLVQEQTESSSPSRPPFPDKHASS-NINAK-TRVARLVDSYLTEVSRDRNLSLTKFQVLA  466

Query  862   APIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLP  683
               +P  AR +DD LYR+ID+YLKAHP +++ ERKR+C+++D +KLS +A +HAAQNERLP
Sbjct  467   EALPESARTSDDGLYRAIDSYLKAHPTLTEHERKRLCRVMDCQKLSIDACMHAAQNERLP  526

Query  682   VRTVIQVLLSEQTKLSKQL----MRQLEWsggsfisasagasgGTCPRSpnppapgaqqq  515
             +R V+QVL SEQ K+S  L    +++   S    +  +        P+S           
Sbjct  527   LRVVVQVLFSEQVKISNALSNSSLKEGVESHYQPMVPNRKTLLEGTPQSFQEGW------  580

Query  514   qqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLE  371
                    +K+D+NT+     E++ +K + L LQ    N+Q Q ++LL+
Sbjct  581   -----AAAKKDINTLK---FELETVKTKYLELQNDMENLQKQFDRLLK  620



>ref|XP_008373205.1| PREDICTED: root phototropism protein 3 [Malus domestica]
Length=674

 Score =   253 bits (645),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 158/415 (38%), Positives = 238/415 (57%), Gaps = 47/415 (11%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             + WF+D  IL +D+FV+ ++ IK KG+R ELIG+ + HYASKWLP L   G         
Sbjct  228   DWWFEDVSILRIDHFVRVITAIKVKGMRFELIGAAMMHYASKWLPGLINEGTGAADEGSN  287

Query  1369  G---------------HLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIP  1235
                             H+I+   +  SSSV          +R  +E+LI I+PP+KDS+ 
Sbjct  288   SSNSTSNSGGSWNGGLHMILAGNKDESSSVQAK------DQRMIIESLISIIPPQKDSVS  341

Query  1234  CNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLR  1055
             C+FLLRLLR+ NM+ V  A   ELEKR+  Q EQATL +L+IPS+ + C T+ DV+LV R
Sbjct  342   CSFLLRLLRMANMLKVAPALVTELEKRVGMQFEQATLADLLIPSY-NKCETMYDVDLVQR  400

Query  1054  LVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNL-----IKVAKLVDDYLAEAAVDSNL  890
             L++ F+V  ++Q  +   S  S  G    +L  +      ++VA+LVD YL E + D +L
Sbjct  401   LLEHFLV--QEQTEISSPSQQSFPGKHYDDLQRSTGPNAKMRVARLVDSYLTEVSRDRSL  458

Query  889   TMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASI  710
             ++++F  LA  +P  AR  DD LYR++D+YLKAHP +S+ ERKR+C+++D +KLS +A +
Sbjct  459   SLTKFQVLAEALPESARICDDGLYRAVDSYLKAHPTLSEHERKRLCRVMDCQKLSIDACM  518

Query  709   HAAQNERLPVRTVIQVLLSEQTKLSKQL----MRQLEWsggsfisasagasgGTCPRSpn  542
             HAAQNERLP+R V+QVL  EQ K+S  L    +++   S    + ++        P+S  
Sbjct  519   HAAQNERLPLRVVVQVLFCEQVKISDALATSSLKEAGDSQYQPMVSNRKTLLEGTPQSFQ  578

Query  541   ppapgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKL  377
                             +K+D+N +     E++ +K + L LQ    N+Q Q +K+
Sbjct  579   EGW-----------AAAKKDINMVK---FELESVKAKHLELQHDMENLQRQFDKM  619



>ref|XP_011023032.1| PREDICTED: root phototropism protein 3-like [Populus euphratica]
Length=676

 Score =   253 bits (645),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 156/417 (37%), Positives = 233/417 (56%), Gaps = 47/417 (11%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             + WF+D  IL +D+FV+ ++ IK KG+R ELIG+ I HYA KWLP L   GG        
Sbjct  228   DWWFEDVSILRIDHFVRVITAIKVKGMRFELIGAAIMHYAGKWLPGLIQDGGGFIDEASN  287

Query  1369  G------------------HLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKD  1244
                                H+I+   +  + +V          +R  +E+LI I+PP+KD
Sbjct  288   SSNSNSNSSSGGISWKGGLHMIVAGTKDDTPTVQAK------DQRMIIESLISIIPPQKD  341

Query  1243  SIPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVEL  1064
             S+ C+FLLRLLR+ NM+ V  A   ELEKRI  Q EQA L +L+IPS++    T+ DV+L
Sbjct  342   SVSCSFLLRLLRMANMLKVAPALVTELEKRIGMQFEQAALADLLIPSYNKN-ETLFDVDL  400

Query  1063  VLRLVKRFIVSLEDQAAV-MRCSGSSSSGAPPLNLNLNL---IKVAKLVDDYLAEAAVDS  896
             V RL++ F+V  + +++   R + S  +       + N    ++VA+LVD YL E + D 
Sbjct  401   VQRLLEHFLVQEQTESSSPSRQTFSDKNMYDGTQRSANTSSKMRVARLVDSYLTEVSRDR  460

Query  895   NLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEA  716
             NL++++F  LA  +P  AR  DD LYR+ID+YLKAHP +S+ ERKR+C+++D +KLS +A
Sbjct  461   NLSLTKFQVLAEALPESARTCDDGLYRAIDSYLKAHPSLSEHERKRLCRVMDCQKLSIDA  520

Query  715   SIHAAQNERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGT----CPRS  548
              +HAAQNERLP+R V+QVL SEQ K+S  L                 ++  T     P+S
Sbjct  521   CMHAAQNERLPLRVVVQVLFSEQVKISNSLANNTLKVSSEAQYQPMISNRKTLLEGTPQS  580

Query  547   pnppapgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKL  377
                               +K+D+NT+     E++ +K + L LQ    N+Q + +K+
Sbjct  581   FQEGW-----------ATAKKDINTLK---FELETMKAKYLELQNDMDNLQRKFDKM  623



>ref|XP_009348533.1| PREDICTED: root phototropism protein 3-like [Pyrus x bretschneideri]
 ref|XP_009348534.1| PREDICTED: root phototropism protein 3-like [Pyrus x bretschneideri]
Length=674

 Score =   252 bits (644),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 158/415 (38%), Positives = 239/415 (58%), Gaps = 47/415 (11%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             + WF+D  IL +D+FV+ ++ IK +G+R ELIG+ + HYASKWLP L   G         
Sbjct  228   DWWFEDVSILRIDHFVRVITAIKVRGMRFELIGAAMMHYASKWLPGLINEGTGTADEGSN  287

Query  1369  G---------------HLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIP  1235
                             H+I+   +  SSSV          +R  +E+LI I+PP+KDS+ 
Sbjct  288   SSNSTSNSSGSWKGGLHMILAGNKDESSSVQAK------DQRMIIESLISIIPPQKDSVS  341

Query  1234  CNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLR  1055
             C+FLLRLLR+ NM+ V  A   ELEKR+  Q EQATL +L+IPS ++ C T+ DV+LV R
Sbjct  342   CSFLLRLLRMANMLKVAPALVTELEKRVGMQFEQATLADLLIPS-NNKCETMYDVDLVQR  400

Query  1054  LVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNL-----IKVAKLVDDYLAEAAVDSNL  890
             L++ F+V  ++Q  +   S  S  G    +L  +      ++VA+LVD YL E + D +L
Sbjct  401   LLEHFLV--QEQTEISSPSQQSFPGKHYDDLQRSTGPNAKMRVARLVDSYLTEVSRDRSL  458

Query  889   TMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASI  710
             ++++F  LA  +P  AR  DD LYR++D+YLKAHP +S+ ERKR+C+++D +KLS +A +
Sbjct  459   SLTKFQVLAEALPESARICDDGLYRAVDSYLKAHPTLSEHERKRLCRVMDCQKLSIDACM  518

Query  709   HAAQNERLPVRTVIQVLLSEQTKLSKQL----MRQLEWsggsfisasagasgGTCPRSpn  542
             HAAQNERLP+R V+QVL  EQ K+S  L    +++   S    + ++        P+S  
Sbjct  519   HAAQNERLPLRVVVQVLFCEQVKISNALATSSLKEAGDSQYQPMVSNRKTLLEGTPQSFQ  578

Query  541   ppapgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKL  377
                             +K+D+NT+     E++ +K + L LQ    N+Q Q +K+
Sbjct  579   EGW-----------AAAKKDINTVK---FELESVKAKHLELQHDMENLQRQFDKM  619



>ref|XP_004504830.1| PREDICTED: root phototropism protein 3-like isoform X2 [Cicer 
arietinum]
 ref|XP_004504831.1| PREDICTED: root phototropism protein 3-like isoform X3 [Cicer 
arietinum]
Length=676

 Score =   252 bits (644),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 154/411 (37%), Positives = 233/411 (57%), Gaps = 33/411 (8%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             + WF+D  IL +D+FV+  + IK KG+R ELIG+ I HYA+KWLP L             
Sbjct  230   DWWFEDVSILRIDHFVRVTTAIKVKGMRFELIGAGIMHYATKWLPGLGNDAAIAVEETSI  289

Query  1369  G------------------HLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKD  1244
                                H+I+       +S  ++       +R  +E+LI I+PP+KD
Sbjct  290   NNGNNSSSSGSDGSWKGGLHMIVAAGTRDETSSLQAK-----DQRMVIESLISIIPPQKD  344

Query  1243  SIPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVEL  1064
             S+ C+FLLRLLR+ NM+ V  A   +LEKR+  Q EQA+L +L+IP +S +  T+ DV+L
Sbjct  345   SVSCSFLLRLLRMANMLKVAHALITDLEKRVGMQFEQASLNDLLIPCYSKS-ETMYDVDL  403

Query  1063  VLRLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTM  884
             V RL++ F+V  + + +      S S      +LN    +VA+LVD YL E + D NL++
Sbjct  404   VQRLLEHFLVQEQVEGSSPSRQQSLSDKLVGSSLNAK-ARVARLVDSYLTEVSRDRNLSL  462

Query  883   SQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHA  704
             ++F  LA  +P  AR +DD LYR+ID+YLKAHP +++ ERKR+C+++D +KLS +A +HA
Sbjct  463   TKFQVLAEALPESARTSDDGLYRAIDSYLKAHPTLTEHERKRLCRVMDCQKLSIDACMHA  522

Query  703   AQNERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapga  524
             AQNERLP+R V+QVL SEQ K+S  L         S       +       +      G 
Sbjct  523   AQNERLPIRVVVQVLFSEQVKISNALANN-----NSLKGGGVESQFQPIITNRKTLLEGT  577

Query  523   qqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLE  371
              Q  Q+    +K+D+NT+     E++ +K + L LQ    N+Q Q +K+++
Sbjct  578   PQSFQEGWSTAKKDINTLK---FELESVKTKYLELQHDMENLQKQFDKVMK  625



>ref|XP_008462886.1| PREDICTED: root phototropism protein 3-like isoform X1 [Cucumis 
melo]
Length=675

 Score =   252 bits (643),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 155/417 (37%), Positives = 238/417 (57%), Gaps = 49/417 (12%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             + WF+D  IL +D+FV+ ++ IK KG+R ELIGS I HY+SKWLP L     +       
Sbjct  229   DWWFEDVSILRIDHFVRVITAIKVKGMRFELIGSSIMHYSSKWLPGLVTDATNAGDEGST  288

Query  1369  G----------------HLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSI  1238
                              H+I+   +   S++          +R  +E+LI I+PP+KD +
Sbjct  289   STTSNTSSGSNSWKGGLHMIVAGNKEDHSAIQAK------DQRMIIESLISIIPPQKDCV  342

Query  1237  PCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVL  1058
              C+FLL+LLR+ NM+ V  A   ELEKR+  Q EQA L +L+IPS+S +  T+ DV+L+ 
Sbjct  343   SCSFLLKLLRMANMLKVAPALVTELEKRVGMQFEQAALVDLLIPSYSKS-DTMYDVDLIQ  401

Query  1057  RLVKRFIVSLEDQAAVMRCSGSSSS------GAPPLNLNLNLIKVAKLVDDYLAEAAVDS  896
             RL++ F+V  ++Q  +   S  S S      G+    +    ++VA+LVD YL E A D 
Sbjct  402   RLLEHFLV--QEQTEISSPSRQSFSDKHMYDGSQRGVVPNAKMRVARLVDSYLTEVARDR  459

Query  895   NLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEA  716
             NL++++F  LA  +P  AR  DD LYR+ID+YLKAHP +++ ERKR+C+++D +KLS +A
Sbjct  460   NLSLTKFQVLAEALPESARTCDDGLYRAIDSYLKAHPTLTEHERKRLCRVMDCQKLSIDA  519

Query  715   SIHAAQNERLPVRTVIQVLLSEQTKLSKQL----MRQLEWsggsfisasagasgGTCPRS  548
              +HAAQNERLP+R V+QVL SEQ K+S  +    +++   S    +  +        P+S
Sbjct  520   CMHAAQNERLPLRVVVQVLFSEQVKISNAIANSSLKEANDSQFQPLVTNRKTLLEATPQS  579

Query  547   pnppapgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKL  377
                               +K+D+NT+     E++ +K + L LQT+  ++Q Q EK+
Sbjct  580   FQEGW-----------ATAKKDINTLK---FELESMKTKYLELQTEMESLQRQCEKV  622



>ref|XP_011014242.1| PREDICTED: root phototropism protein 3-like isoform X2 [Populus 
euphratica]
Length=582

 Score =   250 bits (638),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 139/317 (44%), Positives = 197/317 (62%), Gaps = 21/317 (7%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             + WF+D  IL +D+FV+ ++ IK KG+R ELIG+ I HYA KWLP L   GG        
Sbjct  228   DWWFEDVSILRIDHFVRVITAIKVKGMRFELIGAAIMHYAGKWLPGLIKDGGGSIDEAGN  287

Query  1369  G----------HLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLL  1220
                        H+I+   +  +  V          +R  +E+LI I+PP+KDS+ C+FLL
Sbjct  288   SSGCSSWKGGLHMIVAGTKDDTPKVQAK------DQRMIIESLISIIPPQKDSVSCSFLL  341

Query  1219  RLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRF  1040
             RLLR+ NM+ V  A   ELEKR+  Q EQATL +L+IPS++    T  DV+LV RL++ F
Sbjct  342   RLLRMANMLKVAPALVTELEKRVGMQFEQATLADLLIPSYNKN-ETSYDVDLVQRLLEHF  400

Query  1039  IVSLEDQAAVMRCSGSSS----SGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFI  872
             +V  + +++       S      GAP        I+VA+LVD YL E + D NL++++F 
Sbjct  401   LVQEQIESSSPTTQSFSDKHMYDGAPRCANPSAKIRVARLVDSYLTEVSRDRNLSLTKFQ  460

Query  871   ALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNE  692
              LA  +P  AR  DD LYR++D+YLKAHP +S+ ERKR+C+++D +KLS +A +HAAQNE
Sbjct  461   VLAEALPDSARTCDDGLYRAVDSYLKAHPTLSEHERKRLCRVMDCQKLSIDACMHAAQNE  520

Query  691   RLPVRTVIQVLLSEQTK  641
             RLP+R V+QVL SEQ +
Sbjct  521   RLPLRVVVQVLFSEQGR  537



>ref|XP_004504832.1| PREDICTED: root phototropism protein 3-like isoform X4 [Cicer 
arietinum]
Length=674

 Score =   252 bits (643),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 154/411 (37%), Positives = 233/411 (57%), Gaps = 33/411 (8%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             + WF+D  IL +D+FV+  + IK KG+R ELIG+ I HYA+KWLP L             
Sbjct  228   DWWFEDVSILRIDHFVRVTTAIKVKGMRFELIGAGIMHYATKWLPGLGNDAAIAVEETSI  287

Query  1369  G------------------HLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKD  1244
                                H+I+       +S  ++       +R  +E+LI I+PP+KD
Sbjct  288   NNGNNSSSSGSDGSWKGGLHMIVAAGTRDETSSLQAK-----DQRMVIESLISIIPPQKD  342

Query  1243  SIPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVEL  1064
             S+ C+FLLRLLR+ NM+ V  A   +LEKR+  Q EQA+L +L+IP +S +  T+ DV+L
Sbjct  343   SVSCSFLLRLLRMANMLKVAHALITDLEKRVGMQFEQASLNDLLIPCYSKS-ETMYDVDL  401

Query  1063  VLRLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTM  884
             V RL++ F+V  + + +      S S      +LN    +VA+LVD YL E + D NL++
Sbjct  402   VQRLLEHFLVQEQVEGSSPSRQQSLSDKLVGSSLNAK-ARVARLVDSYLTEVSRDRNLSL  460

Query  883   SQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHA  704
             ++F  LA  +P  AR +DD LYR+ID+YLKAHP +++ ERKR+C+++D +KLS +A +HA
Sbjct  461   TKFQVLAEALPESARTSDDGLYRAIDSYLKAHPTLTEHERKRLCRVMDCQKLSIDACMHA  520

Query  703   AQNERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapga  524
             AQNERLP+R V+QVL SEQ K+S  L         S       +       +      G 
Sbjct  521   AQNERLPIRVVVQVLFSEQVKISNALANN-----NSLKGGGVESQFQPIITNRKTLLEGT  575

Query  523   qqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLE  371
              Q  Q+    +K+D+NT+     E++ +K + L LQ    N+Q Q +K+++
Sbjct  576   PQSFQEGWSTAKKDINTLK---FELESVKTKYLELQHDMENLQKQFDKVMK  623



>ref|XP_002457253.1| hypothetical protein SORBIDRAFT_03g004120 [Sorghum bicolor]
 gb|EES02373.1| hypothetical protein SORBIDRAFT_03g004120 [Sorghum bicolor]
Length=498

 Score =   248 bits (632),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 162/420 (39%), Positives = 236/420 (56%), Gaps = 71/420 (17%)
 Frame = -3

Query  1528  CILDMDYFVKTLSGIKAKGV---RPELIGSIITHYASKWLPELTggggseesiekgGHLI  1358
             C+ D+D F +T++ +K+K     RP+++ S+++HYA+KWLP++     S           
Sbjct  46    CVNDVDNFARTVAAVKSKAASCARPDMLASVLSHYAAKWLPDVAPPLTSSSPASSVSGRF  105

Query  1357  IKFeesssssvaesvsaSWMKKRFFVETLIGILPPE-------------------KDSIP  1235
             +           ES +A+W+KKR  +E+L+  LPP+                    D I 
Sbjct  106   LP---------PESPTATWLKKRLLLESLVAALPPDPLVAGAGGGSCCTAAAVATDDGIT  156

Query  1234  CNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSH------TCGTVLD  1073
             C+FLL+LLR G+MVG +AA   +LE R + +L+QATL  +MIP+F H          +LD
Sbjct  157   CDFLLKLLRAGSMVGADAALLRDLEARAARRLDQATLGAVMIPAFGHAGREHANSALLLD  216

Query  1072  VELVLRLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSN  893
             V LVLRLV+ F+   E  AA      S S  A          +VA+LVD YLAEAA+++ 
Sbjct  217   VPLVLRLVRGFLK--EGAAAGATSKASISGAAIIGGGGAAAARVARLVDAYLAEAALEAG  274

Query  892   LTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEAS  713
             L  ++F  LA  +P HARP DDALYR++DTYLKAHP  +KEERK +C+LID+RKL+AEA+
Sbjct  275   LRPAEFEELARAVPAHARPADDALYRAVDTYLKAHPNTAKEERKSLCRLIDARKLTAEAA  334

Query  712   IHAAQNERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppa  533
              HA QNER+PVR+V+QVL SE  KL++  + +L                     S +   
Sbjct  335   AHAVQNERMPVRSVMQVLFSEHGKLNR--LAELS-------------------NSFSSQR  373

Query  532   pgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQ--------TQCINMQAQIEKL  377
                   +   RC SKR+   +  QH E+++L+E+V+RLQ         QC  +QAQ+++L
Sbjct  374   SPNPALELPGRCPSKRE---VLAQHQEVRRLREDVVRLQVSSSSPHEVQCNALQAQVDRL  430



>ref|XP_007148380.1| hypothetical protein PHAVU_006G203600g [Phaseolus vulgaris]
 gb|ESW20374.1| hypothetical protein PHAVU_006G203600g [Phaseolus vulgaris]
Length=672

 Score =   252 bits (643),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 156/415 (38%), Positives = 240/415 (58%), Gaps = 44/415 (11%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             + WF+DA IL +D+FV+ ++ IK KG+R EL+G+ I HYA+KWLP L             
Sbjct  228   DWWFEDASILRIDHFVRVITAIKVKGMRFELVGAAIMHYATKWLPGLISDTAIPGDEASN  287

Query  1369  G-----------------HLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDS  1241
                               H+I+   +  SSSV         ++R  VE+L+ I+PP+KDS
Sbjct  288   CSVSNSSSSGGSSWKGGLHMIVMGTKDDSSSVQAK------EQRMVVESLVSIIPPQKDS  341

Query  1240  IPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELV  1061
             + C+FLLRLLR+  M+ V  A   ELEKR+  Q EQATL +L+IPS++    T+ DV+LV
Sbjct  342   VSCSFLLRLLRMAIMLKVAPALVTELEKRVGMQFEQATLADLLIPSYTKG-ETMYDVDLV  400

Query  1060  LRLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNL-IKVAKLVDDYLAEAAVDSNLTM  884
              RL++ FIV  + +++       S      +   LN   +VA+LVD YL E + D NL++
Sbjct  401   QRLLEHFIVQEQTESSSPSRQSFSDKQHMGMGCILNAKARVARLVDSYLTEVSRDRNLSL  460

Query  883   SQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHA  704
             ++F  LA  +P  AR  DD LYR+ID+YLKAHP +S+ ERKR+C+++D +KLS +A +HA
Sbjct  461   TKFQVLAEALPESARTCDDGLYRAIDSYLKAHPTLSEHERKRLCRVMDCQKLSIDACLHA  520

Query  703   AQNERLPVRTVIQVLLSEQTKLSKQL----MRQLEWsggsfisasagasgGTCPRSpnpp  536
             AQNERLP+R V+QVL +EQ K+S  L    ++ +E    + ++       GT P+S    
Sbjct  521   AQNERLPLRVVVQVLFAEQVKISNALATSSVKDVESESHAMVTNRKTLLEGT-PQSFQEG  579

Query  535   apgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLE  371
                           +K+D+NT+     E++ +K + + LQ    ++Q Q +++++
Sbjct  580   WSA-----------AKKDINTLK---FELESVKAKYMELQNDMFSLQKQFDRMVK  620



>ref|XP_006351743.1| PREDICTED: root phototropism protein 3-like [Solanum tuberosum]
Length=659

 Score =   251 bits (642),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 157/417 (38%), Positives = 235/417 (56%), Gaps = 52/417 (12%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             + WF+D  IL +D+FV+ ++ IK KG+R ELIG+ I  YA+KWLP L   G         
Sbjct  218   DWWFEDVTILRIDHFVRVITAIKVKGMRHELIGASIMQYATKWLPGLIKEGSGLAEDGSN  277

Query  1369  G-------------HLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCN  1229
                           H+II        +V          +R  VE+LI ILP +KDS+ C+
Sbjct  278   SSNSNGSSSWRGGLHMIIAGSGEEIPTVQAK------DQRMIVESLISILPQQKDSVSCS  331

Query  1228  FLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLV  1049
             FLLRLLR+ NM+ V  A   ELEKR+  Q EQATL +L+IPS++ +  T+ D++LV RL+
Sbjct  332   FLLRLLRMANMLKVAPALITELEKRVGMQFEQATLADLLIPSYNKS-ETMYDIDLVQRLL  390

Query  1048  KRFIVSLEDQAAVMRCSGSSSSGAPPLNL--------NLNL-IKVAKLVDDYLAEAAVDS  896
             + FI+  + ++     S  S    P  ++        NLN  ++VA+LVD YL E + D 
Sbjct  391   EHFIIQEQTES-----SSPSRYSFPDKHMHDGSQRGTNLNAKMRVARLVDSYLTEVSRDR  445

Query  895   NLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEA  716
             NL++++F  LA  +P  AR  DD LYR+ID+YLKAHP +S+ ERKR+C+++D +KLS +A
Sbjct  446   NLSLTKFQVLAEALPDSARTCDDGLYRAIDSYLKAHPTLSEHERKRLCRVMDCQKLSVDA  505

Query  715   SIHAAQNERLPVRTVIQVLLSEQTKLSKQL----MRQLEWsggsfisasagasgGTCPRS  548
              +HAAQNERLP+R V+QVL SEQ K+S  +    ++    S    + +   +     P+S
Sbjct  506   CMHAAQNERLPLRVVVQVLFSEQVKISNAIANISLKDAGESHYQPLVSHHKSLLEATPQS  565

Query  547   pnppapgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKL  377
                               +K+D+NT+     E++ +K + + LQ    N+Q Q +K+
Sbjct  566   FQEGW-----------TAAKKDINTLK---FELETVKTKYVELQNDMDNLQRQFDKI  608



>ref|XP_002323955.2| hypothetical protein POPTR_0017s07540g [Populus trichocarpa]
 gb|EEF04088.2| hypothetical protein POPTR_0017s07540g [Populus trichocarpa]
Length=672

 Score =   252 bits (643),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 142/329 (43%), Positives = 200/329 (61%), Gaps = 32/329 (10%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             + WF+D  IL +D+FV+ ++ IK KG+R ELIG+ I HYA KWLP L   GG        
Sbjct  228   DWWFEDVSILRIDHFVRVITAIKVKGMRFELIGAAIMHYAGKWLPGLIKDGGGSIDEASN  287

Query  1369  G-------------HLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCN  1229
                           H+I+   +  + +           +R  VE+LI I+PP+KDS+ C+
Sbjct  288   SSNSSGGSSWKGGLHMIVAVSKDDTPTAETK------DQRMIVESLISIIPPQKDSVSCS  341

Query  1228  FLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLV  1049
             FLLRLLR+ NM+ V  A   ELEKR+  Q EQATL +L+IPS++    T  DV+LV RL+
Sbjct  342   FLLRLLRMANMLKVAPALVTELEKRVGMQFEQATLADLLIPSYNKN-ETSYDVDLVQRLL  400

Query  1048  KRFIVSLEDQAAVMRCSGSSSS--------GAPPLNLNLNLIKVAKLVDDYLAEAAVDSN  893
             + F+V  + +++       S          GA P       I+VA+LVD YL E + D N
Sbjct  401   EHFLVQEQIESSSPTTQSFSDKHMYDGAQRGANPSAK----IRVARLVDSYLTEVSRDRN  456

Query  892   LTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEAS  713
             L++++F  LA  +P  AR  DD LYR++D+YLKAHP +S+ ERKR+C+++D +KLS +A 
Sbjct  457   LSLTKFQVLAEALPDSARTCDDGLYRAVDSYLKAHPTLSEHERKRLCRVMDCQKLSIDAC  516

Query  712   IHAAQNERLPVRTVIQVLLSEQTKLSKQL  626
             +HAAQNERLP+R V+QVL SEQ K+S  L
Sbjct  517   MHAAQNERLPLRVVVQVLFSEQVKISNAL  545



>ref|XP_002310495.1| hypothetical protein POPTR_0007s03550g [Populus trichocarpa]
 gb|EEE90945.1| hypothetical protein POPTR_0007s03550g [Populus trichocarpa]
Length=676

 Score =   252 bits (643),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 153/417 (37%), Positives = 237/417 (57%), Gaps = 47/417 (11%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             + WF+D  IL +D+FV+ ++ IK KG+R EL G+ I HYA KWLP L   GG        
Sbjct  228   DWWFEDVSILRIDHFVRVVTAIKVKGMRFELTGAAIVHYAGKWLPGLIQNGGGFIDEASN  287

Query  1369  G------------------HLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKD  1244
                                H+I+   +  + +V          +R  +E+LI I+PP+KD
Sbjct  288   SSNSNSSSSSGGISWKGGLHMIVAGTKDDTPTVQAK------DQRMIIESLISIIPPQKD  341

Query  1243  SIPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVEL  1064
             S+ C+FLLRLLR+ NM+ V  A   ELEKR+  Q EQATL +L++PS++    T+ DV+L
Sbjct  342   SVSCSFLLRLLRMANMLKVAPALVTELEKRVGMQFEQATLADLLVPSYNKN-ETLFDVDL  400

Query  1063  VLRLVKRFIVSLEDQAAV-MRCSGSSSSGAPPLNLNLNL---IKVAKLVDDYLAEAAVDS  896
             V RL++ F+V  + +++   R + S  +       + N    ++VA+LVD YL E + D 
Sbjct  401   VQRLLEHFLVQEQTESSSPSRQTFSDKNMHDGTQRSANTSSKMRVARLVDSYLTEVSRDR  460

Query  895   NLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEA  716
             NL++++F  LA  +P  AR  DD LYR+ID+YLKAHP +S+ ERKR+C+++D +KLS +A
Sbjct  461   NLSLTKFQVLAEALPESARTCDDGLYRAIDSYLKAHPSLSEHERKRLCRVMDCQKLSIDA  520

Query  715   SIHAAQNERLPVRTVIQVLLSEQTKLSKQL----MRQLEWsggsfisasagasgGTCPRS  548
              +HAAQNERLP+R V+QVL SEQ K+S  L    +++   +    + ++        P+S
Sbjct  521   CMHAAQNERLPLRVVVQVLFSEQVKISNSLANNTLKESSEAQYQPMISNRKTLLEGTPQS  580

Query  547   pnppapgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKL  377
                               +K+D+NT+     E++ +K + L LQ    N+Q + +K+
Sbjct  581   FQEGW-----------ATAKKDINTLK---FELETVKAKYLELQNDMDNLQRKFDKM  623



>ref|XP_004504829.1| PREDICTED: root phototropism protein 3-like isoform X1 [Cicer 
arietinum]
Length=687

 Score =   252 bits (643),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 154/411 (37%), Positives = 233/411 (57%), Gaps = 33/411 (8%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             + WF+D  IL +D+FV+  + IK KG+R ELIG+ I HYA+KWLP L             
Sbjct  241   DWWFEDVSILRIDHFVRVTTAIKVKGMRFELIGAGIMHYATKWLPGLGNDAAIAVEETSI  300

Query  1369  G------------------HLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKD  1244
                                H+I+       +S  ++       +R  +E+LI I+PP+KD
Sbjct  301   NNGNNSSSSGSDGSWKGGLHMIVAAGTRDETSSLQAK-----DQRMVIESLISIIPPQKD  355

Query  1243  SIPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVEL  1064
             S+ C+FLLRLLR+ NM+ V  A   +LEKR+  Q EQA+L +L+IP +S +  T+ DV+L
Sbjct  356   SVSCSFLLRLLRMANMLKVAHALITDLEKRVGMQFEQASLNDLLIPCYSKS-ETMYDVDL  414

Query  1063  VLRLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTM  884
             V RL++ F+V  + + +      S S      +LN    +VA+LVD YL E + D NL++
Sbjct  415   VQRLLEHFLVQEQVEGSSPSRQQSLSDKLVGSSLNAK-ARVARLVDSYLTEVSRDRNLSL  473

Query  883   SQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHA  704
             ++F  LA  +P  AR +DD LYR+ID+YLKAHP +++ ERKR+C+++D +KLS +A +HA
Sbjct  474   TKFQVLAEALPESARTSDDGLYRAIDSYLKAHPTLTEHERKRLCRVMDCQKLSIDACMHA  533

Query  703   AQNERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapga  524
             AQNERLP+R V+QVL SEQ K+S  L         S       +       +      G 
Sbjct  534   AQNERLPIRVVVQVLFSEQVKISNALANN-----NSLKGGGVESQFQPIITNRKTLLEGT  588

Query  523   qqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLE  371
              Q  Q+    +K+D+NT+     E++ +K + L LQ    N+Q Q +K+++
Sbjct  589   PQSFQEGWSTAKKDINTLK---FELESVKTKYLELQHDMENLQKQFDKVMK  636



>ref|XP_009366303.1| PREDICTED: root phototropism protein 3 [Pyrus x bretschneideri]
 ref|XP_009366304.1| PREDICTED: root phototropism protein 3 [Pyrus x bretschneideri]
Length=674

 Score =   251 bits (642),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 157/415 (38%), Positives = 237/415 (57%), Gaps = 47/415 (11%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             + WF+D  IL + +FV+ ++ IK KG+R ELIG+ + HYASKWLP L   G         
Sbjct  228   DWWFEDVSILRIHHFVRVITAIKVKGMRFELIGAAMMHYASKWLPGLINEGTGTADEGSN  287

Query  1369  G---------------HLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIP  1235
                             H+I+   +  SSSV          +R  +E+LI I+PP+KDS+ 
Sbjct  288   SSNSTSNSSGSWKGGLHMILAGNKDESSSVQAK------DQRMIIESLISIIPPQKDSVS  341

Query  1234  CNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLR  1055
             C+FLLRLLR+ NM+ V  A   ELEKR+  Q EQATL +L+IPS+ + C T+ DV+LV R
Sbjct  342   CSFLLRLLRMANMLKVAPALVTELEKRVGMQFEQATLADLLIPSY-NKCETMYDVDLVQR  400

Query  1054  LVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNL-----IKVAKLVDDYLAEAAVDSNL  890
             L++ F+V  ++Q  +   S  S  G    +L  +      ++VA+LVD YL E + D +L
Sbjct  401   LLEHFLV--QEQTEISSPSQQSFPGKHYDDLQRSTGPNAKMRVARLVDSYLTEVSRDRSL  458

Query  889   TMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASI  710
             ++++F  LA  +P  AR  DD LYR++D+YLKAHP +S+ ERKR+C+++D +KLS +A +
Sbjct  459   SLTKFQVLAEALPESARICDDGLYRAVDSYLKAHPTLSEHERKRLCRVMDCQKLSIDACM  518

Query  709   HAAQNERLPVRTVIQVLLSEQTKLSKQL----MRQLEWsggsfisasagasgGTCPRSpn  542
             HAAQNERLP+R V+QVL  EQ K+S  L    +++        + ++        P+S  
Sbjct  519   HAAQNERLPLRVVVQVLFCEQVKISNALATSSLKEAGDFQYQPMVSNRKTLLEGTPQSFQ  578

Query  541   ppapgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKL  377
                             +K+D+NT+     E++ +K + L LQ    N+Q Q +K+
Sbjct  579   EGW-----------AAAKKDINTVK---FELESVKAKHLELQHDMENLQRQFDKM  619



>ref|XP_003545709.1| PREDICTED: root phototropism protein 3-like [Glycine max]
Length=672

 Score =   251 bits (641),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 153/415 (37%), Positives = 239/415 (58%), Gaps = 44/415 (11%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             + WF+DA IL +D+FV+ ++ IK KG+R EL+G+ I HYA+KWLP L             
Sbjct  228   DWWFEDASILRIDHFVRVITAIKVKGMRFELVGASIMHYATKWLPGLISDTAIPGDEASN  287

Query  1369  G-----------------HLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDS  1241
                               H+++   +  +SS+         ++R  +E+L+ I+PP+KDS
Sbjct  288   CSMSNSSSSGGSSWKGGLHMVVTGTKDDTSSLQAK------EQRMIIESLVSIIPPQKDS  341

Query  1240  IPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELV  1061
             + C+FLLRLLR+  M+ V  A   ELEKR+  Q EQATL +L+IPS+ +   T+ DV+LV
Sbjct  342   VSCSFLLRLLRMAIMLKVAPALVTELEKRVGMQFEQATLADLLIPSY-NKGETMYDVDLV  400

Query  1060  LRLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNL-IKVAKLVDDYLAEAAVDSNLTM  884
              RL++ FI+    +++       S      +   LN   +VA+LVD YL E + D NL++
Sbjct  401   QRLLEHFIIQEHTESSSPSRQSFSDKQHMGMGCILNAKARVARLVDSYLTEVSRDRNLSL  460

Query  883   SQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHA  704
             ++F  LA  +P  AR  DD LYR+ID+YLKAHP +S+ ERKR+C+++D +KLS +A +HA
Sbjct  461   TKFQVLAEALPESARTCDDGLYRAIDSYLKAHPTLSEHERKRLCRVMDCQKLSIDACLHA  520

Query  703   AQNERLPVRTVIQVLLSEQTKLSKQL----MRQLEWsggsfisasagasgGTCPRSpnpp  536
             AQNERLP+R V+QVL +EQ K+S  L    ++ +E    + ++       GT P+S    
Sbjct  521   AQNERLPLRVVVQVLFAEQVKISNALASSSVKDVESESHAMVTNRKTLLEGT-PQSFQEG  579

Query  535   apgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLE  371
                           +K+D+NT+     E++ +K + + LQ    ++Q Q +K+L+
Sbjct  580   WTA-----------AKKDINTLK---FELESVKAKYMELQNDMASLQKQFDKMLK  620



>ref|XP_004248794.1| PREDICTED: root phototropism protein 3-like [Solanum lycopersicum]
Length=674

 Score =   251 bits (641),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 154/414 (37%), Positives = 238/414 (57%), Gaps = 44/414 (11%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesi---  1379
             + WF+D  IL +D+FV+ ++ IK KG+R ELIG+++ HYA+KW+P L   G         
Sbjct  230   DWWFEDVSILRIDHFVRVITAIKVKGMRHELIGAVLMHYATKWIPGLIKEGSGSLDDCSN  289

Query  1378  ------------ekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIP  1235
                         + G H+I+        ++          +R  +E+LI I+P +KDS+ 
Sbjct  290   SSTSNGSSSSSWKGGLHMIVSGSREEVPTIQAK------DQRMIIESLISIIPQQKDSVS  343

Query  1234  CNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLR  1055
             C+FLLRLLR+ N++ V  A   ELEKR+  Q EQATL +L+IPS++ +  T+ DV+LV R
Sbjct  344   CSFLLRLLRMANLLKVAPALVTELEKRVGMQFEQATLADLLIPSYNKS-ETLYDVDLVQR  402

Query  1054  LVKRFIVSLEDQAAVMRCSGSSSSGAPPLN---LNLNL-IKVAKLVDDYLAEAAVDSNLT  887
             L++ F+V  + +++    S  S       N    NLN  ++VAKLVD YL E + D NL+
Sbjct  403   LLEHFLVQEQTESSSPSRSSFSDKHMHDANQRGANLNAKMRVAKLVDSYLTEVSRDRNLS  462

Query  886   MSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIH  707
             +++F  LA  +P  AR  DD LYR+ID+YLKAHP +S+ ERKR+C+++D +KLS +A +H
Sbjct  463   LTKFQVLAEALPESARTCDDGLYRAIDSYLKAHPTLSEHERKRLCRVMDCQKLSIDACMH  522

