BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18116_g1_i1 len=1500 path=[1478:0-1101 2580:1102-1499]

Length=1500
                                                                      Score     E

ref|XP_009760660.1|  PREDICTED: polygalacturonase At1g48100-like        685   0.0      
ref|XP_006344808.1|  PREDICTED: polygalacturonase At1g48100-like ...    683   0.0      
ref|XP_009615869.1|  PREDICTED: polygalacturonase At1g48100-like        682   0.0      
ref|XP_004230341.1|  PREDICTED: polygalacturonase At1g48100 isofo...    680   0.0      
ref|XP_006344807.1|  PREDICTED: polygalacturonase At1g48100-like ...    679   0.0      
ref|XP_010313757.1|  PREDICTED: polygalacturonase At1g48100 isofo...    676   0.0      
ref|XP_011092683.1|  PREDICTED: polygalacturonase At1g48100-like        666   0.0      
gb|EYU38393.1|  hypothetical protein MIMGU_mgv1a021443mg                664   0.0      
ref|XP_002307031.2|  hypothetical protein POPTR_0005s00720g             647   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011039005.1|  PREDICTED: polygalacturonase At1g48100-like        646   0.0      
emb|CDP15213.1|  unnamed protein product                                641   0.0      
ref|XP_002276945.1|  PREDICTED: polygalacturonase At1g48100             638   0.0      Vitis vinifera
ref|XP_002512560.1|  Polygalacturonase precursor, putative              627   0.0      Ricinus communis
ref|XP_010276514.1|  PREDICTED: polygalacturonase At1g48100-like ...    622   0.0      
ref|XP_010102205.1|  Polygalacturonase                                  619   0.0      
ref|XP_009366057.1|  PREDICTED: polygalacturonase At1g48100-like ...    619   0.0      
ref|XP_002272733.2|  PREDICTED: polygalacturonase At1g48100-like        615   0.0      Vitis vinifera
emb|CBI37004.3|  unnamed protein product                                615   0.0      
ref|XP_007221570.1|  hypothetical protein PRUPE_ppa024649mg             611   0.0      
ref|XP_010070078.1|  PREDICTED: polygalacturonase At1g48100-like        611   0.0      
ref|XP_008353865.1|  PREDICTED: polygalacturonase At1g48100-like        611   0.0      
ref|XP_011023841.1|  PREDICTED: polygalacturonase At1g48100-like        610   0.0      
ref|XP_010270902.1|  PREDICTED: polygalacturonase At1g48100             609   0.0      
ref|XP_008227812.1|  PREDICTED: polygalacturonase At1g48100             609   0.0      
ref|XP_007206198.1|  hypothetical protein PRUPE_ppa014719mg             605   0.0      
ref|XP_009367183.1|  PREDICTED: polygalacturonase At1g48100             607   0.0      
ref|XP_011079507.1|  PREDICTED: polygalacturonase At1g48100             605   0.0      
ref|XP_002318932.2|  hypothetical protein POPTR_0013s00640g             605   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010276513.1|  PREDICTED: polygalacturonase At1g48100-like ...    605   0.0      
ref|XP_003518665.1|  PREDICTED: polygalacturonase At1g48100-like        603   0.0      
ref|XP_003536857.1|  PREDICTED: polygalacturonase At1g48100-like        603   0.0      
gb|KHN00324.1|  Polygalacturonase                                       602   0.0      
ref|XP_010092141.1|  Polygalacturonase                                  602   0.0      
ref|XP_011040652.1|  PREDICTED: polygalacturonase At1g48100-like        602   0.0      
ref|XP_008246384.1|  PREDICTED: polygalacturonase At1g48100-like        599   0.0      
gb|KDP28310.1|  hypothetical protein JCGZ_14081                         604   0.0      
ref|XP_009363098.1|  PREDICTED: polygalacturonase At1g48100-like        600   0.0      
gb|AES61595.2|  polygalacturonase/glycoside hydrolase family protein    597   0.0      
ref|XP_002515219.1|  Polygalacturonase precursor, putative              600   0.0      Ricinus communis
ref|XP_002320271.2|  hypothetical protein POPTR_0014s11110g             599   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_008461394.1|  PREDICTED: polygalacturonase At1g48100-like        597   0.0      
ref|XP_007163216.1|  hypothetical protein PHAVU_001G215900g             596   0.0      
ref|XP_004495880.1|  PREDICTED: polygalacturonase At1g48100-like        596   0.0      
ref|XP_003553676.1|  PREDICTED: polygalacturonase At1g48100-like ...    595   0.0      
ref|XP_004135975.1|  PREDICTED: polygalacturonase At1g48100-like        594   0.0      
ref|XP_007145117.1|  hypothetical protein PHAVU_007G211400g             594   0.0      
ref|XP_010322288.1|  PREDICTED: polygalacturonase At1g48100 isofo...    593   0.0      
ref|XP_003591344.1|  Polygalacturonase                                  593   0.0      
ref|XP_004289429.1|  PREDICTED: polygalacturonase At1g48100-like        592   0.0      
ref|XP_006492459.1|  PREDICTED: polygalacturonase At1g48100-like        596   0.0      
gb|KDP23351.1|  hypothetical protein JCGZ_23184                         592   0.0      
gb|KDO86869.1|  hypothetical protein CISIN_1g040748mg                   595   0.0      
ref|XP_006444572.1|  hypothetical protein CICLE_v10024556mg             596   0.0      
ref|XP_006349249.1|  PREDICTED: polygalacturonase At1g48100-like        590   0.0      
gb|KHN14155.1|  Polygalacturonase                                       590   0.0      
ref|XP_007051225.1|  Pectin lyase-like superfamily protein              588   0.0      
ref|XP_003520763.1|  PREDICTED: polygalacturonase At1g48100-like ...    588   0.0      
ref|XP_009777456.1|  PREDICTED: polygalacturonase At1g48100-like        586   0.0      
ref|XP_009592547.1|  PREDICTED: polygalacturonase At1g48100-like        586   0.0      
ref|XP_004304915.1|  PREDICTED: polygalacturonase At1g48100-like        585   0.0      
ref|XP_008346737.1|  PREDICTED: polygalacturonase At1g48100-like        583   0.0      
ref|XP_009366058.1|  PREDICTED: polygalacturonase At1g48100-like ...    582   0.0      
ref|XP_010094423.1|  Polygalacturonase                                  591   0.0      
ref|XP_008781323.1|  PREDICTED: polygalacturonase At1g48100-like        576   0.0      
ref|XP_004494454.1|  PREDICTED: polygalacturonase At1g48100-like        575   0.0      
ref|XP_010679447.1|  PREDICTED: polygalacturonase At1g48100             575   0.0      
ref|XP_010921359.1|  PREDICTED: polygalacturonase At1g48100-like        575   0.0      
ref|XP_006605259.1|  PREDICTED: polygalacturonase At1g48100-like        575   0.0      
ref|XP_011003167.1|  PREDICTED: polygalacturonase At1g48100 isofo...    572   0.0      
ref|XP_003626018.1|  Polygalacturonase                                  566   0.0      
ref|XP_009118766.1|  PREDICTED: polygalacturonase At1g48100-like        563   0.0      
ref|XP_002892109.1|  glycoside hydrolase family 28 protein              562   0.0      
ref|XP_009382473.1|  PREDICTED: polygalacturonase At1g48100             561   0.0      
ref|XP_002302793.1|  glycoside hydrolase family 28 family protein       561   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006604753.1|  PREDICTED: polygalacturonase At1g48100-like ...    560   0.0      
ref|NP_563654.1|  pectin lyase-like superfamily protein                 561   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009417842.1|  PREDICTED: polygalacturonase At1g48100-like        561   0.0      
ref|XP_006418338.1|  hypothetical protein EUTSA_v10007481mg             560   0.0      
ref|XP_008356595.1|  PREDICTED: polygalacturonase At1g48100-like        560   0.0      
ref|XP_008447667.1|  PREDICTED: polygalacturonase At1g48100             559   0.0      
ref|XP_004163976.1|  PREDICTED: polygalacturonase At1g48100-like        560   0.0      
ref|XP_004148582.1|  PREDICTED: polygalacturonase At1g48100-like        559   0.0      
emb|CDX77909.1|  BnaC03g53100D                                          559   0.0      
gb|KGN58536.1|  hypothetical protein Csa_3G664600                       558   0.0      
ref|XP_006303966.1|  hypothetical protein CARUB_v10008847mg             559   0.0      
gb|KFK42608.1|  hypothetical protein AALP_AA1G017600                    554   0.0      
ref|XP_010674532.1|  PREDICTED: polygalacturonase At1g48100-like        556   0.0      
ref|XP_010480981.1|  PREDICTED: polygalacturonase At1g48100-like        555   0.0      
ref|XP_006577178.1|  PREDICTED: polygalacturonase At1g48100-like ...    553   0.0      
ref|XP_010474661.1|  PREDICTED: polygalacturonase At1g48100-like        555   0.0      
ref|XP_010522843.1|  PREDICTED: polygalacturonase At1g48100-like        555   0.0      
ref|XP_010457225.1|  PREDICTED: polygalacturonase At1g48100-like ...    555   0.0      
ref|XP_009391520.1|  PREDICTED: polygalacturonase At1g48100-like        556   0.0      
emb|CDX89966.1|  BnaA10g01160D                                          552   0.0      
ref|XP_010544140.1|  PREDICTED: polygalacturonase At1g48100             551   0.0      
ref|XP_009119629.1|  PREDICTED: polygalacturonase At1g48100             551   0.0      
ref|XP_010914688.1|  PREDICTED: polygalacturonase At1g48100-like        548   0.0      
ref|XP_006841586.1|  hypothetical protein AMTR_s00003p00198650          548   0.0      
emb|CDY15246.1|  BnaC05g01250D                                          546   0.0      
ref|XP_006841583.1|  hypothetical protein AMTR_s00003p00197210          541   0.0      
ref|XP_009414160.1|  PREDICTED: polygalacturonase At1g48100-like ...    540   0.0      
ref|XP_008781188.1|  PREDICTED: polygalacturonase At1g48100-like        539   0.0      
ref|XP_010921358.1|  PREDICTED: polygalacturonase At1g48100-like        538   0.0      
ref|XP_008223441.1|  PREDICTED: polygalacturonase At1g48100             537   0.0      
gb|KFK22235.1|  hypothetical protein AALP_AAs42893U000500               533   0.0      
ref|XP_007223106.1|  hypothetical protein PRUPE_ppa005391mg             535   0.0      
gb|KDP27979.1|  hypothetical protein JCGZ_19059                         532   0.0      
ref|NP_176064.1|  pectin lyase-like protein                             530   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010276517.1|  PREDICTED: polygalacturonase At1g48100-like        530   0.0      
ref|XP_010511313.1|  PREDICTED: polygalacturonase At1g48100-like        528   0.0      
ref|XP_009134468.1|  PREDICTED: polygalacturonase At1g48100             530   0.0      
ref|XP_010418948.1|  PREDICTED: polygalacturonase At1g48100-like        528   0.0      
gb|EPS62496.1|  hypothetical protein M569_12294                         529   0.0      
ref|XP_002894668.1|  glycoside hydrolase family 28 protein              527   0.0      
ref|XP_010428904.1|  PREDICTED: polygalacturonase At1g48100-like        529   0.0      
gb|KHN43364.1|  Polygalacturonase                                       523   0.0      
emb|CDP07996.1|  unnamed protein product                                529   0.0      
emb|CDY41695.1|  BnaA09g15230D                                          526   0.0      
ref|XP_009412152.1|  PREDICTED: polygalacturonase At1g48100-like        528   0.0      
ref|XP_006392401.1|  hypothetical protein EUTSA_v10023906mg             526   0.0      
ref|XP_009773723.1|  PREDICTED: polygalacturonase At1g48100             526   4e-180   
ref|XP_009607016.1|  PREDICTED: polygalacturonase At1g48100             526   6e-180   
ref|XP_009113378.1|  PREDICTED: polygalacturonase At1g48100             524   9e-180   
ref|XP_010270903.1|  PREDICTED: polygalacturonase At1g48100-like ...    525   1e-179   
ref|XP_010422679.1|  PREDICTED: polygalacturonase At1g48100-like        525   1e-179   
ref|XP_010456113.1|  PREDICTED: polygalacturonase At1g48100-like        525   2e-179   
ref|XP_011019224.1|  PREDICTED: polygalacturonase At1g48100             525   3e-179   
ref|XP_007035922.1|  Pectin lyase-like superfamily protein isoform 1    525   4e-179   
ref|XP_010480279.1|  PREDICTED: polygalacturonase At1g48100-like        522   5e-179   
ref|XP_008361575.1|  PREDICTED: polygalacturonase At1g48100-like        524   5e-179   
ref|XP_006301910.1|  hypothetical protein CARUB_v10022386mg             522   6e-179   
ref|XP_006378559.1|  hypothetical protein POPTR_0010s16180g             523   1e-178   
ref|XP_002312305.1|  hypothetical protein POPTR_0008s09990g             523   1e-178   Populus trichocarpa [western balsam poplar]
ref|XP_002263668.1|  PREDICTED: polygalacturonase At1g48100             523   1e-178   Vitis vinifera
ref|XP_007158878.1|  hypothetical protein PHAVU_002G189400g             521   4e-178   
ref|XP_004297108.1|  PREDICTED: polygalacturonase At1g48100-like        521   5e-178   
ref|XP_011011219.1|  PREDICTED: polygalacturonase At1g48100-like        520   9e-178   
ref|XP_011100707.1|  PREDICTED: polygalacturonase At1g48100             519   3e-177   
ref|XP_008390405.1|  PREDICTED: polygalacturonase At1g48100             524   5e-177   
ref|XP_006286811.1|  hypothetical protein CARUB_v10003570mg             518   5e-177   
ref|XP_006355087.1|  PREDICTED: polygalacturonase At1g48100-like        518   9e-177   
ref|XP_003531109.1|  PREDICTED: polygalacturonase At1g48100-like        518   1e-176   
ref|XP_006645792.1|  PREDICTED: polygalacturonase At1g48100-like        514   2e-176   
ref|XP_004962547.1|  PREDICTED: polygalacturonase At1g48100-like        517   2e-176   
gb|EYU43882.1|  hypothetical protein MIMGU_mgv1a005582mg                517   2e-176   
ref|XP_004236918.1|  PREDICTED: polygalacturonase At1g48100             517   3e-176   
ref|XP_009372060.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    521   4e-176   
gb|KHG11151.1|  hypothetical protein F383_15050                         515   7e-176   
ref|XP_011003168.1|  PREDICTED: polygalacturonase At1g48100 isofo...    513   2e-175   
gb|KHN25928.1|  Polygalacturonase                                       514   3e-175   
ref|XP_010024841.1|  PREDICTED: polygalacturonase At1g48100             514   3e-175   
ref|XP_003524819.1|  PREDICTED: polygalacturonase At1g48100             514   4e-175   
ref|XP_002519290.1|  Polygalacturonase precursor, putative              513   8e-175   Ricinus communis
ref|XP_008811536.1|  PREDICTED: polygalacturonase At1g48100-like        507   1e-174   
ref|XP_003567574.1|  PREDICTED: polygalacturonase At1g48100             513   1e-174   
gb|KEH31410.1|  pectin lyase superfamily protein                        511   2e-174   
ref|NP_192098.2|  glycoside hydrolase family 28 protein / polygal...    511   4e-174   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010231630.1|  PREDICTED: polygalacturonase At1g48100             510   2e-173   
gb|EPS63155.1|  hypothetical protein M569_11631                         508   3e-173   
ref|XP_010098760.1|  Polygalacturonase                                  509   4e-173   
ref|XP_004504655.1|  PREDICTED: polygalacturonase At1g48100-like ...    508   5e-173   
ref|XP_003534803.1|  PREDICTED: polygalacturonase At1g48100-like        508   5e-173   
gb|KHG07147.1|  hypothetical protein F383_34413                         508   9e-173   
dbj|BAJ86227.1|  predicted protein                                      507   2e-172   
dbj|BAD86981.1|  putative polygalacturonase PG1                         503   6e-172   Oryza sativa Japonica Group [Japonica rice]
gb|KHN14270.1|  Polygalacturonase                                       503   3e-171   
ref|XP_010461609.1|  PREDICTED: polygalacturonase At1g48100             504   3e-171   
ref|XP_010479218.1|  PREDICTED: polygalacturonase At1g48100-like ...    503   4e-171   
ref|XP_003546297.1|  PREDICTED: polygalacturonase At1g48100-like ...    503   5e-171   
ref|XP_010500319.1|  PREDICTED: polygalacturonase At1g48100             503   7e-171   
emb|CBI25976.3|  unnamed protein product                                499   9e-171   
ref|XP_006654203.1|  PREDICTED: polygalacturonase At1g48100-like        502   2e-170   
tpg|DAA54311.1|  TPA: polygalacturonase                                 502   2e-170   
ref|XP_004486518.1|  PREDICTED: polygalacturonase At1g48100-like        501   2e-170   
ref|NP_001042805.1|  Os01g0296200                                       502   2e-170   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007147401.1|  hypothetical protein PHAVU_006G121300g             501   4e-170   
ref|NP_001150436.1|  polygalacturonase precursor                        502   4e-170   Zea mays [maize]
ref|NP_001055086.1|  Os05g0279900                                       501   7e-170   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006307365.1|  hypothetical protein CARUB_v10008991mg             500   9e-170   
ref|XP_006419286.1|  hypothetical protein CICLE_v10004899mg             497   9e-169   
gb|KDO72101.1|  hypothetical protein CISIN_1g012057mg                   497   1e-168   
ref|XP_004138524.1|  PREDICTED: polygalacturonase At1g48100-like        497   1e-168   
ref|NP_175244.1|  polygalacturonase                                     497   2e-168   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002874953.1|  glycoside hydrolase family 28 protein              497   2e-168   
gb|AAK95305.1|AF410319_1  At1g48100/F21D18_17                           496   2e-168   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009147998.1|  PREDICTED: polygalacturonase At1g48100             495   4e-168   
ref|XP_008655818.1|  PREDICTED: polygalacturonase At1g48100-like        496   7e-168   
ref|XP_008458305.1|  PREDICTED: polygalacturonase At1g48100             494   1e-167   
gb|EAY73623.1|  hypothetical protein OsI_01510                          495   2e-167   Oryza sativa Indica Group [Indian rice]
ref|XP_009414161.1|  PREDICTED: polygalacturonase At1g48100-like ...    493   2e-167   
ref|XP_002891410.1|  glycoside hydrolase family 28 protein              494   3e-167   
ref|XP_004504654.1|  PREDICTED: polygalacturonase At1g48100-like ...    492   2e-166   
gb|KCW61351.1|  hypothetical protein EUGRSUZ_H04092                     491   2e-166   
ref|XP_010551104.1|  PREDICTED: polygalacturonase At1g48100             491   4e-166   
ref|XP_003594633.1|  Polygalacturonase                                  489   9e-166   
ref|XP_002455500.1|  hypothetical protein SORBIDRAFT_03g012280          491   1e-165   Sorghum bicolor [broomcorn]
gb|AAS98503.1|  unknown protein                                         490   2e-165   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010672584.1|  PREDICTED: polygalacturonase At1g48100             489   2e-165   
gb|AAD22651.1|AC007138_15  putative polygalacturonidase                 486   9e-165   Arabidopsis thaliana [mouse-ear cress]
gb|AAF79535.1|AC023673_23  F21D18.18                                    487   2e-164   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004971779.1|  PREDICTED: polygalacturonase At1g48100-like        487   4e-164   
ref|XP_004967589.1|  PREDICTED: polygalacturonase At1g48100-like        486   4e-164   
ref|XP_006393479.1|  hypothetical protein EUTSA_v10011452mg             479   1e-161   
ref|XP_008655877.1|  PREDICTED: polygalacturonase At1g48100-like        486   2e-160   
ref|XP_009366069.1|  PREDICTED: polygalacturonase At1g48100-like        476   3e-160   
emb|CDY43307.1|  BnaC06g01610D                                          474   7e-160   
ref|XP_010024842.1|  PREDICTED: polygalacturonase At1g48100-like        475   1e-159   
gb|KFK36111.1|  hypothetical protein AALP_AA4G079500                    468   2e-157   
ref|XP_008345662.1|  PREDICTED: polygalacturonase At1g48100-like        469   2e-157   
gb|EMT28888.1|  Polygalacturonase                                       461   4e-156   
gb|KGN45612.1|  hypothetical protein Csa_6G000120                       463   1e-155   
ref|XP_003565732.1|  PREDICTED: polygalacturonase At1g48100-like        469   3e-155   
emb|CDX95284.1|  BnaC09g15860D                                          454   1e-152   
tpg|DAA54465.1|  TPA: polygalacturonase                                 454   2e-151   
ref|NP_001132604.2|  uncharacterized protein LOC100194076               454   2e-151   Zea mays [maize]
ref|XP_002455572.1|  hypothetical protein SORBIDRAFT_03g013310          460   4e-151   Sorghum bicolor [broomcorn]
ref|XP_002455574.1|  hypothetical protein SORBIDRAFT_03g013330          454   1e-150   Sorghum bicolor [broomcorn]
ref|XP_010322290.1|  PREDICTED: polygalacturonase At1g48100 isofo...    436   2e-146   
ref|NP_001042921.1|  Os01g0329300                                       447   2e-145   Oryza sativa Japonica Group [Japonica rice]
gb|ACN29256.1|  unknown                                                 416   3e-139   Zea mays [maize]
gb|EEE54470.1|  hypothetical protein OsJ_01569                          428   6e-138   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008364018.1|  PREDICTED: polygalacturonase At1g48100-like        400   1e-132   
tpg|DAA54467.1|  TPA: hypothetical protein ZEAMMB73_770856              399   5e-132   
gb|EEC70551.1|  hypothetical protein OsI_01700                          412   1e-131   Oryza sativa Indica Group [Indian rice]
emb|CDY67535.1|  BnaAnng24580D                                          392   9e-130   
emb|CDY67338.1|  BnaCnng54560D                                          389   1e-128   
gb|KCW58651.1|  hypothetical protein EUGRSUZ_H01308                     372   6e-123   
ref|NP_196969.1|  pectin lyase-like superfamily protein                 375   9e-122   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001755315.1|  predicted protein                                  370   9e-120   
ref|XP_010492279.1|  PREDICTED: polygalacturonase At1g48100-like        370   1e-119   
gb|EYU44763.1|  hypothetical protein MIMGU_mgv1a018728mg                367   1e-118   
ref|XP_010420111.1|  PREDICTED: polygalacturonase At1g48100-like        366   8e-118   
ref|XP_006470302.1|  PREDICTED: polygalacturonase At1g48100-like        366   1e-117   
gb|ABV25002.1|  polygalacturonase 5                                     367   1e-117   
gb|ABV25001.1|  polygalacturonase 4                                     367   1e-117   
gb|ABV24998.1|  polygalacturonase 1                                     366   2e-117   
gb|ABV24999.1|  polygalacturonase 2                                     366   3e-117   
ref|XP_006399978.1|  hypothetical protein EUTSA_v10013501mg             364   5e-117   
ref|XP_011098761.1|  PREDICTED: polygalacturonase At1g48100             364   8e-117   
gb|ABV25000.1|  polygalacturonase 3                                     364   1e-116   
ref|XP_010453593.1|  PREDICTED: polygalacturonase At1g48100-like        363   1e-116   
ref|XP_006290192.1|  hypothetical protein CARUB_v10003877mg             362   2e-116   
gb|ABV25003.1|  polygalacturonase 6                                     363   3e-116   
ref|XP_003552026.1|  PREDICTED: polygalacturonase At1g48100-like ...    364   5e-116   
ref|XP_002963148.1|  hypothetical protein SELMODRAFT_78038              362   5e-116   
gb|KHN26888.1|  Polygalacturonase                                       364   5e-116   
ref|XP_009121648.1|  PREDICTED: polygalacturonase At1g48100 isofo...    360   7e-116   
emb|CDY09873.1|  BnaC09g42880D                                          360   9e-116   
ref|XP_010925884.1|  PREDICTED: polygalacturonase At1g48100-like        361   2e-115   
ref|XP_008812598.1|  PREDICTED: polygalacturonase At1g48100-like        361   2e-115   
ref|XP_003531999.2|  PREDICTED: polygalacturonase At1g48100 isofo...    365   2e-115   
ref|XP_004509758.1|  PREDICTED: polygalacturonase At1g48100-like        362   2e-115   
emb|CDX69569.1|  BnaA10g19180D                                          359   2e-115   
ref|XP_010044612.1|  PREDICTED: polygalacturonase At1g48100-like        362   3e-115   
ref|XP_006350314.1|  PREDICTED: polygalacturonase At1g48100-like        360   3e-115   
ref|XP_009121649.1|  PREDICTED: polygalacturonase At1g48100 isofo...    359   3e-115   
dbj|BAB20805.2|  polygalacturonase                                      359   4e-115   Zinnia violacea [garden zinnia]
ref|XP_009144427.1|  PREDICTED: polygalacturonase At1g48100-like        362   4e-115   
ref|XP_002521450.1|  Polygalacturonase precursor, putative              359   5e-115   Ricinus communis
ref|XP_007044684.1|  Pectin lyase-like superfamily protein              361   6e-115   
ref|XP_010551909.1|  PREDICTED: polygalacturonase At1g48100 isofo...    358   7e-115   
ref|XP_002871625.1|  hypothetical protein ARALYDRAFT_488306             357   1e-114   
ref|NP_001148771.1|  polygalacturonase precursor                        361   1e-114   Zea mays [maize]
emb|CDY20962.1|  BnaA08g25630D                                          360   1e-114   
gb|KEH20046.1|  polygalacturonase plant-like protein                    360   1e-114   
gb|ACN35722.1|  unknown                                                 361   1e-114   Zea mays [maize]
ref|XP_010551910.1|  PREDICTED: polygalacturonase At1g48100 isofo...    358   2e-114   
ref|XP_010100443.1|  Polygalacturonase                                  360   2e-114   
ref|XP_006417442.1|  hypothetical protein EUTSA_v10007255mg             361   2e-114   
ref|XP_007153746.1|  hypothetical protein PHAVU_003G061600g             360   3e-114   
tpg|DAA58413.1|  TPA: polygalacturonase                                 360   4e-114   
ref|XP_008443532.1|  PREDICTED: polygalacturonase At1g48100             357   4e-114   
gb|AES96173.2|  polygalacturonase                                       359   5e-114   
gb|KHN27445.1|  Polygalacturonase                                       356   5e-114   
ref|XP_010924274.1|  PREDICTED: polygalacturonase At1g48100-like ...    357   6e-114   
ref|XP_008444333.1|  PREDICTED: polygalacturonase At1g48100-like        358   7e-114   
emb|CDM83489.1|  unnamed protein product                                358   8e-114   
ref|XP_002298533.2|  hypothetical protein POPTR_0001s35180g             355   1e-113   Populus trichocarpa [western balsam poplar]
gb|EPS67779.1|  polygalacturonase                                       357   1e-113   
ref|XP_002456022.1|  hypothetical protein SORBIDRAFT_03g029030          358   1e-113   
gb|KHG05280.1|  hypothetical protein F383_31181                         357   2e-113   
ref|XP_004489829.1|  PREDICTED: polygalacturonase At1g48100-like        357   3e-113   
ref|XP_010682533.1|  PREDICTED: polygalacturonase At1g48100             357   3e-113   
ref|XP_010108791.1|  Polygalacturonase                                  355   4e-113   
ref|XP_008800720.1|  PREDICTED: polygalacturonase At1g48100-like        355   4e-113   
ref|XP_004171197.1|  PREDICTED: polygalacturonase At1g48100-like        347   4e-113   
ref|XP_004297473.1|  PREDICTED: polygalacturonase At1g48100-like        356   6e-113   
ref|XP_004142980.1|  PREDICTED: polygalacturonase At1g48100-like        355   6e-113   
gb|KGN62292.1|  hypothetical protein Csa_2G348790                       355   9e-113   
gb|KHN23520.1|  Polygalacturonase                                       352   1e-112   
ref|XP_004969270.1|  PREDICTED: polygalacturonase At1g48100-like        356   1e-112   
ref|NP_001238091.1|  polygalacturonase PG1 precursor                    352   1e-112   
ref|XP_002980174.1|  hypothetical protein SELMODRAFT_112735             353   1e-112   
ref|NP_001150912.1|  polygalacturonase precursor                        355   2e-112   
gb|KFK40772.1|  hypothetical protein AALP_AA2G039100                    355   2e-112   
gb|ACU24545.1|  unknown                                                 352   2e-112   
gb|AFK47772.1|  unknown                                                 351   2e-112   
ref|XP_003618193.1|  Polygalacturonase                                  351   3e-112   
ref|XP_004141101.1|  PREDICTED: polygalacturonase At1g48100-like        352   3e-112   
ref|XP_010533949.1|  PREDICTED: polygalacturonase At1g48100-like        354   5e-112   
gb|EEC79746.1|  hypothetical protein OsI_21117                          353   1e-111   
ref|XP_010458422.1|  PREDICTED: polygalacturonase At1g48100-like        353   1e-111   
ref|XP_006841022.1|  hypothetical protein AMTR_s00085p00112760          351   2e-111   
ref|XP_009113198.1|  PREDICTED: polygalacturonase At1g48100             352   2e-111   
ref|XP_010475939.1|  PREDICTED: polygalacturonase At1g48100-like        352   2e-111   
ref|XP_006302097.1|  hypothetical protein CARUB_v10020088mg             353   2e-111   
ref|XP_008230581.1|  PREDICTED: polygalacturonase At1g48100             352   2e-111   
ref|XP_007217288.1|  hypothetical protein PRUPE_ppa018113mg             351   3e-111   
ref|XP_006307174.1|  hypothetical protein CARUB_v10008765mg             352   3e-111   
gb|EEE64806.1|  hypothetical protein OsJ_19662                          352   3e-111   
ref|NP_001238104.1|  polygalacturonase PG2 precursor                    348   3e-111   
ref|XP_011013806.1|  PREDICTED: polygalacturonase At1g48100-like        351   4e-111   
emb|CDY47212.1|  BnaC09g14610D                                          352   4e-111   
emb|CDY50367.1|  BnaA09g13160D                                          352   4e-111   
gb|EMT20816.1|  Polygalacturonase                                       352   4e-111   
ref|XP_010491600.1|  PREDICTED: polygalacturonase At1g48100-like        351   5e-111   
ref|XP_010417992.1|  PREDICTED: polygalacturonase At1g48100-like        351   7e-111   
ref|XP_003613215.1|  Polygalacturonase                                  351   7e-111   
ref|XP_009769209.1|  PREDICTED: polygalacturonase At1g48100 isofo...    347   1e-110   
gb|KDO66116.1|  hypothetical protein CISIN_1g040454mg                   348   1e-110   
gb|AAL31197.1|  At1g60590/F8A5_12                                       348   2e-110   
ref|XP_009419849.1|  PREDICTED: polygalacturonase At1g48100-like        347   2e-110   
ref|XP_008221838.1|  PREDICTED: polygalacturonase At1g48100             350   2e-110   
ref|XP_006446532.1|  hypothetical protein CICLE_v10015111mg             348   2e-110   
ref|XP_010510936.1|  PREDICTED: polygalacturonase At1g48100-like        350   2e-110   
ref|XP_003569422.1|  PREDICTED: polygalacturonase At1g48100-like ...    350   2e-110   
ref|XP_010924275.1|  PREDICTED: polygalacturonase At1g48100-like ...    344   3e-110   
ref|XP_010232068.1|  PREDICTED: polygalacturonase At1g48100-like ...    350   3e-110   
ref|NP_564758.2|  pectin lyase-like protein                             349   5e-110   
ref|XP_009398937.1|  PREDICTED: polygalacturonase At1g48100-like        347   6e-110   
gb|EMT18021.1|  Polygalacturonase                                       339   6e-110   
dbj|BAH56488.1|  polygalacturonase 1                                    348   6e-110   
ref|XP_010029152.1|  PREDICTED: polygalacturonase At1g48100-like        347   6e-110   
ref|XP_006644413.1|  PREDICTED: polygalacturonase At1g48100-like ...    348   7e-110   
ref|XP_010473235.1|  PREDICTED: polygalacturonase At1g48100-like        348   8e-110   
ref|XP_006644412.1|  PREDICTED: polygalacturonase At1g48100-like ...    348   1e-109   
ref|XP_010425372.1|  PREDICTED: polygalacturonase At1g48100-like        345   2e-109   
gb|KCW55998.1|  hypothetical protein EUGRSUZ_I01777                     348   2e-109   
ref|XP_002886607.1|  hypothetical protein ARALYDRAFT_893483             347   3e-109   
ref|XP_004489256.1|  PREDICTED: polygalacturonase At1g48100-like        343   3e-109   
ref|XP_007227459.1|  hypothetical protein PRUPE_ppa004002mg             347   3e-109   
ref|XP_007031503.1|  Pectin lyase-like superfamily protein              347   3e-109   
ref|XP_002266600.1|  PREDICTED: polygalacturonase At1g48100             345   4e-109   
ref|XP_009394799.1|  PREDICTED: polygalacturonase At1g48100-like        344   5e-109   
ref|XP_007151017.1|  hypothetical protein PHAVU_004G011800g             343   5e-109   
ref|XP_008340054.1|  PREDICTED: polygalacturonase At1g48100-like        346   5e-109   
dbj|BAJ96167.1|  predicted protein                                      345   8e-109   
emb|CDY20612.1|  BnaC08g14460D                                          345   8e-109   
gb|KFK33587.1|  hypothetical protein AALP_AA5G033100                    343   8e-109   
ref|NP_001043666.1|  Os01g0636500                                       345   1e-108   
ref|XP_002314612.2|  hypothetical protein POPTR_0010s05180g             345   1e-108   
gb|ABK95830.1|  unknown                                                 345   1e-108   
emb|CDX83631.1|  BnaC07g23710D                                          343   1e-108   
ref|XP_009152042.1|  PREDICTED: polygalacturonase At1g48100             343   1e-108   
emb|CDY13645.1|  BnaA06g32780D                                          343   2e-108   
gb|KFK43344.1|  hypothetical protein AALP_AA1G112800                    345   2e-108   
ref|XP_006392146.1|  hypothetical protein EUTSA_v10023404mg             345   2e-108   
ref|XP_009118238.1|  PREDICTED: polygalacturonase At1g48100-like        344   2e-108   
ref|XP_002875326.1|  hypothetical protein ARALYDRAFT_484425             342   2e-108   
ref|NP_563875.6|  pectin lyase-like protein                             343   4e-108   
gb|EMT04942.1|  Polygalacturonase                                       340   5e-108   
ref|NP_189293.1|  putative polygalacturonase / pectinase                342   5e-108   
emb|CDY54228.1|  BnaC08g49850D                                          343   6e-108   
ref|XP_004135250.1|  PREDICTED: polygalacturonase At1g48100-like        343   9e-108   
ref|XP_006359737.1|  PREDICTED: polygalacturonase At1g48100-like        339   1e-107   
ref|XP_009148407.1|  PREDICTED: polygalacturonase At1g48100             342   1e-107   
ref|XP_008446197.1|  PREDICTED: polygalacturonase At1g48100-like        342   2e-107   
ref|XP_006840430.1|  hypothetical protein AMTR_s00045p00161910          340   3e-107   
ref|XP_010502593.1|  PREDICTED: polygalacturonase At1g48100-like        340   3e-107   
ref|XP_006438345.1|  hypothetical protein CICLE_v10031220mg             342   3e-107   
gb|KDO82378.1|  hypothetical protein CISIN_1g009748mg                   341   4e-107   
gb|KGN51795.1|  hypothetical protein Csa_5G600960                       338   5e-107   
ref|XP_009375163.1|  PREDICTED: polygalacturonase At1g48100-like        339   6e-107   
ref|XP_006483884.1|  PREDICTED: polygalacturonase At1g48100-like        340   6e-107   
emb|CDY37962.1|  BnaC05g08120D                                          340   8e-107   
ref|XP_011071095.1|  PREDICTED: polygalacturonase At1g48100             340   8e-107   
ref|XP_004238649.1|  PREDICTED: polygalacturonase At1g48100-like        339   9e-107   
ref|XP_006395541.1|  hypothetical protein EUTSA_v10004137mg             338   1e-106   
ref|XP_006356424.1|  PREDICTED: polygalacturonase At1g48100-like        339   2e-106   
ref|XP_002441571.1|  hypothetical protein SORBIDRAFT_09g029500          340   2e-106   
ref|XP_008446196.1|  PREDICTED: probable polygalacturonase At1g80170    338   2e-106   
dbj|BAA88472.1|  polygalacturonase                                      335   4e-106   
ref|XP_010429999.1|  PREDICTED: probable polygalacturonase At1g80170    336   4e-106   
ref|XP_002311773.1|  hypothetical protein POPTR_0008s19350g             338   5e-106   
ref|XP_010472976.1|  PREDICTED: probable polygalacturonase At1g80170    335   6e-106   
gb|AAF17670.1|AC009398_19  F20B24.8                                     338   8e-106   
ref|XP_008389668.1|  PREDICTED: polygalacturonase At1g48100             337   1e-105   
gb|EYU28445.1|  hypothetical protein MIMGU_mgv1a004469mg                337   1e-105   
ref|XP_010556330.1|  PREDICTED: polygalacturonase At1g48100             335   1e-105   
gb|KDP26605.1|  hypothetical protein JCGZ_17763                         337   1e-105   
ref|XP_004135255.1|  PREDICTED: probable polygalacturonase At1g80...    339   2e-105   
ref|XP_009629756.1|  PREDICTED: polygalacturonase At1g48100-like        336   2e-105   
ref|XP_011034123.1|  PREDICTED: polygalacturonase At1g48100 isofo...    336   2e-105   
ref|XP_010417741.1|  PREDICTED: probable polygalacturonase At1g80170    333   2e-105   
gb|KCW86703.1|  hypothetical protein EUGRSUZ_B03312                     332   2e-105   
ref|NP_001234256.1|  polygalacturonase                                  334   3e-105   
gb|ADN33827.1|  polygalacturonase                                       339   3e-105   
ref|XP_002525361.1|  polygalacturonase, putative                        336   3e-105   
ref|XP_004239337.1|  PREDICTED: polygalacturonase At1g48100             334   4e-105   
ref|XP_004155358.1|  PREDICTED: probable polygalacturonase At1g80...    338   4e-105   
ref|XP_010547772.1|  PREDICTED: polygalacturonase At1g48100             335   5e-105   
ref|XP_004961120.1|  PREDICTED: polygalacturonase At1g48100-like        335   6e-105   
gb|ACF79104.1|  unknown                                                 334   7e-105   
ref|XP_009796485.1|  PREDICTED: polygalacturonase At1g48100             333   7e-105   
ref|XP_009405655.1|  PREDICTED: polygalacturonase At1g48100-like        333   1e-104   
ref|XP_008782487.1|  PREDICTED: polygalacturonase At1g48100             333   1e-104   
emb|CBI34901.3|  unnamed protein product                                333   1e-104   
ref|XP_011086585.1|  PREDICTED: polygalacturonase At1g48100             334   1e-104   
ref|XP_009334144.1|  PREDICTED: polygalacturonase At1g48100-like        333   2e-104   
ref|XP_009774333.1|  PREDICTED: polygalacturonase At1g48100-like        333   2e-104   
ref|XP_011039286.1|  PREDICTED: probable polygalacturonase At1g80170    332   2e-104   
ref|NP_001141617.1|  hypothetical protein                               334   2e-104   
ref|XP_006364199.1|  PREDICTED: probable polygalacturonase At1g80...    331   4e-104   
ref|XP_006483913.1|  PREDICTED: polygalacturonase At1g48100-like        331   4e-104   
ref|NP_565232.1|  putative polygalacturonase                            330   5e-104   
ref|XP_006291145.1|  hypothetical protein CARUB_v10017263mg             330   7e-104   
ref|XP_009388828.1|  PREDICTED: polygalacturonase At1g48100-like        330   1e-103   
ref|XP_010046047.1|  PREDICTED: polygalacturonase At1g48100-like        330   1e-103   
emb|CDP13178.1|  unnamed protein product                                332   2e-103   
gb|AES96137.2|  polygalacturonase                                       330   2e-103   
ref|XP_003517718.1|  PREDICTED: polygalacturonase At1g48100-like        329   3e-103   
ref|XP_004242881.1|  PREDICTED: polygalacturonase At1g48100-like        328   3e-103   
ref|XP_009769210.1|  PREDICTED: polygalacturonase At1g48100 isofo...    326   4e-103   
ref|XP_008657773.1|  PREDICTED: polygalacturonase At1g48100             327   5e-103   
ref|XP_006356444.1|  PREDICTED: polygalacturonase At1g48100-like        329   5e-103   
ref|XP_010033292.1|  PREDICTED: polygalacturonase At1g48100-like        329   7e-103   
ref|XP_006840713.1|  hypothetical protein AMTR_s00096p00099360          327   9e-103   
ref|XP_006427234.1|  hypothetical protein CICLE_v10027523mg             326   9e-103   
ref|XP_004300928.1|  PREDICTED: polygalacturonase At1g48100-like        328   1e-102   
ref|NP_001267980.1|  polygalacturonase precursor                        328   1e-102   
ref|XP_004489794.1|  PREDICTED: polygalacturonase At1g48100-like        327   1e-102   
ref|XP_004306351.1|  PREDICTED: polygalacturonase At1g48100-like        328   1e-102   
gb|KHN14552.1|  Polygalacturonase                                       327   1e-102   
gb|AFW83000.1|  hypothetical protein ZEAMMB73_048385                    326   1e-102   
ref|XP_002270821.2|  PREDICTED: polygalacturonase At1g48100-like ...    327   2e-102   
gb|AAO24262.1|  putative style polygalacturonase                        327   2e-102   
ref|XP_009802084.1|  PREDICTED: probable polygalacturonase At1g80170    326   3e-102   
ref|XP_006438313.1|  hypothetical protein CICLE_v10033716mg             327   5e-102   
gb|KDO45233.1|  hypothetical protein CISIN_1g013309mg                   325   6e-102   
ref|NP_001275837.1|  polygalacturonase precursor                        325   8e-102   
ref|XP_003519827.1|  PREDICTED: polygalacturonase At1g48100-like        325   9e-102   
gb|ABD62081.1|  putative style polygalacturonase                        325   9e-102   
ref|XP_006465356.1|  PREDICTED: probable polygalacturonase At1g80...    324   1e-101   
ref|XP_007157357.1|  hypothetical protein PHAVU_002G063500g             324   3e-101   
ref|XP_002266099.1|  PREDICTED: polygalacturonase At1g48100             323   5e-101   
emb|CDY71357.1|  BnaAnng37110D                                          318   6e-101   
ref|XP_009616734.1|  PREDICTED: polygalacturonase At1g48100             323   6e-101   
ref|XP_006380229.1|  polygalacturonase family protein                   323   7e-101   
gb|ABR18059.1|  unknown                                                 324   7e-101   
gb|KHG15884.1|  hypothetical protein F383_10630                         325   8e-101   
ref|XP_002887842.1|  hypothetical protein ARALYDRAFT_477239             322   9e-101   
gb|EYU22514.1|  hypothetical protein MIMGU_mgv1a017703mg                322   1e-100   
ref|XP_010100420.1|  Polygalacturonase                                  323   1e-100   
emb|CDY54312.1|  BnaC06g43100D                                          321   1e-100   
gb|EYU28216.1|  hypothetical protein MIMGU_mgv1a007235mg                320   2e-100   
ref|XP_009104448.1|  PREDICTED: probable polygalacturonase At1g80170    321   3e-100   
ref|XP_006841584.1|  hypothetical protein AMTR_s00003p00197480          321   3e-100   
ref|XP_010248557.1|  PREDICTED: polygalacturonase At1g48100             322   3e-100   
gb|ACN27989.1|  unknown                                                 320   3e-100   
gb|AAD55489.1|AC009322_29  Similar to polygalacturonases                321   4e-100   
ref|XP_002299032.1|  hypothetical protein POPTR_0001s46730g             321   4e-100   
ref|XP_010936703.1|  PREDICTED: polygalacturonase At1g48100-like        321   5e-100   
gb|KFK42419.1|  hypothetical protein AALP_AA2G253800                    320   5e-100   
emb|CDY57689.1|  BnaA07g38300D                                          320   6e-100   
gb|AHG12641.1|  polygalacturonase                                       320   6e-100   
ref|XP_004297385.1|  PREDICTED: probable polygalacturonase At1g80...    320   6e-100   
ref|XP_008446184.1|  PREDICTED: polygalacturonase At1g48100             320   7e-100   
ref|XP_002892586.1|  hypothetical protein ARALYDRAFT_471186             317   8e-100   
ref|XP_006396380.1|  hypothetical protein EUTSA_v10029273mg             316   8e-100   
ref|XP_011009731.1|  PREDICTED: probable polygalacturonase At1g80170    319   1e-99    
gb|KHN00378.1|  Polygalacturonase                                       318   2e-99    
ref|XP_010023494.1|  PREDICTED: polygalacturonase At1g48100             319   2e-99    
ref|XP_011034122.1|  PREDICTED: polygalacturonase At1g48100 isofo...    322   2e-99    
ref|XP_009594191.1|  PREDICTED: probable polygalacturonase At1g80170    318   3e-99    
emb|CAN65317.1|  hypothetical protein VITISV_006410                     316   4e-99    
ref|XP_002888783.1|  predicted protein                                  318   4e-99    
ref|XP_011014845.1|  PREDICTED: probable polygalacturonase At1g80...    317   4e-99    
ref|XP_010924245.1|  PREDICTED: polygalacturonase At1g48100             317   1e-98    
ref|XP_006389764.1|  hypothetical protein EUTSA_v10018548mg             317   1e-98    
ref|XP_003551209.1|  PREDICTED: probable polygalacturonase At1g80...    317   1e-98    
ref|XP_008389669.1|  PREDICTED: LOW QUALITY PROTEIN: probable pol...    317   1e-98    
gb|KHN23204.1|  Putative polygalacturonase                              317   1e-98    
ref|XP_004241700.1|  PREDICTED: probable polygalacturonase At1g80170    316   1e-98    
gb|EYU22774.1|  hypothetical protein MIMGU_mgv1a006357mg                316   2e-98    
ref|XP_010415730.1|  PREDICTED: probable polygalacturonase At1g80170    317   2e-98    
ref|XP_008340057.1|  PREDICTED: probable polygalacturonase At1g80...    316   2e-98    
ref|XP_011035674.1|  PREDICTED: probable polygalacturonase At1g80...    316   2e-98    
ref|XP_011075033.1|  PREDICTED: probable polygalacturonase At1g80170    316   2e-98    
ref|XP_011096240.1|  PREDICTED: probable polygalacturonase At1g80170    316   3e-98    
ref|XP_010471045.1|  PREDICTED: probable polygalacturonase At1g80170    316   3e-98    
ref|NP_177207.1|  pectin lyase-like protein                             316   3e-98    
gb|AAK50769.1|AF361321_1  polygalacturonase                             312   4e-98    
ref|XP_010537985.1|  PREDICTED: probable polygalacturonase At1g80...    315   4e-98    
gb|AAK63956.1|  At1g10640/F20B24_8                                      313   4e-98    
ref|XP_008659542.1|  PREDICTED: polygalacturonase At1g48100-like        313   4e-98    
dbj|BAF32144.1|  pollen allergen                                        314   5e-98    
ref|XP_002317091.1|  hypothetical protein POPTR_0011s16230g             315   6e-98    
ref|XP_004161089.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    314   6e-98    
ref|XP_010695816.1|  PREDICTED: polygalacturonase At1g48100             315   6e-98    
ref|XP_009398429.1|  PREDICTED: probable polygalacturonase At1g80170    315   7e-98    



>ref|XP_009760660.1| PREDICTED: polygalacturonase At1g48100-like [Nicotiana sylvestris]
Length=464

 Score =   685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/397 (81%), Positives = 362/397 (91%), Gaps = 3/397 (1%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             NV+SYG +GDGV DDT AFK AWD ACQ D + I+L P H+SF+IQSTIFTGPCK+ L+F
Sbjct  69    NVLSYGAVGDGVTDDTQAFKMAWDAACQVD-SAIVLVPYHYSFMIQSTIFTGPCKSGLVF  127

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             QIEGTIMPPDGPDSWPK ++KRQWLVFYR++GMSMQGGGLIDG+GEKWWNLPCKPH+G+N
Sbjct  128   QIEGTIMPPDGPDSWPKGVSKRQWLVFYRIDGMSMQGGGLIDGKGEKWWNLPCKPHKGIN  187

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G T+ GPCDSPVAIRFF SSNLTVQ LKIKNSP FHFRFD+CHDVHIDSLYIKAP  SPN
Sbjct  188   GKTVAGPCDSPVAIRFFMSSNLTVQGLKIKNSPFFHFRFDSCHDVHIDSLYIKAPSLSPN  247

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT DVTI NSI+ NGDDCISIGAGC+NVDIRNMTCGP HGISIGSLGI+ SRA
Sbjct  248   TDGIHIENTNDVTIQNSIIYNGDDCISIGAGCFNVDIRNMTCGPSHGISIGSLGIRNSRA  307

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYC--SNK  471
             CVSNI VTDSTI++SDNGVRIKTWQGGFGAVSKVTF+NI+M+NVRNPII+DQYYC  +NK
Sbjct  308   CVSNITVTDSTIKHSDNGVRIKTWQGGFGAVSKVTFNNIKMENVRNPIILDQYYCNNNNK  367

Query  470   ACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLD  291
             +C NQTSAVYISDV YSNIKGT+D RSPPMRLACSDSVPCTNLT  +VELYP+QG ++++
Sbjct  368   SCANQTSAVYISDVIYSNIKGTYDVRSPPMRLACSDSVPCTNLTFVDVELYPAQGQKIIE  427

Query  290   PFCWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             P+CWNAYGDL+++TIPPVFCLLEG PQSLP+ DVDQC
Sbjct  428   PYCWNAYGDLRSLTIPPVFCLLEGKPQSLPSNDVDQC  464



>ref|XP_006344808.1| PREDICTED: polygalacturonase At1g48100-like isoform X2 [Solanum 
tuberosum]
Length=476

 Score =   683 bits (1763),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/395 (81%), Positives = 358/395 (91%), Gaps = 1/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             NV+SYG +GDGV DDT AFK AWD ACQ D + ILL PKH+SF+IQSTIFTGPCK+ L+F
Sbjct  83    NVLSYGAVGDGVIDDTQAFKMAWDAACQVD-SAILLVPKHYSFMIQSTIFTGPCKSGLIF  141

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             ++EGTIMPPDGPDSWPK+++K+QWLVFYR++GMSM+GGGLIDGRGEKWWNLPCKPH+G+N
Sbjct  142   KVEGTIMPPDGPDSWPKSVSKKQWLVFYRIDGMSMKGGGLIDGRGEKWWNLPCKPHKGIN  201

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G TLPGPCDSPVAIRFF SSNLTVQ LKIKNSPLFHFRFD+C DVH+DSLYIKAPP SPN
Sbjct  202   GATLPGPCDSPVAIRFFMSSNLTVQGLKIKNSPLFHFRFDSCRDVHVDSLYIKAPPQSPN  261

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT DVTI NSI+SNGDDCISIGAGCYNVDIRNMTCGP HGISIGSLGI+ SRA
Sbjct  262   TDGIHIENTNDVTIRNSIISNGDDCISIGAGCYNVDIRNMTCGPSHGISIGSLGIRNSRA  321

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V DSTI+ SDNGVRIKTWQGGFG VS + F+NIRM++VRNPII+DQYYC+ K+C
Sbjct  322   CVSNITVQDSTIKYSDNGVRIKTWQGGFGTVSNINFNNIRMESVRNPIILDQYYCNTKSC  381

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQTSAVYISDV YSNIKGT+D RSPPM LACS+SVPCTNLT  +VELYP+QG ++L+PF
Sbjct  382   ANQTSAVYISDVIYSNIKGTYDVRSPPMHLACSNSVPCTNLTFLDVELYPAQGQKILEPF  441

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYG L T+TIPPVFCLLEG PQSLP+ D+DQC
Sbjct  442   CWNAYGALMTLTIPPVFCLLEGTPQSLPSNDLDQC  476



>ref|XP_009615869.1| PREDICTED: polygalacturonase At1g48100-like [Nicotiana tomentosiformis]
Length=464

 Score =   682 bits (1759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/397 (81%), Positives = 362/397 (91%), Gaps = 3/397 (1%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             NV+SYG +GDGV DDT AFK AWD ACQ D + I+L P H+SF+IQSTIFTGPCK+ L+F
Sbjct  69    NVLSYGAVGDGVTDDTQAFKMAWDAACQID-SAIVLVPYHYSFMIQSTIFTGPCKSGLVF  127

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             QIEGTIMPPDGPDSWPK+++KRQWLVFYR++GMSMQGGGLIDG+GEKWWNLPCKPH+G+N
Sbjct  128   QIEGTIMPPDGPDSWPKSVSKRQWLVFYRIDGMSMQGGGLIDGKGEKWWNLPCKPHKGIN  187

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             GTT   PCDSPVA+RFF SSNLTVQ LKIKNSP FHFRFD+CHDVHIDSLYIK+P  SPN
Sbjct  188   GTTASVPCDSPVALRFFMSSNLTVQGLKIKNSPFFHFRFDSCHDVHIDSLYIKSPSLSPN  247

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT DVTIHNSI+ NGDDCISIGAGC+NVDIRNMTCGP HGISIGSLGI+ SRA
Sbjct  248   TDGIHIENTNDVTIHNSIIYNGDDCISIGAGCFNVDIRNMTCGPSHGISIGSLGIRNSRA  307

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYC--SNK  471
             CVSNI V+DSTI++SDNGVRIKTWQGGFG VSKVTF+NIRM+NVRNPII+DQYYC  +NK
Sbjct  308   CVSNITVSDSTIKHSDNGVRIKTWQGGFGTVSKVTFNNIRMENVRNPIILDQYYCNNNNK  367

Query  470   ACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLD  291
             +C NQTSAVYISDV YSNIKGT+D RSPPMRLACSDSVPCTNLT  +VELYP+QG ++++
Sbjct  368   SCANQTSAVYISDVIYSNIKGTYDVRSPPMRLACSDSVPCTNLTFVDVELYPAQGQKIIE  427

Query  290   PFCWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             P+CWNAYGDL+++TIPPVFCLLEG PQSLP+ DVDQC
Sbjct  428   PYCWNAYGDLRSLTIPPVFCLLEGKPQSLPSNDVDQC  464



>ref|XP_004230341.1| PREDICTED: polygalacturonase At1g48100 isoform X2 [Solanum lycopersicum]
Length=476

 Score =   680 bits (1755),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/395 (80%), Positives = 356/395 (90%), Gaps = 1/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             NV+SYG +GDGV DDT AFK AWD ACQ D + ILL PKH+SF+IQSTIFTGPCK+ L+F
Sbjct  83    NVLSYGAVGDGVIDDTQAFKMAWDTACQVD-SAILLVPKHYSFMIQSTIFTGPCKSGLIF  141

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             ++EGTIMPPDGPDSWPK ++K+QWLVFYR++GMSMQGGGLIDG+GEKWWNLPCKPH+G+N
Sbjct  142   KVEGTIMPPDGPDSWPKGVSKKQWLVFYRIDGMSMQGGGLIDGKGEKWWNLPCKPHKGIN  201

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             GTTLPGPCDSPVAI+FF SSNLTVQ LKIKNSPLFHFRFD+C  VH+DSLYIKAP  SPN
Sbjct  202   GTTLPGPCDSPVAIKFFMSSNLTVQGLKIKNSPLFHFRFDSCRGVHVDSLYIKAPRQSPN  261

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT DVTI NSI+SNGDDCISIGAGCYNVDIRNMTCGP HGISIGSLGI+ SRA
Sbjct  262   TDGIHIENTNDVTIRNSIISNGDDCISIGAGCYNVDIRNMTCGPSHGISIGSLGIRNSRA  321

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V DSTI+ SDNGVRIKTWQGGFG VS + F+NIRM++VRNPII+DQYYCS K+C
Sbjct  322   CVSNITVEDSTIKYSDNGVRIKTWQGGFGTVSNINFNNIRMESVRNPIILDQYYCSTKSC  381

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQTSAVYISDV YSNIKGT+D RSPPM LACS+SVPCTNLT  +VELYP+QG ++L+PF
Sbjct  382   ANQTSAVYISDVIYSNIKGTYDVRSPPMHLACSNSVPCTNLTFLDVELYPAQGQKILEPF  441

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYG L T+TIPPVFCLLEG PQSLP+ D+DQC
Sbjct  442   CWNAYGALITLTIPPVFCLLEGTPQSLPSNDLDQC  476



>ref|XP_006344807.1| PREDICTED: polygalacturonase At1g48100-like isoform X1 [Solanum 
tuberosum]
Length=477

 Score =   679 bits (1751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/396 (80%), Positives = 358/396 (90%), Gaps = 2/396 (1%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             NV+SYG +GDGV DDT AFK AWD ACQ D + ILL PKH+SF+IQSTIFTGPCK+ L+F
Sbjct  83    NVLSYGAVGDGVIDDTQAFKMAWDAACQVD-SAILLVPKHYSFMIQSTIFTGPCKSGLIF  141

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHR-GV  1008
             ++EGTIMPPDGPDSWPK+++K+QWLVFYR++GMSM+GGGLIDGRGEKWWNLPCKPH+ G+
Sbjct  142   KVEGTIMPPDGPDSWPKSVSKKQWLVFYRIDGMSMKGGGLIDGRGEKWWNLPCKPHKQGI  201

Query  1007  NGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSP  828
             NG TLPGPCDSPVAIRFF SSNLTVQ LKIKNSPLFHFRFD+C DVH+DSLYIKAPP SP
Sbjct  202   NGATLPGPCDSPVAIRFFMSSNLTVQGLKIKNSPLFHFRFDSCRDVHVDSLYIKAPPQSP  261

Query  827   NTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSR  648
             NTDGIHIENT DVTI NSI+SNGDDCISIGAGCYNVDIRNMTCGP HGISIGSLGI+ SR
Sbjct  262   NTDGIHIENTNDVTIRNSIISNGDDCISIGAGCYNVDIRNMTCGPSHGISIGSLGIRNSR  321

Query  647   ACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKA  468
             ACVSNI V DSTI+ SDNGVRIKTWQGGFG VS + F+NIRM++VRNPII+DQYYC+ K+
Sbjct  322   ACVSNITVQDSTIKYSDNGVRIKTWQGGFGTVSNINFNNIRMESVRNPIILDQYYCNTKS  381

Query  467   CTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDP  288
             C NQTSAVYISDV YSNIKGT+D RSPPM LACS+SVPCTNLT  +VELYP+QG ++L+P
Sbjct  382   CANQTSAVYISDVIYSNIKGTYDVRSPPMHLACSNSVPCTNLTFLDVELYPAQGQKILEP  441

Query  287   FCWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             FCWNAYG L T+TIPPVFCLLEG PQSLP+ D+DQC
Sbjct  442   FCWNAYGALMTLTIPPVFCLLEGTPQSLPSNDLDQC  477



>ref|XP_010313757.1| PREDICTED: polygalacturonase At1g48100 isoform X1 [Solanum lycopersicum]
Length=477

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/396 (80%), Positives = 356/396 (90%), Gaps = 2/396 (1%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             NV+SYG +GDGV DDT AFK AWD ACQ D + ILL PKH+SF+IQSTIFTGPCK+ L+F
Sbjct  83    NVLSYGAVGDGVIDDTQAFKMAWDTACQVD-SAILLVPKHYSFMIQSTIFTGPCKSGLIF  141

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHR-GV  1008
             ++EGTIMPPDGPDSWPK ++K+QWLVFYR++GMSMQGGGLIDG+GEKWWNLPCKPH+ G+
Sbjct  142   KVEGTIMPPDGPDSWPKGVSKKQWLVFYRIDGMSMQGGGLIDGKGEKWWNLPCKPHKQGI  201

Query  1007  NGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSP  828
             NGTTLPGPCDSPVAI+FF SSNLTVQ LKIKNSPLFHFRFD+C  VH+DSLYIKAP  SP
Sbjct  202   NGTTLPGPCDSPVAIKFFMSSNLTVQGLKIKNSPLFHFRFDSCRGVHVDSLYIKAPRQSP  261

Query  827   NTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSR  648
             NTDGIHIENT DVTI NSI+SNGDDCISIGAGCYNVDIRNMTCGP HGISIGSLGI+ SR
Sbjct  262   NTDGIHIENTNDVTIRNSIISNGDDCISIGAGCYNVDIRNMTCGPSHGISIGSLGIRNSR  321

Query  647   ACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKA  468
             ACVSNI V DSTI+ SDNGVRIKTWQGGFG VS + F+NIRM++VRNPII+DQYYCS K+
Sbjct  322   ACVSNITVEDSTIKYSDNGVRIKTWQGGFGTVSNINFNNIRMESVRNPIILDQYYCSTKS  381

Query  467   CTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDP  288
             C NQTSAVYISDV YSNIKGT+D RSPPM LACS+SVPCTNLT  +VELYP+QG ++L+P
Sbjct  382   CANQTSAVYISDVIYSNIKGTYDVRSPPMHLACSNSVPCTNLTFLDVELYPAQGQKILEP  441

Query  287   FCWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             FCWNAYG L T+TIPPVFCLLEG PQSLP+ D+DQC
Sbjct  442   FCWNAYGALITLTIPPVFCLLEGTPQSLPSNDLDQC  477



>ref|XP_011092683.1| PREDICTED: polygalacturonase At1g48100-like [Sesamum indicum]
Length=463

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/396 (78%), Positives = 358/396 (90%), Gaps = 1/396 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V+SYG +GDGVADDT AFK AWD ACQ+D   +LL P+H++F+IQSTIFTGPC + L F
Sbjct  68    SVVSYGAVGDGVADDTPAFKAAWDAACQADDPAVLLVPRHYTFMIQSTIFTGPCTSRLAF  127

Query  1184  Q-IEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGV  1008
             Q IEG+I+PPDGPDSWPKN +KRQWLVFYR+NGMSMQGGG+IDGRGEKWW+LPCKPHRG+
Sbjct  128   QVIEGSIVPPDGPDSWPKNYSKRQWLVFYRINGMSMQGGGVIDGRGEKWWDLPCKPHRGI  187

Query  1007  NGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSP  828
             NGTT PGPCDSPVAIRFF SSN+TVQ LKIKNSP FHFRFD+CHDVHIDSLYIK+P  SP
Sbjct  188   NGTTPPGPCDSPVAIRFFWSSNVTVQGLKIKNSPQFHFRFDSCHDVHIDSLYIKSPAGSP  247

Query  827   NTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSR  648
             NTDGIH+EN+ DV I+NS++SNGDDC+SIGAG YNVDIRN+TCGP HGISIGSLGIK SR
Sbjct  248   NTDGIHVENSNDVRIYNSVISNGDDCVSIGAGTYNVDIRNITCGPSHGISIGSLGIKNSR  307

Query  647   ACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKA  468
             ACVSNI VTDS I++SDNGVRIKTWQGGFG+VSKVTF NI +D VRNPII+DQYYCSNKA
Sbjct  308   ACVSNITVTDSVIKHSDNGVRIKTWQGGFGSVSKVTFKNIIVDTVRNPIIIDQYYCSNKA  367

Query  467   CTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDP  288
             C NQTSAVY++D+SY+NIKGT+D RSP M LACSD+VPCTNLTL +VEL+P+QG ++LDP
Sbjct  368   CPNQTSAVYVTDISYTNIKGTYDVRSPAMHLACSDTVPCTNLTLYDVELFPAQGQKILDP  427

Query  287   FCWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             FCWNAYGD+KT+T+PPVFCL+EG P SLP+ DVD+C
Sbjct  428   FCWNAYGDIKTLTVPPVFCLMEGFPLSLPDNDVDKC  463



>gb|EYU38393.1| hypothetical protein MIMGU_mgv1a021443mg [Erythranthe guttata]
Length=464

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/395 (76%), Positives = 353/395 (89%), Gaps = 0/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +VMSYG +GDGV+DDT AFK AWD ACQSD + ++L PKH++F+IQS IFTGPCKN L+F
Sbjct  70    SVMSYGAVGDGVSDDTQAFKTAWDNACQSDESAVILVPKHYTFMIQSAIFTGPCKNGLVF  129

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             QIEG++MPPDGP+SWPKN +KRQWLVFYR+NGM+MQGGGLIDGRG+KWW+LPCKPH+  N
Sbjct  130   QIEGSMMPPDGPNSWPKNFSKRQWLVFYRINGMTMQGGGLIDGRGQKWWDLPCKPHKVKN  189

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             GT  PGPCDSPVA+RFF SS L V+ LKIKNSP FHFRFD+CHDVHIDSLY+K+P  SPN
Sbjct  190   GTIPPGPCDSPVALRFFWSSKLIVKGLKIKNSPQFHFRFDSCHDVHIDSLYVKSPSGSPN  249