Query  706   AAQNERLPVRTVIQVLLSEQTKLSKQL----MRQLEWsggsfisasagasgGTCPRSpnp  539
             AAQNERLP+R V+QVL SEQ K+S  +    ++    S    + ++        P+S   
Sbjct  523   AAQNERLPLRVVVQVLFSEQVKISNAISSSSLKDAGESHYQPLVSNRKTLLEATPQSFQE  582

Query  538   papgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKL  377
                            +K+D+NT+     E+  +K + ++LQ    N+Q Q +K+
Sbjct  583   GW-----------TTAKKDINTLK---FELDTVKAKYVQLQNDMENLQKQFDKI  622



>ref|XP_006420843.1| hypothetical protein CICLE_v10004479mg [Citrus clementina]
 gb|ESR34083.1| hypothetical protein CICLE_v10004479mg [Citrus clementina]
Length=604

 Score =   249 bits (636),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 159/426 (37%), Positives = 241/426 (57%), Gaps = 67/426 (16%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPEL-------------  1409
             + WF+D  IL +D+FV+ ++ IK KG+R ELIG+ I HYA+KWL  L             
Sbjct  158   DWWFEDVSILRIDHFVRVITAIKVKGMRFELIGAAIMHYAAKWLTGLIRESSGSADEISS  217

Query  1408  ---TggggseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSI  1238
                +   GS  S + G H+I+   +    +V          +R  +E+LI I+PP+KDS+
Sbjct  218   CSASNSNGSCSSWKGGLHMIVAGMKDDPPTVQAK------DQRMIIESLISIIPPQKDSV  271

Query  1237  PCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVL  1058
              C+FLLRLLR+ NM+ V  A   ELEKR+  Q EQATL +L+IP++S    T+ DV+LV 
Sbjct  272   SCSFLLRLLRMANMLKVAPALVTELEKRVGMQFEQATLADLLIPAYSKG-ETLYDVDLVQ  330

Query  1057  RLVKRFIVSLEDQA---------------AVMRCSGSSSSGAPPLNLNLNLIKVAKLVDD  923
             RL++ F+V  + ++               A  R +G+S+            ++VA+LVD 
Sbjct  331   RLLEHFLVQEQTESSSPSRQSFSDKHMYDASQRGNGTSAK-----------MRVARLVDG  379

Query  922   YLAEAAVDSNLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLI  743
             YL E A D NL++++F  LA  +P  AR  DD LYR+ID+YLKAHP +S+ ERKR+C+++
Sbjct  380   YLTEVARDRNLSLTKFQVLAEALPESARTCDDGLYRAIDSYLKAHPTLSEHERKRLCRVM  439

Query  742   DSRKLSAEASIHAAQNERLPVRTVIQVLLSEQTKLSKQL----MRQLEWsggsfisasag  575
             D +KLS +A +HAAQNERLP+R V+QVL SEQ K+S  +    +++   S    + ++  
Sbjct  440   DCQKLSIDACMHAAQNERLPLRIVVQVLFSEQIKISNAMANSTLKEAGESQYQPMISNRK  499

Query  574   asgGTCPRSpnppapgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQ  395
             +     P+S                  +K+D+NT+     E++ +K + L LQ     +Q
Sbjct  500   SLLEATPQSFQEGW-----------ATAKKDINTLK---FELESVKAKYLELQNDMETLQ  545

Query  394   AQIEKL  377
              Q +KL
Sbjct  546   RQFDKL  551



>gb|KHN46271.1| Root phototropism protein 3 [Glycine soja]
Length=672

 Score =   250 bits (639),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 156/416 (38%), Positives = 236/416 (57%), Gaps = 46/416 (11%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggs-------  1391
             + WF+D  IL +D+FV+ ++ IK KG+R ELIG+ I HYA KWLP L     S       
Sbjct  228   DWWFEDVSILRIDHFVRVITAIKVKGMRFELIGAGIMHYAIKWLPGLMNKDTSIPGEEGS  287

Query  1390  -----------eesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKD  1244
                          S + G H+I+      +S++          +R  +E+LI I+PP+KD
Sbjct  288   NSSTSNSISSSGGSWKGGLHMIVAGPRDDTSTLQAK------DQRMIIESLISIIPPQKD  341

Query  1243  SIPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVEL  1064
             S+ C+FLLRLLR+ NM+ V  A   ELEKR+  Q EQATL +L+IP ++    T  DV+L
Sbjct  342   SVSCSFLLRLLRMANMLKVAPALITELEKRVGMQFEQATLADLLIPCYNKN-ETTYDVDL  400

Query  1063  VLRLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTM  884
             V RL++ F+V  +++++               N+N    +VA+LVD YL E + D NL++
Sbjct  401   VQRLLEHFLVQEQNESSSPSRPPFPDKHVSS-NINAK-TRVARLVDSYLTEVSRDRNLSL  458

Query  883   SQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHA  704
             ++F  LA  +P  AR +DD LYR+ID+YLKAHP +++ ERKR+C+++D +KLS +A +HA
Sbjct  459   TKFQVLAEALPESARTSDDGLYRAIDSYLKAHPTLTEHERKRLCRVMDCQKLSIDACMHA  518

Query  703   AQNERLPVRTVIQVLLSEQTKLSKQL-----MRQLEWsggsfisasagasgGTCPRSpnp  539
             AQNERLP+R V+QVL SEQ K+S  L     +++   S    +  +        P+S   
Sbjct  519   AQNERLPLRVVVQVLFSEQVKISNALANNGSLKEGAESHYQPMIPNRKTLLEGTPQSFQE  578

Query  538   papgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLE  371
                            +K+D+NT+     E++ +K + L LQ    N+Q   +KLL+
Sbjct  579   GWTA-----------AKKDINTLK---FELETVKTKYLELQNDMENLQKHFDKLLK  620



>ref|XP_009608443.1| PREDICTED: root phototropism protein 3 isoform X1 [Nicotiana 
tomentosiformis]
Length=674

 Score =   250 bits (639),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 144/328 (44%), Positives = 204/328 (62%), Gaps = 27/328 (8%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPEL-------------  1409
             + WF+D  IL +D+FV+ ++ IK KG+R ELIG+ I  YA+KWLP L             
Sbjct  229   DWWFEDVSILRIDHFVRVITAIKVKGMRHELIGAAIMQYAAKWLPGLIREGSGLADDGSN  288

Query  1408  ---TggggseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSI  1238
                +  G S  S   G H+I+        SV          +R  VE+LI I+P  KDS+
Sbjct  289   ISNSINGTSSGSWRGGLHMIVAGSGDEVPSVQAK------DQRMIVESLISIIPQHKDSV  342

Query  1237  PCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVL  1058
              C+FLLRLLR+ NM+ V  A   ELEKR+  Q EQATL +L+IPS++ +  T+ D++LV 
Sbjct  343   SCSFLLRLLRMANMLKVAPALITELEKRVGMQFEQATLADLLIPSYNKS-ETMYDIDLVQ  401

Query  1057  RLVKRFIVSLE-DQAAVMRCSGSSSSGAPPLNLNLNL---IKVAKLVDDYLAEAAVDSNL  890
             RL++ FIV  + + ++  R S S       +    NL   ++VA+LVD YL E + D NL
Sbjct  402   RLLEHFIVQEQTENSSPSRYSFSDKHMHDGIQRGTNLNAKMRVARLVDSYLTEVSRDRNL  461

Query  889   TMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASI  710
             ++++F  LA  +P  AR  DD LYR+ID+YLKAHP +S+ ERKR+C+++D +KLS +A +
Sbjct  462   SLTKFQVLAEALPDSARTCDDGLYRAIDSYLKAHPTLSEHERKRLCRVMDCQKLSVDACM  521

Query  709   HAAQNERLPVRTVIQVLLSEQTKLSKQL  626
             HAAQNERLP+R V+QVL SEQ K+S  +
Sbjct  522   HAAQNERLPLRVVVQVLFSEQVKISNAM  549



>emb|CBI38224.3| unnamed protein product [Vitis vinifera]
Length=577

 Score =   248 bits (633),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 149/402 (37%), Positives = 223/402 (55%), Gaps = 79/402 (20%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             + WF+D  IL +D+FV+ ++ IK KG+R ELIG+ I  YA+KWLP              G
Sbjct  189   DWWFEDVSILRIDHFVRVITAIKVKGMRFELIGASIMQYATKWLP-------------GG  235

Query  1369  GHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMVG  1190
               +++   +    +V          +R  +E+LI I+PP+KDS+ C+FLLRLLR+ NM+ 
Sbjct  236   LQMVVAGAKDDPPTVQAK------DQRMIIESLISIIPPQKDSVSCSFLLRLLRMANMLK  289

Query  1189  VEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAAV  1010
             V  A   ELEKR+  Q EQATL +L+IPS++ +  T+ DV+LV RL++ F+V  +     
Sbjct  290   VAPALVTELEKRVGMQFEQATLADLLIPSYNKS-ETLYDVDLVQRLLEHFLVQEQ-----  343

Query  1009  MRCSGSSSSGAPPL------------NLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIAL  866
                + SSS    P             N +   ++VA+LVD YL E + D NL++++F  L
Sbjct  344   ---TDSSSPSRQPFPEKHLYEGTQRGNGSNAKMRVARLVDSYLTEVSRDRNLSLTKFQVL  400

Query  865   AAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERL  686
             A  +P  AR  DD LYR+ID+YLKAHP +S+ ERKR+C+++D +KLS +A +HAAQNERL
Sbjct  401   AEALPESARTCDDGLYRAIDSYLKAHPTLSEHERKRLCRVMDCQKLSIDACMHAAQNERL  460

Query  685   PVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapgaqqqqqd  506
             P+R V+QVL SEQ K++  +                                        
Sbjct  461   PLRIVVQVLFSEQVKINNAIANN------------------------------------T  484

Query  505   PRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEK  380
              +  +K+D+NT+     E++ +K + L LQ    N+Q Q +K
Sbjct  485   LKEAAKKDINTLK---FELESMKAKYLELQNDMENLQRQFDK  523



>ref|XP_009631478.1| PREDICTED: root phototropism protein 3-like [Nicotiana tomentosiformis]
Length=673

 Score =   249 bits (637),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 156/414 (38%), Positives = 235/414 (57%), Gaps = 44/414 (11%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             + WF+D  IL +D+FV+ ++ IK KG+R ELIG+ + HYA+KWLP L   G         
Sbjct  229   DWWFEDVSILRIDHFVRVITAIKVKGMRHELIGAALMHYAAKWLPGLIKEGSGSSDEGSN  288

Query  1369  G---------------HLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIP  1235
                             H+I+        SV          +R  +E+LI I+P +KDS+ 
Sbjct  289   SNNSNGSSSNSWKGGLHMIVSGTRDEVPSVQAK------DQRMIIESLISIIPQQKDSVS  342

Query  1234  CNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLR  1055
             C+FLLRLLR+ N++ V  A   ELEKR+  Q EQATL +L+IPS++ T  T+ DV+LV R
Sbjct  343   CSFLLRLLRMANLLKVAPALVTELEKRVGMQFEQATLADLLIPSYNKT-DTLYDVDLVQR  401

Query  1054  LVKRFIVSLEDQAAVMRCSGSSSSGAPPLNL---NLNL-IKVAKLVDDYLAEAAVDSNLT  887
             L++ F+V  + + +    S  S       N    NLN  ++VA+LVD YL E + D NL+
Sbjct  402   LLEHFLVQEQTEGSSPSRSSFSDKHMHDGNQRGSNLNAKMRVARLVDSYLTEVSRDRNLS  461

Query  886   MSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIH  707
             +++F  LA  +P  AR  DD LYR+ID+YLKAHP +S+ ERKR+C+++D +KLS +A +H
Sbjct  462   LTKFQVLAEALPESARTCDDGLYRAIDSYLKAHPTLSEHERKRLCRVMDCQKLSIDACMH  521

Query  706   AAQNERLPVRTVIQVLLSEQTKLSKQL----MRQLEWsggsfisasagasgGTCPRSpnp  539
             AAQNERLP+R V+QVL SEQ K+S  +    ++    S    + ++  +     P+S   
Sbjct  522   AAQNERLPLRVVVQVLFSEQVKISNAISNNSLKDAGDSHYQPLVSNRKSLLEATPQSFQE  581

Query  538   papgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKL  377
                            +K+D+NT+     E++ +K + L LQ    ++Q Q +K+
Sbjct  582   GW-----------TTAKKDINTLK---FELETVKTKYLELQNDMDSLQRQFDKI  621



>gb|KDO42273.1| hypothetical protein CISIN_1g005842mg [Citrus sinensis]
Length=674

 Score =   249 bits (637),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 156/420 (37%), Positives = 234/420 (56%), Gaps = 55/420 (13%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             + WF+D  IL +D+FV+ ++ IK KG+R ELIG+ I HYA+KWL  L             
Sbjct  228   DWWFEDVSILRIDHFVRVVTAIKVKGMRFELIGAAIMHYAAKWLTGLIRESSGTADEISS  287

Query  1369  GHLIIKFeesssssvaesvsaSWMK----------KRFFVETLIGILPPEKDSIPCNFLL  1220
                       SS      +  + MK          +R  +E+LI I+PP+KDS+ C+FLL
Sbjct  288   YSASNSNGSCSSWKGGLHMIVAGMKDDPPTVQAKDQRMIIESLISIIPPQKDSVSCSFLL  347

Query  1219  RLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRF  1040
             RLLR+ NM+ V  A   ELEKR+  Q EQATL +L+IP++S    T+ DV+LV RL++ F
Sbjct  348   RLLRMANMLKVAPALVTELEKRVGMQFEQATLADLLIPAYSKG-ETLYDVDLVQRLLEHF  406

Query  1039  IVSLEDQA---------------AVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAA  905
             +V  + ++               A  R +G+S+            ++VA+LVD YL E A
Sbjct  407   LVQEQTESSSPSRQSFSDKHMYDASQRGNGTSAK-----------MRVARLVDGYLTEVA  455

Query  904   VDSNLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLS  725
              D NL++++F  LA  +P  AR  DD LYR+ID+YLKAHP +S+ ERKR+C+++D +KLS
Sbjct  456   RDRNLSLTKFQVLAEALPESARTCDDGLYRAIDSYLKAHPTLSEHERKRLCRVMDCQKLS  515

Query  724   AEASIHAAQNERLPVRTVIQVLLSEQTKLSKQL----MRQLEWsggsfisasagasgGTC  557
              +A +HAAQNERLP+R V+QVL SEQ K+S  +    +++   S    + ++  +     
Sbjct  516   IDACMHAAQNERLPLRIVVQVLFSEQIKISNAMANSTLKEAGESQYQPMISNRKSLLEAT  575

Query  556   PRSpnppapgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKL  377
             P+S                  +K+D+NT+     E++ +K + L LQ     +Q Q +KL
Sbjct  576   PQSFQEGW-----------ATAKKDINTLK---FELESVKAKYLELQNDMETLQRQFDKL  621



>ref|XP_009803877.1| PREDICTED: root phototropism protein 3-like [Nicotiana sylvestris]
 ref|XP_009803878.1| PREDICTED: root phototropism protein 3-like [Nicotiana sylvestris]
Length=673

 Score =   249 bits (637),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 156/414 (38%), Positives = 235/414 (57%), Gaps = 44/414 (11%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             + WF+D  IL +D+FV+ ++ IK KG+R ELIG+ + HYA+KWLP L   G         
Sbjct  229   DWWFEDVSILRIDHFVRVITAIKVKGMRHELIGAALMHYAAKWLPGLIKEGSGSPDEGSN  288

Query  1369  G---------------HLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIP  1235
                             H+I+        SV          +R  +E+LI I+P +KDS+ 
Sbjct  289   SNNSNGSSSNSWKGGLHMIVSGTRDEVPSVQAK------DQRMIIESLISIIPQQKDSVS  342

Query  1234  CNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLR  1055
             C+FLLRLLR+ N++ V  A   ELEKR+  Q EQATL +L+IPS++ T  T+ DV+LV R
Sbjct  343   CSFLLRLLRMANLLKVAPALVTELEKRVGMQFEQATLADLLIPSYNKT-DTLYDVDLVQR  401

Query  1054  LVKRFIVSLEDQAAVMRCSGSSSSGAPPLNL---NLNL-IKVAKLVDDYLAEAAVDSNLT  887
             L++ F+V  + + +    S  S       N    NLN  ++VA+LVD YL E + D NL+
Sbjct  402   LLEHFLVQEQTEGSSPSRSSFSDKHMHDGNQRGSNLNAKMRVARLVDSYLTEVSRDRNLS  461

Query  886   MSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIH  707
             +++F  LA  +P  AR  DD LYR+ID+YLKAHP +S+ ERKR+C+++D +KLS +A +H
Sbjct  462   LTKFQVLAEALPESARTCDDGLYRAIDSYLKAHPTLSEHERKRLCRVMDCQKLSIDACMH  521

Query  706   AAQNERLPVRTVIQVLLSEQTKLSKQL----MRQLEWsggsfisasagasgGTCPRSpnp  539
             AAQNERLP+R V+QVL SEQ K+S  +    ++    S    + ++  +     P+S   
Sbjct  522   AAQNERLPLRVVVQVLFSEQVKISNAISNNSLKDAGDSHYQPLVSNRKSLLEATPQSFQE  581

Query  538   papgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKL  377
                            +K+D+NT+     E++ +K + L LQ    ++Q Q +K+
Sbjct  582   GW-----------TTAKKDINTLK---FELETVKTKYLELQNDMDSLQRQFDKI  621



>ref|XP_006359786.1| PREDICTED: root phototropism protein 3-like [Solanum tuberosum]
Length=676

 Score =   249 bits (636),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 154/414 (37%), Positives = 237/414 (57%), Gaps = 43/414 (10%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesi---  1379
             + WF+D  IL +D+FV+ ++ IK KG+R ELIG+++ HYA+KW+P L   G         
Sbjct  231   DWWFEDVSILRIDHFVRVITAIKVKGMRHELIGAVLMHYATKWIPGLIKEGAGSLDDCNN  290

Query  1378  ------------ekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIP  1235
                         + G H+I+           ++       +R  +E+LI I+P +KDS+ 
Sbjct  291   SSISNSSSSSSWKGGLHMIVSGSRDEVPPTVQAK-----DQRMIIESLISIIPQQKDSVS  345

Query  1234  CNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLR  1055
             C+FLLRLLR+ N++ V  A   ELEKR+  Q EQA L +L+IPS++ +  T+ DV+LV R
Sbjct  346   CSFLLRLLRMANLLKVAPALVTELEKRVGMQFEQAMLADLLIPSYNKS-ETLYDVDLVQR  404

Query  1054  LVKRFIVSLEDQAAVMRCSGSSSSGAPPLN---LNLNL-IKVAKLVDDYLAEAAVDSNLT  887
             L++ F+V  + +++    S  S       N    NLN  ++VAKLVD YL E + D NL+
Sbjct  405   LLEHFLVQEQTESSSPSRSSFSEKHMHDANQRGTNLNAKMRVAKLVDSYLTEVSRDRNLS  464

Query  886   MSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIH  707
             +++F  LA  +P  AR  DD LYR+ID+YLKAHP +S+ ERKR+C+++D +KLS +A +H
Sbjct  465   LTKFQVLAEALPESARTCDDGLYRAIDSYLKAHPTLSEHERKRLCRVMDCQKLSIDACMH  524

Query  706   AAQNERLPVRTVIQVLLSEQTKLSKQL----MRQLEWsggsfisasagasgGTCPRSpnp  539
             AAQNERLP+R V+QVL SEQ K+S  +    ++    S    + ++        P+S   
Sbjct  525   AAQNERLPLRVVVQVLFSEQVKISNAISSSSLKDAGESHYQPLVSNRKTLLEATPQSFQE  584

Query  538   papgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKL  377
                            +K+D+NT+     E+  +K + L+LQ    N+Q Q +K+
Sbjct  585   GW-----------TTAKKDINTLK---FELDSVKAKYLQLQNDMENLQKQFDKI  624



>gb|KHG29755.1| Root phototropism 3 -like protein [Gossypium arboreum]
Length=671

 Score =   249 bits (636),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 163/407 (40%), Positives = 232/407 (57%), Gaps = 32/407 (8%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTgg----------  1400
             + WF+D  IL +D+FV+ ++ IK KG+R ELIG+ I HYA+KWLP L             
Sbjct  228   DWWFEDVSILRIDHFVRVITAIKVKGMRFELIGAAIMHYAAKWLPCLIQDGELQADDMSI  287

Query  1399  ggseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLL  1220
                  S + G H+II   +  + S+          +R  VE+LI ILPP+KDS+ C+FLL
Sbjct  288   SSHSNSWKGGFHMIIPGTKDDNPSIQTK------DQRTIVESLISILPPQKDSVSCSFLL  341

Query  1219  RLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRF  1040
             RLLR  NM+ V  A   ELEKR+  QLEQATL +L+IP+++ +  T  DV+LV RL++ F
Sbjct  342   RLLRAANMLKVAPALVTELEKRVGMQLEQATLADLLIPNYNRS-ETSYDVDLVQRLLEHF  400

Query  1039  IVSLEDQAAVMRCSGSSS------SGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQ  878
              V  +  +     S  S        G    N      +VA+LVD YL E + D NL M++
Sbjct  401   FVQEQTDSLSPSPSRRSFSDKQMYEGTQRGNNPNPKSRVARLVDSYLTEVSRDRNLLMTK  460

Query  877   FIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQ  698
             F  LA  +P  AR  DD LYR+ID+YLKAHP +S+ ERKR+C+++D +KLS +A +HAAQ
Sbjct  461   FQVLAEALPESARTCDDGLYRAIDSYLKAHPTLSEHERKRLCRVMDCQKLSVDACMHAAQ  520

Query  697   NERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapgaqq  518
             NERLP+R V+QVL SEQ K+S  L   +       +   A         +      G  Q
Sbjct  521   NERLPLRVVVQVLFSEQVKISNTLANAI------TLKDPAETRYQPLITNRKTLLEGTPQ  574

Query  517   qqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKL  377
               Q+    +K+D+NT+     E+  +K + ++LQ +  N+Q Q EK+
Sbjct  575   SFQEGWVTAKKDINTLK---FELDGVKSKHVQLQKEMENLQRQFEKM  618



>ref|XP_006420844.1| hypothetical protein CICLE_v10004479mg [Citrus clementina]
 gb|ESR34084.1| hypothetical protein CICLE_v10004479mg [Citrus clementina]
Length=674

 Score =   249 bits (636),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 159/426 (37%), Positives = 241/426 (57%), Gaps = 67/426 (16%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPEL-------------  1409
             + WF+D  IL +D+FV+ ++ IK KG+R ELIG+ I HYA+KWL  L             
Sbjct  228   DWWFEDVSILRIDHFVRVITAIKVKGMRFELIGAAIMHYAAKWLTGLIRESSGSADEISS  287

Query  1408  ---TggggseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSI  1238
                +   GS  S + G H+I+   +    +V          +R  +E+LI I+PP+KDS+
Sbjct  288   CSASNSNGSCSSWKGGLHMIVAGMKDDPPTVQAK------DQRMIIESLISIIPPQKDSV  341

Query  1237  PCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVL  1058
              C+FLLRLLR+ NM+ V  A   ELEKR+  Q EQATL +L+IP++S    T+ DV+LV 
Sbjct  342   SCSFLLRLLRMANMLKVAPALVTELEKRVGMQFEQATLADLLIPAYSKG-ETLYDVDLVQ  400

Query  1057  RLVKRFIVSLEDQA---------------AVMRCSGSSSSGAPPLNLNLNLIKVAKLVDD  923
             RL++ F+V  + ++               A  R +G+S+            ++VA+LVD 
Sbjct  401   RLLEHFLVQEQTESSSPSRQSFSDKHMYDASQRGNGTSAK-----------MRVARLVDG  449

Query  922   YLAEAAVDSNLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLI  743
             YL E A D NL++++F  LA  +P  AR  DD LYR+ID+YLKAHP +S+ ERKR+C+++
Sbjct  450   YLTEVARDRNLSLTKFQVLAEALPESARTCDDGLYRAIDSYLKAHPTLSEHERKRLCRVM  509

Query  742   DSRKLSAEASIHAAQNERLPVRTVIQVLLSEQTKLSKQL----MRQLEWsggsfisasag  575
             D +KLS +A +HAAQNERLP+R V+QVL SEQ K+S  +    +++   S    + ++  
Sbjct  510   DCQKLSIDACMHAAQNERLPLRIVVQVLFSEQIKISNAMANSTLKEAGESQYQPMISNRK  569

Query  574   asgGTCPRSpnppapgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQ  395
             +     P+S                  +K+D+NT+     E++ +K + L LQ     +Q
Sbjct  570   SLLEATPQSFQEGW-----------ATAKKDINTLK---FELESVKAKYLELQNDMETLQ  615

Query  394   AQIEKL  377
              Q +KL
Sbjct  616   RQFDKL  621



>ref|XP_004952704.1| PREDICTED: coleoptile phototropism protein 1-like [Setaria italica]
Length=727

 Score =   250 bits (638),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 144/339 (42%), Positives = 203/339 (60%), Gaps = 33/339 (10%)
 Frame = -3

Query  1558  PMGECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTgggg-----  1394
             P  + WF+D  +L +D+FV+ ++ IK KG+R +LIG+ ITHYASKWLP LT  G      
Sbjct  248   PPADWWFEDVSVLRIDHFVRVVTAIKVKGMRFDLIGAAITHYASKWLPGLTKDGPHGGAV  307

Query  1393  ----seesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNF  1226
                 ++ S   G H+II          A + +    ++R  VE+LI I PP++DS+ C F
Sbjct  308   DEPWAQASPGGGLHMIIAGGGGKDDIAASAPAR---EQRMVVESLISITPPQRDSVSCGF  364

Query  1225  LLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVK  1046
             LLRLLR+  M+    A   ELEKR+  QLEQA L +L+IPS+     T  DV+LV RLV+
Sbjct  365   LLRLLRLAIMLKAAPALVTELEKRVGMQLEQAALADLLIPSYGR-ADTAYDVDLVQRLVE  423

Query  1045  RFIVSLEDQAAVMRCSGSSSSGAPPL-------------------NLNLNLIKVAKLVDD  923
              F+V  E  A +   S      +PPL                          +VA+L+D 
Sbjct  424   HFLVQ-EQTAELASSSPGRGEPSPPLPPEYYGARAAAAAAPSAAAAGLNAKARVARLLDS  482

Query  922   YLAEAAVDSNLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLI  743
             YL+E + D NL++++F  LA  +P  AR  DD LYR++D+YLKAHP +++ ERKR+C+++
Sbjct  483   YLSEVSRDRNLSLTKFQVLAESLPESARTCDDGLYRAVDSYLKAHPTLTEHERKRLCRVM  542

Query  742   DSRKLSAEASIHAAQNERLPVRTVIQVLLSEQTKLSKQL  626
             D +KLS +A +HAAQNERLP+R V+QVL SEQ K+S  L
Sbjct  543   DCQKLSMDACMHAAQNERLPLRVVVQVLFSEQVKISNAL  581



>ref|XP_002970451.1| hypothetical protein SELMODRAFT_93693 [Selaginella moellendorffii]
 gb|EFJ28581.1| hypothetical protein SELMODRAFT_93693 [Selaginella moellendorffii]
Length=655

 Score =   248 bits (634),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 135/308 (44%), Positives = 198/308 (64%), Gaps = 21/308 (7%)
 Frame = -3

Query  1543  WFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekgGH  1364
             WF+D C+L +D+F K L+ IKAKG++ EL+G++I  YA KW+P L+ G            
Sbjct  248   WFEDVCMLCIDHFTKVLTAIKAKGMKSELVGAVIMCYALKWIPTLSNGCHESSKTG----  303

Query  1363  LIIKFeesssssvaesvsaSWMKKR--FFVETLIGILPPEKDSIPCNFLLRLLRIGNMVG  1190
                +   +SS ++      +W++ R    VE+++G+LP +K+S+ C FLL++LRI +M+ 
Sbjct  304   ---RAVATSSPAIVTKEDFTWLQARSKLVVESMVGLLPGQKNSVSCGFLLQMLRIASMLN  360

Query  1189  VEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLE----D  1022
                  + ELEKRI+ QLEQATL +L+IPS  H   T  DV LV RLV+ F+   E    D
Sbjct  361   ASGPCKVELEKRIAIQLEQATLGDLLIPSAPHVSDTRYDVGLVQRLVEYFLAHEEETSPD  420

Query  1021  QAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHA  842
             ++       S SSG+         +KVAKL+D YLAE A D  L +++F ALA  +P ++
Sbjct  421   RSPDAETPSSHSSGSK--------MKVAKLLDSYLAEVAHDPQLPLTKFQALADALPVYS  472

Query  841   RPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQV  662
             R   D LYR+ID YLKAHP  ++++RKR+C+++D ++LS+EA +HA+QNERLP+RTV+QV
Sbjct  473   RACHDGLYRAIDMYLKAHPTATEQDRKRLCRIMDCQRLSSEARLHASQNERLPLRTVVQV  532

Query  661   LLSEQTKL  638
             L SE  KL
Sbjct  533   LFSEHLKL  540



>emb|CAN60915.1| hypothetical protein VITISV_002200 [Vitis vinifera]
Length=665

 Score =   248 bits (634),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 152/399 (38%), Positives = 234/399 (59%), Gaps = 24/399 (6%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             + WF+D  IL +D+FV+ ++ IK KG+R ELIG+ I  YA+KWLP +   G +  +   G
Sbjct  228   DWWFEDVSILRIDHFVRVITAIKVKGMRFELIGASIMQYATKWLPGMGDEGSNSSNGSSG  287

Query  1369  GHLIIKFeesssssvaesvsaSWMK-KRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMV  1193
                     +   +   +       K +R  +E+LI I+PP+KDS+ C+FLLRLLR+ NM+
Sbjct  288   SSSWKGGLQMVVAGAKDDPPTVQAKDQRMIIESLISIIPPQKDSVSCSFLLRLLRMANML  347

Query  1192  GVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLE-DQA  1016
              V  A   ELEKR+  Q EQATL +L+IPS++ +  T+ DV+LV RL++ F+V  + D +
Sbjct  348   KVAPALVTELEKRVGMQFEQATLADLLIPSYNKS-ETLYDVDLVQRLLEHFLVQEQTDSS  406

Query  1015  AVMRCSGSSS---SGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTH  845
             +  R          G    N +   ++VA+LVD YL E + D NL++++F  LA  +P  
Sbjct  407   SPSRQPFPEKHLYEGTQRGNGSNAKMRVARLVDSYLTEVSRDRNLSLTKFQVLAEALPES  466

Query  844   ARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQ  665
             AR  DD LYR+ID+YLKAHP +S+ ERKR+C+++D +KLS +A +HAAQNERLP+R V+Q
Sbjct  467   ARTCDDGLYRAIDSYLKAHPTLSEHERKRLCRVMDCQKLSIDACMHAAQNERLPLRIVVQ  526

Query  664   VLLSEQTKLSKQL----MRQLEWsggsfisasagasgGTCPRSpnppapgaqqqqqdPRC  497
             VL SEQ K++  +    +++   S    + ++        P+S                 
Sbjct  527   VLFSEQVKINNAIANNTLKEAGESQYQPMISNRKTLLEGTPQSFQEGW-----------T  575

Query  496   MSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEK  380
              +K+D+NT+     E++ +K + L LQ    N+Q Q +K
Sbjct  576   AAKKDINTLK---FELESMKAKYLELQNDMENLQRQFDK  611



>ref|XP_006494598.1| PREDICTED: root phototropism protein 3-like isoform X1 [Citrus 
sinensis]
 ref|XP_006494599.1| PREDICTED: root phototropism protein 3-like isoform X2 [Citrus 
sinensis]
Length=674

 Score =   249 bits (635),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 155/420 (37%), Positives = 234/420 (56%), Gaps = 55/420 (13%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             + WF+D  IL +D+FV+ ++ IK KG+R ELIG+ I HYA+KWL  L             
Sbjct  228   DWWFEDVSILRIDHFVRVVTAIKVKGMRFELIGAAIMHYAAKWLTGLIRESSGTADEISS  287

Query  1369  GHLIIKFeesssssvaesvsaSWMK----------KRFFVETLIGILPPEKDSIPCNFLL  1220
                       SS      +  + MK          +R  +E+LI I+PP+KDS+ C+FLL
Sbjct  288   YSASNSNGSCSSWKGGLHMIVAGMKDDPPTVQAKDQRMIIESLISIIPPQKDSVSCSFLL  347

Query  1219  RLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRF  1040
             RLLR+ NM+ V  A   ELEKR+  Q EQATL +L+IP++ +   T+ DV+LV RL++ F
Sbjct  348   RLLRMANMLKVAPALVTELEKRVGMQFEQATLADLLIPAY-NKGETLYDVDLVQRLLEHF  406

Query  1039  IVSLEDQA---------------AVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAA  905
             +V  + ++               A  R +G+S+            ++VA+LVD YL E A
Sbjct  407   LVQEQTESSSPSRQSFSDKHMYDASQRGNGTSAK-----------MRVARLVDGYLTEVA  455

Query  904   VDSNLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLS  725
              D NL++++F  LA  +P  AR  DD LYR+ID+YLKAHP +S+ ERKR+C+++D +KLS
Sbjct  456   RDRNLSLTKFQVLAEALPESARTCDDGLYRAIDSYLKAHPTLSEHERKRLCRVMDCQKLS  515

Query  724   AEASIHAAQNERLPVRTVIQVLLSEQTKLSKQL----MRQLEWsggsfisasagasgGTC  557
              +A +HAAQNERLP+R V+QVL SEQ K+S  +    +++   S    + ++  +     
Sbjct  516   IDACMHAAQNERLPLRIVVQVLFSEQIKISNAMANSTLKEAGESQYQPMISNRKSLLEAT  575

Query  556   PRSpnppapgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKL  377
             P+S                  +K+D+NT+     E++ +K + L LQ     +Q Q +KL
Sbjct  576   PQSFQEGW-----------ATAKKDINTLK---FELESVKAKYLELQNDMETLQRQFDKL  621



>gb|EYU18437.1| hypothetical protein MIMGU_mgv1a002339mg [Erythranthe guttata]
Length=686

 Score =   249 bits (635),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 139/327 (43%), Positives = 205/327 (63%), Gaps = 24/327 (7%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             + WF+D  IL +D+FV+ ++ IK KG+R ELIG+ ITHYA+KWLP L   GG       G
Sbjct  237   DWWFEDVSILRIDHFVRVITAIKVKGMRYELIGAAITHYANKWLPNLAKDGGDGGGDGVG  296

Query  1369  G-----------HLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFL  1223
             G           H+II    +   S   +   +   +R  VE+LI I+PP++D + C+FL
Sbjct  297   GGGDSWQKGGGLHMIIAAGNNKDESFLPAAMQA-KDQRMIVESLISIIPPQRDCVSCSFL  355

Query  1222  LRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKR  1043
             LRLL+  NM  V  A   ELEKR+  QLEQA L +L+IP +S + G + DV+LV RL++ 
Sbjct  356   LRLLKTANMSKVAPALVTELEKRVGMQLEQAALADLLIPCYSKSEGLMYDVDLVQRLLEH  415

Query  1042  FIVSLEDQAAV--------MRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLT  887
             F+V  + + +         M+    +  G   +NL+  L +VA+L+D YL E + D NL+
Sbjct  416   FLVQEQTEGSSPSRQSFSEMKMYDGAQRG---VNLSAKL-RVARLLDGYLTEVSRDRNLS  471

Query  886   MSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIH  707
             +++F  LA  +P  +R   D LYR++D+YLKAHP +++ ERKR+C+++D +KLS +A +H
Sbjct  472   LTKFQVLAEALPESSRSCHDGLYRAVDSYLKAHPTLTEHERKRLCRVMDCQKLSIDACMH  531

Query  706   AAQNERLPVRTVIQVLLSEQTKLSKQL  626
             AAQNERLP+R V+QVL SEQ K+S  +
Sbjct  532   AAQNERLPLRIVVQVLFSEQVKISNAI  558



>ref|XP_006584970.1| PREDICTED: root phototropism protein 3-like [Glycine max]
Length=672

 Score =   248 bits (634),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 154/416 (37%), Positives = 236/416 (57%), Gaps = 46/416 (11%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggs-------  1391
             + WF+D  IL +D+FV+ ++ IK KG+R E+IG+ I HYA KWLP L     S       
Sbjct  228   DWWFEDVSILRIDHFVRVITAIKVKGMRFEMIGAGIMHYAIKWLPGLMNKDTSIPGEEGS  287

Query  1390  -----------eesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKD  1244
                          S + G H+I+      +S++          +R  +E+LI I+PP+KD
Sbjct  288   NSSTSNSISSSGGSWKGGLHMIVAGPRDDTSTLQAK------DQRMIIESLISIIPPQKD  341

Query  1243  SIPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVEL  1064
             S+ C+FLLRLLR+ NM+ V  A   ELEKR+  Q EQATL +L+IP ++    T  DV+L
Sbjct  342   SVSCSFLLRLLRMANMLKVAPALITELEKRVGMQFEQATLADLLIPCYNKN-ETTYDVDL  400

Query  1063  VLRLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTM  884
             V RL++ F+V  +++++               N+N    +VA+LVD YL E + D NL++
Sbjct  401   VQRLLEHFLVQEQNESSSPSRPPFPDKHVSS-NINAK-TRVARLVDSYLTEVSRDRNLSL  458

Query  883   SQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHA  704
             ++F  L+  +P  AR +DD LYR+ID+YLKAHP +++ ERKR+C+++D +KLS +A +HA
Sbjct  459   TKFQVLSEALPESARTSDDGLYRAIDSYLKAHPTLTEHERKRLCRVMDCQKLSIDACMHA  518

Query  703   AQNERLPVRTVIQVLLSEQTKLSKQL-----MRQLEWsggsfisasagasgGTCPRSpnp  539
             AQNERLP+R V+QVL SEQ K+S  L     +++   S    +  +        P+S   
Sbjct  519   AQNERLPLRVVVQVLFSEQVKISNALANNGSLKEGAESHYQPMIPNRKTLLEGTPQSFQE  578

Query  538   papgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLE  371
                            +K+D+NT+     E++ +K + L LQ    N+Q   +KLL+
Sbjct  579   GWTA-----------AKKDINTLK---FELETVKTKYLELQNDMENLQKHFDKLLK  620