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIEN+ DV I+NS++SNGDDC+SIGAG YNVDIRN+TCGP HGISIGSLGIK SRA
Sbjct  250   TDGIHIENSNDVQIYNSVISNGDDCVSIGAGSYNVDIRNITCGPSHGISIGSLGIKNSRA  309

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V DS I++SDNGVRIKTWQGG+G+VSK+TFDNI MD VRNPI++DQYYCSNKAC
Sbjct  310   CVSNITVRDSVIKHSDNGVRIKTWQGGYGSVSKITFDNIHMDTVRNPIMIDQYYCSNKAC  369

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQ+SAVY++D+SY+NIKGT+D RSPPM LACSD+VPCTNLTL +VEL PS G R+LDPF
Sbjct  370   LNQSSAVYVNDISYTNIKGTYDVRSPPMHLACSDAVPCTNLTLYDVELLPSLGQRILDPF  429

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYGD+K VT+PPVFCL+EG PQ+L + DVDQC
Sbjct  430   CWNAYGDIKAVTVPPVFCLMEGFPQALLSSDVDQC  464



>ref|XP_002307031.2| hypothetical protein POPTR_0005s00720g [Populus trichocarpa]
 gb|EEE94027.2| hypothetical protein POPTR_0005s00720g [Populus trichocarpa]
Length=482

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/395 (75%), Positives = 343/395 (87%), Gaps = 0/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             NV+S+G +GDGV DDT AFK AWD AC  + + ILLAP  +SF+IQ TIFTGPCK  L+F
Sbjct  79    NVLSFGAVGDGVTDDTQAFKMAWDTACLQNESAILLAPDDYSFMIQPTIFTGPCKTSLVF  138

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             QI+GTIMPPDGP+SWP  + KRQWLVFYR+NGMSMQGGG+IDGRGEKWWNLPCKPH+G+N
Sbjct  139   QIDGTIMPPDGPESWPSKMNKRQWLVFYRINGMSMQGGGVIDGRGEKWWNLPCKPHKGIN  198

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             GTTLPGPCDSPVAIRFFTSSNLTVQ L++KNSP FHFRFDNC +V +  L IK+P  SPN
Sbjct  199   GTTLPGPCDSPVAIRFFTSSNLTVQGLRVKNSPQFHFRFDNCQNVIVQMLSIKSPAQSPN  258

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENTY+V IHNS+VSNGDDC+SIGAGC+NVDI+N+TCGP HGISIGSLGI+ SRA
Sbjct  259   TDGIHIENTYNVQIHNSVVSNGDDCVSIGAGCHNVDIKNITCGPSHGISIGSLGIRNSRA  318

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI VTDS I+NSDNGVRIKTWQGG+G+VSK+TF NI M+ VRNPII+DQYYC  + C
Sbjct  319   CVSNITVTDSVIKNSDNGVRIKTWQGGYGSVSKITFHNIHMETVRNPIIIDQYYCQTRNC  378

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
             TNQTSAVYISD+ Y+NIKGT+D RSPP+ LACSDSVPCTNL LSE+EL P+QG  M +PF
Sbjct  379   TNQTSAVYISDILYTNIKGTYDIRSPPLHLACSDSVPCTNLRLSEIELLPAQGQFMANPF  438

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYG ++ +TIPPV CLL+G PQ LP  ++DQC
Sbjct  439   CWNAYGPMQNLTIPPVSCLLDGIPQFLPQNNIDQC  473



>ref|XP_011039005.1| PREDICTED: polygalacturonase At1g48100-like [Populus euphratica]
Length=485

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/395 (75%), Positives = 344/395 (87%), Gaps = 0/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             NV+S+G +GDGV DDT AFK AWD AC  + + ILLAP  +SF+IQ TIFTGPCK  L+F
Sbjct  82    NVLSFGAVGDGVTDDTKAFKMAWDTACLQNESAILLAPDDYSFMIQPTIFTGPCKTSLVF  141

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             QI+GTIMPPDGP+SWP  + KRQWLVFY++NGMSMQGGG+IDGRGEKWWNLPCKPH+G+N
Sbjct  142   QIDGTIMPPDGPESWPSKMNKRQWLVFYKINGMSMQGGGVIDGRGEKWWNLPCKPHKGIN  201

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             GTTLPGPCDSPVAIRFFTSSNLTVQ L++KNSP FHFRFDNC +V +  L IK+P  SPN
Sbjct  202   GTTLPGPCDSPVAIRFFTSSNLTVQGLRVKNSPQFHFRFDNCQNVIVQMLSIKSPHRSPN  261

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENTY+V IHNS+VSNGDDC+SIGAGC+NVDI+N+TCGP HGISIGSLGI+ SRA
Sbjct  262   TDGIHIENTYNVQIHNSVVSNGDDCVSIGAGCHNVDIKNITCGPSHGISIGSLGIRNSRA  321

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI VTDS I++SDNGVRIKTWQGG+G+VSK+TF NI M+ VRNPII+DQYYC  + C
Sbjct  322   CVSNITVTDSVIKDSDNGVRIKTWQGGYGSVSKITFHNIHMETVRNPIIIDQYYCQTRNC  381

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
             TNQTSAVYISD+ Y+NIKGT+D+RSPP+ LACSDSVPCTNL LSE+EL PSQG  M +PF
Sbjct  382   TNQTSAVYISDILYTNIKGTYDSRSPPLHLACSDSVPCTNLRLSEIELLPSQGQFMANPF  441

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYG ++ +TIPPV CLL+G PQ LP  ++DQC
Sbjct  442   CWNAYGAMQNLTIPPVSCLLDGIPQFLPQNNIDQC  476



>emb|CDP15213.1| unnamed protein product [Coffea canephora]
Length=462

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/396 (77%), Positives = 346/396 (87%), Gaps = 2/396 (1%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             NV+SYG +GDGVADDT AFK AWD+AC +D + ILL P  +SF+IQSTIFTGPCK+ L+F
Sbjct  68    NVLSYGAVGDGVADDTQAFKMAWDDACHTD-SGILLVPSRYSFMIQSTIFTGPCKSGLVF  126

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             QIEGTIMPPDGPDSWPKN +KRQWLVFYRV+GM+MQGGGLIDGRGE WWNLPCKPH+GVN
Sbjct  127   QIEGTIMPPDGPDSWPKNYSKRQWLVFYRVSGMTMQGGGLIDGRGENWWNLPCKPHKGVN  186

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             GTT  GPCDSPVAIRFF SSNLTVQ L+++NSP FHFRFD C DV++ SLYIK+P  SPN
Sbjct  187   GTTSHGPCDSPVAIRFFMSSNLTVQGLRVRNSPQFHFRFDGCQDVNVYSLYIKSPSLSPN  246

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT DV IHN+I+ NGDDC+SIGAGC+N DIRN+TCGP HGISIGSLG + ++A
Sbjct  247   TDGIHIENTSDVRIHNTIIYNGDDCVSIGAGCHNADIRNITCGPSHGISIGSLGKQNTKA  306

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI VTDS I++S NGVRIKTWQGGFG+VSKVTF+NI MD VRNPII+DQYYC  K C
Sbjct  307   CVSNITVTDSLIKHSANGVRIKTWQGGFGSVSKVTFNNIVMDTVRNPIIIDQYYCETKGC  366

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQTSAVY+SD+ Y+NIKGT+D RSPPMRLACSDSVPCTNLTLS+VEL+P+QG  +LDP+
Sbjct  367   QNQTSAVYVSDILYTNIKGTYDVRSPPMRLACSDSVPCTNLTLSDVELFPAQGQNILDPY  426

Query  284   CWNAYGDLKTVTIPPVFCLLEGN-PQSLPNVDVDQC  180
             CWNAYG LKT+TIPPVFCLLEG  P S+P  DV  C
Sbjct  427   CWNAYGSLKTLTIPPVFCLLEGYPPDSMPPNDVLVC  462



>ref|XP_002276945.1| PREDICTED: polygalacturonase At1g48100 [Vitis vinifera]
 emb|CBI39645.3| unnamed protein product [Vitis vinifera]
Length=464

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/395 (76%), Positives = 338/395 (86%), Gaps = 1/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             NV S+G +GDGV DDT AFK  WD ACQ++ +  LL P  HSF+IQSTIFTGPCK  L+F
Sbjct  71    NVRSFGAVGDGVTDDTQAFKMTWDTACQAE-SATLLVPHGHSFMIQSTIFTGPCKTGLIF  129

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             QIEGTIM PDGP SWP+  ++RQWLVFYR+N MSMQGGG+IDGRGEKWW+LPCKPH+G+N
Sbjct  130   QIEGTIMAPDGPSSWPQGNSRRQWLVFYRINEMSMQGGGVIDGRGEKWWDLPCKPHKGIN  189

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             GTTLPGPCDSPVAIRFFTSSNLTVQ LKIKNSP FHFRFDNC +VHID L IKAP  SPN
Sbjct  190   GTTLPGPCDSPVAIRFFTSSNLTVQGLKIKNSPQFHFRFDNCQNVHIDLLNIKAPAESPN  249

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT  V I+NSIVSNGDDC+SIGAGC+NVDIRN+TCGP HGISIGSLGI+ SRA
Sbjct  250   TDGIHIENTNGVKIYNSIVSNGDDCVSIGAGCHNVDIRNITCGPSHGISIGSLGIRNSRA  309

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI VTDS I++S NGVRIKTWQGG G+VSKVTF+NI MD VRNPII+DQYYC  K C
Sbjct  310   CVSNITVTDSIIKHSANGVRIKTWQGGSGSVSKVTFNNIHMDTVRNPIIIDQYYCLTKGC  369

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQTSAV IS +SY+NIKGT+D RS PM  ACSDSVPCTNLTLSEVEL PS+G  M++PF
Sbjct  370   VNQTSAVLISHISYTNIKGTYDVRSSPMHFACSDSVPCTNLTLSEVELLPSKGQIMMNPF  429

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYG  +T+TIPP+FCLLEG  QSLP  +VD+C
Sbjct  430   CWNAYGASQTLTIPPLFCLLEGTSQSLPQREVDKC  464



>ref|XP_002512560.1| Polygalacturonase precursor, putative [Ricinus communis]
 gb|EEF50012.1| Polygalacturonase precursor, putative [Ricinus communis]
Length=470

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/395 (74%), Positives = 336/395 (85%), Gaps = 0/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             NV+S+G +GDG +DDT AFK AWD AC  + + ILLAP  +SFLIQ TIFTGPCK+ L+F
Sbjct  76    NVLSFGAVGDGASDDTQAFKMAWDSACSQNESSILLAPSRYSFLIQPTIFTGPCKSNLVF  135

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             QI+GTIMPPDGP SWP+N++KRQWLVFYR++GMS+QGGG+IDGRGEKWWNLPCKPH+G N
Sbjct  136   QIDGTIMPPDGPKSWPRNMSKRQWLVFYRISGMSVQGGGVIDGRGEKWWNLPCKPHKGFN  195

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G T  GPCDSPVA+RFF SSNLTVQ LK+KNSP FHFRFDNC +VHI+ L IKAP  SPN
Sbjct  196   GATSAGPCDSPVALRFFMSSNLTVQGLKVKNSPQFHFRFDNCQNVHIEMLNIKAPALSPN  255

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT DV IHNS+VSNGDDC+SIGAGC+NVDIRN+TCGP HGISIGSLGI  SRA
Sbjct  256   TDGIHIENTNDVHIHNSVVSNGDDCVSIGAGCHNVDIRNITCGPSHGISIGSLGIHNSRA  315

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI VTDS I+ SDNGVRIKTWQGG+G+VSKV F NI MD VRNPII+DQYYC  K C
Sbjct  316   CVSNITVTDSVIKYSDNGVRIKTWQGGYGSVSKVAFHNIHMDTVRNPIIIDQYYCLTKNC  375

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
             +NQTSAVYISD+SY++IKGT+D RSPP+ LACSDSVPC+NL LSE+EL P++G  + +PF
Sbjct  376   SNQTSAVYISDISYTDIKGTYDVRSPPLHLACSDSVPCSNLILSEIELLPAKGQFLANPF  435

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYG ++T+ IPPV CLLEG P       VDQC
Sbjct  436   CWNAYGAMETLNIPPVSCLLEGIPPFAAQTIVDQC  470



>ref|XP_010276514.1| PREDICTED: polygalacturonase At1g48100-like isoform X2 [Nelumbo 
nucifera]
Length=455

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/395 (72%), Positives = 344/395 (87%), Gaps = 1/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V+S+G IGDGV DDT AFK AWD ACQ++ +  LL P  +SF+IQSTIFTGPC+N  +F
Sbjct  62    DVLSFGAIGDGVTDDTPAFKMAWDAACQAE-SATLLVPNGYSFMIQSTIFTGPCENGFVF  120

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             QIEGT+MPPDGPD+WPKN ++RQWLVFYR+NG++MQGGGLIDGRGEKWWNLPCKPH+GVN
Sbjct  121   QIEGTLMPPDGPDAWPKNNSRRQWLVFYRINGLTMQGGGLIDGRGEKWWNLPCKPHKGVN  180

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             GTTLPGPCDSPVA+RFF SSNLT+Q L I+NSP FHFRFDNC +V++D++ I+AP  SPN
Sbjct  181   GTTLPGPCDSPVALRFFLSSNLTIQGLAIRNSPQFHFRFDNCRNVYVDTITIRAPSLSPN  240

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT  V I+NS++SNGDDCISIG+GCY+VDI N+TCGP HGISIGSLG + SRA
Sbjct  241   TDGIHIENTDSVRIYNSLISNGDDCISIGSGCYDVDINNITCGPSHGISIGSLGNRNSRA  300

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI +++S I++SDNGVRIKTWQGG G+VS V F NI MD VRNPII+DQ+YC ++AC
Sbjct  301   CVSNITLSNSVIKHSDNGVRIKTWQGGSGSVSGVKFSNIHMDAVRNPIIIDQFYCLSRAC  360

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQTSAVY+SD+SY+NIKGT+D RSPPM  ACSDSVPCTNLTLS+VEL P+QG  +LDPF
Sbjct  361   ANQTSAVYVSDISYTNIKGTYDVRSPPMHFACSDSVPCTNLTLSDVELLPAQGEIVLDPF  420

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYG  +T+TIPPVFCLL+G P+S+   D++QC
Sbjct  421   CWNAYGASETLTIPPVFCLLDGVPRSVLENDIEQC  455



>ref|XP_010102205.1| Polygalacturonase [Morus notabilis]
 gb|EXB93148.1| Polygalacturonase [Morus notabilis]
Length=464

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/396 (73%), Positives = 337/396 (85%), Gaps = 1/396 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNP-LL  1188
             NV ++G +GDGV+D+T AFK AWD ACQ++   ILL P  ++F+I STIFTGPCK+  L 
Sbjct  69    NVRAFGAVGDGVSDETQAFKMAWDTACQAEDPSILLVPHSYTFMIHSTIFTGPCKSSDLT  128

Query  1187  FQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGV  1008
              QI+GT+MPPDGPDSWP+N +K+QWLVFYR+NGM+MQGGG+IDGRGEKWW+LPCKPH+G+
Sbjct  129   LQIDGTLMPPDGPDSWPRNNSKKQWLVFYRINGMAMQGGGVIDGRGEKWWDLPCKPHKGI  188

Query  1007  NGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSP  828
             NGTTLPGPCDSPVAIRFF SSNL V+ L++KNSP FHFRFD C +VHI+SL IKA   SP
Sbjct  189   NGTTLPGPCDSPVAIRFFMSSNLIVKGLRVKNSPQFHFRFDGCQNVHIESLKIKAHAQSP  248

Query  827   NTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSR  648
             NTDGIHIENT +V I+NS++SNGDDC+SIGAGCYNVDIRN+TCGP HGISIGSLG+K +R
Sbjct  249   NTDGIHIENTNNVEIYNSLISNGDDCVSIGAGCYNVDIRNITCGPSHGISIGSLGMKNTR  308

Query  647   ACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKA  468
             ACVSNI VTDS IRNSDNGVRIKTWQGG GAVS VTF NI MD VRNPIIVDQYYCS K 
Sbjct  309   ACVSNITVTDSVIRNSDNGVRIKTWQGGSGAVSGVTFHNIHMDTVRNPIIVDQYYCSTKN  368

Query  467   CTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDP  288
             C NQTSAVY+SD+ YSNIKGT+D RSP +  ACSDSVPCTNLTLSEVEL PS+G  M +P
Sbjct  369   CPNQTSAVYVSDILYSNIKGTYDIRSPAIHFACSDSVPCTNLTLSEVELLPSRGQFMSNP  428

Query  287   FCWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
              CWNAYG+++T+T+PP FCLLEG P  +    VD+C
Sbjct  429   LCWNAYGNMQTLTVPPAFCLLEGIPDMVQESYVDRC  464



>ref|XP_009366057.1| PREDICTED: polygalacturonase At1g48100-like isoform X1 [Pyrus 
x bretschneideri]
Length=475

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/395 (73%), Positives = 338/395 (86%), Gaps = 1/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             NV S+G +GDGVADDT AFK AWD ACQ++ + +L+ PK HSF+IQS IFTGPC + L F
Sbjct  82    NVRSFGAVGDGVADDTQAFKMAWDSACQTEDSEVLV-PKGHSFMIQSMIFTGPCSSGLKF  140

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             QIEGT++PPDGPDSWPK  +KRQWLVFYR+NGMSMQGGG+IDGRGEKWW+LPCKPH+G+N
Sbjct  141   QIEGTLVPPDGPDSWPKKNSKRQWLVFYRINGMSMQGGGVIDGRGEKWWDLPCKPHKGIN  200

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             GTT PGPCDSPVAIRFF SSNL VQ LK+KNSP FHFRFDNC +VHI+SL IKAP  SPN
Sbjct  201   GTTQPGPCDSPVAIRFFMSSNLRVQGLKVKNSPQFHFRFDNCQNVHIESLTIKAPALSPN  260

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT +V ++NS++SNGDDC+SIGAGCYNVDIRN+TCGP HGISIGSLG   SRA
Sbjct  261   TDGIHIENTNNVKLYNSLISNGDDCVSIGAGCYNVDIRNITCGPSHGISIGSLGNLHSRA  320

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V DS I++SDNGVRIKTWQGG G+VS++TF NI MD VRNPI++DQYYC  K C
Sbjct  321   CVSNITVRDSIIKHSDNGVRIKTWQGGSGSVSRITFHNIHMDTVRNPILLDQYYCLTKNC  380

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQTSAV ISD+ Y+NIKGT+D RSPPM  ACSDS+PCTNLTLSEVELYP+QG  + +P 
Sbjct  381   PNQTSAVQISDILYTNIKGTYDVRSPPMNFACSDSMPCTNLTLSEVELYPAQGVYVANPI  440

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CW+AYG ++++TIPPVFCLL G PQ LP  D ++C
Sbjct  441   CWSAYGTVQSLTIPPVFCLLGGTPQRLPQNDNERC  475



>ref|XP_002272733.2| PREDICTED: polygalacturonase At1g48100-like [Vitis vinifera]
Length=465

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/395 (72%), Positives = 336/395 (85%), Gaps = 0/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V S+G +G+G+ADDT AFK AWD ACQ + + I+  P  +SF+IQSTIFTGPC++ L+F
Sbjct  71    DVRSFGAVGNGIADDTQAFKAAWDTACQVEESAIVFVPYGYSFMIQSTIFTGPCQSRLVF  130

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++GT+ PPDGPDSWP+N +KRQWLVFYR+N MS+QGGGLIDGRGE WWNLPCKPH+G+N
Sbjct  131   QVDGTLTPPDGPDSWPQNNSKRQWLVFYRINEMSLQGGGLIDGRGENWWNLPCKPHKGIN  190

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             GTTLPGPCDSP+AIRFF SSNLTVQ L+IKNSP F+FRFDNC DVHI+S+YI AP  SPN
Sbjct  191   GTTLPGPCDSPIAIRFFMSSNLTVQGLRIKNSPQFNFRFDNCRDVHIESIYITAPALSPN  250

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT +V I+NS+VSNGDDC+SIG+GCY+VDI+N+TCGP HGISIGSLG   SRA
Sbjct  251   TDGIHIENTNNVKIYNSVVSNGDDCVSIGSGCYDVDIKNITCGPSHGISIGSLGNHNSRA  310

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V DS ++ SDNGVRIKTWQGG GAVS VTF N+ M+NVRNPII+DQ+YC  K C
Sbjct  311   CVSNITVRDSVLKYSDNGVRIKTWQGGSGAVSGVTFSNLHMNNVRNPIIIDQFYCLAKQC  370

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQTSAV +S++ YSNIKGT+D RSP M  ACSDSVPCTNLTLS+VEL P+QG  MLDPF
Sbjct  371   MNQTSAVLVSNIIYSNIKGTYDIRSPAMHFACSDSVPCTNLTLSDVELLPAQGELMLDPF  430

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYGDL+T+TIPPV CL+EG P+S     +D C
Sbjct  431   CWNAYGDLETLTIPPVSCLMEGTPRSALENYLDHC  465



>emb|CBI37004.3| unnamed protein product [Vitis vinifera]
Length=484

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/395 (72%), Positives = 336/395 (85%), Gaps = 0/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V S+G +G+G+ADDT AFK AWD ACQ + + I+  P  +SF+IQSTIFTGPC++ L+F
Sbjct  90    DVRSFGAVGNGIADDTQAFKAAWDTACQVEESAIVFVPYGYSFMIQSTIFTGPCQSRLVF  149

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++GT+ PPDGPDSWP+N +KRQWLVFYR+N MS+QGGGLIDGRGE WWNLPCKPH+G+N
Sbjct  150   QVDGTLTPPDGPDSWPQNNSKRQWLVFYRINEMSLQGGGLIDGRGENWWNLPCKPHKGIN  209

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             GTTLPGPCDSP+AIRFF SSNLTVQ L+IKNSP F+FRFDNC DVHI+S+YI AP  SPN
Sbjct  210   GTTLPGPCDSPIAIRFFMSSNLTVQGLRIKNSPQFNFRFDNCRDVHIESIYITAPALSPN  269

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT +V I+NS+VSNGDDC+SIG+GCY+VDI+N+TCGP HGISIGSLG   SRA
Sbjct  270   TDGIHIENTNNVKIYNSVVSNGDDCVSIGSGCYDVDIKNITCGPSHGISIGSLGNHNSRA  329

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V DS ++ SDNGVRIKTWQGG GAVS VTF N+ M+NVRNPII+DQ+YC  K C
Sbjct  330   CVSNITVRDSVLKYSDNGVRIKTWQGGSGAVSGVTFSNLHMNNVRNPIIIDQFYCLAKQC  389

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQTSAV +S++ YSNIKGT+D RSP M  ACSDSVPCTNLTLS+VEL P+QG  MLDPF
Sbjct  390   MNQTSAVLVSNIIYSNIKGTYDIRSPAMHFACSDSVPCTNLTLSDVELLPAQGELMLDPF  449

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYGDL+T+TIPPV CL+EG P+S     +D C
Sbjct  450   CWNAYGDLETLTIPPVSCLMEGTPRSALENYLDHC  484



>ref|XP_007221570.1| hypothetical protein PRUPE_ppa024649mg, partial [Prunus persica]
 gb|EMJ22769.1| hypothetical protein PRUPE_ppa024649mg, partial [Prunus persica]
Length=437

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/395 (71%), Positives = 336/395 (85%), Gaps = 0/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V S+G +GDG  DDT AFK AWD ACQS+    +L P+  SF+IQSTIFTGPC   L+ 
Sbjct  43    DVRSFGAVGDGQTDDTEAFKMAWDTACQSESAARILVPRGFSFMIQSTIFTGPCLGGLVL  102

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++GT++PPDGP+SWPKN ++ QWLVFYR+N MS+QGGG+IDGRGEKWWNLPCKPHRG+N
Sbjct  103   QVDGTLVPPDGPESWPKNASRHQWLVFYRINEMSLQGGGVIDGRGEKWWNLPCKPHRGIN  162

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             GTTLPGPC SPVAI+FF SSNLTVQ LKIKNSP FHFRFDNC +VHI+S+ I AP  SPN
Sbjct  163   GTTLPGPCYSPVAIKFFMSSNLTVQGLKIKNSPQFHFRFDNCRNVHIESISISAPARSPN  222

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT DV I+NS++SNGDDC+SIG+GCY+VDIRN+TCGPGHGISIGSLG   SRA
Sbjct  223   TDGIHIENTNDVQIYNSVISNGDDCVSIGSGCYDVDIRNITCGPGHGISIGSLGNHNSRA  282

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V DS I+ +DNGVRIKTWQGG G+VS VTF NI MDNVRNPI+++Q+YC NK C
Sbjct  283   CVSNITVRDSIIKETDNGVRIKTWQGGSGSVSGVTFSNIHMDNVRNPIMINQFYCLNKGC  342

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
             TNQTSAV++SD+ YSNI+GT+D RS PM  ACSD++PCTNLTLSEVEL P+ G  +LDP+
Sbjct  343   TNQTSAVFVSDILYSNIRGTYDVRSSPMHFACSDALPCTNLTLSEVELLPAVGDIVLDPY  402

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYG+L+T+TIPPV CLLEG P+SL + D++ C
Sbjct  403   CWNAYGELQTLTIPPVSCLLEGVPRSLLDNDIEHC  437



>ref|XP_010070078.1| PREDICTED: polygalacturonase At1g48100-like [Eucalyptus grandis]
Length=466

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/395 (71%), Positives = 335/395 (85%), Gaps = 1/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V  +G  GDGV +DT AFK AWD AC ++ +  LL P+ +SF+IQSTIFTGPCK  L+F
Sbjct  73    DVRKFGAKGDGVTNDTDAFKMAWDAACDAE-SATLLVPRGYSFMIQSTIFTGPCKANLVF  131

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             QI+GTIMPPDGPDSWP+ ++KRQWLVFYR+NGMSMQGGGLIDGRGEKWWNLPCKPH+G+N
Sbjct  132   QIDGTIMPPDGPDSWPQGVSKRQWLVFYRINGMSMQGGGLIDGRGEKWWNLPCKPHKGIN  191

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             GTT+PGPCDSPVAIRFF SSNLTV+ L++ NSP FHFRFD C +V I+SL IKAP  SPN
Sbjct  192   GTTMPGPCDSPVAIRFFMSSNLTVRGLRVMNSPQFHFRFDGCRNVLIESLSIKAPSQSPN  251

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIEN+ +V I+NS++SNGDDC+SIGA  Y+VDIRN+TCGP HGISIGSLG++ S A
Sbjct  252   TDGIHIENSNNVGIYNSMISNGDDCVSIGASTYDVDIRNITCGPSHGISIGSLGVRNSHA  311

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI VTDS I++SDNGVRIKTWQGG GAVS VTF+NI MD VRNPII+DQYYC  K C
Sbjct  312   CVSNITVTDSVIKHSDNGVRIKTWQGGSGAVSHVTFNNIHMDTVRNPIIIDQYYCLAKNC  371

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQTSAVY+SD+ YSNIKGT+DARSPPM   CSD++PCTNLTLS++EL P+QG  +L+PF
Sbjct  372   ANQTSAVYVSDILYSNIKGTYDARSPPMHFGCSDAIPCTNLTLSDIELLPAQGQFVLNPF  431

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYG ++T+TIPP  CL+EG P+ +   DVD C
Sbjct  432   CWNAYGIMETLTIPPAMCLVEGMPEKIIQTDVDHC  466



>ref|XP_008353865.1| PREDICTED: polygalacturonase At1g48100-like [Malus domestica]
Length=466

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/396 (72%), Positives = 337/396 (85%), Gaps = 1/396 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPI-LLAPKHHSFLIQSTIFTGPCKNPLL  1188
             +V S+G +GDG  DDT AFK AWD ACQSD +   +L P+  SF IQSTIFTGPC   L+
Sbjct  71    DVRSFGAVGDGQTDDTAAFKMAWDTACQSDESAARILVPQGFSFXIQSTIFTGPCLGGLV  130

Query  1187  FQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGV  1008
              Q++GT++PPDGP+SWPKN+++ QWLVFYRVN MS+QGGG+IDGRGEKWWNLPCKPHRG+
Sbjct  131   LQVDGTLVPPDGPESWPKNISRHQWLVFYRVNEMSLQGGGVIDGRGEKWWNLPCKPHRGI  190

Query  1007  NGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSP  828
             NGTTLPGPCDSP+A+RFF SSNLTVQ L+IKNSP FHFRFDNC +VHI+S+ I AP  SP
Sbjct  191   NGTTLPGPCDSPIALRFFMSSNLTVQGLRIKNSPKFHFRFDNCKNVHIESISISAPAKSP  250

Query  827   NTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSR  648
             NTDGIHIENT DV I+NS++SNGDDCISIG+GCY+VDIRN+TCGPGHGISIGSLG   SR
Sbjct  251   NTDGIHIENTNDVQIYNSVISNGDDCISIGSGCYDVDIRNITCGPGHGISIGSLGNHNSR  310

Query  647   ACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKA  468
             ACVSNI V DS I+ +DNGVRIKTWQGG G+VS VTF NI MDNVRNPI++DQYYC  K 
Sbjct  311   ACVSNITVRDSIIKGTDNGVRIKTWQGGSGSVSAVTFSNIHMDNVRNPIMIDQYYCLTKG  370

Query  467   CTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDP  288
             CTNQTSAV++SD+ YSNIKGT+D RS PM  ACSD++PCTNLTLSEVEL P+ G ++ DP
Sbjct  371   CTNQTSAVFVSDILYSNIKGTYDVRSSPMHFACSDALPCTNLTLSEVELLPAVGDKVSDP  430

Query  287   FCWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             +CWNAYG+L+T+TIPPV CLL+G P+SL +  V++C
Sbjct  431   YCWNAYGELQTLTIPPVSCLLDGVPRSLLDKYVERC  466



>ref|XP_011023841.1| PREDICTED: polygalacturonase At1g48100-like [Populus euphratica]
Length=483

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/395 (71%), Positives = 332/395 (84%), Gaps = 0/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             NV+S+G +GDG  DDT AFK AWD AC  +   ILLAP  +SF+IQ T+FTGPCK  L+F
Sbjct  84    NVLSFGAVGDGDTDDTKAFKMAWDTACFQNKPAILLAPDDYSFMIQPTVFTGPCKTSLVF  143

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             QI+GTIMPPDGP+SWP    KRQWLVFY+++GMSMQGGG+IDGRGEKWWNLPCKPH+G N
Sbjct  144   QIDGTIMPPDGPESWPSKTNKRQWLVFYKIDGMSMQGGGVIDGRGEKWWNLPCKPHKGPN  203

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G TLPGPCDSPVA+RFF SSNLTVQ L++KNSP FHFRFDNC DV +  L IK+PP SPN
Sbjct  204   GATLPGPCDSPVAMRFFMSSNLTVQGLEVKNSPQFHFRFDNCQDVTVQMLSIKSPPRSPN  263

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT +V I+NS+VSNGDDC+SIGAGC+NVDI+N+TCGP HGISIGSLGI  SRA
Sbjct  264   TDGIHIENTNNVQIYNSVVSNGDDCVSIGAGCHNVDIKNITCGPSHGISIGSLGISNSRA  323

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V DS I+ S+NGVRIKTWQGG+G+VSK++F NI M+ VRNPII+DQYYC  K C
Sbjct  324   CVSNITVRDSVIKRSENGVRIKTWQGGYGSVSKISFHNINMETVRNPIIIDQYYCQTKNC  383

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
             TNQTSAV+ISD+ Y++IKGT+D RSPP+ LACSDSVPCTNL L+E+EL P+QG  + DPF
Sbjct  384   TNQTSAVHISDILYTSIKGTYDVRSPPLHLACSDSVPCTNLELAEIELLPAQGQFVADPF  443

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYG ++ +TIPP+ CLL+G PQ +    +DQC
Sbjct  444   CWNAYGAMQNLTIPPISCLLDGIPQYIGQNTIDQC  478



>ref|XP_010270902.1| PREDICTED: polygalacturonase At1g48100 [Nelumbo nucifera]
Length=451

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/395 (72%), Positives = 344/395 (87%), Gaps = 1/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V+S+G +GDGV DDT A K AWD AC+S+ + +LL P  +SF+IQS IFTGPC+N L+F
Sbjct  58    SVLSFGAVGDGVTDDTPALKMAWDAACESE-SAVLLVPDGYSFMIQSAIFTGPCQNGLVF  116

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             QI+G +MPPDGP+SWPKN ++RQWLVFYR+NGM+MQGGGLIDGRGEKWWNLPCKPH+GVN
Sbjct  117   QIDGALMPPDGPESWPKNYSRRQWLVFYRINGMTMQGGGLIDGRGEKWWNLPCKPHKGVN  176

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             GTTLPGPCDSPVAIRFF SSNLT+Q LKI+NSP FHFRFDNC +VH+D++ IK+P +SPN
Sbjct  177   GTTLPGPCDSPVAIRFFMSSNLTIQGLKIRNSPQFHFRFDNCRNVHVDTITIKSPSHSPN  236

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT  V I+NSI+SNGDDC+SIG+GCY+VDI N+TCGP HGISIGSLG + SRA
Sbjct  237   TDGIHIENTNSVRIYNSIISNGDDCVSIGSGCYDVDINNITCGPSHGISIGSLGSRNSRA  296

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI VT+S I++SDNGVRIKTWQGG G+VS V+F+N+RMD VRNPII+DQ+YC  K C
Sbjct  297   CVSNITVTNSVIKHSDNGVRIKTWQGGSGSVSGVSFNNVRMDTVRNPIIIDQFYCLTKGC  356

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQTSAV++SD+SY+NIKGT+D RSPPM  ACSDSVPCTNLTLS+VEL P+QG  +LDPF
Sbjct  357   LNQTSAVFVSDISYTNIKGTYDVRSPPMHFACSDSVPCTNLTLSDVELLPAQGEFVLDPF  416

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYG  +T+TIPPV CLL+G P+S+   D++ C
Sbjct  417   CWNAYGASETLTIPPVSCLLDGIPRSILENDIEHC  451



>ref|XP_008227812.1| PREDICTED: polygalacturonase At1g48100 [Prunus mume]
Length=466

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/395 (71%), Positives = 335/395 (85%), Gaps = 0/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V S+G +GDG  DDT AFK AWD ACQS+    +L P+  SF+IQSTIFTGPC   L+ 
Sbjct  72    DVRSFGAVGDGQTDDTEAFKMAWDTACQSESATRILVPRGFSFMIQSTIFTGPCLGGLVL  131

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++GT++PPDGP+SWPKN ++ QWLVFYR+N MS+QGGG+IDG+GEKWWNLPCKPHRG+N
Sbjct  132   QVDGTLVPPDGPESWPKNASRHQWLVFYRINQMSLQGGGVIDGKGEKWWNLPCKPHRGIN  191

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             GTTLPGPCDSPVAIRFF SSNL VQ LKIKNSP FHFRFDNC +VHI+S+ I AP  SPN
Sbjct  192   GTTLPGPCDSPVAIRFFMSSNLIVQGLKIKNSPKFHFRFDNCRNVHIESISISAPARSPN  251

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT DV I+NS++SNGDDC+SIG+GCY+VDIRN+TCGPGHGISIGSLG   SRA
Sbjct  252   TDGIHIENTNDVQIYNSVISNGDDCVSIGSGCYDVDIRNITCGPGHGISIGSLGNHNSRA  311

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V DS I+ +DNGVRIKTWQGG G+VS VTF NI MDNVRNPI+++Q+YC NK C
Sbjct  312   CVSNITVRDSIIKGTDNGVRIKTWQGGSGSVSGVTFSNIHMDNVRNPIMINQFYCLNKGC  371

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
             TNQTSAV++SD+ YSNIKGT+D RS PM  ACSD++PCTNLTLSE+EL P+ G  + DP+
Sbjct  372   TNQTSAVFVSDILYSNIKGTYDVRSSPMHFACSDALPCTNLTLSEIELLPAVGDIVSDPY  431

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYG+L+T+TIPPV CLLEG P+SL + D++ C
Sbjct  432   CWNAYGELQTLTIPPVSCLLEGVPRSLLDNDIEHC  466



>ref|XP_007206198.1| hypothetical protein PRUPE_ppa014719mg [Prunus persica]
 gb|EMJ07397.1| hypothetical protein PRUPE_ppa014719mg [Prunus persica]
Length=419

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/395 (72%), Positives = 333/395 (84%), Gaps = 1/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             NV SYG IGDGV DDT AFK AWD ACQ++ + +L+ PK H+F+IQSTIFTGPCK  L  
Sbjct  26    NVRSYGAIGDGVTDDTQAFKLAWDTACQTEDSEVLV-PKGHTFMIQSTIFTGPCKPGLKM  84

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             QI+GT+MPPDGPDSWP+N +KRQWLVFYR+N MSMQG G+IDGRGEKWWNLPCKPH+G  
Sbjct  85    QIDGTLMPPDGPDSWPRNNSKRQWLVFYRINEMSMQGTGVIDGRGEKWWNLPCKPHKGFT  144

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             GTT PGPCDSPVAIRFF SSNL+V  LK+KNSP FHFRFDNC +V+I+SL IK P  SPN
Sbjct  145   GTTQPGPCDSPVAIRFFMSSNLSVIGLKVKNSPQFHFRFDNCQNVYIESLNIKTPALSPN  204

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT +V ++NS++SNGDDC+SIGAGCYNV+IRN+TCGP HGISIGSLGI+ SRA
Sbjct  205   TDGIHIENTNNVKLYNSVISNGDDCVSIGAGCYNVEIRNITCGPSHGISIGSLGIRNSRA  264

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V DS I++SDNGVRIKTWQGG G+VS+VTF NI MD VRNPI++DQYYC  K C
Sbjct  265   CVSNITVKDSIIKHSDNGVRIKTWQGGSGSVSRVTFQNIHMDTVRNPILLDQYYCLTKKC  324

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQTSAV+ISD+ YS IKGT+D RSPPM  ACSDS+PCTNLTLSEVEL P+QG  + +P 
Sbjct  325   PNQTSAVHISDILYSKIKGTYDVRSPPMHFACSDSMPCTNLTLSEVELLPAQGKFVSNPI  384

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CW+AYG ++T+TIPPVFCLL G P+ LP    ++C
Sbjct  385   CWSAYGTVQTLTIPPVFCLLGGTPEMLPQNGKERC  419



>ref|XP_009367183.1| PREDICTED: polygalacturonase At1g48100 [Pyrus x bretschneideri]
Length=466

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/396 (71%), Positives = 337/396 (85%), Gaps = 1/396 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLT-PILLAPKHHSFLIQSTIFTGPCKNPLL  1188
             +V S+G +GDG  DDT AFK AWD ACQSD + P +L P+  SF+IQSTIFTGPC   L+
Sbjct  71    DVRSFGAVGDGQTDDTAAFKMAWDTACQSDESAPRILVPQGFSFMIQSTIFTGPCLAGLV  130

Query  1187  FQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGV  1008
              Q++GT++PPDGP+SWPKN+++ QWLVFYRVN MS+QGGG+IDGRG+KWWNLPCKPHRG+
Sbjct  131   LQVDGTLVPPDGPESWPKNISRHQWLVFYRVNEMSLQGGGVIDGRGQKWWNLPCKPHRGI  190

Query  1007  NGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSP  828
             NGTTLPGPCDSP+A+RFF SSNLTVQ L+IKNSP FHFRFDNC +VHI+S+ I AP  SP
Sbjct  191   NGTTLPGPCDSPIALRFFMSSNLTVQGLRIKNSPKFHFRFDNCKNVHIESISISAPAKSP  250

Query  827   NTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSR  648
             NTDGIHIENT DV I+NS++SNGDDCISIG+GCY+VDIRN+TCGPGHGISIGSLG   S 
Sbjct  251   NTDGIHIENTNDVQIYNSVISNGDDCISIGSGCYDVDIRNITCGPGHGISIGSLGNHNSL  310

Query  647   ACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKA  468
             ACVSNI V DS I+ +DNGVRIKTWQGG G+VS VTF +I MDNVRNPI++DQYYC  K 
Sbjct  311   ACVSNITVRDSIIKGTDNGVRIKTWQGGSGSVSAVTFSDIHMDNVRNPIMIDQYYCLTKG  370

Query  467   CTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDP  288
             CTNQTSAV+ISD+ YSNIKGT+D RS PM  ACSD++PCTNLTLSEVEL P+ G  + DP
Sbjct  371   CTNQTSAVFISDILYSNIKGTYDVRSAPMHFACSDALPCTNLTLSEVELLPAVGDTVSDP  430

Query  287   FCWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             +CWNAYG+L+T+TIPPV CLL+G P+SL +  V++C
Sbjct  431   YCWNAYGELQTLTIPPVSCLLDGVPRSLLDTYVERC  466



>ref|XP_011079507.1| PREDICTED: polygalacturonase At1g48100 [Sesamum indicum]
Length=462

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/395 (71%), Positives = 337/395 (85%), Gaps = 1/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V ++G +GDGV DDT AFK AWD ACQ++   ILL P  + F+IQSTIFTGPC++  +F
Sbjct  69    DVRNFGAVGDGVTDDTEAFKTAWDSACQTE-AGILLVPYGYIFMIQSTIFTGPCESGFVF  127

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
              ++GTIMPPDGPDSWPKN ++RQWLVFYRV+ MS+QGGGLIDGRGE+WWNLPCKPH+G N
Sbjct  128   WVDGTIMPPDGPDSWPKNYSRRQWLVFYRVDEMSLQGGGLIDGRGEQWWNLPCKPHKGAN  187

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             GTTL  PCDSP+AIRFF S+NLTVQ LKI+NSP FHFRFDNC +VHI+S++I AP  SPN
Sbjct  188   GTTLREPCDSPIAIRFFMSNNLTVQGLKIRNSPQFHFRFDNCRNVHIESIHITAPALSPN  247

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT +V I+NS++SNGDDC+SIG+GCY+VDIRN+TCGPGHGISIGSLG   SRA
Sbjct  248   TDGIHIENTNNVEIYNSVISNGDDCVSIGSGCYDVDIRNLTCGPGHGISIGSLGNHNSRA  307

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             C SNI V DS I+NSDNGVRIKTWQGG GAVS VTF+NI MDNVRNP+I+DQ+YC +K C
Sbjct  308   CASNITVRDSVIKNSDNGVRIKTWQGGSGAVSGVTFENIHMDNVRNPMIIDQFYCLSKDC  367

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              N+TSAVY+SD+ Y  IKGT+D RSPPM  ACSDSVPCTN+T+S+VEL P++G  +LDPF
Sbjct  368   ANRTSAVYLSDIQYVGIKGTYDIRSPPMHFACSDSVPCTNITISDVELLPAKGDVVLDPF  427

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYG+L+T+TIPPV CLLEG PQS+ + D+  C
Sbjct  428   CWNAYGELQTLTIPPVSCLLEGIPQSVLDNDIGYC  462



>ref|XP_002318932.2| hypothetical protein POPTR_0013s00640g [Populus trichocarpa]
 gb|EEE94855.2| hypothetical protein POPTR_0013s00640g [Populus trichocarpa]
Length=481

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/394 (70%), Positives = 330/394 (84%), Gaps = 0/394 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             NV+S+G +GDG  DDT AFK AWD AC  +   ILLAP  +SF+IQ T+FTGPCK  L+F
Sbjct  81    NVLSFGAVGDGDTDDTQAFKMAWDTACFQNEPAILLAPDDYSFMIQPTVFTGPCKTSLVF  140

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             QI+GTIMPPDGP+SWP    KRQWLVFY+++GMSMQGGG+IDGRGEKWWNLPCKPH+G N
Sbjct  141   QIDGTIMPPDGPESWPSKTNKRQWLVFYKIDGMSMQGGGVIDGRGEKWWNLPCKPHKGPN  200

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G TLPGPCDSPVA+RFF SSNL VQ L++KNSP FHFRFDNC DV +  L IK+PP SPN
Sbjct  201   GATLPGPCDSPVAMRFFMSSNLIVQGLEVKNSPQFHFRFDNCQDVTVQMLSIKSPPLSPN  260

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT +V I+NS++SNGDDC+SIGAGC+NVDI+N+TCGP HGISIGSLGI  SRA
Sbjct  261   TDGIHIENTNNVQIYNSVISNGDDCVSIGAGCHNVDIKNITCGPSHGISIGSLGIGNSRA  320

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V DS I++SDNGVRIKTWQGG+G+VSK++F NI M+ VRNPII+DQYYC  K C
Sbjct  321   CVSNITVRDSVIKHSDNGVRIKTWQGGYGSVSKISFHNINMETVRNPIIIDQYYCQTKNC  380

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
             TNQTSAV+ISD+ Y++IKGT+D RSPP+ LACSDSVPCTNL L+E+EL P+ G  + DPF
Sbjct  381   TNQTSAVHISDILYTSIKGTYDVRSPPLHLACSDSVPCTNLELAEIELLPAHGQFVADPF  440

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQ  183
             CWNAYG ++ +TIPP+ CLL+G PQ +    +DQ
Sbjct  441   CWNAYGAMQNLTIPPISCLLDGIPQYIGQNTIDQ  474



>ref|XP_010276513.1| PREDICTED: polygalacturonase At1g48100-like isoform X1 [Nelumbo 
nucifera]
Length=488

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/428 (67%), Positives = 344/428 (80%), Gaps = 34/428 (8%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V+S+G IGDGV DDT AFK AWD ACQ++ +  LL P  +SF+IQSTIFTGPC+N  +F
Sbjct  62    DVLSFGAIGDGVTDDTPAFKMAWDAACQAE-SATLLVPNGYSFMIQSTIFTGPCENGFVF  120

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             QIEGT+MPPDGPD+WPKN ++RQWLVFYR+NG++MQGGGLIDGRGEKWWNLPCKPH+GVN
Sbjct  121   QIEGTLMPPDGPDAWPKNNSRRQWLVFYRINGLTMQGGGLIDGRGEKWWNLPCKPHKGVN  180

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             GTTLPGPCDSPVA+RFF SSNLT+Q L I+NSP FHFRFDNC +V++D++ I+AP  SPN
Sbjct  181   GTTLPGPCDSPVALRFFLSSNLTIQGLAIRNSPQFHFRFDNCRNVYVDTITIRAPSLSPN  240

Query  824   TDGIHIENTYDVTIHNSIVSNG---------------------------------DDCIS  744
             TDGIHIENT  V I+NS++SNG                                 DDCIS
Sbjct  241   TDGIHIENTDSVRIYNSLISNGMFRVLTSSEAPSLGLSIHQPNEYIYIYINLTPGDDCIS  300

Query  743   IGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRACVSNIKVTDSTIRNSDNGVRIKTWQGG  564
             IG+GCY+VDI N+TCGP HGISIGSLG + SRACVSNI +++S I++SDNGVRIKTWQGG
Sbjct  301   IGSGCYDVDINNITCGPSHGISIGSLGNRNSRACVSNITLSNSVIKHSDNGVRIKTWQGG  360

Query  563   FGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKACTNQTSAVYISDVSYSNIKGTFDARSPP  384
              G+VS V F NI MD VRNPII+DQ+YC ++AC NQTSAVY+SD+SY+NIKGT+D RSPP
Sbjct  361   SGSVSGVKFSNIHMDAVRNPIIIDQFYCLSRACANQTSAVYVSDISYTNIKGTYDVRSPP  420

Query  383   MRLACSDSVPCTNLTLSEVELYPSQGHRMLDPFCWNAYGDLKTVTIPPVFCLLEGNPQSL  204
             M  ACSDSVPCTNLTLS+VEL P+QG  +LDPFCWNAYG  +T+TIPPVFCLL+G P+S+
Sbjct  421   MHFACSDSVPCTNLTLSDVELLPAQGEIVLDPFCWNAYGASETLTIPPVFCLLDGVPRSV  480

Query  203   PNVDVDQC  180
                D++QC
Sbjct  481   LENDIEQC  488



>ref|XP_003518665.1| PREDICTED: polygalacturonase At1g48100-like [Glycine max]
 gb|KHN00228.1| Polygalacturonase [Glycine soja]
Length=473

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/396 (70%), Positives = 339/396 (86%), Gaps = 1/396 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDL-TPILLAPKHHSFLIQSTIFTGPCKNPLL  1188
             +V ++G IGDG+ DDT +FK AWD AC+S+    ++L P+  SF+IQSTIFTGPCK  L+
Sbjct  78    DVRTFGAIGDGITDDTESFKMAWDTACESESPVKVILVPQGFSFVIQSTIFTGPCKGGLV  137

Query  1187  FQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGV  1008
              +++GT+MPPDGP+SWPKN +KRQWLVFYR+NGMS++G GLIDGRG KWW+LPCKPH+G 
Sbjct  138   LKVDGTLMPPDGPESWPKNNSKRQWLVFYRINGMSLEGSGLIDGRGAKWWDLPCKPHKGP  197

Query  1007  NGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSP  828
             NGTT PGPCDSPVAIRFF SSNLTVQ L+IKNSP FHFRFD C  VH++S+YI AP  SP
Sbjct  198   NGTTSPGPCDSPVAIRFFMSSNLTVQGLRIKNSPQFHFRFDGCESVHVESIYITAPALSP  257

Query  827   NTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSR  648
             NTDGIHIENT DV I+NS++SNGDDC+SIGAGC++VDI+N+TCGPGHGISIGSLG   SR
Sbjct  258   NTDGIHIENTNDVRIYNSVISNGDDCVSIGAGCHDVDIKNITCGPGHGISIGSLGNHNSR  317

Query  647   ACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKA  468
             ACVSNI V DS I+ +DNGVRIKTWQGG G+VS VTF NI M++VRNPII+DQ+YC +K 
Sbjct  318   ACVSNITVRDSVIKVADNGVRIKTWQGGSGSVSGVTFSNIHMESVRNPIIIDQFYCLSKD  377

Query  467   CTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDP  288
             C+N+TSAV+++D+ Y+NIKGT+D R PPMR ACSDSVPCTNLTLS++EL P+QG+ +LDP
Sbjct  378   CSNKTSAVFVTDIVYTNIKGTYDIRHPPMRFACSDSVPCTNLTLSDIELLPAQGNIVLDP  437

Query  287   FCWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             FCW+AYG+ +T+TIPPVFC+LEG PQS+   D+D C
Sbjct  438   FCWSAYGNSETLTIPPVFCMLEGLPQSISGNDIDHC  473



>ref|XP_003536857.1| PREDICTED: polygalacturonase At1g48100-like [Glycine max]
Length=475

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/396 (70%), Positives = 337/396 (85%), Gaps = 1/396 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDL-TPILLAPKHHSFLIQSTIFTGPCKNPLL  1188
             +V ++G IGDG+ DDT +FK AWD ACQS+    ++L P+  SF+IQSTIFTGPCK  L+
Sbjct  80    DVRTFGAIGDGITDDTESFKMAWDTACQSESPVKVILVPQGFSFVIQSTIFTGPCKGGLV  139

Query  1187  FQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGV  1008
              +++GT+MPPDGP+SWPKN +KRQWLVF+R+NGMS++G GLIDGRG KWW+LPCKPH+G 
Sbjct  140   LKVDGTLMPPDGPESWPKNNSKRQWLVFFRINGMSLEGSGLIDGRGAKWWDLPCKPHKGP  199

Query  1007  NGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSP  828
             NGTT PGPCDSPVAIRFF SSNLTVQ L+IKNSP FHFRFD C  VH++S+YI AP  SP
Sbjct  200   NGTTSPGPCDSPVAIRFFMSSNLTVQGLRIKNSPQFHFRFDGCESVHVESIYITAPALSP  259

Query  827   NTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSR  648
             NTDGIHIENT DV I+NS++SNGDDC+SIGAGC++VDI+N+TCGPGHGISIGSLG   SR
Sbjct  260   NTDGIHIENTNDVRIYNSVISNGDDCVSIGAGCHDVDIKNITCGPGHGISIGSLGNHNSR  319

Query  647   ACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKA  468
             ACVSNI V DS I+ SDNGVRIKTWQGG G+VS VTF NI M++VRNPIIVDQ+YC +K 
Sbjct  320   ACVSNITVRDSVIKVSDNGVRIKTWQGGAGSVSGVTFSNIHMESVRNPIIVDQFYCLSKD  379

Query  467   CTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDP  288
             C+N+TSAV+++D+ Y+NIKGT+D R PPMR ACSDSVPCTNLTLS++EL P QG  +LDP
Sbjct  380   CSNKTSAVFVTDIVYANIKGTYDIRHPPMRFACSDSVPCTNLTLSDIELLPDQGDIVLDP  439

Query  287   FCWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             FCW+AYG+ +T+TIPPVFCLLEG PQS+   D+D C
Sbjct  440   FCWSAYGNSETLTIPPVFCLLEGLPQSISGNDIDHC  475



>gb|KHN00324.1| Polygalacturonase [Glycine soja]
Length=475

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/396 (70%), Positives = 337/396 (85%), Gaps = 1/396 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDL-TPILLAPKHHSFLIQSTIFTGPCKNPLL  1188
             +V ++G IGDG+ DDT +FK AWD ACQS+    ++L P+  SF+IQSTIFTGPCK  L+
Sbjct  80    DVRTFGAIGDGITDDTESFKMAWDTACQSESPVKVILVPQGFSFVIQSTIFTGPCKGGLV  139

Query  1187  FQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGV  1008
              +++GT+MPPDGP+SWPKN +KRQWLVF+R+NGMS++G GLIDGRG KWW+LPCKPH+G 
Sbjct  140   LKVDGTLMPPDGPESWPKNNSKRQWLVFFRINGMSLEGSGLIDGRGAKWWDLPCKPHKGP  199

Query  1007  NGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSP  828
             NGTT PGPCDSPVAIRFF SSNLTVQ L+IKNSP FHFRFD C  VH++S+YI AP  SP
Sbjct  200   NGTTSPGPCDSPVAIRFFMSSNLTVQGLRIKNSPQFHFRFDGCESVHVESIYITAPALSP  259

Query  827   NTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSR  648
             NTDGIHIENT DV I+NS++SNGDDC+SIGAGC++VDI+N+TCGPGHGISIGSLG   SR
Sbjct  260   NTDGIHIENTNDVRIYNSVISNGDDCVSIGAGCHDVDIKNITCGPGHGISIGSLGNHNSR  319

Query  647   ACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKA  468
             ACVSNI V DS I+ SDNGVRIKTWQGG G+VS VTF NI M++VRNPIIVDQ+YC +K 
Sbjct  320   ACVSNITVRDSVIKVSDNGVRIKTWQGGAGSVSGVTFSNIHMESVRNPIIVDQFYCLSKD  379

Query  467   CTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDP  288
             C+N+TSAV+++D+ Y+NIKGT+D R PPMR ACSDSVPCTNLTLS++EL P QG  +LDP
Sbjct  380   CSNKTSAVFVTDIVYTNIKGTYDIRHPPMRFACSDSVPCTNLTLSDIELLPDQGDIVLDP  439

Query  287   FCWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             FCW+AYG+ +T+TIPPVFCLLEG PQS+   D+D C
Sbjct  440   FCWSAYGNSETLTIPPVFCLLEGLPQSISGNDIDHC  475



>ref|XP_010092141.1| Polygalacturonase [Morus notabilis]
 gb|EXB50292.1| Polygalacturonase [Morus notabilis]
Length=483

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/397 (71%), Positives = 333/397 (84%), Gaps = 2/397 (1%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSD-LTPILLAPKHHSFLIQSTIFTGPCKNPLL  1188
             +V  +G  GDGV DDT AFK AWD ACQSD  + ++L P+  SF+IQSTIFTGPCK+ L+
Sbjct  86    DVRKFGAAGDGVTDDTDAFKMAWDTACQSDSASSLILVPRGFSFMIQSTIFTGPCKSSLV  145

Query  1187  FQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGV  1008
             FQ++GT+MPPDGPDSWP N ++RQWLVFYR+N M++QGGGLIDGRG+KWW+LPCKPH+G 
Sbjct  146   FQVDGTVMPPDGPDSWPNNSSRRQWLVFYRINEMALQGGGLIDGRGQKWWDLPCKPHKGK  205

Query  1007  NGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSP  828
             NGTTLPGPCDSP+AIRFF SSNLTVQ L+IKNSP FHFRFD+C +VHI+S+ I AP  SP
Sbjct  206   NGTTLPGPCDSPIAIRFFMSSNLTVQGLRIKNSPQFHFRFDSCQNVHIESISITAPALSP  265

Query  827   NTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSR  648
             NTDGIHIENT  V I+NS++SNGDDC+SIG+GC++V+IRN+TCGPGHGISIGSLG   SR
Sbjct  266   NTDGIHIENTIGVEIYNSVISNGDDCVSIGSGCHDVNIRNITCGPGHGISIGSLGKHNSR  325

Query  647   ACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKA  468
             ACV+NI V DS I+ S+NGVRIKTWQGG GAVS VTF NI MDNVRNPII+DQ+YC +K 
Sbjct  326   ACVTNITVKDSVIKASNNGVRIKTWQGGSGAVSGVTFSNIHMDNVRNPIIIDQFYCLSKN  385

Query  467   CTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDP  288
             C NQTSAV++SD+ Y NIKGT+D RSPPM   CSDSVPC NLTLSEVEL P+ G  +LDP
Sbjct  386   CANQTSAVFVSDILYDNIKGTYDVRSPPMHFGCSDSVPCANLTLSEVELLPAAGDIVLDP  445

Query  287   FCWNAYGDLKTVTIPPVFCLLEGNPQS-LPNVDVDQC  180
             FCWNAYG+L+T+TIPPV CLLEG P S L N D   C
Sbjct  446   FCWNAYGELQTLTIPPVSCLLEGVPNSKLDNSDKGYC  482



>ref|XP_011040652.1| PREDICTED: polygalacturonase At1g48100-like [Populus euphratica]
Length=470

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/395 (71%), Positives = 334/395 (85%), Gaps = 0/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V S+G IGDGV DDT AFK AWD AC  D +P++L P    F+IQSTIFTGPC+  L+F
Sbjct  76    DVRSFGAIGDGVTDDTDAFKMAWDAACNQDDSPVILVPYGFQFMIQSTIFTGPCQGGLVF  135

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++GT+MPPDGPDSWP N ++RQWLVFYR+N MS+ GGG+IDGRGEKWW+LPCKPH+G+N
Sbjct  136   QVDGTLMPPDGPDSWPHNNSRRQWLVFYRINEMSLLGGGVIDGRGEKWWDLPCKPHKGIN  195

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             GTT+PGPCDSP+AIRFF SSNLTVQ LKIKNSP F+FRFDNC +VH++S++I AP  SPN
Sbjct  196   GTTMPGPCDSPIAIRFFMSSNLTVQGLKIKNSPQFNFRFDNCKNVHVESIHITAPALSPN  255

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT  V I+NS++SNGDDC+SIG+GCY+VDIRN+TCGP HGISIGSLG   SRA
Sbjct  256   TDGIHIENTNGVEIYNSVISNGDDCVSIGSGCYDVDIRNITCGPSHGISIGSLGNHNSRA  315

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V DS IR SDNGVRIKTWQGG GAVS +TF NI MDNVRNPII+DQ+YC +K C
Sbjct  316   CVSNITVRDSVIRVSDNGVRIKTWQGGSGAVSGITFSNIHMDNVRNPIIIDQFYCLSKGC  375

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
             TNQTSA+ +SD+ Y NIKGT++ RSPPM  ACSDSVPCTNLTLS++EL P++G  +LDP+
Sbjct  376   TNQTSALSVSDILYENIKGTYNIRSPPMHFACSDSVPCTNLTLSDIELLPAEGDLVLDPY  435

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYG+ +T+TIPPV CL+EG P+S  N  +D C
Sbjct  436   CWNAYGNFRTLTIPPVSCLMEGIPRSNLNNKMDYC  470



>ref|XP_008246384.1| PREDICTED: polygalacturonase At1g48100-like [Prunus mume]
Length=413

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/395 (73%), Positives = 333/395 (84%), Gaps = 2/395 (1%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             NV SYG IGDGV DDT AFK AWD ACQ++ + +L+ PK  SF+IQSTIFTGPCK  L  
Sbjct  21    NVRSYGAIGDGVTDDTQAFKLAWDTACQTEDSEVLV-PKG-SFMIQSTIFTGPCKPCLKM  78

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             QI+GT+MPPDGPDSWP+N +KRQWLVFYR+N MSMQG G+IDGRGEKWWNLPCKPH+G  
Sbjct  79    QIDGTLMPPDGPDSWPRNNSKRQWLVFYRINEMSMQGTGVIDGRGEKWWNLPCKPHKGFT  138

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             GTT PGPCDSPVAIRFF SSNL+V  LK+KNSP FHFRFDNC +V+I+SL IKAP  SPN
Sbjct  139   GTTQPGPCDSPVAIRFFMSSNLSVIGLKVKNSPQFHFRFDNCQNVYIESLNIKAPALSPN  198

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT +V ++NS++SNGDDC+SIGAGCYNV+IRN+TCGP HGISIGSLGI+ SRA
Sbjct  199   TDGIHIENTNNVKLYNSVISNGDDCVSIGAGCYNVEIRNITCGPSHGISIGSLGIRNSRA  258

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V DS I++SDNGVRIKTWQGG G+VS+VTF NI MD VRNPI++DQYYC  K C
Sbjct  259   CVSNITVKDSIIKHSDNGVRIKTWQGGSGSVSRVTFQNIHMDTVRNPILLDQYYCLTKKC  318

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQTSAV+ISDV YS IKGT+D RSPPM  ACSDS+PCTNLTLSEVEL P+QG  + +P 
Sbjct  319   PNQTSAVHISDVLYSRIKGTYDVRSPPMHFACSDSMPCTNLTLSEVELLPAQGKFVSNPI  378

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CW+AYG ++T+TIPPVFCLL G P+ LP    ++C
Sbjct  379   CWSAYGTVQTLTIPPVFCLLGGTPEMLPQNGNERC  413



>gb|KDP28310.1| hypothetical protein JCGZ_14081 [Jatropha curcas]
Length=567

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/395 (71%), Positives = 337/395 (85%), Gaps = 0/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             NV  +G +GDG+ADDT AFK AWD ACQ++ + ++L P    F+IQSTIFTGPC+  L F
Sbjct  173   NVRKFGAVGDGIADDTDAFKMAWDTACQTEGSTVILVPYGFKFMIQSTIFTGPCQGGLQF  232

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++GT++PPDGP+SWP+  +KRQWLVFYR+N MS+ GGG+IDGRGEKWW+LPCKPH+G+N
Sbjct  233   QVDGTLVPPDGPNSWPQKNSKRQWLVFYRINEMSLVGGGVIDGRGEKWWDLPCKPHKGIN  292

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             GTTLPGPCDSP+AIRFF SSNLTV+ L+IKNSP F+FRFD C +VHIDS++I AP  SPN
Sbjct  293   GTTLPGPCDSPIAIRFFMSSNLTVRGLRIKNSPQFNFRFDGCENVHIDSIHITAPALSPN  352

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT +V I++S++SNGDDCISIG+GCY+VDIRNMTCGP HGISIGSLG   SRA
Sbjct  353   TDGIHIENTNNVEIYDSVISNGDDCISIGSGCYDVDIRNMTCGPSHGISIGSLGNHNSRA  412

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CV NI V DS I+ S+NGVRIKTWQGG GAVS +TF NI MDNVRNPII+DQ+YCS K C
Sbjct  413   CVHNITVRDSVIKVSENGVRIKTWQGGSGAVSGITFSNIHMDNVRNPIIIDQFYCSTKEC  472

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
             TNQTSAVY+SD+ Y NIKGT++ RSPPM  ACSDSVPCTNLTLS+VEL P+QG  +LDPF
Sbjct  473   TNQTSAVYVSDILYENIKGTYNIRSPPMHFACSDSVPCTNLTLSDVELLPAQGDLVLDPF  532

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYGDL+T+TIPPV CL+EG P+SL + +++ C
Sbjct  533   CWNAYGDLETLTIPPVSCLMEGAPRSLISNEIEAC  567



>ref|XP_009363098.1| PREDICTED: polygalacturonase At1g48100-like [Pyrus x bretschneideri]
Length=467

 Score =   600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/396 (69%), Positives = 336/396 (85%), Gaps = 1/396 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPI-LLAPKHHSFLIQSTIFTGPCKNPLL  1188
             +V S+G +GDG  DDT AFK AWD ACQSD +   +L P+  SF+IQSTIFTGPC   L+
Sbjct  72    DVRSFGAVGDGQTDDTTAFKMAWDTACQSDESAARILVPQGFSFMIQSTIFTGPCLGGLV  131