>ref|XP_006594679.1| PREDICTED: root phototropism protein 3-like [Glycine max]
Length=677

 Score =   248 bits (634),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 154/419 (37%), Positives = 247/419 (59%), Gaps = 47/419 (11%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggs-------  1391
             + WF+DA IL +D+FV+ ++ IK KG+R EL+G+ I HYA+KWLP L     +       
Sbjct  228   DWWFEDASILRIDHFVRVITAIKVKGMRFELVGASIMHYATKWLPGLISDTATPGDEASN  287

Query  1390  ----------eesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDS  1241
                         S + G H+++   +  ++S  ++      ++R  +E+L+ I+PP+KDS
Sbjct  288   CSLSNSSSSGGGSWKSGLHMVVTRTKDDNTSSLQAK-----EQRMIIESLVSIIPPQKDS  342

Query  1240  IPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELV  1061
             + C+FLLRLLR+  M+ V  A   ELEKR+  Q EQATL +L+IPS++    T+ DV+LV
Sbjct  343   VSCSFLLRLLRMAIMLKVAPALVTELEKRVGMQFEQATLADLLIPSYNKG-ETMYDVDLV  401

Query  1060  LRLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLI-----KVAKLVDDYLAEAAVDS  896
              RL++ FIV  + +++    +  S      + + +  I     +VA+LVD YL E + D 
Sbjct  402   QRLLEHFIVQEQTESSSPSRNSFSDKQHMGMGMGMGCILNAKARVARLVDSYLTEVSRDR  461

Query  895   NLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEA  716
             NL++++F  LA  +P  AR  DD LYR+ID+YLKAHP +S+ ERKR+C+++D +KLS +A
Sbjct  462   NLSLTKFQVLAEALPESARTCDDGLYRAIDSYLKAHPTLSEHERKRLCRVMDCQKLSIDA  521

Query  715   SIHAAQNERLPVRTVIQVLLSEQTKLSKQL----MRQLEWsggsfisasagasgGTCPRS  548
              +HAAQNERLP+R V+QVL +EQ K+S  L    ++ +E    + ++       GT P+S
Sbjct  522   CLHAAQNERLPLRVVVQVLFAEQVKISNALASSSVKDVESESHAMVTNRKTLLEGT-PQS  580

Query  547   pnppapgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLE  371
                               +K+D+NT+     E++ +K + + LQ    ++Q Q +K+L+
Sbjct  581   FQEGWTA-----------AKKDINTLK---FELESVKAKYMELQNDLASLQKQFDKMLK  625



>dbj|BAK05210.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=731

 Score =   249 bits (635),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 148/348 (43%), Positives = 208/348 (60%), Gaps = 41/348 (12%)
 Frame = -3

Query  1558  PMGECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTgggg-----  1394
             P  + WF+D  +L +D+FV+ ++ IK KG+R +LIG+ ITHYASKWLP LT         
Sbjct  246   PPADWWFEDVSVLRIDHFVRVVTAIKVKGMRFDLIGAAITHYASKWLPGLTKDAPHAVGG  305

Query  1393  ------seesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPC  1232
                   ++ S   G H+II       S    + +    ++R  VE+LI I+PP++DS+ C
Sbjct  306   GVDEQWAQVSAAGGLHMIIAGPGGKDSVATSAPAR---EQRMVVESLISIIPPQRDSVSC  362

Query  1231  NFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRL  1052
              FLLRLLR+  M+    A   ELEKR+  QLEQA L +L+IPS      T  DV+LV RL
Sbjct  363   GFLLRLLRLAIMLKAAPALVTELEKRVGMQLEQAALPDLLIPSVGR-ADTAYDVDLVQRL  421

Query  1051  VKRFIVS------------LEDQAAVMRCSGSSSSGA--PP-----------LNLNLNL-  950
             V+ F+V              E  A   R    S++GA  PP            +L LN  
Sbjct  422   VEHFLVQEQTEQVSYSPGRGEAHAQPEREYYGSAAGARMPPASAAAAASSSSASLGLNAK  481

Query  949   IKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKE  770
              +VA+L+D YL+E + D NL++++F  LA  +P  AR  DD LYR++D+YLKAHP +++ 
Sbjct  482   ARVARLLDSYLSEVSRDRNLSLTKFQVLAESLPESARTCDDGLYRAVDSYLKAHPALTEH  541

Query  769   ERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLSEQTKLSKQL  626
             ERKR+C+++D +KLS +A +HAAQNERLP+R V+QVL SEQ K+S  L
Sbjct  542   ERKRLCRVMDCQKLSFDACMHAAQNERLPLRVVVQVLFSEQVKISNAL  589



>ref|XP_010065706.1| PREDICTED: root phototropism protein 3 [Eucalyptus grandis]
 gb|KCW63331.1| hypothetical protein EUGRSUZ_G00960 [Eucalyptus grandis]
Length=674

 Score =   248 bits (632),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 157/409 (38%), Positives = 231/409 (56%), Gaps = 36/409 (9%)
 Frame = -3

Query  1543  WFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekgG-  1367
             WF+D  IL +D+FV+ ++ IK KG+R ELIG  I  YA+KWLP L   G           
Sbjct  230   WFEDVSILRIDHFVRVVTAIKVKGMRFELIGEAIMQYATKWLPGLIRDGAGAGDEGSNSG  289

Query  1366  ---------------HLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPC  1232
                            H+I+   +   S+V          +R  +E+LI I+PP+KDS+ C
Sbjct  290   NNHSSSGSASWKGGLHMIVAGTKDEPSTVQAK------DQRMIIESLISIIPPQKDSVTC  343

Query  1231  NFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRL  1052
             +FLLRLLR+ NM+ V  A   ELEKR+  Q EQA+L +L+IPS+ +   T+ DV+LV RL
Sbjct  344   SFLLRLLRMANMLKVAPALVTELEKRVGMQFEQASLADLLIPSY-NKIETLYDVDLVQRL  402

Query  1051  VKRFIVSLE-DQAAVMRCSGSSSSG---APPLNLNLNLIKVAKLVDDYLAEAAVDSNLTM  884
             ++ F+V  + + ++  R   S   G   A  +N     ++VA+LVD YL E + D NL++
Sbjct  403   LEHFLVQEQMEGSSPSRQPFSEKHGYDAAQRVNGQNAKMRVARLVDSYLTEVSRDRNLSL  462

Query  883   SQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHA  704
             ++F  LA  +P  AR  DD LYR+ID+YLKAHP +++ ERKR+C+++D +KLS +A +HA
Sbjct  463   TKFQVLAEALPESARTCDDGLYRAIDSYLKAHPTLTEHERKRLCRVMDCQKLSIDACMHA  522

Query  703   AQNERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapga  524
             AQNERLP+R V+QVL SEQ K+S  L      S     +          P +        
Sbjct  523   AQNERLPLRVVVQVLFSEQVKISNTLA-----SSSLKETGGDAHYQPMIP-NRKTLLEAT  576

Query  523   qqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKL  377
              Q  Q+    +K+D+NT+     E+  +K + L LQ    N+Q Q +K+
Sbjct  577   PQSFQEGWAAAKKDINTLK---FELDSMKAKYLELQNDMENLQRQFDKM  622



>ref|XP_010272952.1| PREDICTED: root phototropism protein 3-like isoform X2 [Nelumbo 
nucifera]
Length=616

 Score =   246 bits (629),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 155/416 (37%), Positives = 233/416 (56%), Gaps = 44/416 (11%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLP--------------E  1412
             + WF+D  +L +D+FV+ ++ I  KG+R ELIG+ I HYASKWLP              +
Sbjct  167   DWWFEDVSLLRIDHFVRVVTAIMVKGMRSELIGAAIMHYASKWLPFSEKEGIAVAGEGSQ  226

Query  1411  LTggggseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPC  1232
                   S  S          F   +S +  +  +A   ++R  +E+LI ILP +KDSI C
Sbjct  227   GKESNNSSSSSSSNSSWKGGFHMFASGTKEDQPNAKIKEQRMIIESLISILPSQKDSISC  286

Query  1231  NFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRL  1052
             +FLLRLLR+ NM+ V  A   ELEKR+  Q EQATL +L+IPS++ +  T+ DV+L  RL
Sbjct  287   SFLLRLLRMANMLKVAPALVTELEKRVGMQFEQATLSDLLIPSYNKS-DTLYDVDLFQRL  345

Query  1051  VKRFIVS-----------LEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAA  905
             ++ F+V              ++ +    S S+SS A         + VA+LVD YL E +
Sbjct  346   LEHFLVQEQMEPSSPSTYFSEKHSFEEMSRSTSSNAN--------MTVARLVDSYLTEVS  397

Query  904   VDSNLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLS  725
              D NL++++F ALA  +P  AR  DD LYR++D+YLKAHP +S+ ERKR+C+++D +KLS
Sbjct  398   RDRNLSLTKFQALAEALPESARTCDDGLYRAVDSYLKAHPTLSEHERKRLCRVMDCQKLS  457

Query  724   AEASIHAAQNERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSp  545
              +A +HAAQNERLP+R V+QVL +EQ K+S  +           +  S          + 
Sbjct  458   MDACMHAAQNERLPLRVVVQVLFAEQVKISNAMANS-------SLKESGEYHYHPMVWTQ  510

Query  544   nppapgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKL  377
                  G     Q+   ++K+++NT+     E++ +K + L LQ    N+Q Q EK+
Sbjct  511   KSLLEGTPLFYQEGWAIAKKEINTLK---FELENMKAKYLDLQNDMDNLQTQFEKM  563



>gb|KHN19000.1| Root phototropism protein 3 [Glycine soja]
Length=715

 Score =   248 bits (634),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 154/419 (37%), Positives = 247/419 (59%), Gaps = 47/419 (11%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggs-------  1391
             + WF+DA IL +D+FV+ ++ IK KG+R EL+G+ I HYA+KWLP L     +       
Sbjct  266   DWWFEDASILRIDHFVRVITAIKVKGMRFELVGASIMHYATKWLPGLISDTATPGDEASN  325

Query  1390  ----------eesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDS  1241
                         S + G H+++   +  ++S  ++      ++R  +E+L+ I+PP+KDS
Sbjct  326   CSLSNSSSSGGGSWKSGLHMVVTRTKDDNTSSLQAK-----EQRMIIESLVSIIPPQKDS  380

Query  1240  IPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELV  1061
             + C+FLLRLLR+  M+ V  A   ELEKR+  Q EQATL +L+IPS++    T+ DV+LV
Sbjct  381   VSCSFLLRLLRMAIMLKVAPALVTELEKRVGMQFEQATLADLLIPSYNKG-ETMYDVDLV  439

Query  1060  LRLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLI-----KVAKLVDDYLAEAAVDS  896
              RL++ FIV  + +++    +  S      + + +  I     +VA+LVD YL E + D 
Sbjct  440   QRLLEHFIVQEQTESSSPSRNSFSDKQHMGMGMGMGCILNAKARVARLVDSYLTEVSRDR  499

Query  895   NLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEA  716
             NL++++F  LA  +P  AR  DD LYR+ID+YLKAHP +S+ ERKR+C+++D +KLS +A
Sbjct  500   NLSLTKFQVLAEALPESARTCDDGLYRAIDSYLKAHPTLSEHERKRLCRVMDCQKLSIDA  559

Query  715   SIHAAQNERLPVRTVIQVLLSEQTKLSKQL----MRQLEWsggsfisasagasgGTCPRS  548
              +HAAQNERLP+R V+QVL +EQ K+S  L    ++ +E    + ++       GT P+S
Sbjct  560   CLHAAQNERLPLRVVVQVLFAEQVKISNALASSSVKDVESESHAMVTNRKTLLEGT-PQS  618

Query  547   pnppapgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLE  371
                               +K+D+NT+     E++ +K + + LQ    ++Q Q +K+L+
Sbjct  619   FQEGWTA-----------AKKDINTLK---FELESVKAKYMELQNDLASLQKQFDKMLK  663



>ref|XP_011087936.1| PREDICTED: root phototropism protein 3-like [Sesamum indicum]
Length=675

 Score =   248 bits (632),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 143/336 (43%), Positives = 206/336 (61%), Gaps = 32/336 (10%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             + WF+D  IL +D+FV+ ++ IK KG+R EL+G+ I HYA KWLP L   G    S    
Sbjct  229   DWWFEDVSILRIDHFVRVITAIKVKGMRYELVGAAIMHYAGKWLPGLVKEGSGSVSGGAA  288

Query  1369  G-------------------HLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEK  1247
                                 H+I+   +    +V          +R  +E+LI I+PP+K
Sbjct  289   DEGSNSSNSNGSSSSWKGGLHMIVVGSKEDLPAVQAK------DQRMIIESLISIIPPQK  342

Query  1246  DSIPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVE  1067
             D++ C+FLLRLLR+ NM+ V  A   ELEKR+  Q EQATL +L+IPS++    T+ DV+
Sbjct  343   DTVSCSFLLRLLRMANMLKVAPALVTELEKRVGMQFEQATLADLLIPSYNKH-ETLYDVD  401

Query  1066  LVLRLVKRFIVSLE-DQAAVMRCSGSSS---SGAP-PLNLNLNLIKVAKLVDDYLAEAAV  902
             LV RL++ F+V  + + ++  R S S +    GA    N N  + +VA+LVD YL E + 
Sbjct  402   LVQRLLEHFLVQEQSENSSPSRQSFSDTKMYDGAQRGTNPNAKM-RVARLVDSYLTEVSR  460

Query  901   DSNLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSA  722
             D NL++++F  LA  +P  AR  DD LYR+ID+YLKAHP +++ ERKR+C+++D +KLS 
Sbjct  461   DRNLSLTKFQVLAEALPESARTCDDGLYRAIDSYLKAHPTLTEHERKRLCRVMDCQKLSI  520

Query  721   EASIHAAQNERLPVRTVIQVLLSEQTKLSKQLMRQL  614
             +A +HAAQNERLP+R V+QVL SEQ K+S  L   L
Sbjct  521   DACMHAAQNERLPLRVVVQVLFSEQVKISNALANGL  556



>ref|XP_002269380.1| PREDICTED: root phototropism protein 3 [Vitis vinifera]
 ref|XP_010645167.1| PREDICTED: root phototropism protein 3 [Vitis vinifera]
Length=674

 Score =   247 bits (631),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 156/408 (38%), Positives = 237/408 (58%), Gaps = 33/408 (8%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             + WF+D  IL +D+FV+ ++ IK KG+R ELIG+ I  YA+KWLP L   G      ++G
Sbjct  228   DWWFEDVSILRIDHFVRVITAIKVKGMRFELIGASIMQYATKWLPGLIKEGMGTGMGDEG  287

Query  1369  GHLIIKFeesssssvaesvsaSWMK----------KRFFVETLIGILPPEKDSIPCNFLL  1220
              +       SSS      +  +  K          +R  +E+LI I+PP+KDS+ C+FLL
Sbjct  288   SNSSNGSSGSSSWKGGLQMVVAGAKDDPPTVQAKDQRMIIESLISIIPPQKDSVSCSFLL  347

Query  1219  RLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRF  1040
             RLLR+ NM+ V  A   ELEKR+  Q EQATL +L+IPS++ +  T+ DV+LV RL++ F
Sbjct  348   RLLRMANMLKVAPALVTELEKRVGMQFEQATLADLLIPSYNKS-ETLYDVDLVQRLLEHF  406

Query  1039  IVSLE-DQAAVMRCSGSSS---SGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFI  872
             +V  + D ++  R          G    N +   ++VA+LVD YL E + D NL++++F 
Sbjct  407   LVQEQTDSSSPSRQPFPEKHLYEGTQRGNGSNAKMRVARLVDSYLTEVSRDRNLSLTKFQ  466

Query  871   ALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNE  692
              LA  +P  AR  DD LYR+ID+YLKAHP +S+ ERKR+C+++D +KLS +A +HAAQNE
Sbjct  467   VLAEALPESARTCDDGLYRAIDSYLKAHPTLSEHERKRLCRVMDCQKLSIDACMHAAQNE  526

Query  691   RLPVRTVIQVLLSEQTKLSKQL----MRQLEWsggsfisasagasgGTCPRSpnppapga  524
             RLP+R V+QVL SEQ K++  +    +++   S    + ++        P+S        
Sbjct  527   RLPLRIVVQVLFSEQVKINNAIANNTLKEAGESQYQPMISNRKTLLEGTPQSFQEGW---  583

Query  523   qqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEK  380
                       +K+D+NT+     E++ +K + L LQ    N+Q Q +K
Sbjct  584   --------TAAKKDINTLK---FELESMKAKYLELQNDMENLQRQFDK  620



>ref|NP_001147552.1| transposon protein Mutator sub-class [Zea mays]
 gb|ACG27903.1| transposon protein Mutator sub-class [Zea mays]
Length=739

 Score =   248 bits (634),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 163/421 (39%), Positives = 243/421 (58%), Gaps = 36/421 (9%)
 Frame = -3

Query  1558  PMGECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTgg-------  1400
             P  + WF+D  +L +D+FV+ ++ IK KG+R +LIG+ ITHYASKWLP LT         
Sbjct  254   PPPDWWFEDVSMLRIDHFVRVVTAIKVKGMRFDLIGASITHYASKWLPGLTKDGPHGGAL  313

Query  1399  ----ggseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPC  1232
                   ++ S   G H+II         +A S  A   ++R  VE+LI I+P ++DS+ C
Sbjct  314   EEPWAQAQASPGGGLHMIIASGGGGKDDIAGSTPAR--EQRMVVESLISIIPLQRDSVSC  371

Query  1231  NFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRL  1052
              FLLRLLR+  M+    A   ELEKR+  QLEQA L +L+IPS+     T  DV+LV RL
Sbjct  372   GFLLRLLRLAVMLKAAPALVTELEKRVGMQLEQAVLADLLIPSYGR-ADTAYDVDLVQRL  430

Query  1051  VKRFIVSLEDQAAVMRCSGSSSSGAPPL----------------NLNLNL-IKVAKLVDD  923
             V+ F+V  ++Q  ++  S       PPL                +  LN   +VA+L+D 
Sbjct  431   VEHFLV--QEQTELLASSSPGRVEQPPLPEYYGARTAGAAAASASAGLNAKARVARLLDS  488

Query  922   YLAEAAVDSNLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLI  743
             YL+E + D NL++++F  LA  +P  AR  DD LYR++D+YLKAHP +++ ERKR+C+++
Sbjct  489   YLSEVSRDRNLSLTKFQVLAESLPESARTCDDGLYRAVDSYLKAHPTLTEHERKRLCRVM  548

Query  742   DSRKLSAEASIHAAQNERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgG  563
             D +KLS +A +HAAQNERLP+R V+QVL SEQ K+S  L      +  +    +  A+ G
Sbjct  549   DCQKLSLDACMHAAQNERLPLRVVVQVLFSEQVKISNALASGSSSNAAAAALLANKAADG  608

Query  562   TCPRSpnppapgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIE  383
               P +      G  Q  Q+    +K+D+NT+    LE++ +K + L LQ +   +Q  +E
Sbjct  609   VAPPTRRQLLDGTPQSFQEGWAAAKKDINTLK---LELESMKAKYLELQHEMDALQKLVE  665

Query  382   K  380
             +
Sbjct  666   R  666



>ref|XP_010272951.1| PREDICTED: root phototropism protein 3-like isoform X1 [Nelumbo 
nucifera]
Length=678

 Score =   247 bits (630),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 155/416 (37%), Positives = 233/416 (56%), Gaps = 44/416 (11%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLP--------------E  1412
             + WF+D  +L +D+FV+ ++ I  KG+R ELIG+ I HYASKWLP              +
Sbjct  229   DWWFEDVSLLRIDHFVRVVTAIMVKGMRSELIGAAIMHYASKWLPFSEKEGIAVAGEGSQ  288

Query  1411  LTggggseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPC  1232
                   S  S          F   +S +  +  +A   ++R  +E+LI ILP +KDSI C
Sbjct  289   GKESNNSSSSSSSNSSWKGGFHMFASGTKEDQPNAKIKEQRMIIESLISILPSQKDSISC  348

Query  1231  NFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRL  1052
             +FLLRLLR+ NM+ V  A   ELEKR+  Q EQATL +L+IPS++ +  T+ DV+L  RL
Sbjct  349   SFLLRLLRMANMLKVAPALVTELEKRVGMQFEQATLSDLLIPSYNKS-DTLYDVDLFQRL  407

Query  1051  VKRFIVS-----------LEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAA  905
             ++ F+V              ++ +    S S+SS A         + VA+LVD YL E +
Sbjct  408   LEHFLVQEQMEPSSPSTYFSEKHSFEEMSRSTSSNAN--------MTVARLVDSYLTEVS  459

Query  904   VDSNLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLS  725
              D NL++++F ALA  +P  AR  DD LYR++D+YLKAHP +S+ ERKR+C+++D +KLS
Sbjct  460   RDRNLSLTKFQALAEALPESARTCDDGLYRAVDSYLKAHPTLSEHERKRLCRVMDCQKLS  519

Query  724   AEASIHAAQNERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSp  545
              +A +HAAQNERLP+R V+QVL +EQ K+S  +           +  S          + 
Sbjct  520   MDACMHAAQNERLPLRVVVQVLFAEQVKISNAMANS-------SLKESGEYHYHPMVWTQ  572

Query  544   nppapgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKL  377
                  G     Q+   ++K+++NT+     E++ +K + L LQ    N+Q Q EK+
Sbjct  573   KSLLEGTPLFYQEGWAIAKKEINTLK---FELENMKAKYLDLQNDMDNLQTQFEKM  625



>gb|KHN33549.1| Root phototropism protein 3 [Glycine soja]
Length=676

 Score =   247 bits (630),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 152/419 (36%), Positives = 240/419 (57%), Gaps = 48/419 (11%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             + WF+DA IL +D+FV+ ++ IK KG+R EL+G+ I HYA+KWLP L             
Sbjct  228   DWWFEDASILRIDHFVRVITAIKVKGMRFELVGASIMHYATKWLPGLISDTAIPGDEASN  287

Query  1369  G-----------------HLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDS  1241
                               H+++   +  +SS+         ++R  +E+L+ I+PP+KDS
Sbjct  288   CSMSNSSSSGGSSWKGGLHMVVTGTKDDTSSLQAK------EQRMIIESLVSIIPPQKDS  341

Query  1240  IPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELV  1061
             + C+FLLRLLR+  M+ V  A   ELEKR+  Q EQATL +L+IPS+ +   T+ DV+LV
Sbjct  342   VSCSFLLRLLRMAIMLKVAPALVTELEKRVGMQFEQATLADLLIPSY-NKGETMYDVDLV  400

Query  1060  LRLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLI-----KVAKLVDDYLAEAAVDS  896
              RL++ FI+    +++       S      + + +  I     +VA+LVD YL E + D 
Sbjct  401   QRLLEHFIIQEHTESSSPSRQSFSDKQHMGMGMGMGCILNAKARVARLVDSYLTEVSRDR  460

Query  895   NLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEA  716
             NL++++F  LA  +P  AR  DD LYR+ID+YLKAHP +S+ ERKR+C+++D +KLS +A
Sbjct  461   NLSLTKFQVLAEALPESARTCDDGLYRAIDSYLKAHPTLSEHERKRLCRVMDCQKLSIDA  520

Query  715   SIHAAQNERLPVRTVIQVLLSEQTKLSKQL----MRQLEWsggsfisasagasgGTCPRS  548
              +HAAQNERLP+R V+QVL +EQ K+S  L    ++ +E    + ++       GT P+S
Sbjct  521   CLHAAQNERLPLRVVVQVLFAEQVKISNALASSSVKDVESESHAMVTNRKTLLEGT-PQS  579

Query  547   pnppapgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLE  371
                               +K+D+NT+     E++ +K + + LQ    ++Q Q +K+L+
Sbjct  580   FQEGWTA-----------AKKDINTLK---FELESVKAKYMELQNDMASLQKQFDKMLK  624



>ref|XP_006829676.1| hypothetical protein AMTR_s00122p00139490 [Amborella trichopoda]
 gb|ERM97092.1| hypothetical protein AMTR_s00122p00139490 [Amborella trichopoda]
Length=253

 Score =   234 bits (598),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 126/258 (49%), Positives = 168/258 (65%), Gaps = 36/258 (14%)
 Frame = -3

Query  1567  SCKPMGECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggse  1388
             +C+   + WFDD+ ILD+DYFVKT++ +K+K VRP+L+GSIITHYASKWLPEL+G   + 
Sbjct  18    NCQITVDPWFDDSSILDIDYFVKTIATVKSKDVRPDLVGSIITHYASKWLPELSGEKLAG  77

Query  1387  esiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLR  1208
             ++  K  +                  +S +KKRFFVETL  ILP EKDS+PC F+ RLLR
Sbjct  78    KNTGKSENF----------------GSSQIKKRFFVETLASILPQEKDSVPCGFVFRLLR  121

Query  1207  IGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSL  1028
                 VG E + R ELE+R    LE ATL +LMIP+FSHT  T+LD+++VLR++ +F+ S 
Sbjct  122   TAMAVGAEPSCRVELEQRAGSLLEHATLHDLMIPAFSHTSRTLLDLQVVLRVLTKFLSSE  181

Query  1027  EDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPT  848
             E  A +                    +KVAKL+D YLAEAA+D NLT+ +F  LAA +P+
Sbjct  182   EGGATI--------------------VKVAKLIDCYLAEAALDGNLTVMEFEGLAAALPS  221

Query  847   HARPTDDALYRSIDTYLK  794
             HAR  +D LYR+IDTYLK
Sbjct  222   HARACEDGLYRAIDTYLK  239



>gb|EAY72752.1| hypothetical protein OsI_00618 [Oryza sativa Indica Group]
Length=487

 Score =   241 bits (615),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 165/407 (41%), Positives = 238/407 (58%), Gaps = 59/407 (14%)
 Frame = -3

Query  1537  DDACILDMDYFVKTLSGIKAK-------GVRPELIGSIITHYASKWLPELTggggseesi  1379
             DD+C+ D++ F +T++  K++         RP+++ S+++HYA+KWLP++     S    
Sbjct  45    DDSCVNDVENFARTVAAAKSRQLVGSSAASRPDMLASVLSHYAAKWLPDVVAASSSS---  101

Query  1378  ekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDS-----------IPC  1232
                         S      ES +A+W+KKR  +E+L+  LPP+  +           I C
Sbjct  102   -----SSPATSASGRFLPPESPTATWLKKRLLLESLVAALPPDPPAPGGGGGAADDGITC  156

Query  1231  NFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSH--TCGTVLDVELVL  1058
             +FLL+LLR G+MVG +AA   ELE R + +L+QATL  +MIP+F H   CGT+LDV LVL
Sbjct  157   DFLLKLLRAGSMVGADAALLQELESRAARRLDQATLGAVMIPAFGHGYACGTLLDVPLVL  216

Query  1057  RLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQ  878
             RLV+ F   L+D  A    +  +              +VA+LVD YLAEAA+++ L  ++
Sbjct  217   RLVRGF---LKDAGAGGGGAAKAGG-----GGGAAAARVARLVDAYLAEAALEAGLRPAE  268

Query  877   FIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQ  698
             F  LA  +P HARP DDALYR++DTYLKAH   SKEERK +C+LID+RKL+AEA+ HA Q
Sbjct  269   FEELARAVPAHARPADDALYRAVDTYLKAHASTSKEERKSLCRLIDARKLTAEAAAHAVQ  328

Query  697   NERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapgaqq  518
             N+RLPVR+V+QVL SE  KL++     L    G   S  A +     P +          
Sbjct  329   NDRLPVRSVLQVLFSEHGKLNR-----LAELSGGASSFGAPSPAFDLPGA----------  373

Query  517   qqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKL  377
                  RC SKR+   +  QH E+++L+E+  RLQ QC  +QAQ+++L
Sbjct  374   -----RCPSKRE---VLAQHHELRRLREDFARLQVQCSALQAQVDRL  412



>gb|AFW71924.1| putative phototropic-responsive NPH3 family protein [Zea mays]
Length=746

 Score =   247 bits (630),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 160/422 (38%), Positives = 242/422 (57%), Gaps = 35/422 (8%)
 Frame = -3

Query  1558  PMGECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTgg-------  1400
             P  + WF+D  +L +D+FV+ ++ IK KG+R +LIG+ ITHYASKWLP LT         
Sbjct  258   PPPDWWFEDVSMLRIDHFVRVVTAIKVKGMRFDLIGASITHYASKWLPGLTKDGPHGGAL  317

Query  1399  ----ggseesiekgGHLIIKFeesssssvaesvsaSWMK-KRFFVETLIGILPPEKDSIP  1235
                   ++ S   G H+II           +   ++  + +R  VE+LI I+P ++DS+ 
Sbjct  318   EEPWAQAQASPGGGLHMIIASGGGGGGGKDDIAGSTPAREQRMVVESLISIIPLQRDSVS  377

Query  1234  CNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLR  1055
             C FLLRLLR+  M+    A   ELEKR+  QLEQA L +L+IPS+     T  DV+LV R
Sbjct  378   CGFLLRLLRLAVMLKAAPALVTELEKRVGMQLEQAVLADLLIPSYGR-ADTAYDVDLVQR  436

Query  1054  LVKRFIVSLEDQAAVMRCSGSSSSGAPPL----------------NLNLNL-IKVAKLVD  926
             LV+ F+V  ++Q  ++  S       PPL                +  LN   +VA+L+D
Sbjct  437   LVEHFLV--QEQTELLASSSPGRVEQPPLPEYYGARTAGAAAASASAGLNAKARVARLLD  494

Query  925   DYLAEAAVDSNLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKL  746
              YL+E + D NL++++F  LA  +P  AR  DD LYR++D+YLKAHP +++ ERKR+C++
Sbjct  495   SYLSEVSRDRNLSLTKFQVLAESLPESARTCDDGLYRAVDSYLKAHPTLTEHERKRLCRV  554

Query  745   IDSRKLSAEASIHAAQNERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasg  566
             +D +KLS +A +HAAQNERLP+R V+QVL SEQ K+S  L      +  +    +  A+ 
Sbjct  555   MDCQKLSLDACMHAAQNERLPLRVVVQVLFSEQVKISNALASGSSSNAAAAALLANKAAD  614

Query  565   GTCPRSpnppapgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQI  386
             G  P +      G  Q  Q+    +K+D+NT+    LE++ +K + L LQ +   +Q  +
Sbjct  615   GVAPPTRRQLLDGTPQSFQEGWAAAKKDINTLK---LELESMKAKYLELQHEMDALQKLV  671

Query  385   EK  380
             E+
Sbjct  672   ER  673



>ref|XP_003528390.2| PREDICTED: root phototropism protein 3-like isoform X1 [Glycine 
max]
Length=747

 Score =   246 bits (627),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 157/419 (37%), Positives = 239/419 (57%), Gaps = 49/419 (12%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggs-------  1391
             + WF+D  IL +D+FV+ ++ IK KG+R ELIG+ I HYA+KWLP L   G +       
Sbjct  300   DWWFEDVSILRIDHFVRVITAIKVKGMRFELIGAGIMHYATKWLPGLMNIGTAIPGEEGS  359

Query  1390  --------------eesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPP  1253
                             S + G H+I+      +S++          +R  VE+L+ I+PP
Sbjct  360   NSSTSNSSSSNGGGGGSWKGGLHMIVAGPRDDTSTLQAK------DQRMIVESLVSIIPP  413

Query  1252  EKDSIPCNFLLRLLRIGN-MVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVL  1076
             +KDS+ C+FLLRLLR+ N M+ V  A   ELEKR+  Q EQATL +L+IP ++    T  
Sbjct  414   QKDSVSCSFLLRLLRMANNMLKVAPALITELEKRVGMQFEQATLADLLIPCYNKN-ETTY  472

Query  1075  DVELVLRLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDS  896
             DV+LV RL++ F+V  + +++       S       N+N    +VA+LVD YL E + D 
Sbjct  473   DVDLVQRLLEHFLVQEQTESSSPSRPPFSDKHVSS-NINAK-TRVARLVDSYLTEVSRDR  530

Query  895   NLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEA  716
             NL++++F  LA  +P  AR +DD LYR++D+YLKAHP +++ ERKR+C+++D +KLS +A
Sbjct  531   NLSLTKFQVLAEALPESARTSDDGLYRAVDSYLKAHPTLTEHERKRLCRVMDCQKLSIDA  590

Query  715   SIHAAQNERLPVRTVIQVLLSEQTKLSKQL----MRQLEWsggsfisasagasgGTCPRS  548
              +HAAQNERLP+R V+QVL SEQ K+S  L    +++   S    +  +        P+S
Sbjct  591   CMHAAQNERLPLRVVVQVLFSEQVKISNALANSSLKEGAESHYQPMIPNRKTLLEGTPQS  650

Query  547   pnppapgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLE  371
                               +K+D+NT+     E++ +K + L LQ    N+Q Q +KLL+
Sbjct  651   FQEGWTA-----------AKKDINTLK---FELETVKTKYLELQNDMENLQRQFDKLLK  695



>ref|XP_004136895.1| PREDICTED: root phototropism protein 3-like [Cucumis sativus]
 gb|KGN43771.1| hypothetical protein Csa_7G066280 [Cucumis sativus]
Length=676

 Score =   244 bits (622),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 154/416 (37%), Positives = 235/416 (56%), Gaps = 41/416 (10%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             + WF+DA IL +D+FV+ ++ IK KG+  E IG+ I +YA KWLP L      E +    
Sbjct  228   DWWFEDASILRIDHFVRVITAIKVKGMGYEQIGAAIMYYACKWLPGLVNYENGEGNEATN  287

Query  1369  ----------------GHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSI  1238
                              H+++   ++  S++         ++R  +E+LI ILPP+KDS+
Sbjct  288   CSNGSASSRKYNWNGDLHMVVVNPKNKISTIQAK------ERRMIIESLISILPPQKDSV  341

Query  1237  PCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVL  1058
              C+FLL+LL + N++ V  A   ELEKR+  Q EQATL++L+IPS+ +T  T+ DV+LV 
Sbjct  342   SCSFLLQLLSMANILKVAPALVTELEKRVGMQFEQATLKDLLIPSY-NTSETMYDVDLVQ  400

Query  1057  RLVKRFIVS--LEDQAAVMRCSGS-----SSSGAPPLNLNLNLIKVAKLVDDYLAEAAVD  899
             RL++ F++    ED +   +         +S      N N  + +VA+LVD YL E A D
Sbjct  401   RLLEHFLIQELTEDSSPSSQSFSGKDGLEASQTTASSNQNAKM-RVARLVDSYLTEVARD  459

Query  898   SNLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAE  719
              NL++++F  LA  +P  AR  DD LYR++D+YLKAHP +S+ ERKR+C+++D +KLS +
Sbjct  460   RNLSLTKFQVLAEALPESARSCDDGLYRAVDSYLKAHPTLSEHERKRLCRVMDCQKLSVD  519

Query  718   ASIHAAQNERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnp  539
             A  HAAQNERLP+R V+QVL SEQ K++  +           I  +  +       S   
Sbjct  520   ACTHAAQNERLPLRVVVQVLFSEQIKINNAIANN-------TIKEAGESRCQPIASSRKT  572

Query  538   papgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKLLE  371
                G  Q  Q+    +K+D+NT+     E+  +  + L LQ    N+Q Q EK+L+
Sbjct  573   LLEGTPQSFQEGWAAAKKDINTLK---FELDTVNAKYLELQHNLENLQRQFEKILK  625



>ref|XP_008673635.1| PREDICTED: root phototropism protein 3 [Zea mays]
 tpg|DAA53198.1| TPA: putative phototropic-responsive NPH3 family protein [Zea 
mays]
Length=464

 Score =   238 bits (608),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 156/405 (39%), Positives = 230/405 (57%), Gaps = 62/405 (15%)
 Frame = -3

Query  1528  CILDMDYFVKTLSGIKAKGV---RPELIGSIITHYASKWLPELTggggseesiekgGHLI  1358
             C+ D+D F +T++ +K+K     RP+++ S+++HYA+KWLP++     S  S        
Sbjct  36    CVNDVDSFARTVAAVKSKAASCARPDMLASVLSHYAAKWLPDVAPPTSSSASG-------  88

Query  1357  IKFeesssssvaesvsaSWMKKRFFVETLIGILPPE--------------KDSIPCNFLL  1220
              +F    S +        W+KKR  +E+L+  LPP+               D I C+FLL
Sbjct  89    -RFLPPESPTAT------WLKKRLLLESLVAALPPDPAAGGGGCCAAAVADDGITCDFLL  141

Query  1219  RLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTC----GTVLDVELVLRL  1052
             +LLR G+MVG +AA   +LE R + +L+QATL  +MIP+F H        +LDV LVLRL
Sbjct  142   KLLRAGSMVGADAALLRDLEARAARRLDQATLGAVMIPAFGHGGEHAPALLLDVPLVLRL  201

Query  1051  VKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFI  872
             V+ F+       A    +                 +VA+LVD YLAEAA+++ L  ++F 
Sbjct  202   VRGFLKEGGGSKAGGGAALVGGG-------GAAAARVARLVDAYLAEAALEAGLRPAEFE  254

Query  871   ALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNE  692
              LA  +P HARP DDALYR++DTYLKAHPG +KEERK + +LID+RKL+AEA+ H  QNE
Sbjct  255   ELARAVPAHARPADDALYRAVDTYLKAHPGTAKEERKSLARLIDARKLTAEAAAHTVQNE  314

Query  691   RLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapgaqqqq  512
             R+PVR V+QVL SE  KL++                +  ++  +  RS  P        +
Sbjct  315   RMPVRAVVQVLFSEHGKLNR---------------LAELSASFSGQRS--PSPSPNPALE  357

Query  511   qdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKL  377
                RC SKR+   +  QH E+++L+++V RLQ QC  +QAQ+++L
Sbjct  358   LPGRCPSKRE---VLAQHQEVRRLRDDVARLQVQCNALQAQVDRL  399



>gb|EAY86354.1| hypothetical protein OsI_07731 [Oryza sativa Indica Group]
Length=762

 Score =   245 bits (625),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 161/429 (38%), Positives = 236/429 (55%), Gaps = 41/429 (10%)
 Frame = -3

Query  1558  PMGECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggg------  1397
             P  + WF+D  +L +D+FV+ ++ IK KG+R +LIG+ ITHYASKWLP LT         
Sbjct  265   PPADWWFEDVSVLRIDHFVRVVTAIKVKGMRFDLIGAAITHYASKWLPGLTKDAPLGATH  324