Query  1187  FQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGV  1008
              Q++G ++PPDGP SWPK++++ QWLVFYR+N MS+QGGG+IDG+GEKWWNLPCKPHRG+
Sbjct  132   LQVDGALVPPDGPGSWPKHISRHQWLVFYRINEMSLQGGGVIDGKGEKWWNLPCKPHRGI  191

Query  1007  NGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSP  828
             NGTTLPGPCDSP+AIRFF SSNLTVQ L+IKNSP FHFRFD+C +VHI+S+ I +P  SP
Sbjct  192   NGTTLPGPCDSPIAIRFFMSSNLTVQGLRIKNSPQFHFRFDSCRNVHIESISISSPAKSP  251

Query  827   NTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSR  648
             NTDGIHIE TYDV I+NS++SNGDDC+SIG+GCY+V+IRN+TCGPGHGISIGSLG   SR
Sbjct  252   NTDGIHIEKTYDVQIYNSVISNGDDCVSIGSGCYDVNIRNLTCGPGHGISIGSLGNHNSR  311

Query  647   ACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKA  468
             ACVSNI V DS ++ +DNGVRIKTWQGG G+VS VTF NI MDNVRNPI++DQYYC  K 
Sbjct  312   ACVSNITVRDSIMKGTDNGVRIKTWQGGSGSVSGVTFSNIHMDNVRNPIMIDQYYCLTKR  371

Query  467   CTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDP  288
             CTNQTSAV++SD+ YSNIKGT+D RS PM  ACSD++PCTNLTLSEVEL P+ G+++ DP
Sbjct  372   CTNQTSAVFVSDILYSNIKGTYDVRSSPMHFACSDALPCTNLTLSEVELLPAVGYKVSDP  431

Query  287   FCWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             +CWNAYG+L+T TIPPV CLL+G P+SL   ++++C
Sbjct  432   YCWNAYGELQTPTIPPVSCLLDGVPRSLLGHEIERC  467



>gb|AES61595.2| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=477

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/396 (70%), Positives = 333/396 (84%), Gaps = 1/396 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDL-TPILLAPKHHSFLIQSTIFTGPCKNPLL  1188
             +V  +G IGDG+ DDT +FK AWD ACQS+L   ++  P   SF++QSTIFTGPCK  L+
Sbjct  82    DVRKFGAIGDGITDDTESFKMAWDTACQSELDLNVIFVPPGFSFIVQSTIFTGPCKGGLV  141

Query  1187  FQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGV  1008
              +++GTIM PDGP+SW KN ++RQWLVFYRVNGMS++G G IDGRG+KWW+LPCKPH+G 
Sbjct  142   LKVDGTIMTPDGPESWLKNNSRRQWLVFYRVNGMSLEGSGTIDGRGQKWWDLPCKPHKGP  201

Query  1007  NGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSP  828
             NGTTLPGPCDSPVAIRFF SSNLTVQ L+IKNSP FHFRFD C  VH++S++I AP  SP
Sbjct  202   NGTTLPGPCDSPVAIRFFMSSNLTVQGLRIKNSPQFHFRFDGCQSVHVESIFITAPALSP  261

Query  827   NTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSR  648
             NTDGIHIENT DV I+NS+VSNGDDC+SIG+GCY+VDI+N+TCGPGHGISIGSLG   SR
Sbjct  262   NTDGIHIENTNDVKIYNSVVSNGDDCVSIGSGCYDVDIKNITCGPGHGISIGSLGNHNSR  321

Query  647   ACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKA  468
             ACVSNI V DS IR SDNGVRIKTWQGG G+VS VTF NI MD V+NPII+DQ+YC +K 
Sbjct  322   ACVSNITVRDSVIRVSDNGVRIKTWQGGSGSVSGVTFSNIHMDTVKNPIIIDQFYCLSKD  381

Query  467   CTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDP  288
             C+N+TSAV++SD+ Y++IKGT+D R PPM  ACSDS+PCTNLTLS++EL PSQG  + DP
Sbjct  382   CSNKTSAVFVSDIVYTSIKGTYDIRHPPMHFACSDSIPCTNLTLSDIELLPSQGDMLNDP  441

Query  287   FCWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             FCWNAYG+ +T+TIPPVFCLL+G PQS+P  D+D C
Sbjct  442   FCWNAYGNSETLTIPPVFCLLDGIPQSIPANDIDHC  477



>ref|XP_002515219.1| Polygalacturonase precursor, putative [Ricinus communis]
 gb|EEF47203.1| Polygalacturonase precursor, putative [Ricinus communis]
Length=537

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/395 (70%), Positives = 333/395 (84%), Gaps = 0/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V  +G IGDG+ DDT AFK AW+ AC  + T I+L P    F+IQSTIF GPC+  ++F
Sbjct  143   DVRKFGAIGDGITDDTDAFKMAWETACSQNDTAIILVPYTFKFMIQSTIFNGPCQGGIVF  202

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++GTIMPPDGP+SWP+  +KRQWLVFYR+N +S+ GGG IDGRGEKWW+LPCKPH+G+N
Sbjct  203   QVDGTIMPPDGPESWPQKNSKRQWLVFYRINELSLLGGGTIDGRGEKWWDLPCKPHKGIN  262

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             GTTLPGPCDSP+AIRFF SSNLTVQ ++IKNSP F+FRFDNC +VHIDS++I AP  SPN
Sbjct  263   GTTLPGPCDSPIAIRFFMSSNLTVQGIRIKNSPQFNFRFDNCRNVHIDSIHITAPALSPN  322

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT +V I++S++SNGDDC+SIG+GCY+VDIRN+TCGP HGISIGSLG   SRA
Sbjct  323   TDGIHIENTNNVEIYDSVISNGDDCVSIGSGCYDVDIRNITCGPSHGISIGSLGNHNSRA  382

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V DS I+ SDNGVRIKTWQGG GAV+ +TF NI MDNV+NPII+DQ+YC  K C
Sbjct  383   CVSNITVRDSVIKLSDNGVRIKTWQGGSGAVTGITFSNIHMDNVKNPIIIDQFYCLTKEC  442

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
             +NQTSAV++SD+ Y NIKGT++ RSPPM  ACSDSVPCTNLTLSEVEL P+QG  +LDPF
Sbjct  443   SNQTSAVFVSDILYENIKGTYNIRSPPMHFACSDSVPCTNLTLSEVELLPAQGDLVLDPF  502

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYG+L+T+TIPPV CL+EG P SL N D+D C
Sbjct  503   CWNAYGELETLTIPPVSCLMEGTPSSLLNNDIDYC  537



>ref|XP_002320271.2| hypothetical protein POPTR_0014s11110g [Populus trichocarpa]
 gb|EEE98586.2| hypothetical protein POPTR_0014s11110g [Populus trichocarpa]
Length=526

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/395 (70%), Positives = 334/395 (85%), Gaps = 0/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V S+G IGDG+ DDT AFK AWD AC  D + ++L P    F+IQSTIFTGPC+  L+F
Sbjct  132   DVRSFGAIGDGITDDTDAFKMAWDAACNQDDSAVILVPYGFEFMIQSTIFTGPCQGGLVF  191

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++GT+MPPDGP+SWP+  ++RQWLVFYR+N MS+ GGG+IDGRGEKWW+LPCKPH+G+N
Sbjct  192   QVDGTLMPPDGPESWPQKNSRRQWLVFYRINEMSLLGGGVIDGRGEKWWDLPCKPHKGIN  251

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             GTT+PGPCDSP+AIRFF SSNLTVQ LKIKNSP F+FRFDNC +VH++S++I AP  SPN
Sbjct  252   GTTMPGPCDSPIAIRFFMSSNLTVQGLKIKNSPQFNFRFDNCKNVHVESIHITAPALSPN  311

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT  V I+NS++SNGDDC+SIG+GCY+VDIRN+TCGP HGISIGSLG   SRA
Sbjct  312   TDGIHIENTNGVEIYNSVISNGDDCVSIGSGCYDVDIRNITCGPSHGISIGSLGNHNSRA  371

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V DS IR SDNGVRIKTWQGG GAVS +TF NI MDNVRNPII+DQ+YC +K C
Sbjct  372   CVSNITVRDSVIRVSDNGVRIKTWQGGSGAVSGITFSNIHMDNVRNPIIIDQFYCLSKGC  431

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
             TNQTSA+ +SD+ Y NIKGT++ RSPPM  ACSDSVPCTNLTLS+VEL P++G  +LDP+
Sbjct  432   TNQTSALSVSDILYENIKGTYNIRSPPMHFACSDSVPCTNLTLSDVELLPAEGDLVLDPY  491

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYG+ +T+TIPPV CL+EG P+S  N ++D C
Sbjct  492   CWNAYGNFRTLTIPPVSCLMEGIPRSNLNNEMDYC  526



>ref|XP_008461394.1| PREDICTED: polygalacturonase At1g48100-like [Cucumis melo]
Length=467

 Score =   597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/388 (71%), Positives = 331/388 (85%), Gaps = 1/388 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQS-DLTPILLAPKHHSFLIQSTIFTGPCKNPLL  1188
             +V ++G IGDG+ DDT AFK AWD ACQS D + ++L P   SF+IQSTIFTGPC   L+
Sbjct  71    DVRAFGAIGDGIVDDTEAFKMAWDTACQSEDDSAVMLVPYGFSFMIQSTIFTGPCHGYLM  130

Query  1187  FQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGV  1008
              +++GT+MPPDGPD+WPKN ++RQWLVFYR++GMS++GGG+IDGRG+KWW+LPCKPH+G 
Sbjct  131   LRVDGTLMPPDGPDAWPKNSSRRQWLVFYRIDGMSLEGGGVIDGRGQKWWDLPCKPHKGP  190

Query  1007  NGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSP  828
             NGTTLPGPCDSP+AIRFF SSNLTV  LKI NSP FHFRFD C  VHIDS++IK+P  SP
Sbjct  191   NGTTLPGPCDSPIAIRFFMSSNLTVHGLKITNSPQFHFRFDGCKTVHIDSIHIKSPGLSP  250

Query  827   NTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSR  648
             NTDGIHIENT  V I+NS+++NGDDC+SIG+G Y++DIRN+TCGP HGISIGSLG++ SR
Sbjct  251   NTDGIHIENTNGVEIYNSVINNGDDCVSIGSGSYDLDIRNITCGPSHGISIGSLGVRNSR  310

Query  647   ACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKA  468
             ACV+NI V DS I++SDNGVRIKTWQGG+GAV  +TF NI MDNVRNPII+DQ+YC  K 
Sbjct  311   ACVTNITVRDSVIKDSDNGVRIKTWQGGYGAVRGITFSNIHMDNVRNPIIIDQFYCLTKD  370

Query  467   CTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDP  288
             CTNQTSAV +SD+ Y+NIKGT+D RSPPM  ACSDSVPCTNLTLSE+EL P+QG  +LDP
Sbjct  371   CTNQTSAVSVSDIQYTNIKGTYDIRSPPMHFACSDSVPCTNLTLSEIELLPAQGDIVLDP  430

Query  287   FCWNAYGDLKTVTIPPVFCLLEGNPQSL  204
             FCWNAYGDL+T+TIPPV CL EG P S+
Sbjct  431   FCWNAYGDLQTLTIPPVSCLQEGLPSSI  458



>ref|XP_007163216.1| hypothetical protein PHAVU_001G215900g [Phaseolus vulgaris]
 gb|ESW35210.1| hypothetical protein PHAVU_001G215900g [Phaseolus vulgaris]
Length=460

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/396 (70%), Positives = 337/396 (85%), Gaps = 1/396 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSD-LTPILLAPKHHSFLIQSTIFTGPCKNPLL  1188
             +V ++G IGDG  DDT +FK AWD ACQS+     +L P+  SFLIQSTIFTGPC++ ++
Sbjct  65    DVRTFGAIGDGKTDDTESFKMAWDTACQSESAVNAILVPQGFSFLIQSTIFTGPCQSLMV  124

Query  1187  FQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGV  1008
              +++GT+MPPDGP+SWPKN ++ QWLVFYR+NGMSM+G GLIDGRGEKWW+LPCKPH+G 
Sbjct  125   LKVDGTLMPPDGPESWPKNNSRHQWLVFYRINGMSMEGSGLIDGRGEKWWDLPCKPHKGP  184

Query  1007  NGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSP  828
             NGTTLPGPCDSP+AIRFF SSNLTVQ L++KNSP FHFRFD C +VHI+S+YI AP  SP
Sbjct  185   NGTTLPGPCDSPIAIRFFMSSNLTVQGLRVKNSPQFHFRFDGCKNVHIESIYITAPKLSP  244

Query  827   NTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSR  648
             NTDGIHIENT DV I+NS++SNGDDC+SIG+GC +VDI+N+TCGPGHGISIGSLG   SR
Sbjct  245   NTDGIHIENTNDVKIYNSVISNGDDCVSIGSGCNDVDIKNITCGPGHGISIGSLGNHNSR  304

Query  647   ACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKA  468
             ACVSNI V DS I+ ++NGVRIKTWQGG G+VS VTF+NI M +VRNPII+DQ+YC  K 
Sbjct  305   ACVSNIMVRDSLIKVTENGVRIKTWQGGSGSVSGVTFNNIHMVSVRNPIIIDQFYCLTKD  364

Query  467   CTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDP  288
             CTN+TSAV +S++ Y+NIKGT+D RSPPMR +CSDSVPCTNLTLSE+EL P+QG  + DP
Sbjct  365   CTNKTSAVSVSNIVYTNIKGTYDIRSPPMRFSCSDSVPCTNLTLSEIELLPAQGDIVHDP  424

Query  287   FCWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             FCWNAYGDL+T+TIPPV CLLEG PQS+ + D+ +C
Sbjct  425   FCWNAYGDLETLTIPPVSCLLEGTPQSVLDFDITRC  460



>ref|XP_004495880.1| PREDICTED: polygalacturonase At1g48100-like [Cicer arietinum]
Length=479

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/396 (69%), Positives = 334/396 (84%), Gaps = 1/396 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLT-PILLAPKHHSFLIQSTIFTGPCKNPLL  1188
             +V ++G IGDG+ DDT + K AWD ACQS+L   ++  P   SF++QSTIFTGPCK  L+
Sbjct  84    DVRTFGAIGDGITDDTESIKMAWDTACQSELALNVIFVPHGFSFIVQSTIFTGPCKGGLV  143

Query  1187  FQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGV  1008
              +++GT+M PDGP+SWPKN ++RQWLVFYRVNGMS++G G IDGRG+KWW+LPCKPH+G 
Sbjct  144   LKVDGTLMTPDGPESWPKNNSRRQWLVFYRVNGMSLEGSGSIDGRGQKWWDLPCKPHKGP  203

Query  1007  NGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSP  828
             NGTTLPGPCDSP+AIRFF SSNL+VQ L+IKNSP FHFRFD C  VH++S++I AP  SP
Sbjct  204   NGTTLPGPCDSPIAIRFFMSSNLSVQGLRIKNSPQFHFRFDGCQSVHVESIFITAPALSP  263

Query  827   NTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSR  648
             NTDGIHIENT DV I+NSI+SNGDDC+SIG+GCY+VDI+N+TCGPGHGISIGSLG   SR
Sbjct  264   NTDGIHIENTNDVKIYNSIISNGDDCVSIGSGCYDVDIKNITCGPGHGISIGSLGNHNSR  323

Query  647   ACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKA  468
             ACVSNI V DS I+ SDNGVRIKTWQGG G+VS VTF NI MDNV+NPII+DQ+YC +K 
Sbjct  324   ACVSNITVRDSVIKVSDNGVRIKTWQGGSGSVSGVTFSNIHMDNVKNPIIIDQFYCLSKE  383

Query  467   CTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDP  288
             C+N+TSAV++SD+ Y+NIKGT+D R PPM  ACSDSVPCTNLTLS++EL PSQG  + DP
Sbjct  384   CSNKTSAVFVSDIVYTNIKGTYDIRHPPMHFACSDSVPCTNLTLSDIELLPSQGDIVNDP  443

Query  287   FCWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             FCWNAYG+ + +TIPPVFCLL+G PQS+ + D+D C
Sbjct  444   FCWNAYGNSEALTIPPVFCLLDGIPQSISDNDIDHC  479



>ref|XP_003553676.1| PREDICTED: polygalacturonase At1g48100-like isoform X1 [Glycine 
max]
 gb|KHN43426.1| Polygalacturonase [Glycine soja]
Length=462

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/396 (70%), Positives = 335/396 (85%), Gaps = 1/396 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSD-LTPILLAPKHHSFLIQSTIFTGPCKNPLL  1188
             +V  +G IGDG  DDT +FK AWD ACQS+    ++L P+  SFLIQSTIFTGPC+  L+
Sbjct  67    DVRKFGAIGDGETDDTGSFKMAWDSACQSESAVNVILVPQGFSFLIQSTIFTGPCQGVLV  126

Query  1187  FQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGV  1008
              +++GT+MPPDGP+SWPKN ++ QWLVFYR+NGMS++G GLIDGRGEKWW+LPCKPH+G 
Sbjct  127   LKVDGTLMPPDGPESWPKNNSRHQWLVFYRINGMSLEGSGLIDGRGEKWWDLPCKPHKGP  186

Query  1007  NGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSP  828
             +GTTLPGPCDSP+AIRFF SSNLTVQ L+IKNSP FHFRFD C +VHI+S+YI AP  SP
Sbjct  187   HGTTLPGPCDSPIAIRFFMSSNLTVQGLRIKNSPQFHFRFDGCKNVHIESIYITAPKLSP  246

Query  827   NTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSR  648
             NTDGIHIENT D+ I+NS++SNGDDC+SIG+GC +VDI+N+TCGPGHGISIGSLG   SR
Sbjct  247   NTDGIHIENTNDMKIYNSVISNGDDCVSIGSGCNDVDIKNITCGPGHGISIGSLGNHNSR  306

Query  647   ACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKA  468
             ACVSNI V DS I+ +DNGVRIKTWQGG G+VS VTF NI M +VRNPII+DQ+YC  K 
Sbjct  307   ACVSNIMVRDSFIKVTDNGVRIKTWQGGSGSVSGVTFSNIHMVSVRNPIIIDQFYCLTKE  366

Query  467   CTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDP  288
             CTN+TSAV +S++ Y+NIKGT+D RSPPMR ACSDSVPCTNLTLS++EL PSQG  + DP
Sbjct  367   CTNKTSAVSVSNIIYTNIKGTYDIRSPPMRFACSDSVPCTNLTLSDIELLPSQGDIVHDP  426

Query  287   FCWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             FCWNAYGDL+T+TIPPV CLLEG PQS+ + D+ +C
Sbjct  427   FCWNAYGDLETLTIPPVSCLLEGTPQSVLDYDITRC  462



>ref|XP_004135975.1| PREDICTED: polygalacturonase At1g48100-like [Cucumis sativus]
 ref|XP_004158164.1| PREDICTED: polygalacturonase At1g48100-like [Cucumis sativus]
 gb|KGN45046.1| hypothetical protein Csa_7G414430 [Cucumis sativus]
Length=467

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/388 (71%), Positives = 330/388 (85%), Gaps = 1/388 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQS-DLTPILLAPKHHSFLIQSTIFTGPCKNPLL  1188
             +V ++G IGDG+ DDT AFK AWD ACQS D + ++L P   SF+IQSTIFTGPC   L+
Sbjct  71    DVRAFGAIGDGIVDDTEAFKMAWDTACQSEDDSVVMLVPYGFSFMIQSTIFTGPCHGYLM  130

Query  1187  FQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGV  1008
              +++GT+M PDGPD+WPKN ++RQWLVFYR++GMS++GGG+IDGRG+KWW+LPCKPH+G 
Sbjct  131   LRVDGTLMTPDGPDAWPKNASRRQWLVFYRIDGMSLEGGGVIDGRGQKWWDLPCKPHKGP  190

Query  1007  NGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSP  828
             NGTTLPGPCDSP+AIRFF SSNLTV  LKI NSP FHFRFD C  VHIDS++IK+P  SP
Sbjct  191   NGTTLPGPCDSPIAIRFFMSSNLTVHGLKITNSPQFHFRFDGCKTVHIDSIHIKSPGLSP  250

Query  827   NTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSR  648
             NTDGIHIENT  V I+NS+++NGDDC+SIG+G Y++DIRN+TCGP HGISIGSLG++ SR
Sbjct  251   NTDGIHIENTNGVQIYNSVINNGDDCVSIGSGSYDLDIRNITCGPSHGISIGSLGVRNSR  310

Query  647   ACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKA  468
             ACV+NI V DS I++SDNGVRIKTWQGG+GAV  +TF NI MDNVRNPII+DQ+YC  K 
Sbjct  311   ACVTNITVRDSVIKDSDNGVRIKTWQGGYGAVRGITFSNIHMDNVRNPIIIDQFYCLTKD  370

Query  467   CTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDP  288
             CTNQTSAV +SD+ Y+NIKGT+D RSPPM  ACSDSVPCTNLTLSE+EL P+QG  +LDP
Sbjct  371   CTNQTSAVSVSDIQYTNIKGTYDIRSPPMHFACSDSVPCTNLTLSEIELLPAQGDIVLDP  430

Query  287   FCWNAYGDLKTVTIPPVFCLLEGNPQSL  204
             FCWNAYGDL+T+TIPPV CL EG P S+
Sbjct  431   FCWNAYGDLQTLTIPPVSCLQEGLPSSV  458



>ref|XP_007145117.1| hypothetical protein PHAVU_007G211400g [Phaseolus vulgaris]
 gb|ESW17111.1| hypothetical protein PHAVU_007G211400g [Phaseolus vulgaris]
Length=474

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/396 (69%), Positives = 335/396 (85%), Gaps = 1/396 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSD-LTPILLAPKHHSFLIQSTIFTGPCKNPLL  1188
             ++ ++G IGDGV DDT +FK AWD ACQS+    ++L P   SF+IQSTIFTGPCK  L+
Sbjct  79    DIRAFGAIGDGVTDDTESFKMAWDTACQSESAVKVILVPHGLSFIIQSTIFTGPCKGGLV  138

Query  1187  FQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGV  1008
              +++GT+MPPDGPDSWPKN ++RQWLVFYR+NGMS++G GLIDGRGEKWW+LPCKPH+G 
Sbjct  139   LKVDGTLMPPDGPDSWPKNNSRRQWLVFYRINGMSLEGSGLIDGRGEKWWDLPCKPHKGP  198

Query  1007  NGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSP  828
             +GTT PGPCDSPVA+RFF SSNLTVQ LKIKNSP FHFRFD C  VH++S+YI +P  SP
Sbjct  199   HGTTSPGPCDSPVALRFFMSSNLTVQGLKIKNSPQFHFRFDGCESVHVESIYITSPALSP  258

Query  827   NTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSR  648
             NTDGIHIENT DV I+NS++SNGDDC+SIGAGC++VDI+N+TCGPGHGISIGSLG   SR
Sbjct  259   NTDGIHIENTNDVKIYNSVISNGDDCVSIGAGCHDVDIKNITCGPGHGISIGSLGNHNSR  318

Query  647   ACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKA  468
             ACVSNI V DS I+ SDNGVRIKTWQGG G+VS VTF NI M++VRNPII+DQ+YC +K 
Sbjct  319   ACVSNITVRDSVIKVSDNGVRIKTWQGGSGSVSGVTFTNIHMESVRNPIIIDQFYCLSKD  378

Query  467   CTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDP  288
             C+N+TSAV++S++SY+NIKGT+D R PPM  ACSDSVPCTNLTLS++EL PS+G  + DP
Sbjct  379   CSNKTSAVFVSNISYTNIKGTYDIRHPPMHFACSDSVPCTNLTLSDIELLPSEGDIVHDP  438

Query  287   FCWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             +CW+AYG  +T+TIPPV CLLEG PQS+   D+D C
Sbjct  439   YCWSAYGISQTLTIPPVSCLLEGLPQSISGNDIDHC  474



>ref|XP_010322288.1| PREDICTED: polygalacturonase At1g48100 isoform X1 [Solanum lycopersicum]
Length=472

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/397 (70%), Positives = 336/397 (85%), Gaps = 3/397 (1%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V S+G +GDGV DDT  FK AWD ACQ   + ++  P  +SF+IQSTIFTGPC++ L+F
Sbjct  74    DVRSFGAVGDGVTDDTEGFKAAWDAACQVQ-SAVIHVPLGYSFMIQSTIFTGPCQSGLVF  132

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q+EGTIMPPDGP+SWP   +KRQWLVFYRVN +S+QGGG+IDGRGE+WWNLPCKPH+G  
Sbjct  133   QLEGTIMPPDGPESWPSKTSKRQWLVFYRVNELSLQGGGVIDGRGEEWWNLPCKPHKGPK  192

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G+TLPGPCDSP+AIRFF SSNLTVQ +K+KNSP F+FRFDNC +VHI+SL+I AP  SPN
Sbjct  193   GSTLPGPCDSPIAIRFFMSSNLTVQGIKMKNSPQFNFRFDNCKNVHIESLHITAPIWSPN  252

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGP-GHGISIGSLGIKQSR  648
             TDGIHIE T +V I++S++SNGDDC+SIGAGCY+VDIRN+TCGP GHGISIGSLG   SR
Sbjct  253   TDGIHIEQTSNVEIYDSLISNGDDCVSIGAGCYDVDIRNLTCGPGGHGISIGSLGNHNSR  312

Query  647   ACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKA  468
             ACVSNI V DS I+ SDNGVRIKTWQGGFGAVS V+F NI MDNVRNPII+DQ+YC +K 
Sbjct  313   ACVSNITVRDSVIKQSDNGVRIKTWQGGFGAVSGVSFLNIHMDNVRNPIIIDQFYCLSKD  372

Query  467   CTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDP  288
             C+N+TSAV +SD+ YS+IKGT+D RSPPMR ACSD++PCTN+TLS++EL P++G  +LDP
Sbjct  373   CSNRTSAVSVSDIEYSSIKGTYDIRSPPMRFACSDTIPCTNITLSDIELLPAKGELVLDP  432

Query  287   FCWNAYGDLKTVTIPPVFCLLEGN-PQSLPNVDVDQC  180
             FCWNAYG  +T+TIPP+FCLLEGN P+   N D+  C
Sbjct  433   FCWNAYGGQETLTIPPIFCLLEGNPPKVFENNDLGYC  469



>ref|XP_003591344.1| Polygalacturonase [Medicago truncatula]
Length=478

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/397 (70%), Positives = 333/397 (84%), Gaps = 2/397 (1%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDL-TPILLAPKHHSFLIQSTIFTGPCKNPLL  1188
             +V  +G IGDG+ DDT +FK AWD ACQS+L   ++  P   SF++QSTIFTGPCK  L+
Sbjct  82    DVRKFGAIGDGITDDTESFKMAWDTACQSELDLNVIFVPPGFSFIVQSTIFTGPCKGGLV  141

Query  1187  FQ-IEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRG  1011
              + ++GTIM PDGP+SW KN ++RQWLVFYRVNGMS++G G IDGRG+KWW+LPCKPH+G
Sbjct  142   LKKVDGTIMTPDGPESWLKNNSRRQWLVFYRVNGMSLEGSGTIDGRGQKWWDLPCKPHKG  201

Query  1010  VNGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNS  831
              NGTTLPGPCDSPVAIRFF SSNLTVQ L+IKNSP FHFRFD C  VH++S++I AP  S
Sbjct  202   PNGTTLPGPCDSPVAIRFFMSSNLTVQGLRIKNSPQFHFRFDGCQSVHVESIFITAPALS  261

Query  830   PNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQS  651
             PNTDGIHIENT DV I+NS+VSNGDDC+SIG+GCY+VDI+N+TCGPGHGISIGSLG   S
Sbjct  262   PNTDGIHIENTNDVKIYNSVVSNGDDCVSIGSGCYDVDIKNITCGPGHGISIGSLGNHNS  321

Query  650   RACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNK  471
             RACVSNI V DS IR SDNGVRIKTWQGG G+VS VTF NI MD V+NPII+DQ+YC +K
Sbjct  322   RACVSNITVRDSVIRVSDNGVRIKTWQGGSGSVSGVTFSNIHMDTVKNPIIIDQFYCLSK  381

Query  470   ACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLD  291
              C+N+TSAV++SD+ Y++IKGT+D R PPM  ACSDS+PCTNLTLS++EL PSQG  + D
Sbjct  382   DCSNKTSAVFVSDIVYTSIKGTYDIRHPPMHFACSDSIPCTNLTLSDIELLPSQGDMLND  441

Query  290   PFCWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             PFCWNAYG+ +T+TIPPVFCLL+G PQS+P  D+D C
Sbjct  442   PFCWNAYGNSETLTIPPVFCLLDGIPQSIPANDIDHC  478



>ref|XP_004289429.1| PREDICTED: polygalacturonase At1g48100-like [Fragaria vesca subsp. 
vesca]
Length=471

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/395 (70%), Positives = 328/395 (83%), Gaps = 0/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V  YG +GDG  DDT AFK AWD ACQS+    +L P H +F+IQSTIFTGPC + L+ 
Sbjct  77    DVRLYGAVGDGQTDDTQAFKMAWDTACQSESPAKILVPNHFTFMIQSTIFTGPCLSGLVL  136

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++G I+PPDGP+SWPKN ++RQWLVFYR+N MS+QG G+IDGRG+KWW LPCKPH G+N
Sbjct  137   QVDGVIVPPDGPESWPKNNSRRQWLVFYRINKMSLQGSGVIDGRGDKWWQLPCKPHMGIN  196

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             GTTLPGPCDSPVAIRFF SSNLTVQ L+IKNSP FHFRFD C +V++DS+ I AP  SPN
Sbjct  197   GTTLPGPCDSPVAIRFFMSSNLTVQGLRIKNSPQFHFRFDGCINVNVDSISISAPARSPN  256

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT DV I+NS++SNGDDC+SIG+GCY+VDIRN+TCGPGHGISIGSLG   SRA
Sbjct  257   TDGIHIENTNDVKIYNSVISNGDDCVSIGSGCYDVDIRNITCGPGHGISIGSLGNHNSRA  316

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CV NI V DS IR SDNGVRIKTWQGG GAVS VTF NI MDNVRNPI++DQ+YC  K C
Sbjct  317   CVKNITVRDSIIRVSDNGVRIKTWQGGSGAVSGVTFSNIHMDNVRNPIMIDQFYCLTKQC  376

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
             +NQT+AVY+S++ YS IKGT+D R+ PM   CSDS+PCTNLTLS+VEL P+ G  M DP+
Sbjct  377   SNQTAAVYVSNILYSGIKGTYDVRNAPMHFGCSDSMPCTNLTLSDVELLPAVGDMMSDPY  436

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYG L+T+TIPPV CLLEG P++L + ++D+C
Sbjct  437   CWNAYGQLQTLTIPPVSCLLEGAPRTLLSDEIDRC  471



>ref|XP_006492459.1| PREDICTED: polygalacturonase At1g48100-like [Citrus sinensis]
Length=584

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/395 (70%), Positives = 333/395 (84%), Gaps = 1/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V  +G +GDG++DDT AFK  WD ACQ D   ++  P   SF+IQSTIFTGPC+  ++F
Sbjct  191   DVRKFGAVGDGISDDTEAFKMTWDSACQKDFA-VIHVPYGFSFMIQSTIFTGPCQGSIVF  249

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++GTIMPPDGP+SW +  +KRQWLVFY++N +S+QGGG IDGRG+KWW+LPCKPH+G+N
Sbjct  250   QVDGTIMPPDGPESWLQKNSKRQWLVFYKINELSLQGGGTIDGRGQKWWDLPCKPHKGIN  309

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             GTT PGPCDSP+A+RFF SSNLTVQ L+IK+SP FHFRFDNC +VHI+S++I AP  SPN
Sbjct  310   GTTSPGPCDSPIALRFFMSSNLTVQRLRIKDSPQFHFRFDNCKNVHIESIHITAPALSPN  369

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT  V I+NS++SNGDDC+SIG+GCY+VDIRN+TCGPGHGISIGSLG   SRA
Sbjct  370   TDGIHIENTNGVEIYNSVISNGDDCVSIGSGCYDVDIRNITCGPGHGISIGSLGNHNSRA  429

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V DS I+ S+NGVRIKTWQGG GAVS +TF NI M+NVRNPII+DQYYC  K C
Sbjct  430   CVSNITVRDSVIKVSNNGVRIKTWQGGSGAVSGITFSNIHMNNVRNPIIIDQYYCLTKDC  489

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
             TN+TSAVY+SD+ YSNIKGT+D RSPPM  ACSD+VPCTNLTLSEVEL P++G  + DPF
Sbjct  490   TNKTSAVYVSDILYSNIKGTYDIRSPPMHFACSDTVPCTNLTLSEVELLPAKGDLVSDPF  549

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYGDL T+TIPPV CLLEG P+SL + ++D C
Sbjct  550   CWNAYGDLPTLTIPPVSCLLEGIPRSLLDNEIDHC  584



>gb|KDP23351.1| hypothetical protein JCGZ_23184 [Jatropha curcas]
Length=470

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/396 (70%), Positives = 329/396 (83%), Gaps = 3/396 (1%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             NV+S+G +G+G +DDT AFK AWD AC      +LLAP  +SFLI  TIF GPCK  L+F
Sbjct  77    NVVSFGAVGNGESDDTQAFKMAWDAACSQTAFSVLLAPAGYSFLIFPTIFAGPCKGGLVF  136

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPH-RGV  1008
             QI+GTI+PPDGP+SWPKN +KR WL+FY++N M MQGGG+IDG+GEKWW LPCKPH +G 
Sbjct  137   QIDGTIIPPDGPESWPKNASKRNWLIFYKINEMLMQGGGVIDGKGEKWWKLPCKPHNKGS  196

Query  1007  NGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSP  828
             N    PGPCDSPVAIRFF SSNLTVQ LK+KNSP FHFRFDNC ++H++ L IKAP  SP
Sbjct  197   NAH--PGPCDSPVAIRFFMSSNLTVQGLKMKNSPQFHFRFDNCQNIHVEMLNIKAPALSP  254

Query  827   NTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSR  648
             NTDGIHIENT +V I+NS+VSNGDDCISIGAGC+NVDI+N+TCGP HGISIGSLGI+ SR
Sbjct  255   NTDGIHIENTNNVHIYNSVVSNGDDCISIGAGCHNVDIKNITCGPSHGISIGSLGIRNSR  314

Query  647   ACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKA  468
             ACVSNI VTDS I++SDNGVRIKTWQGG+G+VSKVTF+NI MD VRNPII+DQYYC  K 
Sbjct  315   ACVSNITVTDSVIKHSDNGVRIKTWQGGYGSVSKVTFNNIHMDTVRNPIIIDQYYCQTKN  374

Query  467   CTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDP  288
             CTNQTSAVYISD+ YSNIKGT+D RSP   LACSDSVPC++L LS++EL P++G  M +P
Sbjct  375   CTNQTSAVYISDILYSNIKGTYDVRSPAFHLACSDSVPCSDLILSDIELLPAKGEFMANP  434

Query  287   FCWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             FCWNA+G ++T+TIPPV CL EG PQ L    +DQC
Sbjct  435   FCWNAFGAVQTLTIPPVSCLQEGIPQFLTQDIIDQC  470



>gb|KDO86869.1| hypothetical protein CISIN_1g040748mg [Citrus sinensis]
Length=584

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/395 (70%), Positives = 332/395 (84%), Gaps = 1/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V  +G +GDG++DDT AFK  WD ACQ D   ++  P   SF+IQSTIFTGPC+  ++F
Sbjct  191   DVRKFGAVGDGISDDTEAFKMTWDSACQKDFA-VIHVPYGFSFMIQSTIFTGPCQGSIVF  249

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++GTIMPPDGP+SW +  +KRQWLVFY++N +S+QGGG IDGRG KWW+LPCKPH+G+N
Sbjct  250   QVDGTIMPPDGPESWLQKNSKRQWLVFYKINELSLQGGGTIDGRGHKWWDLPCKPHKGIN  309

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             GTT PGPCDSP+A+RFF SSNLTVQ L+IK+SP FHFRFDNC +VHI+S++I AP  SPN
Sbjct  310   GTTSPGPCDSPIALRFFMSSNLTVQRLRIKDSPQFHFRFDNCKNVHIESIHITAPALSPN  369

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT  V I+NS++SNGDDC+SIG+GCY+VDIRN+TCGPGHGISIGSLG   SRA
Sbjct  370   TDGIHIENTNGVEIYNSVISNGDDCVSIGSGCYDVDIRNITCGPGHGISIGSLGNHNSRA  429

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V DS I+ S+NGVRIKTWQGG GAVS +TF NI M+NVRNPII+DQYYC  K C
Sbjct  430   CVSNITVRDSVIKVSNNGVRIKTWQGGSGAVSGITFSNIHMNNVRNPIIIDQYYCLTKDC  489

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
             TN+TSAVY+SD+ YSNIKGT+D RSPPM  ACSD+VPCTNLTLSEVEL P++G  + DPF
Sbjct  490   TNKTSAVYVSDILYSNIKGTYDIRSPPMHFACSDTVPCTNLTLSEVELLPAKGDLVSDPF  549

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYGDL T+TIPPV CLLEG P+SL + ++D C
Sbjct  550   CWNAYGDLPTLTIPPVSCLLEGIPRSLLDNEIDHC  584



>ref|XP_006444572.1| hypothetical protein CICLE_v10024556mg [Citrus clementina]
 gb|ESR57812.1| hypothetical protein CICLE_v10024556mg [Citrus clementina]
Length=603

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/395 (70%), Positives = 332/395 (84%), Gaps = 1/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V  +G +GDG++DDT AFK  WD ACQ D   ++  P   SF+IQSTIFTGPC+  ++F
Sbjct  210   DVRKFGAVGDGISDDTEAFKMTWDSACQKDFA-VIHVPYGFSFMIQSTIFTGPCQGSIVF  268

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++GTIMPPDGP+SW +  +KRQWLVFY++N +S+QGGG IDGRG KWW+LPCKPH+G+N
Sbjct  269   QVDGTIMPPDGPESWLQKNSKRQWLVFYKINELSLQGGGTIDGRGHKWWDLPCKPHKGIN  328

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             GTT PGPCDSP+A+RFF SSNLTVQ L+IK+SP FHFRFDNC +VHI+S++I AP  SPN
Sbjct  329   GTTSPGPCDSPIALRFFMSSNLTVQRLRIKDSPQFHFRFDNCKNVHIESIHITAPALSPN  388

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT  V I+NS++SNGDDC+SIG+GCY+VDIRN+TCGPGHGISIGSLG   SRA
Sbjct  389   TDGIHIENTNGVEIYNSVISNGDDCVSIGSGCYDVDIRNITCGPGHGISIGSLGNHNSRA  448

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V DS I+ S+NGVRIKTWQGG GAVS +TF NI M+NVRNPII+DQYYC  K C
Sbjct  449   CVSNITVRDSVIKVSNNGVRIKTWQGGSGAVSGITFSNIHMNNVRNPIIIDQYYCLTKDC  508

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
             TN+TSAVY+SD+ YSNIKGT+D RSPPM  ACSD+VPCTNLTLSEVEL P++G  + DPF
Sbjct  509   TNKTSAVYVSDILYSNIKGTYDIRSPPMHFACSDTVPCTNLTLSEVELLPAKGDLVSDPF  568

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYGDL T+TIPPV CLLEG P+SL + ++D C
Sbjct  569   CWNAYGDLPTLTIPPVSCLLEGIPRSLLDNEIDHC  603



>ref|XP_006349249.1| PREDICTED: polygalacturonase At1g48100-like [Solanum tuberosum]
Length=472

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/397 (70%), Positives = 337/397 (85%), Gaps = 3/397 (1%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V S+G +GDGV DDT  FK AWD ACQ D + ++  P  +SF+IQSTIFTGPC++ L+F
Sbjct  74    DVRSFGAVGDGVTDDTEGFKAAWDAACQVD-SAVIHVPVGYSFMIQSTIFTGPCQSGLVF  132

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q+EGTIMPPDGP+SW  N +KRQWLVFYRVN +S+QGGG+IDGRG++WWNLPCKPH+G N
Sbjct  133   QLEGTIMPPDGPESWGSNKSKRQWLVFYRVNELSLQGGGVIDGRGQEWWNLPCKPHKGPN  192

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G+TLPGPCDSP+AIRFF SSNLTVQ +K+KNSP F+FRFDNC +VHI+SL+I AP  SPN
Sbjct  193   GSTLPGPCDSPIAIRFFMSSNLTVQGIKMKNSPQFNFRFDNCKNVHIESLHITAPIWSPN  252

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGP-GHGISIGSLGIKQSR  648
             TDGIHIE T +V I++S++SNGDDC+SIGAGCY+VDIRN+TCGP GHGISIGSLG   SR
Sbjct  253   TDGIHIEQTSNVEIYDSLISNGDDCVSIGAGCYDVDIRNLTCGPGGHGISIGSLGNHNSR  312

Query  647   ACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKA  468
             ACVSNI V DS I+ SDNGVRIKTWQGGFGAVS V+F NI MDNVRNPII+DQ+YC +K 
Sbjct  313   ACVSNITVRDSVIKQSDNGVRIKTWQGGFGAVSGVSFLNIHMDNVRNPIIIDQFYCLSKD  372

Query  467   CTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDP  288
             C+N+TSAV +SD+ YS+IKGT+D RSPPM  ACSD++PCTN+TLS++EL P++G  +LDP
Sbjct  373   CSNRTSAVSVSDIEYSSIKGTYDIRSPPMHFACSDTIPCTNITLSDIELLPAKGELVLDP  432

Query  287   FCWNAYGDLKTVTIPPVFCLLEGNPQSL-PNVDVDQC  180
             FCWN YG  +T+TIPP+FCLLEGNP S+  N D+  C
Sbjct  433   FCWNVYGGQETLTIPPIFCLLEGNPPSVFENNDLGYC  469



>gb|KHN14155.1| Polygalacturonase [Glycine soja]
Length=462

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/396 (69%), Positives = 333/396 (84%), Gaps = 1/396 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSD-LTPILLAPKHHSFLIQSTIFTGPCKNPLL  1188
             ++  +G IGDG  DDT +FK AWD ACQS+    ++L P+  SFL+QSTIFTGPC+  L 
Sbjct  67    DLRKFGAIGDGETDDTESFKMAWDSACQSESAVNVILVPQGFSFLVQSTIFTGPCQGVLE  126

Query  1187  FQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGV  1008
              +++GT+MPPDGP+SWPKN ++ QWLVFYR+NGMS++G GLIDGRGEKWW+LPCKPH+G 
Sbjct  127   LKVDGTLMPPDGPESWPKNNSRHQWLVFYRINGMSLEGSGLIDGRGEKWWDLPCKPHKGP  186

Query  1007  NGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSP  828
             +GTTLPGPCDSP+AIRFF SSNLTVQ L+IKNSP FHFRFD C +VHI+S+YI AP  SP
Sbjct  187   HGTTLPGPCDSPIAIRFFMSSNLTVQGLRIKNSPQFHFRFDGCKNVHIESIYITAPKLSP  246

Query  827   NTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSR  648
             NTDGIHIENT DV I+NS++SNGDDC+SIG+GC +VDI+N+TCGPGHGISIGSLG   SR
Sbjct  247   NTDGIHIENTNDVKIYNSVISNGDDCVSIGSGCNDVDIKNITCGPGHGISIGSLGNHNSR  306

Query  647   ACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKA  468
             ACVSNI V DS I+ +DNGVRIKTWQGG G+VS VTF NI M +VRNPII+DQ+YC  K 
Sbjct  307   ACVSNIMVRDSFIKVTDNGVRIKTWQGGSGSVSGVTFSNIHMVSVRNPIIIDQFYCLTKE  366

Query  467   CTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDP  288
             CTN++SAV +S++ Y+NIKGT+D RSPPMR ACSDSVPCTNLTLS++EL PSQG  + DP
Sbjct  367   CTNKSSAVSVSNIIYTNIKGTYDIRSPPMRFACSDSVPCTNLTLSDIELLPSQGDIVHDP  426

Query  287   FCWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             FCWNAYGDL+T+TIPPV CLLEG PQ + + D+ +C
Sbjct  427   FCWNAYGDLETLTIPPVSCLLEGTPQLVLDYDITRC  462



>ref|XP_007051225.1| Pectin lyase-like superfamily protein [Theobroma cacao]
 gb|EOX95382.1| Pectin lyase-like superfamily protein [Theobroma cacao]
Length=470

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/396 (69%), Positives = 332/396 (84%), Gaps = 2/396 (1%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V  +G +GDGV DDT AFK AWD AC+ + + +L  P   SF+IQSTIF GPC+  L+F
Sbjct  76    DVRKFGAVGDGVTDDTEAFKMAWDSACRVN-SAVLHVPYGFSFMIQSTIFLGPCQGGLVF  134

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++GT+MPPDGPD+WP+N +KRQWLVFYR+NGMS+QGGGLIDGRG+KWW+LPCKPH+G N
Sbjct  135   QVDGTLMPPDGPDAWPENTSKRQWLVFYRINGMSLQGGGLIDGRGQKWWDLPCKPHKGKN  194

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
              T LPGPCDSP+A+RFF SSNLTV+ LKIK+SP FHFRFD C +VH++SL+I AP  SPN
Sbjct  195   RTALPGPCDSPIALRFFMSSNLTVKGLKIKDSPKFHFRFDGCQNVHVESLHITAPALSPN  254

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT  V I+NS++SNGDDCISIG+GC++VDI+N+TCGPGHGISIGSLG   SRA
Sbjct  255   TDGIHIENTNGVEIYNSVISNGDDCISIGSGCHDVDIKNLTCGPGHGISIGSLGNHNSRA  314

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSN+ V DS I+ SDNGVRIKTWQGG GAVS +TF NI M+ VRNPII+DQ+YC  K C
Sbjct  315   CVSNVTVRDSVIKVSDNGVRIKTWQGGSGAVSGITFSNIHMEAVRNPIIIDQFYCLTKGC  374

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
             TNQTSAVY+SD+ Y +IKGT+D RSPPM  ACSDSVPCTN+TLS++EL P+QG  +LDPF
Sbjct  375   TNQTSAVYVSDILYESIKGTYDIRSPPMHFACSDSVPCTNITLSDIELLPAQGDIVLDPF  434

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQS-LPNVDVDQC  180
             CWNAYGDL+++TIPPV CL+ G P+S L N D+  C
Sbjct  435   CWNAYGDLESLTIPPVSCLMAGIPRSILDNKDMGYC  470



>ref|XP_003520763.1| PREDICTED: polygalacturonase At1g48100-like isoform X1 [Glycine 
max]
Length=462

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/396 (69%), Positives = 332/396 (84%), Gaps = 1/396 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSD-LTPILLAPKHHSFLIQSTIFTGPCKNPLL  1188
             ++  +G IGDG  DDT +FK AWD ACQS+    ++L P+  SFL+QSTIFTGPC+  L 
Sbjct  67    DLRKFGAIGDGETDDTESFKMAWDSACQSESAVNVILVPQGFSFLVQSTIFTGPCQGVLE  126

Query  1187  FQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGV  1008
              +++GT+MPPDGP+SWPKN ++ QWLVFYR+NGMS++G GLIDGRGEKWW+LPCKPH+G 
Sbjct  127   LKVDGTLMPPDGPESWPKNNSRHQWLVFYRINGMSLEGSGLIDGRGEKWWDLPCKPHKGP  186

Query  1007  NGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSP  828
             +GTTLPGPCDSP+AIRFF SSNLTVQ L+IKNSP FHFRFD C +VHI+S+YI AP  SP
Sbjct  187   HGTTLPGPCDSPIAIRFFMSSNLTVQGLRIKNSPQFHFRFDGCKNVHIESIYITAPKLSP  246

Query  827   NTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSR  648
             NTDGIHIENT DV I+NS++SNGDDC+SIG+GC +VDI+N+TCGPGHGISIGSLG   SR
Sbjct  247   NTDGIHIENTNDVKIYNSVISNGDDCVSIGSGCNDVDIKNITCGPGHGISIGSLGNHNSR  306

Query  647   ACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKA  468
             ACVSNI V DS I+ +DNGVRIKTWQGG G+VS VTF NI M +VRNPII+DQ+YC  K 
Sbjct  307   ACVSNIMVRDSFIKVTDNGVRIKTWQGGSGSVSGVTFSNIHMVSVRNPIIIDQFYCLTKE  366

Query  467   CTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDP  288
             CTN++SAV +S++ Y+NIKGT+D RSPPMR ACSDSVPCTNLTLS++EL PSQG  + DP
Sbjct  367   CTNKSSAVSVSNIIYTNIKGTYDIRSPPMRFACSDSVPCTNLTLSDIELLPSQGDIVHDP  426

Query  287   FCWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             FCWNAYGDL+T+TIPPV CLLE  PQ + + D+ +C
Sbjct  427   FCWNAYGDLETLTIPPVSCLLESTPQLVLDYDITRC  462



>ref|XP_009777456.1| PREDICTED: polygalacturonase At1g48100-like [Nicotiana sylvestris]
Length=469

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/397 (68%), Positives = 339/397 (85%), Gaps = 3/397 (1%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V S+G +GDG+ DDT AFK AWD ACQ + + ++  P  +SF+IQSTIFTGPC++ L+F
Sbjct  73    DVRSFGAVGDGIVDDTEAFKAAWDAACQVE-SAVIFVPSGYSFMIQSTIFTGPCQSGLVF  131

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q+EGTIMPPDGP+SWP N ++RQWLVFYRV+ +S+QGGG+IDGRGE+WWNLPCKPH+G N
Sbjct  132   QLEGTIMPPDGPESWPGNNSRRQWLVFYRVDELSLQGGGVIDGRGEQWWNLPCKPHKGPN  191

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G+TLPGPCDSP+AIRFF SSNLTV+ ++++NSP F+FRFDNC +VHI+SL+I AP  SPN
Sbjct  192   GSTLPGPCDSPIAIRFFMSSNLTVEGIRMENSPQFNFRFDNCKNVHIESLHITAPAWSPN  251

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGP-GHGISIGSLGIKQSR  648
             TDGIHIE T +V I++S++SNGDDC+SIGAGC++VDIRN+TCGP GHGISIGSLG   SR
Sbjct  252   TDGIHIEQTTNVEIYDSLISNGDDCVSIGAGCHDVDIRNLTCGPGGHGISIGSLGNHNSR  311

Query  647   ACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKA  468
             ACVSNI VTDS I+ SDNGVRIKTWQGG+GAVS ++F  I MDNVRNPII+DQ+YC +K 
Sbjct  312   ACVSNITVTDSVIKESDNGVRIKTWQGGYGAVSGISFLKIHMDNVRNPIIIDQFYCLSKE  371

Query  467   CTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDP  288
             C+N+TSAV +SD+ YS+IKGT+D RSPPM  ACSD++PCTN+TLS++EL P+QG  +LDP
Sbjct  372   CSNRTSAVSVSDIEYSSIKGTYDIRSPPMHFACSDTIPCTNITLSDIELLPAQGDLVLDP  431

Query  287   FCWNAYGDLKTVTIPPVFCLLEGNPQSL-PNVDVDQC  180
             FCWN YG  +T+TIPP+FCLLEGNP ++  N D+  C
Sbjct  432   FCWNVYGGQETLTIPPIFCLLEGNPPAVFENNDLGYC  468



>ref|XP_009592547.1| PREDICTED: polygalacturonase At1g48100-like [Nicotiana tomentosiformis]
Length=472

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/397 (68%), Positives = 339/397 (85%), Gaps = 3/397 (1%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V S+G +GDG+ DDT AFK AWD ACQ + + ++  P  +SF+IQSTIFTGPC++ L+F
Sbjct  76    DVRSFGAVGDGIVDDTEAFKAAWDAACQVE-SVVIFVPSGYSFMIQSTIFTGPCQSGLVF  134

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q+EGTIMPPDGP+SWP N ++RQWLVFYRV+ +S+QGGG+IDGRGE+WWNLPCKPH+G N
Sbjct  135   QLEGTIMPPDGPESWPGNNSRRQWLVFYRVDELSLQGGGVIDGRGEQWWNLPCKPHKGPN  194

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G+TLPGPCDSP+AIRFF SSNLTV+ ++++NSP F+FRFDNC +VHI+SL+I AP  SPN
Sbjct  195   GSTLPGPCDSPIAIRFFMSSNLTVEGIRMENSPQFNFRFDNCKNVHIESLHITAPAWSPN  254

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGP-GHGISIGSLGIKQSR  648
             TDGIHIE T +V I++S++SNGDDC+SIGAGC++VDIRN+TCGP GHGISIGSLG   SR
Sbjct  255   TDGIHIEQTTNVEIYDSLISNGDDCVSIGAGCHDVDIRNLTCGPGGHGISIGSLGNHNSR  314

Query  647   ACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKA  468
             ACVS+I V DS I+ SDNGVRIKTWQGGFGAVS ++F NI MDNVRNPII+DQ+YC +K 
Sbjct  315   ACVSSITVRDSVIKESDNGVRIKTWQGGFGAVSGISFLNIHMDNVRNPIIIDQFYCLSKE  374

Query  467   CTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDP  288
             C+N+TSAV +SD+ YS+IKGT+D RSPPM  ACSD++PCTN+TLS++EL P+QG  +LDP
Sbjct  375   CSNRTSAVSVSDIEYSSIKGTYDIRSPPMHFACSDTIPCTNITLSDIELLPAQGDLVLDP  434

Query  287   FCWNAYGDLKTVTIPPVFCLLEGNPQSL-PNVDVDQC  180
             FCWN YG  +T+TIPP+FCLLEGNP ++  N D+  C
Sbjct  435   FCWNVYGGQETLTIPPIFCLLEGNPPAVFENNDLAYC  471



>ref|XP_004304915.1| PREDICTED: polygalacturonase At1g48100-like [Fragaria vesca subsp. 
vesca]
Length=459

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/396 (68%), Positives = 333/396 (84%), Gaps = 2/396 (1%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             NV ++G +G+GV DDT AFK AWD ACQ++ + +L+ PK  S+++QSTIFTGPCK+ L  
Sbjct  65    NVRTFGAVGNGVTDDTEAFKMAWDSACQTENSEVLV-PKSRSYMLQSTIFTGPCKSGLKL  123

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             QI+GT++PPDGPDSWPK ++KRQWLVFYR+NGMSMQG G+IDGRGEKWWNLPCKPH+G +
Sbjct  124   QIDGTLVPPDGPDSWPKKISKRQWLVFYRINGMSMQGDGVIDGRGEKWWNLPCKPHKGPH  183

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             GTTLPGPCDSP AIRFF  SNL ++ L+IKNSP FHF+FDNC +V+++SL IK+P  SPN
Sbjct  184   GTTLPGPCDSPTAIRFFMCSNLKLKGLRIKNSPQFHFKFDNCQNVYVESLTIKSPALSPN  243

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHI+NT ++ I+NS+VSNGDDC+SIG G YN+DIRN+TCGP HGISIGSLG   SRA
Sbjct  244   TDGIHIQNTNNMKIYNSLVSNGDDCVSIGTGSYNIDIRNITCGPSHGISIGSLGDGNSRA  303

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V DS I++SDNGVRIKTWQGG G+VS +TF+NI MD VRNPI++DQYYC  K C
Sbjct  304   CVSNITVKDSIIKHSDNGVRIKTWQGGSGSVSSITFNNIHMDTVRNPIVLDQYYCLTKHC  363

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPS-QGHRMLDP  288
              NQTSAV+IS++ Y+NI+GT+D RSPPM  ACSDS+PCTNLTLSEVEL P+ +GH +  P
Sbjct  364   PNQTSAVHISNILYTNIRGTYDVRSPPMHFACSDSMPCTNLTLSEVELLPATKGHLVPIP  423

Query  287   FCWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
              CW+AYG ++T+T+PPV CLLEG P+ +P  D D+C
Sbjct  424   LCWSAYGTMQTITVPPVLCLLEGIPELMPQNDSDRC  459



>ref|XP_008346737.1| PREDICTED: polygalacturonase At1g48100-like [Malus domestica]
Length=467

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/396 (68%), Positives = 330/396 (83%), Gaps = 1/396 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPI-LLAPKHHSFLIQSTIFTGPCKNPLL  1188
             +V S+G +GDG  DDT+AFK AW  ACQSD +   +L P+  SF+IQSTIFTGPC   L+
Sbjct  72    DVRSFGAVGDGQTDDTVAFKMAWXTACQSDESXARILVPQGFSFMIQSTIFTGPCLGGLV  131

Query  1187  FQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGV  1008
              Q++GT+ PPDGP SWPK++++ QWLVF R+N MS+QGGG+IDGRGEKWWNLPCKPHRG+
Sbjct  132   LQVDGTLXPPDGPGSWPKHISRHQWLVFNRINEMSLQGGGVIDGRGEKWWNLPCKPHRGI  191

Query  1007  NGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSP  828
             NGTTLPGPCDSP+AIRFF SSNLTVQ L IKNSP FHFRFD+C +VHI+S+ I +P  SP
Sbjct  192   NGTTLPGPCDSPIAIRFFMSSNLTVQGLXIKNSPQFHFRFDSCRNVHIESISISSPAKSP  251

Query  827   NTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSR  648
             NTDGIHIE TYDV I+NS++SNGDDC+SIG+GCY+V+IRN+TCGPGHGISIGSLG   SR
Sbjct  252   NTDGIHIEKTYDVQIYNSVISNGDDCVSIGSGCYDVNIRNLTCGPGHGISIGSLGNHNSR  311

Query  647   ACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKA  468
             ACVSNI V DS ++ +DNGVRIKTWQGG G+VS VTF NI MDNV+NPI++DQYYC  K 
Sbjct  312   ACVSNITVRDSIMKGTDNGVRIKTWQGGSGSVSGVTFSNIHMDNVKNPIMIDQYYCPTKR  371

Query  467   CTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDP  288
             CTNQTSAV++SD+ YSNIKGT+D  S PM  ACSD++PCTNLTLSEVEL P+  +++ DP
Sbjct  372   CTNQTSAVFVSDILYSNIKGTYDVXSSPMHFACSDALPCTNLTLSEVELLPAVRYKVSDP  431

Query  287   FCWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             +CWNAYG+L T TIPP  CLL+G P+SL   ++++C
Sbjct  432   YCWNAYGELLTGTIPPXSCLLDGVPRSLLGHEIERC  467



>ref|XP_009366058.1| PREDICTED: polygalacturonase At1g48100-like isoform X2 [Pyrus 
x bretschneideri]
Length=460

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/395 (70%), Positives = 324/395 (82%), Gaps = 16/395 (4%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             NV S+G +GDGVADDT AFK AWD ACQ++ + +L+ PK HSF+IQS IFTGPC + L F
Sbjct  82    NVRSFGAVGDGVADDTQAFKMAWDSACQTEDSEVLV-PKGHSFMIQSMIFTGPCSSGLKF  140

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             QIEGT++PPDGPDSWPK  +KRQWLVFYR+NGMSMQGGG+IDGRGEKWW+LPCKPH+   
Sbjct  141   QIEGTLVPPDGPDSWPKKNSKRQWLVFYRINGMSMQGGGVIDGRGEKWWDLPCKPHK---  197

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
                         AIRFF SSNL VQ LK+KNSP FHFRFDNC +VHI+SL IKAP  SPN
Sbjct  198   ------------AIRFFMSSNLRVQGLKVKNSPQFHFRFDNCQNVHIESLTIKAPALSPN  245

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT +V ++NS++SNGDDC+SIGAGCYNVDIRN+TCGP HGISIGSLG   SRA
Sbjct  246   TDGIHIENTNNVKLYNSLISNGDDCVSIGAGCYNVDIRNITCGPSHGISIGSLGNLHSRA  305

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V DS I++SDNGVRIKTWQGG G+VS++TF NI MD VRNPI++DQYYC  K C
Sbjct  306   CVSNITVRDSIIKHSDNGVRIKTWQGGSGSVSRITFHNIHMDTVRNPILLDQYYCLTKNC  365

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQTSAV ISD+ Y+NIKGT+D RSPPM  ACSDS+PCTNLTLSEVELYP+QG  + +P 
Sbjct  366   PNQTSAVQISDILYTNIKGTYDVRSPPMNFACSDSMPCTNLTLSEVELYPAQGVYVANPI  425

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CW+AYG ++++TIPPVFCLL G PQ LP  D ++C
Sbjct  426   CWSAYGTVQSLTIPPVFCLLGGTPQRLPQNDNERC  460



>ref|XP_010094423.1| Polygalacturonase [Morus notabilis]
 gb|EXB56004.1| Polygalacturonase [Morus notabilis]
Length=750

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/397 (71%), Positives = 328/397 (83%), Gaps = 5/397 (1%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSD-LTPILLAPKHHSFLIQSTIFTGPCKNPLL  1188
             +V  +G  GDGV DDT AFK AWD ACQSD  + ++L PK  SF+IQSTIFTGPCK+ L+
Sbjct  356   DVRKFGAAGDGVTDDTDAFKMAWDTACQSDSASSLILVPKGFSFMIQSTIFTGPCKSSLV  415

Query  1187  FQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGV  1008
             FQ++GT+MPPDGPDSWP N ++RQWLVFYR+N M++QGGGLIDGRG+KWW+LPCKPH+G 
Sbjct  416   FQVDGTVMPPDGPDSWPNNSSRRQWLVFYRINEMALQGGGLIDGRGQKWWDLPCKPHKGK  475

Query  1007  NGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSP  828
             NGT   GPCDSP+AIRFF SSNLTVQ L+IKNSP FHFRFD+C +VHI+S+ I AP  SP
Sbjct  476   NGT---GPCDSPIAIRFFMSSNLTVQGLRIKNSPQFHFRFDSCQNVHIESISITAPALSP  532

Query  827   NTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSR  648
             NTDGIHIENT  V I+NS++SNGDDC+SIG+GC++V+IRN+TCGPGHGISIGSLG   S 
Sbjct  533   NTDGIHIENTIGVEIYNSVISNGDDCVSIGSGCHDVNIRNVTCGPGHGISIGSLGNHNSW  592

Query  647   ACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKA  468
             ACV+NI V DS I+ S+NGVRIKTWQGG GAVS VTF NI MDNVRNPII+DQ+YC  K 
Sbjct  593   ACVTNITVKDSVIKASNNGVRIKTWQGGSGAVSGVTFSNIHMDNVRNPIIIDQFYCLPKN  652

Query  467   CTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDP  288
             C NQTSAV++SD+ Y NIKGT+D RSPPM   CSDSVPC NLTLSEVEL P+ G  +LDP
Sbjct  653   CANQTSAVFVSDILYDNIKGTYDVRSPPMHFGCSDSVPCANLTLSEVELLPATGDIVLDP  712

Query  287   FCWNAYGDLKTVTIPPVFCLLEGNPQS-LPNVDVDQC  180
             FCWNAYG+L+T+TIPPV CLLEG P S L N D   C
Sbjct  713   FCWNAYGELQTLTIPPVSCLLEGVPNSKLDNSDKGYC  749



>ref|XP_008781323.1| PREDICTED: polygalacturonase At1g48100-like [Phoenix dactylifera]
Length=482

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/395 (66%), Positives = 335/395 (85%), Gaps = 1/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V S+G +GDGV+DDT AF+ AW  ACQ+    +LLAP+ +SF I+S IFTGPC++ L+F
Sbjct  88    DVRSFGAVGDGVSDDTEAFESAWVSACQAG-PGVLLAPQGYSFKIRSAIFTGPCQSGLVF  146

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++G ++PPDGP SWP++ ++RQWLVFYR +GM++QGGGLIDG+GEKWWNLPCKPH+G+N
Sbjct  147   QVDGIVVPPDGPHSWPQSNSRRQWLVFYRADGMTLQGGGLIDGKGEKWWNLPCKPHKGIN  206

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G TLPG CDSPVA+RFF SSNLTV+ LKI+NSP FHFRFDNC +V IDS++I +P  SPN
Sbjct  207   GMTLPGSCDSPVALRFFMSSNLTVRGLKIQNSPQFHFRFDNCKNVTIDSIFITSPARSPN  266

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIH+ENT  V I+NS++SNGDDCISIG+G  N+DI+N+TCGP HGISIGSLG + SRA
Sbjct  267   TDGIHVENTETVGIYNSVISNGDDCISIGSGSLNIDIQNVTCGPSHGISIGSLGKQNSRA  326

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CV+NI V ++ I++SDNGVRIKTWQGG G+VS +TF+NI MD VRNPII+DQYYC +K C
Sbjct  327   CVTNITVRNAVIKHSDNGVRIKTWQGGSGSVSSITFENIHMDTVRNPIIIDQYYCLSKPC  386

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
             +NQTSAVYISD+SY+NI+GT+D RSP +   CSDSVPCTN+T++EVEL PSQG+ + +PF
Sbjct  387   SNQTSAVYISDISYTNIRGTYDVRSPAIHFGCSDSVPCTNITVTEVELLPSQGNIISEPF  446