Query  1396  --------gseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDS  1241
                      +         +II         V  + SA   ++R  VE++I I PP++DS
Sbjct  325   DEPWAQASAAGVGGGGLHMMIISGAGGGKDDVLAACSAPSREQRMVVESIISITPPQRDS  384

Query  1240  IPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFS-HTCGTVLDVEL  1064
             + C FLLRLLR+  M+    A   ELEKR+  QLEQA L +L+IPS+      T  DV+L
Sbjct  385   VSCGFLLRLLRLAIMLRAAPALVTELEKRVGMQLEQAALADLLIPSYGGRAADTAYDVDL  444

Query  1063  VLRLVKRFIVSLEDQAAVMRCSGSS-----------SSGAPPLNL----------NLNL-  950
             V RLV+ F+V  + + AV    G             S   PP +            LN  
Sbjct  445   VQRLVEHFLVQEQTEMAVASSPGRGDPPPPPQPEYYSGRMPPSSAAAASASASTGGLNAK  504

Query  949   IKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKE  770
              +VA+L+D YL+E + D NL++++F  LA  +P  AR  DD LYR++D+YLKAHP +++ 
Sbjct  505   ARVARLLDSYLSEVSRDRNLSLTKFQVLAESLPESARACDDGLYRAVDSYLKAHPTLTEH  564

Query  769   ERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfi  590
             ERKR+C+++D +KLS +A +HAAQNERLP+R V+QVL SEQ K+S  L      +  S  
Sbjct  565   ERKRLCRVMDCQKLSFDACMHAAQNERLPLRVVVQVLFSEQVKISNALASSSA-ALRSSS  623

Query  589   sasagasgGTCPRSpnppapgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQ  410
             SA    +    P +      G  Q  Q+    +K+D+NT+     E++ +K + L LQ +
Sbjct  624   SAPGADAAPAMPTTRRQLLDGTPQSFQEGWAAAKKDINTLK---FELESMKAKYLELQHE  680

Query  409   CINMQAQIE  383
                +Q Q++
Sbjct  681   MDALQKQVD  689



>ref|XP_004485603.1| PREDICTED: root phototropism protein 3-like [Cicer arietinum]
Length=691

 Score =   244 bits (622),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 157/425 (37%), Positives = 234/425 (55%), Gaps = 55/425 (13%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTgggg--------  1394
             + WF+D  IL +D+FV+ ++ IK KG+R ELIG+ I HYA+KWL  L             
Sbjct  237   DWWFEDVSILRIDHFVRVITAIKVKGMRFELIGAAIMHYATKWLQGLVTDTSILCDEKTS  296

Query  1393  -----------------seesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIG  1265
                                   E G H+I+      +S++         ++R  +E+LI 
Sbjct  297   NCSISNSNNNNSTTSSSGNSWNENGLHMILVGTRDENSNLQAK------EQRMIIESLIS  350

Query  1264  ILPPEKDSIPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHT-C  1088
             I+PP+KDS+ C+FLLRLLR+  +  V  A   ELEKR+  Q EQATL +L+IP ++    
Sbjct  351   IIPPQKDSVSCSFLLRLLRMAIVSKVAHALVTELEKRVGMQFEQATLSDLLIPCYNKGET  410

Query  1087  GTVLDVELVLRLVKRFIVSLEDQAAV-MRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAE  911
              T+ DV+LVLRL++ F+V  + +++   R S S    A  LN      +VA+LVD YL E
Sbjct  411   LTMYDVDLVLRLLEHFLVQEQTESSSPKRMSFSEKHMACNLNAK---ARVARLVDSYLTE  467

Query  910   AAVDSNLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRK  731
              + D NL++++F  LA  +P  AR  DD LYR+ID+YLKAHP +S+ ERKR+C+++D +K
Sbjct  468   VSRDRNLSLTKFQVLAEALPESARTCDDGLYRAIDSYLKAHPTLSEHERKRLCRVMDCQK  527

Query  730   LSAEASIHAAQNERLPVRTVIQVLLSEQTKLSKQLMRQL-----EWsggsfisasagasg  566
             LS +A +HAAQNERLP+R V+QVL +EQ K+S  L         E      +  +     
Sbjct  528   LSIDACMHAAQNERLPLRVVVQVLFAEQVKISNALSNTSLKDVNESFTQPMVITNRKTLL  587

Query  565   GTCPRSpnppapgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQI  386
                P+S                  +K+D+NT+     E++ +K + L LQ    N+Q Q 
Sbjct  588   EGTPQSFQEGWTA-----------AKKDVNTLK---FELESVKAKYLELQNDMENLQKQF  633

Query  385   EKLLE  371
             +K+L+
Sbjct  634   DKMLK  638



>ref|XP_009766094.1| PREDICTED: root phototropism protein 3-like isoform X1 [Nicotiana 
sylvestris]
Length=674

 Score =   243 bits (620),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 153/415 (37%), Positives = 231/415 (56%), Gaps = 45/415 (11%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             + WF+D  IL +D+FV+ ++ IK KG++ ELIG+ I  YA+KWLP L   G         
Sbjct  229   DWWFEDVSILRIDHFVRVITAIKVKGMKHELIGAAIMQYAAKWLPGLIKEGSGLADDGSN  288

Query  1369  ----------------GHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSI  1238
                              H+I+        SV          +R  VE+LI I+P  KDS+
Sbjct  289   ISNGINGTSSGSWRGGLHMIVAGIGDEVPSVQAK------DQRMIVESLISIIPQHKDSV  342

Query  1237  PCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVL  1058
              C+FLLRLLR+ NM+ V  A   ELEKR+  Q EQATL +L+IPS++ +  T+ D++LV 
Sbjct  343   SCSFLLRLLRVANMLKVAPALITELEKRVGMQFEQATLADLLIPSYNKS-ETMYDIDLVQ  401

Query  1057  RLVKRFIVSLEDQAAVMRCSGSSSS---GAPPLNLNLNL-IKVAKLVDDYLAEAAVDSNL  890
             RL++ FIV  + +++       S            +LN  ++VA+LVD YL E + D NL
Sbjct  402   RLLEHFIVQEQTESSSPSSYPFSDKHMHDGIQRGTHLNAKMRVARLVDSYLTEVSRDRNL  461

Query  889   TMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASI  710
             ++++F  LA  +P  AR  DD LYR+ID+YLKAHP +S+ ERKR+C+++D +KLS +A +
Sbjct  462   SLTKFQVLAEALPDSARTCDDGLYRAIDSYLKAHPTLSEHERKRLCRVMDCQKLSVDACM  521

Query  709   HAAQNERLPVRTVIQVLLSEQTKLSKQL----MRQLEWsggsfisasagasgGTCPRSpn  542
             HAAQNERLP+R V+QVL SEQ K+S  +    ++    S    + ++  +     P+S  
Sbjct  522   HAAQNERLPLRVVVQVLFSEQVKISNAMANLSLKDAGESHYQPLVSNRKSLLEATPQSFQ  581

Query  541   ppapgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKL  377
                             +K+D+NT+     E++ +K +   LQ    N+Q Q +K+
Sbjct  582   EGW-----------TAAKKDINTLK---FELETVKTKYRELQNDMDNLQRQFDKI  622



>ref|NP_001047181.1| Os02g0568200 [Oryza sativa Japonica Group]
 sp|Q5KS50.1|NPH3_ORYSJ RecName: Full=Coleoptile phototropism protein 1; AltName: Full=BTB/POZ 
domain-containing protein CPT1; AltName: Full=Non-phototropic 
hypocotyl 3-like protein; Short=NPH3-like protein 
[Oryza sativa Japonica Group]
 dbj|BAD86496.1| NPH3 [Oryza sativa Japonica Group]
 dbj|BAF09095.1| Os02g0568200 [Oryza sativa Japonica Group]
Length=762

 Score =   244 bits (622),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 160/429 (37%), Positives = 236/429 (55%), Gaps = 41/429 (10%)
 Frame = -3

Query  1558  PMGECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggg------  1397
             P  + WF+D  +L +D+FV+ ++ IK KG+R +LIG+ ITHYASKWLP LT         
Sbjct  265   PPADWWFEDVSVLRIDHFVRVVTAIKVKGMRFDLIGAAITHYASKWLPGLTKDAPLGATH  324

Query  1396  --------gseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDS  1241
                      +         +II         V  + SA   ++R  VE++I I PP++DS
Sbjct  325   DEPWAQASAAGVGGGGLHMMIISGAGGGKDDVLAACSAPSREQRMVVESIISITPPQRDS  384

Query  1240  IPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFS-HTCGTVLDVEL  1064
             + C FLLRLLR+  M+    A   ELEKR+  QLEQA L +L+IPS+      T  DV+L
Sbjct  385   VSCGFLLRLLRLAIMLRAAPALVTELEKRVGMQLEQAALADLLIPSYGGRAADTAYDVDL  444

Query  1063  VLRLVKRFIVSLEDQAAVMRCSGSS-----------SSGAPPLNL----------NLNL-  950
             V RLV+ F+V  + + AV    G             S   PP +            LN  
Sbjct  445   VQRLVEHFLVQEQTEMAVASSPGRGDPPPPPQPEYYSGRMPPSSAAAASASASTGGLNAK  504

Query  949   IKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKE  770
              +VA+L+D YL+E + D NL++++F  LA  +P  AR  DD LYR++D+YLKAHP +++ 
Sbjct  505   ARVARLLDSYLSEVSRDRNLSLTKFQVLAESLPESARACDDGLYRAVDSYLKAHPTLTEH  564

Query  769   ERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfi  590
             ERKR+C+++D +KLS +A +HAAQNERLP+R V+QVL +EQ K+S  L      +  S  
Sbjct  565   ERKRLCRVMDCQKLSFDACMHAAQNERLPLRVVVQVLFTEQVKISNALASSSA-ALRSSS  623

Query  589   sasagasgGTCPRSpnppapgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQ  410
             SA    +    P +      G  Q  Q+    +K+D+NT+     E++ +K + L LQ +
Sbjct  624   SAPGADAAPAMPTTRRQLLDGTPQSFQEGWAAAKKDINTLK---FELESMKAKYLELQHE  680

Query  409   CINMQAQIE  383
                +Q Q++
Sbjct  681   MDALQKQVD  689



>gb|KHN09117.1| Root phototropism protein 3 [Glycine soja]
Length=621

 Score =   241 bits (615),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 139/328 (42%), Positives = 203/328 (62%), Gaps = 31/328 (9%)
 Frame = -3

Query  1543  WFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggs---------  1391
             WF+D  IL +D+FV+ ++ IK KG+R ELIG+ I HYA+KWLP L   G +         
Sbjct  230   WFEDVSILRIDHFVRVITAIKVKGMRFELIGAGIMHYATKWLPGLMNIGTAIPGEEGSNS  289

Query  1390  ------------eesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEK  1247
                           S + G H+I+      +S++          +R  VE+L+ I+PP+K
Sbjct  290   STSNSSSSNGGGGGSWKGGLHMIVAGPRDDTSTLQAK------DQRMIVESLVSIIPPQK  343

Query  1246  DSIPCNFLLRLLRIGN-MVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDV  1070
             DS+ C+FLLRLLR+ N M+ V  A   ELEKR+  Q EQATL +L+IP ++    T  DV
Sbjct  344   DSVSCSFLLRLLRMANNMLKVAPALITELEKRVGMQFEQATLADLLIPCYNKN-ETTYDV  402

Query  1069  ELVLRLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNL  890
             +LV RL++ F+V  + +++       S       N+N    +VA+LVD YL E + D NL
Sbjct  403   DLVQRLLEHFLVQEQTESSSPSRPPFSDKHVSS-NINAK-TRVARLVDSYLTEVSRDRNL  460

Query  889   TMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASI  710
             ++++F  LA  +P  AR +DD LYR++D+YLKAHP +++ ERKR+C+++D +KLS +A +
Sbjct  461   SLTKFQVLAEALPESARTSDDGLYRAVDSYLKAHPTLTEHERKRLCRVMDCQKLSIDACM  520

Query  709   HAAQNERLPVRTVIQVLLSEQTKLSKQL  626
             HAAQNERLP+R V+QVL SEQ K+S  L
Sbjct  521   HAAQNERLPLRVVVQVLFSEQVKISNAL  548



>ref|XP_002454038.1| hypothetical protein SORBIDRAFT_04g023550 [Sorghum bicolor]
 gb|EES07014.1| hypothetical protein SORBIDRAFT_04g023550 [Sorghum bicolor]
Length=773

 Score =   243 bits (620),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 145/347 (42%), Positives = 208/347 (60%), Gaps = 41/347 (12%)
 Frame = -3

Query  1558  PMGECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTgg-------  1400
             P  + WF+D  +L +D+FV+ ++ IK KG+R +LIG+ ITHYASKWLP LT         
Sbjct  267   PPPDWWFEDVSVLRIDHFVRVVTAIKVKGMRFDLIGASITHYASKWLPGLTKDGPHGGAL  326

Query  1399  ----ggseesiekgGHLIIKFeesssssva-----esvsaSWMKKRFFVETLIGILPPEK  1247
                   ++ S   G H+II                 + SA   ++R  VE+LI I+PP++
Sbjct  327   DEPWAQAQASPGGGLHMIIASGSGGGGGGGGGRDDTTASAPAREQRMVVESLISIIPPQR  386

Query  1246  DSIPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVE  1067
             DS+ C FLLRLLR+  M+    A   ELEKR+  QLEQA L +L+IPS+     T  DV+
Sbjct  387   DSVSCGFLLRLLRLAIMLKAAPALVTELEKRVGMQLEQAVLADLLIPSYGR-ADTAYDVD  445

Query  1066  LVLRLVKRFIVSLEDQAAVMRCSGSSSSGAP----PLNL-----------------NLNL  950
             LV RLV+ F+V  ++Q  ++  S SS  G      P ++                  LN 
Sbjct  446   LVQRLVEHFLV--QEQTELLMASSSSPPGRAGDHQPSSVLPEYYGARTAAAASASAGLNA  503

Query  949   -IKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSK  773
               +VA+L+D YL+E + D NL++++F  LA  +P  AR  DD LYR++D+YLKAHP +++
Sbjct  504   KARVARLLDSYLSEVSRDRNLSLTKFQVLAESLPESARTCDDGLYRAVDSYLKAHPTLTE  563

Query  772   EERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLSEQTKLSK  632
              ERKR+C+++D +KLS +A +HAAQNERLP+R V+QVL SEQ K+S 
Sbjct  564   HERKRLCRVMDCQKLSLDACMHAAQNERLPLRVVVQVLFSEQVKISN  610



>ref|XP_002978524.1| hypothetical protein SELMODRAFT_108722, partial [Selaginella 
moellendorffii]
 gb|EFJ20510.1| hypothetical protein SELMODRAFT_108722, partial [Selaginella 
moellendorffii]
Length=621

 Score =   239 bits (611),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 133/320 (42%), Positives = 199/320 (62%), Gaps = 25/320 (8%)
 Frame = -3

Query  1543  WFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekgGH  1364
             WF+D  +L +D+F K L+ IKAKG++ EL+G++I  YA KW+P L+              
Sbjct  194   WFEDVSMLCIDHFTKVLTAIKAKGMKSELVGAVIMCYALKWIPTLSNTCHESSKTG----  249

Query  1363  LIIKFeesssssvaesvsaSWMKKR--FFVETLIGILPPEKDSIPCNFLLRLLRIGNMVG  1190
                +   +SS ++      +W++ R    VE+++G+LP +K+S+ C FLL++LRI +M+ 
Sbjct  250   ---RAVATSSPAIVTKEDFTWLQARSKLVVESMVGLLPGQKNSVSCGFLLQMLRIASMLN  306

Query  1189  VEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLE-----  1025
                  + ELEKRI+ QLEQATL +L+IPS  H   T  DV LV RLV+ F+   E     
Sbjct  307   ASGPCKVELEKRIAIQLEQATLGDLLIPSAPHVSDTRYDVGLVQRLVEYFLAHEEETSPD  366

Query  1024  -----------DQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQ  878
                        D+A +   + SSS      + + + +KVAKL+D YLAE A D  L +++
Sbjct  367   RSPDAETPSSIDKAKLSFDNKSSSISVLNEHSSGSKMKVAKLLDSYLAEVAHDPQLPLTK  426

Query  877   FIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQ  698
             F ALA  +P ++R   D LYR+ID YLKAHP  ++++RKR+C+++D ++LS+EA +HA+Q
Sbjct  427   FQALADALPVYSRACHDGLYRAIDMYLKAHPTATEQDRKRLCRIMDCQRLSSEARLHASQ  486

Query  697   NERLPVRTVIQVLLSEQTKL  638
             NERLP+RTV+QVL SE  KL
Sbjct  487   NERLPLRTVVQVLFSEHLKL  506



>ref|XP_008455135.1| PREDICTED: root phototropism protein 3 isoform X2 [Cucumis melo]
Length=676

 Score =   240 bits (613),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 134/332 (40%), Positives = 203/332 (61%), Gaps = 33/332 (10%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             + WF+D  IL +D+FV+ ++ IK KG+  E IG+ I +YA KWLP L      E +    
Sbjct  228   DWWFEDVSILRIDHFVRVITAIKVKGMGYEQIGAAIMYYACKWLPGLVNHENGEGTEATN  287

Query  1369  ----------------GHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSI  1238
                              H+++   ++  S++         ++R  +E+LI ILPP+KDS+
Sbjct  288   CSNGSGSSRKYNWNGDLHMVVVNPKNKISTIQVK------ERRMIIESLISILPPQKDSV  341

Query  1237  PCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVL  1058
              C+FLL+LL + N++ V  A   ELEKR+  Q EQATL++L+IPS+ +T  T+ DV+LV 
Sbjct  342   SCSFLLQLLSMANVLKVAPALVTELEKRVGMQFEQATLKDLLIPSY-NTSETMYDVDLVQ  400

Query  1057  RLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNL--------IKVAKLVDDYLAEAAV  902
             RL++ F++    + +   C   S SG   L  +           ++VA+LVD YL E A 
Sbjct  401   RLLEHFLIQELTEDSSPSCQ--SFSGKDALEASQTTASSDQNAKMRVARLVDSYLTEVAR  458

Query  901   DSNLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSA  722
             D NL++++F  LA  +P  AR  DD LYR++D+YLKAHP +S+ ERKR+C+++D +KLS 
Sbjct  459   DRNLSLTKFQVLAEALPESARSCDDGLYRAVDSYLKAHPTLSEHERKRLCRVMDCQKLSV  518

Query  721   EASIHAAQNERLPVRTVIQVLLSEQTKLSKQL  626
             +A +HAAQNERLP+R V+QVL SEQ K++  +
Sbjct  519   DACMHAAQNERLPLRVVVQVLFSEQIKINNAI  550



>ref|XP_010916684.1| PREDICTED: root phototropism protein 3-like [Elaeis guineensis]
 ref|XP_010916685.1| PREDICTED: root phototropism protein 3-like [Elaeis guineensis]
Length=663

 Score =   240 bits (612),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 141/324 (44%), Positives = 196/324 (60%), Gaps = 36/324 (11%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLP----ELTggggsees  1382
             + WF+D   L +D+FV+ ++ IK KG+R ELIG+ I HYA KWLP    E T    +  +
Sbjct  232   DWWFEDVSTLRIDHFVRVVTAIKVKGMRFELIGATIIHYALKWLPGLVSEATHSYDNTWN  291

Query  1381  iekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIG  1202
                   +++        S  +       K+R  VE+LI I+P  KD +PC+FLL+LLR+ 
Sbjct  292   QGGRNMIVVSNSSKEELSGTQVR-----KRRTVVESLITIIPHIKDCVPCSFLLQLLRLA  346

Query  1201  NMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIV----  1034
             NM+ V  A   +LEKRI  QLEQA+L +L+IPS+   C T  DVELV RLV+ F+V    
Sbjct  347   NMLRVAHALIMDLEKRIGMQLEQASLADLLIPSYG-KCETFYDVELVQRLVEHFMVQEQT  405

Query  1033  --------SLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQ  878
                     SL D+    R SG S+             +VA L+D YL+E + D NL  ++
Sbjct  406   EPSSPERESLSDK---HRQSGPSAEA-----------RVAWLLDGYLSEVSRDQNLPPTK  451

Query  877   FIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQ  698
             F  LA  +P  AR + D LYR+ID+YLKAHP +S+ ERKR+C+L+D RKLS +A +HAAQ
Sbjct  452   FQDLAEALPEPARSSHDGLYRAIDSYLKAHPRLSEHERKRLCRLMDCRKLSVDARMHAAQ  511

Query  697   NERLPVRTVIQVLLSEQTKLSKQL  626
             N+RLP+R V+Q+L SEQ K+S  +
Sbjct  512   NDRLPLRFVVQILFSEQVKISNAI  535



>ref|XP_008455134.1| PREDICTED: root phototropism protein 3 isoform X1 [Cucumis melo]
Length=719

 Score =   239 bits (611),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 134/332 (40%), Positives = 203/332 (61%), Gaps = 33/332 (10%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             + WF+D  IL +D+FV+ ++ IK KG+  E IG+ I +YA KWLP L      E +    
Sbjct  271   DWWFEDVSILRIDHFVRVITAIKVKGMGYEQIGAAIMYYACKWLPGLVNHENGEGTEATN  330

Query  1369  ----------------GHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSI  1238
                              H+++   ++  S++         ++R  +E+LI ILPP+KDS+
Sbjct  331   CSNGSGSSRKYNWNGDLHMVVVNPKNKISTIQVK------ERRMIIESLISILPPQKDSV  384

Query  1237  PCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVL  1058
              C+FLL+LL + N++ V  A   ELEKR+  Q EQATL++L+IPS+ +T  T+ DV+LV 
Sbjct  385   SCSFLLQLLSMANVLKVAPALVTELEKRVGMQFEQATLKDLLIPSY-NTSETMYDVDLVQ  443

Query  1057  RLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNL--------IKVAKLVDDYLAEAAV  902
             RL++ F++    + +   C   S SG   L  +           ++VA+LVD YL E A 
Sbjct  444   RLLEHFLIQELTEDSSPSCQ--SFSGKDALEASQTTASSDQNAKMRVARLVDSYLTEVAR  501

Query  901   DSNLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSA  722
             D NL++++F  LA  +P  AR  DD LYR++D+YLKAHP +S+ ERKR+C+++D +KLS 
Sbjct  502   DRNLSLTKFQVLAEALPESARSCDDGLYRAVDSYLKAHPTLSEHERKRLCRVMDCQKLSV  561

Query  721   EASIHAAQNERLPVRTVIQVLLSEQTKLSKQL  626
             +A +HAAQNERLP+R V+QVL SEQ K++  +
Sbjct  562   DACMHAAQNERLPLRVVVQVLFSEQIKINNAI  593



>ref|XP_008795219.1| PREDICTED: root phototropism protein 3-like [Phoenix dactylifera]
Length=706

 Score =   239 bits (610),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 136/307 (44%), Positives = 193/307 (63%), Gaps = 4/307 (1%)
 Frame = -3

Query  1543  WFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekgGH  1364
             WF+D   L +D+FV+ +  IK KG+R ELIG+ I  YAS WLP L               
Sbjct  273   WFEDVSTLRIDHFVRVVVAIKVKGMRFELIGAAIMSYASTWLPGLASEATQNSYDSTWNE  332

Query  1363  LIIKFeesssssvaesvsaSWMKKR-FFVETLIGILPPEKDSIPCNFLLRLLRIGNMVGV  1187
                      +SS  E +S   ++++   VE+LI I+PP KD + C+FLL+LLR+ NM+  
Sbjct  333   RGRNMIGVGNSSKEELLSGMPIREQCMLVESLISIIPPIKDCVSCSFLLQLLRLANMLQA  392

Query  1186  EAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAAVM  1007
               A   +LEKRI  QLEQA+L +L+IPS+S  C T  DVELV RLV+ F+V  ++Q    
Sbjct  393   AHALIEDLEKRIGMQLEQASLADLLIPSYS-KCETFYDVELVRRLVQHFMV--QEQTGPS  449

Query  1006  RCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPTDD  827
                  SSS     +      +VA+L+D YLAE + D +L+ ++F ALA  +P  AR +DD
Sbjct  450   SPGRESSSDKHRQSGASAKARVARLLDGYLAEVSRDQHLSPTEFQALAEALPKSARTSDD  509

Query  826   ALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLSEQ  647
              LYR+ID+YLKAHP +S+  R+R+C+L+D +KLS +A +HAAQN+RLP+R  +Q+L SEQ
Sbjct  510   GLYRAIDSYLKAHPTLSEHGRRRLCRLMDCQKLSVDACMHAAQNDRLPLRFAVQILFSEQ  569

Query  646   TKLSKQL  626
              K+SK +
Sbjct  570   VKISKSI  576



>ref|XP_010691413.1| PREDICTED: root phototropism protein 3 [Beta vulgaris subsp. 
vulgaris]
Length=695

 Score =   238 bits (607),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 142/350 (41%), Positives = 203/350 (58%), Gaps = 56/350 (16%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLP---------------  1415
             + W++D  IL +D+FV+ ++ IK KG+R ELIG+ I  YASKWLP               
Sbjct  228   DWWYEDVSILRIDHFVRVITAIKVKGMRFELIGASIVQYASKWLPGLIRDGGGGSGGGEP  287

Query  1414  ---ELTggggseesiekgG-------------HLIIKFeesssssvaesvsaSWMKKRFF  1283
                ELT    S  +I +               H+I+   +    ++          +R  
Sbjct  288   TLEELTSVCSSNGNISRDSSSSGGSGSWKGGLHMIVSGNKDDPETIKAK------DQRMI  341

Query  1282  VETLIGILPPEKDSIPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPS  1103
             +E+LI I+PP+KDS+ C+FLLRLLR+ N + V  A   ELEKR+  Q EQATL +L+IPS
Sbjct  342   IESLISIIPPQKDSVSCSFLLRLLRMANKLKVAPALVTELEKRVGMQFEQATLSDLLIPS  401

Query  1102  FSHTCGTVLDVELVLRLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNL-----------  956
             +  +  T  DV+LV RL++ F+V  + + A       SS     L+ N+           
Sbjct  402   YDKS-ETTYDVDLVQRLLEHFLVQEQTECA-------SSPSRQYLDKNMYEESQRGAVSS  453

Query  955   NLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVS  776
               ++VA+LVD YL E A D NL +++F  LA  +P  AR  DD LYR+ID+YLKAHP +S
Sbjct  454   AKMRVARLVDSYLTEIARDRNLCLTKFQVLAEALPESARTCDDGLYRAIDSYLKAHPTLS  513

Query  775   KEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLSEQTKLSKQL  626
             + ERKR+C+++D +KLS +A +HAAQNERLP+R V+QVL SEQ K+S  +
Sbjct  514   EHERKRLCRVMDCQKLSIDACMHAAQNERLPLRVVVQVLFSEQVKISNAI  563



>emb|CDY18715.1| BnaA09g06800D [Brassica napus]
Length=724

 Score =   238 bits (606),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 160/422 (38%), Positives = 234/422 (55%), Gaps = 43/422 (10%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggse------  1388
             + WF+D  IL +D+FV+ ++ IK KG+R EL+G+ I HYA KWLP +   G         
Sbjct  254   DWWFEDVSILRIDHFVRVITAIKVKGMRFELLGAAIMHYAGKWLPGVIKEGAPAPCGSNS  313

Query  1387  -------esiekgGHLIIKFeesssssvaesvsaSWM---KKRFFVETLIGILPPEKDSI  1238
                    ++ + G H+++  + ++       ++       ++R  VE+LI I+PP+KDS+
Sbjct  314   SGGSSSHDNWKGGLHMVLSGKPNAHQDSTAYLAGHVTSPKEQRMIVESLISIIPPQKDSV  373

Query  1237  PCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVL  1058
              C FLLRLLR  +M+ V  A   ELEKR+  QLEQATL++L+I        T+ DV+LV 
Sbjct  374   TCTFLLRLLRAASMLKVAPALTTELEKRVGMQLEQATLQDLLIKG-----ETMYDVDLVQ  428

Query  1057  RLVKRFIV----------------SLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVD  926
             RL++ F+V                 +  +A V R  G+S SG    N     ++VA+LVD
Sbjct  429   RLLEHFLVQEQTEGSSPSRMSPSRGMYAEAGVPR--GNSISGNNSNNSQNAKMRVARLVD  486

Query  925   DYLAEAAVDSNLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKL  746
              YL E A D NL +++F  LA  +P  AR  DD LYR+ID+YLKAHP +S+ ERKR+C++
Sbjct  487   GYLTEVARDRNLPLTKFQVLAEALPESARTCDDGLYRAIDSYLKAHPTLSEHERKRLCRV  546

Query  745   IDSRKLSAEASIHAAQNERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasg  566
             +D +KLS +A +HAAQNERLP+R V+QVL SEQ K+S  L         +   A      
Sbjct  547   MDCQKLSMDACMHAAQNERLPLRVVVQVLFSEQVKISNALANTSLKESTTLGEAMGTTYQ  606

Query  565   GTCPRSpnppapgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQI  386
                P +         Q  Q     +K+D+NT+     EI+ +K + + LQ +   MQ Q 
Sbjct  607   PMIP-NRKTLIEATPQSFQARWAAAKKDINTLK---FEIETVKTKYVELQNEMEAMQRQF  662

Query  385   EK  380
             EK
Sbjct  663   EK  664



>ref|XP_002978505.1| hypothetical protein SELMODRAFT_443843 [Selaginella moellendorffii]
 gb|EFJ20491.1| hypothetical protein SELMODRAFT_443843 [Selaginella moellendorffii]
Length=615

 Score =   235 bits (600),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 135/330 (41%), Positives = 198/330 (60%), Gaps = 19/330 (6%)
 Frame = -3

Query  1621  KMEELKMATALPESGTLSSCKPMG--ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGS  1448
             ++  L   T    S  + S +P G  + W +D  IL +D++ + L+ + ++G+R E IG+
Sbjct  183   QLSSLSSHTDFSNSERMESLQPKGPVDWWAEDLSILRIDFYQRVLAAMMSRGLRHETIGA  242

Query  1447  IITHYASKWLPELTggggseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLI  1268
              + HYA + L                   + +    +   V +S +A   ++R  VET++
Sbjct  243   ALMHYAHRALKGFNRKQ------------VARDSSRTKLKVHDSATAIEHEQRILVETIV  290

Query  1267  GILPPEKDSIPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTC  1088
              +LP EK+SI C+FL  LLR   ++    A R +LE+RI  QLE+ATL +L++P+FS++ 
Sbjct  291   SMLPREKNSISCSFLFGLLRTALILDTTVACRIDLEQRIGMQLERATLDDLLVPAFSYSG  350

Query  1087  GTVLDVELVLRLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEA  908
              T+ DV+++ R+V  F+    D   VM     S  GA P    L  ++VAKL+D YLAE 
Sbjct  351   DTLFDVDIIHRIVVSFLKQESDDNKVMY---ESDGGASPSQSAL--MRVAKLMDGYLAEV  405

Query  907   AVDSNLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKL  728
             A D NL +S+FIALA   P HAR  DD+LYR++D YLKAHP +S  ERK++CKL+D +KL
Sbjct  406   APDPNLKVSKFIALAELFPDHARLVDDSLYRAVDIYLKAHPALSDLERKKLCKLLDVQKL  465

Query  727   SAEASIHAAQNERLPVRTVIQVLLSEQTKL  638
             S EA  HAAQNERLPV+ V+QVL  EQ +L
Sbjct  466   SQEACQHAAQNERLPVQMVVQVLYYEQMRL  495



>gb|KDP40950.1| hypothetical protein JCGZ_24949 [Jatropha curcas]
Length=664

 Score =   236 bits (603),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 156/407 (38%), Positives = 230/407 (57%), Gaps = 40/407 (10%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             + WF+D  IL +D+FV+ ++ IK KG+R ELIG+ I  YA+KWLP L   G         
Sbjct  228   DWWFEDVSILRIDHFVRVITAIKVKGMRFELIGAAIMQYAAKWLPGLIKDGAGPVDEGSN  287

Query  1369  G------------HLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNF  1226
                          H+I+   +    SV          +R  +E+LI I+P +KDS+ C+F
Sbjct  288   SSNSSSSSWKGGLHMIVAGTKDDIPSVQAK------DQRLIIESLISIIPQQKDSVSCSF  341

Query  1225  LLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVK  1046
             LLRLLR+ NM+ V  A   ELEKR+  Q EQATL +L+IPS+  +  T+ DV+LV RL++
Sbjct  342   LLRLLRMANMLKVAPALVTELEKRVGMQFEQATLADLLIPSYDKS-ETLYDVDLVQRLLE  400

Query  1045  RFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIAL  866
              F+V  ++Q      S    S     N N  + +VA+LVD YL E + D NL++++F  L
Sbjct  401   HFLV--QEQTENSSPSRQPFSDQRVTNPNAKM-RVARLVDSYLTEVSRDRNLSLTKFQVL  457

Query  865   AAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERL  686
             A  +P  AR  DD LYR+ID+YLKAHP +S+ ERKR+C+++D +KLS +A +HAAQNERL
Sbjct  458   AEALPESARTCDDGLYRAIDSYLKAHPTLSEHERKRLCRVMDCQKLSIDACMHAAQNERL  517

Query  685   PVRTVIQVLLSEQTKLSKQL----MRQLEWsggsfisasagasgGTCPRSpnppapgaqq  518
             P+R V+QVL SEQ K+S  L    +++   +    +  +        P+S          
Sbjct  518   PLRVVVQVLFSEQVKISNALASSSLKEAGEAQYQPMIPNRKTLLEGTPQSFQEGW-----  572

Query  517   qqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKL  377
                     +K+D+NT+     E+  +K + + LQ    N+Q Q +KL
Sbjct  573   ------TAAKKDINTLK---FELDSVKTKYIELQNDMENLQRQFDKL  610



>dbj|BAD17765.1| putative non-phototropic hypocotyl 3 (NPH3) [Oryza sativa Japonica 
Group]
 dbj|BAD17773.1| putative non-phototropic hypocotyl 3 (NPH3) [Oryza sativa Japonica 
Group]
Length=771

 Score =   238 bits (607),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 162/444 (36%), Positives = 238/444 (54%), Gaps = 47/444 (11%)
 Frame = -3

Query  1585  ESGTLSSCKPMGECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELT  1406
             ES       P  + WF+D  +L +D+FV+ ++ IK KG+R +LIG+ ITHYASKWLP LT
Sbjct  259   ESSPSRQAVPPADWWFEDVSVLRIDHFVRVVTAIKVKGMRFDLIGAAITHYASKWLPGLT  318

Query  1405  ggg--------------gseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLI  1268
                               +         +II         V  + SA   ++R  VE++I
Sbjct  319   KDAPLGATHDEPWAQASAAGVGGGGLHMMIISGAGGGKDDVLAACSAPSREQRMVVESII  378

Query  1267  GILPPEKDSIPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFS-HT  1091
              I PP++DS+ C FLLRLLR+  M+    A   ELEKR+  QLEQA L +L+IPS+    
Sbjct  379   SITPPQRDSVSCGFLLRLLRLAIMLRAAPALVTELEKRVGMQLEQAALADLLIPSYGGRA  438

Query  1090  CGTVLDVELVLRLVKRFIVSLEDQAAVMRCSGSS-----------SSGAPPLNL------  962
               T  DV+LV RLV+ F+V  + + AV    G             S   PP +       
Sbjct  439   ADTAYDVDLVQRLVEHFLVQEQTEMAVASSPGRGDPPPPPQPEYYSGRMPPSSAAAASAS  498

Query  961   ----NLNL-IKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPTDDALYRSIDTYL  797
                  LN   +VA+L+D YL+E + D NL++++F  LA  +P  AR  DD LYR++D+YL
Sbjct  499   ASTGGLNAKARVARLLDSYLSEVSRDRNLSLTKFQVLAESLPESARACDDGLYRAVDSYL  558

Query  796   K------AHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLSEQTKLS  635
             K      AHP +++ ERKR+C+++D +KLS +A +HAAQNERLP+R V+QVL +EQ K+S
Sbjct  559   KVTSTLQAHPTLTEHERKRLCRVMDCQKLSFDACMHAAQNERLPLRVVVQVLFTEQVKIS  618

Query  634   KQLMRQLEWsggsfisasagasgGTCPRSpnppapgaqqqqqdPRCMSKRDMNTINIQHL  455
               L      +  S  SA    +    P +      G  Q  Q+    +K+D+NT+     
Sbjct  619   NALASSSA-ALRSSSSAPGADAAPAMPTTRRQLLDGTPQSFQEGWAAAKKDINTLK---F  674

Query  454   EIKKLKEEVLRLQTQCINMQAQIE  383
             E++ +K + L LQ +   +Q Q++
Sbjct  675   ELESMKAKYLELQHEMDALQKQVD  698



>ref|XP_002970426.1| hypothetical protein SELMODRAFT_231529 [Selaginella moellendorffii]
 gb|EFJ28556.1| hypothetical protein SELMODRAFT_231529 [Selaginella moellendorffii]
Length=603

 Score =   234 bits (596),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 134/330 (41%), Positives = 198/330 (60%), Gaps = 19/330 (6%)
 Frame = -3

Query  1621  KMEELKMATALPESGTLSSCKPMG--ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGS  1448
             ++  L   T    S  + + +P G  + W +D  IL +D++ + L+ + ++G+R E IG+
Sbjct  171   QLSSLSSHTDFSNSERMETLQPKGPVDWWAEDLSILRIDFYQRVLAAMMSRGLRHETIGA  230

Query  1447  IITHYASKWLPELTggggseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLI  1268
              + HYA + L                   + +    +   V +S +A   ++R  VET++
Sbjct  231   ALMHYAHRALKGFNRKQ------------VARDSSRTKLKVHDSATAIEHEQRILVETIV  278

Query  1267  GILPPEKDSIPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTC  1088
              +LP EK+SI C+FL  LLR   ++    A R +LE+RI  QLE+ATL +L++P+FS++ 
Sbjct  279   SMLPREKNSISCSFLFGLLRTALILDTTMACRIDLEQRIGMQLERATLDDLLVPAFSYSG  338

Query  1087  GTVLDVELVLRLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEA  908
              T+ DV+++ R+V  F+    D   VM     S  GA P    L  ++VAKL+D YLAE 
Sbjct  339   DTLFDVDIIHRIVVSFLKQESDDNKVMY---ESDGGASPSQSAL--MRVAKLMDGYLAEV  393