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWN YG  +T+TIPPV CLL+G P+S+ +++ D+C
Sbjct  447   CWNVYGVSETLTIPPVSCLLDGLPRSIMDIEADKC  481



>ref|XP_004494454.1| PREDICTED: polygalacturonase At1g48100-like [Cicer arietinum]
Length=456

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/397 (68%), Positives = 332/397 (84%), Gaps = 3/397 (1%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTP-ILLAPKHHSFLIQSTIFTGPCKNPLL  1188
             +V S+G IGDG  DDT +FK AWD ACQS L   ++L P+  SF++QS IFTGPC+  L+
Sbjct  61    DVRSFGAIGDGKKDDTESFKMAWDTACQSQLEDNVILVPQGFSFIVQSIIFTGPCQGDLV  120

Query  1187  FQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGV  1008
             F+++GT+MPPDGP+SWPKN ++RQWLVFYR+NGMS++G GLIDGRG+KWW+LPCKPH+G 
Sbjct  121   FKVDGTVMPPDGPESWPKNNSRRQWLVFYRINGMSLEGSGLIDGRGQKWWDLPCKPHKGS  180

Query  1007  NGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSP  828
             N T L GPCDSP+AIRFF  SNLTVQ LK+KNSP F+FRFD+C  V+I+S+YI AP  SP
Sbjct  181   NVTAL-GPCDSPIAIRFFMCSNLTVQGLKVKNSPQFNFRFDDCKKVYIESIYITAPKLSP  239

Query  827   NTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSR  648
             NTDGIH+EN  DV I+NS++SNGDDC+SIG+GCY+VDI+N+TCGP HGISIGSLG   S+
Sbjct  240   NTDGIHLENANDVKIYNSVISNGDDCVSIGSGCYDVDIKNITCGPSHGISIGSLGNHNSK  299

Query  647   ACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKA  468
             ACVSNI V DS I+ SDNGVRIKTWQGG G+VS VTF+NI M +VRNPII+DQ+YC  K 
Sbjct  300   ACVSNITVRDSIIKMSDNGVRIKTWQGGSGSVSGVTFNNINMISVRNPIIIDQFYCLTKE  359

Query  467   -CTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLD  291
              CTN+TSAV++S++ Y++IKGT+D RSPPM  ACSDSVPCTN+TLS++EL PSQG  + D
Sbjct  360   HCTNKTSAVFVSNILYTDIKGTYDIRSPPMHFACSDSVPCTNITLSDIELLPSQGDIVYD  419

Query  290   PFCWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             PFCWNAYGDL+T+TIPPV CLL G PQSL + D+D C
Sbjct  420   PFCWNAYGDLETLTIPPVSCLLVGTPQSLLDYDIDHC  456



>ref|XP_010679447.1| PREDICTED: polygalacturonase At1g48100 [Beta vulgaris subsp. 
vulgaris]
Length=475

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/399 (67%), Positives = 326/399 (82%), Gaps = 4/399 (1%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTP---ILLAPKHHSFLIQSTIFTGPCKNP  1194
             +V S+G +GDGV DDT AFK AWD AC S+ +    +L AP  H+F+IQSTIF+GPC++ 
Sbjct  77    DVSSFGAVGDGVVDDTEAFKAAWDAACSSNNSGSSSVLHAPSGHTFMIQSTIFSGPCQSN  136

Query  1193  LLFQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHR  1014
             ++FQI+G+++PPDGP+ WPKN++K QWLVFYRV GMS+QGGG IDGRGEKWW LPCKPH+
Sbjct  137   IIFQIDGSVVPPDGPEEWPKNISKHQWLVFYRVEGMSLQGGGRIDGRGEKWWELPCKPHK  196

Query  1013  GVNGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPN  834
             G NGTTLPGPC+SP+AIRFF SSNLTV+ L+I+NSP FHFRFD CH+VHI+S++I AP  
Sbjct  197   GPNGTTLPGPCESPIAIRFFQSSNLTVKGLRIQNSPQFHFRFDVCHNVHIESIHITAPAL  256

Query  833   SPNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQ  654
             SPNTDGIHIENT +V I+NS + NGDDCISIG+GCY+VDIRNMTCG GHGISIGSLG   
Sbjct  257   SPNTDGIHIENTNNVQIYNSFIFNGDDCISIGSGCYDVDIRNMTCGHGHGISIGSLGNHN  316

Query  653   SRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSN  474
             SRACV N+ V DS IR S NGVRIKTWQGG+GAVS VTFDNIRMD VRNPI++DQ+YC  
Sbjct  317   SRACVHNVTVRDSLIRASSNGVRIKTWQGGYGAVSGVTFDNIRMDTVRNPIMIDQFYCLG  376

Query  473   KACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRML  294
             K C NQ+SAV ++D+ YS +KGT+D RSPPM   CSD+VPC+N+TL+++EL P+ G  +L
Sbjct  377   KGCNNQSSAVLVTDILYSGLKGTYDVRSPPMHFGCSDAVPCSNITLTDIELLPAVGEMVL  436

Query  293   DPFCWNAYGDLKTVTIPPVFCLLEG-NPQSLPNVDVDQC  180
             DPFCWN YG L ++TIPPV CL EG  PQ L    +D C
Sbjct  437   DPFCWNVYGSLDSLTIPPVSCLQEGIPPQPLLASGIDHC  475



>ref|XP_010921359.1| PREDICTED: polygalacturonase At1g48100-like [Elaeis guineensis]
Length=523

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/395 (67%), Positives = 330/395 (84%), Gaps = 1/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V S+G +GDGV+DDT AFK AW  ACQ   T +LL P+ +SF I+S IFTGPC++ ++F
Sbjct  129   DVRSFGAVGDGVSDDTEAFKSAWVSACQGG-TGVLLVPQGYSFKIRSAIFTGPCQSGIVF  187

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++G +MPPDGPDSWP+N  +RQWLVFYR +GM++QGGGLIDG+GEKWW+LPCKPH+G N
Sbjct  188   QVDGIVMPPDGPDSWPQNNNRRQWLVFYRADGMTLQGGGLIDGKGEKWWDLPCKPHKGNN  247

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G T PGPCDSPVA+RFF SSNLTV+ LKI+NSP FH RFDNC +V IDS+ I +P  SPN
Sbjct  248   GATSPGPCDSPVALRFFMSSNLTVRGLKIQNSPQFHVRFDNCKNVTIDSIVITSPALSPN  307

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIH+ENT  V I+NS++SNGDDCISIG+G  N+DI+N+TCGP HGISIGSLG + SRA
Sbjct  308   TDGIHVENTETVGIYNSVISNGDDCISIGSGSINIDIQNVTCGPSHGISIGSLGKQSSRA  367

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CV+NI V ++ I++SDNGVRIKTWQGG G+VS V F+NIRMD VRNPII+DQ+YC +K C
Sbjct  368   CVTNITVRNAVIKHSDNGVRIKTWQGGSGSVSSVAFENIRMDTVRNPIIIDQFYCLSKPC  427

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQTSAVYISD+SY+NI+GT+D RSPP+   CSDSVPCTN+T++EVEL PSQG+ + +PF
Sbjct  428   ANQTSAVYISDISYTNIQGTYDVRSPPIHFGCSDSVPCTNITITEVELLPSQGYIVSEPF  487

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWN YG  +T+TIPPV CLLEG P+S+ +++  +C
Sbjct  488   CWNVYGVSETLTIPPVSCLLEGLPRSIMDIEAAKC  522



>ref|XP_006605259.1| PREDICTED: polygalacturonase At1g48100-like [Glycine max]
Length=533

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/398 (69%), Positives = 318/398 (80%), Gaps = 3/398 (1%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             NV S+G +GDGV+DDT AFK AWD AC ++ +  L  PK H F+IQST FTGPC + L F
Sbjct  136   NVKSFGAVGDGVSDDTEAFKLAWDAACHAEESGTLFVPKGHIFMIQSTTFTGPCNSKLTF  195

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             +++GTI PPDGPDSWP +  KRQWLVFYR+NGM MQG GLIDGRGEKWWNL  K H+G N
Sbjct  196   KVDGTIWPPDGPDSWPLSSRKRQWLVFYRINGMLMQGSGLIDGRGEKWWNLSYKSHKGAN  255

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G    GP D PVAIRFF SSNL V+ LKIKNSP FHFRFD C +VH++ L IK+P  SPN
Sbjct  256   GAKQLGPGDRPVAIRFFESSNLRVEGLKIKNSPKFHFRFDECQNVHVEKLIIKSPALSPN  315

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT +V IHNS++SNGDDC+S+GAGCYNVDIRN+TCGP HGISIGSLG   SRA
Sbjct  316   TDGIHIENTTNVNIHNSVISNGDDCVSVGAGCYNVDIRNITCGPSHGISIGSLGNYNSRA  375

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V+DS I++SDNGVRIKTWQGG GAVSKV F+NI+MD VRNPII+DQYYC +K C
Sbjct  376   CVSNITVSDSIIKHSDNGVRIKTWQGGRGAVSKVVFNNIQMDTVRNPIIIDQYYCPSKNC  435

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYP---SQGHRML  294
              NQ+ AV +S+VSYSNIKGT+DARSPPMR ACSDSVPCTNLTLSEVEL P   SQG  + 
Sbjct  436   HNQSYAVSVSNVSYSNIKGTYDARSPPMRFACSDSVPCTNLTLSEVELLPAAHSQGKILT  495

Query  293   DPFCWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             +PFCW  YG ++T+T P V CLLEGN  +L   DV  C
Sbjct  496   NPFCWKVYGTVQTLTTPHVLCLLEGNQLTLKPRDVVWC  533



>ref|XP_011003167.1| PREDICTED: polygalacturonase At1g48100 isoform X1 [Populus euphratica]
Length=464

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/395 (67%), Positives = 325/395 (82%), Gaps = 0/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V ++G IGDG+ DDT AFK AWD AC      ++L P    F+IQSTIF+GPCK+ L+F
Sbjct  70    DVRNFGAIGDGIIDDTDAFKMAWDAACNQVDPAVILVPYGFDFMIQSTIFSGPCKDGLVF  129

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++GT+MPPDGPDSWP+  ++RQWLVFYR+N MS+QGGG+I GRGEKWW+LPCKPH+G+N
Sbjct  130   QVDGTLMPPDGPDSWPQKNSRRQWLVFYRINEMSLQGGGVIYGRGEKWWDLPCKPHKGIN  189

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             GTT+PGPCDSP AIRFF SSNLT+  LKIKNSP F+ RFDNC +VH++S++I AP  SPN
Sbjct  190   GTTMPGPCDSPTAIRFFMSSNLTIHGLKIKNSPQFNLRFDNCKNVHVESIHITAPALSPN  249

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT  V I+NS++SNGDDC+SIG+GC++VDI N+TCGP HGISIGSLG   SRA
Sbjct  250   TDGIHIENTNGVGIYNSVISNGDDCVSIGSGCFDVDIENITCGPSHGISIGSLGNHNSRA  309

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V DS IR SDNGVRIKTWQGG GAVS +TF NI MD VRNPII+DQ+YC  K C
Sbjct  310   CVSNITVRDSVIRVSDNGVRIKTWQGGSGAVSGITFSNIHMDYVRNPIIIDQFYCLTKRC  369

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQTSAV +S++ Y NIKGT++ RS P+  ACSDS+PCTN+TLS++EL P++G+ +LDP+
Sbjct  370   ANQTSAVSVSEILYENIKGTYNIRSSPIHFACSDSLPCTNITLSDIELLPAEGYSVLDPY  429

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYGD +T+TIPPV CL+EG P S+ N ++  C
Sbjct  430   CWNAYGDSQTLTIPPVSCLMEGIPGSILNNEMHYC  464



>ref|XP_003626018.1| Polygalacturonase [Medicago truncatula]
 gb|AES82236.1| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=462

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/397 (67%), Positives = 330/397 (83%), Gaps = 4/397 (1%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQ--SDLTPILLAPKHHSFLIQSTIFTGPCKNPL  1191
             +V S+G IGDG+ DDT +FK AWD ACQ  SD+  ++L P+  SF+IQSTIFTGPC+  L
Sbjct  68    DVRSFGAIGDGIEDDTESFKMAWDTACQNGSDVN-VILVPQGFSFVIQSTIFTGPCQGDL  126

Query  1190  LFQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRG  1011
             +F+++GT++ PDGP+SWPKN ++RQWLVFYR+ GMS++G G IDGRG+KWW+LPCKPH+G
Sbjct  127   IFKVDGTVLAPDGPESWPKNNSRRQWLVFYRMKGMSLEGSGSIDGRGQKWWDLPCKPHKG  186

Query  1010  VNGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNS  831
              NGT L G CDSP+AIRFF SSNLTV+ LK+KNSP F+FRFD C++VHI+S+YI AP  S
Sbjct  187   SNGTAL-GTCDSPIAIRFFMSSNLTVKGLKVKNSPQFNFRFDACNNVHIESIYITAPKIS  245

Query  830   PNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQS  651
             PNTDGIH+E   DV I+NS++SNGDDC+SIG G Y+VDI+N+TCGP HGISIGSLG   +
Sbjct  246   PNTDGIHLEYANDVKIYNSVISNGDDCVSIGTGSYDVDIKNITCGPSHGISIGSLGNHNT  305

Query  650   RACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNK  471
             +ACVSNI V DS I+ SDNG+RIKTWQGG G+VS VTF+NI M +VRNPII+DQYYC  K
Sbjct  306   KACVSNITVRDSIIKMSDNGIRIKTWQGGSGSVSGVTFNNIHMISVRNPIIIDQYYCLTK  365

Query  470   ACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLD  291
              CTN+TSAV +S++ Y+NIKGT+D +SPPM  ACSDSVPCTN+TLSE+EL PSQG  + D
Sbjct  366   DCTNKTSAVSVSNILYTNIKGTYDIKSPPMHFACSDSVPCTNITLSEIELLPSQGDIVHD  425

Query  290   PFCWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             PFCWNAYGDL+T+TIPPV CLLEG PQSL + D+  C
Sbjct  426   PFCWNAYGDLETLTIPPVSCLLEGIPQSLLDYDIGHC  462



>ref|XP_009118766.1| PREDICTED: polygalacturonase At1g48100-like [Brassica rapa]
Length=493

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/399 (65%), Positives = 325/399 (81%), Gaps = 4/399 (1%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQS--DLTPILLAPKHHSFLIQSTIFTGPCKNPL  1191
             +V  +G +GDGVADDT AFK AWD +C +  D   +LL P  ++F+IQSTIFTGPC +  
Sbjct  92    DVRKFGAVGDGVADDTEAFKTAWDSSCSNGNDTVSVLLVPYGYTFMIQSTIFTGPCHSYQ  151

Query  1190  LFQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRG  1011
             LFQ++GTI+ PDGP+SWP N++KRQWLVFYRVNGM+++G G+IDGRG+KWW+LPCKPHR 
Sbjct  152   LFQVDGTIVTPDGPESWPSNISKRQWLVFYRVNGMALKGAGVIDGRGQKWWDLPCKPHRT  211

Query  1010  VN-GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPN  834
             VN    + GPCDSP+A+RFF SSNLTV+ L+IKNSP FHFRFD C  VH++SL+I APP 
Sbjct  212   VNISAIVAGPCDSPIALRFFMSSNLTVEGLQIKNSPQFHFRFDGCQGVHVESLHITAPPL  271

Query  833   SPNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPG-HGISIGSLGIK  657
             SPNTDGIHIEN+  VTI+NS++SNGDDC+SIG+G Y+VDIRN+TCGPG HGISIGSLG  
Sbjct  272   SPNTDGIHIENSNSVTIYNSVISNGDDCVSIGSGSYDVDIRNLTCGPGGHGISIGSLGNH  331

Query  656   QSRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCS  477
              S ACVSNI V DS I+ SDNGVRIKTWQGGFG+VS VTF+NI +++VRNPII+DQYYC 
Sbjct  332   NSHACVSNITVRDSVIKYSDNGVRIKTWQGGFGSVSGVTFNNIHVESVRNPIIIDQYYCM  391

Query  476   NKACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRM  297
              K C N+TSAV++SD++Y  IKGT+D RSPPM   CSD+VPCTNLTLS +EL P +G  +
Sbjct  392   TKDCANKTSAVFVSDITYQGIKGTYDIRSPPMHFGCSDAVPCTNLTLSGIELLPEKGEIV  451

Query  296   LDPFCWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             +DPFCWNAYG ++ ++IPPV+CL+   P +L    VD+C
Sbjct  452   VDPFCWNAYGIVEELSIPPVWCLMSDPPTALQGALVDKC  490



>ref|XP_002892109.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68368.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=491

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/399 (66%), Positives = 325/399 (81%), Gaps = 4/399 (1%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEAC--QSDLTPILLAPKHHSFLIQSTIFTGPCKNPL  1191
             NV  YG +GDG  DDT AFK AWD AC  +++   +LL P  ++F+IQSTIFTGPC++  
Sbjct  90    NVRKYGAVGDGETDDTEAFKMAWDSACNNENNTDSVLLVPYGYTFMIQSTIFTGPCRSYQ  149

Query  1190  LFQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRG  1011
              FQ++GTI+ PDGP+SWP N++KRQWLVFYRVNGMS++G G+IDGRG+KWW+LPCKPHR 
Sbjct  150   FFQVDGTIVTPDGPESWPSNISKRQWLVFYRVNGMSLKGDGVIDGRGQKWWDLPCKPHRS  209

Query  1010  VNGTTL-PGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPN  834
             VN + +  GPCDSP+A+RFF SSNL V+ L+IKNSP FHFRFD C  VH++SL+I APP 
Sbjct  210   VNKSAIVAGPCDSPIALRFFMSSNLRVEGLQIKNSPQFHFRFDGCQGVHVESLHITAPPL  269

Query  833   SPNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPG-HGISIGSLGIK  657
             SPNTDGIHIEN+  VTI+NSI+SNGDDC+SIG+G Y+VDIRN+TCGPG HGISIGSLG  
Sbjct  270   SPNTDGIHIENSNSVTIYNSIISNGDDCVSIGSGSYDVDIRNLTCGPGGHGISIGSLGNH  329

Query  656   QSRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCS  477
              SRACVSNI V DS I+ SDNGVRIKTWQGG G+VS VTF+NI +D+VRNPII+DQYYC 
Sbjct  330   NSRACVSNITVRDSVIKYSDNGVRIKTWQGGSGSVSGVTFNNIHVDSVRNPIIIDQYYCM  389

Query  476   NKACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRM  297
              K C N+TSAV++SD++Y  IKGT+D RSPPM   CSD++PCTNLTLS++EL P++G  +
Sbjct  390   TKDCANKTSAVFVSDIAYQGIKGTYDIRSPPMHFGCSDAIPCTNLTLSDIELLPAKGEFV  449

Query  296   LDPFCWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             LDPFCWNAYG  + ++IPPV+CL+   P+ L    VD+C
Sbjct  450   LDPFCWNAYGIAEELSIPPVWCLMSDPPKGLQGSLVDKC  488



>ref|XP_009382473.1| PREDICTED: polygalacturonase At1g48100 [Musa acuminata subsp. 
malaccensis]
Length=465

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/395 (64%), Positives = 320/395 (81%), Gaps = 1/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             NV+S+G +GDGV DDT AFK AWD AC+     ++L P+ ++F I STIF GPC   L  
Sbjct  71    NVLSFGAVGDGVTDDTEAFKSAWDSACEEG-PGVVLVPQGYAFKISSTIFAGPCHGELTL  129

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++GTIMPPDGPD+WP+  ++RQWLVFYR N +++QGGGL DG+G KWW+LPCKPH+G N
Sbjct  130   QVDGTIMPPDGPDAWPQGTSRRQWLVFYRANDLTLQGGGLFDGKGAKWWDLPCKPHKGRN  189

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
              TTL GPCDSPVA RFF SSNL V  ++I NSP FHFRFDNC +V +D++ I +P  SPN
Sbjct  190   HTTLTGPCDSPVAFRFFMSSNLAVHRIRIHNSPQFHFRFDNCRNVTVDAISINSPALSPN  249

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIH+EN+ DV I+NS++S+GDDC+SIGAG  N+ IRN+TCGP HGISIGSLG + +RA
Sbjct  250   TDGIHVENSVDVGIYNSVISSGDDCVSIGAGSTNIHIRNLTCGPSHGISIGSLGKQNTRA  309

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CV+N+ V DS I++SDNGVRIKTWQGG G+VS V+F+NIRMD VRNPII++QYYC  K C
Sbjct  310   CVTNVTVKDSVIKHSDNGVRIKTWQGGSGSVSWVSFENIRMDTVRNPIIINQYYCLTKVC  369

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQTSAVY+SDVSY+ IKG++D RSPP+   CSD+VPCTN+TL++VEL P+QG  + DPF
Sbjct  370   KNQTSAVYVSDVSYAGIKGSYDTRSPPIHFGCSDAVPCTNITLTDVELLPAQGDAIADPF  429

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWN YG+ +T+TIPPV CLL+G P+S+ ++D D+C
Sbjct  430   CWNVYGESQTLTIPPVSCLLQGLPRSIMDIDSDRC  464



>ref|XP_002302793.1| glycoside hydrolase family 28 family protein [Populus trichocarpa]
 gb|EEE82066.1| glycoside hydrolase family 28 family protein [Populus trichocarpa]
Length=457

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/395 (66%), Positives = 320/395 (81%), Gaps = 7/395 (2%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V ++G IGDG+ DDT AFK AWD AC      ++L P    F+IQSTIF+GPCK+ L+F
Sbjct  70    DVRNFGAIGDGIIDDTDAFKMAWDAACNQVDPAVILVPYGFDFMIQSTIFSGPCKDGLVF  129

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++GT+MPPDGPDSWP+  ++RQWLVFYR+N MS+QGGG+I GRGEKWW+LPCKPH+G+N
Sbjct  130   QVDGTLMPPDGPDSWPQKNSRRQWLVFYRINEMSLQGGGVIYGRGEKWWDLPCKPHKGIN  189

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             GTT+PGPCDSP AIRFF SSNLT+  LKIKNSP F+ RFDNC +VH++S++I AP  SPN
Sbjct  190   GTTMPGPCDSPTAIRFFMSSNLTIHGLKIKNSPQFNLRFDNCKNVHVESIHITAPALSPN  249

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT  V I+NS++SN       G+GC++VDI N+TCGP HGISIGSLG   SRA
Sbjct  250   TDGIHIENTNGVGIYNSVISN-------GSGCFDVDIENITCGPSHGISIGSLGNHNSRA  302

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V DS IR SDNGVRIKTWQGG GAVS +TF NI MDNVRNPII+DQ+YC  K C
Sbjct  303   CVSNITVRDSVIRVSDNGVRIKTWQGGSGAVSGITFSNIHMDNVRNPIIIDQFYCLTKRC  362

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQTSAV +S++ Y NIKGT++ RSPPM  ACSDS+PCTN+TLS+VEL P++G+ +LDP+
Sbjct  363   ANQTSAVSVSEILYENIKGTYNIRSPPMHFACSDSLPCTNITLSDVELLPAEGYSVLDPY  422

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYGD +T+TIPPV CL+EG P S+ N D+  C
Sbjct  423   CWNAYGDSQTLTIPPVSCLMEGIPGSILNNDMHYC  457



>ref|XP_006604753.1| PREDICTED: polygalacturonase At1g48100-like isoform X2 [Glycine 
max]
Length=447

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/396 (67%), Positives = 321/396 (81%), Gaps = 16/396 (4%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSD-LTPILLAPKHHSFLIQSTIFTGPCKNPLL  1188
             +V  +G IGDG  DDT +FK AWD ACQS+    ++L P+  SFLIQSTIFTGPC+  L+
Sbjct  67    DVRKFGAIGDGETDDTGSFKMAWDSACQSESAVNVILVPQGFSFLIQSTIFTGPCQGVLV  126

Query  1187  FQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGV  1008
              +++GT+MPPDGP+SWPKN ++ QWLVFYR+NGMS++G GLIDGRGEKWW+LPCKPH+  
Sbjct  127   LKVDGTLMPPDGPESWPKNNSRHQWLVFYRINGMSLEGSGLIDGRGEKWWDLPCKPHK--  184

Query  1007  NGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSP  828
                          AIRFF SSNLTVQ L+IKNSP FHFRFD C +VHI+S+YI AP  SP
Sbjct  185   -------------AIRFFMSSNLTVQGLRIKNSPQFHFRFDGCKNVHIESIYITAPKLSP  231

Query  827   NTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSR  648
             NTDGIHIENT D+ I+NS++SNGDDC+SIG+GC +VDI+N+TCGPGHGISIGSLG   SR
Sbjct  232   NTDGIHIENTNDMKIYNSVISNGDDCVSIGSGCNDVDIKNITCGPGHGISIGSLGNHNSR  291

Query  647   ACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKA  468
             ACVSNI V DS I+ +DNGVRIKTWQGG G+VS VTF NI M +VRNPII+DQ+YC  K 
Sbjct  292   ACVSNIMVRDSFIKVTDNGVRIKTWQGGSGSVSGVTFSNIHMVSVRNPIIIDQFYCLTKE  351

Query  467   CTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDP  288
             CTN+TSAV +S++ Y+NIKGT+D RSPPMR ACSDSVPCTNLTLS++EL PSQG  + DP
Sbjct  352   CTNKTSAVSVSNIIYTNIKGTYDIRSPPMRFACSDSVPCTNLTLSDIELLPSQGDIVHDP  411

Query  287   FCWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             FCWNAYGDL+T+TIPPV CLLEG PQS+ + D+ +C
Sbjct  412   FCWNAYGDLETLTIPPVSCLLEGTPQSVLDYDITRC  447



>ref|NP_563654.1| pectin lyase-like superfamily protein [Arabidopsis thaliana]
 gb|AAG10640.1|AC022521_18 Putative polygalacturonase [Arabidopsis thaliana]
 gb|AAY56453.1| At1g02460 [Arabidopsis thaliana]
 gb|AEE27432.1| pectin lyase-like superfamily protein [Arabidopsis thaliana]
Length=491

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/399 (65%), Positives = 325/399 (81%), Gaps = 4/399 (1%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEAC--QSDLTPILLAPKHHSFLIQSTIFTGPCKNPL  1191
             NV  YG +GDG  DDT AFK AWD +C  +++   +LL P  ++F+IQSTIFTGPC++  
Sbjct  90    NVRKYGAVGDGETDDTEAFKTAWDSSCNNENNTDSVLLVPYGYTFMIQSTIFTGPCRSYQ  149

Query  1190  LFQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRG  1011
              FQ++GTI+ PDGP+SWP N++KRQWLVFYRVNGM+++G G+IDGRG+KWW+LPCKPHR 
Sbjct  150   FFQVDGTIVTPDGPESWPSNISKRQWLVFYRVNGMALKGEGVIDGRGQKWWDLPCKPHRS  209

Query  1010  VNGTTL-PGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPN  834
             VN + +  GPCDSP+A+RFF SSNL V+ L+IKNSP FHFRFD C  VH++SL+I APP 
Sbjct  210   VNKSAIVTGPCDSPIALRFFMSSNLRVEGLQIKNSPQFHFRFDGCQGVHVESLHITAPPL  269

Query  833   SPNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPG-HGISIGSLGIK  657
             SPNTDGIHIEN+  VTI+NSI+SNGDDC+SIG+G Y+VDIRN+TCGPG HGISIGSLG  
Sbjct  270   SPNTDGIHIENSNSVTIYNSIISNGDDCVSIGSGSYDVDIRNLTCGPGGHGISIGSLGNH  329

Query  656   QSRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCS  477
              SRACVSNI V DS I+ SDNGVRIKTWQGG G+VS VTF+NI +D+VRNPII+DQYYC 
Sbjct  330   NSRACVSNITVRDSVIKYSDNGVRIKTWQGGSGSVSGVTFNNIHVDSVRNPIIIDQYYCM  389

Query  476   NKACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRM  297
              K C N+TSAV++SD++Y  IKGT+D RSPPM   CSD+VPCTNLTLS++EL P++G  +
Sbjct  390   TKDCANKTSAVFVSDIAYQGIKGTYDIRSPPMHFGCSDAVPCTNLTLSDIELLPAKGEIV  449

Query  296   LDPFCWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             LDPFCWNAYG  + ++IPPV+CL+   P+ L    VD+C
Sbjct  450   LDPFCWNAYGIAEELSIPPVWCLMSDPPKGLQGSLVDKC  488



>ref|XP_009417842.1| PREDICTED: polygalacturonase At1g48100-like [Musa acuminata subsp. 
malaccensis]
Length=501

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/395 (67%), Positives = 330/395 (84%), Gaps = 1/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V + G IGDGV+DDT A K AW+ ACQ     ILL P+ ++F IQSTIF GPC++ L F
Sbjct  104   DVRALGAIGDGVSDDTEALKSAWEAACQGGPGLILL-PQGYTFKIQSTIFAGPCRSELTF  162

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++GTI PPDGPD WP+++++RQWLVFYRVNGM +QGGGLIDG+GEKWWNLPCKPH+G N
Sbjct  163   QVDGTITPPDGPDEWPQSISRRQWLVFYRVNGMKLQGGGLIDGKGEKWWNLPCKPHKGPN  222

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             GTTLPG CDSPVA+RFF SSNLTV++L+I+NSP FHFRFDNC +V ID++ I +P  SPN
Sbjct  223   GTTLPGTCDSPVALRFFMSSNLTVRELRIQNSPQFHFRFDNCRNVTIDTICISSPALSPN  282

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIH+ENT  V I+NS++SNGDDC+SIGAG   + I N+TCGP HGISIGSLG + +RA
Sbjct  283   TDGIHVENTELVGIYNSVISNGDDCVSIGAGSVGISIVNVTCGPSHGISIGSLGKQNTRA  342

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CV+NI V ++ I++SDNGVRIKTWQGG G+VS ++F+NIRMD VRNPII+DQ+YC +K+C
Sbjct  343   CVANITVRNAVIKHSDNGVRIKTWQGGSGSVSSISFENIRMDTVRNPIIIDQFYCLSKSC  402

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQTSAVY+SDVSY+ I+GT+D RSPP+ L CSDSVPCTN+TLS+VEL P+QG  + DPF
Sbjct  403   LNQTSAVYVSDVSYTGIRGTYDVRSPPIHLGCSDSVPCTNITLSDVELLPAQGDFISDPF  462

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYG  +T+TIPPV CL EG PQS+ ++D D+C
Sbjct  463   CWNAYGATETLTIPPVSCLSEGLPQSIIDIDSDKC  497



>ref|XP_006418338.1| hypothetical protein EUTSA_v10007481mg [Eutrema salsugineum]
 gb|ESQ36691.1| hypothetical protein EUTSA_v10007481mg [Eutrema salsugineum]
Length=488

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/399 (65%), Positives = 325/399 (81%), Gaps = 4/399 (1%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEAC--QSDLTPILLAPKHHSFLIQSTIFTGPCKNPL  1191
             NV  +G +GDGV DDT AFK AWD +C  ++D   +LL P  ++F+IQSTIFTGPC++  
Sbjct  87    NVRKFGAVGDGVTDDTEAFKTAWDSSCSNENDTVSVLLVPYGYTFMIQSTIFTGPCRSYQ  146

Query  1190  LFQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRG  1011
             LFQ++GTI+ PDGP+SWP N++KRQWLVFYRVNGM+++G G+IDGRG+KWW+LPCKPHR 
Sbjct  147   LFQVDGTIVTPDGPESWPSNISKRQWLVFYRVNGMALKGAGVIDGRGQKWWDLPCKPHRA  206

Query  1010  VNGTTL-PGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPN  834
             VN + +  GPCDSP+A+RFF SSNLTV+ L+IKNSP FHFRFD C  V++DSL+I APP 
Sbjct  207   VNKSAVVAGPCDSPIALRFFMSSNLTVEGLQIKNSPQFHFRFDGCQGVNVDSLHITAPPL  266

Query  833   SPNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPG-HGISIGSLGIK  657
             SPNTDGIHIEN+  VTI+NS++SNGDDC+SIG+G Y+VDIRN+TCGPG HGISIGSLG  
Sbjct  267   SPNTDGIHIENSNSVTIYNSVISNGDDCVSIGSGSYDVDIRNLTCGPGGHGISIGSLGNH  326

Query  656   QSRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCS  477
              S ACVSNI V DS I+ SDNGVRIKTWQGG G+VS VTF+NI +D VRNPII+DQYYC 
Sbjct  327   NSHACVSNITVRDSVIKYSDNGVRIKTWQGGSGSVSGVTFNNIHVDTVRNPIIIDQYYCM  386

Query  476   NKACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRM  297
              K C+N+TSAV++SD++Y  IKGT+D RSPPM   CSD+VPCTNLTLS++EL P++G  +
Sbjct  387   TKDCSNKTSAVFVSDIAYQGIKGTYDIRSPPMHFGCSDAVPCTNLTLSDIELLPAKGEIV  446

Query  296   LDPFCWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
              DPFCWNAYG  + ++IPPV+CL+   P +L    V +C
Sbjct  447   SDPFCWNAYGIAEELSIPPVWCLMSDPPTALQGALVGKC  485



>ref|XP_008356595.1| PREDICTED: polygalacturonase At1g48100-like [Malus domestica]
Length=466

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/396 (66%), Positives = 324/396 (82%), Gaps = 2/396 (1%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPI-LLAPKHHSFLIQSTIFTGPCKNPLL  1188
             +V S+G +GDG  DDT+AFK AWD ACQSD +   +L P+  SF+IQSTIFTGPC   L+
Sbjct  72    DVRSFGAVGDGQTDDTVAFKMAWDTACQSDESXARILVPQGFSFMIQSTIFTGPCLGGLV  131

Query  1187  FQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGV  1008
              Q++GT+ PPDGP SWPK++++ QWLVF R+N MS+QGGG+IDGRGEKWWNLPCKPHRG+
Sbjct  132   LQVDGTLXPPDGPGSWPKHISRHQWLVFNRINEMSLQGGGVIDGRGEKWWNLPCKPHRGI  191

Query  1007  NGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSP  828
             NGTTLPGPCDSP+AIRFF SSNLTVQ L I  +P     + +C +VHI+S+ I +P  SP
Sbjct  192   NGTTLPGPCDSPIAIRFFMSSNLTVQGLXIXXTPNSTSXY-SCRNVHIESISISSPAKSP  250

Query  827   NTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSR  648
             NTDGIHIE TYDV I+NS++SNGDDC+SIG+GCY+V+IRN+TCGPGHGISIGSLG   SR
Sbjct  251   NTDGIHIEKTYDVQIYNSVISNGDDCVSIGSGCYDVNIRNLTCGPGHGISIGSLGNHNSR  310

Query  647   ACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKA  468
             ACVSNI V DS ++ +DNGVRIKTWQGG G+VS VTF NI MDNV+NPI++DQYYC  K 
Sbjct  311   ACVSNITVRDSIMKGTDNGVRIKTWQGGSGSVSGVTFSNIHMDNVKNPIMIDQYYCPTKR  370

Query  467   CTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDP  288
             CTNQTSAV++SD+ YSNIKGT+D  S PM  ACSD++PCTNLTLSEVEL P+  +++ DP
Sbjct  371   CTNQTSAVFVSDILYSNIKGTYDVXSSPMHFACSDALPCTNLTLSEVELLPAVRYKVSDP  430

Query  287   FCWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             +CWNAYG+L T TIPP  CLL+G P+SL   ++++C
Sbjct  431   YCWNAYGELLTGTIPPXSCLLDGVPRSLLGHEIERC  466



>ref|XP_008447667.1| PREDICTED: polygalacturonase At1g48100 [Cucumis melo]
Length=473

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/400 (66%), Positives = 319/400 (80%), Gaps = 8/400 (2%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTP-----ILLAPKHHSFLIQSTIFTGPCK  1200
             +V  +G IGDG ADDT AFK AWD ACQ +        ++L P   SF+IQSTIFTGPC+
Sbjct  77    DVRHFGAIGDGTADDTAAFKMAWDTACQRNDDDDNNYGVILVPYGFSFMIQSTIFTGPCR  136

Query  1199  NPLLFQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKP  1020
             N ++FQ++GT+M PDGPD+WPK  +  QWLVFYRV  MS+QG GLIDGRG+KWW+LPCKP
Sbjct  137   NGIVFQVDGTLMAPDGPDAWPKGYSAHQWLVFYRVYNMSLQGNGLIDGRGQKWWDLPCKP  196

Query  1019  HRGVNGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAP  840
             H+G    T+ GPCDSP+AIRFF SS L V+ ++IK+SP FHFRFDNC DV+IDSL+I +P
Sbjct  197   HKG---KTMTGPCDSPIAIRFFMSSKLRVEGVRIKDSPQFHFRFDNCKDVYIDSLHITSP  253

Query  839   PNSPNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGI  660
               SPNTDGIHIENT  V I NSIV+NGDDCISIG+G YNV+I N+TCGPGHGISIGSLG 
Sbjct  254   ALSPNTDGIHIENTNGVQIFNSIVANGDDCISIGSGSYNVEITNITCGPGHGISIGSLGN  313

Query  659   KQSRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYC  480
               SRACVSNI V DS I+ SDNGVRIKTWQGG+GAV  V+F+NI MDNVRNPII+DQ+YC
Sbjct  314   HNSRACVSNITVRDSIIKVSDNGVRIKTWQGGYGAVRGVSFNNINMDNVRNPIIIDQFYC  373

Query  479   SNKACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHR  300
              NK C NQTSAV +SD+SY +IKGT+D RSPPM   CSDS+PC NLTL+ +EL+PS+G  
Sbjct  374   LNKGCLNQTSAVVVSDISYIDIKGTYDIRSPPMHFGCSDSMPCMNLTLANIELFPSKGDI  433

Query  299   MLDPFCWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             +LDPFCWNAYG+L+T+TIPP+ CLLE + +S    + D C
Sbjct  434   LLDPFCWNAYGNLQTLTIPPISCLLETSSRSFLESEKDYC  473



>ref|XP_004163976.1| PREDICTED: polygalacturonase At1g48100-like [Cucumis sativus]
Length=483

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/401 (66%), Positives = 319/401 (80%), Gaps = 9/401 (2%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTP------ILLAPKHHSFLIQSTIFTGPC  1203
             +V  +G IGDG ADDT AFK AWD ACQ +         ++L P   SF+IQSTIFTGPC
Sbjct  86    DVRHFGAIGDGTADDTAAFKMAWDTACQRNDDDNNDDYGVILVPYGFSFMIQSTIFTGPC  145

Query  1202  KNPLLFQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCK  1023
             KN ++FQ++GT+M PDGPD+WPK  +  QWLVFYRV  MS+QG GLIDGRG+KWW+LPCK
Sbjct  146   KNGVVFQVDGTLMAPDGPDAWPKGYSAHQWLVFYRVYNMSLQGNGLIDGRGQKWWDLPCK  205

Query  1022  PHRGVNGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKA  843
             PH+G    T+ GPCDSP+AIRFF SS L V+ ++IK+SP FHFRFDNC DV+IDSL+I +
Sbjct  206   PHKG---KTMTGPCDSPIAIRFFMSSELRVEGVRIKDSPQFHFRFDNCKDVYIDSLHITS  262

Query  842   PPNSPNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLG  663
             P  SPNTDGIHIENT  V I NSIV+NGDDC+SIG+G +NV+IRN+TCGPGHGISIGSLG
Sbjct  263   PALSPNTDGIHIENTNGVQIFNSIVANGDDCVSIGSGSFNVEIRNITCGPGHGISIGSLG  322

Query  662   IKQSRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYY  483
                SRACVSNI V DS I+ SDNGVRIKTWQGGFG V  V+F+NI MDNVRNPII+DQ+Y
Sbjct  323   NHNSRACVSNITVRDSIIKVSDNGVRIKTWQGGFGTVRGVSFNNINMDNVRNPIIIDQFY  382

Query  482   CSNKACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGH  303
             C NK C NQTSAV +SD+SY +IKGT+D RSPPM   CSDS+PC NLTL+ +EL+PS+G 
Sbjct  383   CLNKGCLNQTSAVVVSDISYIDIKGTYDIRSPPMHFGCSDSMPCMNLTLANIELFPSRGD  442

Query  302   RMLDPFCWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
              +LDPFCWNAYG+L+T+TIPP+ CLLE + +S    + D C
Sbjct  443   ILLDPFCWNAYGNLQTLTIPPISCLLETSSRSFLESEKDYC  483



>ref|XP_004148582.1| PREDICTED: polygalacturonase At1g48100-like [Cucumis sativus]
Length=483

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/401 (66%), Positives = 319/401 (80%), Gaps = 9/401 (2%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTP------ILLAPKHHSFLIQSTIFTGPC  1203
             +V  +G IGDG ADDT AFK AWD ACQ +         ++L P   SF+IQSTIFTGPC
Sbjct  86    DVRHFGAIGDGTADDTAAFKMAWDTACQRNDDDNNDDYGVILVPYGFSFMIQSTIFTGPC  145

Query  1202  KNPLLFQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCK  1023
             KN ++FQ++GT+M PDGPD+WPK  +  QWLVFYRV  MS+QG GLIDGRG+KWW+LPCK
Sbjct  146   KNGVVFQVDGTLMAPDGPDAWPKGYSAHQWLVFYRVYNMSLQGNGLIDGRGQKWWDLPCK  205

Query  1022  PHRGVNGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKA  843
             PH+G    T+ GPCDSP+AIRFF SS L V+ ++IK+SP FHFRFDNC DV+IDSL+I +
Sbjct  206   PHKG---KTMTGPCDSPIAIRFFMSSELRVEGVRIKDSPQFHFRFDNCKDVYIDSLHITS  262

Query  842   PPNSPNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLG  663
             P  SPNTDGIHIENT  V I NSIV+NGDDC+SIG+G +NV+IRN+TCGPGHGISIGSLG
Sbjct  263   PALSPNTDGIHIENTNGVQIFNSIVANGDDCVSIGSGSFNVEIRNITCGPGHGISIGSLG  322

Query  662   IKQSRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYY  483
                SRACVSNI V DS I+ SDNGVRIKTWQGGFG V  V+F+NI MDNVRNPII+DQ+Y
Sbjct  323   NHNSRACVSNITVRDSIIKVSDNGVRIKTWQGGFGTVRGVSFNNINMDNVRNPIIIDQFY  382

Query  482   CSNKACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGH  303
             C NK C NQTSAV +SD+SY +IKGT+D RSPPM   CSDS+PC NLTL+ +EL+PS+G 
Sbjct  383   CLNKGCLNQTSAVVVSDISYIDIKGTYDIRSPPMHFGCSDSMPCMNLTLANIELFPSRGD  442

Query  302   RMLDPFCWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
              +LDPFCWNAYG+L+T+TIPP+ CLLE + +S    + D C
Sbjct  443   ILLDPFCWNAYGNLQTLTIPPISCLLETSSRSFLESEKDYC  483



>emb|CDX77909.1| BnaC03g53100D [Brassica napus]
Length=491

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/399 (65%), Positives = 326/399 (82%), Gaps = 4/399 (1%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQS--DLTPILLAPKHHSFLIQSTIFTGPCKNPL  1191
             +V  +G +GDG ADDT AFK AWD +C +  D   +LL P  ++F+IQSTIFTGPC +  
Sbjct  90    DVRKFGAVGDGAADDTEAFKTAWDSSCSNGNDTVSVLLVPYGYTFMIQSTIFTGPCHSYQ  149

Query  1190  LFQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRG  1011
             LFQ++GTI+ PDGP+SWP N++KRQWLVFYRVNGM+++G G+IDGRG+KWW+LPCKPHR 
Sbjct  150   LFQVDGTIVTPDGPESWPSNISKRQWLVFYRVNGMALKGAGVIDGRGQKWWDLPCKPHRT  209

Query  1010  VNGTTL-PGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPN  834
             VN + +  GPCDSP+A+RFF SSNLTV+ L+IKNSP FHFRFD C  VH++SL+I APP 
Sbjct  210   VNKSAIVAGPCDSPIALRFFMSSNLTVEGLQIKNSPQFHFRFDGCQGVHVESLHITAPPL  269

Query  833   SPNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPG-HGISIGSLGIK  657
             SPNTDGIHIEN+  VTI+NS++SNGDDC+SIG+G Y+VDIRN+TCGPG HGISIGSLG  
Sbjct  270   SPNTDGIHIENSNSVTIYNSVISNGDDCVSIGSGSYDVDIRNLTCGPGGHGISIGSLGNH  329

Query  656   QSRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCS  477
              S ACVSNI V DS I+ S+NGVRIKTWQGGFG+VS VTF+NI +++VRNPII+DQYYC 
Sbjct  330   NSHACVSNITVRDSVIKYSNNGVRIKTWQGGFGSVSGVTFNNIHVESVRNPIIIDQYYCM  389

Query  476   NKACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRM  297
              K C+N+TSAV++SD++Y  IKGT+D RSPPM   CSD+VPCTNLTLS +EL P +G  +
Sbjct  390   TKDCSNKTSAVFVSDIAYQGIKGTYDIRSPPMHFGCSDAVPCTNLTLSGIELLPEKGEIV  449

Query  296   LDPFCWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             +DPFCWNAYG ++ ++IPPV+CL+   P +L    V++C
Sbjct  450   VDPFCWNAYGIVEELSIPPVWCLMSDPPTALQGALVNKC  488



>gb|KGN58536.1| hypothetical protein Csa_3G664600 [Cucumis sativus]
Length=469

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/401 (66%), Positives = 319/401 (80%), Gaps = 9/401 (2%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTP------ILLAPKHHSFLIQSTIFTGPC  1203
             +V  +G IGDG ADDT AFK AWD ACQ +         ++L P   SF+IQSTIFTGPC
Sbjct  72    DVRHFGAIGDGTADDTAAFKMAWDTACQRNDDDNNDDYGVILVPYGFSFMIQSTIFTGPC  131

Query  1202  KNPLLFQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCK  1023
             KN ++FQ++GT+M PDGPD+WPK  +  QWLVFYRV  MS+QG GLIDGRG+KWW+LPCK
Sbjct  132   KNGVVFQVDGTLMAPDGPDAWPKGYSAHQWLVFYRVYNMSLQGNGLIDGRGQKWWDLPCK  191

Query  1022  PHRGVNGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKA  843
             PH+G    T+ GPCDSP+AIRFF SS L V+ ++IK+SP FHFRFDNC DV+IDSL+I +
Sbjct  192   PHKG---KTMTGPCDSPIAIRFFMSSELRVEGVRIKDSPQFHFRFDNCKDVYIDSLHITS  248

Query  842   PPNSPNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLG  663
             P  SPNTDGIHIENT  V I NSIV+NGDDC+SIG+G +NV+IRN+TCGPGHGISIGSLG
Sbjct  249   PALSPNTDGIHIENTNGVQIFNSIVANGDDCVSIGSGSFNVEIRNITCGPGHGISIGSLG  308

Query  662   IKQSRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYY  483
                SRACVSNI V DS I+ SDNGVRIKTWQGGFG V  V+F+NI MDNVRNPII+DQ+Y
Sbjct  309   NHNSRACVSNITVRDSIIKVSDNGVRIKTWQGGFGTVRGVSFNNINMDNVRNPIIIDQFY  368

Query  482   CSNKACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGH  303
             C NK C NQTSAV +SD+SY +IKGT+D RSPPM   CSDS+PC NLTL+ +EL+PS+G 
Sbjct  369   CLNKGCLNQTSAVVVSDISYIDIKGTYDIRSPPMHFGCSDSMPCMNLTLANIELFPSRGD  428

Query  302   RMLDPFCWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
              +LDPFCWNAYG+L+T+TIPP+ CLLE + +S    + D C
Sbjct  429   ILLDPFCWNAYGNLQTLTIPPISCLLETSSRSFLESEKDYC  469



>ref|XP_006303966.1| hypothetical protein CARUB_v10008847mg, partial [Capsella rubella]
 gb|EOA36864.1| hypothetical protein CARUB_v10008847mg, partial [Capsella rubella]
Length=523

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/399 (65%), Positives = 323/399 (81%), Gaps = 4/399 (1%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEAC--QSDLTPILLAPKHHSFLIQSTIFTGPCKNPL  1191
             NV  +G +GDG  DDT AFK AWD AC  ++    +LL P  ++F+IQSTIFTGPC++  
Sbjct  122   NVRKFGAVGDGETDDTQAFKTAWDSACNNENSTDSVLLVPYGYTFMIQSTIFTGPCRSYQ  181

Query  1190  LFQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRG  1011
              FQ++GTI+ PDGPDSWP N++KRQWLVFYRVNG++++G G+IDGRG+KWW+LPCKPHR 
Sbjct  182   FFQVDGTIVTPDGPDSWPSNVSKRQWLVFYRVNGLALKGAGVIDGRGQKWWDLPCKPHRA  241

Query  1010  VNGTTL-PGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPN  834
             VN + +  GPCDSP+A+RFF SSNL V+ L IKNSP FHFRFD C  VH++SL+I APP 
Sbjct  242   VNKSAIVAGPCDSPIALRFFMSSNLRVEGLHIKNSPQFHFRFDGCQGVHVESLHITAPPL  301

Query  833   SPNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPG-HGISIGSLGIK  657
             SPNTDGIHIEN+  VTI+NSI+SNGDDC+SIG+G Y+VDIRN+TCGPG HGISIGSLG  
Sbjct  302   SPNTDGIHIENSNSVTIYNSIISNGDDCVSIGSGSYDVDIRNLTCGPGGHGISIGSLGNH  361

Query  656   QSRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCS  477
              S ACVSNI V+DS I+ SDNGVRIKTWQGG G+VS VTF+NI +D+VRNPII+DQYYC 
Sbjct  362   NSHACVSNITVSDSIIKYSDNGVRIKTWQGGSGSVSGVTFNNIHVDSVRNPIIIDQYYCM  421

Query  476   NKACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRM  297
              K C N+TSAV++SD++Y  IKGT+D RSPPM   CSD+VPCTNLTLS++EL P++G  +
Sbjct  422   TKDCANKTSAVFVSDIAYQGIKGTYDIRSPPMHFGCSDAVPCTNLTLSDIELLPAKGDIV  481

Query  296   LDPFCWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             LDPFCWNAYG  + ++IPPV+CL+   P +L    VD+C
Sbjct  482   LDPFCWNAYGIAEELSIPPVWCLMSDPPTALQGALVDKC  520



>gb|KFK42608.1| hypothetical protein AALP_AA1G017600 [Arabis alpina]
Length=437

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/400 (65%), Positives = 323/400 (81%), Gaps = 5/400 (1%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQS--DLTPILLAPKHHSFLIQSTIFTGPCKNPL  1191
             NV  +G +GDGV DDT AFK  WD +C +  D   +L  P  ++F+IQSTIFTGPC++  
Sbjct  34    NVRKFGAVGDGVTDDTEAFKTTWDTSCSNANDTVSVLFVPYGYTFMIQSTIFTGPCRSYQ  93

Query  1190  LFQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRG  1011
              FQ++GTI+ PDGP+SWP N++KRQWLVFYRVNGM+++G G+IDGRG+KWW+LPCKPHR 
Sbjct  94    SFQVDGTIITPDGPESWPSNISKRQWLVFYRVNGMALKGAGVIDGRGQKWWDLPCKPHRA  153

Query  1010  VNGTTL-PGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPN  834
             VN + +  GPCDSP+ +RFF SSNLTV+ LKI+NSP FHFRFD C  VH+DSL+I APP 
Sbjct  154   VNKSAIVAGPCDSPITLRFFMSSNLTVEGLKIQNSPQFHFRFDGCQGVHVDSLHITAPPL  213

Query  833   SPNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPG-HGISIGSLGIK  657
             SPNTDGIHIEN+  VTI+NSI+SNGDDC+SIG+G Y+VDIRN+TCGPG HGISIGSLG  
Sbjct  214   SPNTDGIHIENSNSVTIYNSIISNGDDCVSIGSGSYDVDIRNLTCGPGGHGISIGSLGNH  273

Query  656   QSRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCS  477
              S ACVSNI V DS I+ SDNGVRIKTWQGG G+VS VTFDNI M++VRNPII+DQYYC 
Sbjct  274   NSHACVSNITVRDSIIKYSDNGVRIKTWQGGSGSVSGVTFDNIHMESVRNPIIIDQYYCM  333

Query  476   NKACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRM  297
              K C N+TSAV++SD++Y  IKGT+D RSPPM   CSD++PCTNLTLS++EL P++G  +
Sbjct  334   TKDCGNKTSAVFVSDIAYQGIKGTYDIRSPPMHFGCSDAIPCTNLTLSDIELLPAKGEIV  393

Query  296   LDPFCWNAYGDLKTVTIPPVFCLL-EGNPQSLPNVDVDQC  180
             LDPFCWNAYG  + ++IPPV+CL+ +  P +L    VD+C
Sbjct  394   LDPFCWNAYGIAEELSIPPVWCLMSDPPPTALQGALVDKC  433



>ref|XP_010674532.1| PREDICTED: polygalacturonase At1g48100-like [Beta vulgaris subsp. 
vulgaris]
Length=491

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/405 (65%), Positives = 326/405 (80%), Gaps = 11/405 (3%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V S+G  GDG+ DDT+AFK AWD AC+ +    ++ PK +SFL+Q  IFTGPC   ++F
Sbjct  88    DVRSFGATGDGLTDDTIAFKSAWDAACKVENNAKIVVPKGYSFLLQPLIFTGPCNVGVVF  147

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             QIEG+IM PDGP+SWPKN +KRQW++FYR++G+++QGGGLIDGRGEKWWNLPCK H+G+N
Sbjct  148   QIEGSIMAPDGPESWPKNSSKRQWIIFYRIHGLTLQGGGLIDGRGEKWWNLPCKHHKGIN  207

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             GTT+ GPCDSPVAIRFF S+NLT++ +K+ NSP FH RFD C +V +DS+ IK+P NSPN
Sbjct  208   GTTMSGPCDSPVAIRFFGSTNLTMRGIKVINSPQFHIRFDVCQNVSVDSIVIKSPGNSPN  267

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIH+ENT DV IHNS++SNGDDCISIGAG +N+DI+N+TCGP HGISIGSLGI  S+A
Sbjct  268   TDGIHVENTNDVMIHNSVISNGDDCISIGAGSHNLDIKNITCGPSHGISIGSLGIHNSKA  327

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI VT+  I++SDNGVRIKTWQGG G+VS VTF+ I MD VRNPII+DQYYC +  C
Sbjct  328   CVSNITVTNCLIKHSDNGVRIKTWQGGSGSVSAVTFEAIHMDTVRNPIIIDQYYCLSSNC  387

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYP--------SQ  309
             +NQTSA+ I+ +SYSNIKGT+D R+PP+RLACSDSV CTN+TLS +EL P        SQ
Sbjct  388   SNQTSAISINTISYSNIKGTYDPRTPPVRLACSDSVACTNITLSGLELLPAVPTSPVTSQ  447

Query  308   GHRMLDPFCWNAYG-DLKTVTIPPVFCLLEGNPQ-SLPNVDVDQC  180
              H+ L PFCWNAYG  L  +T PPV+CLLEG P   +   D+ QC
Sbjct  448   KHK-LQPFCWNAYGSSLGDMTTPPVYCLLEGLPYLDVSGSDIGQC  491



>ref|XP_010480981.1| PREDICTED: polygalacturonase At1g48100-like [Camelina sativa]
Length=491

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/399 (65%), Positives = 323/399 (81%), Gaps = 4/399 (1%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEAC--QSDLTPILLAPKHHSFLIQSTIFTGPCKNPL  1191
             NV  +G +GDG  DDT AFK AWD AC  +++   +LL P  ++F+IQSTIFTGPC++  
Sbjct  90    NVRKFGAVGDGETDDTEAFKTAWDSACNNENNTDSVLLVPYGYTFMIQSTIFTGPCRSYQ  149

Query  1190  LFQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRG  1011
              FQ++GTI+ PDGP+SWP N++KRQWLVFYRV+GM+++G G+IDGRG+KWW+LPCKPHR 
Sbjct  150   FFQVDGTIVTPDGPESWPSNVSKRQWLVFYRVDGMALKGAGVIDGRGQKWWDLPCKPHRT  209

Query  1010  VNGTTL-PGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPN  834
             VN + +  GPCDSP+A+RFF SSNL V+ L+IKNSP FHFRFD C  VH+DSL+I APP 
Sbjct  210   VNKSAIVAGPCDSPIALRFFMSSNLRVEGLQIKNSPQFHFRFDGCQGVHVDSLHITAPPL  269

Query  833   SPNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPG-HGISIGSLGIK  657
             SPNTDGIHIEN+  VTI+NSI+SNGDDC+SIG+G Y+VDIRN+TCGPG HGISIGSLG  
Sbjct  270   SPNTDGIHIENSNSVTIYNSIISNGDDCVSIGSGSYDVDIRNLTCGPGGHGISIGSLGNH  329

Query  656   QSRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCS  477
              S ACVSNI V DS I+ SDNGVRIKTWQGG G+VS VTF+NI +D+VRNPII+DQYYC 
Sbjct  330   NSHACVSNITVRDSIIKYSDNGVRIKTWQGGSGSVSGVTFNNIHVDSVRNPIIIDQYYCM  389

Query  476   NKACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRM  297
              K C N+TSAV++SD++Y  I+GT+D RSPPM   CSD+VPCTNLTLS++EL P++G  +
Sbjct  390   TKDCANKTSAVFVSDIAYQGIRGTYDIRSPPMHFGCSDAVPCTNLTLSDIELLPAKGDIV  449

Query  296   LDPFCWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
              DPFCWNAYG  + ++IPPV+CL+   P +L    VD+C
Sbjct  450   FDPFCWNAYGIAEELSIPPVWCLMSDPPTALQGALVDKC  488



>ref|XP_006577178.1| PREDICTED: polygalacturonase At1g48100-like isoform X2 [Glycine 
max]
Length=447

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/396 (66%), Positives = 318/396 (80%), Gaps = 16/396 (4%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSD-LTPILLAPKHHSFLIQSTIFTGPCKNPLL  1188
             ++  +G IGDG  DDT +FK AWD ACQS+    ++L P+  SFL+QSTIFTGPC+  L 
Sbjct  67    DLRKFGAIGDGETDDTESFKMAWDSACQSESAVNVILVPQGFSFLVQSTIFTGPCQGVLE  126

Query  1187  FQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGV  1008
              +++GT+MPPDGP+SWPKN ++ QWLVFYR+NGMS++G GLIDGRGEKWW+LPCKPH+  
Sbjct  127   LKVDGTLMPPDGPESWPKNNSRHQWLVFYRINGMSLEGSGLIDGRGEKWWDLPCKPHK--  184

Query  1007  NGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSP  828
                          AIRFF SSNLTVQ L+IKNSP FHFRFD C +VHI+S+YI AP  SP
Sbjct  185   -------------AIRFFMSSNLTVQGLRIKNSPQFHFRFDGCKNVHIESIYITAPKLSP  231

Query  827   NTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSR  648
             NTDGIHIENT DV I+NS++SNGDDC+SIG+GC +VDI+N+TCGPGHGISIGSLG   SR
Sbjct  232   NTDGIHIENTNDVKIYNSVISNGDDCVSIGSGCNDVDIKNITCGPGHGISIGSLGNHNSR  291

Query  647   ACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKA  468
             ACVSNI V DS I+ +DNGVRIKTWQGG G+VS VTF NI M +VRNPII+DQ+YC  K 
Sbjct  292   ACVSNIMVRDSFIKVTDNGVRIKTWQGGSGSVSGVTFSNIHMVSVRNPIIIDQFYCLTKE  351

Query  467   CTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDP  288
             CTN++SAV +S++ Y+NIKGT+D RSPPMR ACSDSVPCTNLTLS++EL PSQG  + DP
Sbjct  352   CTNKSSAVSVSNIIYTNIKGTYDIRSPPMRFACSDSVPCTNLTLSDIELLPSQGDIVHDP  411

Query  287   FCWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             FCWNAYGDL+T+TIPPV CLLE  PQ + + D+ +C
Sbjct  412   FCWNAYGDLETLTIPPVSCLLESTPQLVLDYDITRC  447



>ref|XP_010474661.1| PREDICTED: polygalacturonase At1g48100-like [Camelina sativa]
Length=491

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/399 (65%), Positives = 323/399 (81%), Gaps = 4/399 (1%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEAC--QSDLTPILLAPKHHSFLIQSTIFTGPCKNPL  1191
             NV  +G +GDG  DDT AFK AWD AC  +++   +LL P  ++F+IQSTIFTGPC++  
Sbjct  90    NVRKFGAVGDGETDDTEAFKTAWDSACNNENNTDSVLLVPYGYTFMIQSTIFTGPCRSYQ  149

Query  1190  LFQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRG  1011
              FQ++GTI+ PDGP+SWP N++KRQWLVFYRV+GM+++G G+IDGRG+KWW+LPCKPHR 
Sbjct  150   FFQVDGTIVTPDGPESWPSNVSKRQWLVFYRVDGMALKGAGVIDGRGQKWWDLPCKPHRT  209

Query  1010  VNGTTL-PGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPN  834
             VN + +  GPCDSP+A+RFF SSNL V+ L+IKNSP FHFRFD C  VH+DSL+I APP 
Sbjct  210   VNKSAIVTGPCDSPIALRFFMSSNLRVEGLQIKNSPQFHFRFDGCQGVHVDSLHITAPPL  269

Query  833   SPNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPG-HGISIGSLGIK  657
             SPNTDGIHIEN+  VTI+NSI+SNGDDC+SIG+G Y+VDIRN+TCGPG HGISIGSLG  
Sbjct  270   SPNTDGIHIENSNSVTIYNSIISNGDDCVSIGSGSYDVDIRNLTCGPGGHGISIGSLGNH  329

Query  656   QSRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCS  477
              S ACVSNI V DS I+ SDNGVRIKTWQGG G+VS VTF+NI +D+VRNPII+DQYYC 
Sbjct  330   NSHACVSNITVRDSIIKYSDNGVRIKTWQGGSGSVSGVTFNNIHVDSVRNPIIIDQYYCM  389

Query  476   NKACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRM  297
              K C N+TSAV++SD++Y  I+GT+D RSPPM   CSD+VPCTNLTLS++EL P++G  +
Sbjct  390   TKDCANKTSAVFVSDIAYQGIRGTYDIRSPPMHFGCSDAVPCTNLTLSDIELLPAKGDIV  449

Query  296   LDPFCWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
              DPFCWNAYG  + ++IPPV+CL+   P +L    VD+C
Sbjct  450   FDPFCWNAYGIAEELSIPPVWCLMSDPPTALQRALVDKC  488



>ref|XP_010522843.1| PREDICTED: polygalacturonase At1g48100-like [Tarenaya hassleriana]
Length=485

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/399 (65%), Positives = 323/399 (81%), Gaps = 4/399 (1%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSD--LTPILLAPKHHSFLIQSTIFTGPCKNPL  1191
             +V  +G +GDGV DDT AFK AWD AC ++   T +LL P   +F+IQSTIFTGPC++  
Sbjct  85    DVRKFGAVGDGVTDDTEAFKTAWDSACSNENVTTSVLLVPYGFTFMIQSTIFTGPCRSYQ  144

Query  1190  LFQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRG  1011
             + Q++GTI+PPDGP+SWP N++KRQWLVFYR+NGMS++G G+IDGRG+KWW+LPCKPHR 
Sbjct  145   ILQVDGTIVPPDGPESWPSNISKRQWLVFYRINGMSLKGAGVIDGRGQKWWDLPCKPHRS  204

Query  1010  VNGTT-LPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPN  834
              N T  + GPCDSP+AIRFF SSNLTV+ L+IKNSP FHFRFD C DVH+ SL+I AP  
Sbjct  205   ANKTEYVVGPCDSPIAIRFFMSSNLTVEGLRIKNSPQFHFRFDGCKDVHVHSLHITAPAL  264

Query  833   SPNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPG-HGISIGSLGIK  657
             SPN DGIH+EN+  V I+NS++SNGDDC+SIG+G Y+VDIRN+TCGPG HGISIGSLG  
Sbjct  265   SPNPDGIHVENSNSVQIYNSVISNGDDCVSIGSGSYDVDIRNLTCGPGGHGISIGSLGNH  324

Query  656   QSRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCS  477
              SRACVSNI V DS I+ S NGVRIKTWQGG GAVS VTF NI +DNVRNP+I+DQYYC 
Sbjct  325   NSRACVSNITVRDSVIKQSANGVRIKTWQGGSGAVSGVTFSNIHVDNVRNPMIIDQYYCL  384

Query  476   NKACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRM  297
             ++ C+N+TSAV++SD++Y +IKGT+D RSPPM   CSDSVPCTNLTLS++EL P+ G  +
Sbjct  385   SRDCSNKTSAVFVSDITYESIKGTYDIRSPPMHFGCSDSVPCTNLTLSDIELLPAIGDIV  444

Query  296   LDPFCWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             LDPFCW AYG+ + +TIPP+ CL+   P SL +  ++QC
Sbjct  445   LDPFCWKAYGNAEELTIPPISCLMPDPPTSLLDALLEQC  483



>ref|XP_010457225.1| PREDICTED: polygalacturonase At1g48100-like isoform X1 [Camelina 
sativa]
 ref|XP_010457226.1| PREDICTED: polygalacturonase At1g48100-like isoform X2 [Camelina 
sativa]
Length=492

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/399 (65%), Positives = 323/399 (81%), Gaps = 4/399 (1%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEAC--QSDLTPILLAPKHHSFLIQSTIFTGPCKNPL  1191
             NV  +G +GDG  DDT AFK AWD AC  +++   +LL P  ++F+IQSTIFTGPC++  
Sbjct  91    NVRKFGAVGDGETDDTEAFKTAWDSACNNENNTDSVLLVPYGYTFMIQSTIFTGPCRSYQ  150

Query  1190  LFQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRG  1011
              FQ++GTI+ PDGP+SWP N++KRQWLVFYRV+GM+++G G+IDGRG+KWW+LPCKPHR 
Sbjct  151   FFQVDGTIVTPDGPESWPSNVSKRQWLVFYRVDGMALKGAGVIDGRGQKWWDLPCKPHRT  210

Query  1010  VNGTTL-PGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPN  834
             VN + +  GPCDSP+A+RFF SSNL V+ L+IKNSP FHFRFD C  VH+DSL+I APP 
Sbjct  211   VNKSAIVTGPCDSPIALRFFMSSNLRVEGLQIKNSPQFHFRFDGCQGVHVDSLHITAPPL  270

Query  833   SPNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPG-HGISIGSLGIK  657
             SPNTDGIHIEN+  VTI+NSI+SNGDDC+SIG+G Y+VDIRN+TCGPG HGISIGSLG  
Sbjct  271   SPNTDGIHIENSNSVTIYNSIISNGDDCVSIGSGSYDVDIRNLTCGPGGHGISIGSLGNH  330

Query  656   QSRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCS  477
              S ACVSNI V DS I+ SDNGVRIKTWQGG G+VS VTF+NI +D+VRNPII+DQYYC 
Sbjct  331   NSHACVSNITVRDSIIKYSDNGVRIKTWQGGSGSVSGVTFNNIHVDSVRNPIIIDQYYCM  390

Query  476   NKACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRM  297
              K C N+TSAV++SD++Y  I+GT+D RSPPM   CSD+VPCTNLTLS++EL P++G  +
Sbjct  391   TKDCANKTSAVFVSDIAYQGIRGTYDIRSPPMHFGCSDAVPCTNLTLSDIELLPAKGDIV  450

Query  296   LDPFCWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
              DPFCWNAYG  + ++IPPV+CL+   P +L    VD+C
Sbjct  451   FDPFCWNAYGIAEELSIPPVWCLMSDPPTALQGALVDKC  489



>ref|XP_009391520.1| PREDICTED: polygalacturonase At1g48100-like [Musa acuminata subsp. 
malaccensis]
Length=532

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/395 (67%), Positives = 321/395 (81%), Gaps = 1/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V ++G +GDGVADDT AFK AWD ACQ D    +L P+ ++F I STIF GPC + L F
Sbjct  138   DVRAFGAVGDGVADDTEAFKTAWDIACQ-DGPGTILVPQGYAFKILSTIFAGPCHSELTF  196

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++GTIMPPDGPD WP+N  +RQWLVFYR NG+ +QG G+IDGRGEKWWNLPCKPH+G N
Sbjct  197   QVDGTIMPPDGPDEWPRNNNRRQWLVFYRANGLKLQGRGVIDGRGEKWWNLPCKPHKGPN  256

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             GTTL GPCDSPVA+RFF SSNL V  ++++NSP FHFRFDNC +V +D++ I +P  SPN
Sbjct  257   GTTLSGPCDSPVALRFFMSSNLIVHGIRVQNSPQFHFRFDNCRNVTVDAISISSPALSPN  316

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIH+ENT  V I+NS++S+GDDCISIGAG  N+DIRN+TCGP HGISIGSLG K +RA
Sbjct  317   TDGIHVENTEMVGIYNSVISSGDDCISIGAGSINIDIRNVTCGPSHGISIGSLGTKNTRA  376

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CV+NI V +S IR+SDNGVRIKTWQGG G+VS V+FDNIRMD V+NPII+DQYYC +K+C
Sbjct  377   CVTNITVKNSVIRHSDNGVRIKTWQGGSGSVSSVSFDNIRMDAVKNPIIIDQYYCLSKSC  436

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQTSAVY+SDVSY+ IKGT+D RSPP+   CSDSVPCTN+TLSEV L P+Q + + +PF
Sbjct  437   KNQTSAVYVSDVSYTGIKGTYDVRSPPIHFGCSDSVPCTNITLSEVVLLPAQAYFISNPF  496

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWN YG + T TIPPV CLLEG P S+  +  D+C
Sbjct  497   CWNVYGVMATQTIPPVSCLLEGFPSSIMAIGSDRC  531



>emb|CDX89966.1| BnaA10g01160D [Brassica napus]
Length=491

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/399 (64%), Positives = 322/399 (81%), Gaps = 4/399 (1%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEAC--QSDLTPILLAPKHHSFLIQSTIFTGPCKNPL  1191
             NV  +G +GDGV DDT AFK AWD +C  Q+D   +L  P  ++F+I STIFTGPC +  
Sbjct  90    NVRKFGAVGDGVTDDTEAFKTAWDSSCSNQNDTVSVLFVPYGYTFMIHSTIFTGPCHSYQ  149

Query  1190  LFQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRG  1011
             + Q++GTI+ PDGP+SWP N++KRQWLVFYRVNGM+++G G+IDGRG+KWW+LPCKPHR 
Sbjct  150   ILQVDGTIITPDGPESWPSNISKRQWLVFYRVNGMALKGAGVIDGRGQKWWDLPCKPHRS  209

Query  1010  VNGTTL-PGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPN  834
             VN + +  GPCDSP+A+RFF SSNLTV+ L IKNSP F+FRFD C  VH++SL+I APP 
Sbjct  210   VNKSAIFAGPCDSPIALRFFMSSNLTVEGLMIKNSPQFNFRFDGCQGVHVESLHITAPPL  269

Query  833   SPNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPG-HGISIGSLGIK  657
             SPNTDGIHIEN+  VTI+NS++SNGDDC+SIG+G Y+VDIRN+TCGPG HGISIGSLG  
Sbjct  270   SPNTDGIHIENSNSVTIYNSVISNGDDCVSIGSGSYDVDIRNLTCGPGGHGISIGSLGNH  329

Query  656   QSRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCS  477
              S ACVSNI V DS I+ SDNGVRIKTWQGG G+VS VTF+NI +++VRNPII+DQYYC 
Sbjct  330   NSHACVSNITVRDSIIKYSDNGVRIKTWQGGSGSVSGVTFNNIHVESVRNPIIIDQYYCM  389

Query  476   NKACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRM  297
              K C+N+TSAV++SD++Y  IKGT+D RSPPM   CSD++PCTNLTLS +EL P++G  +
Sbjct  390   TKDCSNKTSAVFVSDIAYQGIKGTYDIRSPPMHFGCSDAIPCTNLTLSGIELLPAKGDIV  449

Query  296   LDPFCWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             LDPFCWNAYG  + ++IPPV+CL+   P +L    VD+C
Sbjct  450   LDPFCWNAYGLAEELSIPPVWCLMSDPPTALQGALVDKC  488



>ref|XP_010544140.1| PREDICTED: polygalacturonase At1g48100 [Tarenaya hassleriana]
Length=457

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/397 (65%), Positives = 319/397 (80%), Gaps = 3/397 (1%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQ--SDLTPILLAPKHHSFLIQSTIFTGPCKNPL  1191
             +V S+G +GD VADDT AFK AWD AC+  S    ++L P    FL+   IF GPC + L
Sbjct  62    DVTSFGAVGDCVADDTSAFKMAWDSACERSSPELSVVLVPYSFCFLVNPAIFNGPCNSQL  121

Query  1190  LFQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRG  1011
             + QI+G I+PP+GP+SWP N  KRQWL+FYRV+G+S+QG G+I+GRG+KWW+LPCKPH+G
Sbjct  122   VLQIDGIIVPPEGPESWPWN-NKRQWLMFYRVHGLSLQGSGVINGRGQKWWDLPCKPHKG  180

Query  1010  VNGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNS  831
             +NGT   G CDSPVA+RFF SSNLT++ L  K+SP FH RFDNC DV +DS+ IKAP +S
Sbjct  181   INGTIQTGSCDSPVAVRFFQSSNLTIRGLSFKDSPQFHVRFDNCSDVLVDSVAIKAPASS  240

Query  830   PNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQS  651
             PNTDGIHIENT +V IHNS++S+GDDCISIGA C+NVDI+N+TCGP HGISIGSLG+  S
Sbjct  241   PNTDGIHIENTNNVQIHNSVISSGDDCISIGARCFNVDIQNITCGPSHGISIGSLGVHNS  300

Query  650   RACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNK  471
             RACVSNI VT+STIR+SDNGVRIKTWQGG G VS++ F NI MDNVRNPII+DQYYC  K
Sbjct  301   RACVSNITVTNSTIRDSDNGVRIKTWQGGSGTVSRIVFSNILMDNVRNPIIIDQYYCQTK  360

Query  470   ACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLD  291
              CTNQTSAV +SDV Y++IKGT++ +SPPM  ACSDSVPCT+L L++VEL+PS+G  + +
Sbjct  361   NCTNQTSAVLVSDVLYAHIKGTYNLKSPPMHFACSDSVPCTDLKLADVELFPSKGQILAN  420

Query  290   PFCWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             PFCWNAYG ++T+TIPPV+CLLE  P  +   D   C
Sbjct  421   PFCWNAYGSVQTLTIPPVYCLLEQFPGLVTEEDALGC  457



>ref|XP_009119629.1| PREDICTED: polygalacturonase At1g48100 [Brassica rapa]
Length=497

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/399 (64%), Positives = 322/399 (81%), Gaps = 4/399 (1%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEAC--QSDLTPILLAPKHHSFLIQSTIFTGPCKNPL  1191
             NV  +G +GDGV DDT AFK AWD +C  Q+D   +L  P  ++F+I STIFTGPC +  
Sbjct  96    NVRKFGAVGDGVTDDTEAFKTAWDSSCSNQNDTVSVLFVPYGYTFMIHSTIFTGPCHSYQ  155

Query  1190  LFQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRG  1011
             + Q++GTI+ PDGP+SWP N++KRQWLVFYRVNGM+++G G+IDGRG+KWW+LPCKPHR 
Sbjct  156   ILQVDGTIITPDGPESWPSNISKRQWLVFYRVNGMALKGAGVIDGRGQKWWDLPCKPHRS  215

Query  1010  VNGTTL-PGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPN  834
             VN + +  GPCDSP+A+RFF SSNLTV+ L IKNSP F+FRFD C  VH++SL+I APP 
Sbjct  216   VNKSAIFAGPCDSPIALRFFMSSNLTVEGLMIKNSPQFNFRFDGCQGVHVESLHITAPPL  275

Query  833   SPNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPG-HGISIGSLGIK  657
             SPNTDGIHIEN+  VTI+NS++SNGDDC+SIG+G Y+VDIRN+TCGPG HGISIGSLG  
Sbjct  276   SPNTDGIHIENSNSVTIYNSVISNGDDCVSIGSGSYDVDIRNLTCGPGGHGISIGSLGNH  335

Query  656   QSRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCS  477
              S ACVSNI V DS I+ SDNGVRIKTWQGG G+VS VTF+NI +++VRNPII+DQYYC 
Sbjct  336   NSHACVSNITVRDSIIKYSDNGVRIKTWQGGSGSVSGVTFNNIHVESVRNPIIIDQYYCM  395

Query  476   NKACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRM  297
              K C+N+TSAV++SD++Y  IKGT+D RSPPM   CSD++PCTNLTLS +EL P++G  +
Sbjct  396   TKDCSNKTSAVFVSDIAYQGIKGTYDIRSPPMHFGCSDAIPCTNLTLSGIELLPAKGDIV  455

Query  296   LDPFCWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             LDPFCWNAYG  + ++IPPV+C +   P +LP   VD+C
Sbjct  456   LDPFCWNAYGLAEELSIPPVWCPMSDPPTALPGALVDKC  494



>ref|XP_010914688.1| PREDICTED: polygalacturonase At1g48100-like [Elaeis guineensis]
Length=466

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/387 (65%), Positives = 312/387 (81%), Gaps = 1/387 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V S+G IGDG  DDT AF+ AW  AC ++ + ILL P    F+I STIF+GPC+   +F
Sbjct  73    DVRSFGAIGDGSTDDTQAFREAWKAACAAE-SGILLVPSDGDFMITSTIFSGPCQPGFVF  131

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++G +MPPDGPD WP++ +KRQWLVFY+++ M+++G G I+G GE WWNLPCKPHRG +
Sbjct  132   QVDGVLMPPDGPDCWPESDSKRQWLVFYKLDVMTLRGEGTIEGNGEDWWNLPCKPHRGPH  191

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             GTTLPGPCDSP  IRFF SSNLTV+DL+I+NSP FH +FD C  VHI+ L I +P  SPN
Sbjct  192   GTTLPGPCDSPALIRFFMSSNLTVKDLRIENSPQFHMKFDGCEGVHIEGLKINSPALSPN  251

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT  V IHNS++SNGDDCISIG GC NVDI N+TCGP HGISIGSLG+  S+A
Sbjct  252   TDGIHIENTKSVGIHNSMISNGDDCISIGTGCSNVDIENVTCGPSHGISIGSLGVHNSQA  311

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI+V ++ IRNSDNGVRIKTWQGG G+V+ ++F+NI M+NV+N II+DQYYC +K C
Sbjct  312   CVSNIRVKNAVIRNSDNGVRIKTWQGGMGSVTSISFENIIMENVKNCIIIDQYYCLSKQC  371

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQTSAVY+ DVSY NIKGT+D RSPP+  ACSD+VPCTN+T+S+VEL P  G  + DPF
Sbjct  372   MNQTSAVYVKDVSYMNIKGTYDVRSPPIHFACSDAVPCTNITMSDVELLPFDGELVDDPF  431

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSL  204
             CWNAYG ++T+TIPP+ CL +G PQS+
Sbjct  432   CWNAYGSMETLTIPPISCLQDGEPQSI  458



>ref|XP_006841586.1| hypothetical protein AMTR_s00003p00198650 [Amborella trichopoda]
 gb|ERN03261.1| hypothetical protein AMTR_s00003p00198650 [Amborella trichopoda]
Length=539

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/395 (64%), Positives = 317/395 (80%), Gaps = 1/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V  +G  GD + DDT A K+AW  AC  ++  ILLAP   +F+IQSTIF GPC+  L+F
Sbjct  146   DVRYFGAKGDAITDDTEALKKAWAAACLVEMA-ILLAPAGFTFMIQSTIFAGPCQPGLIF  204

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++GT+M PDGPDSWPKN ++RQWLVF+R +G+S++GGGLI+G+GEKWWNLPCKPHRGVN
Sbjct  205   QVDGTLMAPDGPDSWPKNNSRRQWLVFFRADGLSLKGGGLIEGKGEKWWNLPCKPHRGVN  264

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G+TLPGPCDSPVAIRFF SSNLT++ LK++NSP FH  FD+C +V +DS++I  P  SPN
Sbjct  265   GSTLPGPCDSPVAIRFFKSSNLTMKGLKLQNSPQFHIIFDSCREVFVDSIFITTPALSPN  324

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIH+ENT  V I+NSI+ NGDDCISIGAGC NVDI+N+TCG  HGISIGSLG   S A
Sbjct  325   TDGIHLENTESVRIYNSIIFNGDDCISIGAGCMNVDIQNVTCGHSHGISIGSLGNHNSHA  384

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             C+S+++V ++ IRNSDNGVRIKTWQGG G V+ V+F +I MDNVRNPII+DQYYC +K C
Sbjct  385   CISDVRVRNTVIRNSDNGVRIKTWQGGAGLVTGVSFKDICMDNVRNPIIIDQYYCLSKDC  444

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQTSAV IS +SYS I+GT+D RSP + LACSD+VPC N++L+E+EL P +G R+  PF
Sbjct  445   RNQTSAVAISGISYSRIQGTYDIRSPAVHLACSDTVPCANISLAEIELIPFKGERIAAPF  504

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNA+G  +T+T PPVFCL EG P+++     D C
Sbjct  505   CWNAFGGSQTLTTPPVFCLQEGVPKAIAETTDDYC  539



>emb|CDY15246.1| BnaC05g01250D [Brassica napus]
Length=491

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/399 (63%), Positives = 321/399 (80%), Gaps = 4/399 (1%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEAC--QSDLTPILLAPKHHSFLIQSTIFTGPCKNPL  1191
             NV  +G +GDGV DDT AFK AWD +C  ++D   +L  P  ++F+I STIFTGPC +  
Sbjct  90    NVRKFGAVGDGVTDDTEAFKTAWDSSCSNKNDTVSVLFVPYGYTFMIHSTIFTGPCHSYQ  149

Query  1190  LFQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRG  1011
             + Q++GTI+ PDGP+SWP N++KRQWLVFYRVNGM+++G G+IDGRG+KWW+LPCKPHR 
Sbjct  150   ILQVDGTIITPDGPESWPSNISKRQWLVFYRVNGMALKGAGVIDGRGQKWWDLPCKPHRS  209

Query  1010  VNGTTL-PGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPN  834
             VN + +  GPCDSP+A+RFF SSNLTV+ L IKNSP F+FRFD C  VH++S++I APP 
Sbjct  210   VNKSAIFAGPCDSPIALRFFMSSNLTVEGLMIKNSPQFNFRFDGCQGVHVESVHITAPPL  269

Query  833   SPNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPG-HGISIGSLGIK  657
             SPNTDGIHIEN+  VTI+NS++SNGDDC+SIG+G Y+VDIRN+TCGPG HGISIGSLG  
Sbjct  270   SPNTDGIHIENSNSVTIYNSVISNGDDCVSIGSGSYDVDIRNLTCGPGGHGISIGSLGNH  329

Query  656   QSRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCS  477
              S ACVSNI V DS I+ SDNGVRIKTWQGG G+VS VTF+NI +++VRNPII+DQYYC 
Sbjct  330   NSHACVSNITVRDSIIKYSDNGVRIKTWQGGSGSVSGVTFNNIHVESVRNPIIIDQYYCM  389

Query  476   NKACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRM  297
              K C+N+TSAV++SD++Y  IKGT+D RSPPM   CSD++PCTNLTLS +EL P++G  +
Sbjct  390   TKDCSNKTSAVFVSDIAYQGIKGTYDIRSPPMHFGCSDAIPCTNLTLSGIELLPAKGDIV  449

Query  296   LDPFCWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
              DPFCWNAYG  + ++IPPV+CL+   P +L    VD+C
Sbjct  450   RDPFCWNAYGLAEELSIPPVWCLMSDPPTALQGALVDKC  488



>ref|XP_006841583.1| hypothetical protein AMTR_s00003p00197210 [Amborella trichopoda]
 gb|ERN03258.1| hypothetical protein AMTR_s00003p00197210 [Amborella trichopoda]
Length=480

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/395 (65%), Positives = 319/395 (81%), Gaps = 1/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V SYG +GD   DDT AF  AW+EACQ++ +  LLAP  ++F I STIF+GPCK    F
Sbjct  87    DVRSYGAVGDCSTDDTQAFIEAWNEACQTE-SGTLLAPSDYNFTITSTIFSGPCKPGFTF  145

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             QI+GT+MPPDGPD WP + +K+QWLVFYRV+GM++QG GLI+G GEKWW+LPCKPHRG N
Sbjct  146   QIDGTLMPPDGPDCWPNDDSKKQWLVFYRVDGMALQGNGLIEGNGEKWWDLPCKPHRGPN  205

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G+TLPGPCDSP  IRFF  SNL VQ L+I NSP FH +FD C +V I++L+I +P  SPN
Sbjct  206   GSTLPGPCDSPALIRFFDCSNLHVQGLRIHNSPQFHVKFDACENVLIENLFIDSPALSPN  265

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIH+ENT  V I+NS++ NGDDC+SIGAGC +VDI N+TCGPGHGISIGSLG+  ++A
Sbjct  266   TDGIHVENTKFVGIYNSVIRNGDDCVSIGAGCSHVDIENITCGPGHGISIGSLGVHHTQA  325

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSN+ VT+  I+NSDNGVRIKTWQGG G+V+ +TF+++ M+NVRN II+DQYYC  K C
Sbjct  326   CVSNVTVTNVVIKNSDNGVRIKTWQGGMGSVTFITFESVLMENVRNCIIIDQYYCFTKGC  385

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
             TNQTSAV++SDV+Y NIKGT+D RSPPM  ACSD+VPCTN+TLSEVEL P +G  + DPF
Sbjct  386   TNQTSAVFVSDVAYRNIKGTYDVRSPPMHFACSDTVPCTNITLSEVELLPYEGEMVADPF  445

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYG ++T+TIPP+ CL +G PQS+    V +C
Sbjct  446   CWNAYGGMETLTIPPITCLQDGAPQSIEESTVYRC  480



>ref|XP_009414160.1| PREDICTED: polygalacturonase At1g48100-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=473

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/391 (64%), Positives = 312/391 (80%), Gaps = 2/391 (1%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V S+G +GDGV DDT AF+ AW  AC  + +  L  P    F+I STIF GPC+  L+F
Sbjct  79    DVRSFGAVGDGVTDDTEAFRSAWRAACSVE-SATLSVPSDGVFMITSTIFPGPCQPGLVF  137

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++G +MPPDGP  WPK+ +K QWLVFY++ GM+++G G I+G GE WW+LPCKPHRG +
Sbjct  138   QVDGVVMPPDGPQCWPKSDSKHQWLVFYQLEGMTLRGEGTIEGNGEDWWSLPCKPHRGPH  197

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G+TLPG CDSPV IRFF S NLTV+DL+I+NSP FH +FD C DVHI+ L I +P  SPN
Sbjct  198   GSTLPGSCDSPVLIRFFMSCNLTVRDLRIENSPQFHIKFDACEDVHIEGLSINSPAFSPN  257

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDG+HIENT  VTI+NS++SNGDDCISIG GC +VDI+N+TCGPGHGISIGSLG+  S A
Sbjct  258   TDGVHIENTRSVTIYNSMISNGDDCISIGPGCSDVDIQNVTCGPGHGISIGSLGMHNSEA  317

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKA-  468
             CVSN+ V ++ IRNSDNGVRIKTWQGG G+VS ++FD + M+NVRN II+DQYYCSNK  
Sbjct  318   CVSNVSVKNAVIRNSDNGVRIKTWQGGMGSVSDISFDTVYMENVRNCIIIDQYYCSNKGY  377

Query  467   CTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDP  288
             C NQ+SAVY+S V+Y+NIKGT+D RSPPM  ACSD++PCTN+T+SEVEL P +G  + DP
Sbjct  378   CQNQSSAVYVSGVTYANIKGTYDVRSPPMHFACSDTLPCTNITMSEVELLPHEGELVDDP  437

Query  287   FCWNAYGDLKTVTIPPVFCLLEGNPQSLPNV  195
             FCWNAYG ++TVTIPP+ CL +G P+SL  +
Sbjct  438   FCWNAYGVMRTVTIPPIPCLQDGQPESLQEI  468



>ref|XP_008781188.1| PREDICTED: polygalacturonase At1g48100-like [Phoenix dactylifera]
Length=469

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/387 (64%), Positives = 311/387 (80%), Gaps = 1/387 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V S+G +GDG ADDT AF+ AW  AC ++ + ILL P    F+I STIFTGPC+  L+F
Sbjct  76    DVRSFGAVGDGSADDTKAFRSAWKAACSAE-SGILLVPSDGVFMITSTIFTGPCQPGLVF  134

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++G +MPPDGPD WP++ +K QWLVFYR++GM+++GGG I+G GE WWNLPCKPHRG N
Sbjct  135   QVDGVLMPPDGPDLWPQSDSKLQWLVFYRLDGMTLRGGGTIEGNGEDWWNLPCKPHRGPN  194

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G+TLPGPC SP  IRFF S NL V+DL+I+NSP FH +FD C  VHI+ L I +P  SPN
Sbjct  195   GSTLPGPCSSPALIRFFMSCNLIVRDLRIENSPQFHIKFDGCEGVHIEGLTINSPALSPN  254

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIH+ENT  V I+NS++SNGDDCISIG GC +VDI N+TCGPGHGISIGSLGI  S+A
Sbjct  255   TDGIHVENTKSVAIYNSMISNGDDCISIGPGCSDVDIENITCGPGHGISIGSLGIHNSQA  314

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSN+ V ++ IR+SDNGVRIKTWQGG G+VS ++FD + M+NV+N II+DQYYC +K C
Sbjct  315   CVSNVAVRNAVIRHSDNGVRIKTWQGGTGSVSSISFDMVYMENVKNCIIIDQYYCLDKKC  374

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              N+TSAVY+ DVSY+NIKGT+D RS P+  ACSD+VPCTN+T+SEVEL P +G  + DPF
Sbjct  375   RNETSAVYVFDVSYTNIKGTYDVRSAPIHFACSDTVPCTNITMSEVELLPYEGELVDDPF  434

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSL  204
             CWNAYG  +T+TIPP+ CL +G PQ+L
Sbjct  435   CWNAYGVTQTLTIPPISCLQDGQPQNL  461



>ref|XP_010921358.1| PREDICTED: polygalacturonase At1g48100-like [Elaeis guineensis]
Length=468

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/387 (64%), Positives = 309/387 (80%), Gaps = 1/387 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V S+G +GDG  DDT AF+ AW EAC  + +  LL P    F+I STIF+GPC+  L+F
Sbjct  75    DVRSFGAVGDGSTDDTEAFRSAWKEACSVE-SGTLLVPSDGVFMITSTIFSGPCQPGLVF  133

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++G +MPPDGPD WP++ +K QWLVFYR++GM+++G G I+G GE+WWNLPCKPHRG N
Sbjct  134   QVDGVLMPPDGPDCWPESDSKLQWLVFYRLDGMTLRGEGTIEGNGEEWWNLPCKPHRGPN  193

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G+TLPGPC SP  IRFF S NLTV+DL I+NSP FH +FD C  VHI+ L I +P  SPN
Sbjct  194   GSTLPGPCSSPALIRFFMSRNLTVRDLCIENSPQFHVKFDGCEGVHIEGLTINSPALSPN  253

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIH+ENT  V I+NS++SNGDDCISIG GC +VDI N+TCGPGHGISIGSLGI  S+A
Sbjct  254   TDGIHVENTKSVAIYNSMISNGDDCISIGPGCSDVDIENITCGPGHGISIGSLGIHNSQA  313

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSN+ V ++ IR+SDNG+RIKTWQGG G VS ++FD + ++NVRN II+DQYYC +K C
Sbjct  314   CVSNVSVRNAVIRHSDNGLRIKTWQGGMGTVSSISFDTVYLENVRNCIIIDQYYCLDKKC  373

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQTSAVY+SDVSY+NIKGT+D RS P+  ACSD+VPCTN+T+SEVEL P +G  + DPF
Sbjct  374   RNQTSAVYVSDVSYTNIKGTYDVRSAPIHFACSDTVPCTNITMSEVELLPYEGELVDDPF  433

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSL  204
             CWNAYG  +T+TIPP+ CL +G PQ+L
Sbjct  434   CWNAYGVTQTLTIPPISCLQDGQPQNL  460



>ref|XP_008223441.1| PREDICTED: polygalacturonase At1g48100 [Prunus mume]
 ref|XP_008223443.1| PREDICTED: polygalacturonase At1g48100 [Prunus mume]
 ref|XP_008223444.1| PREDICTED: polygalacturonase At1g48100 [Prunus mume]
Length=479

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/395 (62%), Positives = 310/395 (78%), Gaps = 1/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             NVM+YG +GDG ADDT AF+ AW EAC  + + ++ AP  +SF I STIF+GPC+  L+F
Sbjct  86    NVMNYGAVGDGSADDTAAFRAAWKEACAVE-SGVVFAPADYSFKITSTIFSGPCQPGLVF  144

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++G +MPP+GP +WPK  +++QWLVFYR++ M+  G G I+G G+KWW+LPCKPHRG N
Sbjct  145   QVDGILMPPEGPQTWPKGDSQKQWLVFYRLDQMTFTGSGTIEGNGQKWWDLPCKPHRGPN  204

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G+TLPGPCDSP  IRFF S+NL V+ L+I+NSP FH +FD C  V I+ L I +P  SPN
Sbjct  205   GSTLPGPCDSPALIRFFMSNNLVVRGLRIQNSPQFHMKFDGCEGVQIEKLSISSPKLSPN  264

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT  V I++S++SNGDDCISIG GC NVDIR +TCGP HGISIGSLG+  S+A
Sbjct  265   TDGIHIENTKSVGIYDSVISNGDDCISIGTGCANVDIRGVTCGPSHGISIGSLGVHNSQA  324

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V D+ IR SDNGVRIKTWQGG G VS + F+NI+M+NV N ++VDQYYC +KAC
Sbjct  325   CVSNITVRDAIIRESDNGVRIKTWQGGTGCVSAIVFENIQMENVMNCLLVDQYYCLSKAC  384

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              N+TSAV+++D++Y NIKGT+D R PP+  ACSD+V CTN+TLSEVELYP +G  M DPF
Sbjct  385   RNETSAVFVTDLTYRNIKGTYDVRRPPIHFACSDTVACTNITLSEVELYPHEGELMDDPF  444

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYG  +T TIPP+ CL EG+P+S+  V    C
Sbjct  445   CWNAYGTQETATIPPIDCLQEGDPESVAEVSQYTC  479



>gb|KFK22235.1| hypothetical protein AALP_AAs42893U000500 [Arabis alpina]
Length=411

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/386 (66%), Positives = 304/386 (79%), Gaps = 3/386 (1%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDL--TPILLAPKHHSFLIQSTIFTGPCKNPL  1191
             +V S+G IGD   DDT AFK AWD AC S    + +LL P    FL++ T F GPC   L
Sbjct  25    DVTSFGAIGDCTTDDTSAFKMAWDAACMSRGVDSALLLVPCTFCFLVKPTSFNGPCGTHL  84

Query  1190  LFQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRG  1011
               QI+G I+ PDGP SWP N  KRQW++FYRVNG+S+QG G+I+GRG+KWWNLPCKPH+G
Sbjct  85    ELQIDGIIVSPDGPRSWPWNY-KRQWIMFYRVNGLSIQGSGVINGRGQKWWNLPCKPHKG  143

Query  1010  VNGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNS  831
              NGTT PGPCDSPV IR F SS + ++ L  +NS  FH RFDNC DV +DS+ IKAP +S
Sbjct  144   PNGTTQPGPCDSPVMIRIFQSSKVRIKGLSFQNSAQFHVRFDNCSDVVVDSVIIKAPASS  203

Query  830   PNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQS  651
             PNTDGIHIENT++V IH+S +SNGDDCISIGAGC+NVDI N+TCGP HGISIGSLG+  S
Sbjct  204   PNTDGIHIENTHNVQIHDSEISNGDDCISIGAGCFNVDITNVTCGPSHGISIGSLGVHNS  263

Query  650   RACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNK  471
              ACVSNI VTDSTI NSDNGVRIKTWQGG G+VSK+ F NI+M NVRNPI++DQYYC  K
Sbjct  264   SACVSNITVTDSTIWNSDNGVRIKTWQGGSGSVSKIVFRNIQMVNVRNPIVIDQYYCQTK  323

Query  470   ACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLD  291
              C NQTSAV ISDV Y+NI+GT+D RSPP+  +CSDS PCTNL L +VEL+PS+G  + +
Sbjct  324   NCANQTSAVIISDVLYANIRGTYDLRSPPIHFSCSDSFPCTNLRLEDVELFPSKGQLLEN  383

Query  290   PFCWNAYGDLKTVTIPPVFCLLEGNP  213
             PFCWNAYG ++T+TIPPV+CLLE  P
Sbjct  384   PFCWNAYGSMQTITIPPVYCLLEELP  409



>ref|XP_007223106.1| hypothetical protein PRUPE_ppa005391mg [Prunus persica]
 gb|EMJ24305.1| hypothetical protein PRUPE_ppa005391mg [Prunus persica]
Length=463

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/395 (62%), Positives = 308/395 (78%), Gaps = 1/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             NVM+YG +GDG ADDT AF+ AW EAC  + + ++ AP  +SF I STIF+GPC+  L+F
Sbjct  70    NVMNYGAVGDGSADDTAAFRAAWKEACAVE-SGVVFAPADYSFKITSTIFSGPCQPGLVF  128

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++G +MPP+GP +WPK  +++QWLVFYR++ M+  G G I+G G+KWW+LPCKPHRG N
Sbjct  129   QVDGILMPPEGPQTWPKGDSQKQWLVFYRLDKMTFTGSGTIEGNGQKWWDLPCKPHRGPN  188

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G+TLPG CDSP  IRFF S+NL V+ L+I+NSP FH +FD C  V I+ L I +P  SPN
Sbjct  189   GSTLPGQCDSPALIRFFMSNNLVVKGLRIQNSPQFHMKFDGCEGVQIEKLSISSPKLSPN  248

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT  V I++S++SNGDDCISIG GC NVDIR +TCGP HGISIGSLG+  S+A
Sbjct  249   TDGIHIENTKSVGIYDSMISNGDDCISIGTGCANVDIRGVTCGPSHGISIGSLGVHNSQA  308

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V D+ IR SDNGVRIKTWQGG G VS + F+NI+M+NV N ++VDQYYC +KAC
Sbjct  309   CVSNITVRDTIIRESDNGVRIKTWQGGTGCVSAIVFENIQMENVMNCLLVDQYYCLSKAC  368

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              N+TSAVY++D++Y NIKGT+D R PP+  ACSD+V CTN+TLSEVELYP +G  M DPF
Sbjct  369   RNETSAVYVTDLTYRNIKGTYDVRRPPIHFACSDTVACTNITLSEVELYPHEGELMDDPF  428

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYG  +T TIPP+ CL +G P+S+  V    C
Sbjct  429   CWNAYGTQETATIPPIDCLRDGEPESVAEVSQYTC  463



>gb|KDP27979.1| hypothetical protein JCGZ_19059 [Jatropha curcas]
Length=485

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/395 (63%), Positives = 308/395 (78%), Gaps = 1/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V SYG +GDG  DDT AF+ AW  AC  + + ++LAP  + F+I STIFTGPCK  L+F
Sbjct  92    DVTSYGAVGDGSTDDTAAFREAWKAACAVE-SGVILAPSGYVFMITSTIFTGPCKPGLVF  150

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             QI+G +MPPDGPDSWPK  +++QWLVFYR++GM++ G G I+G G+KWW+LPCKPHRG N
Sbjct  151   QIDGCLMPPDGPDSWPKADSQKQWLVFYRLDGMTLTGKGTIEGNGDKWWDLPCKPHRGPN  210

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G +  GPCDSP  IRFF SSNL V  L+I+NSP FH +FD C  V I+ L I +P  SPN
Sbjct  211   GGSSKGPCDSPALIRFFMSSNLEVSGLRIQNSPQFHMKFDGCEGVLINQLSISSPKLSPN  270

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT  V I+NS +SNGDDCISIG GC NVDI  +TCGP HGISIGSLG+  S+A
Sbjct  271   TDGIHIENTKTVGIYNSFISNGDDCISIGTGCSNVDIEGVTCGPSHGISIGSLGVHNSQA  330

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V+++ IR+SDNGVRIKTWQGG G VS ++F NI+M+NVRN +I+DQYYC +K C
Sbjct  331   CVSNITVSNAIIRDSDNGVRIKTWQGGTGCVSGISFQNIQMENVRNCMIIDQYYCLSKGC  390

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQTSAV+++DVSY NIKGT+D R+PP+  ACSD+VPCTN+TLSEVEL P +G  + DPF
Sbjct  391   LNQTSAVFVTDVSYKNIKGTYDVRTPPIHFACSDTVPCTNITLSEVELLPEEGELVDDPF  450

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYG  +TVTIPP+ CL +G P+S+  V    C
Sbjct  451   CWNAYGIEETVTIPPLECLRDGEPESVQEVAAYGC  485



>ref|NP_176064.1| pectin lyase-like protein [Arabidopsis thaliana]
 gb|AAG09093.1|AC009323_4 Putative polygalacturonase [Arabidopsis thaliana]
 gb|AEE33427.1| pectin lyase-like protein [Arabidopsis thaliana]
Length=434

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/386 (65%), Positives = 306/386 (79%), Gaps = 4/386 (1%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSD--LTPILLAPKHHSFLIQSTIFTGPCKNPL  1191
             +V S+G IGD   DDT AFK AWD AC S    + +LL P    FL++ T F GPC+  L
Sbjct  49    DVTSFGAIGDCSTDDTSAFKMAWDAACMSTGPKSALLLVPYTFCFLVKPTTFNGPCRTNL  108

Query  1190  LFQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRG  1011
             + QI+G I+ PDGP SWP N  +RQW++FYRVNG+S+QG G+I+GRG+KWWNLPCKPH+G
Sbjct  109   VLQIDGFIVSPDGPRSWPSNY-QRQWMMFYRVNGLSIQGSGVINGRGQKWWNLPCKPHKG  167

Query  1010  VNGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNS  831
             +NGTT  GPCDSPVAIR F SS + +Q +   NS  FH RFDNC DV +DS+ IKAP +S
Sbjct  168   LNGTTQTGPCDSPVAIRLFQSSKVRIQGINFMNSAQFHVRFDNCSDVVVDSVIIKAPASS  227

Query  830   PNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQS  651
             PNTDGIHIENT++V I NS++SNGDDCISIGAGC+NVDI+N+TCGP HGISIGSLG+  S
Sbjct  228   PNTDGIHIENTHNVQIRNSMISNGDDCISIGAGCFNVDIKNVTCGPSHGISIGSLGVHNS  287

Query  650   RACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNK  471
             +A VSNI VT+STI NSDNGVRIKTWQGG G+VS++ F NI M NVRNPI++DQYYC   
Sbjct  288   QAYVSNITVTNSTIWNSDNGVRIKTWQGGSGSVSRIVFSNILMVNVRNPIMIDQYYCQTN  347

Query  470   ACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLD  291
              C NQTSAV ISDV Y+NIKGT+D RSPP+   CSDSVPCTNLTL+EV+L+PS+G  + +
Sbjct  348   NCANQTSAVIISDVLYANIKGTYDLRSPPIHFGCSDSVPCTNLTLTEVDLFPSKGQHLEN  407

Query  290   PFCWNAYGDLKTVTIPPVFCLLEGNP  213
             PFCWNAYG +K +T+PPV+CLL+  P
Sbjct  408   PFCWNAYGSMK-ITVPPVYCLLDAPP  432



>ref|XP_010276517.1| PREDICTED: polygalacturonase At1g48100-like [Nelumbo nucifera]
Length=467

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/387 (65%), Positives = 308/387 (80%), Gaps = 1/387 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V S+G +GDG  DDT AF  AW  AC ++ + +LLAP  + FLI+STIF+GPC+   +F
Sbjct  74    DVTSFGAVGDGSTDDTDAFMAAWKAACAAE-SGVLLAPSDYVFLIRSTIFSGPCRPGFVF  132

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q+EG +MPPDGPD WPK+ + +QWLVFYR++GM++ G G I+G G+KWW LPCKPHRG N
Sbjct  133   QVEGILMPPDGPDCWPKSDSNKQWLVFYRIDGMTLTGCGTIEGNGQKWWELPCKPHRGPN  192

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             GTTLPGPCDSP  IRFF SSN+ V  L+I+NSP FH +FD C +V I+ L I +P  SPN
Sbjct  193   GTTLPGPCDSPALIRFFMSSNVVVSGLRIQNSPQFHMKFDGCEEVLIEQLSISSPARSPN  252

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT  V I+NSI++NGDDCISIG GC  VDI N+TCGP HGISIGSLG+  S+A
Sbjct  253   TDGIHIENTKSVGIYNSIIANGDDCISIGPGCSGVDIENVTCGPSHGISIGSLGVHNSQA  312

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V ++ IRNSDNGVRIKTWQGG G+VS ++F+NI+M+NVRN IIVDQYYC  K C
Sbjct  313   CVSNITVRNALIRNSDNGVRIKTWQGGMGSVSAISFENIQMENVRNCIIVDQYYCFTKGC  372

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQTSAV +++VSY NIKGT+D RSPP+  ACSD+V CTN+TLSEVEL P++G  + DPF
Sbjct  373   LNQTSAVLVTNVSYKNIKGTYDVRSPPIHFACSDTVACTNITLSEVELLPAEGELVDDPF  432

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSL  204
             CWNAYG  +T TIPP+ CLL+G PQS+
Sbjct  433   CWNAYGTQQTATIPPISCLLDGEPQSI  459



>ref|XP_010511313.1| PREDICTED: polygalacturonase At1g48100-like [Camelina sativa]
Length=435

 Score =   528 bits (1361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/386 (65%), Positives = 303/386 (78%), Gaps = 4/386 (1%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQS--DLTPILLAPKHHSFLIQSTIFTGPCKNPL  1191
             +V S+G IGD   DDT AFK AWD AC +    + +LL P    FL++ T F GPC+  L
Sbjct  51    DVTSFGAIGDCATDDTSAFKMAWDAACMTTGSKSSLLLVPDTFCFLVKPTSFNGPCRTQL  110

Query  1190  LFQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRG  1011
             + QI+G I+ PDGP SWP N  +RQW++FYRVNG+S+QG G I+GRG+KWWNLPCKPH+G
Sbjct  111   VLQIDGFIVSPDGPRSWPSNY-QRQWMIFYRVNGLSIQGSGFINGRGQKWWNLPCKPHKG  169

Query  1010  VNGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNS  831
              NGTT  GPCDSPVA R F SS + ++ L   NS  FH RFDNC DV +DS+ IKAP +S
Sbjct  170   QNGTTQTGPCDSPVAFRIFQSSKVRIKGLNFINSAQFHVRFDNCSDVIVDSVTIKAPASS  229

Query  830   PNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQS  651
             PNTDGIHIENT++V IHNS++SNGDDCISIGAGC+NVDI+N+TCGP HGISIGSLG+  S
Sbjct  230   PNTDGIHIENTHNVQIHNSVISNGDDCISIGAGCFNVDIKNVTCGPSHGISIGSLGVHNS  289

Query  650   RACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNK  471
             +A VSNI V +STI NSDNGVRIKTWQGG G+VS++ F NI M NVRNPI++DQYYC  K
Sbjct  290   QAYVSNITVANSTIWNSDNGVRIKTWQGGSGSVSRIVFSNILMVNVRNPIMIDQYYCQTK  349

Query  470   ACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLD  291
              C NQTSAV ISDV Y+NIKGT+D RSPPM+  CSDSVPCTNL L +V+L+PS+G  + +
Sbjct  350   NCANQTSAVIISDVLYANIKGTYDLRSPPMQFGCSDSVPCTNLRLMDVDLFPSKGQLLEN  409

Query  290   PFCWNAYGDLKTVTIPPVFCLLEGNP  213
             PFCWNAYG ++ +T+PPV+CLLE  P
Sbjct  410   PFCWNAYGSMQ-ITVPPVYCLLEALP  434



>ref|XP_009134468.1| PREDICTED: polygalacturonase At1g48100 [Brassica rapa]
Length=486

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/392 (64%), Positives = 314/392 (80%), Gaps = 7/392 (2%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSD----LTPILLAPKHHSFLIQSTIFTGPCKN  1197
             +V +YG IGDG+ DDT AFK AWD AC +D       ILL P   +F+I STIFTGPC++
Sbjct  83    DVRNYGAIGDGITDDTDAFKTAWDSACSNDEDNNTVSILLVPFGFTFVIHSTIFTGPCRS  142

Query  1196  PLLFQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPH  1017
                FQ++GTI+P DGP+SWP    KRQWLVFYR+ GM++ G G+IDGRG+KWW+LPCKPH
Sbjct  143   YQYFQVDGTIVPRDGPESWPSGFNKRQWLVFYRIKGMALIGNGVIDGRGQKWWDLPCKPH  202

Query  1016  RGVNGTT-LPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAP  840
             R VN TT L GPC+SP A+RFF SSNL++Q + IKNSP FH  FD CH+VHI+SL I +P
Sbjct  203   RNVNKTTALTGPCESPAALRFFMSSNLSMQGVTIKNSPQFHMTFDGCHEVHINSLRITSP  262

Query  839   PNSPNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPG-HGISIGSLG  663
             P+SPNTDGIHIEN+  V IHNS++SNGDDC+SIG+G YN+DI N+TCGPG HGISIGSLG
Sbjct  263   PSSPNTDGIHIENSNSVEIHNSVISNGDDCVSIGSGSYNIDILNLTCGPGGHGISIGSLG  322

Query  662   IKQSRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYY  483
              + SRACVSNI V DS I+ SDNGVRIKTWQGG G+VS VTFDNI+MDNVRNPII+DQYY
Sbjct  323   NQNSRACVSNITVRDSFIKFSDNGVRIKTWQGGSGSVSGVTFDNIQMDNVRNPIIIDQYY  382

Query  482   CSNKACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGH  303
             C++K C N+T+AV+++DV Y +IKGT+D RSPPM   CS++VPC NLTLS+++L PS+G 
Sbjct  383   CTSKNCPNKTNAVFVNDVVYQSIKGTYDRRSPPMHFGCSNNVPCVNLTLSDIDLVPSKGE  442

Query  302   RMLDPFCWNAYGDLKTVTIPPVFCLLEGNPQS  207
              ++DPFCWNAYG +  +++P + C L+ NP +
Sbjct  443   MVVDPFCWNAYGVVDELSVPSISC-LKSNPST  473



>ref|XP_010418948.1| PREDICTED: polygalacturonase At1g48100-like [Camelina sativa]
Length=434

 Score =   528 bits (1360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/386 (65%), Positives = 304/386 (79%), Gaps = 4/386 (1%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQS--DLTPILLAPKHHSFLIQSTIFTGPCKNPL  1191
             +V S+G IGD   DDT AFK AWD AC +    + +LL P    FL++ T F GPC+  L
Sbjct  50    DVTSFGAIGDCTTDDTSAFKMAWDAACMTTGSKSSLLLVPDTFCFLVKPTSFNGPCRTQL  109

Query  1190  LFQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRG  1011
             + QI+G I+ PDGP SWP N  +RQW++FYRVNG+S+QG G I+GRG+KWWNLPCKPH+G
Sbjct  110   VLQIDGFIVSPDGPRSWPSNY-QRQWMMFYRVNGLSIQGSGFINGRGQKWWNLPCKPHKG  168

Query  1010  VNGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNS  831
              NGTT  GPCDSPVA R F SS + ++ L   NS  FH RFDNC DV +DS+ IKAP +S
Sbjct  169   PNGTTQTGPCDSPVAFRIFQSSKVRIKGLNFINSAQFHVRFDNCSDVIVDSVTIKAPASS  228

Query  830   PNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQS  651
             PNTDGIHIENT++V IHNS++SNGDDCISIGAGC+NVDI+N+TCGP HGISIGSLG+  S
Sbjct  229   PNTDGIHIENTHNVQIHNSVISNGDDCISIGAGCFNVDIKNVTCGPSHGISIGSLGVHNS  288

Query  650   RACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNK  471
             +A VSNI VT+STI NSDNGVRIKTWQGG G+VS++ F NI M NVRNPI++DQYYC  K
Sbjct  289   QAYVSNITVTNSTIWNSDNGVRIKTWQGGSGSVSRIVFSNILMVNVRNPIMIDQYYCQTK  348

Query  470   ACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLD  291
              CTNQTSAV ISD+ Y+NIKGT+D RSPPM   CSDSVPCTNL L +V+L+PS+G  + +
Sbjct  349   NCTNQTSAVIISDILYANIKGTYDLRSPPMHFGCSDSVPCTNLRLMDVDLFPSKGQLLEN  408

Query  290   PFCWNAYGDLKTVTIPPVFCLLEGNP  213
             PFCWNAYG ++ +T+PPV+CLLE  P
Sbjct  409   PFCWNAYGSMQ-ITVPPVYCLLEALP  433



>gb|EPS62496.1| hypothetical protein M569_12294, partial [Genlisea aurea]
Length=475

 Score =   529 bits (1363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 241/387 (62%), Positives = 312/387 (81%), Gaps = 1/387 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +VM++G +GDG  DDT AF+ AW  ACQ + + ++L P  +SF+I STIF+GPC+  L+ 
Sbjct  87    DVMNFGAVGDGETDDTDAFRSAWKTACQIE-SSVVLVPSGYSFMITSTIFSGPCQRGLVV  145

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++GT+MPPDGPD WP++ ++RQWLVFYR++ M++ G G I+G+G+KWW+LPCKPHRG N
Sbjct  146   QVDGTLMPPDGPDCWPESDSRRQWLVFYRLDEMTLTGTGTIEGKGQKWWDLPCKPHRGPN  205

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G+TLPGPCDSP  IRFF SSNL +  L+I+NSP FH +FD C +V ID L I +P  SPN
Sbjct  206   GSTLPGPCDSPTLIRFFISSNLVLTGLRIQNSPQFHIKFDGCQEVFIDKLSISSPKLSPN  265

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT  V I+NS++ NGDDCISIG GC +VDI ++TCGP HGISIGSLG+  S A
Sbjct  266   TDGIHIENTKSVGIYNSLIGNGDDCISIGPGCSDVDIESVTCGPSHGISIGSLGVHNSHA  325

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V ++ I+NSDNG+RIKTWQGG G+VS +TF+NI+M+NVRN +I+DQYYC  KAC
Sbjct  326   CVSNITVRNAFIKNSDNGLRIKTWQGGTGSVSGITFENIQMENVRNSVIIDQYYCLTKAC  385

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              N+TSAVY++DV+Y NIKGT+D ++PP+  ACS++V CTN+T+SEVEL+P  G  M DPF
Sbjct  386   RNETSAVYLTDVTYRNIKGTYDVQTPPIHFACSETVACTNITMSEVELWPYDGILMDDPF  445

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSL  204
             CWNAYG  +T+TIPP+ CL EG P+SL
Sbjct  446   CWNAYGFQETLTIPPIDCLQEGLPESL  472



>ref|XP_002894668.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70927.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=434

 Score =   527 bits (1358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/386 (65%), Positives = 303/386 (78%), Gaps = 4/386 (1%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQS--DLTPILLAPKHHSFLIQSTIFTGPCKNPL  1191
             +V S+G IGD   DDT AFK AWD AC S    + +LL P    FL++ T F GPC+  L
Sbjct  49    DVTSFGAIGDCATDDTSAFKMAWDVACMSTGSKSALLLVPYTFCFLVKPTTFNGPCRTQL  108

Query  1190  LFQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRG  1011
             + QI+G I+ PDGP SWP N  +RQW++FYRVNG+S+QG G+I+GRG+KWWNLPCKPH+G
Sbjct  109   VLQIDGFILSPDGPGSWPSNY-QRQWMMFYRVNGLSIQGSGVINGRGQKWWNLPCKPHKG  167

Query  1010  VNGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNS  831
             +NGTT PGPCDSPV IR F SS + +Q L   NS  FH RFDNC DV +DS+ IKAP +S
Sbjct  168   INGTTQPGPCDSPVTIRVFQSSKVRIQGLNFMNSAQFHVRFDNCSDVVVDSVTIKAPASS  227

Query  830   PNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQS  651
             PNTDGIHIENT++V IHNS++SNGDDCISIG GC+NVDI+N+TCGP HGISIGSLG+  S
Sbjct  228   PNTDGIHIENTHNVQIHNSVISNGDDCISIGGGCFNVDIQNVTCGPSHGISIGSLGLHNS  287

Query  650   RACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNK  471
             +A VSNI VT+STI NSDNGVRIKTWQGG G+VS++ F NI M NVRNPI++DQYYC   
Sbjct  288   QAYVSNITVTNSTIWNSDNGVRIKTWQGGSGSVSRIVFSNILMVNVRNPIMIDQYYCQTN  347

Query  470   ACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLD  291
              C NQTSAV I DV Y+NIKGT+D RSPPM   CSDSVPCTNL L++V+L+PS+G  + +
Sbjct  348   NCANQTSAVIIRDVLYANIKGTYDLRSPPMHFGCSDSVPCTNLRLADVDLFPSKGQHLEN  407

Query  290   PFCWNAYGDLKTVTIPPVFCLLEGNP  213
             PFCWNAYG  + +T+PPV+CLL+  P
Sbjct  408   PFCWNAYGSTQ-ITVPPVYCLLDAPP  432



>ref|XP_010428904.1| PREDICTED: polygalacturonase At1g48100-like [Camelina sativa]
Length=478

 Score =   529 bits (1362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/390 (63%), Positives = 306/390 (78%), Gaps = 5/390 (1%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSD---LTPILLAPKHHSFLIQSTIFTGPCKNP  1194
             NV  YG +G+GV+DDT +FK+AWD AC +D      +LL P   +F+I STIFTGPC++ 
Sbjct  77    NVRHYGAVGNGVSDDTESFKKAWDSACSNDNNNTVSVLLVPYGFTFMIHSTIFTGPCRSY  136

Query  1193  LLFQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHR  1014
               FQ++GTI+P DGP SWP  L KRQWLVFYRVNGM+++G G+IDGRG+ WW+LPCKPHR
Sbjct  137   QHFQVDGTIVPRDGPKSWPSGLNKRQWLVFYRVNGMALKGVGVIDGRGQTWWDLPCKPHR  196

Query  1013  GVNGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPN  834
              VN T   GPC+SP A+RFF SSNL V+ L IKNSP  H +FD CH VHI+ L I +P +
Sbjct  197   NVNKTAHAGPCESPAALRFFMSSNLIVESLSIKNSPQVHLKFDECHVVHINLLRIISPSS  256

Query  833   SPNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGP-GHGISIGSLGIK  657
             SPNTDGIHIEN+  V I+NS++SNGDDC+SIG G YN+D+RN+TCGP GHGISIGSLG +
Sbjct  257   SPNTDGIHIENSNSVEIYNSVISNGDDCVSIGTGSYNIDVRNLTCGPGGHGISIGSLGDR  316

Query  656   QSRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCS  477
              SRACVSN+ V DS I+ SDNGVRIKTWQGG G+VS VTFDNI MD VRNPII+DQYYC+
Sbjct  317   NSRACVSNVTVRDSVIKFSDNGVRIKTWQGGSGSVSGVTFDNINMDTVRNPIIIDQYYCT  376

Query  476   NKACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRM  297
              K+C N+TSAVY++D+ Y +IKGT+D RSPP+   CS++VPCTNLTLS++EL PS+G   
Sbjct  377   AKSCANKTSAVYVNDIVYQSIKGTYDIRSPPIHFGCSNNVPCTNLTLSDIELLPSKGETD  436

Query  296   LDPFCWNAYGDLKTVTIPPVFCLLEGNPQS  207
             +DPFCWNAYG     ++P V C L+ NP +
Sbjct  437   VDPFCWNAYGITDEFSVPSVSC-LKSNPST  465



>gb|KHN43364.1| Polygalacturonase [Glycine soja]
Length=355

 Score =   523 bits (1348),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/355 (71%), Positives = 288/355 (81%), Gaps = 3/355 (1%)
 Frame = -2

Query  1235  LIQSTIFTGPCKNPLLFQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDG  1056
             +IQST FTGPC + L F+++GTI PPDGPDSWP +  KRQWLVFYR+NGM MQG GLIDG
Sbjct  1     MIQSTTFTGPCNSKLTFKVDGTIWPPDGPDSWPLSSRKRQWLVFYRINGMLMQGSGLIDG  60

Query  1055  RGEKWWNLPCKPHRGVNGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCH  876
             RGEKWWNL  K H+G NG    GP D PVAIRFF SSNL V+ LKIKNSP FHFRFD C 
Sbjct  61    RGEKWWNLSYKSHKGANGAKQLGPGDRPVAIRFFESSNLRVEGLKIKNSPKFHFRFDECQ  120

Query  875   DVHIDSLYIKAPPNSPNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCG  696
             +VH++ L IK+P  SPNTDGIHIENT +V IHNS++SNGDDC+S+GAGCYNVDIRN+TCG
Sbjct  121   NVHVEKLIIKSPALSPNTDGIHIENTTNVNIHNSVISNGDDCVSVGAGCYNVDIRNITCG  180

Query  695   PGHGISIGSLGIKQSRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDN  516
             P HGISIGSLG   SRACVSNI V+DS I++SDNGVRIKTWQGG GAVSKV F+NI+MD 
Sbjct  181   PSHGISIGSLGNYNSRACVSNITVSDSIIKHSDNGVRIKTWQGGRGAVSKVVFNNIQMDT  240

Query  515   VRNPIIVDQYYCSNKACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTL  336
             VRNPII+DQYYC +K C NQ+ AV +S+VSYSNIKGT+DARSPPMR ACSDSVPCTNLTL
Sbjct  241   VRNPIIIDQYYCPSKNCHNQSYAVSVSNVSYSNIKGTYDARSPPMRFACSDSVPCTNLTL  300

Query  335   SEVELYP---SQGHRMLDPFCWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             SEVEL P   SQG  + +PFCW  YG ++T+T P V CLLEGN  +L   DV  C
Sbjct  301   SEVELLPAAHSQGKILTNPFCWKVYGTVQTLTTPHVLCLLEGNQLTLKPRDVVWC  355



>emb|CDP07996.1| unnamed protein product [Coffea canephora]
Length=494

 Score =   529 bits (1362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/395 (62%), Positives = 315/395 (80%), Gaps = 1/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             NVM +G +GDG  DDT AF+ AW EACQ++ + +LL P+++ FLI STIF+GPCK  L+F
Sbjct  100   NVMDFGAVGDGSTDDTAAFRDAWKEACQAE-SSVLLVPENYVFLITSTIFSGPCKPGLVF  158

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++G +M P+GPD WPK  + +QWLVFYR+N M++ G G I+G GEKWW+LPCKPH G +
Sbjct  159   QVDGVLMAPNGPDCWPKGDSPQQWLVFYRLNDMTLTGTGTIEGNGEKWWSLPCKPHMGPH  218

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G+TLPGPCDSP  IRFF SSNL V +L+I+NSP FH +FD C  V ID + + +P  SPN
Sbjct  219   GSTLPGPCDSPALIRFFMSSNLMVTNLRIQNSPKFHVKFDGCEGVIIDRVSVSSPKLSPN  278

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIH+ENT  V I+NS+++NGDDCISIG GC NVDI ++TCGP HGISIGSLG+  SRA
Sbjct  279   TDGIHVENTKSVGIYNSVIANGDDCISIGPGCSNVDIESVTCGPSHGISIGSLGVHNSRA  338

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V ++ I++SDNGVRIKTWQGG G+V+ + F++I+MDNVRN II+DQYYC +KAC
Sbjct  339   CVSNITVRNAIIKDSDNGVRIKTWQGGAGSVTGIYFEDIQMDNVRNCIIIDQYYCLSKAC  398

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQTSAVY+SDVS+ NIKGT+D RSPP+  ACSD+V CTN+T+SEVEL P +G  + DPF
Sbjct  399   RNQTSAVYLSDVSFRNIKGTYDVRSPPIHFACSDTVACTNITMSEVELLPFEGILVDDPF  458

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYG  +T+TIPP+ CLL+G P+++   ++  C
Sbjct  459   CWNAYGIQETLTIPPIDCLLDGMPETVGESNLYAC  493



>emb|CDY41695.1| BnaA09g15230D [Brassica napus]
Length=435

 Score =   526 bits (1356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/386 (65%), Positives = 301/386 (78%), Gaps = 3/386 (1%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDL--TPILLAPKHHSFLIQSTIFTGPCKNPL  1191
             +V S+G IGD   DDT AFK AWD AC +    + +LL P    FL++ T F GPC+  L
Sbjct  49    DVTSFGAIGDCRTDDTSAFKMAWDTACMTTGVDSAVLLVPYTFCFLVKPTSFNGPCRTRL  108

Query  1190  LFQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRG  1011
               QI+G I+ PDGP SWP N  KRQWL+FYRVNG+S+QG GL++GRG+KWW+LPCKPH+G
Sbjct  109   TLQIDGIIVSPDGPKSWPWNF-KRQWLMFYRVNGLSIQGSGLVNGRGQKWWDLPCKPHKG  167

Query  1010  VNGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNS  831
             VNGTT PGPCDSPVAIR F SS++ ++ L  KNS  FH RFDNC DV +DS+ I AP +S
Sbjct  168   VNGTTQPGPCDSPVAIRIFQSSDVKIKGLTFKNSAQFHVRFDNCDDVVVDSVTINAPASS  227

Query  830   PNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQS  651
             PNTDGIHIENT++V I NS++SNGDDC+SIGAGC+NVDI+N+TCGP HGISIGSLG+  S
Sbjct  228   PNTDGIHIENTHNVQIRNSVISNGDDCVSIGAGCFNVDIKNITCGPSHGISIGSLGVHNS  287

Query  650   RACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNK  471
              A VSNI VT+STI NSDNGVRIKTWQGG G VS++ F NI M NVRNPI++DQYYC  K
Sbjct  288   SAWVSNITVTNSTIWNSDNGVRIKTWQGGSGLVSRIVFRNILMVNVRNPIMIDQYYCQTK  347

Query  470   ACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLD  291
              C NQTSAV ISDV Y+NIKG++D RSPPM   CSDS PCTNL L +V+L+P +G    +
Sbjct  348   NCANQTSAVIISDVLYANIKGSYDLRSPPMHFGCSDSFPCTNLRLEDVDLFPYKGQLFEN  407

Query  290   PFCWNAYGDLKTVTIPPVFCLLEGNP  213
             PFCWNAYG ++TVT+PPV CL+E  P
Sbjct  408   PFCWNAYGSMQTVTVPPVNCLIEALP  433



>ref|XP_009412152.1| PREDICTED: polygalacturonase At1g48100-like [Musa acuminata subsp. 
malaccensis]
Length=468

 Score =   528 bits (1359),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/395 (64%), Positives = 313/395 (79%), Gaps = 1/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V S+G +GDG +DDT AF+ AW  AC ++ + +LL P    F+I STIF+GPCK   + 
Sbjct  75    DVRSFGALGDGSSDDTQAFRAAWKAACAAE-SSVLLVPSDGVFMITSTIFSGPCKPGFVL  133

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             QI+G +MPPDGPD WP + +K+QWLVFYRV+GM+++G G I+G GE+WWNLPCKPHRG  
Sbjct  134   QIDGVLMPPDGPDCWPASDSKKQWLVFYRVDGMTLKGEGTIEGNGEEWWNLPCKPHRGPK  193

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G+TLPGPCDSP  IRFF S NLTV+ L+++NSP FH +FD C  VHI+ L I++P  SPN
Sbjct  194   GSTLPGPCDSPALIRFFMSYNLTVRGLRVENSPQFHVKFDGCEGVHIEDLSIRSPALSPN  253

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT  V I+NS++SNGDDCISIG GC NVDI N+TCGP HGISIGSLG+  S+A
Sbjct  254   TDGIHIENTKSVAIYNSVISNGDDCISIGPGCSNVDIANVTCGPSHGISIGSLGVHNSQA  313

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V ++ IRNSDNGVRIKTWQGG G+VS ++FDNI M+NVRN II+DQYYC  K C
Sbjct  314   CVSNITVRNARIRNSDNGVRIKTWQGGTGSVSGISFDNIYMENVRNCIIIDQYYCLTKQC  373

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQTSAV+++DV+Y+NIKGT+D RSPP+  ACSD+V CTN+TLS+VEL P +G  + DPF
Sbjct  374   LNQTSAVWVTDVAYANIKGTYDVRSPPIHFACSDAVACTNITLSDVELLPYEGVLVDDPF  433

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYG ++T+TIPP+ CL EG PQSL    V  C
Sbjct  434   CWNAYGIMQTLTIPPMSCLQEGQPQSLQENPVLGC  468



>ref|XP_006392401.1| hypothetical protein EUTSA_v10023906mg [Eutrema salsugineum]
 gb|ESQ29687.1| hypothetical protein EUTSA_v10023906mg [Eutrema salsugineum]
Length=434