Query  907   AVDSNLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKL  728
             A D NL +S+FIALA   P HAR  DD+LYR++D YLKAHP +S  ERK++CKL+D +KL
Sbjct  394   APDPNLKVSKFIALAELFPDHARLVDDSLYRAVDIYLKAHPALSDLERKKLCKLLDVQKL  453

Query  727   SAEASIHAAQNERLPVRTVIQVLLSEQTKL  638
             S EA  HAAQNERLPV+ V+QVL  EQ +L
Sbjct  454   SQEACQHAAQNERLPVQMVVQVLYYEQMRL  483



>gb|KCW63332.1| hypothetical protein EUGRSUZ_G00960 [Eucalyptus grandis]
Length=667

 Score =   233 bits (594),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 154/409 (38%), Positives = 225/409 (55%), Gaps = 43/409 (11%)
 Frame = -3

Query  1543  WFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekgG-  1367
             WF+D  IL +D+FV+ ++ IK KG+R ELIG  I  YA+KWLP L   G           
Sbjct  230   WFEDVSILRIDHFVRVVTAIKVKGMRFELIGEAIMQYATKWLPGLIRDGAGAGDEGSNSG  289

Query  1366  ---------------HLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPC  1232
                            H+I+   +   S+V          +R  +E+LI I+PP+KDS+ C
Sbjct  290   NNHSSSGSASWKGGLHMIVAGTKDEPSTVQAK------DQRMIIESLISIIPPQKDSVTC  343

Query  1231  NFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRL  1052
             +FLLRLLR+ NM+ V  A   ELEKR+  Q EQA+L +L+IPS+ +   T+ DV+LV RL
Sbjct  344   SFLLRLLRMANMLKVAPALVTELEKRVGMQFEQASLADLLIPSY-NKIETLYDVDLVQRL  402

Query  1051  VKRFIVSLE-DQAAVMRCSGSSSSG---APPLNLNLNLIKVAKLVDDYLAEAAVDSNLTM  884
             ++ F+V  + + ++  R   S   G   A  +N     ++VA+LVD YL E + D NL++
Sbjct  403   LEHFLVQEQMEGSSPSRQPFSEKHGYDAAQRVNGQNAKMRVARLVDSYLTEVSRDRNLSL  462

Query  883   SQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHA  704
             ++F  LA  +P  AR  DD LYR+ID+YL       K ERKR+C+++D +KLS +A +HA
Sbjct  463   TKFQVLAEALPESARTCDDGLYRAIDSYL-------KHERKRLCRVMDCQKLSIDACMHA  515

Query  703   AQNERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapga  524
             AQNERLP+R V+QVL SEQ K+S  L      S     +          P +        
Sbjct  516   AQNERLPLRVVVQVLFSEQVKISNTLA-----SSSLKETGGDAHYQPMIP-NRKTLLEAT  569

Query  523   qqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKL  377
              Q  Q+    +K+D+NT+     E+  +K + L LQ    N+Q Q +K+
Sbjct  570   PQSFQEGWAAAKKDINTLK---FELDSMKAKYLELQNDMENLQRQFDKM  615



>ref|XP_009623089.1| PREDICTED: putative BTB/POZ domain-containing protein DOT3 [Nicotiana 
tomentosiformis]
Length=626

 Score =   228 bits (582),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 121/310 (39%), Positives = 189/310 (61%), Gaps = 21/310 (7%)
 Frame = -3

Query  1543  WFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekgGH  1364
             WFDD   L +++F++ ++ I+ KG++PE+IGS I HY  KWLP +       ++      
Sbjct  217   WFDDIATLRINFFLRIITAIRVKGIKPEIIGSCIMHYGEKWLPNMNSETKGTDNKYGSRR  276

Query  1363  LIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMVGVE  1184
                ++  +S      S+  +  ++R  +E+LI ILPP+K++I C FLLRLL++  +    
Sbjct  277   NDSQWSITSGRMQETSIGQNNKEQRTIIESLISILPPQKEAISCKFLLRLLKMAILYAAS  336

Query  1183  AAYRAELEKRISWQLEQATLRELMIPSF--------SHTCGTVLDVELVLRLVKRFIVSL  1028
              A  +ELEKRI   LE A+  +L+IP++        S    T+ ++++V R++  F++  
Sbjct  337   PALISELEKRIGMALENASPNDLLIPTYAVSEQTIISTEEQTIYNIDVVQRILDYFLL-Y  395

Query  1027  EDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPT  848
             E Q    +   S++            + ++KLVD YLAE A D N+++++F  LA  +P 
Sbjct  396   EHQKLQQQEPKSTT------------VNISKLVDSYLAEIARDHNVSITKFQVLAESLPR  443

Query  847   HARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVI  668
             H R   D LYR+IDTYLK HP +S+ +R+R+CK++DS KLS +A +HAAQNERLP+R VI
Sbjct  444   HVRTCHDGLYRAIDTYLKTHPSLSEHDRRRLCKIMDSEKLSLDACMHAAQNERLPLRIVI  503

Query  667   QVLLSEQTKL  638
             QVLLSEQ K+
Sbjct  504   QVLLSEQVKM  513



>gb|EAZ10750.1| hypothetical protein OsJ_00587 [Oryza sativa Japonica Group]
Length=487

 Score =   224 bits (572),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 158/407 (39%), Positives = 234/407 (57%), Gaps = 59/407 (14%)
 Frame = -3

Query  1537  DDACILDMDYFVKTLSGIKAK-------GVRPELIGSIITHYASKWLPELTggggseesi  1379
             DD+C+ D++ F +T++  K++         RP+++ S+++HYA+KWLP++     S    
Sbjct  45    DDSCVNDVENFARTVAAAKSRQLVGSSAASRPDMLASVLSHYAAKWLPDVVAASSSS---  101

Query  1378  ekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDS-----------IPC  1232
                         S      ES +A+W+KKR  +E+L+  LPP+  +           I C
Sbjct  102   -----SSPATSASGRFLPPESPTATWLKKRLLLESLVAALPPDPPAPAGGGGAADDGITC  156

Query  1231  NFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFS--HTCGTVLDVELVL  1058
             +FLL+LLR G+MVG +AA   ELE R + +++QA L  +MI +F   + CG +L+V LVL
Sbjct  157   DFLLKLLRAGSMVGADAALLQELESRAARRVDQAKLGAVMITAFGQGYACGKLLEVPLVL  216

Query  1057  RLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQ  878
              LV+ F   L+D  A    +  +              +VA+LVD YLAEAA+++ L  ++
Sbjct  217   GLVRGF---LKDAGAGGGGAAKAGG-----GGGAAAARVARLVDAYLAEAALEAGLRPAE  268

Query  877   FIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQ  698
             F  LA  +P HARP DDALYR++DTYLKAH   SKEERK +C+LID+RKL+AEA+ HA Q
Sbjct  269   FEELARAVPGHARPADDALYRAVDTYLKAHASTSKEERKSLCRLIDARKLTAEAAAHAVQ  328

Query  697   NERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapgaqq  518
             N+RLPVR+V+QVL SE  KL++     L    G   S  A +     P +          
Sbjct  329   NDRLPVRSVLQVLFSEHGKLNR-----LAELSGGASSFGAPSPAFDLPGA----------  373

Query  517   qqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKL  377
                  RC SKR+   +  QH E+++L+E+  RLQ QC  +QAQ+++L
Sbjct  374   -----RCPSKRE---VLAQHHELRRLREDFARLQVQCSALQAQVDRL  412



>ref|XP_004968398.1| PREDICTED: coleoptile phototropism protein 1-like [Setaria italica]
Length=482

 Score =   224 bits (570),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 156/401 (39%), Positives = 233/401 (58%), Gaps = 59/401 (15%)
 Frame = -3

Query  1525  ILDMDYFVKTLSGIKAKGV---RPELIGSIITHYASKWLPELTggggseesiekgGHLII  1355
             + D+D F +T++ +K+K     RP+++ S+++HYA+KWLP++     +           +
Sbjct  50    VNDVDNFARTVAAVKSKSASCARPDMLASVLSHYAAKWLPDVAPPPLASSPASSASGRFL  109

Query  1354  KFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDS---------------IPCNFLL  1220
                        ES +A+W+KKR  +E+L+  LPP+  +               I C+FLL
Sbjct  110   P---------PESPTATWLKKRLLLESLVAALPPDPPAPGCGGGGAGGGGDDGITCDFLL  160

Query  1219  RLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSH---TCGTVLDVELVLRLV  1049
             +LLR G+MVG +AA   +LE R + +L+QATL  +MIP+F H       +LDV LVLRLV
Sbjct  161   KLLRAGSMVGADAALLRDLEARAARRLDQATLGAVMIPAFGHAGENAALLLDVPLVLRLV  220

Query  1048  KRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIA  869
             + F+     +      S  +SS A          +VA+LVD YLAEAA+++ L  ++F  
Sbjct  221   RGFL-----KEGAAASSNKASSAAAVGGGGAAAARVARLVDAYLAEAALEAGLRPAEFEE  275

Query  868   LAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNER  689
             LA  +P HARP DDALYR++DTYLKAHP  +KEERK +C+LID+RKL+AEA+ HA QNER
Sbjct  276   LARAVPAHARPADDALYRAVDTYLKAHPNTAKEERKLLCRLIDARKLTAEAAAHAVQNER  335

Query  688   LPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRSpnppapgaqqqqq  509
             +PVR+V+QVL SE  KL++                +  ++  + PR+           + 
Sbjct  336   MPVRSVMQVLFSEHGKLNR---------------LAELSASFSGPRT------PNPALEL  374

Query  508   dPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQI  386
               RC SKR+   +  QH E+++L+E+V RLQ QC  +QAQ+
Sbjct  375   PGRCPSKRE---VLAQHQEVRRLREDVARLQVQCNALQAQV  412



>ref|XP_001770455.1| predicted protein [Physcomitrella patens]
 gb|EDQ64792.1| predicted protein [Physcomitrella patens]
Length=622

 Score =   226 bits (577),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 132/313 (42%), Positives = 188/313 (60%), Gaps = 25/313 (8%)
 Frame = -3

Query  1558  PMGECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesi  1379
             PM + W +D  +L +D++ + L+ ++ KG+R E IG  + H+A + L  L         +
Sbjct  202   PMADWWAEDLAVLRIDFYQRVLAAMRMKGLRVESIGGALMHFAQRSLKGLNRKQNGRSDL  261

Query  1378  ekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGN  1199
             +      IK                  ++R  VET++ +LPPEK++  C+FL  LLR   
Sbjct  262   KPPK---IKH-----------------EQRILVETIVSLLPPEKNTASCSFLFGLLRTAI  301

Query  1198  MVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIV--SLE  1025
             ++    A R +LEKRI  QLEQATL +L+IPSFS+T  T+ D ++V R+V  F+     E
Sbjct  302   ILDTTLACRLDLEKRIGMQLEQATLDDLLIPSFSYTGDTLFDNDIVHRIVVNFLQQDDSE  361

Query  1024  DQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTH  845
             D         S   G+P  +    ++KVAKLVD YLAE A D+NL +S+FIALA  +P +
Sbjct  362   DSQVAHPMYDSDGGGSPSQSA---MMKVAKLVDSYLAEIAPDANLKLSKFIALAEILPDY  418

Query  844   ARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQ  665
             AR  DD LYR+ID YLKAHP +S+ +RK++CKL+D +KLS EA  HAAQNERLPV+ V+Q
Sbjct  419   ARVVDDGLYRAIDIYLKAHPALSEVDRKKICKLMDCQKLSQEACTHAAQNERLPVQVVVQ  478

Query  664   VLLSEQTKLSKQL  626
             VL  EQ ++   L
Sbjct  479   VLYFEQVRMRNAL  491



>ref|XP_006386870.1| hypothetical protein POPTR_0002s24380g [Populus trichocarpa]
 gb|ERP64667.1| hypothetical protein POPTR_0002s24380g [Populus trichocarpa]
Length=499

 Score =   223 bits (568),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 128/312 (41%), Positives = 180/312 (58%), Gaps = 20/312 (6%)
 Frame = -3

Query  1561  KPMGECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggsees  1382
             K  G+ W +D  +L +D + + ++ +K +GVRPE IG+ + +YA K   ELT        
Sbjct  87    KREGDWWIEDLSVLRIDLYQRVMTAMKCRGVRPESIGASLVNYAQK---ELTKKSSLWNP  143

Query  1381  iekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIG  1202
               +    +I                    +R  VET++ +LP EK ++P  FL  LLR  
Sbjct  144   SSQTKVDLISTG----------------HERLVVETIVNLLPVEKLAVPITFLFGLLRSA  187

Query  1201  NMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLED  1022
              M+    A R +LE+RI  QL+ ATL +L+IPSF H   T+ DV+ V R++  F    +D
Sbjct  188   VMLDCTIACRLDLERRIGSQLDVATLDDLLIPSFRHAGDTLFDVDTVHRILVNF-SQQDD  246

Query  1021  QAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHA  842
                 M  +    S +P       L KVAKLVD+YLAE A D+NL +S+F+ +A  +PTHA
Sbjct  247   SEDDMEDASVFESDSPHSPSQTALFKVAKLVDNYLAEIAPDANLKLSKFMVIAETLPTHA  306

Query  841   RPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQV  662
             R   D LYR+ID YLKAH G+S  +RK++CKLID +KLS EA  HAAQNERLP++ ++QV
Sbjct  307   RTVHDGLYRAIDIYLKAHQGLSDSDRKKLCKLIDFQKLSQEAGAHAAQNERLPLQAIVQV  366

Query  661   LLSEQTKLSKQL  626
             L  EQ +L   L
Sbjct  367   LYFEQIRLRNAL  378



>ref|XP_004960831.1| PREDICTED: coleoptile phototropism protein 1-like [Setaria italica]
Length=481

 Score =   221 bits (564),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 161/420 (38%), Positives = 225/420 (54%), Gaps = 54/420 (13%)
 Frame = -3

Query  1588  PESGTLSSCKPMGECWFDDACIL-DMDYFVKTLSGIKAK-------GVRPELIGSIITHY  1433
             PES  LS          DD+C++ D+D F +T++ I++K             + S+++HY
Sbjct  28    PESSRLSYSAATPSRASDDSCVVNDVDAFARTIAAIRSKPPSAAAASGGSSSLASVLSHY  87

Query  1432  ASKWLPELTggggseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPP  1253
             A++WLP+      S            +F      S   +    W+KKR  +E+L+  LPP
Sbjct  88    AARWLPDAASASPSG-----------RFVLLPPESPTAA----WLKKRLLLESLVAALPP  132

Query  1252  EKDS----IPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSH--T  1091
             +       I C+FLLRLLR G+ VG +AA   +LE R + +L+QA+L  +MIP+F     
Sbjct  133   DDGGGGDGITCDFLLRLLRAGSTVGADAALLGDLEARAARRLDQASLGAVMIPAFGGLAP  192

Query  1090  CG---TVLDVELVLRLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDY  920
             C    T+LDV LVLRLV+ F+                              +VA+LVD Y
Sbjct  193   CAPSPTLLDVPLVLRLVRGFLREGASGGGGG----------------AAAARVARLVDAY  236

Query  919   LAEAAVDSNLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLID  740
             LAEAA+++ L   +F  LA  +P HAR T D LYR++DTYLKAHP  SKEER+ +C+LID
Sbjct  237   LAEAALEAGLRPVEFEELARAVPAHARATADGLYRAVDTYLKAHPRASKEERRSLCRLID  296

Query  739   SRKLSAEASIHAAQNERLPVRTVIQVL-LSEQTKLSKQLMRQLEWsggsfisasagasgG  563
              RKL+AEA+ HA QN+RLP R V+QVL LSE         R  EWSGGS        S  
Sbjct  297   PRKLTAEAAAHAVQNDRLPARFVVQVLFLSEHGGGKLGHHRLAEWSGGSSFRDLQSRSPA  356

Query  562   TCPRSpnppapgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIE  383
                 +     P A       RC SKR++  +  QH E+++L+E+V RLQ QC  +QAQ++
Sbjct  357   P---AGGLELPSAAVGTAGARCPSKREV--VAAQHHELRRLREDVARLQVQCHALQAQVD  411



>ref|XP_004975049.1| PREDICTED: coleoptile phototropism protein 1-like isoform X1 
[Setaria italica]
Length=640

 Score =   224 bits (572),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 124/318 (39%), Positives = 193/318 (61%), Gaps = 20/318 (6%)
 Frame = -3

Query  1558  PMGECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesi  1379
             P  + W DD C+L +D+FV+ ++ ++AKG+R +L+G+ IT Y+ KWL  +     S    
Sbjct  243   PPPDWWVDDVCVLRIDHFVRVITAVQAKGMRGDLVGAAITRYSFKWL-NIKESPASHGHG  301

Query  1378  ekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGN  1199
                  ++I  E  + ++          ++R  VE+LI I+P +KDS+ C+FLLRLLR+  
Sbjct  302   HCALEIVIAGEGDTQTTPETDS-----EQRMVVESLISIIPAQKDSVSCSFLLRLLRLAV  356

Query  1198  MVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCG-----TVLDVELVLRLVKRFIV  1034
              +    A   E+EKR+  QL+QA L +++IPS S+  G        DV+LV RLV++F+V
Sbjct  357   TLKAAPALVTEVEKRVGMQLDQAALSDILIPSSSYPYGRLRSDAAYDVDLVQRLVEQFVV  416

Query  1033  SLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPI  854
               ++Q+       SSS+ +     N    +VA L+D YL+E + D +L + +F ALA  +
Sbjct  417   --QEQS-------SSSTPSRGKEENTRSQRVASLIDSYLSEVSRDRHLPLGKFQALAESV  467

Query  853   PTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRT  674
             P  AR   D LYR++D+YLKAHP  ++ ERKR+C+ +D  KLS E   HAA+NERLP+R 
Sbjct  468   PEPARGCHDGLYRAVDSYLKAHPAATEHERKRLCRAVDCGKLSREVRAHAAENERLPLRV  527

Query  673   VIQVLLSEQTKLSKQLMR  620
              ++VLL+EQ K++  + R
Sbjct  528   AVRVLLAEQAKMAASIGR  545



>ref|XP_003566481.2| PREDICTED: coleoptile phototropism protein 1-like [Brachypodium 
distachyon]
Length=534

 Score =   222 bits (566),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 154/414 (37%), Positives = 221/414 (53%), Gaps = 61/414 (15%)
 Frame = -3

Query  1546  CWFDDACILDMDYFVKTLSGIKAK-GVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             C      I D+D F +T++ I++K     + + S+++HYA++WLP++             
Sbjct  85    CAEASVVINDVDAFARTVAAIRSKPAASDDSLASVLSHYAARWLPDVASSSSPSG-----  139

Query  1369  GHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEK------------DSIPCNF  1226
                  +F+        ES +A+W+KKR  +E+L+  LPPE+              I C+F
Sbjct  140   -----RFQFPQQQHPPESPTATWLKKRLLLESLVAALPPEEPDAGAGDDDGNDSGIACDF  194

Query  1225  LLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFS----------HTCGTVL  1076
             LLRLLR G+MVG + A   +LE R + +L+QA+L  +MIP+F               T+L
Sbjct  195   LLRLLRAGSMVGADRALLGDLEARAARRLDQASLGAVMIPAFGLQGHGGPARDRHPATLL  254

Query  1075  DVELVLRLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDS  896
             DV LVLRLV+ F+                              KVA LVD YLAEAA+++
Sbjct  255   DVGLVLRLVRGFLREG--------------------AKAGAAAKVAMLVDAYLAEAALEA  294

Query  895   NLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEA  716
              L   +F  LA  +P HAR  DD LYR++DTYLK HP  SKEER+ +C+LID+RKLSAEA
Sbjct  295   GLRPLEFEELARAVPAHARAADDGLYRAVDTYLKVHPQASKEERRSLCRLIDARKLSAEA  354

Query  715   SIHAAQNERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfisasagasgGTCPRS-pnp  539
             + HA QN+RLPVR V+QVL S  ++   +L R  +WS      +         PRS    
Sbjct  355   AAHAVQNDRLPVRCVVQVLFS--SEHGGKLSRLADWSAAGSFRSLQQH----TPRSPAAL  408

Query  538   papgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQCINMQAQIEKL  377
                 +       RC SKR+      QH E+++L+E+V RLQ QC  +QAQ+++L
Sbjct  409   DLSSSSASAIAARCPSKREAVAQQQQH-ELRRLREDVARLQVQCHALQAQVDRL  461



>ref|XP_004975050.1| PREDICTED: coleoptile phototropism protein 1-like isoform X2 
[Setaria italica]
Length=639

 Score =   224 bits (571),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 124/318 (39%), Positives = 193/318 (61%), Gaps = 20/318 (6%)
 Frame = -3

Query  1558  PMGECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesi  1379
             P  + W DD C+L +D+FV+ ++ ++AKG+R +L+G+ IT Y+ KWL  +     S    
Sbjct  242   PPPDWWVDDVCVLRIDHFVRVITAVQAKGMRGDLVGAAITRYSFKWL-NIKESPASHGHG  300

Query  1378  ekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGN  1199
                  ++I  E  + ++          ++R  VE+LI I+P +KDS+ C+FLLRLLR+  
Sbjct  301   HCALEIVIAGEGDTQTTPETDS-----EQRMVVESLISIIPAQKDSVSCSFLLRLLRLAV  355

Query  1198  MVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCG-----TVLDVELVLRLVKRFIV  1034
              +    A   E+EKR+  QL+QA L +++IPS S+  G        DV+LV RLV++F+V
Sbjct  356   TLKAAPALVTEVEKRVGMQLDQAALSDILIPSSSYPYGRLRSDAAYDVDLVQRLVEQFVV  415

Query  1033  SLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPI  854
               ++Q+       SSS+ +     N    +VA L+D YL+E + D +L + +F ALA  +
Sbjct  416   --QEQS-------SSSTPSRGKEENTRSQRVASLIDSYLSEVSRDRHLPLGKFQALAESV  466

Query  853   PTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRT  674
             P  AR   D LYR++D+YLKAHP  ++ ERKR+C+ +D  KLS E   HAA+NERLP+R 
Sbjct  467   PEPARGCHDGLYRAVDSYLKAHPAATEHERKRLCRAVDCGKLSREVRAHAAENERLPLRV  526

Query  673   VIQVLLSEQTKLSKQLMR  620
              ++VLL+EQ K++  + R
Sbjct  527   AVRVLLAEQAKMAASIGR  544



>ref|XP_011024680.1| PREDICTED: BTB/POZ domain-containing protein At5g48800 [Populus 
euphratica]
Length=610

 Score =   223 bits (567),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 128/312 (41%), Positives = 180/312 (58%), Gaps = 20/312 (6%)
 Frame = -3

Query  1561  KPMGECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggsees  1382
             K  G+ W +D  +L +D + + ++ +K +GVRPE IG+ + +YA K   ELT        
Sbjct  198   KREGDWWIEDLSVLRIDLYQRVMTAMKCRGVRPESIGASLVNYAQK---ELTKKSSLWNP  254

Query  1381  iekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIG  1202
               +    +I                    +R  VET++ +LP EK ++P  FL  LLR  
Sbjct  255   SSQTKVDLISTG----------------HERLVVETIVNLLPVEKLAVPITFLFGLLRSA  298

Query  1201  NMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLED  1022
              M+    A R +LE+RI  QL+ ATL +L+IPSF H   T+ DV+ V R++  F    +D
Sbjct  299   VMLDCTIACRLDLERRIGSQLDVATLDDLLIPSFRHAGDTLFDVDTVHRILVNF-SQQDD  357

Query  1021  QAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHA  842
                 M  +    S +P       L KVAKLVD+YLAE A D+NL +S+F+ +A  +PTHA
Sbjct  358   SEDDMEDASVFESDSPHSPSQTALFKVAKLVDNYLAEIAPDANLKLSKFMVIAETLPTHA  417

Query  841   RPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQV  662
             R   D LYR+ID YLKAH G+S  +RK++CKLID +KLS EA  HAAQNERLP++ ++QV
Sbjct  418   RTVHDGLYRAIDIYLKAHQGLSDSDRKKLCKLIDFQKLSQEAGAHAAQNERLPLQAIVQV  477

Query  661   LLSEQTKLSKQL  626
             L  EQ +L   L
Sbjct  478   LYFEQIRLRNAL  489



>ref|XP_002301784.2| hypothetical protein POPTR_0002s24380g [Populus trichocarpa]
 gb|EEE81057.2| hypothetical protein POPTR_0002s24380g [Populus trichocarpa]
Length=610

 Score =   223 bits (567),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 128/312 (41%), Positives = 180/312 (58%), Gaps = 20/312 (6%)
 Frame = -3

Query  1561  KPMGECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggsees  1382
             K  G+ W +D  +L +D + + ++ +K +GVRPE IG+ + +YA K   ELT        
Sbjct  198   KREGDWWIEDLSVLRIDLYQRVMTAMKCRGVRPESIGASLVNYAQK---ELTKKSSLWNP  254

Query  1381  iekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIG  1202
               +    +I                    +R  VET++ +LP EK ++P  FL  LLR  
Sbjct  255   SSQTKVDLISTG----------------HERLVVETIVNLLPVEKLAVPITFLFGLLRSA  298

Query  1201  NMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLED  1022
              M+    A R +LE+RI  QL+ ATL +L+IPSF H   T+ DV+ V R++  F    +D
Sbjct  299   VMLDCTIACRLDLERRIGSQLDVATLDDLLIPSFRHAGDTLFDVDTVHRILVNF-SQQDD  357

Query  1021  QAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHA  842
                 M  +    S +P       L KVAKLVD+YLAE A D+NL +S+F+ +A  +PTHA
Sbjct  358   SEDDMEDASVFESDSPHSPSQTALFKVAKLVDNYLAEIAPDANLKLSKFMVIAETLPTHA  417

Query  841   RPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQV  662
             R   D LYR+ID YLKAH G+S  +RK++CKLID +KLS EA  HAAQNERLP++ ++QV
Sbjct  418   RTVHDGLYRAIDIYLKAHQGLSDSDRKKLCKLIDFQKLSQEAGAHAAQNERLPLQAIVQV  477

Query  661   LLSEQTKLSKQL  626
             L  EQ +L   L
Sbjct  478   LYFEQIRLRNAL  489



>ref|XP_008776569.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein 
At5g48800 [Phoenix dactylifera]
Length=608

 Score =   221 bits (563),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 131/315 (42%), Positives = 181/315 (57%), Gaps = 26/315 (8%)
 Frame = -3

Query  1561  KPMGECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWL---PELTggggs  1391
             K  G+ W +D  +L +D + + +  +K +GV PE IG+ + +YA K     P L      
Sbjct  203   KCNGDWWIEDLSVLRIDLYQRVIEAMKCRGVHPESIGASLVNYAEKLFKRKPAL------  256

Query  1390  eesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLL  1211
                     HL +     S             +++  VET+  +LP EK ++P +FL  LL
Sbjct  257   ---WTATSHLRVGLMPGSI----------GFEEKTVVETIASLLPAEKLAVPMSFLFGLL  303

Query  1210  RIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVS  1031
             R   M+    + R  LE+RI  QLE ATL +L+IPSF H   T+ DV+ V R++   I S
Sbjct  304   RSAVMLDCTMSCRLSLERRIGSQLEMATLDDLLIPSFQHAGDTLFDVDTVHRIL--VIFS  361

Query  1030  LEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIP  851
              +D++        S    PP    L  +KVAKLVD YLAE A D+NL +++FI +A  +P
Sbjct  362   QQDESEDGGLGYDSDGPNPPSQTAL--VKVAKLVDSYLAEIATDANLKLAKFIVIAXTLP  419

Query  850   THARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTV  671
              +AR TDD LYR+ID YLKAH G+S  ERKR+CKLID +KLS EAS HAAQNERLP++ +
Sbjct  420   GYARTTDDGLYRAIDIYLKAHQGLSDLERKRLCKLIDFQKLSEEASAHAAQNERLPLQAI  479

Query  670   IQVLLSEQTKLSKQL  626
             +QVL  EQ +L   L
Sbjct  480   VQVLYIEQLRLRNAL  494



>ref|XP_001764279.1| predicted protein [Physcomitrella patens]
 gb|EDQ70833.1| predicted protein [Physcomitrella patens]
Length=561

 Score =   219 bits (558),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 128/317 (40%), Positives = 179/317 (56%), Gaps = 29/317 (9%)
 Frame = -3

Query  1570  SSCKPMGECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggs  1391
             S   P+ E W +D  +L  D+F + L+ ++ KG+R E +G  + HYA + L  +      
Sbjct  181   SPAAPVVEWWAEDLAVLRFDFFQRVLTAMRTKGLRCESLGGAVMHYAHRALKGI------  234

Query  1390  eesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLL  1211
                                            ++R  VE ++ ILPPEK +I C+FL  LL
Sbjct  235   ------------------HKRQTMKSPKPQHEQRILVEAIVSILPPEKTAISCSFLFGLL  276

Query  1210  RIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIV-  1034
             R   ++    A R +LE+RI  QLEQATL +L+IPS +H   T+ DV+ V R++  F+  
Sbjct  277   RAAVVLETTLACRLDLERRIGLQLEQATLDDLLIPSANHNVDTLFDVDAVQRILNCFMQQ  336

Query  1033  -SLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAP  857
                ED            +G+P  +    L+KVAKL+D YLAE A D+NLTM++FI LA  
Sbjct  337   DGAEDVDDTHPMYDVEGAGSPTHSA---LVKVAKLLDTYLAEIAPDANLTMNKFITLAEV  393

Query  856   IPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVR  677
             +P HAR  DD LYR++D +LKAHP +S  ERK +CKLID +KLS +A  HAAQNERLPV+
Sbjct  394   LPEHARTVDDGLYRAVDVFLKAHPAISDAERKTLCKLIDCKKLSQDACTHAAQNERLPVQ  453

Query  676   TVIQVLLSEQTKLSKQL  626
              V+QVL  EQ +L   +
Sbjct  454   VVVQVLYFEQLRLRNAM  470



>gb|KHN13450.1| BTB/POZ domain-containing protein [Glycine soja]
Length=624

 Score =   220 bits (561),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 130/321 (40%), Positives = 189/321 (59%), Gaps = 20/321 (6%)
 Frame = -3

Query  1588  PESGTLSSCKPMGECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPEL  1409
             P   T+   K  G+ W +D  +L +D + + ++ +K +GVRPE IG+ + +YA K   EL
Sbjct  203   PPRETMHVVKCDGDWWIEDLSVLRIDMYQRIITAMKCRGVRPESIGASLVNYAQK---EL  259

Query  1408  TggggseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCN  1229
             T                 K    + SS  +  S S + ++  VET++ +LP EK ++P N
Sbjct  260   TK----------------KSSLWNPSSQTKVDSNSTLHEKLVVETVVSLLPVEKLAVPIN  303

Query  1228  FLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLV  1049
             FL  LLR   M+    A R +LE+RI  QL+ ATL +++IPSF H   T+ DV+ V R++
Sbjct  304   FLFGLLRSAVMLDCTIASRLDLERRIGSQLDVATLDDILIPSFRHAGDTLFDVDTVHRIL  363

Query  1048  KRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIA  869
               F    +D       +    S +PP      LIKV+KLVD+YLAE A D+NL +S+F+ 
Sbjct  364   VNF-CQQDDSEEEPEDTSVFESDSPPSPSQTALIKVSKLVDNYLAEIAPDANLKLSKFMV  422

Query  868   LAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNER  689
             +A  +P HAR   D LYR+ID YLKAH G +  ++K++CKLID +KLS EA  HAAQNER
Sbjct  423   IAETLPAHARTVHDGLYRAIDIYLKAHQGSTDLDKKKLCKLIDFQKLSQEAGAHAAQNER  482

Query  688   LPVRTVIQVLLSEQTKLSKQL  626
             LP+++++QVL  EQ +L   L
Sbjct  483   LPLQSIVQVLYFEQLRLRNSL  503



>ref|XP_003551322.2| PREDICTED: BTB/POZ domain-containing protein At5g48800-like [Glycine 
max]
Length=616

 Score =   220 bits (560),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 128/309 (41%), Positives = 185/309 (60%), Gaps = 20/309 (6%)
 Frame = -3

Query  1552  GECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiek  1373
             G+ W +D  +L +D + + ++ +K +GVRPE IG+ + +YA K   ELT           
Sbjct  207   GDWWIEDLSVLRIDMYQRIITAMKCRGVRPESIGASLVNYAQK---ELTK----------  253

Query  1372  gGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMV  1193
                   K    + SS  +  S S + ++  VET++ +LP EK ++P NFL  LLR   M+
Sbjct  254   ------KSSLWNPSSQTKVDSNSTLHEKLVVETVVSLLPVEKLAVPINFLFGLLRSAVML  307

Query  1192  GVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAA  1013
                 A R +LE+RI  QL+ ATL +++IPSF H   T+ DVE V R++  F    +D   
Sbjct  308   DCTIASRLDLERRIGSQLDVATLDDILIPSFRHAGDTLFDVETVHRILVNF-CQQDDSEE  366

Query  1012  VMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPT  833
                 +    S +PP      LIKV+KLVD+YLAE A D+NL +S+F+ +A  +P HAR  
Sbjct  367   EPEDTSVFESDSPPSPSQTALIKVSKLVDNYLAEIAPDANLKLSKFMVIAETLPAHARTV  426

Query  832   DDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLS  653
              D LYR+ID YLKAH G +  ++K++CKLID +KLS EA  HAAQNERLP+++++QVL  
Sbjct  427   HDGLYRAIDIYLKAHQGSTDLDKKKLCKLIDFQKLSQEAGAHAAQNERLPLQSIVQVLYF  486

Query  652   EQTKLSKQL  626
             EQ +L   L
Sbjct  487   EQLRLRNSL  495



>ref|XP_001763717.1| predicted protein [Physcomitrella patens]
 gb|EDQ71359.1| predicted protein [Physcomitrella patens]
Length=599

 Score =   219 bits (559),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 133/338 (39%), Positives = 193/338 (57%), Gaps = 41/338 (12%)
 Frame = -3

Query  1615  EELKMATALPESGTLSSCK----------PMGECWFDDACILDMDYFVKTLSGIKAKGVR  1466
             E+L + +   ES    +C           PM + W +D  +L +D + + L+ ++ KG+R
Sbjct  156   EDLGIVSKCIESAATKACSSSNFSHASKVPMADWWAEDLAVLRIDLYQRLLAAMRTKGLR  215

Query  1465  PELIGSIITHYASKWLPELTggggseesiekgGHLIIKFeesssssvaesvsaSWMKKRF  1286
              E IG  + H+A + L                                        ++R 
Sbjct  216   VESIGGALMHFAHRSLKGFNRKQNGRTMEH--------------------------EQRI  249

Query  1285  FVETLIGILPPEKDSIPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIP  1106
              VET++ +LPPEK++  C+FL  LLR   M+    A R +LEKRI  QLEQATL +L+IP
Sbjct  250   LVETIVSLLPPEKNTASCSFLFGLLRTAIMLDTTLACRLDLEKRIGMQLEQATLDDLLIP  309

Query  1105  SFSHTCGTVLDVELVLRLVKRFIVSLE-DQAAVMRCSGSSSSGAPPLNLNLN-LIKVAKL  932
             SFS+T  T+ D ++V R+V  F+   + D   V      S +G    +L+ + ++KVAKL
Sbjct  310   SFSYTGDTLFDNDIVHRIVVNFLQQDDSDDLQVAHTMYDSDNGG---SLSQSAMMKVAKL  366

Query  931   VDDYLAEAAVDSNLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVC  752
             VD YLAE A D+NL +S+F+ALA  +P +AR  DD LYR+ID YLKAHP +S+ +RK++C
Sbjct  367   VDSYLAEIAPDANLKLSKFLALAEILPDYARVVDDGLYRAIDIYLKAHPALSEVDRKKLC  426

Query  751   KLIDSRKLSAEASIHAAQNERLPVRTVIQVLLSEQTKL  638
             KL+D +KLS EA  HAAQNERLPV+ V+QVL  EQ ++
Sbjct  427   KLMDCQKLSQEACTHAAQNERLPVQVVVQVLYFEQLRM  464



>ref|XP_006845260.1| hypothetical protein AMTR_s00005p00262560 [Amborella trichopoda]
 gb|ERN06935.1| hypothetical protein AMTR_s00005p00262560 [Amborella trichopoda]
Length=615

 Score =   219 bits (559),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 129/315 (41%), Positives = 186/315 (59%), Gaps = 24/315 (8%)
 Frame = -3

Query  1561  KPMGECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWL---PELTggggs  1391
             K  G+ W +D  +L +D + + ++ ++ +GVRPE IG+ + +YA K+L   P L      
Sbjct  200   KCSGDWWIEDLSVLRIDMYQRVITAMRCRGVRPESIGASLVNYAQKFLTKKPTLWNASNG  259

Query  1390  eesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLL  1211
              +         I+F  S  +           ++R  VE++  +LP EK ++P +FL  LL
Sbjct  260   SK---------IEFAGSVEN-----------EQRVLVESIASLLPVEKLAVPISFLFGLL  299

Query  1210  RIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVS  1031
             R   M+    A R +LE+RI  QL+ ATL +L+IPSF H+  T+ DV+ V R++  F   
Sbjct  300   RTAVMLDCSIACRLDLERRIGSQLDMATLDDLLIPSFRHSGDTLFDVDTVHRILVNF-SQ  358

Query  1030  LEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIP  851
              +D    +  S +  S  P       +IKVAKLVD YLAE A D+NL +++F+A+A  +P
Sbjct  359   QDDSEDGLDESSTYESDGPQSPSQTAVIKVAKLVDSYLAEIAPDANLRLTKFMAIAEILP  418

Query  850   THARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTV  671
               AR  DD LYR+ID YLKAH G+S  ER+++CKLID +KLS EA  HAAQNERLPV+ V
Sbjct  419   GDARMLDDGLYRAIDIYLKAHQGLSDLERRKLCKLIDFQKLSQEAGAHAAQNERLPVQAV  478

Query  670   IQVLLSEQTKLSKQL  626
             +QVL  EQ +L   L
Sbjct  479   VQVLYFEQLRLRNAL  493



>ref|XP_010264098.1| PREDICTED: BTB/POZ domain-containing protein At5g48800 isoform 
X1 [Nelumbo nucifera]
Length=681

 Score =   221 bits (562),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 129/318 (41%), Positives = 188/318 (59%), Gaps = 35/318 (11%)
 Frame = -3