 Score =   526 bits (1356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/386 (65%), Positives = 301/386 (78%), Gaps = 3/386 (1%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSD--LTPILLAPKHHSFLIQSTIFTGPCKNPL  1191
             +V S+G IGD   DDT AFK AWD AC S    + +LL P    FL++ T F GPC+  L
Sbjct  48    DVTSFGAIGDCTTDDTSAFKMAWDVACMSTGIESTMLLVPYTFCFLVKPTTFNGPCRTRL  107

Query  1190  LFQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRG  1011
               QI+G I+ PDGP SWP N  KRQW++ YRVNG+S+QG GLIDGRG+KWW+LPCKPH+G
Sbjct  108   ALQIDGIIVSPDGPRSWPWNY-KRQWIMIYRVNGLSIQGSGLIDGRGQKWWDLPCKPHKG  166

Query  1010  VNGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNS  831
             +NGTT PGPCDSPVAIR F SSN+ ++ L  KNS  FH RFDNC DV +DS+ IK+P +S
Sbjct  167   INGTTQPGPCDSPVAIRIFQSSNVRIKGLNFKNSAQFHVRFDNCSDVVVDSVTIKSPASS  226

Query  830   PNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQS  651
             PNTDGIHIENT++V I  S++SNGDDCISIGAGC+NVDI+N+TCGP HGISIGSLG+  S
Sbjct  227   PNTDGIHIENTHNVQIRTSVISNGDDCISIGAGCFNVDIKNITCGPSHGISIGSLGVHNS  286

Query  650   RACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNK  471
              A VSNI VT+STI NSDNGVRIKTWQGG G+VS++ F NI M NVRNPI++DQYYC  K
Sbjct  287   SAWVSNITVTNSTIWNSDNGVRIKTWQGGSGSVSRIVFRNIWMVNVRNPIMIDQYYCQTK  346

Query  470   ACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLD  291
              C NQTSAV I DV Y+NIKG++D RSPPM + CSDS PCTNL L  V+L+P +G  + +
Sbjct  347   NCANQTSAVIIRDVLYANIKGSYDLRSPPMHIGCSDSFPCTNLRLENVDLFPYKGQLLNN  406

Query  290   PFCWNAYGDLKTVTIPPVFCLLEGNP  213
             PFCWNAYG ++ +TIPPV+CLLE  P
Sbjct  407   PFCWNAYGSMQPITIPPVYCLLEALP  432



>ref|XP_009773723.1| PREDICTED: polygalacturonase At1g48100 [Nicotiana sylvestris]
Length=477

 Score =   526 bits (1355),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 244/387 (63%), Positives = 300/387 (78%), Gaps = 1/387 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V  YG IGDG  DDT AF+ AW EACQ + + ++LAP  H F+I STIF+GPCK  L F
Sbjct  84    DVTEYGAIGDGSTDDTDAFRAAWKEACQVE-SAVVLAPADHVFMITSTIFSGPCKPGLEF  142

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q+ G +MPPDGPD WPK  + +QWLVFYR++ M+  G G I+G GEKWW LPCKPHRG N
Sbjct  143   QVNGILMPPDGPDCWPKEDSNKQWLVFYRLDNMTFTGTGTIEGNGEKWWELPCKPHRGPN  202

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G+TLPGPCDSP  IRFF SSNL V+ L+I+NSP+FH +FD C  V ID L I +P  SPN
Sbjct  203   GSTLPGPCDSPAMIRFFMSSNLVVRGLRIQNSPMFHMKFDGCEGVLIDQLSISSPKLSPN  262

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT  V I+NS+++NGDDCISIG G  NVDI  +TCGP HGISIGSLG+  S+A
Sbjct  263   TDGIHIENTKSVGIYNSVIANGDDCISIGPGSSNVDIEAVTCGPSHGISIGSLGVHHSQA  322

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V ++ IR+SDNGVRIKTWQGG G+V+ ++FD I+M+NVRN II+DQYYC  K C
Sbjct  323   CVSNITVRNAIIRDSDNGVRIKTWQGGSGSVTGLSFDTIQMENVRNCIIIDQYYCMTKGC  382

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              N+TSAV + D+SY NIKGT+D RS P+  ACSD++ CTN+T+SEVEL P +G  + DPF
Sbjct  383   QNETSAVCVKDISYRNIKGTYDVRSAPIHFACSDTIACTNITMSEVELLPHEGELVDDPF  442

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSL  204
             CWNAYG  +T+TIPP+ CL +G PQS+
Sbjct  443   CWNAYGIQQTLTIPPIDCLQDGMPQSI  469



>ref|XP_009607016.1| PREDICTED: polygalacturonase At1g48100 [Nicotiana tomentosiformis]
Length=477

 Score =   526 bits (1355),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 244/387 (63%), Positives = 299/387 (77%), Gaps = 1/387 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V  YG IGDG  DDT AF+ AW EACQ + + ++LAP  H F+I STIF+GPCK  L F
Sbjct  84    DVTEYGAIGDGSTDDTDAFRAAWKEACQVE-SAVVLAPADHVFMITSTIFSGPCKPGLEF  142

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q+ G +MPPDGPD WPK  + +QWLVFYR++ M+  G G I+G GEKWW LPCKPHRG N
Sbjct  143   QVNGILMPPDGPDCWPKKDSNKQWLVFYRLDNMTFTGTGTIEGNGEKWWELPCKPHRGPN  202

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G+TLPGPCDSP  IRFF SSNL V+ L+I+NSP+FH +FD C  V ID L I +P  SPN
Sbjct  203   GSTLPGPCDSPAMIRFFMSSNLVVRGLRIQNSPMFHMKFDGCEGVLIDQLSISSPKLSPN  262

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT  V I+NS+++NGDDCISIG G  NVDI  +TCGP HGISIGSLG+  S+A
Sbjct  263   TDGIHIENTKSVGIYNSVIANGDDCISIGPGSSNVDIEAVTCGPSHGISIGSLGVHHSQA  322

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V ++ IR SDNGVRIKTWQGG G+V+ ++FD I+M+NVRN II+DQYYC  K C
Sbjct  323   CVSNITVRNTIIRESDNGVRIKTWQGGSGSVTGLSFDTIQMENVRNCIIIDQYYCMTKGC  382

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              N+TSAV + D+SY NIKGT+D RS P+  ACSD++ CTN+T+SEVEL P +G  + DPF
Sbjct  383   QNETSAVCVKDISYRNIKGTYDVRSAPIHFACSDTIACTNITMSEVELLPHEGELVDDPF  442

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSL  204
             CWNAYG  +T+TIPP+ CL +G PQS+
Sbjct  443   CWNAYGIQQTLTIPPIDCLQDGMPQSI  469



>ref|XP_009113378.1| PREDICTED: polygalacturonase At1g48100 [Brassica rapa]
Length=435

 Score =   524 bits (1349),  Expect = 9e-180, Method: Compositional matrix adjust.
 Identities = 250/386 (65%), Positives = 300/386 (78%), Gaps = 3/386 (1%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDL--TPILLAPKHHSFLIQSTIFTGPCKNPL  1191
             +V S+G IGD   DDT AFK AWD AC +    + +LL P    FL++ T F GPC+  L
Sbjct  49    DVTSFGAIGDCRTDDTSAFKMAWDTACMTIGVDSAVLLVPYTFCFLVKPTSFNGPCRTRL  108

Query  1190  LFQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRG  1011
               QI+G I+ PDGP SWP N  KRQWL+FYRVNG+S+QG GL++GRG+KWW+LPCKPH+G
Sbjct  109   TLQIDGIIVSPDGPKSWPWNF-KRQWLMFYRVNGLSIQGSGLVNGRGQKWWDLPCKPHKG  167

Query  1010  VNGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNS  831
             VNGTT PGPCDSPVAIR F SS++ ++ L  KNS  FH RFDNC DV +DS+ I AP +S
Sbjct  168   VNGTTQPGPCDSPVAIRIFQSSDVKIKGLTFKNSAQFHVRFDNCDDVVVDSVTINAPASS  227

Query  830   PNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQS  651
             PNTDGIHIENT++V I NS++SNGDDC+SIGAGC+NVDI+N+TCGP HGISIGSLG+  S
Sbjct  228   PNTDGIHIENTHNVQIRNSVISNGDDCVSIGAGCFNVDIKNITCGPSHGISIGSLGVHNS  287

Query  650   RACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNK  471
              A VSNI VT+STI NSDNGVRIKTWQGG G VS++ F NI M NVRNPI++DQYYC  K
Sbjct  288   SAWVSNITVTNSTIWNSDNGVRIKTWQGGSGLVSRIVFRNILMVNVRNPIMIDQYYCQTK  347

Query  470   ACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLD  291
              C NQTSAV ISDV Y+NIKG++D RSPPM   CSDS P TNL L +V+L+P +G    +
Sbjct  348   NCANQTSAVIISDVLYANIKGSYDLRSPPMHFGCSDSFPSTNLRLEDVDLFPYKGQLFEN  407

Query  290   PFCWNAYGDLKTVTIPPVFCLLEGNP  213
             PFCWNAYG ++TVT+PPV CLLE  P
Sbjct  408   PFCWNAYGSMQTVTVPPVNCLLEALP  433



>ref|XP_010270903.1| PREDICTED: polygalacturonase At1g48100-like isoform X1 [Nelumbo 
nucifera]
Length=476

 Score =   525 bits (1352),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 250/387 (65%), Positives = 307/387 (79%), Gaps = 1/387 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V S+G +GDG  DDT AF  AW  AC  + + +LLAP  H FLI STI +GPCK   +F
Sbjct  83    DVTSFGAVGDGSTDDTAAFMAAWKAACAVE-SGVLLAPSDHVFLITSTILSGPCKPGFVF  141

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++G +MPPDGPD+WPK+ + +QWLVFYRV+GM+  G G I+G G+KWW LPCKPHRG +
Sbjct  142   QVDGVLMPPDGPDNWPKSDSDKQWLVFYRVDGMTFTGRGTIEGNGQKWWELPCKPHRGPH  201

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             GT+LPGPC+SP  IRFF SSNL V  L+I+NSP FH +FD C  V I+ L I +P  SPN
Sbjct  202   GTSLPGPCNSPALIRFFMSSNLVVSGLRIQNSPQFHMKFDGCEGVLIEKLSISSPALSPN  261

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT  V I+NSI++NGDDCISIG GC +VDI N+TCGP HGISIGSLG+  S+A
Sbjct  262   TDGIHIENTKSVGIYNSIIANGDDCISIGPGCSDVDIENVTCGPSHGISIGSLGVHNSQA  321

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V ++ IRNSDNGVRIKTWQGG G+VS ++FD+I+M+NVRN II+DQYYC  KAC
Sbjct  322   CVSNITVRNAFIRNSDNGVRIKTWQGGMGSVSGISFDSIQMENVRNCIIIDQYYCLAKAC  381

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQTSAV+++DVSY NIKGT+D RSPP+  ACSD+V CTN+TLSEVEL P+ G  + DPF
Sbjct  382   LNQTSAVFVTDVSYKNIKGTYDVRSPPIHFACSDAVACTNITLSEVELLPAAGELVDDPF  441

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSL  204
             CWNAYG  +T+TIPP+ CLL+G PQS+
Sbjct  442   CWNAYGTQETLTIPPISCLLDGEPQSI  468



>ref|XP_010422679.1| PREDICTED: polygalacturonase At1g48100-like [Camelina sativa]
Length=478

 Score =   525 bits (1352),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 244/390 (63%), Positives = 306/390 (78%), Gaps = 5/390 (1%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSD---LTPILLAPKHHSFLIQSTIFTGPCKNP  1194
             NV  YG +G+GV+DDT +FK+AWD AC +D      +LL P   +F+I STIFTGPC++ 
Sbjct  77    NVRHYGAVGNGVSDDTESFKKAWDSACSNDNNNTVSVLLVPYGFTFMIHSTIFTGPCRSY  136

Query  1193  LLFQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHR  1014
               FQ++GTI+P DGP SWP  L KR+WLVFYRVNGM ++G G+IDGRG+ WW+LPCKPHR
Sbjct  137   QYFQVDGTIVPRDGPKSWPSGLNKREWLVFYRVNGMVLKGVGVIDGRGQTWWDLPCKPHR  196

Query  1013  GVNGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPN  834
              VN T   GPC+SP A+RFF SSNL ++ L IKNSP  H +FD CH VHI+ L I +P +
Sbjct  197   NVNKTAHAGPCESPAALRFFMSSNLIMESLSIKNSPQVHLKFDECHVVHINLLRIISPSS  256

Query  833   SPNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGP-GHGISIGSLGIK  657
             SPNTDGIHIEN+  V I+NS++SNGDDC+SIG+G Y++D+RN+TCGP GHGISIGSLG +
Sbjct  257   SPNTDGIHIENSNSVEIYNSVISNGDDCVSIGSGSYDIDVRNLTCGPGGHGISIGSLGDR  316

Query  656   QSRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCS  477
              SRACVSN+ V DS I+ SDNGVRIKTWQGG G+VS VTFDNI MD VRNPII+DQYYC+
Sbjct  317   NSRACVSNVTVRDSVIKFSDNGVRIKTWQGGSGSVSGVTFDNIHMDTVRNPIIIDQYYCT  376

Query  476   NKACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRM  297
              K+C N+TSAVY++D+ Y +IKGT+D RSPPM   CS++VPCTNLTLS++EL PS+G   
Sbjct  377   AKSCANKTSAVYVNDIVYQSIKGTYDIRSPPMHFGCSNNVPCTNLTLSDIELLPSKGETD  436

Query  296   LDPFCWNAYGDLKTVTIPPVFCLLEGNPQS  207
             +DPFCWNAYG     ++P + C L+ NP +
Sbjct  437   VDPFCWNAYGITDEFSVPSIPC-LKSNPST  465



>ref|XP_010456113.1| PREDICTED: polygalacturonase At1g48100-like [Camelina sativa]
Length=479

 Score =   525 bits (1351),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 246/390 (63%), Positives = 306/390 (78%), Gaps = 5/390 (1%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSD---LTPILLAPKHHSFLIQSTIFTGPCKNP  1194
             NV  YG +G+GV DDT  FK+AWD AC ++      +LL P   +F+I STIFTGPC++ 
Sbjct  78    NVRHYGAVGNGVTDDTEPFKKAWDSACSNNNNNTVSVLLVPYGFTFMIHSTIFTGPCRSY  137

Query  1193  LLFQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHR  1014
               FQ++GTI+P DGP+SWP  L KRQWLVFYRVNGM+++G G+IDGRG+ WW+LPCKPHR
Sbjct  138   QYFQVDGTIVPRDGPNSWPSGLNKRQWLVFYRVNGMALKGVGVIDGRGQTWWDLPCKPHR  197

Query  1013  GVNGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPN  834
              VN T   GPC+SP A+RFF SSNL V+ L IKNSP  H +FD CH VHI+ L I +P +
Sbjct  198   NVNKTAHAGPCESPAALRFFMSSNLFVESLSIKNSPQVHLKFDECHVVHINLLRIISPSS  257

Query  833   SPNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGP-GHGISIGSLGIK  657
             SPNTDGIHIEN+  V I+NS++SNGDDC+SIG+G Y++D+RN+TCGP GHGISIGSLG  
Sbjct  258   SPNTDGIHIENSNSVEIYNSVISNGDDCVSIGSGSYDIDVRNLTCGPGGHGISIGSLGDN  317

Query  656   QSRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCS  477
              SRACVSN+ V DS I+ SDNGVRIKTWQGG G+VS VTFDNI MD VRNPII+DQYYC+
Sbjct  318   NSRACVSNVTVRDSVIKFSDNGVRIKTWQGGSGSVSGVTFDNIHMDTVRNPIIIDQYYCT  377

Query  476   NKACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRM  297
              K+C N+TSAVY++D+ Y +IKGT+D RSPPM   CS++VPCTNLTLS++EL PS+G   
Sbjct  378   AKSCANKTSAVYVNDIVYQSIKGTYDIRSPPMHFGCSNNVPCTNLTLSDIELLPSKGETD  437

Query  296   LDPFCWNAYGDLKTVTIPPVFCLLEGNPQS  207
             +DPFCWNAYG    V++P + C L+ NP +
Sbjct  438   VDPFCWNAYGITDEVSVPSISC-LKSNPST  466



>ref|XP_011019224.1| PREDICTED: polygalacturonase At1g48100 [Populus euphratica]
Length=482

 Score =   525 bits (1351),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 246/395 (62%), Positives = 303/395 (77%), Gaps = 1/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             NVM YG IGDG  DDT AF++AW EAC  + + ++LAP  HSF+I STIFTGPCK  L+F
Sbjct  89    NVMDYGAIGDGSTDDTDAFRQAWKEACGVE-SGVILAPSGHSFMITSTIFTGPCKPGLVF  147

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++G +MPPDGPD WP+  + +QWLVFYR++GM++ G G I+G GEKWW+LPCKPHRG N
Sbjct  148   QVDGYLMPPDGPDCWPEKDSTKQWLVFYRLDGMTLTGKGTIEGNGEKWWDLPCKPHRGPN  207

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G+T  GPCDSP  IRFF SSNLTV  L+I+NSP FH +FD C  V I+ L I +P  SPN
Sbjct  208   GSTSKGPCDSPALIRFFMSSNLTVSGLRIQNSPQFHMKFDGCEGVLIEKLSISSPKLSPN  267

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT  V I++S +SNGDDCISIG GC NVDI  +TCGP HGISIGSLG+  S+A
Sbjct  268   TDGIHIENTKAVGIYDSSISNGDDCISIGTGCSNVDIDGLTCGPSHGISIGSLGVHNSQA  327

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CV NI V +S I+ SDNG+RIKTWQGG G V  + F+NI+M+NVRN + +DQYYC +KAC
Sbjct  328   CVRNITVRNSVIKESDNGLRIKTWQGGTGCVYDINFENIQMENVRNCMNIDQYYCLSKAC  387

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              N+TSAVY++ V+Y NIKGT+D R+PP+  ACSD+V CT++ LS+VEL P +G  M DPF
Sbjct  388   LNETSAVYVTGVTYRNIKGTYDVRTPPIHFACSDTVACTDIILSDVELLPEEGELMDDPF  447

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYG  +TVTIPP+ CL EG P+S   V    C
Sbjct  448   CWNAYGTQETVTIPPINCLREGQPESQGEVSSVGC  482



>ref|XP_007035922.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007035923.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY06848.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY06849.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
Length=500

 Score =   525 bits (1351),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 242/387 (63%), Positives = 301/387 (78%), Gaps = 1/387 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V S+G +GDG +DDT AF+ AW  AC  + +  +LAP    F+I STIF+GPCK  L+ 
Sbjct  107   DVTSFGAVGDGSSDDTAAFREAWKAACAVE-SATILAPSDKVFIITSTIFSGPCKPGLVL  165

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             QI+G +MPPDGPD WPK  +++QWLVFYR++ M + G G+I+G G+KWW LPCKPHRG N
Sbjct  166   QIDGVLMPPDGPDCWPKADSRKQWLVFYRLDDMKLTGNGIIEGNGQKWWELPCKPHRGPN  225

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G+TL GPCDSP  IRFF SSNL V  ++I+NSP FH +FD C  V I+ L I  P  SPN
Sbjct  226   GSTLSGPCDSPAMIRFFMSSNLVVSGIRIQNSPQFHMKFDGCEGVLIEKLSISTPKLSPN  285

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT  V I+NS++SNGDDCISIG GC NVDI  +TCGP HGISIGSLG+  S+A
Sbjct  286   TDGIHIENTKSVGIYNSMISNGDDCISIGPGCSNVDIEGVTCGPSHGISIGSLGVHNSQA  345

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSN+ V ++ IR SDNGVRIKTWQGG G+VS ++F+NI+M+NVRN IIVDQYYC  KAC
Sbjct  346   CVSNVTVRNAIIRESDNGVRIKTWQGGTGSVSGISFENIQMENVRNCIIVDQYYCLTKAC  405

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQTSAV+++DV Y NIKGT+D R+ P+  ACSD+VPCTN+T+SEVEL P +G  + DPF
Sbjct  406   LNQTSAVFVTDVQYRNIKGTYDVRNTPIHFACSDTVPCTNITMSEVELLPQEGELLDDPF  465

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSL  204
             CWNAYG  +T+TIPP+ CL EG PQ++
Sbjct  466   CWNAYGVEETLTIPPIGCLQEGMPQTI  492



>ref|XP_010480279.1| PREDICTED: polygalacturonase At1g48100-like [Camelina sativa]
Length=435

 Score =   522 bits (1344),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 249/386 (65%), Positives = 301/386 (78%), Gaps = 4/386 (1%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQS--DLTPILLAPKHHSFLIQSTIFTGPCKNPL  1191
             +V S+G IGD   DDT AFK AWD AC +    + +LL P    FL++ T F GPC+  L
Sbjct  51    DVTSFGAIGDCATDDTSAFKMAWDAACMTTGSKSSLLLVPDTFCFLVKPTSFNGPCRTQL  110

Query  1190  LFQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRG  1011
             + QI+G I+ PDGP SWP N  +RQW++FYRVNG+S+QG G I+GRG+KWWNLPCKPH+G
Sbjct  111   VLQIDGFIVSPDGPRSWPSNY-QRQWMMFYRVNGLSIQGSGFINGRGKKWWNLPCKPHKG  169

Query  1010  VNGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNS  831
              NGTT  GPCDSPVA R F SS +T++ L   NS  FH RFDNC DV +DS+ IKAP +S
Sbjct  170   PNGTTQTGPCDSPVAFRIFQSSKVTIKGLNFINSAQFHVRFDNCSDVIVDSVTIKAPASS  229

Query  830   PNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQS  651
             PNTDGIHIENT++V IHNS++SNGDDCISIGAGC+NVDI+N+TCGP HGISIGSL I  S
Sbjct  230   PNTDGIHIENTHNVQIHNSVISNGDDCISIGAGCFNVDIKNVTCGPSHGISIGSLWIHNS  289

Query  650   RACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNK  471
             +A VSNI VT+STI NSDNGVRIKTWQGG G+VS++ F NI M NVRNPI++DQYYC   
Sbjct  290   QAYVSNITVTNSTIWNSDNGVRIKTWQGGSGSVSRIVFSNILMVNVRNPIMIDQYYCQTM  349

Query  470   ACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLD  291
              C NQTSAV ISDV Y+NIKGT+D RSP M   CSDSVPCTNL L +V+L+PS+G  + +
Sbjct  350   NCANQTSAVIISDVLYANIKGTYDQRSPSMHFGCSDSVPCTNLRLMDVDLFPSKGQLLEN  409

Query  290   PFCWNAYGDLKTVTIPPVFCLLEGNP  213
             PFCWNAYG ++ +T+PPV+CLLE  P
Sbjct  410   PFCWNAYGSMQ-ITVPPVYCLLEALP  434



>ref|XP_008361575.1| PREDICTED: polygalacturonase At1g48100-like [Malus domestica]
 ref|XP_008361576.1| PREDICTED: polygalacturonase At1g48100-like [Malus domestica]
Length=480

 Score =   524 bits (1349),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 244/395 (62%), Positives = 301/395 (76%), Gaps = 1/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             NVM YG +GDG ADDT AF++AW EAC    + ++ AP  + F I STIF+GPC+  L+F
Sbjct  87    NVMDYGAVGDGSADDTAAFRQAWKEACAVK-SGVVFAPSDYRFKITSTIFSGPCQPGLVF  145

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++G +MPPDGP +WPK  +K+QWLVFY++N M+  G G I+G G+KWW LPCKPHRG N
Sbjct  146   QVDGVLMPPDGPATWPKKDSKQQWLVFYKLNRMTFTGTGTIEGNGQKWWALPCKPHRGPN  205

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G+TL GPCDSP  IRFF SSNL V+ L+I+NSP FH +FD C  V I  + I +P  SPN
Sbjct  206   GSTLRGPCDSPAMIRFFMSSNLVVRGLRIQNSPQFHMKFDGCVGVLIQKISISSPKLSPN  265

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT  V IHNS++SNGDDCISIG GC NVDI  +TCGP HGISIGSLG+  S+A
Sbjct  266   TDGIHIENTKSVAIHNSVISNGDDCISIGTGCANVDIMGVTCGPSHGISIGSLGVHNSQA  325

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V +S IR SDNG+RIKTWQGG G+VS + F+NI+M+NV N ++VDQYYC ++AC
Sbjct  326   CVSNITVRNSVIRESDNGLRIKTWQGGTGSVSGILFENIQMENVLNCLLVDQYYCLSQAC  385

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              N+TSAV ++D++Y NIKGT+D R PP+  ACSD+V C N+ LSEVELYP +G  M DPF
Sbjct  386   RNETSAVLVTDLTYRNIKGTYDVRRPPIHFACSDTVACRNIILSEVELYPYEGELMDDPF  445

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYG  +T TIPP+ CL EG PQ+L  V    C
Sbjct  446   CWNAYGTQETATIPPIDCLREGEPQALDEVSKYTC  480



>ref|XP_006301910.1| hypothetical protein CARUB_v10022386mg [Capsella rubella]
 gb|EOA34808.1| hypothetical protein CARUB_v10022386mg [Capsella rubella]
Length=434

 Score =   522 bits (1344),  Expect = 6e-179, Method: Compositional matrix adjust.
 Identities = 250/386 (65%), Positives = 299/386 (77%), Gaps = 4/386 (1%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQS--DLTPILLAPKHHSFLIQSTIFTGPCKNPL  1191
             +V S+G IGD   DDT AFK AWD AC S    + +LL P    FL++ T F GPC+  L
Sbjct  49    DVTSFGAIGDCATDDTSAFKMAWDAACMSTGSKSALLLVPDTFCFLVKPTSFNGPCRTQL  108

Query  1190  LFQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRG  1011
             + QI+G I+ PDGP SWP N  +RQW++FYRVNG+S+QG G I+GRG+KWWNLPCKPH+G
Sbjct  109   VLQIDGFIVSPDGPKSWPLNY-QRQWMMFYRVNGLSIQGSGFINGRGQKWWNLPCKPHKG  167

Query  1010  VNGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNS  831
              NGTT  GPCDSPVA R F SS + ++ L   NS  FH RFDNC DV +DS+ IKAP +S
Sbjct  168   PNGTTQTGPCDSPVAFRIFQSSKVRIKGLNFMNSAQFHVRFDNCSDVVVDSVTIKAPASS  227

Query  830   PNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQS  651
             PNTDGIHIENT++V IHNS++SNGDDCISIGAGC+NVDI+N+TCGP HGISIGSLG+  S
Sbjct  228   PNTDGIHIENTHNVQIHNSVISNGDDCISIGAGCFNVDIKNVTCGPSHGISIGSLGVHNS  287

Query  650   RACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNK  471
              A VSNI VT+ST+ NSDNGVRIKTWQGG G+VS++ F NI M NVRNPI++DQYYC  K
Sbjct  288   EAYVSNITVTNSTLWNSDNGVRIKTWQGGSGSVSRIVFSNILMVNVRNPIMIDQYYCQTK  347

Query  470   ACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLD  291
              C NQTSAV ISDV Y NIKGT+D RSPP+   CSDSVPCTNL L +V+L+PS+G    +
Sbjct  348   NCANQTSAVIISDVLYENIKGTYDLRSPPIHFGCSDSVPCTNLRLMDVDLFPSKGQLFEN  407

Query  290   PFCWNAYGDLKTVTIPPVFCLLEGNP  213
             PFCWNAYG ++ +TIPPV CLLE  P
Sbjct  408   PFCWNAYGSMQ-ITIPPVHCLLEPLP  432



>ref|XP_006378559.1| hypothetical protein POPTR_0010s16180g [Populus trichocarpa]
 gb|ERP56356.1| hypothetical protein POPTR_0010s16180g [Populus trichocarpa]
Length=482

 Score =   523 bits (1347),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 244/395 (62%), Positives = 304/395 (77%), Gaps = 1/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             NVM YG +GDG  DDT AF++AW EAC  + + ++LAP  +SF+I STIF+GPCK  ++F
Sbjct  89    NVMDYGAVGDGSTDDTNAFRQAWKEACGVE-SGVILAPSGYSFMITSTIFSGPCKPGIVF  147

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++G +MPPDGPDSWP+  + +QWLVFYR++GM++ G G I+G GEKWW+LPCKPHRG N
Sbjct  148   QVDGCLMPPDGPDSWPEKDSTQQWLVFYRLDGMTLTGEGTIEGNGEKWWDLPCKPHRGPN  207

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G+T  GPC SP  IRFF SSNL V  LKI+NSP FH +FD C  V I  L I +P  SPN
Sbjct  208   GSTSKGPCVSPALIRFFMSSNLEVSGLKIQNSPQFHMKFDGCEGVLIKKLSISSPKLSPN  267

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT  V I++S +SNGDDCISIG GC NVDI  +TCGP HGISIGSLG+  S+A
Sbjct  268   TDGIHIENTKAVGIYDSFISNGDDCISIGTGCSNVDIDGLTCGPSHGISIGSLGVHNSQA  327

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V ++ I+ SD+G+RIKTWQGG G VS + F+NI+M+NVRN II+DQYYC +KAC
Sbjct  328   CVSNITVRNTIIKESDDGLRIKTWQGGTGCVSDINFENIQMENVRNCIIIDQYYCLSKAC  387

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              N+TSAVY++ V+Y NIKGT+D R+PP+  ACSD+V CTN+ LSEVEL P +G  + DPF
Sbjct  388   QNETSAVYVTGVTYRNIKGTYDVRTPPIHFACSDTVACTNILLSEVELLPEEGELVDDPF  447

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYG  +TVTIPP+ CL EG P+ L  +    C
Sbjct  448   CWNAYGTEETVTIPPINCLREGEPEGLREISSYGC  482



>ref|XP_002312305.1| hypothetical protein POPTR_0008s09990g [Populus trichocarpa]
 gb|EEE89672.1| hypothetical protein POPTR_0008s09990g [Populus trichocarpa]
Length=482

 Score =   523 bits (1346),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 244/395 (62%), Positives = 301/395 (76%), Gaps = 1/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             NVM YG +GDG  DDT AF++AW EAC  + + ++LAP  HSF+I STIFTGPCK  L+F
Sbjct  89    NVMDYGAVGDGSTDDTDAFRQAWKEACGVE-SGVILAPSGHSFMITSTIFTGPCKPGLVF  147

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++G +MPPDGPD WP+  + +QWLVFYR++GM++ G G I+G GEKWW+LPCKPHR  N
Sbjct  148   QVDGYLMPPDGPDCWPEKDSTKQWLVFYRLDGMTLTGKGTIEGNGEKWWDLPCKPHRSPN  207

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G+T  GPCDSP  IRFF SSNL V  L+I+NSP FH +FD C  V I+ L I +P  SPN
Sbjct  208   GSTSKGPCDSPALIRFFMSSNLAVSGLRIQNSPQFHMKFDGCEGVLIEKLSISSPKLSPN  267

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT  V I++S +SNGDDCISIG GC NVDI  +TCGP HGISIGSLG+  S+A
Sbjct  268   TDGIHIENTKAVGIYDSSISNGDDCISIGTGCSNVDIDGLTCGPSHGISIGSLGVHHSQA  327

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CV NI V +S I+ SDNG+RIKTWQGG G VS + F+NI+M+NVRN + +DQYYC +KAC
Sbjct  328   CVRNITVRNSVIKESDNGLRIKTWQGGTGCVSDINFENIQMENVRNCMNIDQYYCLSKAC  387

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              N+TSAVY++ V+Y NIKGT+D R+PP+  ACSD+V CT++ LSEVEL P +G  M DPF
Sbjct  388   LNETSAVYVTGVTYRNIKGTYDVRTPPIHFACSDTVACTDIILSEVELLPEEGELMDDPF  447

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYG  +TV IPP+ CL EG P+S   V    C
Sbjct  448   CWNAYGTQETVIIPPINCLREGQPESQGEVSSVGC  482



>ref|XP_002263668.1| PREDICTED: polygalacturonase At1g48100 [Vitis vinifera]
Length=477

 Score =   523 bits (1346),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 241/387 (62%), Positives = 303/387 (78%), Gaps = 1/387 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V S+G +GDG  DDT AF  AW  AC  + + I+L P  H F+I STIF+GPCK  L+F
Sbjct  84    DVTSFGAVGDGTTDDTAAFMEAWKAACAVE-SGIVLVPADHVFMITSTIFSGPCKPGLVF  142

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++G +MPP+GPD WPK+ +K+QWLVFYR++ M+  G G I+G G  WW LPCKPHRG N
Sbjct  143   QVDGVLMPPNGPDCWPKSDSKKQWLVFYRLDQMTFTGSGTIEGNGGDWWELPCKPHRGPN  202

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G+TLPGPCDSP  IRFF SSNL V  L+I+NSP FH +FD C  V I+ L I +P  SPN
Sbjct  203   GSTLPGPCDSPALIRFFMSSNLVVSSLRIQNSPQFHMKFDGCEGVLIEKLSISSPKLSPN  262

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT  V I+NS + NGDDCISIG GC +V+I  +TCGP HGISIGSLG++ S+A
Sbjct  263   TDGIHIENTKSVGIYNSEIGNGDDCISIGRGCSDVNIEGVTCGPSHGISIGSLGVQNSQA  322

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V +  I++SDNGVRIKTWQGG G+VS ++F+NI+M+NVRN +I+DQYYC +KAC
Sbjct  323   CVSNITVRNVFIKDSDNGVRIKTWQGGTGSVSGISFENIQMENVRNCMIIDQYYCLSKAC  382

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQTSAVY++DV+Y NIKGT+D RSPP+  ACSD+V CTN+T+SEVEL P++G  + DPF
Sbjct  383   RNQTSAVYLTDVTYRNIKGTYDVRSPPIHFACSDTVACTNITMSEVELLPAEGELVDDPF  442

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSL  204
             CWNAYG  +T+TIPP+ CL +G P+SL
Sbjct  443   CWNAYGTQETLTIPPITCLQDGMPESL  469



>ref|XP_007158878.1| hypothetical protein PHAVU_002G189400g [Phaseolus vulgaris]
 gb|ESW30872.1| hypothetical protein PHAVU_002G189400g [Phaseolus vulgaris]
Length=479

 Score =   521 bits (1343),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 246/395 (62%), Positives = 308/395 (78%), Gaps = 1/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V S+G +GDG ADDT AF+ AW  AC  + + ILLAP+++SF I STIF+GPCK  L+F
Sbjct  85    DVRSFGAVGDGCADDTPAFRAAWKAACAVE-SGILLAPENYSFKITSTIFSGPCKPGLVF  143

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++GT+M PDGP+SWP+  ++ QWLVFYR++ M++ G G I+G G+KWW+LPCKPHRG N
Sbjct  144   QVDGTLMAPDGPNSWPEKDSRNQWLVFYRLDQMTLNGTGTIEGNGDKWWDLPCKPHRGPN  203

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G TL GPC SP  IRFF SSNL V  LKI+NSP FH +FD C  V ID L I +P  SPN
Sbjct  204   GKTLSGPCGSPAMIRFFMSSNLKVNGLKIENSPQFHMKFDGCQGVLIDKLSISSPKLSPN  263

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIH+ENT DV I+NS +SNGDDCIS+G G  NVDI  +TCGP HGISIGSLG+  S+A
Sbjct  264   TDGIHVENTKDVGIYNSFISNGDDCISVGPGSSNVDIAGLTCGPSHGISIGSLGVHNSQA  323

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSN+ V DS IR SDNG+RIKTWQGG G+V+ + FDNI+M+NV N II+DQYYC +K C
Sbjct  324   CVSNLTVRDSIIRESDNGLRIKTWQGGMGSVTGLRFDNIQMENVGNCIIIDQYYCLSKEC  383

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQTSAV+++DVSYSNIKGT+D R+ P+  ACSD+V CTN+TLSEVEL P +G  + DPF
Sbjct  384   LNQTSAVHVNDVSYSNIKGTYDVRTTPIHFACSDTVACTNITLSEVELLPFEGALLDDPF  443

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYG  +T+TIPP+ CL EG P+++ ++   QC
Sbjct  444   CWNAYGTQETLTIPPINCLREGYPETVGDLSEYQC  478



>ref|XP_004297108.1| PREDICTED: polygalacturonase At1g48100-like [Fragaria vesca subsp. 
vesca]
Length=487

 Score =   521 bits (1343),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 243/395 (62%), Positives = 302/395 (76%), Gaps = 1/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             NVMSYG +GDG ADDT AF+ AW  AC  + + ++LAP  + F I STIF+GPCK  L+F
Sbjct  94    NVMSYGAVGDGDADDTKAFRDAWKAACAVE-SAVVLAPADYCFKITSTIFSGPCKPGLVF  152

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++G +M PDGP +WPK  + +QWLVFYR++ M+  G G I+G G+KWW+LPCKPHRG N
Sbjct  153   QVDGILMTPDGPKAWPKVDSNKQWLVFYRLDQMTFTGSGTIEGNGQKWWDLPCKPHRGPN  212

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G+T  GPCDSP  IRFF SSNL V+ L+I+NSP+FH +FD C  VHI+ L I +P  SPN
Sbjct  213   GSTASGPCDSPALIRFFMSSNLVVKGLRIQNSPMFHMKFDGCEGVHIERLSISSPKLSPN  272

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT  V I++S++SNGDDCISIG GC NVDI  +TCGP HGISIGSLG+  S+A
Sbjct  273   TDGIHIENTKSVGIYDSMISNGDDCISIGPGCANVDIMGVTCGPSHGISIGSLGVHNSQA  332

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V +  IR SDNG+RIKTWQGG G VS + F+NI M+NV N ++VDQYYC++K C
Sbjct  333   CVSNITVRNVVIRESDNGLRIKTWQGGTGCVSGILFENINMENVMNCLLVDQYYCTSKGC  392

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQTSAVY++D++Y  IKGT+D R PP+  ACSD+V CTN+TLSEVELYP +G  M DPF
Sbjct  393   LNQTSAVYVTDLTYRMIKGTYDVRKPPIHFACSDTVACTNITLSEVELYPYEGELMDDPF  452

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYG  +T TIPP+ CL +G P++L  V    C
Sbjct  453   CWNAYGTQETPTIPPIECLQDGQPEALAEVAQYTC  487



>ref|XP_011011219.1| PREDICTED: polygalacturonase At1g48100-like [Populus euphratica]
Length=469

 Score =   520 bits (1339),  Expect = 9e-178, Method: Compositional matrix adjust.
 Identities = 241/395 (61%), Positives = 304/395 (77%), Gaps = 1/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             NVM YG +GDG  DDT AF++AW EAC+ + + ++LAP  +SF+I STIF+GPCK  ++F
Sbjct  76    NVMDYGAVGDGSTDDTNAFRQAWKEACRVE-SGVILAPSGYSFMITSTIFSGPCKPGIVF  134

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++G +MPPDGPDSWP+  + +QWLVFYR++GM++ G G I+G GEKWW+LPCKPHRG N
Sbjct  135   QVDGRLMPPDGPDSWPEKDSTQQWLVFYRLDGMTLTGEGTIEGNGEKWWDLPCKPHRGPN  194

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G+T  GPC SP  IRFF SSNL V  LKI+NSP FH +FD C  V I  L I +P  SPN
Sbjct  195   GSTSKGPCVSPALIRFFMSSNLAVSGLKIQNSPQFHMKFDGCEGVLIKKLSISSPKLSPN  254

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT  V I++S +SNGDDCISIG GC NVDI  +TCGP HGISIGSLG+  S+A
Sbjct  255   TDGIHIENTKAVGIYDSSISNGDDCISIGTGCSNVDIDGLTCGPSHGISIGSLGVHNSQA  314

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V ++ I+ SD+G+RIKTWQGG G VS + F+NI+M+NVRN II+DQYYC ++AC
Sbjct  315   CVSNITVRNTIIKESDDGLRIKTWQGGTGCVSDINFENIQMENVRNCIIIDQYYCLSQAC  374

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              N+TSAVY++ V+Y NIKGT+D R+PP+  ACSD+V CTN+ LSEVEL P +G  + DPF
Sbjct  375   LNKTSAVYVTGVTYRNIKGTYDVRTPPIHFACSDAVACTNILLSEVELLPEEGELVDDPF  434

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYG  +T TIPP+ CL EG P+ +  +    C
Sbjct  435   CWNAYGTQETATIPPINCLREGEPKGIREISSYGC  469



>ref|XP_011100707.1| PREDICTED: polygalacturonase At1g48100 [Sesamum indicum]
Length=481

 Score =   519 bits (1337),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 240/387 (62%), Positives = 302/387 (78%), Gaps = 1/387 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V  +G IGDG  DDT AF+ AW  ACQ +   ++ AP    F+I STIF+GPC+  L+ 
Sbjct  88    DVTDFGAIGDGATDDTAAFRSAWKAACQVE-NGVVFAPSDLVFMITSTIFSGPCQPGLVL  146

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++G +MPPDGPD WPK+ + +QWLVFYR++ M++ G G I+G G+KWW+LPCKPHRG N
Sbjct  147   QVDGVLMPPDGPDCWPKSDSNKQWLVFYRLDDMTLTGTGTIEGNGQKWWDLPCKPHRGPN  206

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G+TLPGPCDSP  IRFF SSNL V  L+I+NSP FH +FD C  V ID L I +P  SPN
Sbjct  207   GSTLPGPCDSPALIRFFMSSNLVVSGLRIQNSPQFHMKFDGCQGVLIDKLSISSPKLSPN  266

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT  V I+NS++ NGDDCISIG GC +VDI  +TCGP HGISIGSLG++ S A
Sbjct  267   TDGIHIENTKSVGIYNSVIGNGDDCISIGTGCSDVDIEAVTCGPSHGISIGSLGVQHSHA  326

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V ++ IR+SDNG+RIKTWQGG G+V+ ++F+NI+M+NVRN +I+DQYYC  KAC
Sbjct  327   CVSNITVRNAFIRDSDNGLRIKTWQGGTGSVTGISFENIQMENVRNCVIIDQYYCLTKAC  386

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              N+TSAVY+SDV+Y NIKGT+D RSPP+  ACSD+V CTN+T+SEVEL P +G  + DPF
Sbjct  387   RNETSAVYLSDVTYRNIKGTYDVRSPPIHFACSDTVACTNITMSEVELLPYEGVLVDDPF  446

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSL  204
             CWNAYG  +T+TIPP+ CL +G P SL
Sbjct  447   CWNAYGLQETLTIPPIDCLQDGMPLSL  473



>ref|XP_008390405.1| PREDICTED: polygalacturonase At1g48100 [Malus domestica]
Length=615

 Score =   524 bits (1349),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 242/395 (61%), Positives = 299/395 (76%), Gaps = 1/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             NVM YG +GDG ADDT AF++AW EAC  + + ++LAP  + F I STIF+GPC+  L+F
Sbjct  222   NVMDYGAVGDGSADDTAAFRQAWKEACAVE-SGVVLAPSDYCFKITSTIFSGPCQPGLVF  280

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++G +MPPDGP++WP   +  QWLVFYR++ M+  G G I+G G+KWW LPCKPHRG  
Sbjct  281   QVDGVLMPPDGPETWPTTDSLNQWLVFYRLDQMTFTGTGTIEGNGQKWWELPCKPHRGPK  340

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G+TLPGPCDSP  IRFF SSNL V+ L+I+NSP FH +FD C  V I+ + I +P  SPN
Sbjct  341   GSTLPGPCDSPAMIRFFMSSNLVVRGLRIQNSPKFHMKFDGCEGVLIEKISISSPKLSPN  400

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT  V I++S++SNGDDCISIG GC NVDI  +TCGP HGISIGSLG+  SRA
Sbjct  401   TDGIHIENTKSVAIYDSMISNGDDCISIGTGCANVDIMGVTCGPSHGISIGSLGVHNSRA  460

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V ++ IR SDNG RIKTWQGG G VS + F+NI+M+NV N ++VDQYYC +K C
Sbjct  461   CVSNITVRNAVIRESDNGARIKTWQGGTGCVSGILFENIQMENVLNCLLVDQYYCLSKGC  520

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQTSAV ++D++Y NIKGT+D R+PP+  ACSD+V C N+TLSEVELYP +G  M DPF
Sbjct  521   LNQTSAVLVTDLTYRNIKGTYDVRTPPIHFACSDTVACRNITLSEVELYPHEGELMDDPF  580

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYG  +T TIPP+ CL EG PQ    V    C
Sbjct  581   CWNAYGIQETATIPPIDCLQEGEPQVAAEVSEYTC  615



>ref|XP_006286811.1| hypothetical protein CARUB_v10003570mg [Capsella rubella]
 gb|EOA19709.1| hypothetical protein CARUB_v10003570mg [Capsella rubella]
Length=477

 Score =   518 bits (1335),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 245/394 (62%), Positives = 307/394 (78%), Gaps = 9/394 (2%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDL------TPILLAPKHHSFLIQSTIFTGPC  1203
             NV +YG +GDGV DDT +FK+AWD AC +D+        ILL P   +F+I STIFTGPC
Sbjct  72    NVRNYGAVGDGVTDDTDSFKKAWDSACSNDIDNNNNTVSILLVPYGFTFMIHSTIFTGPC  131

Query  1202  KNPLLFQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCK  1023
             ++   FQ++GTI+P DGP SWP    KRQWLVFYRVNG++++G G+IDGRG+ WW+LPCK
Sbjct  132   RSYQYFQVDGTIVPRDGPKSWPSGFNKRQWLVFYRVNGIALKGVGVIDGRGQTWWDLPCK  191

Query  1022  PHR-GVNGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIK  846
             PHR  VN T L GPC+SP A+RFF SSN+ V+ L IKNSP  H +FD C+ VHI++L I 
Sbjct  192   PHRQNVNKTALAGPCESPAALRFFMSSNVIVESLSIKNSPQVHLKFDGCNVVHINTLRII  251

Query  845   APPNSPNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPG-HGISIGS  669
             +P +SPNTDGIHIEN+  + I+NS++SNGDDC+SIG G Y++DIRN+TCGPG HGISIGS
Sbjct  252   SPSSSPNTDGIHIENSNSIEIYNSVISNGDDCVSIGTGSYDIDIRNLTCGPGGHGISIGS  311

Query  668   LGIKQSRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQ  489
             LG K SRACVSN+ V DS I+ SDNGVRIKTWQGG G+VS VTFDNI MD VRNPII+DQ
Sbjct  312   LGDKNSRACVSNVTVRDSVIKFSDNGVRIKTWQGGSGSVSGVTFDNIHMDAVRNPIIIDQ  371

Query  488   YYCSNKACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQ  309
             YYC+ K+C N+TSAV+++D++Y +IKGT+D RSPPM   CS++VPCTNLTLS++EL PS 
Sbjct  372   YYCTAKSCANKTSAVFVNDIAYQSIKGTYDIRSPPMHFGCSNNVPCTNLTLSDIELLPSN  431

Query  308   GHRMLDPFCWNAYGDLKTVTIPPVFCLLEGNPQS  207
             G   +DPFCWNAYG     + P + C L+ NP +
Sbjct  432   GETDVDPFCWNAYGITDEFSKPSISC-LKSNPST  464



>ref|XP_006355087.1| PREDICTED: polygalacturonase At1g48100-like, partial [Solanum 
tuberosum]
Length=479

 Score =   518 bits (1334),  Expect = 9e-177, Method: Compositional matrix adjust.
 Identities = 240/387 (62%), Positives = 299/387 (77%), Gaps = 1/387 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +VM YG +GDG  DDT AF  AW  ACQ + + +LLAP    F+I STIF GPCK  L F
Sbjct  84    DVMEYGAVGDGSTDDTEAFIAAWKAACQVE-SAVLLAPADRIFMITSTIFYGPCKPGLEF  142

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             ++ G +M P+GPD WPK  +KRQW+VFY+++ M+  G G I+G GEKWW LPCKPHRG N
Sbjct  143   RVNGVLMTPEGPDCWPKKDSKRQWIVFYKLDNMTFTGTGTIEGNGEKWWELPCKPHRGPN  202

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G+TLPGPCDSP  IRFF SSNLTV+ L+I+NSP+FH +FD C  V ID L I +P  SPN
Sbjct  203   GSTLPGPCDSPSMIRFFMSSNLTVRGLRIQNSPMFHMKFDGCEGVLIDQLSISSPKLSPN  262

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIE+T  V I+NS+++NGDDCISIG GC NV+I  +TCGP HGISIGSLG+  S+A
Sbjct  263   TDGIHIEDTKSVGIYNSVIANGDDCISIGPGCSNVEIEAVTCGPSHGISIGSLGVHNSQA  322

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V ++ IR+SDNGVRIKTWQGG G+V+ ++FD I+M+NVRN II+DQYYC +K C
Sbjct  323   CVSNITVRNAIIRDSDNGVRIKTWQGGSGSVTGLSFDTIQMENVRNCIIIDQYYCLSKGC  382

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              N+TSAV + D+SY NIKGT+D RS P+  ACSD+V CTN+T+SEVEL P +G  M DPF
Sbjct  383   RNETSAVSVGDISYRNIKGTYDVRSAPIHFACSDTVACTNITMSEVELLPHEGELMEDPF  442

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSL  204
             CWNAYG  +T+TIPP+ CL +G P ++
Sbjct  443   CWNAYGIQQTLTIPPIDCLQDGMPLAI  469



>ref|XP_003531109.1| PREDICTED: polygalacturonase At1g48100-like [Glycine max]
 gb|KHN28933.1| Polygalacturonase [Glycine soja]
Length=484

 Score =   518 bits (1334),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 244/395 (62%), Positives = 309/395 (78%), Gaps = 1/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V S+G +GDG ADDT AF+ AW  AC  D + I+LAP+++SF I STIF+GPCK  L+F
Sbjct  90    DVRSFGAVGDGCADDTRAFRAAWKAACAVD-SGIVLAPENYSFKITSTIFSGPCKPGLVF  148

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++GT+M PDGP+SWP+  ++ QWLVFYR++ M++ G G I+G G+KWW+LPCKPHRG N
Sbjct  149   QVDGTLMAPDGPNSWPEADSRNQWLVFYRLDQMTLNGTGTIEGNGDKWWDLPCKPHRGPN  208

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G TL GPC SP  IRFF SSNL V+ LKI+NSP FH  F+ C  V ID L I +P  SPN
Sbjct  209   GKTLSGPCGSPAMIRFFMSSNLKVKGLKIQNSPQFHMIFNGCQGVLIDKLSISSPKLSPN  268

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIH+EN+  V I+NS++SNGDDCISIG G  NVDI  +TCGP HGISIGSLG+  S+A
Sbjct  269   TDGIHVENSKYVGIYNSMISNGDDCISIGPGSSNVDIAGLTCGPSHGISIGSLGVHNSQA  328

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSN+ V DS IR SDNG+RIKTWQGG G+VS + F+NI+M+NV N II+DQYYC +K C
Sbjct  329   CVSNLTVRDSIIRESDNGLRIKTWQGGMGSVSSLRFENIQMENVGNCIIIDQYYCLSKEC  388

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQTSAV+++DVSYSNIKGT+D R+ P+  ACSD+V CTN+TLSEVEL P +G  + DPF
Sbjct  389   LNQTSAVHVNDVSYSNIKGTYDVRTAPIHFACSDTVACTNITLSEVELLPFEGALLDDPF  448

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYG  +T+TIPP+ CL EG+P+++ ++   QC
Sbjct  449   CWNAYGTQETLTIPPINCLREGDPETVGDLSEYQC  483



>ref|XP_006645792.1| PREDICTED: polygalacturonase At1g48100-like, partial [Oryza brachyantha]
Length=398

 Score =   514 bits (1324),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 236/394 (60%), Positives = 301/394 (76%), Gaps = 4/394 (1%)
 Frame = -2

Query  1361  VMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLFQ  1182
             V  +G  GDGV DDT A K AWD ACQ D   ++LA   HSFL+++T+FTGPC+  +  Q
Sbjct  8     VKDFGAAGDGVTDDTDALKTAWDTACQDDGAGVVLAAAGHSFLVRNTVFTGPCQGSVTLQ  67

Query  1181  IEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVNG  1002
             ++GTI+ P  P +WP N  +R WL+FYR +G+S+ G GLIDG+G+KWW+LPCKPH+G N 
Sbjct  68    VDGTIVAPSDPATWPAN-NRRNWLIFYRADGVSLVGSGLIDGKGQKWWDLPCKPHKGGN-  125

Query  1001  TTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPNT  822
                 GPCDSPVA+RFFTS+N+TVQ L+++NSP FHFRFD+C  V +D L I +P  SPNT
Sbjct  126   --THGPCDSPVAMRFFTSNNVTVQGLRVQNSPEFHFRFDSCRGVRVDGLSISSPALSPNT  183

Query  821   DGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRAC  642
             DGIH+ENT DV I N++VSNGDDC+SIGAG  NV I N+TCGPGHGISIGSLG   +RAC
Sbjct  184   DGIHVENTQDVLITNTVVSNGDDCVSIGAGTLNVHIENVTCGPGHGISIGSLGKAGTRAC  243

Query  641   VSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKACT  462
             V N+ V ++ IR+SDNGVRIKTWQGG G+VS V F+N+RMD VRNPII+DQYYC +K+C 
Sbjct  244   VGNVTVRNAVIRHSDNGVRIKTWQGGSGSVSAVAFENVRMDAVRNPIIIDQYYCLSKSCE  303

Query  461   NQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPFC  282
             N+T+AV +  VSY+ I+GT+DARSPP+   CSD+VPCTN+TLS+VEL P+ G  + DPFC
Sbjct  304   NETTAVLVDGVSYAGIRGTYDARSPPIHFGCSDAVPCTNITLSDVELLPASGDTVDDPFC  363

Query  281   WNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             WN YG+  T T+PPV CL+ G P++       +C
Sbjct  364   WNVYGNAATPTVPPVACLMGGVPRNYEESSNHKC  397



>ref|XP_004962547.1| PREDICTED: polygalacturonase At1g48100-like [Setaria italica]
Length=484

 Score =   517 bits (1332),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 238/387 (61%), Positives = 305/387 (79%), Gaps = 1/387 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V +YG +GDG  DDT AF+ AW  AC SD   +LL P   +F I +T F+GPCK  L+F
Sbjct  90    DVRAYGAVGDGTTDDTQAFREAWKAACASDFA-VLLVPSDGTFTITTTTFSGPCKPGLVF  148

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++G +MPPDGPD WP +  +RQW+VF  ++GM+++G G I+G GE WWNLPCKPHRG N
Sbjct  149   QVDGVLMPPDGPDCWPASDNRRQWVVFSNLDGMTLRGSGTIEGNGEDWWNLPCKPHRGPN  208

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G+TL GPCDSP  +RFF S NL V+ L+++NSP FHFRFD C DV +D LYI +P NSPN
Sbjct  209   GSTLRGPCDSPTLVRFFMSRNLVVEGLRVENSPEFHFRFDGCSDVRVDGLYISSPANSPN  268

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIH+ENT  V I+NS +SNGDDCISIG G Y+VDI+N+TCGPGHGISIGSLG+  S+A
Sbjct  269   TDGIHVENTERVAIYNSRISNGDDCISIGTGSYDVDIQNVTCGPGHGISIGSLGVHNSQA  328

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CV+N+ V ++ IRNSDNG+RIKTWQGG GAVS +TFD + M+NVRN IIVDQYYC +K C
Sbjct  329   CVANVTVRNAVIRNSDNGLRIKTWQGGMGAVSGITFDTVVMENVRNCIIVDQYYCLDKRC  388

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQ++AV+++DVSY+N++G++D R+ P+  ACSD+VPCTN+T+SEVEL P+ G  + DPF
Sbjct  389   MNQSTAVHVTDVSYTNVRGSYDVRAAPIHFACSDTVPCTNITMSEVELLPASGELVDDPF  448

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSL  204
             CW+AYG  +T TIPP+ CL EG P +L
Sbjct  449   CWSAYGTQQTPTIPPITCLQEGLPDAL  475



>gb|EYU43882.1| hypothetical protein MIMGU_mgv1a005582mg [Erythranthe guttata]
Length=478

 Score =   517 bits (1331),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 239/387 (62%), Positives = 302/387 (78%), Gaps = 1/387 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V  +G +GDG  DDT AFK AW  ACQ +   ++LAP   +F+I STIF+GPC+  L+F
Sbjct  84    DVTDFGAVGDGDTDDTAAFKSAWKAACQVE-NGVVLAPNDFTFVITSTIFSGPCQPGLVF  142

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++G +  PDGPD WP++ + +QW+VFYR++ MS  G G I+G G+KWW+LPCKPH+G N
Sbjct  143   QVDGVLATPDGPDCWPESDSHKQWIVFYRLDNMSFTGTGTIEGNGQKWWDLPCKPHKGPN  202

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G+TLPGPCDSP  IRFF SSNL V  L+I+NSP FH +FD C  V ID L I +P  SPN
Sbjct  203   GSTLPGPCDSPAMIRFFMSSNLVVSSLRIQNSPQFHMKFDGCQGVTIDKLSIFSPKLSPN  262

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT  V I+NS++ NGDDCISIG GC +V+I  +TCGP HGISIGSLG+  SRA
Sbjct  263   TDGIHIENTKSVGIYNSLIHNGDDCISIGQGCADVEIDGVTCGPSHGISIGSLGVHNSRA  322

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V +  IR+SDNG+RIKTWQGG G+VS ++F+NI+M+NVRN +I+DQYYC  KAC
Sbjct  323   CVSNITVKNIIIRDSDNGLRIKTWQGGAGSVSGISFENIQMENVRNSVIIDQYYCLTKAC  382

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              N+TSAVY++DVSY NIKGT+D RSPP+  ACSD+V CTN+T+SEVEL P +G  + DPF
Sbjct  383   RNETSAVYLTDVSYKNIKGTYDVRSPPIHFACSDTVACTNITMSEVELLPYEGVLVDDPF  442

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSL  204
             CWNAYG  +T+TIPP+ CL +G P+SL
Sbjct  443   CWNAYGVQETLTIPPIDCLQDGMPESL  469



>ref|XP_004236918.1| PREDICTED: polygalacturonase At1g48100 [Solanum lycopersicum]
Length=490

 Score =   517 bits (1332),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 239/387 (62%), Positives = 299/387 (77%), Gaps = 1/387 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +VM YG +GDG  DDT AF  AW  ACQ + + +LLAP    F+I STIF GPCK  L F
Sbjct  95    DVMEYGAVGDGSTDDTEAFVAAWKAACQVE-SAVLLAPADRIFMITSTIFYGPCKPGLEF  153

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             ++ G +M P+GPD WPK  +KRQW+VFY+++ M+  G G I+G GEKWW LPCKPHRG N
Sbjct  154   RVNGVLMTPEGPDCWPKKDSKRQWIVFYKLDNMTFSGTGTIEGNGEKWWELPCKPHRGPN  213

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G+TLPGPCDSP  IRFF SSNLTV+ L+I+NSP+FH +FD C  V ID L I +P  SPN
Sbjct  214   GSTLPGPCDSPSMIRFFMSSNLTVRGLRIQNSPMFHMKFDGCEGVLIDQLSISSPKLSPN  273

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIE+T  V I+NS+++NGDDCISIG GC NV+I  +TCGP HGISIGSLG+  S+A
Sbjct  274   TDGIHIEDTKSVGIYNSVIANGDDCISIGPGCSNVEIEAVTCGPSHGISIGSLGVHNSQA  333

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V ++ IR+SDNGVRIKTWQGG G+V+ ++FD I+M+NVRN II+DQYYC +K C
Sbjct  334   CVSNITVRNAIIRDSDNGVRIKTWQGGSGSVTGLSFDTIQMENVRNCIIIDQYYCLSKGC  393

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              N+TSAV + D+SY +IKGT+D RS P+  ACSD+V CTN+T+SEVEL P +G  M DPF
Sbjct  394   RNETSAVSVGDISYRSIKGTYDVRSAPIHFACSDTVACTNITMSEVELLPHEGELMEDPF  453

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSL  204
             CWNAYG  +T+TIPP+ CL +G P ++
Sbjct  454   CWNAYGIQQTLTIPPIDCLQDGMPLAI  480



>ref|XP_009372060.1| PREDICTED: LOW QUALITY PROTEIN: polygalacturonase At1g48100 [Pyrus 
x bretschneideri]
Length=617

 Score =   521 bits (1343),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 239/386 (62%), Positives = 299/386 (77%), Gaps = 1/386 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             NVM YG +GDG AD T AF++AW EAC  + + ++LAP  + F I STIF+GPC+  L+F
Sbjct  224   NVMDYGAVGDGSADGTAAFRQAWKEACAVE-SGVVLAPSDYCFKIISTIFSGPCQPGLVF  282

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++G +MPPDGP++WP   +  QWLVFYR+N M+  G G I+G G+KWW+LPCKPHRG  
Sbjct  283   QVDGVLMPPDGPETWPTKDSLNQWLVFYRLNQMTFTGTGTIEGNGQKWWDLPCKPHRGPK  342

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G+TLPGPCDSP  IRFF SSNL V+ L+I+NSP FH +FD C  V I+ + I +P  SPN
Sbjct  343   GSTLPGPCDSPAMIRFFMSSNLVVRGLRIQNSPKFHMKFDGCEGVLIEKISISSPKLSPN  402

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT  V I++S++SNGDDCISIG GC NVDI  +TCGP HGISIGSLG+  S+A
Sbjct  403   TDGIHIENTKSVAIYDSMISNGDDCISIGTGCANVDIMGVTCGPSHGISIGSLGVHNSQA  462

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V ++ IR SDNGVRIKTWQGG G VS + F+NI+M+NV N ++VDQYYC +K C
Sbjct  463   CVSNITVRNAVIRESDNGVRIKTWQGGTGCVSGILFENIQMENVLNCLLVDQYYCLSKGC  522

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQTSAV ++D++Y NIKGT+D R+PP+  ACSD+V C N+TLSEVELYP +G  M DPF
Sbjct  523   LNQTSAVLVTDLTYRNIKGTYDVRTPPIHFACSDTVACRNITLSEVELYPHEGELMDDPF  582

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQS  207
             CWNAYG+ +T  IPP+ CL EG PQ+
Sbjct  583   CWNAYGNQETAIIPPIDCLQEGEPQA  608



>gb|KHG11151.1| hypothetical protein F383_15050 [Gossypium arboreum]
Length=476

 Score =   515 bits (1327),  Expect = 7e-176, Method: Compositional matrix adjust.
 Identities = 238/395 (60%), Positives = 298/395 (75%), Gaps = 1/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V +YG +GDG +DDT+AF+ AW  AC  +   IL+ P   SF I STIF+GPCK  L+ 
Sbjct  83    DVTAYGAVGDGSSDDTVAFREAWKAACSVESATILV-PSDKSFTITSTIFSGPCKPGLVL  141

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q+ G +MPP GPD WPK  +++QWLVFYR++ M + G G I+G G KWW LPCKPH+G  
Sbjct  142   QVNGVLMPPKGPDCWPKADSRKQWLVFYRLDDMKLTGNGTIEGNGHKWWELPCKPHKGPK  201

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G++LPGPC+SP  IRFF SSN+ V  L+I+NSP FH +FD C  V I+ L I  P  SPN
Sbjct  202   GSSLPGPCESPAMIRFFMSSNIVVSGLRIQNSPQFHMKFDGCEGVLIEELSISTPKLSPN  261

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT  V I+NS++SNGDDCISIG GC NVDI  +TCGP HGISIGSLG+  S+A
Sbjct  262   TDGIHIENTKSVGIYNSMISNGDDCISIGPGCSNVDINGVTCGPSHGISIGSLGVHNSQA  321

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V ++ IR SDNGVRIKTWQGG G+VS ++F+NI+M+NVRN IIVDQYYC +K C
Sbjct  322   CVSNITVRNAVIRESDNGVRIKTWQGGTGSVSGISFENIQMENVRNCIIVDQYYCLSKEC  381

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQTSAVY++D+ Y NIKGT+D R+PP+  ACSD+V CTN+T++EVEL P +G  + DPF
Sbjct  382   LNQTSAVYVTDIRYKNIKGTYDVRNPPIHFACSDTVACTNITMAEVELLPQEGELVDDPF  441

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYG  +T+TIPP+ CL EG PQ++       C
Sbjct  442   CWNAYGIEETLTIPPIGCLQEGMPQAITETSQYSC  476



>ref|XP_011003168.1| PREDICTED: polygalacturonase At1g48100 isoform X2 [Populus euphratica]
Length=430

 Score =   513 bits (1320),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 244/395 (62%), Positives = 300/395 (76%), Gaps = 34/395 (9%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V ++G IGDG+ DDT AFK AWD AC      ++L P    F+IQSTIF+GPCK+ L+F
Sbjct  70    DVRNFGAIGDGIIDDTDAFKMAWDAACNQVDPAVILVPYGFDFMIQSTIFSGPCKDGLVF  129

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++GT+MPPDGPDSWP+  ++RQWLVFYR+N MS+QGGG+I GRGEKWW+LPCKPH+G+N
Sbjct  130   QVDGTLMPPDGPDSWPQKNSRRQWLVFYRINEMSLQGGGVIYGRGEKWWDLPCKPHKGIN  189

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             GTT+PGPCDSP AIRFF SSNLT+  LKIKNSP F+ RFDNC +VH++S++I AP  SPN
Sbjct  190   GTTMPGPCDSPTAIRFFMSSNLTIHGLKIKNSPQFNLRFDNCKNVHVESIHITAPALSPN  249

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT  V I+NS++SNGDDC+SIG+GC++VDI N+TCGP HGISIGSLG   SRA
Sbjct  250   TDGIHIENTNGVGIYNSVISNGDDCVSIGSGCFDVDIENITCGPSHGISIGSLGNHNSRA  309

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V DS IR SDNGVRIKTWQGG GAVS +TF NI MD VRNPII+DQ+YC  K  
Sbjct  310   CVSNITVRDSVIRVSDNGVRIKTWQGGSGAVSGITFSNIHMDYVRNPIIIDQFYCLTK--  367

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
                                             SDS+PCTN+TLS++EL P++G+ +LDP+
Sbjct  368   --------------------------------SDSLPCTNITLSDIELLPAEGYSVLDPY  395

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYGD +T+TIPPV CL+EG P S+ N ++  C
Sbjct  396   CWNAYGDSQTLTIPPVSCLMEGIPGSILNNEMHYC  430



>gb|KHN25928.1| Polygalacturonase [Glycine soja]
Length=490

 Score =   514 bits (1325),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 241/395 (61%), Positives = 307/395 (78%), Gaps = 1/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V S+G +GDG ADDT AF+ AW  AC  D + ++LAP+++ F I STIF+GPCK  L+F
Sbjct  96    DVRSFGAVGDGCADDTRAFRAAWKAACAVD-SGVVLAPENYIFKISSTIFSGPCKPGLVF  154

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++GT+M PDGP+SWP+  ++ QWLVFYR++ M++ G G I+G G+KWW+LPCKPHRG +
Sbjct  155   QVDGTLMAPDGPNSWPEADSRNQWLVFYRLDQMTLNGTGTIEGNGDKWWDLPCKPHRGPS  214

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G TL GPC SP  IRFF SSNL V  LKI+NSP FH  F+ C  V ID L I +P  SPN
Sbjct  215   GKTLSGPCGSPAMIRFFMSSNLKVNGLKIQNSPQFHMIFNGCQGVLIDKLSISSPKLSPN  274

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIH+EN+  V I+NS++SNGDDCISIG G  NVDI  +TCGP HGISIGSLG+  S+A
Sbjct  275   TDGIHVENSKYVGIYNSMISNGDDCISIGPGSSNVDIAGLTCGPSHGISIGSLGVHNSQA  334

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSN+ V DS IR SDNG+RIKTWQGG G+VS + F+NI+M+NV N II+DQYYC +K C
Sbjct  335   CVSNLTVRDSIIRESDNGLRIKTWQGGMGSVSSLRFENIQMENVGNCIIIDQYYCMSKEC  394

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQTSAV+++DVSYSNIKGT+D R+ P+  ACSD+V CTN+TLSEVEL P +G  + DPF
Sbjct  395   LNQTSAVHVNDVSYSNIKGTYDVRTAPIHFACSDTVACTNITLSEVELLPFEGALLDDPF  454

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYG  +T+TIPP+ CL EG+P+++ ++   QC
Sbjct  455   CWNAYGTQETLTIPPINCLREGDPETVGDLSEYQC  489



>ref|XP_010024841.1| PREDICTED: polygalacturonase At1g48100 [Eucalyptus grandis]
 gb|KCW61352.1| hypothetical protein EUGRSUZ_H04092 [Eucalyptus grandis]
Length=477

 Score =   514 bits (1324),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 237/395 (60%), Positives = 305/395 (77%), Gaps = 1/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V ++G +GDG +DDT AF  AW  AC  + + ++LAP  H+F+I STIF+GPCK  L+F
Sbjct  84    DVTAFGAVGDGSSDDTPAFTAAWKAACAVE-SGVVLAPSGHTFMITSTIFSGPCKPGLVF  142

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++G +MPP+GPDSWPK  +K QWLVFYR++GM++ G G I+G GE WW+LPCKPHRG +
Sbjct  143   QVDGVLMPPNGPDSWPKADSKNQWLVFYRLDGMTLTGTGTIEGNGEPWWDLPCKPHRGPS  202

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G T  GPCDSP  IRFF SSNL V  L+I+NSP FH +FD C  V I+ L I +P  SPN
Sbjct  203   GQTASGPCDSPTMIRFFMSSNLAVNGLRIQNSPQFHMKFDGCEGVQIEKLSISSPKLSPN  262

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIH+ NT  V I+NS++SNGDDCISIG GC +++I  +TCGP HGISIGSLG+  S+A
Sbjct  263   TDGIHLGNTKSVGIYNSMISNGDDCISIGTGCSDINIEGVTCGPSHGISIGSLGVHNSQA  322

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V +  IR SDNG+RIKTWQGG G+V+ ++F+NI+M++VRN IIVDQYYC +KAC
Sbjct  323   CVSNITVRNVMIRESDNGLRIKTWQGGSGSVTGISFENIQMEDVRNCIIVDQYYCLSKAC  382

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              N+TSAVY++D+SY NIKGT++  SPP+  ACSD+VPCTN+T+SEVEL P +G  + DPF
Sbjct  383   RNETSAVYVNDLSYRNIKGTYNVISPPIHFACSDTVPCTNITMSEVELLPHEGELVDDPF  442

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYG  +TVTIPP+ CL +G PQ++       C
Sbjct  443   CWNAYGVQETVTIPPIDCLRDGMPQTVAESPAYSC  477



>ref|XP_003524819.1| PREDICTED: polygalacturonase At1g48100 [Glycine max]
Length=490

 Score =   514 bits (1324),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 241/395 (61%), Positives = 307/395 (78%), Gaps = 1/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V S+G +GDG ADDT AF+ AW  AC  D + ++LAP+++ F I STIF+GPCK  L+F
Sbjct  96    DVRSFGAVGDGCADDTRAFRAAWKAACAVD-SGVVLAPENYIFKISSTIFSGPCKPGLVF  154

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++GT+M PDGP+SWP+  ++ QWLVFYR++ M++ G G I+G G+KWW+LPCKPHRG +
Sbjct  155   QVDGTLMAPDGPNSWPEADSRNQWLVFYRLDQMTLNGTGTIEGNGDKWWDLPCKPHRGPS  214

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G TL GPC SP  IRFF SSNL V  LKI+NSP FH  F+ C  V ID L I +P  SPN
Sbjct  215   GKTLSGPCGSPAMIRFFMSSNLKVNGLKIQNSPQFHMIFNGCQGVLIDKLSISSPKLSPN  274

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIH+EN+  V I+NS++SNGDDCISIG G  NVDI  +TCGP HGISIGSLG+  S+A
Sbjct  275   TDGIHVENSKYVGIYNSMISNGDDCISIGPGSSNVDIAGLTCGPSHGISIGSLGVHNSQA  334

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSN+ V DS IR SDNG+RIKTWQGG G+VS + F+NI+M+NV N II+DQYYC +K C
Sbjct  335   CVSNLTVRDSIIRESDNGLRIKTWQGGMGSVSSLRFENIQMENVGNCIIIDQYYCMSKEC  394

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQTSAV+++DVSYSNIKGT+D R+ P+  ACSD+V CTN+TLSEVEL P +G  + DPF
Sbjct  395   LNQTSAVHVNDVSYSNIKGTYDVRTAPIHFACSDTVACTNITLSEVELLPFEGALLDDPF  454

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYG  +T+TIPP+ CL EG+P+++ ++   QC
Sbjct  455   CWNAYGTQETLTIPPINCLREGDPETVGDLSEYQC  489



>ref|XP_002519290.1| Polygalacturonase precursor, putative [Ricinus communis]
 gb|EEF43154.1| Polygalacturonase precursor, putative [Ricinus communis]
Length=479

 Score =   513 bits (1321),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 245/390 (63%), Positives = 304/390 (78%), Gaps = 1/390 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V SYG +GDG  DDT AF  AW  AC  + + ++LAP  +SF+I STIF+GPC+  L+F
Sbjct  87    DVTSYGAVGDGSTDDTAAFVAAWKAACAVE-SGVILAPSGYSFMITSTIFSGPCQPGLVF  145

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++G +MPPDGPDSWP+  +K+QWLVFYR+  M++ G G I+G GEKWW+LPCKPHR  N
Sbjct  146   QVDGCLMPPDGPDSWPEKDSKKQWLVFYRLTDMTLTGKGTIEGNGEKWWDLPCKPHRSPN  205

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G +   PCDSP  IRFF SSNL V  L I+NSP FH +FD C  V I+ L I +P  SPN
Sbjct  206   GESSKEPCDSPAMIRFFMSSNLVVSGLSIQNSPQFHMKFDGCEGVLIEKLSISSPKLSPN  265

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT  V I+NS++SNGDDCISIG GC NVDI  +TCGP HGISIGSLG+  S+A
Sbjct  266   TDGIHIENTKTVGIYNSMISNGDDCISIGTGCSNVDIEGVTCGPSHGISIGSLGVHNSQA  325

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V+++ IR+SDNGVRIKTWQGG G VS ++F NI+M+NVRN +I+DQYYC +KAC
Sbjct  326   CVSNITVSNAIIRDSDNGVRIKTWQGGTGCVSGISFQNIQMENVRNCMIIDQYYCMSKAC  385

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQTSAV+++DVSY NIKGT+D R+PP+  ACSD+VPCTN+TLSEVEL P +G  + DPF
Sbjct  386   LNQTSAVHVTDVSYRNIKGTYDVRTPPIHFACSDTVPCTNITLSEVELLPEEGELVDDPF  445

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNV  195
             CWNAYG  +TVTIPP+ CL +G P+S+  V
Sbjct  446   CWNAYGTEETVTIPPLNCLRDGEPESVQEV  475



>ref|XP_008811536.1| PREDICTED: polygalacturonase At1g48100-like [Phoenix dactylifera]
Length=352

 Score =   507 bits (1306),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 230/344 (67%), Positives = 283/344 (82%), Gaps = 0/344 (0%)
 Frame = -2

Query  1235  LIQSTIFTGPCKNPLLFQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDG  1056
             +I STIF+GPCK   +FQ++G +MPPDGPD WP + +K QWLVFY+++G++++G G I+G
Sbjct  1     MITSTIFSGPCKPGFVFQVDGVLMPPDGPDCWPASDSKHQWLVFYKLDGLTLRGEGTIEG  60

Query  1055  RGEKWWNLPCKPHRGVNGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCH  876
              GE WWNLPCKPHRG +GTTLPGPCDSP  IRFF SSNLTV+DL+I+NSP FH +FD C 
Sbjct  61    NGEDWWNLPCKPHRGPDGTTLPGPCDSPALIRFFMSSNLTVKDLRIENSPQFHIKFDGCE  120

Query  875   DVHIDSLYIKAPPNSPNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCG  696
              VHI+ + I +P  SPNTDGIHIENT  V+I+NS++ NGDDCISIG GC NVDI N+TCG
Sbjct  121   GVHIEGIKINSPALSPNTDGIHIENTKSVSIYNSMIGNGDDCISIGTGCSNVDIENVTCG  180

Query  695   PGHGISIGSLGIKQSRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDN  516
             P HGISIGSLG+  S+ACVSNI V ++ IRNSDNGVRIKTWQGG G+V+ ++F+NI M+N
Sbjct  181   PSHGISIGSLGVHNSQACVSNISVKNAVIRNSDNGVRIKTWQGGMGSVTSISFENIIMEN  240

Query  515   VRNPIIVDQYYCSNKACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTL  336
             VRN II+DQYYC  K C NQTSAVY++DVSY NIKGT+D RSPP+  ACSD+VPCTN+T+
Sbjct  241   VRNCIIIDQYYCLTKQCMNQTSAVYVTDVSYMNIKGTYDVRSPPIHFACSDTVPCTNITM  300

Query  335   SEVELYPSQGHRMLDPFCWNAYGDLKTVTIPPVFCLLEGNPQSL  204
             SEVEL P  G  + DPFCWNAYG ++T+TIPP+ CL EG PQS+
Sbjct  301   SEVELLPFDGELVDDPFCWNAYGSMETLTIPPISCLQEGEPQSV  344



>ref|XP_003567574.1| PREDICTED: polygalacturonase At1g48100 [Brachypodium distachyon]
Length=499

 Score =   513 bits (1321),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 236/394 (60%), Positives = 303/394 (77%), Gaps = 4/394 (1%)
 Frame = -2

Query  1361  VMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLFQ  1182
             +  +G  GDGV DDT A K AWD ACQ     +++A   HSFL++ST+FTGPC+  +  Q
Sbjct  109   IKDFGAAGDGVTDDTDAIKTAWDTACQDAGEGVVVAAAGHSFLVRSTVFTGPCQGSVTLQ  168

Query  1181  IEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVNG  1002
             I+GTI+ P  P  WP N +KR WLVFY+ +G+S++G GLIDG+G+KWW+LPCKPH+G N 
Sbjct  169   IDGTIVAPSEPTEWPAN-SKRNWLVFYKADGVSLRGAGLIDGKGQKWWDLPCKPHKGGN-  226

Query  1001  TTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPNT  822
                 GPCDSPVA+RFF S+N+TVQ LK++NSP FHFRFD+C  VH+  L I +P  SPNT
Sbjct  227   --THGPCDSPVALRFFMSNNVTVQGLKVQNSPEFHFRFDSCRGVHVHGLSISSPALSPNT  284

Query  821   DGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRAC  642
             DGIH+ENT DV I N++VSNGDDC+SIGAG  NV I N+TCGPGHGISIGSLG + +RAC
Sbjct  285   DGIHVENTQDVLIANTVVSNGDDCVSIGAGTLNVHIENVTCGPGHGISIGSLGKQGTRAC  344

Query  641   VSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKACT  462
             VSNI V ++ IR+SDNGVRIKTWQGG G+VS VTF+N+RMD VRNPII+DQYYC +K+C 
Sbjct  345   VSNITVRNAVIRHSDNGVRIKTWQGGSGSVSGVTFENVRMDAVRNPIIIDQYYCLSKSCE  404

Query  461   NQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPFC  282
             N T+AV+++ V+YS I+GT+D R PP+   CSD+VPCTN+TLS VEL P+ G  +  PFC
Sbjct  405   NATTAVFVNGVTYSGIRGTYDVRGPPIHFGCSDAVPCTNITLSGVELLPATGDTVDSPFC  464

Query  281   WNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             WN YG+  T T+PPV CL++G P+++ +    +C
Sbjct  465   WNVYGNATTPTVPPVACLMDGVPRNVDDSSSLKC  498



>gb|KEH31410.1| pectin lyase superfamily protein [Medicago truncatula]
Length=461

 Score =   511 bits (1317),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 238/395 (60%), Positives = 306/395 (77%), Gaps = 1/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V S+G IGDG ADDT AFK+AW  AC  + + ILL P++++F+I S IF+GPCK  L+F
Sbjct  66    DVTSFGAIGDGSADDTPAFKKAWKAACAVE-SGILLVPENYTFMITSIIFSGPCKPGLVF  124

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++G +M PDGPDSWP+  ++ QWLVFY+++ MS+ G G I+G G++WW+LPCKPHRG +
Sbjct  125   QVDGMLMAPDGPDSWPEADSRNQWLVFYKLDQMSLNGTGTIEGNGDQWWDLPCKPHRGPD  184

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G TL GPC SP  IRFF SSNL V  LKI+NSP FH  F+ C  V I+ L I AP  SPN
Sbjct  185   GKTLSGPCGSPAMIRFFMSSNLYVNGLKIENSPQFHMIFNGCQGVMINMLSISAPKLSPN  244

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIH+EN+ DV I+NS++SNGDDCISIG G  NV+I  +TCGP HGISIGSLG+  S+A
Sbjct  245   TDGIHVENSKDVGIYNSLISNGDDCISIGPGTSNVEIAGVTCGPSHGISIGSLGVHNSQA  304

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSN+ V D+ IR SDNG+RIKTWQGG G+VS + F+NI+M+NV N I++DQYYC  K C
Sbjct  305   CVSNLTVRDTVIRESDNGLRIKTWQGGMGSVSNLKFENIQMENVGNCILIDQYYCLTKEC  364

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQTSAV+++DVSY NIKGT+D R+ P+  ACSD+V CTN+TLSEVEL P +G  + DPF
Sbjct  365   LNQTSAVHVNDVSYKNIKGTYDVRTAPIHFACSDTVACTNITLSEVELLPFEGELLDDPF  424

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYG  +T+TIPP+ CL EG+P+++ ++   QC
Sbjct  425   CWNAYGAQETLTIPPINCLREGDPETVGDLSTYQC  459



>ref|NP_192098.2| glycoside hydrolase family 28 protein / polygalacturonase (pectinase) 
family protein [Arabidopsis thaliana]
 gb|AEE82091.1| glycoside hydrolase family 28 protein / polygalacturonase (pectinase) 
family protein [Arabidopsis thaliana]
Length=468

 Score =   511 bits (1315),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 239/391 (61%), Positives = 305/391 (78%), Gaps = 6/391 (2%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEAC---QSDLTPILLAPKHHSFLIQSTIFTGPCKNP  1194
             +V  YG +G+GVADDT++FK AWD AC   +++   +L  P   +F+I+STIFTGPC++ 
Sbjct  66    DVRKYGAVGNGVADDTVSFKTAWDSACSNNKNNTASVLHVPYGFTFMIRSTIFTGPCRSY  125

Query  1193  LLFQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHR  1014
               FQ++GTI+P DGP SWP +L KRQWL FYR+NGM++QG G+IDGRG+ WW+LPCKPH+
Sbjct  126   QYFQVDGTIVPRDGPKSWPSSLNKRQWLAFYRINGMALQGAGVIDGRGQNWWDLPCKPHQ  185

Query  1013  -GVNGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPP  837
               VN T L GPC+SP A+RFF SSN+ V+ L IKNSP  H + D CH VHI+SL I +PP
Sbjct  186   QNVNKTKLAGPCESPAALRFFMSSNVIVKGLSIKNSPQVHLKLDGCHVVHINSLRIISPP  245

Query  836   NSPNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPG-HGISIGSLGI  660
              SPNTDGIHIEN+  V I+NS++SNGDDC+SIG G Y++DIRN+TCGPG HGISIGSLG 
Sbjct  246   ASPNTDGIHIENSNSVEIYNSVISNGDDCVSIGPGAYDIDIRNITCGPGGHGISIGSLGE  305

Query  659   KQSRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYC  480
             K S ACVSN+ V DS I+ S+NGVRIKTWQGG G+VS VTFDNI +D VRNPII+DQYYC
Sbjct  306   KNSHACVSNVTVRDSFIKFSENGVRIKTWQGGSGSVSGVTFDNIHVDTVRNPIIIDQYYC  365

Query  479   SNKACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHR  300
             + K+C N+TSAV+++D+ Y +IKGT+D RSPPM   CS++VPCTNLTLS +EL PS+   
Sbjct  366   TTKSCANKTSAVFVNDIVYQSIKGTYDIRSPPMHFGCSNNVPCTNLTLSNIELLPSKEDI  425

Query  299   MLDPFCWNAYGDLKTVTIPPVFCLLEGNPQS  207
             ++ PFCWNAYG     ++P + C L+ NP +
Sbjct  426   VVGPFCWNAYGITDEFSVPLISC-LKSNPST  455



>ref|XP_010231630.1| PREDICTED: polygalacturonase At1g48100 [Brachypodium distachyon]
Length=498

 Score =   510 bits (1313),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 231/387 (60%), Positives = 301/387 (78%), Gaps = 1/387 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V ++G  G+  ADDT AF+ AW  AC    + +LL P   +F I ST F+GPC+  L+F
Sbjct  104   DVRAFGAAGESTADDTDAFRAAWSAACAVQ-SGVLLVPSDGTFTIASTTFSGPCQPGLVF  162

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++G +MPPDGPD WP +  +RQWLVF  ++GM+++G G I+G GE+WWNLPCKPHRG N
Sbjct  163   QVDGVLMPPDGPDCWPPSDNRRQWLVFSNLDGMTLRGAGTIEGNGEEWWNLPCKPHRGPN  222

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G+TL GPCDSP  IRFF S NL V+ L+++NSP FHFRFD C DV +D L+I AP NSPN
Sbjct  223   GSTLHGPCDSPTLIRFFMSRNLVVEGLRVENSPEFHFRFDGCSDVLVDGLFISAPANSPN  282

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIH+ENT  V I+NS +SNGDDCISIG G Y++DI+N++CGPGHGISIGSLG+  S+A
Sbjct  283   TDGIHVENTERVRIYNSKISNGDDCISIGTGSYDLDIQNISCGPGHGISIGSLGVHNSQA  342

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CV+N+ V ++ IRNSDNG+RIKTWQGG G+VS + FD + M+NVRN II+DQYYC +K C
Sbjct  343   CVANVTVRNAVIRNSDNGLRIKTWQGGAGSVSGIAFDGVLMENVRNCIIIDQYYCLDKRC  402

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              N ++AV +++VSYSN++G++D RS P+  ACSD+VPCTN+T+SEVEL P  G  + DPF
Sbjct  403   MNASTAVRVANVSYSNVRGSYDVRSAPIHFACSDAVPCTNVTMSEVELLPFSGELVDDPF  462

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSL  204
             CW+AYG  +T TIPP+ CL +G P+SL
Sbjct  463   CWSAYGVQQTPTIPPISCLQDGLPESL  489



>gb|EPS63155.1| hypothetical protein M569_11631, partial [Genlisea aurea]
Length=442

 Score =   508 bits (1307),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 238/395 (60%), Positives = 303/395 (77%), Gaps = 3/395 (1%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V ++G +GD VADDT AF  AW+ AC ++ + +LLAP  + FL+QSTIFTGPCK    F
Sbjct  51    DVTTFGAVGDSVADDTEAFNAAWNGACGAN-SGVLLAPAGYKFLVQSTIFTGPCKPGFTF  109

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             QIEGTI+PPDGP+SWP++L++RQWLVFYR N M+++GGG+IDGRG+KWWNLPCKPH+G  
Sbjct  110   QIEGTIVPPDGPESWPEDLSRRQWLVFYRANDMAIRGGGVIDGRGKKWWNLPCKPHKG--  167

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G  +  PCDSP AIRFF S  + V+ +KIK+SP FH RFD+C  VH+DS++I +P  SPN
Sbjct  168   GFRVDAPCDSPTAIRFFMSHRVIVEGIKIKHSPQFHVRFDDCAHVHVDSIHITSPFWSPN  227

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIH+EN+  V I+NS +SNGDDC+SIG+G  NVDI+N+TCG GHGISIGSLG   S A
Sbjct  228   TDGIHLENSNFVQIYNSRISNGDDCVSIGSGTNNVDIKNVTCGSGHGISIGSLGNHNSLA  287

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             C SNI V +S I+NS NGVRIKTWQGG G V+ V FD I M+NVRNPII+DQ+YC    C
Sbjct  288   CASNITVRESVIKNSANGVRIKTWQGGSGQVTGVIFDGIFMENVRNPIIIDQFYCLANDC  347

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              N+TSAV +S V Y  I GT+   +PPM   CSDSVPCTN+TLS++EL+P++G  + DPF
Sbjct  348   VNRTSAVSVSGVQYRRISGTYSVSAPPMHFGCSDSVPCTNVTLSDIELFPAEGSLVSDPF  407

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWN YG ++T T+PPV C+ EG P+S  + +   C
Sbjct  408   CWNVYGQIETPTVPPVNCVSEGCPRSFADYNAGIC  442



>ref|XP_010098760.1| Polygalacturonase [Morus notabilis]
 gb|EXB75663.1| Polygalacturonase [Morus notabilis]
Length=483

 Score =   509 bits (1310),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 236/395 (60%), Positives = 300/395 (76%), Gaps = 1/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V S+G +GDG ADDT AF+ AW  AC  + + ++LAP ++ F I STIF+GPCK  L+F
Sbjct  90    DVTSFGAVGDGSADDTAAFREAWKAACAVE-SGVVLAPANYCFKITSTIFSGPCKPGLVF  148

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++G +MPPDGP+ WPK  +++QWLVFYR++ MS  G G I+G GEKWW+LPCKPHRG +
Sbjct  149   QVDGVLMPPDGPEEWPKADSRKQWLVFYRLDNMSFTGSGTIEGNGEKWWDLPCKPHRGPD  208

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G+T+ GPCDSP  IRFF SSNL V  L I+NSP FH +FD C  V ID L I +P  SPN
Sbjct  209   GSTMSGPCDSPALIRFFMSSNLVVSGLCIQNSPQFHMKFDGCEGVFIDKLSISSPKLSPN  268

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIE T  V I+NS+++NGDDCISIG GC +VDI  +TCGP HGISIGSLG+  S+A
Sbjct  269   TDGIHIEGTKTVGIYNSLIANGDDCISIGPGCADVDIEGVTCGPSHGISIGSLGVHNSQA  328

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V +  I+ SDNG+RIKTWQGG G+V+ + F+NI+M+NVRN I VDQYYC +KAC
Sbjct  329   CVSNITVRNVIIKESDNGLRIKTWQGGTGSVTGILFENIQMENVRNCINVDQYYCLSKAC  388

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQTSAVY++D+ Y  IKGT+D R+ P+  ACSD+V CTN+T+S+VEL P +G  + DPF
Sbjct  389   LNQTSAVYVNDIQYRTIKGTYDVRNTPIHFACSDTVACTNITMSDVELLPYEGELVEDPF  448

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYG  +T+TIPP+ CL EG P S+   +   C
Sbjct  449   CWNAYGTQETLTIPPINCLQEGEPVSVKESNKYDC  483



>ref|XP_004504655.1| PREDICTED: polygalacturonase At1g48100-like isoform X2 [Cicer 
arietinum]
Length=473

 Score =   508 bits (1309),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 236/395 (60%), Positives = 304/395 (77%), Gaps = 1/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V S+G +GDG  DDT AFK AW  AC  + + ++L P+ + F I STIF+GPCK  L+F
Sbjct  78    DVRSFGAVGDGSTDDTPAFKAAWKAACGVE-SGVVLVPESYIFKITSTIFSGPCKPGLVF  136

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++G I+ PDGPDSWP+  ++ QWLVFYR++ MS+ G G I+G G++WW+LPCKPHRG +
Sbjct  137   QVDGMIIAPDGPDSWPEGDSRNQWLVFYRLDQMSLNGTGTIEGNGDQWWDLPCKPHRGPD  196

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G TL GPC SP  IRFF SSNL V  L+I+NSP FH +FD C  V ID L I AP  SPN
Sbjct  197   GKTLSGPCGSPAMIRFFMSSNLMVSGLQIQNSPQFHMKFDGCQGVLIDRLTISAPKLSPN  256

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIH+EN+  V I+NS++SNGDDCISIG G  +VDI  +TCGP HGISIGSLG+  S+A
Sbjct  257   TDGIHVENSQAVGIYNSMISNGDDCISIGPGTSDVDIAGVTCGPSHGISIGSLGVHNSQA  316

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSN+ V D+ IR SDNG+RIKTWQGG G+V+ + F+NI+M+NV N I++DQYYC  K C
Sbjct  317   CVSNLTVRDTVIRESDNGLRIKTWQGGMGSVTGLKFENIQMENVGNCILIDQYYCLTKEC  376

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQTSAV+++DVSY NIKGT+D R+ P+  ACSDSV CTN+TLSEVEL+P +G  + DPF
Sbjct  377   LNQTSAVHVNDVSYKNIKGTYDVRTAPIHFACSDSVACTNITLSEVELFPYEGELLDDPF  436

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYG+ +T+TIPP+ CL EG+P+++ ++   QC
Sbjct  437   CWNAYGNQETLTIPPINCLREGDPETVGDLSTYQC  471



>ref|XP_003534803.1| PREDICTED: polygalacturonase At1g48100-like [Glycine max]
 gb|KHN44687.1| Polygalacturonase [Glycine soja]
Length=474

 Score =   508 bits (1308),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 235/395 (59%), Positives = 303/395 (77%), Gaps = 1/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V S+G +GDG ADDT AF  AW EAC  + + ++L P+ H F I STIFTGPCK  L+F
Sbjct  79    DVRSFGAVGDGSADDTDAFVAAWKEACAVE-SGVVLVPEDHCFKITSTIFTGPCKPGLVF  137

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++GT+M PDGP+SWPK  +  QWLVFYR++ M++ G G I+G GE+WW+LPCKPHRG +
Sbjct  138   QVDGTLMAPDGPESWPKEDSHSQWLVFYRLDQMTLTGKGTIEGNGEQWWDLPCKPHRGPD  197

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G T+ GPCDSP  IRFF SSNL +  +KI+NSP+FH +FD C  V ID L I +P  SPN
Sbjct  198   GKTVSGPCDSPTMIRFFMSSNLVLSGVKIQNSPMFHVKFDGCQGVLIDKLSISSPKLSPN  257

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIH+ NT  V I+NS++SNGDDCISIG GC +VDI  +TC P HGISIGSLG+  S+A
Sbjct  258   TDGIHLGNTRGVGIYNSMISNGDDCISIGPGCSDVDIEGVTCAPTHGISIGSLGVHNSQA  317

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSN+ V ++ I+ SDNG+RIKTWQGG G+V+ + F+NI+M+NVRN II+DQYYC +K C
Sbjct  318   CVSNLTVRNTIIKESDNGLRIKTWQGGTGSVTGLRFENIQMENVRNCIIIDQYYCMSKEC  377

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQTSAV+++DV+Y NIKGT+D R+PP+  ACSD+V CTN+TLSE+EL P +G  + DPF
Sbjct  378   LNQTSAVHVNDVTYRNIKGTYDVRTPPIHFACSDTVACTNITLSEIELLPYEGELLDDPF  437

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYG  +T+TIPP+ CL EG P ++  +    C
Sbjct  438   CWNAYGTQETMTIPPLDCLREGEPDTVVELSAYDC  472



>gb|KHG07147.1| hypothetical protein F383_34413 [Gossypium arboreum]
Length=478

 Score =   508 bits (1307),  Expect = 9e-173, Method: Compositional matrix adjust.
 Identities = 235/395 (59%), Positives = 296/395 (75%), Gaps = 1/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V SYG +GDG +DDT AF  AW  AC  + +  +L P    F+I STIF GPCK+ L+ 
Sbjct  78    DVTSYGAVGDGCSDDTAAFMEAWKAACAVE-SATVLVPSDKVFMITSTIFPGPCKHGLVL  136

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++G +MPPDGP+ WPK  +++QWLVFYR+N M + G G+I+G G+KWW+LPCKPHRG N
Sbjct  137   QVDGVLMPPDGPNCWPKADSRQQWLVFYRLNDMKLTGNGIIEGNGQKWWDLPCKPHRGPN  196

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G+TLPGPCDSP  IRFF SSNL V  +KI+NSP FH +FD C  V I+ L I  P  SPN
Sbjct  197   GSTLPGPCDSPTMIRFFMSSNLVVSGIKIQNSPQFHMKFDGCEGVLIEKLLISTPKLSPN  256

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHI NT  V I+NS++SNGDDCISIG GC +V I  +TCGP HGISIGSLG+  S A
Sbjct  257   TDGIHIGNTKSVGIYNSMISNGDDCISIGPGCSDVHIEGVTCGPSHGISIGSLGVHNSLA  316

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V ++ IR SDNGVRIKTWQGG G+VS ++F+NI+M+NVRN I +DQYYC  KAC
Sbjct  317   CVSNITVRNAVIRESDNGVRIKTWQGGTGSVSGISFENIQMENVRNCINIDQYYCLQKAC  376

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQTSAVY+ DV Y NIKG++D R+ P+  ACSD+V CTN+T+++VEL P +G  M +PF
Sbjct  377   LNQTSAVYVRDVQYRNIKGSYDVRNTPIHFACSDTVACTNITMADVELMPHEGELMEEPF  436

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYG  +T++IPP+ CLL+G P ++       C
Sbjct  437   CWNAYGIEETLSIPPIGCLLKGMPHAITESSQYSC  471



>dbj|BAJ86227.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=489

 Score =   507 bits (1306),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 235/387 (61%), Positives = 304/387 (79%), Gaps = 1/387 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V +YG  G+  ADDT AF+ AW  AC  + + +LL P   +F I +T F+GPCK  L+F
Sbjct  95    DVRAYGATGESTADDTEAFRAAWRAACAVE-SAVLLVPSDGTFTISTTTFSGPCKPGLVF  153

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++G +MPPDGPD WP +  +RQWLVF  ++G++++G G I+G GE+WWNLPCKPHRG N
Sbjct  154   QVDGVMMPPDGPDCWPPSDNRRQWLVFSNLDGLTLRGAGTIEGNGEEWWNLPCKPHRGPN  213

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G+TL GPCDSP  IRFF S NL VQ L+++NSP FHFRFD C DV +D L+I +P NSPN
Sbjct  214   GSTLHGPCDSPTLIRFFESCNLVVQGLRVENSPEFHFRFDGCSDVLVDGLFISSPANSPN  273

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIH+ENT  V I+NS +SNGDDCISIG G Y+VDI+N+TCGPGHGISIGSLG+  S+A
Sbjct  274   TDGIHVENTERVGIYNSKISNGDDCISIGTGSYDVDIQNVTCGPGHGISIGSLGVHNSQA  333

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CV+N+ V D+ IRNSDNG+RIKTWQGG G+VS +TFD + M+NVRN II+DQYYC +K C
Sbjct  334   CVANVTVRDAVIRNSDNGLRIKTWQGGMGSVSGITFDGVTMENVRNCIIIDQYYCQDKRC  393

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQ++AV+++DVSY+N++G++D RS P+  ACSD+VPCTN+T++EVEL P  G  + DP+
Sbjct  394   MNQSTAVHVTDVSYANVRGSYDVRSAPIHFACSDTVPCTNVTMAEVELLPFSGELVDDPY  453

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSL  204
             CW+AYG  +T TIPPV CL +G P SL
Sbjct  454   CWSAYGAQQTPTIPPVSCLQDGVPDSL  480



>dbj|BAD86981.1| putative polygalacturonase PG1 [Oryza sativa Japonica Group]
Length=410

 Score =   503 bits (1295),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 235/394 (60%), Positives = 297/394 (75%), Gaps = 5/394 (1%)
 Frame = -2

Query  1361  VMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLFQ  1182
             V  +G  GDGV DDT A K AWD AC  D   ++LA    SFLI +T+FTGPC+  +  Q
Sbjct  21    VKDFGAAGDGVTDDTDALKTAWDTACADDGAGVVLAAAGRSFLIHTTVFTGPCQGSVTLQ  80

Query  1181  IEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVNG  1002
             ++GTI+ P  P +WP N  KR WLVFYR +G+S+ G GLIDG+G+KWW+LPCKPH+G N 
Sbjct  81    VDGTIVAPSEPATWPAN-NKRNWLVFYRADGVSLVGAGLIDGKGQKWWDLPCKPHKGGN-  138

Query  1001  TTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPNT  822
                 GPCDSPVA+RF  S+N+TV+ LK++NSP FHFRFDNC+ V +D L I +P  SPNT
Sbjct  139   --THGPCDSPVAMRFAISNNVTVRGLKVQNSPEFHFRFDNCNGVRVDGLSISSPALSPNT  196

Query  821   DGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRAC  642
             DGIH+ENT DV I N++VSNGDDC+SIGAG  NV I N+TCGPGHGISIGSLG   ++AC
Sbjct  197   DGIHVENTSDVLITNTVVSNGDDCVSIGAGTLNVHIENVTCGPGHGISIGSLGKAGTKAC  256

Query  641   VSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKACT  462
             V+N+ V ++ IR+SDNGVRIKTWQGG G+VS V F+N+RMD VRNPII+DQYYC +K+C 
Sbjct  257   VANVTVRNAVIRHSDNGVRIKTWQGGSGSVSAVAFENVRMDAVRNPIIIDQYYCLSKSCE  316

Query  461   NQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPFC  282
             N+T+AV+++ VSYS I+GT+D R PP+   CSD+VPCTN+TLS+VEL P+ G  + +PFC
Sbjct  317   NETTAVFVNGVSYSGIRGTYDVRGPPIHFGCSDAVPCTNITLSDVELLPASGDTVDEPFC  376

Query  281   WNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             WN YG+  T T+PPV CL  G P      D+ QC
Sbjct  377   WNVYGNAATPTVPPVSCLSSGFPNYTEKKDL-QC  409



>gb|KHN14270.1| Polygalacturonase [Glycine soja]
Length=465

 Score =   503 bits (1296),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 233/395 (59%), Positives = 302/395 (76%), Gaps = 1/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V S+G +GDG ADDT AF  AW EAC  + + ++L P+ + F I STIFTGPCK  L+F
Sbjct  70    DVRSFGAVGDGSADDTDAFVAAWKEACAVE-SGVVLVPEDYCFKITSTIFTGPCKPGLVF  128

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++GT+M PDGP+ WPK  +  QWLVFYR++ M++ G G I+G GE+WW+LPCKPHRG +
Sbjct  129   QVDGTLMAPDGPECWPKEDSHSQWLVFYRLDQMTLTGKGTIEGNGEQWWDLPCKPHRGPD  188

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G T+ GPCDSP  IRFF SSNL +  +KI+NSP+FH +FD C  V ID L I +P  SPN
Sbjct  189   GKTVSGPCDSPTMIRFFMSSNLVLSGVKIQNSPMFHVKFDGCQGVLIDKLSISSPKLSPN  248

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIH+ NT  V I+NS++SNGDDCISIG GC +VDI  +TC P HGISIGSLG+  S+A
Sbjct  249   TDGIHLGNTRGVGIYNSMISNGDDCISIGPGCSDVDIEGVTCAPTHGISIGSLGVHNSQA  308

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSN+ V ++ I+ SDNG+RIKTWQGG G+V+ + F+NI+M+NVRN II+DQYYC +K C
Sbjct  309   CVSNLTVRNTIIKESDNGLRIKTWQGGTGSVTGLRFENIQMENVRNCIIIDQYYCMSKEC  368

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQTSAV+++DV+Y NIKGT+D R+PP+  ACSD+V CTN+TLSE+EL P +G  + DPF
Sbjct  369   LNQTSAVHVNDVTYRNIKGTYDVRTPPIHFACSDTVACTNITLSEIELLPYEGELLDDPF  428

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYG  +T+TIPP+ CL EG P ++  +    C
Sbjct  429   CWNAYGTQETMTIPPLDCLREGEPDTVVELSAYDC  463



>ref|XP_010461609.1| PREDICTED: polygalacturonase At1g48100 [Camelina sativa]
Length=483

 Score =   504 bits (1297),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 231/384 (60%), Positives = 300/384 (78%), Gaps = 1/384 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V SYG +GDG  DDT AF+ AW  AC  + + I+LAP+   F I STIF+GPC+  L+F
Sbjct  89    DVTSYGAVGDGSCDDTAAFRDAWKAACAVE-SGIVLAPEGGVFKITSTIFSGPCQPGLVF  147

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++G +MPPDGP+ WP+  +K+QWLVFYR+ G++  G G ++G G+KWW+LPCKPHRG N
Sbjct  148   QLDGVLMPPDGPEEWPEKDSKQQWLVFYRLEGITFAGKGTVEGNGQKWWDLPCKPHRGPN  207

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G++  GPC+SP  IRFF S+N+ V+ L+I+NSP FH +FD C  V I+ + I +P  SPN
Sbjct  208   GSSSSGPCESPTMIRFFMSNNIVVRGLRIQNSPQFHMKFDGCEGVLINEIQISSPKLSPN  267

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIH+ NT  V I+NS+VSNGDDCISIG GC +VDI+ +TCGP HGISIGSLG+  S+A
Sbjct  268   TDGIHLGNTRSVAIYNSVVSNGDDCISIGTGCSDVDIQGVTCGPSHGISIGSLGVHNSQA  327

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V ++ IR+SDNG+R+KTWQGG G+VS + F+NI+M+NV N IIVDQYYCS+K C
Sbjct  328   CVSNITVRNTAIRDSDNGLRVKTWQGGTGSVSNLLFENIQMENVLNCIIVDQYYCSSKEC  387

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              N+TSAV + DV Y NIKGT+D RSPP+  ACSD+V CTN+T+SEVEL P +G  + DPF
Sbjct  388   RNETSAVRVFDVEYRNIKGTYDVRSPPIHFACSDTVACTNITMSEVELLPEEGELVDDPF  447

Query  284   CWNAYGDLKTVTIPPVFCLLEGNP  213
             CWNAYG  +T+TIPP+ CLL+G+P
Sbjct  448   CWNAYGKQETLTIPPIDCLLDGSP  471



>ref|XP_010479218.1| PREDICTED: polygalacturonase At1g48100-like isoform X1 [Camelina 
sativa]
 ref|XP_010479219.1| PREDICTED: polygalacturonase At1g48100-like isoform X2 [Camelina 
sativa]
Length=483

 Score =   503 bits (1296),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 231/384 (60%), Positives = 300/384 (78%), Gaps = 1/384 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V SYG +GDG  DDT AF+ AW  AC  + + I+LAP+   F I STIF+GPC+  L+F
Sbjct  89    DVTSYGAVGDGSCDDTAAFRDAWKAACAVE-SGIVLAPEGGVFKITSTIFSGPCQPGLVF  147

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++G +MPPDGP+ WP+  +K+QWLVFYR+ G++  G G ++G G+KWW+LPCKPHRG N
Sbjct  148   QLDGVLMPPDGPEEWPEKDSKQQWLVFYRLEGITFAGKGTVEGNGQKWWDLPCKPHRGPN  207

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G++  GPC+SP  IRFF S+N+ V+ L+I+NSP FH +FD C  V I+ + I +P  SPN
Sbjct  208   GSSSSGPCESPTMIRFFMSNNIVVRGLRIQNSPQFHMKFDGCEGVLINEIQISSPKLSPN  267

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIH+ NT  V I+NS+VSNGDDCISIG GC +VDI+ +TCGP HGISIGSLG+  S+A
Sbjct  268   TDGIHLGNTRSVAIYNSVVSNGDDCISIGTGCSDVDIQGVTCGPSHGISIGSLGVHNSQA  327

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V ++ IR+SDNG+R+KTWQGG G+VS + F+NI+M+NV N IIVDQYYCS+K C
Sbjct  328   CVSNITVRNTAIRDSDNGLRVKTWQGGTGSVSNLLFENIQMENVLNCIIVDQYYCSSKEC  387

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              N+TSAV + DV Y NIKGT+D RSPP+  ACSD+V CTN+T+SEVEL P +G  + DPF
Sbjct  388   RNETSAVRVFDVEYRNIKGTYDVRSPPIHFACSDTVACTNITMSEVELLPEEGELVDDPF  447

Query  284   CWNAYGDLKTVTIPPVFCLLEGNP  213
             CWNAYG  +T+TIPP+ CLL+G+P
Sbjct  448   CWNAYGKQETLTIPPIDCLLDGSP  471



>ref|XP_003546297.1| PREDICTED: polygalacturonase At1g48100-like isoform 1 [Glycine 
max]
Length=479

 Score =   503 bits (1296),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 233/395 (59%), Positives = 302/395 (76%), Gaps = 1/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V S+G +GDG ADDT AF  AW EAC  + + ++L P+ + F I STIFTGPCK  L+F
Sbjct  84    DVRSFGAVGDGSADDTDAFVAAWKEACAVE-SGVVLVPEDYCFKITSTIFTGPCKPGLVF  142

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++GT+M PDGP+ WPK  +  QWLVFYR++ M++ G G I+G GE+WW+LPCKPHRG +
Sbjct  143   QVDGTLMAPDGPECWPKEDSHSQWLVFYRLDQMTLTGKGTIEGNGEQWWDLPCKPHRGPD  202

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G T+ GPCDSP  IRFF SSNL +  +KI+NSP+FH +FD C  V ID L I +P  SPN
Sbjct  203   GKTVSGPCDSPTMIRFFMSSNLVLSGVKIQNSPMFHVKFDGCQGVLIDKLSISSPKLSPN  262

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIH+ NT  V I+NS++SNGDDCISIG GC +VDI  +TC P HGISIGSLG+  S+A
Sbjct  263   TDGIHLGNTRGVGIYNSMISNGDDCISIGPGCSDVDIEGVTCAPTHGISIGSLGVHNSQA  322

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSN+ V ++ I+ SDNG+RIKTWQGG G+V+ + F+NI+M+NVRN II+DQYYC +K C
Sbjct  323   CVSNLTVRNTIIKESDNGLRIKTWQGGTGSVTGLRFENIQMENVRNCIIIDQYYCMSKEC  382

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQTSAV+++DV+Y NIKGT+D R+PP+  ACSD+V CTN+TLSE+EL P +G  + DPF
Sbjct  383   LNQTSAVHVNDVTYRNIKGTYDVRTPPIHFACSDTVACTNITLSEIELLPYEGELLDDPF  442

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYG  +T+TIPP+ CL EG P ++  +    C
Sbjct  443   CWNAYGTQETMTIPPLDCLREGEPDTVVELSAYDC  477



>ref|XP_010500319.1| PREDICTED: polygalacturonase At1g48100 [Camelina sativa]
Length=479

 Score =   503 bits (1295),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 231/384 (60%), Positives = 299/384 (78%), Gaps = 1/384 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V SYG +GDG  DDT AF+ AW  AC  + + I+LAP+   F I STIF+GPC+  L+F
Sbjct  85    DVTSYGAVGDGSCDDTAAFRDAWKAACAVE-SGIVLAPEGGVFKITSTIFSGPCQPGLVF  143

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++G +MPPDGP+ WP+  +K+QWLVFYR+ G++  G G ++G G+KWW+LPCKPHRG N
Sbjct  144   QLDGVLMPPDGPEEWPEKDSKQQWLVFYRLEGITFAGKGTVEGNGQKWWDLPCKPHRGPN  203

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G++  GPC+SP  IRFF S+N+ V+ L+I+NSP FH +FD C  V I+ + I +P  SPN
Sbjct  204   GSSSSGPCESPTMIRFFMSNNIVVRGLRIQNSPQFHMKFDGCEGVLINEIQISSPKLSPN  263

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIH+ NT  V I+NS+VSNGDDCISIG GC +VDI  +TCGP HGISIGSLG+  S+A
Sbjct  264   TDGIHLGNTRSVAIYNSVVSNGDDCISIGTGCSDVDIHGVTCGPSHGISIGSLGVHNSQA  323

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V ++ IR+SDNG+R+KTWQGG G+VS + F+NI+M+NV N IIVDQYYCS+K C
Sbjct  324   CVSNITVRNTAIRDSDNGLRVKTWQGGTGSVSNLLFENIQMENVLNCIIVDQYYCSSKEC  383

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              N+TSAV + DV Y NIKGT+D RSPP+  ACSD+V CTN+T+SEVEL P +G  + DPF
Sbjct  384   RNETSAVRVFDVEYRNIKGTYDVRSPPIHFACSDTVACTNITMSEVELLPEEGELVDDPF  443

Query  284   CWNAYGDLKTVTIPPVFCLLEGNP  213
             CWNAYG  +T+TIPP+ CLL+G+P
Sbjct  444   CWNAYGKQETLTIPPIDCLLDGSP  467



>emb|CBI25976.3| unnamed protein product [Vitis vinifera]
Length=375

 Score =   499 bits (1284),  Expect = 9e-171, Method: Compositional matrix adjust.
 Identities = 230/367 (63%), Positives = 289/367 (79%), Gaps = 1/367 (0%)
 Frame = -2

Query  1304  RAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLFQIEGTIMPPDGPDSWPKNLT  1125
              AW  AC  + + I+L P  H F+I STIF+GPCK  L+FQ++G +MPP+GPD WPK+ +
Sbjct  2     EAWKAACAVE-SGIVLVPADHVFMITSTIFSGPCKPGLVFQVDGVLMPPNGPDCWPKSDS  60

Query  1124  KRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVNGTTLPGPCDSPVAIRFFTSS  945
             K+QWLVFYR++ M+  G G I+G G  WW LPCKPHRG NG+TLPGPCDSP  IRFF SS
Sbjct  61    KKQWLVFYRLDQMTFTGSGTIEGNGGDWWELPCKPHRGPNGSTLPGPCDSPALIRFFMSS  120

Query  944   NLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPNTDGIHIENTYDVTIHNSIVS  765
             NL V  L+I+NSP FH +FD C  V I+ L I +P  SPNTDGIHIENT  V I+NS + 
Sbjct  121   NLVVSSLRIQNSPQFHMKFDGCEGVLIEKLSISSPKLSPNTDGIHIENTKSVGIYNSEIG  180

Query  764   NGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRACVSNIKVTDSTIRNSDNGVR  585
             NGDDCISIG GC +V+I  +TCGP HGISIGSLG++ S+ACVSNI V +  I++SDNGVR
Sbjct  181   NGDDCISIGRGCSDVNIEGVTCGPSHGISIGSLGVQNSQACVSNITVRNVFIKDSDNGVR  240

Query  584   IKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKACTNQTSAVYISDVSYSNIKGT  405
             IKTWQGG G+VS ++F+NI+M+NVRN +I+DQYYC +KAC NQTSAVY++DV+Y NIKGT
Sbjct  241   IKTWQGGTGSVSGISFENIQMENVRNCMIIDQYYCLSKACRNQTSAVYLTDVTYRNIKGT  300

Query  404   FDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPFCWNAYGDLKTVTIPPVFCLL  225
             +D RSPP+  ACSD+V CTN+T+SEVEL P++G  + DPFCWNAYG  +T+TIPP+ CL 
Sbjct  301   YDVRSPPIHFACSDTVACTNITMSEVELLPAEGELVDDPFCWNAYGTQETLTIPPITCLQ  360

Query  224   EGNPQSL  204
             +G P+SL
Sbjct  361   DGMPESL  367



>ref|XP_006654203.1| PREDICTED: polygalacturonase At1g48100-like [Oryza brachyantha]
Length=489

 Score =   502 bits (1293),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 228/387 (59%), Positives = 304/387 (79%), Gaps = 1/387 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V ++G  GDG  DDT AF+ AW  AC  + + ++L P   +F I +T F GPCK  L+F
Sbjct  94    DVRAFGAAGDGTTDDTEAFRAAWRAACAVE-SAVILVPSDGTFTITTTTFAGPCKPGLVF  152

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++G +MPPDGPD WP +  +RQW+VF  ++G++++G G I+G GE WWNLPCKPHRG N
Sbjct  153   QVDGVLMPPDGPDCWPASDNRRQWVVFSNLDGLTLRGAGTIEGNGEGWWNLPCKPHRGPN  212

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G+TL GPCDSP  +RFF S NL V+ L+++NSP FHFRFD C DV +D L I++P +SPN
Sbjct  213   GSTLRGPCDSPTLVRFFMSRNLAVEGLRVENSPEFHFRFDGCSDVRVDGLSIRSPASSPN  272

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIH+ENT  V I+NS++SNGDDCISIG G Y+VDI+N+TCGPGHGISIGSLG+  S+A
Sbjct  273   TDGIHVENTERVAIYNSMISNGDDCISIGTGSYDVDIQNVTCGPGHGISIGSLGVHNSQA  332

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CV+N+ V ++ IRNSDNG+RIKTWQGG G+VS ++FD + M+NVRN II+DQYYC +K C
Sbjct  333   CVANVTVRNAVIRNSDNGLRIKTWQGGMGSVSGISFDTVAMENVRNCIIIDQYYCLDKRC  392

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQ++AV+++DVSY+N++G++D R+ P+  ACSD+VPCTN+T+SEVEL P  G  + DPF
Sbjct  393   MNQSTAVHVTDVSYANVRGSYDVRAAPIHFACSDTVPCTNITMSEVELLPFSGELVDDPF  452

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSL  204
             CW+AYG  +T TIPP++CL +G P SL
Sbjct  453   CWSAYGLQQTPTIPPIYCLQDGLPDSL  479



>tpg|DAA54311.1| TPA: polygalacturonase [Zea mays]
Length=499

 Score =   502 bits (1293),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 233/388 (60%), Positives = 299/388 (77%), Gaps = 3/388 (1%)
 Frame = -2

Query  1361  VMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLFQ  1182
             V  +G +GDGV DDT A K AWD ACQ D   ++LA   +SFL+ +T+FTGPC+  +  Q
Sbjct  104   VKDFGAVGDGVTDDTGAIKTAWDTACQDDGASVVLAAAGYSFLVHTTVFTGPCQGSVTIQ  163

Query  1181  IEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVNG  1002
             ++GTI+ P  PD WP N +KR WL+FY+ +GMS++G GLIDG+G+KWW+LPCK H+G  G
Sbjct  164   LDGTIVAPSDPDMWPAN-SKRNWLLFYQAHGMSLRGAGLIDGKGQKWWDLPCKSHKGQGG  222

Query  1001  TTLPGP-CDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             ++  G  CDSPVA+RFF ++N+TVQ LK++NSP FH RFD+C  V    L I +P  SPN
Sbjct  223   SSGHGASCDSPVALRFFMTNNVTVQGLKVQNSPEFHIRFDSCRGVVASGLSISSPALSPN  282

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPG-HGISIGSLGIKQSR  648
             TDGIH+ENT DV I N+ VSNGDDC+SIGAG  N+ + N+TCGPG HGISIGSLG + SR
Sbjct  283   TDGIHVENTQDVLITNTAVSNGDDCVSIGAGTLNMHVENVTCGPGGHGISIGSLGKQGSR  342

Query  647   ACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKA  468
             ACV+N+ V ++ IR+SDNGVRIKTWQGG GAVS V+F N+RMD VRNPII+DQYYC +K+
Sbjct  343   ACVANVTVRNAVIRHSDNGVRIKTWQGGSGAVSSVSFQNVRMDAVRNPIIIDQYYCLSKS  402

Query  467   CTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDP  288
             C N TSAV++S VSY+ I+GT+D R+PP+   CSD+VPCTN+TLS+VEL P+ G  + DP
Sbjct  403   CENATSAVFVSGVSYAGIRGTYDPRTPPIHFGCSDAVPCTNITLSDVELLPASGETIDDP  462

Query  287   FCWNAYGDLKTVTIPPVFCLLEGNPQSL  204
             FCWN YG   T T+PPV CL+EG P++L
Sbjct  463   FCWNVYGSTATPTVPPVPCLIEGVPRNL  490



>ref|XP_004486518.1| PREDICTED: polygalacturonase At1g48100-like [Cicer arietinum]
Length=472

 Score =   501 bits (1290),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 240/395 (61%), Positives = 307/395 (78%), Gaps = 1/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V S+G +GDG ADDT AF+ AW  AC  D + +L AP+++ F I STIF+GPCK  L+F
Sbjct  78    DVRSFGAVGDGEADDTAAFRAAWKAACSVD-SGVLFAPQNYCFKITSTIFSGPCKPGLVF  136

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             QI+GT+M PDGPD WP+  ++ QWLVFYR++ M++ G G I+G GE+WW+LPCKPHRG N
Sbjct  137   QIDGTLMAPDGPDCWPEKDSRNQWLVFYRLDQMTLNGTGTIEGNGEQWWDLPCKPHRGPN  196

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G ++ GPC+SP  IRFF SSNL +  LKI+NSP FH +FD C  V ID L I AP  SPN
Sbjct  197   GNSISGPCESPTMIRFFMSSNLVLSGLKIQNSPQFHVKFDGCEGVLIDKLSISAPKLSPN  256

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIH+ NT DV I+NS++SNGDDCISIG GC +V++  +TC P HGISIGSLG+  SRA
Sbjct  257   TDGIHLGNTRDVGIYNSLISNGDDCISIGPGCSDVNVEGVTCAPTHGISIGSLGVHNSRA  316

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSN+ V +S I+ SDNG+RIKTWQGG G+V+ +TF+NI+M+NVRN II+DQYYC +K C
Sbjct  317   CVSNLTVRNSIIKESDNGLRIKTWQGGTGSVTDLTFENIQMENVRNCIIIDQYYCLSKEC  376

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
             TNQTSAVY+++VSY NIKGT+D R+PP+  ACSDSV CTN+TLS+VEL P +G  + DPF
Sbjct  377   TNQTSAVYVNNVSYKNIKGTYDVRTPPIHFACSDSVACTNITLSDVELLPYEGALLDDPF  436

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYG  +T+TIPP+ CL EG P+++      +C
Sbjct  437   CWNAYGRQETMTIPPLDCLREGEPETVVESSEYEC  471



>ref|NP_001042805.1| Os01g0296200 [Oryza sativa Japonica Group]
 dbj|BAF04719.1| Os01g0296200 [Oryza sativa Japonica Group]
 gb|EAZ11548.1| hypothetical protein OsJ_01413 [Oryza sativa Japonica Group]
Length=503

 Score =   502 bits (1293),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 235/394 (60%), Positives = 297/394 (75%), Gaps = 5/394 (1%)
 Frame = -2

Query  1361  VMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLFQ  1182
             V  +G  GDGV DDT A K AWD AC  D   ++LA    SFLI +T+FTGPC+  +  Q
Sbjct  114   VKDFGAAGDGVTDDTDALKTAWDTACADDGAGVVLAAAGRSFLIHTTVFTGPCQGSVTLQ  173

Query  1181  IEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVNG  1002
             ++GTI+ P  P +WP N  KR WLVFYR +G+S+ G GLIDG+G+KWW+LPCKPH+G N 
Sbjct  174   VDGTIVAPSEPATWPAN-NKRNWLVFYRADGVSLVGAGLIDGKGQKWWDLPCKPHKGGN-  231

Query  1001  TTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPNT  822
                 GPCDSPVA+RF  S+N+TV+ LK++NSP FHFRFDNC+ V +D L I +P  SPNT
Sbjct  232   --THGPCDSPVAMRFAISNNVTVRGLKVQNSPEFHFRFDNCNGVRVDGLSISSPALSPNT  289

Query  821   DGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRAC  642
             DGIH+ENT DV I N++VSNGDDC+SIGAG  NV I N+TCGPGHGISIGSLG   ++AC
Sbjct  290   DGIHVENTSDVLITNTVVSNGDDCVSIGAGTLNVHIENVTCGPGHGISIGSLGKAGTKAC  349

Query  641   VSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKACT  462
             V+N+ V ++ IR+SDNGVRIKTWQGG G+VS V F+N+RMD VRNPII+DQYYC +K+C 
Sbjct  350   VANVTVRNAVIRHSDNGVRIKTWQGGSGSVSAVAFENVRMDAVRNPIIIDQYYCLSKSCE  409

Query  461   NQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPFC  282
             N+T+AV+++ VSYS I+GT+D R PP+   CSD+VPCTN+TLS+VEL P+ G  + +PFC
Sbjct  410   NETTAVFVNGVSYSGIRGTYDVRGPPIHFGCSDAVPCTNITLSDVELLPASGDTVDEPFC  469

Query  281   WNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             WN YG+  T T+PPV CL  G P      D+ QC
Sbjct  470   WNVYGNAATPTVPPVSCLSSGFPNYTEKKDL-QC  502



>ref|XP_007147401.1| hypothetical protein PHAVU_006G121300g [Phaseolus vulgaris]
 ref|XP_007147402.1| hypothetical protein PHAVU_006G121300g [Phaseolus vulgaris]
 gb|ESW19395.1| hypothetical protein PHAVU_006G121300g [Phaseolus vulgaris]
 gb|ESW19396.1| hypothetical protein PHAVU_006G121300g [Phaseolus vulgaris]
Length=472

 Score =   501 bits (1289),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 232/395 (59%), Positives = 302/395 (76%), Gaps = 1/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V S+G +GDG ADDT AF  AW  AC  + + ++L P+++ F I STIFTGPCK  L+F
Sbjct  77    DVRSFGAVGDGSADDTEAFVAAWKAACAVE-SGVVLVPENYCFKITSTIFTGPCKPGLVF  135

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++GT+M PDGP+SWPK  +  QWLVFYR++ M++ G G I+G GE+WW+LPCKPHRG +
Sbjct  136   QVDGTLMAPDGPESWPKEDSHSQWLVFYRLDQMTLTGKGTIEGNGEQWWDLPCKPHRGPD  195

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
               T+ GPCDSP  IRFF SSNL +  +KI+NSP+FH +FD C  V ID L I +P  SPN
Sbjct  196   EKTVSGPCDSPTMIRFFMSSNLVLSGVKIQNSPMFHVKFDGCQGVLIDKLSISSPKLSPN  255

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIH+ NT  V I+NS++SNGDDCISIG GC +VDI  +TC P HGISIGSLG+  S+A
Sbjct  256   TDGIHLGNTKGVGIYNSVISNGDDCISIGPGCSDVDIEGVTCAPTHGISIGSLGVHNSQA  315

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSN+ V ++ I+ SDNG+RIKTWQGG G+VS + F+NI+M+NVRN II+DQYYC +K C
Sbjct  316   CVSNLTVRNTIIKESDNGLRIKTWQGGTGSVSGLRFENIQMENVRNCIIIDQYYCLSKEC  375

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQTSAV++++V Y NIKGT+D R+PP+  ACSD+V CTN+TLSE+EL P +G  + DPF
Sbjct  376   LNQTSAVHVNNVIYRNIKGTYDVRTPPIHFACSDTVACTNITLSEIELLPYEGQLLDDPF  435

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYG  +T+TIPP+ CL EG P ++  +   +C
Sbjct  436   CWNAYGTQETMTIPPLDCLREGEPDTVVELSAYEC  470



>ref|NP_001150436.1| polygalacturonase precursor [Zea mays]
 gb|ACG39090.1| polygalacturonase precursor [Zea mays]
Length=499

 Score =   502 bits (1292),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 233/396 (59%), Positives = 302/396 (76%), Gaps = 3/396 (1%)
 Frame = -2

Query  1361  VMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLFQ  1182
             V  +G +GDG+ DDT A K AWD ACQ D   ++LA   +SFL+ +T+FTGPC+  +  Q
Sbjct  104   VKGFGAVGDGLTDDTGAIKTAWDTACQDDGASVVLAAAGYSFLVHTTVFTGPCQGSVTIQ  163

Query  1181  IEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVNG  1002
             ++GTI+ P  PD WP N +KR WL+FY+ +GMS++G GLIDG+G+KWW+LPCK H+G  G
Sbjct  164   LDGTIVAPSDPDMWPAN-SKRNWLLFYQAHGMSLRGAGLIDGKGQKWWDLPCKSHKGQGG  222

Query  1001  TTLPGP-CDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             ++  G  CDSPVA+RFF ++N+TVQ LK++NSP FH RFD+C  V    L I +P  SPN
Sbjct  223   SSGHGASCDSPVALRFFMTNNVTVQGLKVQNSPEFHIRFDSCRGVVASGLSISSPALSPN  282

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPG-HGISIGSLGIKQSR  648
             TDGIH+ENT DV I N+ VSNGDDC+SIGAG  N+ + N+TCGPG HGISIGSLG + SR
Sbjct  283   TDGIHVENTQDVLITNTAVSNGDDCVSIGAGTLNMHVENVTCGPGGHGISIGSLGKQGSR  342

Query  647   ACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKA  468
             ACV+N+ V ++ IR+SDNGVRIKTWQGG GAVS V+F N+RMD VRNPII+DQYYC +K+
Sbjct  343   ACVANVTVRNAVIRHSDNGVRIKTWQGGSGAVSSVSFQNVRMDAVRNPIIIDQYYCLSKS  402

Query  467   CTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDP  288
             C N TSAV++S VSY+ I+GT+D R+PP+   CSD+VPCTN+TLS+VEL P+ G  + DP
Sbjct  403   CENATSAVFVSGVSYAGIRGTYDPRTPPIHFGCSDAVPCTNITLSDVELLPASGETIDDP  462

Query  287   FCWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             FCWN YG   T T+PPV CL+EG P++L +    +C
Sbjct  463   FCWNVYGSTATPTVPPVPCLIEGVPRNLDDNSSLKC  498



>ref|NP_001055086.1| Os05g0279900 [Oryza sativa Japonica Group]
 dbj|BAF17000.1| Os05g0279900 [Oryza sativa Japonica Group]
 gb|EAY97360.1| hypothetical protein OsI_19283 [Oryza sativa Indica Group]
 gb|EEE63088.1| hypothetical protein OsJ_17896 [Oryza sativa Japonica Group]
Length=485

 Score =   501 bits (1289),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 229/387 (59%), Positives = 304/387 (79%), Gaps = 1/387 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V ++G +GDG  DDT AF+ AW  AC  + + ++  P   +F I +T FTGPCK  L+F
Sbjct  91    DVRAFGAVGDGTTDDTEAFRAAWRAACAVE-SAVISVPSDGTFTITTTTFTGPCKPGLVF  149