Query  1552  GECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWL---PELTggggsees  1382
             G+ W +D  +L +D + K +  +K +GVRPE IG+ + +YA K+L   P L         
Sbjct  262   GDWWIEDLSVLRIDLYQKVIEAMKCRGVRPESIGASLVNYAQKFLTNKPSL---------  312

Query  1381  iekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIG  1202
                       +  S+  +    V +   ++RF VET+  +LP EK ++P +FL  LLR  
Sbjct  313   ----------WNASTQPNFDLVVGSVGNEQRFMVETITSLLPVEKLAVPISFLFGLLRTA  362

Query  1201  NMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIV----  1034
              M+    + R  LE+RI+ QLE A+L +L+IPSF H   T+ +V+ + R++  F      
Sbjct  363   VMLDCATSCRLNLERRIASQLEMASLDDLLIPSFRHAGDTLFNVDTIHRILVNFSQQDVS  422

Query  1033  --SLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAA  860
                LED++      GS S  +P  +    L KVAKL+D+YLAE A D+NL +S+FIA+A 
Sbjct  423   EDDLEDESTY----GSDSPHSPSQSA---LFKVAKLLDNYLAEIAADANLKLSKFIAMAD  475

Query  859   PIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPV  680
              +P +AR   D LYR+ID YLKAH G+S  E+K +CKLID +KLS EA  HAAQNERLP+
Sbjct  476   SLPAYARNIHDGLYRAIDIYLKAHQGLSDPEKKMLCKLIDFQKLSEEAGAHAAQNERLPL  535

Query  679   RTVIQVLLSEQTKLSKQL  626
             ++++QVL  EQ +L   L
Sbjct  536   QSIVQVLYFEQIRLRNAL  553



>ref|XP_002521098.1| protein binding protein, putative [Ricinus communis]
 gb|EEF41249.1| protein binding protein, putative [Ricinus communis]
Length=610

 Score =   219 bits (558),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 131/312 (42%), Positives = 183/312 (59%), Gaps = 20/312 (6%)
 Frame = -3

Query  1561  KPMGECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggsees  1382
             K  G+ W +D  IL +D + + ++ +K +GVRPE IG+ + +YA K   ELT        
Sbjct  198   KCEGDWWIEDLSILRIDLYQRVMTAMKCRGVRPESIGASLVNYAQK---ELTK-------  247

Query  1381  iekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIG  1202
                      K    + SS  +    S   +R  VET+  +LP EK ++P +FL  LLR  
Sbjct  248   ---------KSSLWNPSSGTKVDLVSTGHERLVVETIANLLPVEKLAVPISFLFGLLRSA  298

Query  1201  NMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLED  1022
              M+    A R +LE+RI  QL+ ATL +L+IPSF H   T+ DV+ V R++  F    +D
Sbjct  299   VMLDCTIACRLDLERRIGSQLDIATLDDLLIPSFRHAGDTLFDVDTVHRILVNF-SQQDD  357

Query  1021  QAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHA  842
                 M  +    S +P       L KVAKLVD+YLAE A D+NL +S+F+ +A  +P+HA
Sbjct  358   SEDDMEDASVFESDSPHSPSQTALFKVAKLVDNYLAEIAPDANLKLSKFMVIAETLPSHA  417

Query  841   RPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQV  662
             R   D LYR+ID YLKAH G+S  +RK++CKLID +KLS EA  HAAQNERLP++ ++QV
Sbjct  418   RTIHDGLYRAIDIYLKAHQGLSDSDRKKLCKLIDFQKLSQEAGAHAAQNERLPLQAIVQV  477

Query  661   LLSEQTKLSKQL  626
             L  EQ +L   L
Sbjct  478   LYFEQIRLRNAL  489



>ref|XP_006443605.1| hypothetical protein CICLE_v10019330mg [Citrus clementina]
 ref|XP_006479282.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like [Citrus 
sinensis]
 gb|ESR56845.1| hypothetical protein CICLE_v10019330mg [Citrus clementina]
 gb|KDO65925.1| hypothetical protein CISIN_1g007123mg [Citrus sinensis]
Length=617

 Score =   219 bits (559),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 124/309 (40%), Positives = 181/309 (59%), Gaps = 18/309 (6%)
 Frame = -3

Query  1552  GECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiek  1373
             G+ W +D  +L  D + + ++ +K +GVRPE IG+ + +YA K   ELT          +
Sbjct  206   GDWWIEDLSVLRFDLYQRVMTAMKCRGVRPESIGASLMNYAQK---ELTKKSSLWNPTTQ  262

Query  1372  gGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMV  1193
                 ++                    +R  VET+IG+LP EK ++P NFL  LLR   M+
Sbjct  263   AKVDLVSVPSG--------------HERQVVETIIGLLPVEKLAVPINFLFGLLRSAVML  308

Query  1192  GVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAA  1013
                 A R +LE+RI+ QL+ A L +L+IPSF H   T+ DV+ V R++  F    +D   
Sbjct  309   DCTVACRLDLERRIASQLDIAALDDLLIPSFRHAGDTLFDVDTVHRILVNF-AQQDDSED  367

Query  1012  VMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPT  833
              M  +    S +P       L+KVAKLVD+YLAE A D+NL +++F+ +A  +P+HAR  
Sbjct  368   EMDDASVFESDSPHSPSQTALLKVAKLVDNYLAEIAPDANLKLAKFMVIAETLPSHARTV  427

Query  832   DDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLS  653
              D LYR+ID YLKAH  +S  ++KR+CK+ID +KLS EA  HAAQNERLP+++++QVL  
Sbjct  428   HDGLYRAIDIYLKAHQNLSDSDKKRLCKMIDFQKLSQEAGAHAAQNERLPLQSIVQVLYF  487

Query  652   EQTKLSKQL  626
             EQ +L   L
Sbjct  488   EQLRLRNAL  496



>emb|CAN78287.1| hypothetical protein VITISV_008137 [Vitis vinifera]
Length=582

 Score =   218 bits (556),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 124/309 (40%), Positives = 180/309 (58%), Gaps = 18/309 (6%)
 Frame = -3

Query  1552  GECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiek  1373
             G+ W +D   L +D + K ++ +K +GVRPE IG+ + +YA K   ELT          +
Sbjct  176   GDWWIEDLSALRIDLYQKVITAMKCRGVRPESIGASLVNYAQK---ELTKKSSLWNPSGQ  232

Query  1372  gGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMV  1193
                 ++                  + +R  VET++ +LP EK ++P NFL  +LR   M+
Sbjct  233   QKVELVAGSS--------------VHERLXVETIVSLLPVEKLAVPINFLFGILRSAVML  278

Query  1192  GVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAA  1013
                 A R +LE+RI  QL+ ATL +L+IPSF H   T+ DV+ V R++  F    +D   
Sbjct  279   DCSVASRLDLERRIGSQLDIATLDDLLIPSFRHAGDTLFDVDTVHRILVNF-SQQDDSEE  337

Query  1012  VMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPT  833
              M  +    S +PP      L KV+KLVD+YLAE A D+NL +S+F+ +A  +P HAR  
Sbjct  338   DMDDASVFESESPPSPSQTALFKVSKLVDNYLAEIAPDANLKLSKFMVIAETLPAHARTV  397

Query  832   DDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLS  653
              D LYR+ID YLKAH G+S  ++K++ KLID +KLS EA  HAAQNERLP+++++QVL  
Sbjct  398   HDGLYRAIDIYLKAHQGLSDPDKKKLSKLIDFQKLSQEAGAHAAQNERLPLQSIVQVLYF  457

Query  652   EQTKLSKQL  626
             EQ +L   L
Sbjct  458   EQLRLRNAL  466



>ref|XP_002447461.1| hypothetical protein SORBIDRAFT_06g001450 [Sorghum bicolor]
 gb|EES11789.1| hypothetical protein SORBIDRAFT_06g001450 [Sorghum bicolor]
Length=648

 Score =   219 bits (559),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 133/327 (41%), Positives = 197/327 (60%), Gaps = 18/327 (6%)
 Frame = -3

Query  1576  TLSSCKPMGECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPE--LTg  1403
             T     P  + W DD C+L +D+FV+ ++ ++A+G+RP+LIG+ IT YASKWL    LT 
Sbjct  232   TSDGGGPQADWWVDDVCVLSIDHFVRVVTAVQARGMRPDLIGAAITRYASKWLSSTGLTI  291

Query  1402  gggseesiekgGHLI--IKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCN  1229
                +  S   GG ++  +   E  +S+       +  ++R  VE+LI ILPP+KD + C+
Sbjct  292   NKENPTSRGGGGGVLQMVVASEGDNSNTNTPTETTASEQRRIVESLISILPPQKDCVSCS  351

Query  1228  FLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSF---SHTCGTVLDVELVL  1058
             FLLRLLR+  ++    A   E+EK +  QL+QA L ++++PS+     +     DV+LV 
Sbjct  352   FLLRLLRLAVVLKAAPALITEVEKHVGMQLDQAALPDILVPSYLSGGRSEAAAYDVDLVQ  411

Query  1057  RLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQ  878
             RLV++F+V  +          S   G      +   ++VA L+D YLAE + D NL + +
Sbjct  412   RLVEQFVVQEQ----------SGGRGKEKQQDSSKALRVASLIDSYLAEVSRDRNLAVGK  461

Query  877   FIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCK-LIDSRKLSAEASIHAA  701
             F ALA  +P  AR   D LYR++DTYLKAHP V++ ERKR+C+ ++D  KLS E   HAA
Sbjct  462   FQALAESLPESARVCHDGLYRAVDTYLKAHPAVTEHERKRLCRAVVDCGKLSREVRTHAA  521

Query  700   QNERLPVRTVIQVLLSEQTKLSKQLMR  620
              NERLP+R V+QVLLSEQ K++  L +
Sbjct  522   GNERLPLRVVVQVLLSEQAKMAGALGK  548



>ref|XP_003604967.1| BTB/POZ domain-containing protein [Medicago truncatula]
 gb|AES87164.1| phototropic-responsive NPH3 family protein [Medicago truncatula]
Length=617

 Score =   219 bits (557),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 125/309 (40%), Positives = 187/309 (61%), Gaps = 20/309 (6%)
 Frame = -3

Query  1552  GECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiek  1373
             G+ W +D  +L +D + + ++ +K +GVRPE IG+ + +YA K   ELT           
Sbjct  208   GDWWIEDISVLRIDMYQRVITAMKCRGVRPESIGASLVNYAEK---ELTK----------  254

Query  1372  gGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMV  1193
                   K    + S+  ++ S S + ++  VET++ +LP EK  +P NFL  LLR   M+
Sbjct  255   ------KSSLWNQSNQNKTDSNSTLHEKLVVETIVSLLPVEKLVVPINFLFGLLRSAVML  308

Query  1192  GVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAA  1013
                 + R +LE+RI  QL+ +TL +++IPSF H+  T+ DV+ V RL+  F    ED   
Sbjct  309   DCAISSRLDLERRIGSQLDLSTLDDILIPSFKHSGDTLFDVDTVHRLLVNF-CQQEDSDD  367

Query  1012  VMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPT  833
              +       S +P      +L+KV+KLVD+YLAE A D+NL +S+F+ +A  +P HAR  
Sbjct  368   DLEDGSLFESDSPRSPSQTSLVKVSKLVDNYLAEIAPDANLKLSKFLVIAETLPAHARTV  427

Query  832   DDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLS  653
              D LYR+ID YLKAH G+S  ++K++CKLID +KL+ EA  HAAQNERLP+++++QVL  
Sbjct  428   HDGLYRAIDIYLKAHQGLSDLDKKKLCKLIDFQKLTQEAGAHAAQNERLPLQSIVQVLYF  487

Query  652   EQTKLSKQL  626
             EQ KL   L
Sbjct  488   EQLKLRNSL  496



>ref|XP_002531260.1| Root phototropism protein, putative [Ricinus communis]
 gb|EEF31124.1| Root phototropism protein, putative [Ricinus communis]
Length=643

 Score =   219 bits (558),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 123/321 (38%), Positives = 196/321 (61%), Gaps = 27/321 (8%)
 Frame = -3

Query  1543  WFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekgGH  1364
             WFDD   L  D+F++ ++ ++AKG +PE+ G  I HYAS+WLP +            G +
Sbjct  233   WFDDVATLRTDHFMRIVTAVRAKGAKPEITGKCIMHYASRWLPGMDVELEGLRGYRYGKN  292

Query  1363  LIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMVGVE  1184
              + +F      +  E V  S  +K   +E+++ +LPP+ +++PC FLL++L++  +    
Sbjct  293   EL-QFGILCGRNKDEGVGHSKEQKNI-IESIVRLLPPQPEAVPCKFLLKMLKMAIVYSAS  350

Query  1183  AAYRAELEKRISWQLEQATLRELMIPSFS---------HTCGTVL-DVELVLRLVKRFIV  1034
              A  +ELE R+   LE A++ +L+IP++          H    V+ ++E+V R+V+ F++
Sbjct  351   PALISELEMRVGLTLENASVNDLLIPNYKTEDQVKTMKHPEHCVMYNIEVVQRIVEYFLM  410

Query  1033  SLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPI  854
               ++Q  +   SG S+              V+KL+D+YLAE A D NL++++F  LA  +
Sbjct  411   HEQEQQQLQPMSGKSN--------------VSKLMDNYLAEIARDPNLSITKFQVLAEVL  456

Query  853   PTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRT  674
             P +AR  DD LYRSIDTYLK HP +S+ +RKR+CK+++  KLS +A +HAAQN+RLP+RT
Sbjct  457   PENARTCDDGLYRSIDTYLKTHPSLSEHDRKRLCKVMNCEKLSLDACMHAAQNDRLPMRT  516

Query  673   VIQVLLSEQTKLSKQLMRQLE  611
             VIQVL SEQ K+ ++ MR  E
Sbjct  517   VIQVLFSEQVKM-REAMRGKE  536



>emb|CBI37309.3| unnamed protein product [Vitis vinifera]
Length=605

 Score =   218 bits (556),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 125/313 (40%), Positives = 178/313 (57%), Gaps = 37/313 (12%)
 Frame = -3

Query  1552  GECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiek  1373
             G+ W +D   L +D + K ++ +K +GVRPE IG+ + +YA K   ELT           
Sbjct  210   GDWWIEDLSALRIDLYQKVITAMKCRGVRPESIGASLVNYAQK---ELTKKSSL------  260

Query  1372  gGHLIIKFeesssssvaesvsaSW----MKKRFFVETLIGILPPEKDSIPCNFLLRLLRI  1205
                                    W     +KR  VET++ +LP EK ++P NFL  +LR 
Sbjct  261   -----------------------WNPSGQQKRLVVETIVSLLPVEKLAVPINFLFGILRS  297

Query  1204  GNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLE  1025
               M+    A R +LE+RI  QL+ ATL +L+IPSF H   T+ DV+ V R++  F    +
Sbjct  298   AVMLDCSVASRLDLERRIGSQLDIATLDDLLIPSFRHAGDTLFDVDTVHRILVNF-SQQD  356

Query  1024  DQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTH  845
             D    M  +    S +PP      L KV+KLVD+YLAE A D+NL +S+F+ +A  +P H
Sbjct  357   DSEEDMDDASVFESESPPSPSQTALFKVSKLVDNYLAEIAPDANLKLSKFMVIAETLPAH  416

Query  844   ARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQ  665
             AR   D LYR+ID YLKAH G++  ++K++ KLID +KLS EA  HAAQNERLP+++++Q
Sbjct  417   ARTVHDGLYRAIDIYLKAHQGLTDPDKKKLSKLIDFQKLSQEAGAHAAQNERLPLQSIVQ  476

Query  664   VLLSEQTKLSKQL  626
             VL  EQ +L   L
Sbjct  477   VLYFEQLRLRNAL  489



>ref|XP_008669708.1| PREDICTED: coleoptile phototropism protein 1-like [Zea mays]
Length=638

 Score =   219 bits (557),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 133/330 (40%), Positives = 206/330 (62%), Gaps = 18/330 (5%)
 Frame = -3

Query  1588  PESGTLSSCK----PMGECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKW  1421
             P +GT  + +    P  + W +D C+L +D+FV+ ++ ++A+G+RP+LIG+ IT YASKW
Sbjct  226   PTAGTAGNSQQQPGPPADWWVEDICVLRIDHFVRVVTAVQARGMRPDLIGAAITRYASKW  285

Query  1420  LPE--LTggggseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEK  1247
             L    L     S  S   GG  +++   +S    A++ + +  ++R  VE+LI I+PP+K
Sbjct  286   LSSAGLLANKDSPASRGGGGGGVLQMIVASEGDDAQTETEA-SEQRRIVESLISIIPPQK  344

Query  1246  DSIPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHT-CGTVLDV  1070
             D + C+FLLRLLR+  ++    A   E+EK +  QL+QA L ++++PS+ +       DV
Sbjct  345   DCLSCSFLLRLLRLAVVLKAAPALVTEVEKHVGMQLDQAKLLDILVPSYPYARSEAAYDV  404

Query  1069  ELVLRLVKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNL  890
             +LV RLV++F+V  +      +    SS            +++A L+D YL+E + D NL
Sbjct  405   DLVQRLVEQFVVQEQSGRDKEKQEQQSSRA----------LRMASLMDSYLSEVSRDRNL  454

Query  889   TMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASI  710
             ++ +F ALA  +P  AR   D LYR++D+YLKAHP V++ ERKR+C+ +D  KLS EA +
Sbjct  455   SLGKFQALAESLPESARVCHDELYRAVDSYLKAHPTVTEHERKRLCRAVDCGKLSREARL  514

Query  709   HAAQNERLPVRTVIQVLLSEQTKLSKQLMR  620
             HAAQNERLP+R V+QVLLSEQ K++  L R
Sbjct  515   HAAQNERLPLRVVVQVLLSEQAKMAGALGR  544



>ref|XP_010652501.1| PREDICTED: BTB/POZ domain-containing protein At5g48800 isoform 
X3 [Vitis vinifera]
Length=586

 Score =   217 bits (553),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 124/309 (40%), Positives = 182/309 (59%), Gaps = 18/309 (6%)
 Frame = -3

Query  1552  GECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiek  1373
             G+ W +D   L +D + K ++ +K +GVRPE IG+ + +YA K   ELT          +
Sbjct  180   GDWWIEDLSALRIDLYQKVITAMKCRGVRPESIGASLVNYAQK---ELTKKSSLWNPSGQ  236

Query  1372  gGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMV  1193
                 ++              + S + +R  VET++ +LP EK ++P NFL  +LR   M+
Sbjct  237   QKVELV--------------AGSSVHERLVVETIVSLLPVEKLAVPINFLFGILRSAVML  282

Query  1192  GVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAA  1013
                 A R +LE+RI  QL+ ATL +L+IPSF H   T+ DV+ V R++  F    +D   
Sbjct  283   DCSVASRLDLERRIGSQLDIATLDDLLIPSFRHAGDTLFDVDTVHRILVNF-SQQDDSEE  341

Query  1012  VMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPT  833
              M  +    S +PP      L KV+KLVD+YLAE A D+NL +S+F+ +A  +P HAR  
Sbjct  342   DMDDASVFESESPPSPSQTALFKVSKLVDNYLAEIAPDANLKLSKFMVIAETLPAHARTV  401

Query  832   DDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLS  653
              D LYR+ID YLKAH G++  ++K++ KLID +KLS EA  HAAQNERLP+++++QVL  
Sbjct  402   HDGLYRAIDIYLKAHQGLTDPDKKKLSKLIDFQKLSQEAGAHAAQNERLPLQSIVQVLYF  461

Query  652   EQTKLSKQL  626
             EQ +L   L
Sbjct  462   EQLRLRNAL  470



>ref|XP_010245990.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like isoform 
X3 [Nelumbo nucifera]
Length=546

 Score =   216 bits (550),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 122/310 (39%), Positives = 186/310 (60%), Gaps = 17/310 (5%)
 Frame = -3

Query  1552  GECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiek  1373
             G+ W +D  +L +D + + ++ +K +GVRPE IG+ +  YA K+L +         S + 
Sbjct  133   GDWWIEDLSVLRIDLYQRVIATMKCRGVRPESIGASLVDYAQKFLAK--KPSLWNASTQP  190

Query  1372  gGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMV  1193
                L++               +   ++R  VET+  +LP EK ++P +FL  LLR   M+
Sbjct  191   KVDLVVG--------------SVGNEQRLMVETITSLLPTEKVAVPISFLFGLLRTAVML  236

Query  1192  GVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAA  1013
                 A R +LE+RI+ QLE ATL +L+IPSF H   T+ DV+ V R++  F    + +  
Sbjct  237   DCTVACRLDLERRIASQLEMATLDDLLIPSFRHAGDTLFDVDTVHRILVNFSQQDDSEDD  296

Query  1012  VMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPT  833
             V     +  S +P      +L+KV+KL+D+YLAE A D+NL +++F+ +A  +P +AR  
Sbjct  297   VED-VSAYESDSPCSPSQSSLLKVSKLLDNYLAEIAADANLKLTKFMVIADSLPAYARTN  355

Query  832   DDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLS  653
              D LYR+ID YLKAH G+S  E+KR+CKLID +KLS EA  HAAQNERLP+++++QVL  
Sbjct  356   HDGLYRAIDIYLKAHQGLSDPEKKRLCKLIDFQKLSQEAGAHAAQNERLPLQSIVQVLYF  415

Query  652   EQTKLSKQLM  623
             EQ +L   L+
Sbjct  416   EQVRLRNALL  425



>ref|XP_010685004.1| PREDICTED: BTB/POZ domain-containing protein At5g48800 [Beta 
vulgaris subsp. vulgaris]
Length=610

 Score =   218 bits (554),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 126/322 (39%), Positives = 190/322 (59%), Gaps = 21/322 (7%)
 Frame = -3

Query  1582  SGTLSSCKPM---GECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPE  1412
             SG L+  +P+   G+ W +D  +L +D++ + +S +K +GVRPE +G+ + +YA K   E
Sbjct  188   SGRLNLSRPVKCEGDWWIEDLSVLRVDFYQRVISAMKCRGVRPESVGASLINYAEK---E  244

Query  1411  LTggggseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPC  1232
             LT       +  +    II              + S   +R  VET++ +LP EK  +P 
Sbjct  245   LTKKASLWNASGQTRTDII--------------AGSGSHERTVVETIVSLLPVEKLVVPL  290

Query  1231  NFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRL  1052
             +FL  LLR   ++    A R +LE+RI  QL+ ATL +L+IPSF H   T+ DV+ V R+
Sbjct  291   SFLFGLLRSAILLDCSVACRLDLERRIGSQLDMATLDDLLIPSFRHAGDTLFDVDTVHRI  350

Query  1051  VKRFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFI  872
             +  F    +D    +       S +P       L KV+KLVD+YLAE A D+NL +++F+
Sbjct  351   LVNF-CQQDDSEEELEDVSVFESDSPQSPSQGALFKVSKLVDNYLAEIAPDANLKLNKFL  409

Query  871   ALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNE  692
              +A  +P HAR   DALYR+ID YLKAH G+S  +++++CK+ID +KLS EA  HAAQNE
Sbjct  410   VIAEALPAHARTIHDALYRAIDVYLKAHQGLSDADKRKLCKMIDFQKLSQEAGAHAAQNE  469

Query  691   RLPVRTVIQVLLSEQTKLSKQL  626
             RLP+++++QVL  EQ +L   L
Sbjct  470   RLPLQSIVQVLYFEQLRLRNAL  491



>ref|XP_009334929.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like [Pyrus 
x bretschneideri]
Length=687

 Score =   219 bits (557),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 128/312 (41%), Positives = 183/312 (59%), Gaps = 18/312 (6%)
 Frame = -3

Query  1561  KPMGECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggsees  1382
             K  G+ W +D  ++ +D + + ++ +K +GVRPE IG+ + +YA K   ELT        
Sbjct  274   KSDGDWWIEDLSVIRVDLYERVITAMKCRGVRPESIGASLVNYAQK---ELTKKS-----  325

Query  1381  iekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIG  1202
                           S  +  +  SAS   ++  VET++G+LP EK  IP NFL  LLR  
Sbjct  326   ---------SLWNPSGQTKVDVNSASTGHEKLVVETIVGLLPVEKLVIPINFLFGLLRSA  376

Query  1201  NMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLED  1022
              M+    A R +LE+RI  QL+ ATL +L+IPSF H   T+ DV+ V R++  F    +D
Sbjct  377   VMLDCTIACRLDLERRIGSQLDIATLDDLLIPSFKHAGDTLFDVDTVHRILVNF-SQQDD  435

Query  1021  QAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHA  842
                 M       S +P       L KV+KLVD+YLAE A D+NL +++FI +A  +P HA
Sbjct  436   SEEDMEDGSVFESDSPHSPSQTALFKVSKLVDNYLAEIAPDANLKLAKFIVIADALPEHA  495

Query  841   RPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQV  662
             R   D LYR+ID YLKAH G++  ++KR+CK+ID +KLS EA  HAAQNERLP+++++QV
Sbjct  496   RTVHDGLYRAIDIYLKAHQGLTDTDKKRLCKMIDFQKLSQEAGAHAAQNERLPLQSIVQV  555

Query  661   LLSEQTKLSKQL  626
             L  EQ +L   L
Sbjct  556   LYFEQIRLRNSL  567



>ref|XP_010652500.1| PREDICTED: BTB/POZ domain-containing protein At5g48800 isoform 
X2 [Vitis vinifera]
Length=593

 Score =   217 bits (552),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 123/309 (40%), Positives = 180/309 (58%), Gaps = 18/309 (6%)
 Frame = -3

Query  1552  GECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiek  1373
             G+ W +D   L +D + K ++ +K +GVRPE IG+ + +YA K   ELT          +
Sbjct  187   GDWWIEDLSALRIDLYQKVITAMKCRGVRPESIGASLVNYAQK---ELTKKSSLWNPSGQ  243

Query  1372  gGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMV  1193
                 ++                  + +R  VET++ +LP EK ++P NFL  +LR   M+
Sbjct  244   QKVELVAGSS--------------VHERLVVETIVSLLPVEKLAVPINFLFGILRSAVML  289

Query  1192  GVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAA  1013
                 A R +LE+RI  QL+ ATL +L+IPSF H   T+ DV+ V R++  F    +D   
Sbjct  290   DCSVASRLDLERRIGSQLDIATLDDLLIPSFRHAGDTLFDVDTVHRILVNF-SQQDDSEE  348

Query  1012  VMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPT  833
              M  +    S +PP      L KV+KLVD+YLAE A D+NL +S+F+ +A  +P HAR  
Sbjct  349   DMDDASVFESESPPSPSQTALFKVSKLVDNYLAEIAPDANLKLSKFMVIAETLPAHARTV  408

Query  832   DDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLS  653
              D LYR+ID YLKAH G++  ++K++ KLID +KLS EA  HAAQNERLP+++++QVL  
Sbjct  409   HDGLYRAIDIYLKAHQGLTDPDKKKLSKLIDFQKLSQEAGAHAAQNERLPLQSIVQVLYF  468

Query  652   EQTKLSKQL  626
             EQ +L   L
Sbjct  469   EQLRLRNAL  477



>ref|XP_002265786.1| PREDICTED: BTB/POZ domain-containing protein At5g48800 isoform 
X1 [Vitis vinifera]
Length=616

 Score =   217 bits (553),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 123/309 (40%), Positives = 180/309 (58%), Gaps = 18/309 (6%)
 Frame = -3

Query  1552  GECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiek  1373
             G+ W +D   L +D + K ++ +K +GVRPE IG+ + +YA K   ELT          +
Sbjct  210   GDWWIEDLSALRIDLYQKVITAMKCRGVRPESIGASLVNYAQK---ELTKKSSLWNPSGQ  266

Query  1372  gGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMV  1193
                 ++                  + +R  VET++ +LP EK ++P NFL  +LR   M+
Sbjct  267   QKVELVAGSS--------------VHERLVVETIVSLLPVEKLAVPINFLFGILRSAVML  312

Query  1192  GVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAA  1013
                 A R +LE+RI  QL+ ATL +L+IPSF H   T+ DV+ V R++  F    +D   
Sbjct  313   DCSVASRLDLERRIGSQLDIATLDDLLIPSFRHAGDTLFDVDTVHRILVNF-SQQDDSEE  371

Query  1012  VMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPT  833
              M  +    S +PP      L KV+KLVD+YLAE A D+NL +S+F+ +A  +P HAR  
Sbjct  372   DMDDASVFESESPPSPSQTALFKVSKLVDNYLAEIAPDANLKLSKFMVIAETLPAHARTV  431

Query  832   DDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLS  653
              D LYR+ID YLKAH G++  ++K++ KLID +KLS EA  HAAQNERLP+++++QVL  
Sbjct  432   HDGLYRAIDIYLKAHQGLTDPDKKKLSKLIDFQKLSQEAGAHAAQNERLPLQSIVQVLYF  491

Query  652   EQTKLSKQL  626
             EQ +L   L
Sbjct  492   EQLRLRNAL  500



>ref|XP_002306309.2| hypothetical protein POPTR_0005s07690g, partial [Populus trichocarpa]
 gb|EEE93305.2| hypothetical protein POPTR_0005s07690g, partial [Populus trichocarpa]
Length=591

 Score =   216 bits (551),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 117/313 (37%), Positives = 187/313 (60%), Gaps = 26/313 (8%)
 Frame = -3

Query  1546  CWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekgG  1367
             CWFDD   L +D+F++ ++ I A+G +PE+IG  I  YA +WLP +            G 
Sbjct  223   CWFDDVASLRIDHFMRIITAIGARGTKPEIIGKCIMQYAERWLPGMDVELEGPRGYGYGK  282

Query  1366  HLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMVGV  1187
             + + +F         E +  S  +++  +E+L+ ILPP+  ++PC FLL++L++  +   
Sbjct  283   NEL-QFSILIGRKEDEGIEHS-QEQKSIIESLVSILPPQPGAVPCKFLLKMLKMAMVYSA  340

Query  1186  EAAYRAELEKRISWQLEQATLRELMIPSF----------SHTCGTVLDVELVLRLVKRFI  1037
               A  +ELEKR+   LE A + +L+IP++          S    T+ D+E++ R+V+ F+
Sbjct  341   SQALISELEKRVGMMLENANVNDLLIPNYKREDQGKFVNSLEHRTMHDIEVIQRIVEYFL  400

Query  1036  VSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAP  857
             +  ++Q  + + +G SS              V+KL+D YL E A D NL++++F  LA  
Sbjct  401   MHEQEQQQLPQTTGKSS--------------VSKLLDSYLTEVAKDPNLSITKFQVLAEA  446

Query  856   IPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVR  677
             +P  AR  DD LY +IDTYLKAHP +S+ +RKR+C++++  KLS +A +HAAQN+RLP+R
Sbjct  447   LPEKARTCDDGLYGAIDTYLKAHPLLSEHDRKRLCRIMNCGKLSLDACLHAAQNDRLPLR  506

Query  676   TVIQVLLSEQTKL  638
             TVIQVL  EQ K+
Sbjct  507   TVIQVLFCEQIKI  519



>ref|XP_007133999.1| hypothetical protein PHAVU_010G010500g [Phaseolus vulgaris]
 gb|ESW05993.1| hypothetical protein PHAVU_010G010500g [Phaseolus vulgaris]
Length=610

 Score =   216 bits (551),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 126/306 (41%), Positives = 184/306 (60%), Gaps = 20/306 (7%)
 Frame = -3

Query  1543  WFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekgGH  1364
             W +D  +L +D + + +S +K +GVRPE IG+ + +YA K   ELT              
Sbjct  204   WIEDLSVLRIDMYQRVISAMKCRGVRPESIGASLVNYAQK---ELTK-------------  247

Query  1363  LIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMVGVE  1184
                K    + SS  +  S S + ++  VET++ +LP EK ++P NFL  LLR   M+   
Sbjct  248   ---KSSLWNPSSQTKIDSESSLHEKLVVETIVSLLPVEKLAVPINFLFGLLRSAVMLDCT  304

Query  1183  AAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAAVMR  1004
              A R +LE+RI  QL+ ATL +++IPSF H   T+ DV+ V R++  F    +D      
Sbjct  305   VASRLDLERRIGSQLDVATLDDILIPSFRHAGDTLFDVDTVHRILVNFFQQ-DDSDEDPE  363

Query  1003  CSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPTDDA  824
              +    S +P       L+KV+KLVD+YLAE A D+NL +S+F+ +A  +P HAR   DA
Sbjct  364   DASFFESDSPRSPSQTALVKVSKLVDNYLAEIAPDANLKLSKFLVIAETLPAHARTVHDA  423

Query  823   LYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLSEQT  644
             LYR+ID YLKAH G+S  ++K++C+LID +KLS EA  HAAQNERLP+++++QVL  EQ 
Sbjct  424   LYRAIDIYLKAHQGLSDLDKKKLCRLIDFQKLSQEAGAHAAQNERLPLQSIVQVLYFEQL  483

Query  643   KLSKQL  626
             +L   L
Sbjct  484   RLRNSL  489



>ref|XP_010245989.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like isoform 
X2 [Nelumbo nucifera]
Length=599

 Score =   216 bits (550),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 125/313 (40%), Positives = 187/313 (60%), Gaps = 23/313 (7%)
 Frame = -3

Query  1552  GECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWL---PELTggggsees  1382
             G+ W +D  +L +D + + ++ +K +GVRPE IG+ +  YA K+L   P L         
Sbjct  186   GDWWIEDLSVLRIDLYQRVIATMKCRGVRPESIGASLVDYAQKFLAKKPSL---------  236

Query  1381  iekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIG  1202
                       +  S+   V   V +   ++R  VET+  +LP EK ++P +FL  LLR  
Sbjct  237   ----------WNASTQPKVDLVVGSVGNEQRLMVETITSLLPTEKVAVPISFLFGLLRTA  286

Query  1201  NMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLED  1022
              M+    A R +LE+RI+ QLE ATL +L+IPSF H   T+ DV+ V R++  F    + 
Sbjct  287   VMLDCTVACRLDLERRIASQLEMATLDDLLIPSFRHAGDTLFDVDTVHRILVNFSQQDDS  346

Query  1021  QAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHA  842
             +  V     +  S +P      +L+KV+KL+D+YLAE A D+NL +++F+ +A  +P +A
Sbjct  347   EDDVED-VSAYESDSPCSPSQSSLLKVSKLLDNYLAEIAADANLKLTKFMVIADSLPAYA  405

Query  841   RPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQV  662
             R   D LYR+ID YLKAH G+S  E+KR+CKLID +KLS EA  HAAQNERLP+++++QV
Sbjct  406   RTNHDGLYRAIDIYLKAHQGLSDPEKKRLCKLIDFQKLSQEAGAHAAQNERLPLQSIVQV  465

Query  661   LLSEQTKLSKQLM  623
             L  EQ +L   L+
Sbjct  466   LYFEQVRLRNALL  478



>ref|XP_008382632.1| PREDICTED: BTB/POZ domain-containing protein At5g48800 [Malus 
domestica]
Length=621

 Score =   216 bits (551),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 127/312 (41%), Positives = 181/312 (58%), Gaps = 18/312 (6%)
 Frame = -3

Query  1561  KPMGECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggsees  1382
             K  G+ W +D  ++ +D + + ++ +K +GVRPE IG+ + +YA K   ELT        
Sbjct  208   KSDGDWWIEDLSVIRVDLYERVITAMKCRGVRPESIGASLVNYAQK---ELTKKS-----  259

Query  1381  iekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIG  1202
                           S  +  +  SA    ++  VET++ +LP EK  IP NFL  LLR  
Sbjct  260   ---------SLWNPSGQTKVDINSAPTGHEKLVVETIVSLLPVEKLVIPINFLFGLLRSA  310

Query  1201  NMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLED  1022
              M+    A R +LE+RI  QL+ ATL +L+IPSF H   T+ DV+ V R++  F    +D
Sbjct  311   VMLDCTIACRLDLERRIGSQLDIATLDDLLIPSFKHAGDTLFDVDTVHRILVNF-SQQDD  369

Query  1021  QAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHA  842
                 M       S +P       L KV+KLVD+YLAE A D+NL +++FI +A  +P HA
Sbjct  370   SEEDMEDGSVFESDSPHSPSQTALFKVSKLVDNYLAEIAPDANLKLAKFIVIADALPEHA  429

Query  841   RPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQV  662
             R   D LYR+ID YLKAH G++  +RKR+CK+ID +KLS EA  HAAQNERLP+++++QV
Sbjct  430   RTIHDGLYRAIDIYLKAHQGLTDTDRKRLCKMIDFQKLSQEAGAHAAQNERLPLQSIVQV  489

Query  661   LLSEQTKLSKQL  626
             L  EQ +L   L
Sbjct  490   LYFEQIRLRNSL  501



>ref|XP_006836308.1| hypothetical protein AMTR_s00092p00041800 [Amborella trichopoda]
 gb|ERM99161.1| hypothetical protein AMTR_s00092p00041800 [Amborella trichopoda]
Length=631

 Score =   217 bits (552),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 124/315 (39%), Positives = 184/315 (58%), Gaps = 23/315 (7%)
 Frame = -3

Query  1561  KPMGECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggsees  1382
              P  + W++D   L ++ + + ++ + ++GV+PE+I   +T+YA ++LP L         
Sbjct  210   NPSSDWWYEDVSALSLNLYKRLIAVMTSRGVKPEIIAGSLTYYAKRYLPGLNRRQS----  265

Query  1381  iekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIG  1202
                    I +      S  +   + S  ++R  VE +  +LP EK      FL  LLR  
Sbjct  266   -------ISENSTRLVSMGSGPTAPSEDEQRVLVEEIEALLPSEKGVTSTKFLFGLLRTA  318

Query  1201  NMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLED  1022
              ++      +A LE+RI WQL+QATL +L++P+FS++  T+ DVE V R+++ F+    D
Sbjct  319   MIINASQNCKANLERRIGWQLDQATLEDLLMPNFSYSVDTLYDVECVQRILEHFLKM--D  376

Query  1021  QAAVMRCSGSSSS-------GAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALA  863
             QA+       + S       G+P L     +  VAKLVD YLAE A D NL + +F ALA
Sbjct  377   QASGGGGISPTCSIEDERLMGSPSLT---PITTVAKLVDGYLAEVAPDINLKLPKFQALA  433

Query  862   APIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLP  683
             A +P +ARP DD LYR+ID YLKAHP +S  ER+++C+L+D +KLS EA  HAAQNERLP
Sbjct  434   AAVPEYARPLDDGLYRAIDIYLKAHPWLSDSEREQLCRLMDCQKLSLEACTHAAQNERLP  493

Query  682   VRTVIQVLLSEQTKL  638
             +R V+QVL  EQ +L
Sbjct  494   LRVVVQVLFFEQLQL  508



>gb|KHG05588.1| hypothetical protein F383_31158 [Gossypium arboreum]
Length=566

 Score =   215 bits (548),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 121/313 (39%), Positives = 178/313 (57%), Gaps = 31/313 (10%)
 Frame = -3

Query  1576  TLSSCKPMGECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggg  1397
             T+   K  G+ W +D  ++ +D + + ++ +K +GVRPE IG+ + +YA K L +     
Sbjct  159   TIRQAKCEGDWWIEDLSVIRIDLYQRVITAMKCRGVRPESIGASLVNYAQKVLTKKVDLV  218

Query  1396  gseesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLR  1217
              +                                ++  VET+I +LP E+ ++P +FL  
Sbjct  219   STG------------------------------HQKLVVETIISLLPVERLAVPISFLFE  248

Query  1216  LLRIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFI  1037
             LLR   M+    A R +LE+RI  QL+ ATL +L+IPSF H C T+ DV+ V R+V  F 
Sbjct  249   LLRNAVMLDCTIAGRLDLERRIGSQLDIATLDDLLIPSFRHGCETLFDVDTVYRIVVNF-  307

Query  1036  VSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAP  857
                +D    M       S +P       L+KV+KLVDDYLAE A+D NL +S+F+A+A  
Sbjct  308   SQQDDGEYDMDDVSIFESDSPHSPSQSALLKVSKLVDDYLAEIALDVNLKLSKFMAIAEA  367

Query  856   IPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVR  677
             +P H+R   D LYR+ID YLK H G+   ++K++CKLID +KLS EA  HAA NERLP++
Sbjct  368   LPAHSRTIHDGLYRAIDIYLKTHKGILDADKKKLCKLIDFQKLSQEAGAHAALNERLPLQ  427

Query  676   TVIQVLLSEQTKL  638
             +V+QVL  EQ +L
Sbjct  428   SVVQVLYFEQLRL  440



>ref|XP_010245988.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like isoform 
X1 [Nelumbo nucifera]
Length=620

 Score =   216 bits (550),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 125/313 (40%), Positives = 187/313 (60%), Gaps = 23/313 (7%)
 Frame = -3

Query  1552  GECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWL---PELTggggsees  1382
             G+ W +D  +L +D + + ++ +K +GVRPE IG+ +  YA K+L   P L         
Sbjct  207   GDWWIEDLSVLRIDLYQRVIATMKCRGVRPESIGASLVDYAQKFLAKKPSL---------  257

Query  1381  iekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIG  1202
                       +  S+   V   V +   ++R  VET+  +LP EK ++P +FL  LLR  
Sbjct  258   ----------WNASTQPKVDLVVGSVGNEQRLMVETITSLLPTEKVAVPISFLFGLLRTA  307

Query  1201  NMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLED  1022
              M+    A R +LE+RI+ QLE ATL +L+IPSF H   T+ DV+ V R++  F    + 
Sbjct  308   VMLDCTVACRLDLERRIASQLEMATLDDLLIPSFRHAGDTLFDVDTVHRILVNFSQQDDS  367

Query  1021  QAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHA  842
             +  V     +  S +P      +L+KV+KL+D+YLAE A D+NL +++F+ +A  +P +A
Sbjct  368   EDDVED-VSAYESDSPCSPSQSSLLKVSKLLDNYLAEIAADANLKLTKFMVIADSLPAYA  426

Query  841   RPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQV  662
             R   D LYR+ID YLKAH G+S  E+KR+CKLID +KLS EA  HAAQNERLP+++++QV
Sbjct  427   RTNHDGLYRAIDIYLKAHQGLSDPEKKRLCKLIDFQKLSQEAGAHAAQNERLPLQSIVQV  486

Query  661   LLSEQTKLSKQLM  623
             L  EQ +L   L+
Sbjct  487   LYFEQVRLRNALL  499



>ref|XP_009802686.1| PREDICTED: putative BTB/POZ domain-containing protein DOT3 isoform 
X2 [Nicotiana sylvestris]
Length=624

 Score =   216 bits (550),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 123/313 (39%), Positives = 191/313 (61%), Gaps = 21/313 (7%)
 Frame = -3

Query  1552  GECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiek  1373
             G  WFDD   L +++F++ ++ I+ KG++PE+IGS I HY  KWLP +       +    
Sbjct  212   GTWWFDDIATLRINFFLRIITAIRVKGIKPEIIGSCIMHYGEKWLPNMNSETKGTDKYGN  271

Query  1372  gGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMV  1193
               +   ++  +S     +S+  +  ++R  +E+LI ILPP+K+++ C FLLRLL++  + 
Sbjct  272   IRN-DSQWSITSGRMQEKSIGQNNKEQRIIIESLISILPPQKEAVSCKFLLRLLKMAMLY  330

Query  1192  GVEAAYRAELEKRISWQLEQATLRELMIPSF--------SHTCGTVLDVELVLRLVKRFI  1037
                 A  +ELEKRI    E A L +L+IPS+        S    T+ ++++V R++  F+
Sbjct  331   AASPALISELEKRIGMVFENAGLNDLLIPSYAVSEQTINSTEEQTIYNIDVVQRILDYFL  390

Query  1036  VSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAP  857
               L +Q  + +    SS+           + ++KLVD YLAE A D N+++++F  LA  
Sbjct  391   --LYEQQKLQQQEMKSST----------TVNISKLVDSYLAEIARDHNVSITKFQVLAES  438

Query  856   IPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVR  677
             +P H R   D LYR+IDTYLK HP +S+ +R+R+CK++DS KLS +A +HAAQNERLP+R
Sbjct  439   LPRHIRTCHDGLYRAIDTYLKTHPSLSEHDRRRLCKIMDSEKLSLDACMHAAQNERLPLR  498

Query  676   TVIQVLLSEQTKL  638
              VIQVLLSEQ K+
Sbjct  499   IVIQVLLSEQVKM  511



>ref|XP_010909076.1| PREDICTED: BTB/POZ domain-containing protein At5g48800 [Elaeis 
guineensis]
Length=705

 Score =   217 bits (553),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 129/315 (41%), Positives = 186/315 (59%), Gaps = 26/315 (8%)
 Frame = -3

Query  1561  KPMGECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWL---PELTggggs  1391
             K  G+ W +D  +L +D + + +  +K +GV PE IG+ + +YA K     P L      
Sbjct  300   KCNGDWWIEDLSVLRIDLYQRVIEAMKCRGVHPESIGASLVNYAEKLFKRKPTL------  353

Query  1390  eesiekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLL  1211
                          +  +S   V     +   +++  VET+  +LP EK ++P +FL  LL
Sbjct  354   -------------WTATSRPRVGLMPGSVGFEEKTVVETIASLLPAEKVAVPMSFLFGLL  400

Query  1210  RIGNMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVS  1031
             R   M+    + R  LE+RI  QLE ATL +L+IPSF H   T+ DV+ + R++   I S
Sbjct  401   RSAVMLDCTMSCRLNLERRIGSQLEMATLDDLLIPSFQHAGDTLFDVDTIHRIL--VIFS  458

Query  1030  LEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIP  851
              +D++     SG  S G  P +    L+KVAKLVD+YLAE A D+NL +++F+ +A  +P
Sbjct  459   QQDESEDG-GSGYDSDGPNPPS-QTALVKVAKLVDNYLAEIAPDANLKLAKFVVIADTLP  516

Query  850   THARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTV  671
              +AR TDD LYR++D YLKAH G+S  ERKR+CKLID +KLS EAS HAAQNERLP++ +
Sbjct  517   GYARTTDDGLYRAVDIYLKAHQGLSDLERKRLCKLIDFQKLSEEASAHAAQNERLPLQAI  576

Query  670   IQVLLSEQTKLSKQL  626
             +QVL  EQ +L   L
Sbjct  577   VQVLYIEQLRLRNAL  591



>ref|XP_010109730.1| BTB/POZ domain-containing protein [Morus notabilis]
 gb|EXC24200.1| BTB/POZ domain-containing protein [Morus notabilis]
Length=626

 Score =   216 bits (549),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 124/312 (40%), Positives = 180/312 (58%), Gaps = 18/312 (6%)
 Frame = -3

Query  1561  KPMGECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggsees  1382
             K  G+ W +D  IL +D + + ++ +K +GVRPE IG+ + +YA K   ELT        
Sbjct  205   KCEGDWWIEDLSILRIDLYQRVITAMKCRGVRPESIGASLVNYAQK---ELTKKSSLWNP  261

Query  1381  iekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIG  1202
               +    +I                    ++  VE ++G+LP EK ++P +FL  LLR  
Sbjct  262   SSQTKVDVISGSNE--------------HEKLVVEAIVGLLPVEKLAVPISFLFGLLRSA  307

Query  1201  NMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLED  1022
              M+    A R +LE+RI  QL+ ATL +L+IPSF H   T+ DV+ V R++  F    +D
Sbjct  308   VMLDCSIACRLDLERRIGSQLDIATLDDLLIPSFRHAGDTLFDVDTVHRILVNF-SQQDD  366

Query  1021  QAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHA  842
                 M  +    S +P       L KV+KLVD+YLAE A D+NL + +F+ +A  +P HA
Sbjct  367   SEEDMEDASVFESDSPHSPTQSALFKVSKLVDNYLAEIAPDANLKLPKFMVIADTLPAHA  426

Query  841   RPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQV  662
             R   D LYR+ID YLKAH  +S+ +RK++CKLID +KLS EA  HAAQNERLP+++++QV
Sbjct  427   RTIHDGLYRAIDIYLKAHQNLSETDRKKLCKLIDFQKLSQEAGAHAAQNERLPLQSIVQV  486

Query  661   LLSEQTKLSKQL  626
             L  EQ +L   L
Sbjct  487   LYFEQIRLRNSL  498



>ref|XP_004506596.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like [Cicer 
arietinum]
Length=616

 Score =   215 bits (548),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 130/310 (42%), Positives = 186/310 (60%), Gaps = 22/310 (7%)
 Frame = -3

Query  1552  GECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiek  1373
             G+ W +D   L +D + + ++ +K +GVRPE IG+ + +YA K   ELT           
Sbjct  206   GDWWIEDLSGLRIDIYQRVITAMKCRGVRPESIGASLVNYAEK---ELTK----------  252

Query  1372  gGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMV  1193
                   K    + SS  +  S S + ++  VET++ +LP EK +IP NFL  LLR   M+
Sbjct  253   ------KSSLWNQSSQNKVDSNSTLHEKLVVETIVSLLPVEKLAIPINFLFGLLRSAVML  306

Query  1192  GVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAA  1013
                 A R +LE+RI  QL+Q+TL +++IPSF H   T+ DV+ V RL+  F    +D + 
Sbjct  307   DCTIASRLDLERRIGSQLDQSTLDDILIPSFKHGGDTLFDVDTVHRLLVNFCQ--QDDSD  364

Query  1012  VMRCSGS-SSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARP  836
                  GS   S +P      +L+KV+KLVD+YLAE A D NL +S+F+ +A  +P HAR 
Sbjct  365   DDLEDGSLFESDSPRSPSQTSLVKVSKLVDNYLAEIAPDVNLKLSKFLVIAETLPEHART  424

Query  835   TDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLL  656
               D LYR+ID YLKAH  +S  ++K++CKLID +KLS EA  HAAQNERLP+++++QVL 
Sbjct  425   VHDGLYRAIDIYLKAHQSLSDLDKKKLCKLIDFQKLSQEAGAHAAQNERLPLQSIVQVLY  484

Query  655   SEQTKLSKQL  626
              EQ KL   L
Sbjct  485   FEQLKLRNNL  494



>ref|XP_003520918.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like [Glycine 
max]
 gb|KHN29840.1| BTB/POZ domain-containing protein [Glycine soja]
Length=612

 Score =   215 bits (547),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 124/309 (40%), Positives = 184/309 (60%), Gaps = 20/309 (6%)
 Frame = -3

Query  1552  GECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiek  1373
             G+ W +D  +L +D + + ++ +K +GVRPE IG+ + +YA K   ELT           
Sbjct  203   GDWWIEDLSVLRIDMYQRVITAMKCRGVRPESIGASLVNYAQK---ELTK----------  249

Query  1372  gGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMV  1193
                   K    + SS     S S + ++  VET++ +LP EK ++P NFL  LLR   M+
Sbjct  250   ------KSSLWNPSSQTNVDSNSTLHEKLVVETIVSLLPVEKLAVPINFLFGLLRSAMML  303

Query  1192  GVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAA  1013
                 A R ++E+RI  QL+ ATL +++IPSF H   T+ DV+ V R++  F    +D   
Sbjct  304   DCTIASRLDMERRIGSQLDVATLDDILIPSFRHAGDTLFDVDTVHRILVNF-CQQDDSEE  362

Query  1012  VMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPT  833
                 +    S +P       L+KV+KL+D+YLAE A D+NL +S+F+ +A  +P HAR  
Sbjct  363   EPEDASVFESDSPISPSQTALVKVSKLMDNYLAEIAPDANLKLSKFMVIAETLPAHARTI  422

Query  832   DDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLS  653
              D LYR+ID YLKAH G++  ++K++CKLID +KLS EA  HAAQNERLPV++++QVL  
Sbjct  423   HDGLYRAIDIYLKAHQGLTDLDKKKLCKLIDFQKLSQEAGAHAAQNERLPVQSIVQVLYF  482

Query  652   EQTKLSKQL  626
             EQ +L   L
Sbjct  483   EQLRLRNSL  491



>ref|XP_007201187.1| hypothetical protein PRUPE_ppa002993mg [Prunus persica]
 gb|EMJ02386.1| hypothetical protein PRUPE_ppa002993mg [Prunus persica]
Length=614

 Score =   214 bits (545),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 121/309 (39%), Positives = 178/309 (58%), Gaps = 18/309 (6%)
 Frame = -3

Query  1552  GECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiek  1373
             G+ W +D  +L +D + + ++ +K +GVRPE IG+ + +YA K   ELT          +
Sbjct  204   GDWWIEDLSVLRVDLYQRVITAMKCRGVRPESIGASLVNYAQK---ELTKKSSLWNPSGQ  260

Query  1372  gGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMV  1193
                 +I                    ++  VET++G+LP EK  +P  FL  LLR   M+
Sbjct  261   TKVDVIPASTG--------------HEKLVVETIVGLLPVEKLVVPITFLFGLLRSAVML  306

Query  1192  GVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAA  1013
                 A R +LE+RI  QL+ ATL +L+IPSF H   T+ DV+ V R++  F    +D   
Sbjct  307   DCTIACRLDLERRIGSQLDIATLDDLLIPSFKHAGDTLFDVDTVHRILVNF-SQQDDSEE  365

Query  1012  VMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPT  833
              M       S +P       L KV+KL+D+YLAE A D+NL +++F+ +A  +P HAR  
Sbjct  366   DMEDGSVFESDSPHSPSQTALFKVSKLLDNYLAEIAPDANLKLAKFLVIADALPEHARTV  425

Query  832   DDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLS  653
              D LYR+ID YLKAH G+S  ++K++CK+ID +KLS EA  HAAQNERLP+++++QVL  
Sbjct  426   HDGLYRAIDIYLKAHQGLSDTDKKKLCKMIDFQKLSQEAGAHAAQNERLPLQSIVQVLYF  485

Query  652   EQTKLSKQL  626
             EQ +L   L
Sbjct  486   EQIRLRNSL  494



>ref|XP_008235484.1| PREDICTED: BTB/POZ domain-containing protein At5g48800 [Prunus 
mume]
Length=614

 Score =   214 bits (544),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 121/309 (39%), Positives = 178/309 (58%), Gaps = 18/309 (6%)
 Frame = -3

Query  1552  GECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiek  1373
             G+ W +D  +L +D + + ++ +K +GVRPE IG+ + +YA K   ELT          +
Sbjct  204   GDWWIEDLSVLRVDLYQRVITAMKCRGVRPESIGASLVNYAQK---ELTKKSSLWNPSGQ  260

Query  1372  gGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMV  1193
                 +I                    ++  VET++G+LP EK  +P  FL  LLR   M+
Sbjct  261   TKVDVIPASTG--------------HEKLVVETIVGLLPVEKLVVPITFLFGLLRSAVML  306

Query  1192  GVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAA  1013
                 A R +LE+RI  QL+ ATL +L+IPSF H   T+ DV+ V R++  F    +D   
Sbjct  307   DCTIACRLDLERRIGSQLDIATLDDLLIPSFKHAGDTLFDVDTVHRILVNF-SQQDDSEE  365

Query  1012  VMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPT  833
              M       S +P       L KV+KL+D+YLAE A D+NL +++F+ +A  +P HAR  
Sbjct  366   DMEDGSVFESDSPHSPSQTALFKVSKLLDNYLAEIAPDANLKLAKFLVIADALPEHARTV  425

Query  832   DDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLS  653
              D LYR+ID YLKAH G+S  ++K++CK+ID +KLS EA  HAAQNERLP+++++QVL  
Sbjct  426   HDGLYRAIDIYLKAHQGLSDTDKKKLCKMIDFQKLSQEAGAHAAQNERLPLQSIVQVLYF  485

Query  652   EQTKLSKQL  626
             EQ +L   L
Sbjct  486   EQIRLRNSL  494



>ref|XP_011092443.1| PREDICTED: root phototropism protein 3 [Sesamum indicum]
Length=690

 Score =   215 bits (547),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 123/312 (39%), Positives = 190/312 (61%), Gaps = 22/312 (7%)
 Frame = -3

Query  1294  KRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLREL  1115
             +R  +E+LI I+PP++DS+ C+FLLRLLR+ NM+ V  A   ELEKR+  Q EQATL +L
Sbjct  340   QRMIIESLISIIPPQRDSVSCSFLLRLLRMANMLNVAPALVTELEKRVGMQFEQATLADL  399

Query  1114  MIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAAVMRCSGSSS---SGAPPLNLNLNLIK  944
             +IPS++    T+ DV+LV RL++ F+V  + + +  R S   +    G      +   ++
Sbjct  400   LIPSYNKN-DTMYDVDLVQRLLEHFLVQEQPENSSPRQSSYDTKVYDGFQRATHSNAQMR  458

Query  943   VAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEER  764
             VA+LVD YL E A D NL++++F  LA  +P  AR  DD LYR++D+YLKAHP +++ ER
Sbjct  459   VARLVDSYLTEVARDKNLSLTKFQVLAEALPESARTCDDGLYRAVDSYLKAHPTLTEHER  518

Query  763   KRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLSEQTKLSKQL----MRQLEWsggs  596
             KR+C+++D +KLS +A +HAAQNERLP+R V+QVL SEQ K+S  L    +++   S   
Sbjct  519   KRLCRVMDCQKLSIDACMHAAQNERLPLRIVVQVLFSEQVKISNALANSALKEAGESHYQ  578

Query  595   fisasagasgGTCPRSpnppapgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQ  416
              + ++        P+S                  +K+D+NT+     E++ +K   L LQ
Sbjct  579   PMVSNRRTLLEGTPQSFQEGW-----------AAAKKDINTLK---FELESIKAMYLELQ  624

Query  415   TQCINMQAQIEK  380
              +   +Q Q++K
Sbjct  625   NEMETLQRQVDK  636


 Score = 64.3 bits (155),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPEL  1409
             + WF+DA IL +D+FV+ ++ IK KG+R ELIG+ I HYASKWL  L
Sbjct  229   DWWFEDASILRIDHFVRVITAIKVKGMRYELIGAAIMHYASKWLTGL  275



>ref|XP_009792130.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like [Nicotiana 
sylvestris]
Length=606

 Score =   213 bits (542),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 124/310 (40%), Positives = 177/310 (57%), Gaps = 18/310 (6%)
 Frame = -3

Query  1552  GECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiek  1373
             G+ W +D  +L +D + + ++ +K +GVRPE I + + +YA K   ELT    S     +
Sbjct  200   GDWWIEDLSVLRIDLYQRVITAMKCRGVRPESIAASLVNYAQK---ELTKKSSSWNQSSQ  256

Query  1372  gGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMV  1193
                 ++                    ++  VET++ ++P EK  +P  FL  LLR   M+
Sbjct  257   PKVDVVSGSNG--------------HEKVVVETIVSLMPVEKLVVPITFLFGLLRSAVML  302

Query  1192  GVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAA  1013
                 A R +LE+RI  QL+ ATL +L+IP F +   T+ DV+ V R++  F    ED   
Sbjct  303   DCTVACRLDLERRIGSQLDIATLDDLLIPFFRNAGDTLFDVDTVHRILVNFFQQ-EDSDE  361

Query  1012  VMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPT  833
              M       SG+P       L KVAKLVD+YLAE A D+NL +++FIA+A  +P HAR  
Sbjct  362   DMDDVSVFESGSPTSPSQTALFKVAKLVDNYLAEIAPDANLKLNKFIAIAESLPAHARTV  421

Query  832   DDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLS  653
              D LYRSID YLKAH  +S  +R+R+CKLID +KLS EA  HAAQNERLP+++++QVL  
Sbjct  422   HDGLYRSIDVYLKAHQALSDPDRRRLCKLIDFQKLSQEAGSHAAQNERLPLQSIVQVLYF  481

Query  652   EQTKLSKQLM  623
             EQ +L   L 
Sbjct  482   EQLRLRNALF  491



>gb|KHG00255.1| hypothetical protein F383_19997 [Gossypium arboreum]
Length=611

 Score =   213 bits (543),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 124/312 (40%), Positives = 180/312 (58%), Gaps = 26/312 (8%)
 Frame = -3

Query  1552  GECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiek  1373
             G+ W +D  ++ +D + + ++ +K +GVRPE IG+ + +YA K   ELT           
Sbjct  201   GDWWIEDLSVIRIDLYQRVMTAMKCRGVRPESIGASLVNYAQK---ELTKKSSLWNPSG-  256

Query  1372  gGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMV  1193
               H  I    +               +R  VET++ +LP EK ++P  FL  LLR   M+
Sbjct  257   --HTKIDLFSTD-------------HERLVVETIVSLLPVEKLAVPITFLFGLLRSAVML  301

Query  1192  GVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAA  1013
                 A R +LE+RI  QL+ ATL +L+IPSF H   T+ DV+ V    +R +V+   Q  
Sbjct  302   DCSIACRLDLERRIGSQLDIATLDDLLIPSFRHAGDTLFDVDTV----QRILVNFSQQDD  357

Query  1012  VMRCSGSSS---SGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHA  842
                    +S   S +P       L KV+KLVD+YLAE A D+NL +++F+A+A  +PTHA
Sbjct  358   SEDDMDDASVFESDSPHSPSQGALFKVSKLVDNYLAEIAPDANLKLAKFMAIAETLPTHA  417

Query  841   RPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQV  662
             R   D LYR+ID YLKAH G+   ++K++CKLID +KLS EA  HAAQNERLP+++++QV
Sbjct  418   RTIHDGLYRAIDIYLKAHQGLPDADKKKLCKLIDFQKLSQEAGAHAAQNERLPLQSIVQV  477

Query  661   LLSEQTKLSKQL  626
             L  EQ +L   L
Sbjct  478   LYFEQLRLRNAL  489



>ref|XP_010520803.1| PREDICTED: root phototropism protein 3 [Tarenaya hassleriana]
 ref|XP_010520813.1| PREDICTED: root phototropism protein 3 [Tarenaya hassleriana]
Length=719

 Score =   214 bits (545),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 127/311 (41%), Positives = 189/311 (61%), Gaps = 9/311 (3%)
 Frame = -3

Query  1294  KRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLREL  1115
             +R  VE+LI I+PP+KD + C+FLLRLLR+ NM+ V  A   ELEKR+  Q EQA L +L
Sbjct  358   QRMIVESLISIIPPQKDCVSCSFLLRLLRMANMLKVAPALITELEKRVGMQFEQAALPDL  417

Query  1114  MIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAAVMRCSGSS--SSGAPPLNLNLN---L  950
             +IP++++   T+ DV+LV RL++ F+V  +   +    S SS  + G   +N   N    
Sbjct  418   LIPAYNNKGETMYDVDLVQRLLEHFLVQEQTDGSSPSRSSSSVYADGVQRVNSGNNPTAK  477

Query  949   IKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKE  770
             ++VA+LVD YL E A D NL++++F  LA  +P  AR  DD LYR+ID+YLKAHP +S+ 
Sbjct  478   MRVARLVDSYLTEVARDRNLSLTKFQVLAEALPESARTCDDGLYRAIDSYLKAHPTLSEH  537

Query  769   ERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLSEQTKLSKQLMRQLEWsggsfi  590
             ERKR+C+++D +KLS +A +HAAQNERLP+R V+QVL SEQ K+S  L            
Sbjct  538   ERKRLCRVMDCQKLSIDACMHAAQNERLPLRVVVQVLFSEQVKISNALANSSLKDSSMAA  597

Query  589   sasagasgGTCPRSpnppapgaqqqqqdPRCMSKRDMNTINIQHLEIKKLKEEVLRLQTQ  410
               +  +     P +         Q  Q+    +K+D+NT+     E++ +K + + LQ +
Sbjct  598   GEALSSYQPMIP-NRKTLIEATPQSFQEGWAAAKKDINTMK---FELESVKTKYVELQNE  653

Query  409   CINMQAQIEKL  377
                +Q Q EK+
Sbjct  654   MEALQRQFEKM  664


 Score = 63.2 bits (152),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPEL  1409
             + WF+D  IL +D+FV+ ++ IK KG+R EL+G+ I HYA KWLP L
Sbjct  242   DWWFEDVSILRIDHFVRVITAIKVKGMRFELVGAAIMHYAGKWLPGL  288



>gb|KFK28125.1| hypothetical protein AALP_AA8G475700 [Arabis alpina]
Length=739

 Score =   214 bits (545),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 117/238 (49%), Positives = 161/238 (68%), Gaps = 15/238 (6%)
 Frame = -3

Query  1294  KRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLREL  1115
             +R  VE+LI I+PP+KDS+ C+FLLRLLR  NM+ V  A   ELEKR+  Q EQATL++L
Sbjct  368   QRMIVESLISIIPPQKDSVTCSFLLRLLRAANMLKVAPALITELEKRVGMQFEQATLQDL  427

Query  1114  MIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAAV-MRCSGSSS----SGAPPLNLNLNL  950
             +IP +++   T+ DV+LV RL++ F+V  + + +   R S S S    SG P  N + N 
Sbjct  428   LIPGYNNKGETMYDVDLVQRLLEHFLVQEQTEGSSPSRMSPSQSMYAESGIPRANSSSNN  487

Query  949   ----------IKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPTDDALYRSIDTY  800
                       ++VA+LVD YL E A D NL +++F  LA  +P  AR  DD LYR+ID+Y
Sbjct  488   GGGGGNQNAKMRVARLVDSYLTEVARDRNLPLTKFQVLAEALPESARTCDDGLYRAIDSY  547

Query  799   LKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLSEQTKLSKQL  626
             LKAHP +S+ ERKR+C+++D +KLS +A +HAAQNERLP+R V+QVL SEQ K+S  L
Sbjct  548   LKAHPTLSEHERKRLCRVMDCQKLSMDACMHAAQNERLPLRVVVQVLFSEQVKISNAL  605


 Score = 62.4 bits (150),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPEL  1409
             + WF+D  IL +D+FV+ ++ IK KG+R EL+G+ I HYA KWLP L
Sbjct  247   DWWFEDVSILRIDHFVRVITAIKVKGMRFELLGAAIMHYAGKWLPGL  293



>ref|XP_009371616.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like [Pyrus 
x bretschneideri]
Length=599

 Score =   212 bits (539),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 126/312 (40%), Positives = 180/312 (58%), Gaps = 18/312 (6%)
 Frame = -3

Query  1561  KPMGECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggsees  1382
             K  G+ W +D  +L +D + + ++ +K +GVRPE IG+ + +YA K   ELT        
Sbjct  186   KSDGDWWIEDLSVLRVDLYQRVITAMKCRGVRPESIGASLVNYAQK---ELTKKS-----  237

Query  1381  iekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIG  1202
                           S  +  + +SAS       VET++ +LP EK  IP NFL  L  + 
Sbjct  238   ---------SLWNMSGQTKVDGISASTGHTGHVVETIVSLLPVEKLVIPINFLFGLFGLS  288

Query  1201  NMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLED  1022
              M+    A R +LE+RI  QL+ ATL +L+IPSF H   T+ DV+ V R++  F    +D
Sbjct  289   VMLDCTIACRLDLERRIGSQLDIATLDDLLIPSFKHAGDTLFDVDTVHRILVNF-SQQDD  347

Query  1021  QAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHA  842
                 M       S +P       L KV+KLVD+YLAE A D+NL +++FI +A  +P HA
Sbjct  348   SKEDMEDMEDVESDSPHSPSQTALFKVSKLVDNYLAEIAPDANLKLAKFIVIADALPEHA  407

Query  841   RPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQV  662
             R   D LYR+ID YLKAH G++  ++KR+CK+ID +KLS EA  HAAQNERLP+++++QV
Sbjct  408   RTVHDGLYRAIDIYLKAHQGLTDTDKKRLCKMIDFQKLSQEAGAHAAQNERLPLQSIVQV  467

Query  661   LLSEQTKLSKQL  626
             L  EQ +L   L
Sbjct  468   LYFEQIRLRNSL  479



>ref|XP_011089103.1| PREDICTED: BTB/POZ domain-containing protein At5g48800 [Sesamum 
indicum]
Length=612

 Score =   212 bits (539),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 124/313 (40%), Positives = 178/313 (57%), Gaps = 24/313 (8%)
 Frame = -3

Query  1552  GECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiek  1373
             G+ W +D  +L +D + + ++ +K +GVRPE IG+ + +YA K L + +           
Sbjct  201   GDWWIEDLSVLRIDLYQRVIAAMKCRGVRPESIGASLVNYAQKELIKKS-----------  249

Query  1372  gGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMV  1193
                        S+    E  S +    R  VET+I +LP EK ++P  FL  LLR   M+
Sbjct  250   ------SLRNQSTQPKVELTSGASSHARLVVETIISLLPVEKFAVPITFLFGLLRSAVML  303

Query  1192  GVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAA  1013
                 A R +LE+RI  QL+ ATL +L+IPSF H   T+ DV+ V     R +V+   Q  
Sbjct  304   DCTVACRLDLERRIGSQLDIATLDDLLIPSFRHAGDTLFDVDTV----HRILVNFSQQDD  359

Query  1012  VMRCSGSS---SSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHA  842
                    S    S +P       L KV+KLVD+YLAE A D+NL +++FIA+A  +P HA
Sbjct  360   SEEDMDDSSLFESDSPSSPSQTALFKVSKLVDNYLAEIAPDANLKLNKFIAVAETLPAHA  419

Query  841   RPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQV  662
             R   D LYR+ID Y KAH G++  +R+++CKLID +KLS EA  HAAQNERLP+++++QV
Sbjct  420   RTIHDGLYRAIDVYFKAHQGLTDADRRKLCKLIDFQKLSQEAGAHAAQNERLPLQSIVQV  479

Query  661   LLSEQTKLSKQLM  623
             L  EQ +L   L 
Sbjct  480   LYYEQLRLRNALF  492



>ref|XP_002989054.1| hypothetical protein SELMODRAFT_272040 [Selaginella moellendorffii]
 gb|EFJ09848.1| hypothetical protein SELMODRAFT_272040 [Selaginella moellendorffii]
Length=607

 Score =   211 bits (538),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 125/312 (40%), Positives = 183/312 (59%), Gaps = 36/312 (12%)
 Frame = -3

Query  1558  PMGECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesi  1379
             P  + W +D  IL +D++ + L+ ++++G+  E +   + HYA + L             
Sbjct  192   PQLDWWAEDLSILSLDFYQRVLAVMRSQGMPQENLWGSLMHYAQQALK------------  239

Query  1378  ekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGN  1199
                      F  +SS S   SV+    ++R  VET++G+LPP+K S  C FL  LLR   
Sbjct  240   --------GFNSTSSKSPGRSVTGLEHEQRMLVETIVGLLPPDKRSASCGFLFGLLRTSI  291

Query  1198  MVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVS-LED  1022
             ++    A R ELE+RIS QL++ATL +L+IPSFS    T+ D +LV RL+  F+   L+D
Sbjct  292   ILDTTVACRLELERRISLQLDEATLDDLLIPSFSFAADTLFDTDLVHRLLSSFLQHHLQD  351

Query  1021  QAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHA  842
             ++   + S               L KVAKL+D YLAE A D+NL +S+FIALA  +P H+
Sbjct  352   ESKASQSS---------------LAKVAKLMDSYLAEVAPDANLKVSKFIALAELLPEHS  396

Query  841   RPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQV  662
             R  +D LYR++D +LKAHP + + +RKR+CKL+D ++LS EA  HAAQNERLP   +IQV
Sbjct  397   RMVEDGLYRAVDIFLKAHPLLVEADRKRICKLMDPQRLSQEACSHAAQNERLPAHFIIQV  456

Query  661   LLSEQTKLSKQL  626
             L  EQ ++   L
Sbjct  457   LYFEQLRIKTAL  468



>gb|KEH20837.1| phototropic-responsive NPH3 family protein [Medicago truncatula]
Length=517

 Score =   209 bits (533),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 115/321 (36%), Positives = 188/321 (59%), Gaps = 32/321 (10%)
 Frame = -3

Query  1543  WFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekgGH  1364
             WFDD   L +D+F++ +S I+AKG + E+IG  I  YA +WLP +       E +   GH
Sbjct  215   WFDDLATLRIDHFMRIISAIRAKGTKQEIIGKCIMQYAKRWLPGM---YEELEGLRGYGH  271

Query  1363  LIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMVGVE  1184
                  + +  S   E  +    ++   +E+LI I+PP++D++PC FLL++L++  M  V 
Sbjct  272   GKSNLQFTIFSMKKEESTRHSKEQTTIIESLISIIPPQQDAVPCKFLLQMLKMAMMYSVS  331

Query  1183  AAYRAELEKRISWQLEQATLRELMIPSFSH--------------TCGTVLDVELVLRLVK  1046
             +A  ++LEKR+   LE A + +L+IP + +               C T+ D+++V R+V+
Sbjct  332   SALISDLEKRVGMVLEDAEVDDLLIPRYQNGGQGKMVNMPNSPENC-TMQDIDVVQRIVE  390

Query  1045  RFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIAL  866
              F++  + Q  + + SG                 +++L+D+YLAE A D NL+++ F  L
Sbjct  391   YFLMHEKQQTQLQQKSGK--------------FNISRLLDNYLAEVATDPNLSITTFQVL  436

Query  865   AAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERL  686
             A  +P H R   D LYR+IDTYLK HP ++ ++R+R+CK+++  KLS +A IHAAQN+RL
Sbjct  437   AELLPEHTRSFHDGLYRAIDTYLKTHPSLTDQDRRRLCKIMNCEKLSLDACIHAAQNDRL  496

Query  685   PVRTVIQVLLSEQTKLSKQLM  623
             P+RTV+QV      +LS +L+
Sbjct  497   PLRTVVQVKFLGSLELSLRLL  517



>ref|XP_001769248.1| predicted protein [Physcomitrella patens]
 gb|EDQ65960.1| predicted protein [Physcomitrella patens]
Length=586

 Score =   211 bits (536),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 126/318 (40%), Positives = 180/318 (57%), Gaps = 48/318 (15%)
 Frame = -3

Query  1558  PMGECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesi  1379
             P+ E W +D  +L  D+F K L+ ++ +G+R E +G  + HYA + L             
Sbjct  179   PVVEWWAEDLAVLRFDFFQKVLAQMRTRGMRCESLGGAVMHYAHRAL-------------  225

Query  1378  ekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGN  1199
                                     S  ++R  VE ++ I+PPE+++I C+FL  LLR   
Sbjct  226   --------------------KAQRSTHEQRILVEAIVSIMPPERNAISCSFLFGLLRAAV  265

Query  1198  MVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFI------  1037
             ++    A R +LE+RI  QLEQATL +L+IPS +H+  T+ DV+ V R++  F+      
Sbjct  266   VLECTLACRLDLERRIGLQLEQATLDDLLIPSVNHSGETLFDVDAVQRILNCFMQQDGDG  325

Query  1036  -VSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAA  860
              V   D        GS +  A        LIKVAKL+D YLAE A D+NLT+S+F+ALA 
Sbjct  326   EVDHTDPMYEAEGVGSPTQSA--------LIKVAKLLDTYLAEIAPDANLTISKFMALAE  377

Query  859   PIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPV  680
              +P HAR  DD LYR++D +LKAHP + + ERK +CK+ID +KLS +A  HAAQNERLPV
Sbjct  378   VLPEHARRVDDGLYRAVDVFLKAHPAIIEAERKTLCKIIDCQKLSQDACTHAAQNERLPV  437

Query  679   RTVIQVLLSEQTKLSKQL  626
             + V+QVL  EQ +L   +
Sbjct  438   QVVVQVLYFEQLRLRNAM  455



>ref|XP_002963864.1| hypothetical protein SELMODRAFT_141980 [Selaginella moellendorffii]
 gb|EFJ35735.1| hypothetical protein SELMODRAFT_141980 [Selaginella moellendorffii]
Length=631

 Score =   211 bits (538),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 118/309 (38%), Positives = 187/309 (61%), Gaps = 18/309 (6%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             E W +D  +L +D++ + L  +K+KGVR E +   + HYA + L  L             
Sbjct  215   EWWAEDLSLLRIDFYQRVLEAMKSKGVREESLWGTLMHYAQQSLKGLNRAPTGGRG----  270

Query  1369  GHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMVG  1190
                ++K +E++++           ++R  VET++ +LP EK+   C+FL  LLR   ++ 
Sbjct  271   ---LMKVQENTAALE--------HEQRILVETIVSLLPREKNIASCSFLFGLLRTAIILD  319

Query  1189  VEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLE-DQAA  1013
                A R ++EKRI+ QL+QATL +L++PSFS+   T+ DV++V R++  FI   E D   
Sbjct  320   TTVACRLDIEKRIALQLDQATLDDLLVPSFSYNGETLFDVDIVQRILTNFIQQHENDDLP  379

Query  1012  VMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPT  833
               + +  S   A P   +++  KVAKL+D YLAE A D+NL +++F+A+   +P +AR  
Sbjct  380   EAQTTYESDGLATPTQTSVS--KVAKLMDGYLAEIAPDANLKVNKFVAIGELLPDYARAI  437

Query  832   DDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLS  653
             DD LYR++D YLKAHP + ++ERK++C+L+ ++KLS EA  HAAQNERLP    IQVL  
Sbjct  438   DDGLYRAVDIYLKAHPNLGEQERKKICRLLSAQKLSQEACCHAAQNERLPAHFAIQVLYF  497

Query  652   EQTKLSKQL  626
             EQ ++  ++
Sbjct  498   EQVRIRTEM  506



>ref|XP_002983725.1| hypothetical protein SELMODRAFT_228979 [Selaginella moellendorffii]
 gb|EFJ15221.1| hypothetical protein SELMODRAFT_228979 [Selaginella moellendorffii]
Length=604

 Score =   211 bits (537),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 125/312 (40%), Positives = 182/312 (58%), Gaps = 36/312 (12%)
 Frame = -3

Query  1558  PMGECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesi  1379
             P  + W +D  IL +D++ + L+ +++ G+  E +   + HYA + L             
Sbjct  192   PQLDWWAEDLSILSLDFYQRVLAVMRSHGMPQENLWGSLMHYAQQALK------------  239

Query  1378  ekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGN  1199
                      F  +SS S   SV+    ++R  VET++G+LPP+K S  C FL  LLR   
Sbjct  240   --------GFNSTSSKSPGRSVTGLEHEQRMLVETIVGLLPPDKRSASCGFLFGLLRTSI  291

Query  1198  MVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVS-LED  1022
             ++    A R ELE+RIS QL++ATL +L+IPSFS    T+ D +LV RL+  F+   L+D
Sbjct  292   ILDTTVACRLELERRISLQLDEATLDDLLIPSFSFAADTLFDTDLVHRLLSSFLQHHLQD  351

Query  1021  QAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHA  842
             ++   + S               L KVAKL+D YLAE A D+NL +S+FIALA  +P H+
Sbjct  352   ESKASQSS---------------LAKVAKLMDSYLAEVAPDANLKVSKFIALAEVLPEHS  396

Query  841   RPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQV  662
             R  +D LYR++D +LKAHP + + +RKR+CKL+D ++LS EA  HAAQNERLP   +IQV
Sbjct  397   RMVEDGLYRAVDIFLKAHPLLVEADRKRICKLMDPQRLSQEACSHAAQNERLPAHFIIQV  456

Query  661   LLSEQTKLSKQL  626
             L  EQ ++   L
Sbjct  457   LYFEQLRIKTAL  468



>ref|XP_006394165.1| hypothetical protein EUTSA_v10003710mg [Eutrema salsugineum]
 gb|ESQ31451.1| hypothetical protein EUTSA_v10003710mg [Eutrema salsugineum]
Length=735

 Score =   213 bits (542),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 115/234 (49%), Positives = 160/234 (68%), Gaps = 11/234 (5%)
 Frame = -3

Query  1294  KRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLREL  1115
             +R  VE+LI I+PP+KDS+ C+FLLRLLR  +M+ V  A   ELEKR+  Q EQATL++L
Sbjct  367   QRMIVESLISIIPPQKDSVSCSFLLRLLRAASMLKVAPALITELEKRVGMQFEQATLQDL  426

Query  1114  MIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAAV-MRCSGSSS----SGAPPLNLNLNL  950
             +IP +++   T+ DV+LV RL++ F+V  + + +   R S S S    +G P  N N   
Sbjct  427   LIPGYNNKGETMYDVDLVQRLLEHFLVQEQTEGSSPSRMSPSQSMYTDAGIPRANSNNGN  486

Query  949   ------IKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAH  788
                   ++VA+LVD YL E A D NL +++F  LA  +P  AR  DD LYR+ID+YLKAH
Sbjct  487   SNQNAKMRVARLVDSYLTEVARDRNLPLTKFQVLAEALPESARTCDDGLYRAIDSYLKAH  546

Query  787   PGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLSEQTKLSKQL  626
             P +S+ ERKR+C+++D +KLS +A +HAAQNERLP+R V+QVL SEQ K+S  L
Sbjct  547   PTLSEHERKRLCRVMDCQKLSMDACMHAAQNERLPLRVVVQVLFSEQVKISNAL  600


 Score = 62.8 bits (151),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPEL  1409
             + WF+D  IL +D+FV+ ++ IK KG+R EL+G+ I HYA KWLP L
Sbjct  250   DWWFEDVSILRIDHFVRVITAIKVKGMRFELLGAAIMHYAGKWLPGL  296



>gb|AFO63285.1| bZIP6 [Tamarix hispida]
Length=629

 Score =   211 bits (538),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 122/311 (39%), Positives = 183/311 (59%), Gaps = 32/311 (10%)
 Frame = -3

Query  1543  WFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekgGH  1364
             W+DDA  L +  +   +S ++++G++PELI   I +Y  K+LP L              H
Sbjct  216   WYDDASTLSLCLYKSLISAMESRGIKPELIAGSIAYYGKKYLPGLNR------------H  263

Query  1363  LIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMVGVE  1184
                    +  S+ A    +S  +++  VE +  +LP +K  +   FL  LLR   ++  E
Sbjct  264   QAASNSSTCLSTQAMETLSSEEEQKHLVEEVDRLLPMQKGLVSTKFLFGLLRTAMILKAE  323

Query  1183  AAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAAVMR  1004
               + + LEKRI  QL+QATL +L++P+FSH+  T+ +V+ V R+++ F+    DQA    
Sbjct  324   PTHISNLEKRIGMQLDQATLEDLLMPNFSHSMETLYNVDCVERILEHFLAM--DQA----  377

Query  1003  CSGSSSSGAPPLNLNLNLIK---------VAKLVDDYLAEAAVDSNLTMSQFIALAAPIP  851
                  + GA P +++  L+          VAKL+D YLAE A D  L + +F ALAA +P
Sbjct  378   -----NDGASPGSVDDQLMASPSLTPITMVAKLIDGYLAEVAPDVYLKLPKFQALAAAVP  432

Query  850   THARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTV  671
              +ARP DD LYR+ID YLK+HP +S+ ER+++C+LID +KLS EA  HAAQNERLPVR +
Sbjct  433   EYARPLDDGLYRAIDIYLKSHPWLSESEREQLCRLIDCQKLSLEACTHAAQNERLPVRII  492

Query  670   IQVLLSEQTKL  638
             +QVL  EQ +L
Sbjct  493   VQVLFFEQLQL  503



>ref|XP_003613103.1| BTB/POZ domain-containing protein [Medicago truncatula]
 gb|AES96061.1| phototropic-responsive NPH3 family protein [Medicago truncatula]
Length=636

 Score =   211 bits (538),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 127/330 (38%), Positives = 191/330 (58%), Gaps = 50/330 (15%)
 Frame = -3

Query  1543  WFDDACILDMDYFVKTLSGIKAKGVRP-ELIGSIITHYASKWLPELTggggseesiekgG  1367
             W +D   L +D + +T+  IK+ G  P  LIG  +  YAS+WLP ++  G  ++      
Sbjct  211   WAEDLAELSIDLYWRTMIAIKSGGKVPSNLIGDALKIYASRWLPNISKNGNRKK------  264

Query  1366  HLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMVGV  1187
                     + S S ++S S    K R  +E+++ +LP EK ++ C+FLL+LL+  N++  
Sbjct  265   ----NVSLAESESNSDSASEITSKHRLLLESIVSLLPTEKGAVSCSFLLKLLKASNILNA  320

Query  1186  EAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAAVM  1007
              ++ + EL +R+  QLE+AT+ +L+IPS S+T  T+ DVELV+ ++++F++         
Sbjct  321   SSSSKMELARRVGLQLEEATVNDLLIPSLSYTNDTLYDVELVMTILEQFMLQ--------  372

Query  1006  RCSGSSSSGAPPLNL------------NLNL----------------IKVAKLVDDYLAE  911
                G S   +PP +L            N+N                 +KVAKLVD YL E
Sbjct  373   ---GQSPPTSPPRSLKTFERRRSRSAENINFELQESRRSSSASHSSKLKVAKLVDRYLQE  429

Query  910   AAVDSNLTMSQFIALAAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRK  731
              A D N ++S+FIALA  IP  AR   D LYR+ID YLKAHP ++K ERKR+C+++D +K
Sbjct  430   VARDVNFSLSKFIALADIIPEFARYDHDDLYRAIDIYLKAHPELNKSERKRLCRILDCKK  489

Query  730   LSAEASIHAAQNERLPVRTVIQVLLSEQTK  641
             LS EA +HAAQNE LP+R V+QVL  EQ +
Sbjct  490   LSMEACMHAAQNELLPLRVVVQVLFFEQAR  519



>ref|XP_007049780.1| Phototropic-responsive NPH3 family protein [Theobroma cacao]
 gb|EOX93937.1| Phototropic-responsive NPH3 family protein [Theobroma cacao]
Length=619

 Score =   211 bits (537),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 127/314 (40%), Positives = 185/314 (59%), Gaps = 24/314 (8%)
 Frame = -3

Query  1561  KPMGECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggsees  1382
             K  G+ W +D  ++ +D + + ++ +K +GVRPE IG+ + +YA K   ELT        
Sbjct  206   KCEGDWWIEDLSVIRIDLYQRVMTAMKCRGVRPESIGASLVNYAQK---ELTK-------  255

Query  1381  iekgGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIG  1202
                      K    + S   +    S   +R  VET++ +LP EK ++P +FL  LLR  
Sbjct  256   ---------KSSLWNPSGQTKVDLVSTGHERLVVETVVSLLPVEKLAVPISFLFGLLRSA  306

Query  1201  NMVGVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLED  1022
              M+    A R +LE+RI  QL+ ATL +L+IPSF H   T+ DV+ V R++  F    + 
Sbjct  307   VMLDCTIACRLDLERRIGSQLDIATLDDLLIPSFRHAGDTLFDVDTVQRILVNFSQQDDS  366

Query  1021  QAAVMRCS--GSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPT  848
             +  +   S   S S  +P  +    L KVAKLVD+YLAE A D+NL +++F+A+A  +P 
Sbjct  367   EDDMDDASVFESDSLHSPSQSA---LFKVAKLVDNYLAEIAPDANLKLAKFMAIAETLPA  423

Query  847   HARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVI  668
             HAR   D LYR+ID YLKAH G+   +RK++CKLID +KLS EA  HAAQNERLP+++++
Sbjct  424   HARTIHDGLYRAIDIYLKAHQGLPDADRKKLCKLIDFQKLSQEAGAHAAQNERLPLQSIV  483

Query  667   QVLLSEQTKLSKQL  626
             QVL  EQ +L   L
Sbjct  484   QVLYFEQLRLRNAL  497



>ref|XP_007159657.1| hypothetical protein PHAVU_002G256200g [Phaseolus vulgaris]
 gb|ESW31651.1| hypothetical protein PHAVU_002G256200g [Phaseolus vulgaris]
Length=624

 Score =   211 bits (537),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 121/316 (38%), Positives = 177/316 (56%), Gaps = 32/316 (10%)
 Frame = -3

Query  1543  WFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekgGH  1364
             WF+D     +D+F++ +S I+AKG RPE+IG  I  YA KWLP +              H
Sbjct  211   WFNDVATFRIDHFMRIISAIRAKGTRPEIIGKCIMEYAKKWLPGMDVEIEGLRGYG---H  267

Query  1363  LIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMVGVE  1184
                  E S  S   +  S     ++  +ETLI I+P + D++ C F+L++L++  M  V 
Sbjct  268   EKYNLEFSIFSGKKKESSGHSKDQKTIIETLISIIPHQPDAVSCKFMLQMLKMAMMYSVS  327

Query  1183  AAYRAELEKRISWQLEQATLRELMIPSF--------------SHTCGTVLDVELVLRLVK  1046
              A   ELEKR+S  LE A +  L+IP +              S  C T+LD+++V R+V+
Sbjct  328   PALTTELEKRVSMVLEDAEVSHLLIPRYQNGDQGKTVIMTSSSEEC-TMLDIDVVQRIVE  386

Query  1045  RFIVSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIAL  866
              F+         M               N     V++L+D+YLAE A D NL++++F   
Sbjct  387   YFL---------MHEQQQMQQQQKTRKFN-----VSRLLDNYLAEIARDPNLSITKFQVF  432

Query  865   AAPIPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERL  686
             A  +P  +R  DD LYR+IDTYLK HP +S+ +RKR+CK+++  KLS +A +HAAQNERL
Sbjct  433   AELLPESSRSYDDGLYRAIDTYLKTHPALSEHDRKRLCKIMNCEKLSLDACLHAAQNERL  492

Query  685   PVRTVIQVLLSEQTKL  638
             P+RTV+QVL SEQ K+
Sbjct  493   PLRTVVQVLFSEQVKM  508



>ref|XP_004240016.1| PREDICTED: putative BTB/POZ domain-containing protein DOT3 isoform 
X2 [Solanum lycopersicum]
Length=624

 Score =   211 bits (537),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 116/313 (37%), Positives = 184/313 (59%), Gaps = 21/313 (7%)
 Frame = -3

Query  1552  GECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiek  1373
             G  WFDD   L +D+F++ ++ ++ KGV+PE+IGS I +Y  K LP + G     +    
Sbjct  218   GTWWFDDVATLRIDFFMRIITAVRVKGVKPEIIGSCIMNYGEKCLPCMYGDTRGMDCKTS  277

Query  1372  gGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMV  1193
                        +S  + E+      ++R  +E+LI ILPP+K+++ C FLLRLL+I  + 
Sbjct  278   TNRRNDSQWSITSGRIGETSIGQNKEQRTIIESLISILPPQKETVSCKFLLRLLKISIVY  337

Query  1192  GVEAAYRAELEKRISWQLEQATLRELMIPSF--------SHTCGTVLDVELVLRLVKRFI  1037
                 A  +ELEKRI   LE A+  +L+IP++        S+   T+ ++++V R++  F+
Sbjct  338   AASPALISELEKRIGMVLENASTNDLLIPTYAVGDQTINSNEEQTIHNIDVVQRILDYFL  397

Query  1036  VSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAP  857
             +  + +        ++             + ++KL D YLAE A D N+++++F  LA  
Sbjct  398   MYEQQKLQQQELKSTT-------------LNISKLFDSYLAEIARDPNVSITKFRVLAES  444

Query  856   IPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVR  677
             +P HAR   D LYR+IDTYLK HP +S+ +R+R+CK++D  KLS +  +HAAQNERLP+R
Sbjct  445   LPRHARTCHDGLYRAIDTYLKTHPSLSEHDRRRLCKIMDCGKLSLDGCMHAAQNERLPMR  504

Query  676   TVIQVLLSEQTKL  638
              +IQVLLSEQ K+
Sbjct  505   IIIQVLLSEQVKM  517



>ref|XP_010484214.1| PREDICTED: root phototropism protein 3-like isoform X2 [Camelina 
sativa]
Length=655

 Score =   211 bits (538),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 114/242 (47%), Positives = 160/242 (66%), Gaps = 23/242 (10%)
 Frame = -3

Query  1294  KRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLREL  1115
             +R  VE+LI I+PP+KDS+ C+FLLRLLR  NM+ V  A   ELEKR+  Q EQATL++L
Sbjct  374   QRMIVESLISIIPPQKDSVSCSFLLRLLRAANMLKVAPALITELEKRVGMQFEQATLQDL  433

Query  1114  MIPSFSHTCGTVL-DVELVLRLVKRFIVSLEDQ------------------AAVMRCSGS  992
             +IP +++   T + DV+LV RL++ F+V  + +                  A + R  G+
Sbjct  434   LIPGYNNKGETTMYDVDLVQRLLEHFLVQEQTEGSSPSRMSPSPSQSMYADAGIPR--GN  491

Query  991   SSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPTDDALYRS  812
             S+ G+   N     ++VA+LVD YL E A D NL +++F  LA  +P  AR  DD LYR+
Sbjct  492   SNGGSS--NTQNAKMRVARLVDSYLTEVARDRNLPLTKFQVLAEALPESARTCDDGLYRA  549

Query  811   IDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLSEQTKLSK  632
             ID+YLKAHP +S+ ERKR+C+++D +KLS +A +HAAQNERLP+R V+QVL SEQ K+S 
Sbjct  550   IDSYLKAHPTLSEHERKRLCRVMDCQKLSMDACMHAAQNERLPLRVVVQVLFSEQVKISN  609

Query  631   QL  626
              L
Sbjct  610   AL  611


 Score = 63.9 bits (154),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPEL  1409
             + WF+D  IL +D+FV+ ++ IK KG+R EL+G++I HYA KWLP L
Sbjct  254   DWWFEDVSILRIDHFVRVITAIKVKGMRFELLGAVIMHYAGKWLPGL  300



>ref|XP_009766800.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like isoform 
X2 [Nicotiana sylvestris]
Length=555

 Score =   209 bits (533),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 118/308 (38%), Positives = 177/308 (57%), Gaps = 31/308 (10%)
 Frame = -3

Query  1543  WFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekgGH  1364
             W +D  +L +D + + ++ +K +GVRPE I + + +YA K L + +  G +         
Sbjct  162   WIEDISMLRIDLYQRVITAMKFRGVRPESIAASLVNYAQKELIQKSLSGSN---------  212

Query  1363  LIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMVGVE  1184
                                  ++++  VET++ ++P EK  +P +FL  LLR   M+   
Sbjct  213   ---------------------IQEKLVVETIVSLMPVEKFVVPLSFLFGLLRSAVMLDCT  251

Query  1183  AAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAAVMR  1004
              A R +LE+RI  QL+ ATL +++IPSF H   T+ DV+ V R++  F     D    M 
Sbjct  252   VASRLDLERRIGSQLDTATLDDILIPSFRHAGDTLFDVDTVHRILVNFSQQEGDSDDDME  311

Query  1003  CSGSSSSGAPPLNLNLN-LIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPTDD  827
                   S +P    + N L KV+KLVD+YLAE A D+NL +S+FIA+A  +P HAR   D
Sbjct  312   DVSVFESDSPTTTPSQNALFKVSKLVDNYLAEIAPDANLKLSKFIAVAETLPAHARTVHD  371

Query  826   ALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLSEQ  647
              LYR+ID YLKAH  ++  +++R+CKLID +KLS EA  HAAQNERLP+++++QVL  EQ
Sbjct  372   GLYRAIDVYLKAHQTLADPDKRRLCKLIDFQKLSQEAGAHAAQNERLPLQSIVQVLYFEQ  431

Query  646   TKLSKQLM  623
              +L   L 
Sbjct  432   LRLRNALF  439



>gb|KHG21232.1| hypothetical protein F383_08117 [Gossypium arboreum]
 gb|KHG21831.1| hypothetical protein F383_08674 [Gossypium arboreum]
Length=616

 Score =   211 bits (536),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 124/310 (40%), Positives = 182/310 (59%), Gaps = 21/310 (7%)
 Frame = -3

Query  1552  GECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiek  1373
             G+ W +D  ++ +D + + ++ +K +GVRPE IG+ + ++A K   ELT           
Sbjct  204   GDWWIEDLSVIQIDLYQRLITAMKCRGVRPESIGASLVNFAQK---ELTK----------  250

Query  1372  gGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMV  1193
                   K    + S + +    S   ++  VE +IG+LP EK ++P +FL  LLR   M+
Sbjct  251   ------KCSLWNPSGLTKVDLGSTDHEQLVVEAIIGLLPVEKLAVPISFLFGLLRSAVML  304

Query  1192  GVEAAYRAELEKRISWQLEQATLRELMIPSFSHTC-GTVLDVELVLRLVKRFIVSLEDQA  1016
                 + R +LE+RI   L+ ATL +++IPSF H+  GT+ DV+ V R++  F    +D  
Sbjct  305   DCSISCRLDLERRIGSMLDIATLDDILIPSFRHSGDGTLFDVDTVQRILVNF-SQQDDSE  363

Query  1015  AVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARP  836
               M       S +P       L KVA LVD+YLAE A D+NL + +F+ +A  +P HAR 
Sbjct  364   GDMDDESVFESDSPRSPSQTALFKVAILVDNYLAEIAPDANLKLPKFLGIAETLPEHART  423

Query  835   TDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLL  656
               D LYR+ID YLKAHPG+  E+RKR+CKLID +KLS EA  HAAQNERLP+++++QVL 
Sbjct  424   IHDGLYRAIDIYLKAHPGLLDEDRKRLCKLIDFQKLSQEAGAHAAQNERLPIQSIVQVLY  483

Query  655   SEQTKLSKQL  626
              EQ +L   L
Sbjct  484   FEQLRLRNAL  493



>ref|XP_006356774.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like [Solanum 
tuberosum]
Length=607

 Score =   210 bits (535),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 122/310 (39%), Positives = 177/310 (57%), Gaps = 18/310 (6%)
 Frame = -3

Query  1552  GECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiek  1373
             G+ W +D  +L +D + + ++ +K +GVRPE I + + +YA K   ELT    S     +
Sbjct  201   GDWWIEDLSVLRIDLYQRVITAMKCRGVRPESIAASLVNYAQK---ELTKKSTSWNQSTQ  257

Query  1372  gGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMV  1193
                 ++                    ++  VET++ ++P EK  +P  FL  LLR   M+
Sbjct  258   PKVDVVSGSND--------------HEKVVVETIVSLMPVEKLVVPITFLFGLLRSAVML  303

Query  1192  GVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAA  1013
                 A R +LE+RI  QL+ ATL +L+IPSF +   T+ DV+ V R++  F    ED   
Sbjct  304   DCTVACRLDLERRIGSQLDIATLNDLLIPSFHNAGETLFDVDTVHRILVSF-SQQEDSDE  362

Query  1012  VMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPT  833
              M       S +P       L KVAKLVD+YLAE A D+NL +++FIA+A  +P HAR  
Sbjct  363   DMDDVSVFESDSPTSPSQTALFKVAKLVDNYLAEIAPDANLKLNKFIAIAESLPAHARTI  422

Query  832   DDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLS  653
              D LYR+ID YLKAH  +S  +R+R+CKLID +KLS E+  HAAQNERLP+++++QVL  
Sbjct  423   HDGLYRAIDVYLKAHQALSDPDRRRLCKLIDFQKLSQESGAHAAQNERLPLQSIVQVLYF  482

Query  652   EQTKLSKQLM  623
             EQ +L   L 
Sbjct  483   EQMRLRNALF  492



>gb|KDO56565.1| hypothetical protein CISIN_1g0070151mg [Citrus sinensis]
Length=548

 Score =   209 bits (532),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 113/311 (36%), Positives = 179/311 (58%), Gaps = 26/311 (8%)
 Frame = -3

Query  1543  WFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekgGH  1364
             WFDD   L +D+F++ ++ IK KG +PE+IG  I HYA KWLP +            G H
Sbjct  142   WFDDVATLGIDHFMRIITTIKVKGTKPEIIGKCIMHYAKKWLPGMDVELEGLRGYGYGKH  201

Query  1363  LIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMVGVE  1184
                + + S  ++  E VS    ++R  +E L+ +LP + + + C F L++L++  +    
Sbjct  202   ---ELQFSILNAGKEEVSVGQKEQRTIIENLVNLLPHQDEGVSCKFFLQMLKMAMVYNAS  258

Query  1183  AAYRAELEKRISWQLEQATLRELMIPSF---------SHTCGTVLDVELVLRLVKRFIVS  1031
              A  +ELEKR+   LE A   +L+IP++         S    T+ ++++V R++  F++ 
Sbjct  259   PALISELEKRVGMMLEDANANDLLIPNYKNEDHAKLNSPEHNTMHNIDVVQRIMDYFLMH  318

Query  1030  LEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIP  851
                                    N+    V+K++D+YLAE A D NL++++F  LA  +P
Sbjct  319   --------------EQQQQQKQQNMGKTNVSKILDNYLAEVARDPNLSITKFQVLAESLP  364

Query  850   THARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTV  671
              +AR   D LYR+IDTYLK+HP +S+ +R+R+CKL++  KLS +A  HAAQN+RLP+RTV
Sbjct  365   ENARTCHDGLYRAIDTYLKSHPSLSEHDRRRLCKLMNCEKLSLDACTHAAQNDRLPLRTV  424

Query  670   IQVLLSEQTKL  638
             +QVL SEQ K+
Sbjct  425   VQVLFSEQVKM  435



>ref|XP_010484212.1| PREDICTED: root phototropism protein 3-like isoform X1 [Camelina 
sativa]
 ref|XP_010484213.1| PREDICTED: root phototropism protein 3-like isoform X1 [Camelina 
sativa]
Length=747

 Score =   212 bits (540),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 114/242 (47%), Positives = 160/242 (66%), Gaps = 23/242 (10%)
 Frame = -3

Query  1294  KRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMVGVEAAYRAELEKRISWQLEQATLREL  1115
             +R  VE+LI I+PP+KDS+ C+FLLRLLR  NM+ V  A   ELEKR+  Q EQATL++L
Sbjct  374   QRMIVESLISIIPPQKDSVSCSFLLRLLRAANMLKVAPALITELEKRVGMQFEQATLQDL  433

Query  1114  MIPSFSHTCGTVL-DVELVLRLVKRFIVSLEDQ------------------AAVMRCSGS  992
             +IP +++   T + DV+LV RL++ F+V  + +                  A + R  G+
Sbjct  434   LIPGYNNKGETTMYDVDLVQRLLEHFLVQEQTEGSSPSRMSPSPSQSMYADAGIPR--GN  491

Query  991   SSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPTDDALYRS  812
             S+ G+   N     ++VA+LVD YL E A D NL +++F  LA  +P  AR  DD LYR+
Sbjct  492   SNGGSS--NTQNAKMRVARLVDSYLTEVARDRNLPLTKFQVLAEALPESARTCDDGLYRA  549

Query  811   IDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLSEQTKLSK  632
             ID+YLKAHP +S+ ERKR+C+++D +KLS +A +HAAQNERLP+R V+QVL SEQ K+S 
Sbjct  550   IDSYLKAHPTLSEHERKRLCRVMDCQKLSMDACMHAAQNERLPLRVVVQVLFSEQVKISN  609

Query  631   QL  626
              L
Sbjct  610   AL  611


 Score = 63.9 bits (154),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPEL  1409
             + WF+D  IL +D+FV+ ++ IK KG+R EL+G++I HYA KWLP L
Sbjct  254   DWWFEDVSILRIDHFVRVITAIKVKGMRFELLGAVIMHYAGKWLPGL  300



>ref|XP_002988267.1| hypothetical protein SELMODRAFT_447227 [Selaginella moellendorffii]
 gb|EFJ10686.1| hypothetical protein SELMODRAFT_447227 [Selaginella moellendorffii]
Length=631

 Score =   211 bits (536),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 117/309 (38%), Positives = 187/309 (61%), Gaps = 18/309 (6%)
 Frame = -3

Query  1549  ECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekg  1370
             E W +D  +L +D++ + L  +K+KGVR E +   + HYA + L  L             
Sbjct  215   EWWAEDLSLLRIDFYQRVLEAMKSKGVREESLWGTLMHYAQQSLKGLNRAPTGGRG----  270

Query  1369  GHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMVG  1190
                ++K +E++++           ++R  VET++ +LP EK+   C+FL  LLR   ++ 
Sbjct  271   ---LMKVQENTAALEH--------EQRILVETIVSLLPREKNIASCSFLFGLLRTAIILD  319

Query  1189  VEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLE-DQAA  1013
                A R ++EKRI+ QL+QATL +L++PSFS+   T+ DV++V R++  FI   E D   
Sbjct  320   TTVACRLDIEKRIALQLDQATLDDLLVPSFSYNGETLFDVDIVQRILTNFIQQHENDDLP  379

Query  1012  VMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPT  833
               + +  S   A P   +++  KVAKL+D YLAE A D+NL +++F+A+   +P +AR  
Sbjct  380   EAQTTYESDGLATPTQTSVS--KVAKLMDGYLAEIAPDANLKVNKFVAIGELLPDYARAI  437

Query  832   DDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLS  653
             DD LYR++D YLKAHP + ++ERK++C+L+ ++KLS EA  HAAQN+RLP    IQVL  
Sbjct  438   DDGLYRAVDIYLKAHPNLGEQERKKICRLLSAQKLSQEACCHAAQNDRLPAHFAIQVLYF  497

Query  652   EQTKLSKQL  626
             EQ ++  ++
Sbjct  498   EQVRIRTEM  506



>ref|XP_004247086.1| PREDICTED: BTB/POZ domain-containing protein At5g48800 [Solanum 
lycopersicum]
Length=607

 Score =   210 bits (534),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 122/310 (39%), Positives = 177/310 (57%), Gaps = 18/310 (6%)
 Frame = -3

Query  1552  GECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiek  1373
             G+ W +D  +L +D + + ++ +K +GVRPE I + + +YA K   ELT    S     +
Sbjct  201   GDWWIEDLSVLRIDLYQRVITAMKCRGVRPESIAASLVNYAQK---ELTKKATSWNQSNQ  257

Query  1372  gGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMV  1193
                 ++                    ++  VET++ ++P EK  +P  FL  LLR   M+
Sbjct  258   PKVDVVSGSND--------------HEKVVVETIVSLMPVEKLVVPITFLFGLLRSAVML  303

Query  1192  GVEAAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAA  1013
                 A R +LE+RI  QL+ ATL +L+IPSF +   T+ DV+ V R++  F    ED   
Sbjct  304   DCTVACRLDLERRIGSQLDIATLDDLLIPSFHNAGDTLFDVDTVHRILVSF-SQQEDSDE  362

Query  1012  VMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPT  833
              M       S +P       L KVAKLVD+YLAE A D+NL +++FIA+A  +P HAR  
Sbjct  363   DMDDVSVFESDSPTSPSQTALFKVAKLVDNYLAEIAPDANLKLNKFIAIAESLPAHARTI  422

Query  832   DDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLS  653
              D LYR+ID YLKAH  +S  +R+R+CKLID +KLS E+  HAAQNERLP+++++QVL  
Sbjct  423   HDGLYRAIDVYLKAHQSLSDPDRRRLCKLIDFQKLSQESGAHAAQNERLPLQSIVQVLYF  482

Query  652   EQTKLSKQLM  623
             EQ +L   L 
Sbjct  483   EQMRLRNSLF  492



>gb|ADN33739.1| phototropic-responsive NPH3 family protein [Cucumis melo subsp. 
melo]
Length=570

 Score =   209 bits (532),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 121/306 (40%), Positives = 180/306 (59%), Gaps = 18/306 (6%)
 Frame = -3

Query  1543  WFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekgGH  1364
             W +D  +L +D + + ++ +K +GVRPE IG  + +YA +   ELT          +   
Sbjct  162   WIEDISVLRVDLYERVITAMKCRGVRPESIGVSLVNYAQR---ELTKKSSLWNPSGQTK-  217

Query  1363  LIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMVGVE  1184
               + F   S+            +++  VET++ +LP EK ++P NFL  LLR   M+   
Sbjct  218   --VDFVTGSNG-----------QEQIVVETIVSLLPVEKLAVPINFLFGLLRSAVMLDCS  264

Query  1183  AAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAAVMR  1004
              A R +LE+RI  QL+ ATL +L+IPSF H+  T+ DV+ V R++  F    +D    M 
Sbjct  265   VACRLDLERRIGSQLDIATLDDLLIPSFKHSADTLFDVDTVHRILVNF-SQQDDSEEDMD  323

Query  1003  CSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPTDDA  824
              +    S +P       L KV+KL+D+YLAE A D+NL +S+F+ +A  +P+HAR   D 
Sbjct  324   DTSVFESDSPRSPSQSALFKVSKLLDNYLAEIAPDANLKLSKFVVIADSLPSHARTIHDG  383

Query  823   LYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLSEQT  644
             LYR+ID YLKAH G+   ++K++CKLID +KLS EA  HAAQNERLP++ ++QVL  EQ 
Sbjct  384   LYRAIDIYLKAHQGLPDIDKKKLCKLIDFQKLSPEAGAHAAQNERLPLQCMVQVLYFEQL  443

Query  643   KLSKQL  626
             +L   L
Sbjct  444   RLRNAL  449



>gb|KDO56564.1| hypothetical protein CISIN_1g0070151mg, partial [Citrus sinensis]
Length=551

 Score =   209 bits (531),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 113/311 (36%), Positives = 179/311 (58%), Gaps = 26/311 (8%)
 Frame = -3

Query  1543  WFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekgGH  1364
             WFDD   L +D+F++ ++ IK KG +PE+IG  I HYA KWLP +            G H
Sbjct  145   WFDDVATLGIDHFMRIITTIKVKGTKPEIIGKCIMHYAKKWLPGMDVELEGLRGYGYGKH  204

Query  1363  LIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMVGVE  1184
                + + S  ++  E VS    ++R  +E L+ +LP + + + C F L++L++  +    
Sbjct  205   ---ELQFSILNAGKEEVSVGQKEQRTIIENLVNLLPHQDEGVSCKFFLQMLKMAMVYNAS  261

Query  1183  AAYRAELEKRISWQLEQATLRELMIPSF---------SHTCGTVLDVELVLRLVKRFIVS  1031
              A  +ELEKR+   LE A   +L+IP++         S    T+ ++++V R++  F++ 
Sbjct  262   PALISELEKRVGMMLEDANANDLLIPNYKNEDHAKLNSPEHNTMHNIDVVQRIMDYFLMH  321

Query  1030  LEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIP  851
                                    N+    V+K++D+YLAE A D NL++++F  LA  +P
Sbjct  322   --------------EQQQQQKQQNMGKTNVSKILDNYLAEVARDPNLSITKFQVLAESLP  367

Query  850   THARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTV  671
              +AR   D LYR+IDTYLK+HP +S+ +R+R+CKL++  KLS +A  HAAQN+RLP+RTV
Sbjct  368   ENARTCHDGLYRAIDTYLKSHPSLSEHDRRRLCKLMNCEKLSLDACTHAAQNDRLPLRTV  427

Query  670   IQVLLSEQTKL  638
             +QVL SEQ K+
Sbjct  428   VQVLFSEQVKM  438



>ref|XP_004144382.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like [Cucumis 
sativus]
 ref|XP_004165102.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like [Cucumis 
sativus]
Length=570

 Score =   209 bits (532),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 120/306 (39%), Positives = 180/306 (59%), Gaps = 18/306 (6%)
 Frame = -3

Query  1543  WFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiekgGH  1364
             W +D  +L +D + + ++ +K +GVRPE IG+ + +YA +   ELT          +   
Sbjct  162   WIEDISVLRVDLYERVITAMKCRGVRPESIGASLVNYAQR---ELTKKSSLWNPSGQTK-  217

Query  1363  LIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMVGVE  1184
               + F   S+            +++  VET++ +LP EK ++P NFL  LLR   M+   
Sbjct  218   --VDFVTGSNG-----------QEQIVVETIVSLLPVEKLAVPINFLFGLLRSAVMLDCS  264

Query  1183  AAYRAELEKRISWQLEQATLRELMIPSFSHTCGTVLDVELVLRLVKRFIVSLEDQAAVMR  1004
                R +LE+RI  QL+ ATL +L+IPSF H+  T+ DV+ V R++  F    +D    M 
Sbjct  265   VGCRLDLERRIGSQLDIATLDDLLIPSFKHSADTLFDVDTVHRILVNF-SQQDDSEEDMD  323

Query  1003  CSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAPIPTHARPTDDA  824
              +    S +P       L KV+KL+D+YLAE A D+NL +S+F+ +A  +P+HAR   D 
Sbjct  324   DASVFESDSPRSPSQSALFKVSKLLDNYLAEIAPDANLKLSKFVVIADSLPSHARTIHDG  383

Query  823   LYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVRTVIQVLLSEQT  644
             LYR+ID YLKAH G+   ++K++CKLID +KLS EA  HAAQNERLP++ ++QVL  EQ 
Sbjct  384   LYRAIDIYLKAHQGLPDIDKKKLCKLIDFQKLSPEAGAHAAQNERLPLQCMVQVLYFEQL  443

Query  643   KLSKQL  626
             +L   L
Sbjct  444   RLRNAL  449



>ref|XP_009802685.1| PREDICTED: putative BTB/POZ domain-containing protein DOT3 isoform 
X1 [Nicotiana sylvestris]
Length=628

 Score =   210 bits (535),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 123/317 (39%), Positives = 191/317 (60%), Gaps = 25/317 (8%)
 Frame = -3

Query  1552  GECWFDDACILDMDYFVKTLSGIKAKGVRPELIGSIITHYASKWLPELTggggseesiek  1373
             G  WFDD   L +++F++ ++ I+ KG++PE+IGS I HY  KWLP +       +    
Sbjct  212   GTWWFDDIATLRINFFLRIITAIRVKGIKPEIIGSCIMHYGEKWLPNMNSETKGTDKYGN  271

Query  1372  gGHLIIKFeesssssvaesvsaSWMKKRFFVETLIGILPPEKDSIPCNFLLRLLRIGNMV  1193
               +   ++  +S     +S+  +  ++R  +E+LI ILPP+K+++ C FLLRLL++  + 
Sbjct  272   IRN-DSQWSITSGRMQEKSIGQNNKEQRIIIESLISILPPQKEAVSCKFLLRLLKMAMLY  330

Query  1192  GVEAAYRAELEKRISWQLEQATLRELMIPSF--------SHTCGTVLDVELVLRLVKRFI  1037
                 A  +ELEKRI    E A L +L+IPS+        S    T+ ++++V R++  F+
Sbjct  331   AASPALISELEKRIGMVFENAGLNDLLIPSYAVSEQTINSTEEQTIYNIDVVQRILDYFL  390

Query  1036  VSLEDQAAVMRCSGSSSSGAPPLNLNLNLIKVAKLVDDYLAEAAVDSNLTMSQFIALAAP  857
               L +Q  + +    SS+           + ++KLVD YLAE A D N+++++F  LA  
Sbjct  391   --LYEQQKLQQQEMKSST----------TVNISKLVDSYLAEIARDHNVSITKFQVLAES  438

Query  856   IPTHARPTDDALYRSIDTYLKAHPGVSKEERKRVCKLIDSRKLSAEASIHAAQNERLPVR  677
             +P H R   D LYR+IDTYLK HP +S+ +R+R+CK++DS KLS +A +HAAQNERLP+R
Sbjct  439   LPRHIRTCHDGLYRAIDTYLKTHPSLSEHDRRRLCKIMDSEKLSLDACMHAAQNERLPLR  498

Query  676   TVI----QVLLSEQTKL  638
              VI    QVLLSEQ K+
Sbjct  499   IVIQRILQVLLSEQVKM  515



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4614068855760