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++G +MPPDGPD WP +  +RQWLVF  ++G++++G G I+G GE WWNLPCKPHRG N
Sbjct  150   QVDGVLMPPDGPDCWPPSDNRRQWLVFSNLDGLTLRGAGTIEGNGEGWWNLPCKPHRGPN  209

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G+TL GPCDSP  +RFF S NL V+ L+++NSP FHFRFD C DV +D L I++P NSPN
Sbjct  210   GSTLRGPCDSPTLVRFFMSRNLVVEGLRVENSPEFHFRFDGCSDVRVDGLSIRSPANSPN  269

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIH+ENT  V I+NS++SNGDDCISIG G Y+VDI+N++CGPGHGISIGSLG+  S+A
Sbjct  270   TDGIHVENTQRVAIYNSMISNGDDCISIGTGSYDVDIQNVSCGPGHGISIGSLGVHNSQA  329

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CV+N+ V ++ IRNSDNG+RIKTWQGG G+VS + FD + M+NVRN II+DQYYC +K C
Sbjct  330   CVANVTVRNAVIRNSDNGLRIKTWQGGMGSVSGINFDTVSMENVRNCIIIDQYYCLDKRC  389

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQ++AV+++DVSY+N++G++D R+ P+  ACSD+VPCTN+T+SEVEL P  G  + DPF
Sbjct  390   MNQSTAVHVTDVSYANVRGSYDVRAAPIHFACSDTVPCTNITMSEVELLPFSGELVDDPF  449

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSL  204
             CW+AYG  +T TIPP++CL +G P SL
Sbjct  450   CWSAYGLQQTPTIPPIYCLQDGLPDSL  476



>ref|XP_006307365.1| hypothetical protein CARUB_v10008991mg [Capsella rubella]
 gb|EOA40263.1| hypothetical protein CARUB_v10008991mg [Capsella rubella]
Length=484

 Score =   500 bits (1288),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 228/384 (59%), Positives = 298/384 (78%), Gaps = 1/384 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V SYG +GDG  DDT AF+ AW  AC  + + ++LAP+   F I STIF+GPC+  L+F
Sbjct  90    DVTSYGAVGDGSCDDTAAFRDAWKAACAVE-SGVVLAPEGGVFKITSTIFSGPCQPGLVF  148

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++G +MPPDGP+ WP+  +K QWLVFYR++ ++  G G ++G G+KWW+LPCKPHRG N
Sbjct  149   QLDGVLMPPDGPEEWPEKDSKNQWLVFYRLDSITFAGKGTVEGNGQKWWDLPCKPHRGPN  208

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G++  GPC+SP  IRFF S+N+ V+ L+I+NSP FH +FD C  V I+ + I +P  SPN
Sbjct  209   GSSSSGPCESPTMIRFFMSNNIEVKGLRIQNSPQFHMKFDGCQGVLINEIQISSPKLSPN  268

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIH+ NT  V I+NS+VSNGDDCISIG GC +VDI+ +TCGP HGISIGSLG+  S+A
Sbjct  269   TDGIHLGNTRSVGIYNSVVSNGDDCISIGTGCSDVDIQGVTCGPSHGISIGSLGVHNSQA  328

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V ++ IR+SDNG+R+KTWQGG G+VS + F+NI+M+NV N IIVDQYYC +K C
Sbjct  329   CVSNITVRNTAIRDSDNGLRVKTWQGGTGSVSNLLFENIQMENVLNCIIVDQYYCQSKEC  388

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              N+TSAV + DV Y NIKGT+D RSPP+  ACSD+V CTN+T+SEVEL P +G  + DPF
Sbjct  389   RNETSAVRVFDVEYRNIKGTYDVRSPPIHFACSDTVACTNITMSEVELLPEEGELVDDPF  448

Query  284   CWNAYGDLKTVTIPPVFCLLEGNP  213
             CWNAYG  +T+TIPP+ CLL+G+P
Sbjct  449   CWNAYGTQETLTIPPIDCLLDGSP  472



>ref|XP_006419286.1| hypothetical protein CICLE_v10004899mg [Citrus clementina]
 ref|XP_006419287.1| hypothetical protein CICLE_v10004899mg [Citrus clementina]
 ref|XP_006488776.1| PREDICTED: polygalacturonase At1g48100-like [Citrus sinensis]
 gb|ESR32526.1| hypothetical protein CICLE_v10004899mg [Citrus clementina]
 gb|ESR32527.1| hypothetical protein CICLE_v10004899mg [Citrus clementina]
Length=472

 Score =   497 bits (1280),  Expect = 9e-169, Method: Compositional matrix adjust.
 Identities = 238/395 (60%), Positives = 299/395 (76%), Gaps = 1/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V  YG +GDG ADDT AF+ AW  AC  +   ++LAP  + F I STIF+GPCK  L+F
Sbjct  79    DVRDYGAVGDGSADDTAAFRAAWKAACAVEAG-VVLAPSDYVFKITSTIFSGPCKPRLVF  137

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++G +MPPDGPD+WPK  +++QWLVFY+++ M+  G G I+G G+ WW+LPCKPHRG N
Sbjct  138   QLDGVLMPPDGPDTWPKADSRKQWLVFYKLDDMTFTGKGTIEGNGQPWWDLPCKPHRGPN  197

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G+T  GPCDSP  IRFF SSNL V  L I+NSP FH +FD C  V ID L I +P  SPN
Sbjct  198   GSTSSGPCDSPALIRFFMSSNLVVSGLTIQNSPQFHMKFDGCEGVMIDKLSISSPKLSPN  257

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT  V I+NS++SNGDDCISIG GC +VDI ++TCGP HGISIGSLG   S+A
Sbjct  258   TDGIHIENTKSVGIYNSMISNGDDCISIGTGCSDVDIADVTCGPSHGISIGSLGAHYSQA  317

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V ++ IR SDNG+RIKTWQGG G VS ++F+NI+M+NVRN I +DQYYC +K C
Sbjct  318   CVSNITVRNAIIRESDNGLRIKTWQGGTGCVSDLSFENIQMENVRNCINIDQYYCLSKEC  377

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQTSAV+++ ++Y NIKGT+D R+PP+  ACSD+VPCT +T++EVEL P +G  + DPF
Sbjct  378   LNQTSAVFVTGITYRNIKGTYDVRTPPIHFACSDTVPCTKITMAEVELLPYEGQLLDDPF  437

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYG  +T+TIPP+ CL EG PQS   V    C
Sbjct  438   CWNAYGTQETLTIPPIDCLQEGEPQSEQEVSAYGC  472



>gb|KDO72101.1| hypothetical protein CISIN_1g012057mg [Citrus sinensis]
Length=472

 Score =   497 bits (1280),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 238/395 (60%), Positives = 299/395 (76%), Gaps = 1/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V  YG +GDG ADDT AF+ AW  AC  +   ++LAP  + F I STIF+GPCK  L+F
Sbjct  79    DVRDYGAVGDGSADDTAAFRAAWKAACAVEAG-VVLAPSDYVFKITSTIFSGPCKPGLVF  137

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++G +MPPDGPD+WPK  +++QWLVFY+++ M+  G G I+G G+ WW+LPCKPHRG N
Sbjct  138   QLDGVLMPPDGPDTWPKADSRKQWLVFYKLDDMTFTGKGTIEGNGQPWWDLPCKPHRGPN  197

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G+T  GPCDSP  IRFF SSNL V  L I+NSP FH +FD C  V ID L I +P  SPN
Sbjct  198   GSTSSGPCDSPALIRFFMSSNLVVSGLTIQNSPQFHMKFDGCEGVMIDKLSISSPKLSPN  257

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT  V I+NS++SNGDDCISIG GC +VDI ++TCGP HGISIGSLG   S+A
Sbjct  258   TDGIHIENTKSVGIYNSMISNGDDCISIGTGCSDVDIADVTCGPSHGISIGSLGAHYSQA  317

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V ++ IR SDNG+RIKTWQGG G VS ++F+NI+M+NVRN I +DQYYC +K C
Sbjct  318   CVSNITVRNAIIRESDNGLRIKTWQGGTGCVSDLSFENIQMENVRNCINIDQYYCLSKEC  377

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQTSAV+++ ++Y NIKGT+D R+PP+  ACSD+VPCT +T++EVEL P +G  + DPF
Sbjct  378   LNQTSAVFVTGITYRNIKGTYDVRTPPIHFACSDTVPCTKITMAEVELLPYEGQLLDDPF  437

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYG  +T+TIPP+ CL EG PQS   V    C
Sbjct  438   CWNAYGTQETLTIPPIDCLQEGEPQSEQEVSAYGC  472



>ref|XP_004138524.1| PREDICTED: polygalacturonase At1g48100-like [Cucumis sativus]
Length=475

 Score =   497 bits (1280),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 242/395 (61%), Positives = 301/395 (76%), Gaps = 1/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V  +G +GDG  DDT AFK AW  AC  + +  LL P +  F I STIF+GPCK  L+F
Sbjct  82    DVTDFGAVGDGCTDDTAAFKAAWKAACAVE-SATLLVPSNLCFKITSTIFSGPCKPGLVF  140

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             +++GT+MPPDGP+SWPK  + RQWLVFYR++ M++ G G I+G G+KWW LPCKPHRG N
Sbjct  141   KVDGTLMPPDGPESWPKADSPRQWLVFYRLDQMTLTGSGTIEGNGQKWWELPCKPHRGPN  200

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G+TLPGPCDSP  IRFF SSNL V  L+I+NSP+FH +FD C  V I+ L I +P  SPN
Sbjct  201   GSTLPGPCDSPALIRFFMSSNLAVNSLRIQNSPMFHMKFDGCEGVLIEKLSISSPKLSPN  260

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT  V I+NS++SNGDDCISIG GC NV I  +TCGP HGISIGSLG+  S+A
Sbjct  261   TDGIHIENTKGVGIYNSMISNGDDCISIGPGCANVAIEGVTCGPSHGISIGSLGVHNSQA  320

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V ++ IR+SDNG+RIKTWQGG G+VS + F+NI+M+NVRN IIVDQYYC +K C
Sbjct  321   CVSNITVRNAVIRDSDNGLRIKTWQGGSGSVSDILFENIQMENVRNCIIVDQYYCLSKDC  380

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQTSAV+++ V Y NIKGT+D R+ P+  ACSDSV CTN+T+SEVEL P +G  + DPF
Sbjct  381   LNQTSAVFVNQVLYKNIKGTYDVRNTPIHFACSDSVACTNITMSEVELLPHEGELVEDPF  440

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNA+G  +T+TIPP+ CL EG PQ++       C
Sbjct  441   CWNAFGIQETLTIPPIDCLQEGEPQNVAETSEYSC  475



>ref|NP_175244.1| polygalacturonase [Arabidopsis thaliana]
 sp|Q949Z1.1|PGLR4_ARATH RecName: Full=Polygalacturonase At1g48100; Short=PG; AltName: 
Full=Pectinase At1g48100; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK92733.1| putative polygalacturonase PG1 [Arabidopsis thaliana]
 gb|AAM20001.1| putative polygalacturonase PG1 [Arabidopsis thaliana]
 gb|AEE32248.1| polygalacturonase [Arabidopsis thaliana]
Length=475

 Score =   497 bits (1279),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 228/384 (59%), Positives = 296/384 (77%), Gaps = 1/384 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V S+G +GDG  DDT AF+ AW  AC  + + ++LAP+   F I STIF+GPCK  L+F
Sbjct  81    DVTSFGAVGDGSCDDTAAFQDAWKAACAVE-SGVVLAPEGGVFKITSTIFSGPCKPGLVF  139

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++G +MPPDGP+ WP+   K QWLVFYR++G +  G G ++G G+KWW+LPCKPHRG +
Sbjct  140   QLDGVLMPPDGPEEWPEKDNKNQWLVFYRLDGFTFSGKGTVEGNGQKWWDLPCKPHRGPD  199

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G++  GPC SP  IRFF S+N+ V+ L+I+NSP FH +FD C  V I+ + I +P  SPN
Sbjct  200   GSSSSGPCASPTMIRFFMSNNIEVKGLRIQNSPQFHMKFDGCQGVLINEIQISSPKLSPN  259

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIH+ NT  V I+NS+VSNGDDCISIG GC +VDI+ +TCGP HGISIGSLG+  S+A
Sbjct  260   TDGIHLGNTRSVGIYNSVVSNGDDCISIGTGCSDVDIQGVTCGPSHGISIGSLGVHNSQA  319

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V ++ IR+SDNG+R+KTWQGG G+VS + F+NI+M+NV N IIVDQYYC +K C
Sbjct  320   CVSNITVRNTVIRDSDNGLRVKTWQGGTGSVSNLLFENIQMENVLNCIIVDQYYCQSKDC  379

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              N+TSAV + DV Y NIKGT+D RSPP+  ACSD+V CTN+T+SEVEL P +G  + DPF
Sbjct  380   RNETSAVKVFDVEYRNIKGTYDVRSPPIHFACSDTVACTNITMSEVELLPEEGELVDDPF  439

Query  284   CWNAYGDLKTVTIPPVFCLLEGNP  213
             CWNAYG  +T+TIPP+ CLL+G+P
Sbjct  440   CWNAYGKQETLTIPPIDCLLDGSP  463



>ref|XP_002874953.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51212.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=480

 Score =   497 bits (1279),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 241/391 (62%), Positives = 308/391 (79%), Gaps = 6/391 (2%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEAC---QSDLTPILLAPKHHSFLIQSTIFTGPCKNP  1194
             NV  YG +GDGV DDT +FK AWD AC   +++   +LL P   +F+I+STIFTGPC++ 
Sbjct  78    NVKKYGAVGDGVTDDTESFKTAWDSACGNYKNNTASVLLVPYGFTFMIRSTIFTGPCRSY  137

Query  1193  LLFQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHR  1014
               FQ++GTI+P DGP SWP +L KRQWLVFYR+NGM+++G G+IDGRG+ WW+LPCKPHR
Sbjct  138   QYFQVDGTIVPRDGPKSWPSSLDKRQWLVFYRINGMALKGVGVIDGRGQNWWDLPCKPHR  197

Query  1013  -GVNGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPP  837
               VN T L GPC+SP A+RFF SSN+TV+ L IKNSP  H + D CH VHI+S+ I +P 
Sbjct  198   QNVNKTKLAGPCESPAALRFFMSSNVTVKGLSIKNSPQVHLKLDGCHVVHINSIRIISPS  257

Query  836   NSPNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPG-HGISIGSLGI  660
             +SPNTDGIHIEN+  V I+NS++SNGDDC+SIG G Y++DIRN+TCGPG HGISIGSLG 
Sbjct  258   SSPNTDGIHIENSKSVEIYNSVISNGDDCVSIGPGSYDIDIRNLTCGPGGHGISIGSLGE  317

Query  659   KQSRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYC  480
             K S ACVSN+ V DS I+ S+NGVRIKTWQGG G+VS VTF+NI +D VRNPII+DQYYC
Sbjct  318   KSSHACVSNVTVRDSFIKFSENGVRIKTWQGGSGSVSGVTFNNIHVDTVRNPIIIDQYYC  377

Query  479   SNKACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHR  300
             + K+C N+TSAV+++D+ Y +IKGT+D RSPPM   CS++VPCTNLTLS++EL PS+   
Sbjct  378   TAKSCANKTSAVFVNDIVYQSIKGTYDIRSPPMHFGCSNNVPCTNLTLSDIELLPSKKDI  437

Query  299   MLDPFCWNAYGDLKTVTIPPVFCLLEGNPQS  207
             ++DPFCWNAYG     ++P + C L+ NP +
Sbjct  438   VVDPFCWNAYGITDEFSVPLISC-LKSNPST  467



>gb|AAK95305.1|AF410319_1 At1g48100/F21D18_17 [Arabidopsis thaliana]
Length=475

 Score =   496 bits (1278),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 228/384 (59%), Positives = 296/384 (77%), Gaps = 1/384 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V S+G +GDG  DDT AF+ AW  AC  + + ++LAP+   F I STIF+GPCK  L+F
Sbjct  81    DVTSFGAVGDGSCDDTAAFQDAWKAACAVE-SGVVLAPEGGVFRITSTIFSGPCKPGLVF  139

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++G +MPPDGP+ WP+   K QWLVFYR++G +  G G ++G G+KWW+LPCKPHRG +
Sbjct  140   QLDGVLMPPDGPEEWPEKDNKNQWLVFYRLDGFTFSGKGTVEGNGQKWWDLPCKPHRGPD  199

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G++  GPC SP  IRFF S+N+ V+ L+I+NSP FH +FD C  V I+ + I +P  SPN
Sbjct  200   GSSSSGPCASPTMIRFFMSNNIEVKGLRIQNSPQFHMKFDGCQGVLINEIQISSPKLSPN  259

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIH+ NT  V I+NS+VSNGDDCISIG GC +VDI+ +TCGP HGISIGSLG+  S+A
Sbjct  260   TDGIHLGNTRSVGIYNSVVSNGDDCISIGTGCSDVDIQGVTCGPSHGISIGSLGVHNSQA  319

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V ++ IR+SDNG+R+KTWQGG G+VS + F+NI+M+NV N IIVDQYYC +K C
Sbjct  320   CVSNITVRNTVIRDSDNGLRVKTWQGGTGSVSNLLFENIQMENVLNCIIVDQYYCQSKDC  379

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              N+TSAV + DV Y NIKGT+D RSPP+  ACSD+V CTN+T+SEVEL P +G  + DPF
Sbjct  380   RNETSAVKVFDVEYRNIKGTYDVRSPPIHFACSDTVACTNITMSEVELLPEEGELVDDPF  439

Query  284   CWNAYGDLKTVTIPPVFCLLEGNP  213
             CWNAYG  +T+TIPP+ CLL+G+P
Sbjct  440   CWNAYGKQETLTIPPIDCLLDGSP  463



>ref|XP_009147998.1| PREDICTED: polygalacturonase At1g48100 [Brassica rapa]
 emb|CDX93644.1| BnaA06g04040D [Brassica napus]
Length=472

 Score =   495 bits (1275),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 227/384 (59%), Positives = 294/384 (77%), Gaps = 1/384 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V S+G +GDG  DDT AFK AW  AC  + + ++LAP+   F I STIF+GPCK  L+F
Sbjct  78    DVTSFGAVGDGSCDDTAAFKDAWKAACAVE-SSVVLAPEGGVFKITSTIFSGPCKPGLVF  136

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++G +MPPDGP+ WP+  +K QWLVFYR++G +  G G ++G G+KWW+LPCKPHRG +
Sbjct  137   QLDGVLMPPDGPEEWPEKDSKSQWLVFYRLDGFTFAGKGTVEGNGQKWWDLPCKPHRGPD  196

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G++   PC SP  IRFF S+N+ V  L+I+NSP FH +FD C  V I+ + I +P  SPN
Sbjct  197   GSSSSEPCVSPTMIRFFMSNNIEVGGLRIQNSPQFHMKFDGCEGVSINDIQISSPKLSPN  256

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIH+ NT  V IHNS+VSNGDDCISIG GC ++DI+ +TCGP HGISIGSLG+  S+A
Sbjct  257   TDGIHLGNTRSVAIHNSVVSNGDDCISIGTGCSDIDIQGVTCGPSHGISIGSLGVHNSQA  316

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V ++ IR+SDNG+R+KTWQGG G+VS + F+NI+M+NV N IIVDQYYC +K C
Sbjct  317   CVSNITVRNTVIRDSDNGLRVKTWQGGTGSVSNLLFENIQMENVLNCIIVDQYYCQSKEC  376

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              N+TSAV + DV Y NIKGT+D RS P+  ACSD+V CTN+T+SEVEL P +G  + DPF
Sbjct  377   RNETSAVRVFDVQYRNIKGTYDVRSAPIHFACSDTVACTNITMSEVELLPEEGELVDDPF  436

Query  284   CWNAYGDLKTVTIPPVFCLLEGNP  213
             CWNAYG  +T+TIPP+ CLL+G+P
Sbjct  437   CWNAYGTQETLTIPPIDCLLDGSP  460



>ref|XP_008655818.1| PREDICTED: polygalacturonase At1g48100-like [Zea mays]
 gb|AFW80563.1| hypothetical protein ZEAMMB73_033652 [Zea mays]
Length=494

 Score =   496 bits (1276),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 233/397 (59%), Positives = 300/397 (76%), Gaps = 4/397 (1%)
 Frame = -2

Query  1361  VMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLFQ  1182
             V  +G +GDGV DDT A K AWD ACQ D   ++LA   +SFL+ +T+FTGPC+  +  Q
Sbjct  98    VKDFGAVGDGVTDDTDALKTAWDTACQDDGDSVVLAAAGYSFLVHTTVFTGPCQGSVTIQ  157

Query  1181  IEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVNG  1002
             ++G I+ P  PD+WP N +KR WL+FY+ +GMS+QG GLIDGRG+KWW LPCK H+G  G
Sbjct  158   LDGAIVAPSDPDTWPAN-SKRNWLLFYQAHGMSLQGAGLIDGRGQKWWELPCKSHKGQGG  216

Query  1001  TTLPGP-CDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             ++  G  CDSPVA+RFF ++N+TVQ LK++NSP FH RFD+C  V    L I +P  SPN
Sbjct  217   SSGHGASCDSPVALRFFMTNNVTVQGLKVQNSPEFHIRFDSCCGVVASGLSISSPALSPN  276

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPG-HGISIGSLGIKQSR  648
             TDGIH+ENT DV I N+ VSNGDDC+SIGAG  N+ + N+TCGPG HGISIGSLG + SR
Sbjct  277   TDGIHVENTEDVLITNTAVSNGDDCVSIGAGTRNMHVENVTCGPGGHGISIGSLGKQGSR  336

Query  647   ACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKA  468
             ACV+N+ V ++ IR+SDNGVRIKTWQGG GAVS V+F+N+RMD VRNPII+DQYYC +K+
Sbjct  337   ACVANVTVRNAVIRHSDNGVRIKTWQGGSGAVSSVSFENVRMDAVRNPIIIDQYYCLSKS  396

Query  467   CTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLD-  291
             C N TSAV++S VSY+ I+GT+D R+ P+   CSD+VPCTN+TLS+VEL P+ G   +D 
Sbjct  397   CDNATSAVFVSGVSYAGIRGTYDPRTTPIHFGCSDAVPCTNITLSDVELLPASGDSTIDN  456

Query  290   PFCWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             PFCWN YG   T T+PPV CL+EG P+ + +    +C
Sbjct  457   PFCWNVYGSTATPTVPPVPCLIEGVPRRVDDNSTLKC  493



>ref|XP_008458305.1| PREDICTED: polygalacturonase At1g48100 [Cucumis melo]
Length=475

 Score =   494 bits (1272),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 241/395 (61%), Positives = 300/395 (76%), Gaps = 1/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V  +G +GDG  DDT AFK AW  AC  + +  LL P +  F I STIF+GPCK  L+F
Sbjct  82    DVTDFGAVGDGCTDDTAAFKAAWKAACAVE-SATLLVPSNLCFKITSTIFSGPCKPGLVF  140

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             +++GT+ PPDGP+SWPK  + RQWLVFYR++ M++ G G I+G G+KWW LPCKPHRG N
Sbjct  141   KVDGTLTPPDGPESWPKADSPRQWLVFYRLDQMTLTGSGTIEGNGQKWWELPCKPHRGPN  200

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G+TLPGPCDSP  IRFF SSNL V  L+I+NSP+FH +FD C  V I+ L I +P  SPN
Sbjct  201   GSTLPGPCDSPALIRFFMSSNLAVNSLRIQNSPMFHMKFDGCEGVLIERLSISSPKLSPN  260

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT  V I+NS++SNGDDCISIG GC NV I  +TCGP HGISIGSLG+  S+A
Sbjct  261   TDGIHIENTKGVGIYNSMISNGDDCISIGPGCANVAIEGVTCGPSHGISIGSLGVHNSQA  320

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V ++ IR+SDNG+RIKTWQGG G+VS + F+NI+M+NVRN IIVDQYYC +K C
Sbjct  321   CVSNITVRNAVIRDSDNGLRIKTWQGGSGSVSDILFENIQMENVRNCIIVDQYYCLSKDC  380

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQTSAV+++ V Y NIKGT+D R+ P+  ACSDSV CTN+T+SEVEL P +G  + DPF
Sbjct  381   LNQTSAVFVNQVLYKNIKGTYDVRNTPIHFACSDSVACTNITMSEVELLPHEGELVEDPF  440

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNA+G  +T+TIPP+ CL EG PQ++       C
Sbjct  441   CWNAFGVQETLTIPPIDCLQEGEPQNVAETSEYSC  475



>gb|EAY73623.1| hypothetical protein OsI_01510 [Oryza sativa Indica Group]
Length=503

 Score =   495 bits (1274),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 230/383 (60%), Positives = 291/383 (76%), Gaps = 4/383 (1%)
 Frame = -2

Query  1361  VMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLFQ  1182
             V  +G  GDGV DDT A K AWD AC  D   ++LA    SFLI +T+FTGPC+  +  Q
Sbjct  114   VKDFGAAGDGVTDDTDALKTAWDTACADDGAGVVLAAAGRSFLIHTTVFTGPCQGSVTLQ  173

Query  1181  IEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVNG  1002
             ++GTI+ P  P +WP N  KR WLVFYR + +S+ G GLIDG+G+KWW+LPCKP +G N 
Sbjct  174   VDGTIVAPSEPATWPAN-NKRNWLVFYRADCVSLVGAGLIDGKGQKWWDLPCKPQKGGN-  231

Query  1001  TTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPNT  822
                 GPCDSPVA+RF  S+N+TV+ LK++NSP FHFRFDNC+ V +D L I +P  SPNT
Sbjct  232   --THGPCDSPVAMRFAISNNVTVRGLKVQNSPEFHFRFDNCNGVRVDGLSISSPALSPNT  289

Query  821   DGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRAC  642
             DGIH+ENT DV I N++VSNGDDC+SIGAG  NV I N+TCGPGHGISIGSLG   ++AC
Sbjct  290   DGIHVENTQDVLITNTVVSNGDDCVSIGAGTLNVHIENVTCGPGHGISIGSLGKAGTKAC  349

Query  641   VSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKACT  462
             V+N+ V ++ IR+SDNGVRIKTWQGG G+VS V F+N+RMD VRNPII+DQYYC +K+C 
Sbjct  350   VANVTVRNAVIRHSDNGVRIKTWQGGSGSVSAVAFENVRMDAVRNPIIIDQYYCLSKSCE  409

Query  461   NQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPFC  282
             N+T+AV+++ VSYS I+GT+D R PP+   CSD+VPCTN+TLS+VEL P+ G  + +PFC
Sbjct  410   NETTAVFVNGVSYSGIRGTYDVRGPPIHFGCSDAVPCTNITLSDVELLPASGDTVDEPFC  469

Query  281   WNAYGDLKTVTIPPVFCLLEGNP  213
             WN YG+  T T+PPV CL  G P
Sbjct  470   WNVYGNAATPTVPPVSCLSSGFP  492



>ref|XP_009414161.1| PREDICTED: polygalacturonase At1g48100-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=447

 Score =   493 bits (1268),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 228/354 (64%), Positives = 284/354 (80%), Gaps = 2/354 (1%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V S+G +GDGV DDT AF+ AW  AC  + +  L  P    F+I STIF GPC+  L+F
Sbjct  79    DVRSFGAVGDGVTDDTEAFRSAWRAACSVE-SATLSVPSDGVFMITSTIFPGPCQPGLVF  137

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++G +MPPDGP  WPK+ +K QWLVFY++ GM+++G G I+G GE WW+LPCKPHRG +
Sbjct  138   QVDGVVMPPDGPQCWPKSDSKHQWLVFYQLEGMTLRGEGTIEGNGEDWWSLPCKPHRGPH  197

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G+TLPG CDSPV IRFF S NLTV+DL+I+NSP FH +FD C DVHI+ L I +P  SPN
Sbjct  198   GSTLPGSCDSPVLIRFFMSCNLTVRDLRIENSPQFHIKFDACEDVHIEGLSINSPAFSPN  257

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDG+HIENT  VTI+NS++SNGDDCISIG GC +VDI+N+TCGPGHGISIGSLG+  S A
Sbjct  258   TDGVHIENTRSVTIYNSMISNGDDCISIGPGCSDVDIQNVTCGPGHGISIGSLGMHNSEA  317

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKA-  468
             CVSN+ V ++ IRNSDNGVRIKTWQGG G+VS ++FD + M+NVRN II+DQYYCSNK  
Sbjct  318   CVSNVSVKNAVIRNSDNGVRIKTWQGGMGSVSDISFDTVYMENVRNCIIIDQYYCSNKGY  377

Query  467   CTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQG  306
             C NQ+SAVY+S V+Y+NIKGT+D RSPPM  ACSD++PCTN+T+SEVEL P +G
Sbjct  378   CQNQSSAVYVSGVTYANIKGTYDVRSPPMHFACSDTLPCTNITMSEVELLPHEG  431



>ref|XP_002891410.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67669.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=474

 Score =   494 bits (1271),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 227/384 (59%), Positives = 297/384 (77%), Gaps = 1/384 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V S+G +GDG  +DT+AF+ AW  AC  + + ++LAP+   F I STIF+GPCK  L+F
Sbjct  80    DVTSFGAVGDGSCNDTVAFQNAWKAACAVE-SGVVLAPEGGVFKITSTIFSGPCKPGLVF  138

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++G +MPPDGP+ WP+   K QWLVFYR++G++  G G ++G G+KWW+LPCKPHRG +
Sbjct  139   QLDGVLMPPDGPEEWPEKDDKNQWLVFYRLDGITFSGKGTVEGNGQKWWDLPCKPHRGPD  198

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G++  GPC SP  IRFF S+N+ V+ L+I+NSP FH +FD C  V I+ + I +P  SPN
Sbjct  199   GSSSSGPCASPTMIRFFMSNNIEVKGLRIQNSPQFHMKFDGCQGVLINEIQISSPKLSPN  258

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIH+ NT  V I+NS+VSNGDDCISIG GC +VDI+ +TCGP HGISIGSLG+  S+A
Sbjct  259   TDGIHLGNTRSVGIYNSVVSNGDDCISIGTGCSDVDIQGVTCGPSHGISIGSLGVHNSQA  318

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V ++ IR+SDNG+R+KTWQGG G+VS + F+NI+M+NV N IIVDQYYC +K C
Sbjct  319   CVSNITVRNTVIRDSDNGLRVKTWQGGTGSVSNLLFENIQMENVLNCIIVDQYYCQSKDC  378

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              N+TSAV + DV Y NIKGT+D RSPP+  ACSD+V CTN+T+SEVEL P +G  + DPF
Sbjct  379   RNETSAVKVFDVEYRNIKGTYDVRSPPIHFACSDTVACTNITMSEVELLPEEGELVDDPF  438

Query  284   CWNAYGDLKTVTIPPVFCLLEGNP  213
             CWNAYG  +T+TIPP+ CLL G+P
Sbjct  439   CWNAYGTQETLTIPPIDCLLGGSP  462



>ref|XP_004504654.1| PREDICTED: polygalacturonase At1g48100-like isoform X1 [Cicer 
arietinum]
Length=503

 Score =   492 bits (1267),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 236/425 (56%), Positives = 304/425 (72%), Gaps = 31/425 (7%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V S+G +GDG  DDT AFK AW  AC  + + ++L P+ + F I STIF+GPCK  L+F
Sbjct  78    DVRSFGAVGDGSTDDTPAFKAAWKAACGVE-SGVVLVPESYIFKITSTIFSGPCKPGLVF  136

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++G I+ PDGPDSWP+  ++ QWLVFYR++ MS+ G G I+G G++WW+LPCKPHRG +
Sbjct  137   QVDGMIIAPDGPDSWPEGDSRNQWLVFYRLDQMSLNGTGTIEGNGDQWWDLPCKPHRGPD  196

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G TL GPC SP  IRFF SSNL V  L+I+NSP FH +FD C  V ID L I AP  SPN
Sbjct  197   GKTLSGPCGSPAMIRFFMSSNLMVSGLQIQNSPQFHMKFDGCQGVLIDRLTISAPKLSPN  256

Query  824   TDGIHIENTYDVTIHNSIVSNG------------------------------DDCISIGA  735
             TDGIH+EN+  V I+NS++SNG                              DDCISIG 
Sbjct  257   TDGIHVENSQAVGIYNSMISNGIYGYSPINVYLPCLVISFYINFTISIIIIGDDCISIGP  316

Query  734   GCYNVDIRNMTCGPGHGISIGSLGIKQSRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGA  555
             G  +VDI  +TCGP HGISIGSLG+  S+ACVSN+ V D+ IR SDNG+RIKTWQGG G+
Sbjct  317   GTSDVDIAGVTCGPSHGISIGSLGVHNSQACVSNLTVRDTVIRESDNGLRIKTWQGGMGS  376

Query  554   VSKVTFDNIRMDNVRNPIIVDQYYCSNKACTNQTSAVYISDVSYSNIKGTFDARSPPMRL  375
             V+ + F+NI+M+NV N I++DQYYC  K C NQTSAV+++DVSY NIKGT+D R+ P+  
Sbjct  377   VTGLKFENIQMENVGNCILIDQYYCLTKECLNQTSAVHVNDVSYKNIKGTYDVRTAPIHF  436

Query  374   ACSDSVPCTNLTLSEVELYPSQGHRMLDPFCWNAYGDLKTVTIPPVFCLLEGNPQSLPNV  195
             ACSDSV CTN+TLSEVEL+P +G  + DPFCWNAYG+ +T+TIPP+ CL EG+P+++ ++
Sbjct  437   ACSDSVACTNITLSEVELFPYEGELLDDPFCWNAYGNQETLTIPPINCLREGDPETVGDL  496

Query  194   DVDQC  180
                QC
Sbjct  497   STYQC  501



>gb|KCW61351.1| hypothetical protein EUGRSUZ_H04092 [Eucalyptus grandis]
Length=464

 Score =   491 bits (1263),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 228/379 (60%), Positives = 291/379 (77%), Gaps = 1/379 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V ++G +GDG +DDT AF  AW  AC  + + ++LAP  H+F+I STIF+GPCK  L+F
Sbjct  84    DVTAFGAVGDGSSDDTPAFTAAWKAACAVE-SGVVLAPSGHTFMITSTIFSGPCKPGLVF  142

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++G +MPP+GPDSWPK  +K QWLVFYR++GM++ G G I+G GE WW+LPCKPHRG +
Sbjct  143   QVDGVLMPPNGPDSWPKADSKNQWLVFYRLDGMTLTGTGTIEGNGEPWWDLPCKPHRGPS  202

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G T  GPCDSP  IRFF SSNL V  L+I+NSP FH +FD C  V I+ L I +P  SPN
Sbjct  203   GQTASGPCDSPTMIRFFMSSNLAVNGLRIQNSPQFHMKFDGCEGVQIEKLSISSPKLSPN  262

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIH+ NT  V I+NS++SNGDDCISIG GC +++I  +TCGP HGISIGSLG   S+A
Sbjct  263   TDGIHLGNTKSVGIYNSMISNGDDCISIGTGCSDINIEGVTCGPSHGISIGSLGANNSQA  322

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
              VSNI V ++ IR+SDNG+RIKTWQGG G+V+ ++++NIRM NV N IIVDQYYCSNK C
Sbjct  323   WVSNITVRNAVIRDSDNGLRIKTWQGGSGSVTDISYENIRMQNVLNSIIVDQYYCSNKVC  382

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQ+SAVY+S +SY NIKGT++   PP+R ACSD+V CTN+ +SEVEL P  G  + +P+
Sbjct  383   RNQSSAVYVSGLSYRNIKGTYNMIKPPIRFACSDAVGCTNIRISEVELLPHVGDLVDEPY  442

Query  284   CWNAYGDLKTVTIPPVFCL  228
             CWNA+G  +T TIPPV CL
Sbjct  443   CWNAFGVQETPTIPPVACL  461



>ref|XP_010551104.1| PREDICTED: polygalacturonase At1g48100 [Tarenaya hassleriana]
Length=473

 Score =   491 bits (1263),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 233/386 (60%), Positives = 296/386 (77%), Gaps = 1/386 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V SYG +GDG  DDT AF+ AW  AC  + + ++LAP+   F I STIF+GPCK  L+F
Sbjct  75    DVTSYGAVGDGSCDDTAAFRAAWKAACGVE-SGVVLAPEGGVFKITSTIFSGPCKPGLVF  133

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++G +M PDGP+ WP+  +K+QWLVFYR++G  ++G G I+G G+KWW+LPCKPHRG N
Sbjct  134   QVDGVVMTPDGPEEWPEADSKKQWLVFYRLDGFRLKGKGTIEGNGQKWWDLPCKPHRGPN  193

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G+T+ GPCDSP  IRFF S+N+ V+ ++I+NSP FH +FD C  VHI+ L I +P  SPN
Sbjct  194   GSTVSGPCDSPAMIRFFMSNNIEVRGVRIENSPQFHMKFDGCEGVHINELQISSPKLSPN  253

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT  V+I+NS+VSNGDDCISIG GC +VDI  +TCGP HGISIGSLG+  S A
Sbjct  254   TDGIHIENTRSVSIYNSLVSNGDDCISIGPGCSDVDIDGVTCGPSHGISIGSLGVHNSEA  313

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CV NI V +  IR SDNG+RIKTWQGG G V ++ F+NI M+NVRN II+DQYYC +K C
Sbjct  314   CVRNITVRNVAIRESDNGLRIKTWQGGTGYVGQLLFENIEMENVRNCIIIDQYYCMSKEC  373

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              N+TSAV +  + Y NIKGT+D RSPP+  ACSD+V CTN+T+SEVEL P +G  + DPF
Sbjct  374   RNETSAVRVDGIEYRNIKGTYDVRSPPIHFACSDTVACTNITMSEVELLPEEGELVDDPF  433

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQS  207
             CWNAYG  +T+TIPP+ CLL+G P S
Sbjct  434   CWNAYGTQETLTIPPISCLLQGFPPS  459



>ref|XP_003594633.1| Polygalacturonase [Medicago truncatula]
 gb|AES64884.1| polygalacturonase plant-like protein [Medicago truncatula]
Length=463

 Score =   489 bits (1259),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 235/395 (59%), Positives = 305/395 (77%), Gaps = 1/395 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V S+G +GDG ADDT AF+ AW  AC  D + +LLAP+++ F I STIF+GPCK  L+F
Sbjct  68    DVRSFGAVGDGDADDTAAFRAAWKAACAVD-SGVLLAPENYCFKITSTIFSGPCKPGLVF  126

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             QI+GT+M PDGP+ WP+  +K QWLVFYR++ M++ G G+I+G GE+WW+LPCKPHR  +
Sbjct  127   QIDGTLMAPDGPNCWPEADSKSQWLVFYRLDQMTLNGTGIIEGNGEQWWDLPCKPHRSPD  186

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G T+ GPC SP  IRFF SSNL ++ LKI+NSP FH +FD C  V ID L I AP  SPN
Sbjct  187   GKTVSGPCVSPTMIRFFMSSNLVLRGLKIQNSPQFHVKFDGCQGVLIDELSISAPKLSPN  246

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIH+ NT DV I+NS++SNGDDCISIG GC NV++  +TC P HGISIGSLG+  S A
Sbjct  247   TDGIHLGNTRDVGIYNSLISNGDDCISIGPGCSNVNVDGVTCAPTHGISIGSLGVHNSHA  306

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSN+ V +S I+ SDNG+RIKTWQGG G+V+ +TFDNI+M+NVRN I +DQ+YC +K C
Sbjct  307   CVSNLTVRNSIIKESDNGLRIKTWQGGTGSVTGLTFDNIQMENVRNCINIDQFYCLSKEC  366

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQTSAVY++++SY  IKGT+D R+PP+  ACSD+V CTN+TLSE+EL P +G  + DPF
Sbjct  367   MNQTSAVYVNNISYRKIKGTYDVRTPPIHFACSDTVACTNITLSEIELLPYEGELVDDPF  426

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNAYG  +T+TIPP+ CL EG P+++  +   +C
Sbjct  427   CWNAYGRQETLTIPPLDCLREGQPETVVELSEYEC  461



>ref|XP_002455500.1| hypothetical protein SORBIDRAFT_03g012280 [Sorghum bicolor]
 gb|EES00620.1| hypothetical protein SORBIDRAFT_03g012280 [Sorghum bicolor]
Length=506

 Score =   491 bits (1263),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 231/396 (58%), Positives = 302/396 (76%), Gaps = 3/396 (1%)
 Frame = -2

Query  1361  VMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLFQ  1182
             V  +G +GDGV DDT A K AWD ACQ D   ++LA   +SFL+ ST+FTGPC+  +  Q
Sbjct  111   VKDFGAVGDGVTDDTDAVKTAWDTACQDDGDSVVLAAAGYSFLVHSTVFTGPCQGSVTIQ  170

Query  1181  IEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVNG  1002
             ++GTI+ P  PD WP N +KR WL+FY+ +GMS++G GLIDG+G+KWW LPCK  +G  G
Sbjct  171   LDGTIVAPSDPDKWPAN-SKRNWLLFYQAHGMSLKGAGLIDGKGQKWWELPCKSQKGHGG  229

Query  1001  TTLPGP-CDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             ++  G  CDSPVA+RFF ++N+T+Q LK++NSP FH RFD+C  V    L I +P  SPN
Sbjct  230   SSGHGAACDSPVAMRFFMTNNVTLQGLKVQNSPEFHIRFDSCRGVVASGLSISSPALSPN  289

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPG-HGISIGSLGIKQSR  648
             TDGIH+EN+ DV I N+ VSNGDDC+SIGAG  N+ + N+TCGPG HGISIGSLG + SR
Sbjct  290   TDGIHVENSQDVVITNTAVSNGDDCVSIGAGTLNMHVENVTCGPGGHGISIGSLGKQGSR  349

Query  647   ACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKA  468
             ACV+N+ V ++ IR+SDNGVRIKTWQGG GAVS V+F+N+RMD VRNPII+DQYYC +K+
Sbjct  350   ACVANVTVRNAVIRHSDNGVRIKTWQGGSGAVSAVSFENVRMDAVRNPIIIDQYYCLSKS  409

Query  467   CTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDP  288
             C N TSAV+++ VSY+ I+GT+DAR+PP+   CSD+VPCTN+TLS+VEL P+ G  + DP
Sbjct  410   CENATSAVFVNGVSYAGIRGTYDARTPPIHFGCSDAVPCTNITLSDVELLPASGETIDDP  469

Query  287   FCWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             FCWN YG   T T+PPV CL+EG P+++ +    +C
Sbjct  470   FCWNVYGSAATPTVPPVPCLMEGVPRNVEDNSSLKC  505



>gb|AAS98503.1| unknown protein [Oryza sativa Japonica Group]
Length=504

 Score =   490 bits (1261),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 229/406 (56%), Positives = 304/406 (75%), Gaps = 20/406 (5%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V ++G +GDG  DDT AF+ AW  AC  + + ++  P   +F I +T FTGPCK  L+F
Sbjct  91    DVRAFGAVGDGTTDDTEAFRAAWRAACAVE-SAVISVPSDGTFTITTTTFTGPCKPGLVF  149

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHR---  1014
             Q++G +MPPDGPD WP +  +RQWLVF  ++G++++G G I+G GE WWNLPCKPHR   
Sbjct  150   QVDGVLMPPDGPDCWPPSDNRRQWLVFSNLDGLTLRGAGTIEGNGEGWWNLPCKPHRLAR  209

Query  1013  ----------------GVNGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDN  882
                             G NG+TL GPCDSP  +RFF S NL V+ L+++NSP FHFRFD 
Sbjct  210   LNTGSEFALVTLNSVQGPNGSTLRGPCDSPTLVRFFMSRNLVVEGLRVENSPEFHFRFDG  269

Query  881   CHDVHIDSLYIKAPPNSPNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMT  702
             C DV +D L I++P NSPNTDGIH+ENT  V I+NS++SNGDDCISIG G Y+VDI+N++
Sbjct  270   CSDVRVDGLSIRSPANSPNTDGIHVENTQRVAIYNSMISNGDDCISIGTGSYDVDIQNVS  329

Query  701   CGPGHGISIGSLGIKQSRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRM  522
             CGPGHGISIGSLG+  S+ACV+N+ V ++ IRNSDNG+RIKTWQGG G+VS + FD + M
Sbjct  330   CGPGHGISIGSLGVHNSQACVANVTVRNAVIRNSDNGLRIKTWQGGMGSVSGINFDTVSM  389

Query  521   DNVRNPIIVDQYYCSNKACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNL  342
             +NVRN II+DQYYC +K C NQ++AV+++DVSY+N++G++D R+ P+  ACSD+VPCTN+
Sbjct  390   ENVRNCIIIDQYYCLDKRCMNQSTAVHVTDVSYANVRGSYDVRAAPIHFACSDTVPCTNI  449

Query  341   TLSEVELYPSQGHRMLDPFCWNAYGDLKTVTIPPVFCLLEGNPQSL  204
             T+SEVEL P  G  + DPFCW+AYG  +T TIPP++CL +G P SL
Sbjct  450   TMSEVELLPFSGELVDDPFCWSAYGLQQTPTIPPIYCLQDGLPDSL  495



>ref|XP_010672584.1| PREDICTED: polygalacturonase At1g48100 [Beta vulgaris subsp. 
vulgaris]
Length=472

 Score =   489 bits (1258),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 229/388 (59%), Positives = 295/388 (76%), Gaps = 2/388 (1%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V S+G +GDG  DDT AF+  W  AC  + + ILL P    F+I S+IF GPCK  L+ 
Sbjct  79    DVTSFGAVGDGNTDDTAAFQATWKAACAVESSVILL-PSKGKFMITSSIFNGPCKPGLVM  137

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             QI+G +MPPDGPD WP++ +K+QWLVFYR+N  +M G G I+G G+KWW+LPCKPHRG +
Sbjct  138   QIDGILMPPDGPDCWPESDSKKQWLVFYRLNEFTMNGTGTIEGNGQKWWDLPCKPHRGPH  197

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G+TLPGPCDSP  IRFF S+N  +  ++I+NSP FH +FD C  V I+ L I +P  SPN
Sbjct  198   GSTLPGPCDSPAMIRFFLSNNTQISGIRIQNSPQFHIKFDGCDGVLINKLQINSPQFSPN  257

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIH++ T +V I+NS+++NGDDCISIG GC NVDI+ + C   HGISIGSLG+  +R+
Sbjct  258   TDGIHVQETKNVGIYNSMIANGDDCISIGPGCSNVDIQGVVCDHSHGISIGSLGVHNTRS  317

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V  + I+NSDNGVRIKTWQGG G+VS ++F +I+M+N  N II+DQYYC  KAC
Sbjct  318   CVSNITVRGALIKNSDNGVRIKTWQGGSGSVSDISFHDIQMENTTNSIIIDQYYCLTKAC  377

Query  464   TNQTSAVYISDVSYSNIKGTF-DARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDP  288
              N+TSAVY+S VSY NIKGT+ + RS P+  ACSD+VPCTN+T+SEVEL P+QG  + DP
Sbjct  378   RNETSAVYLSGVSYKNIKGTYNNVRSAPIHFACSDAVPCTNITMSEVELLPAQGELVDDP  437

Query  287   FCWNAYGDLKTVTIPPVFCLLEGNPQSL  204
             FCWNAYG  +++TIPP+ CL +G P SL
Sbjct  438   FCWNAYGIQESLTIPPIDCLQDGMPLSL  465



>gb|AAD22651.1|AC007138_15 putative polygalacturonidase [Arabidopsis thaliana]
 emb|CAB80682.1| putative polygalacturonidase [Arabidopsis thaliana]
Length=452

 Score =   486 bits (1252),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 230/390 (59%), Positives = 295/390 (76%), Gaps = 20/390 (5%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEAC---QSDLTPILLAPKHHSFLIQSTIFTGPCKNP  1194
             +V  YG +G+GVADDT++FK AWD AC   +++   +L  P   +F+I+STIFTGPC++ 
Sbjct  66    DVRKYGAVGNGVADDTVSFKTAWDSACSNNKNNTASVLHVPYGFTFMIRSTIFTGPCRSY  125

Query  1193  LLFQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHR  1014
               FQ++GTI+P DGP SWP +L KRQWL FYR+NGM++QG G+IDGRG+ WW+LPCKPH+
Sbjct  126   QYFQVDGTIVPRDGPKSWPSSLNKRQWLAFYRINGMALQGAGVIDGRGQNWWDLPCKPHQ  185

Query  1013  GVNGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPN  834
                            A+RFF SSN+ V+ L IKNSP  H + D CH VHI+SL I +PP 
Sbjct  186   ---------------ALRFFMSSNVIVKGLSIKNSPQVHLKLDGCHVVHINSLRIISPPA  230

Query  833   SPNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPG-HGISIGSLGIK  657
             SPNTDGIHIEN+  V I+NS++SNGDDC+SIG G Y++DIRN+TCGPG HGISIGSLG K
Sbjct  231   SPNTDGIHIENSNSVEIYNSVISNGDDCVSIGPGAYDIDIRNITCGPGGHGISIGSLGEK  290

Query  656   QSRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCS  477
              S ACVSN+ V DS I+ S+NGVRIKTWQGG G+VS VTFDNI +D VRNPII+DQYYC+
Sbjct  291   NSHACVSNVTVRDSFIKFSENGVRIKTWQGGSGSVSGVTFDNIHVDTVRNPIIIDQYYCT  350

Query  476   NKACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRM  297
              K+C N+TSAV+++D+ Y +IKGT+D RSPPM   CS++VPCTNLTLS +EL PS+   +
Sbjct  351   TKSCANKTSAVFVNDIVYQSIKGTYDIRSPPMHFGCSNNVPCTNLTLSNIELLPSKEDIV  410

Query  296   LDPFCWNAYGDLKTVTIPPVFCLLEGNPQS  207
             + PFCWNAYG     ++P + C L+ NP +
Sbjct  411   VGPFCWNAYGITDEFSVPLISC-LKSNPST  439



>gb|AAF79535.1|AC023673_23 F21D18.18 [Arabidopsis thaliana]
Length=492

 Score =   487 bits (1253),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 228/401 (57%), Positives = 297/401 (74%), Gaps = 18/401 (4%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V S+G +GDG  DDT AF+ AW  AC  + + ++LAP+   F I STIF+GPCK  L+F
Sbjct  81    DVTSFGAVGDGSCDDTAAFQDAWKAACAVE-SGVVLAPEGGVFKITSTIFSGPCKPGLVF  139

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++G +MPPDGP+ WP+   K QWLVFYR++G +  G G ++G G+KWW+LPCKPHRG +
Sbjct  140   QLDGVLMPPDGPEEWPEKDNKNQWLVFYRLDGFTFSGKGTVEGNGQKWWDLPCKPHRGPD  199

Query  1004  GTTLPGPCDSP-----------------VAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCH  876
             G++  GPC SP                 + IRFF S+N+ V+ L+I+NSP FH +FD C 
Sbjct  200   GSSSSGPCASPTVSLLKPNQIIKLDRFYLMIRFFMSNNIEVKGLRIQNSPQFHMKFDGCQ  259

Query  875   DVHIDSLYIKAPPNSPNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCG  696
              V I+ + I +P  SPNTDGIH+ NT  V I+NS+VSNGDDCISIG GC +VDI+ +TCG
Sbjct  260   GVLINEIQISSPKLSPNTDGIHLGNTRSVGIYNSVVSNGDDCISIGTGCSDVDIQGVTCG  319

Query  695   PGHGISIGSLGIKQSRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDN  516
             P HGISIGSLG+  S+ACVSNI V ++ IR+SDNG+R+KTWQGG G+VS + F+NI+M+N
Sbjct  320   PSHGISIGSLGVHNSQACVSNITVRNTVIRDSDNGLRVKTWQGGTGSVSNLLFENIQMEN  379

Query  515   VRNPIIVDQYYCSNKACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTL  336
             V N IIVDQYYC +K C N+TSAV + DV Y NIKGT+D RSPP+  ACSD+V CTN+T+
Sbjct  380   VLNCIIVDQYYCQSKDCRNETSAVKVFDVEYRNIKGTYDVRSPPIHFACSDTVACTNITM  439

Query  335   SEVELYPSQGHRMLDPFCWNAYGDLKTVTIPPVFCLLEGNP  213
             SEVEL P +G  + DPFCWNAYG  +T+TIPP+ CLL+G+P
Sbjct  440   SEVELLPEEGELVDDPFCWNAYGKQETLTIPPIDCLLDGSP  480



>ref|XP_004971779.1| PREDICTED: polygalacturonase At1g48100-like [Setaria italica]
Length=521

 Score =   487 bits (1254),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 227/397 (57%), Positives = 296/397 (75%), Gaps = 10/397 (3%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDL--TPILLAPKHHSFLIQSTIFTGPCKNPL  1191
             +V ++G  G+G +DDT AF+ AW  AC S+   T  LL P    F I STIF GPCK+ L
Sbjct  118   DVRAFGASGNGSSDDTRAFRAAWKAACSSNASTTATLLVPPDGVFTITSTIFAGPCKSGL  177

Query  1190  LFQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRG  1011
             +FQI+G +MPPDGP SWP   ++RQW+VFY+ +GM++ G G I+G GE+WW+LPCKPHRG
Sbjct  178   IFQIDGVLMPPDGPASWPATDSRRQWIVFYKADGMTLAGKGTIEGNGEEWWDLPCKPHRG  237

Query  1010  VNGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNS  831
              NG+TLPGPCDSP  IRFF S+ +TV  L+I+NSP FH +FD+C  V +D L++ +P  S
Sbjct  238   PNGSTLPGPCDSPALIRFFLSNGVTVSGLRIENSPQFHLKFDDCVGVLVDGLFVSSPAFS  297

Query  830   PNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQS  651
             PNTDG+H+ENT  V I NS + NGDDC+SIGAGC +V I N+TCG GHGISIGSLG+  +
Sbjct  298   PNTDGVHVENTTAVQIINSRIYNGDDCVSIGAGCSDVHIENITCGHGHGISIGSLGVHNT  357

Query  650   RACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNK  471
             RACVSN+ V ++ I +SDNG+RIKTWQGG GAVS V FD +R+ NV+N I++DQYYC   
Sbjct  358   RACVSNVTVRNARILDSDNGLRIKTWQGGAGAVSGVEFDGVRVQNVKNCIVIDQYYCLGS  417

Query  470   ACTNQTSAVYISDVSYSNIKGTFDAR-SPPMRLACSDSVPCTNLTLSEVELYP-------  315
              C NQTSAV ++ V+Y +I+GT++ R   P+RLACSD+V CT +T+S VEL P       
Sbjct  418   GCANQTSAVRVAGVAYRDIRGTYNPRGGAPIRLACSDAVACTGITMSGVELLPAGSGAGA  477

Query  314   SQGHRMLDPFCWNAYGDLKTVTIPPVFCLLEGNPQSL  204
               G R+ DP+CWNAYG ++T+T+PPV+CL EG P+SL
Sbjct  478   GAGARLADPYCWNAYGLMETLTLPPVYCLQEGRPESL  514



>ref|XP_004967589.1| PREDICTED: polygalacturonase At1g48100-like [Setaria italica]
Length=486

 Score =   486 bits (1250),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 230/384 (60%), Positives = 295/384 (77%), Gaps = 2/384 (1%)
 Frame = -2

Query  1361  VMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLFQ  1182
             V  +G +GDGVADDT A K AWD AC  D   ++LA   +SFL+ +T+FTGPC+  +  Q
Sbjct  92    VKDFGAVGDGVADDTDAIKTAWDTACADDGDGVVLARAGYSFLVHTTVFTGPCQGSVTIQ  151

Query  1181  IEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVNG  1002
             ++GT++ P  PD WP N  KR WLVFY  +G +++G GLIDG+G+ WW LPCK H+G  G
Sbjct  152   LDGTMVAPSDPDKWPAN-NKRNWLVFYNAHGTTLRGAGLIDGKGQNWWELPCKVHKGQGG  210

Query  1001  TTLPG-PCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             ++  G  CDSPV +RFFTS+N+TVQ LK++NSP FHFRFD+C  VH+  L I +P  SPN
Sbjct  211   SSGHGTSCDSPVMLRFFTSNNVTVQGLKVQNSPEFHFRFDSCRGVHVSGLSISSPQGSPN  270

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIH+ENT DV I ++ VSNGDDC+SIGAG  NV I N+TCG GHGISIGSLG + +RA
Sbjct  271   TDGIHVENTQDVLITDTAVSNGDDCVSIGAGTLNVHIENVTCGLGHGISIGSLGKQGTRA  330

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CV+NI V ++ IR+SDNGVRIKTWQGG G+VS V+F+N+RMD VRNPII+DQYYC +K+C
Sbjct  331   CVANITVRNAVIRHSDNGVRIKTWQGGSGSVSSVSFENVRMDAVRNPIIIDQYYCLSKSC  390

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              N T+AV++S VSY+ I+GT+DARS P+   CSD+VPCTN+TLS+VEL P+ G  + DPF
Sbjct  391   ENATTAVFVSGVSYAGIRGTYDARSAPIHFGCSDAVPCTNITLSDVELLPASGQTVDDPF  450

Query  284   CWNAYGDLKTVTIPPVFCLLEGNP  213
             CWN YG+  T T+PPV CL++G P
Sbjct  451   CWNVYGNATTPTVPPVACLMDGVP  474



>ref|XP_006393479.1| hypothetical protein EUTSA_v10011452mg [Eutrema salsugineum]
 gb|ESQ30765.1| hypothetical protein EUTSA_v10011452mg [Eutrema salsugineum]
Length=475

 Score =   479 bits (1234),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 228/384 (59%), Positives = 297/384 (77%), Gaps = 1/384 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V S+G +GDG  DDT AF+ AW  AC  + + ++LAP+   F I STIF+GPCK  L+F
Sbjct  81    DVTSFGAVGDGSCDDTAAFRAAWKAACAVE-SGVVLAPEGGVFKITSTIFSGPCKPGLVF  139

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++G +MPPDGP+ WP+  +K QWLVFYR++G++  G G ++G G+KWW+LPCKPHRG  
Sbjct  140   QLDGVLMPPDGPEEWPEKDSKTQWLVFYRLDGVTFAGKGTVEGNGQKWWDLPCKPHRGPE  199

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G+T  GPC SP  IRFF S+N+ V+ L+I+NSP FH +FD C  V I+ + I +P  SPN
Sbjct  200   GSTSFGPCVSPTMIRFFMSNNIEVKGLRIQNSPQFHMKFDGCEGVLINDIQISSPKLSPN  259

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIH+ NT  V I+NS+VSNGDDCISIG GC ++DI+ +TCGP HGISIGSLG+  S+A
Sbjct  260   TDGIHLGNTRSVGIYNSLVSNGDDCISIGTGCSDIDIQGVTCGPSHGISIGSLGVHNSQA  319

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V ++ IR+SDNG+RIKTWQGG G+VS + F+NI+M+NV N IIVDQYYC +K C
Sbjct  320   CVSNITVRNTAIRDSDNGLRIKTWQGGTGSVSNLLFENIQMENVLNCIIVDQYYCQSKDC  379

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              N+TSAV + D+ Y NIKGT+D RSPP+  ACSD+V CTN+T+SEVEL P +G  + DPF
Sbjct  380   RNETSAVRVFDIEYRNIKGTYDVRSPPIHFACSDTVACTNITMSEVELLPEEGELVDDPF  439

Query  284   CWNAYGDLKTVTIPPVFCLLEGNP  213
             CWNAYG  +T+TIPP+ CLL+G+P
Sbjct  440   CWNAYGTQETLTIPPIDCLLDGSP  463



>ref|XP_008655877.1| PREDICTED: polygalacturonase At1g48100-like [Zea mays]
 gb|AFW80672.1| hypothetical protein ZEAMMB73_326479 [Zea mays]
Length=766

 Score =   486 bits (1252),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 221/393 (56%), Positives = 297/393 (76%), Gaps = 6/393 (2%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSD-LTPILLAPKHHSFLIQSTIFTGPCKNPLL  1188
             +V ++G  G G  +DT A + AW  AC S+  TP LL P    F I STIF GPCK+ + 
Sbjct  367   DVRAFGASGSGSGNDTRALRAAWKAACSSNSTTPTLLVPSDGVFTISSTIFAGPCKSAVT  426

Query  1187  FQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGV  1008
             FQI+G +MPPDGP SWP + +++QW+VFY+ NGM++ G G I+G GE+WW+LPCKPHRG 
Sbjct  427   FQIDGVLMPPDGPASWPASDSRKQWIVFYKANGMTLAGEGTIEGNGEEWWDLPCKPHRGP  486

Query  1007  NGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSP  828
             NG+TLPGPCDSP  +RFF S+++TV+ L+I+NSP FH +FD+C  V +D L++++P  SP
Sbjct  487   NGSTLPGPCDSPALVRFFLSNDVTVRGLRIENSPQFHLKFDDCERVRVDGLFVRSPAFSP  546

Query  827   NTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSR  648
             NTDG+H+ENT  V I NS + NGDDC+SIGAGC +V I N+TCG GHGISIGSLG+  +R
Sbjct  547   NTDGVHVENTTSVQILNSRIYNGDDCVSIGAGCSDVRIENITCGHGHGISIGSLGVHGTR  606

Query  647   ACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKA  468
             ACVSNI V ++ I +SDNGVRIKTWQGG GAV+ V F  ++M NV+N I++DQYYC    
Sbjct  607   ACVSNITVRNARILDSDNGVRIKTWQGGTGAVTAVEFAGVQMQNVKNCILIDQYYCLGSG  666

Query  467   CTNQTSAVYISDVSYSNIKGTFDAR-SPPMRLACSDSVPCTNLTLSEVELYPSQG----H  303
             C N +SAV ++ V+Y +I+GT++ + S P+RLACSD+V CT++T+S VEL P+ G     
Sbjct  667   CANLSSAVRVAGVTYRDIRGTYNPQASAPIRLACSDAVACTDITMSGVELLPASGGGARA  726

Query  302   RMLDPFCWNAYGDLKTVTIPPVFCLLEGNPQSL  204
              + DP+CWNAYG ++T+T+PPV+CL EG P+SL
Sbjct  727   LLADPYCWNAYGVMETLTLPPVYCLQEGRPESL  759



>ref|XP_009366069.1| PREDICTED: polygalacturonase At1g48100-like [Pyrus x bretschneideri]
Length=481

 Score =   476 bits (1225),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 230/399 (58%), Positives = 290/399 (73%), Gaps = 8/399 (2%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLT--PILLAPKHHSFLIQSTIFTGPCKNPL  1191
             NV+ +G  G+GV DDT AFK  W+  CQ++++   + L P + SFLIQ  +F GPCK+ L
Sbjct  89    NVLDFGAQGNGVKDDTEAFKDTWNAVCQAEISTAAMFLVPNNLSFLIQPIVFEGPCKSRL  148

Query  1190  LFQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRG  1011
             +FQIEG +MPPDGPD WP N  ++ WL F  V+ M MQG GL++GRGEKWW+LPCKPH+G
Sbjct  149   VFQIEGALMPPDGPDQWPPNTKRQDWLGFKEVHRMLMQGNGLLNGRGEKWWDLPCKPHKG  208

Query  1010  VNGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNS  831
               G     PCDSP  IRF   S+L V+ L+++NSP  H RFD+C  V ++S+ I +P +S
Sbjct  209   GKG-----PCDSPSIIRFSKGSDLFVRGLRLENSPKIHIRFDSCAHVSVESISIISPEDS  263

Query  830   PNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQS  651
             PNTDGIHIE+T +  IH+S +S GDDC+SIG GCYNVDI  MTCGP HGISIGSLG   S
Sbjct  264   PNTDGIHIEDTTNAEIHHSTISTGDDCVSIGTGCYNVDISYMTCGPSHGISIGSLGKGNS  323

Query  650   RACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNK  471
             +ACV+NI V+DS I+NS+NGVRIKTWQGG G VSKVTF +I MD V NPII++Q+YC  K
Sbjct  324   QACVTNITVSDSIIKNSNNGVRIKTWQGGSGMVSKVTFKDIHMDTVLNPIIINQFYCLKK  383

Query  470   ACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLD  291
              C+NQTSAV I  V +SNI+GT+D+R PPM LACSDS+PC NLTLS + L P+QG   LD
Sbjct  384   QCSNQTSAVLIDSVQFSNIRGTYDSRKPPMHLACSDSLPCKNLTLSGIHLLPAQGGTHLD  443

Query  290   PFCWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC*F  174
              FC  A+G     + P V CL+ G P+ L N +VD+  F
Sbjct  444   SFCSQAFGTKDAFSTPQVPCLMTGYPKGLEN-EVDRSCF  481



>emb|CDY43307.1| BnaC06g01610D [Brassica napus]
Length=473

 Score =   474 bits (1221),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 227/384 (59%), Positives = 294/384 (77%), Gaps = 1/384 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V S+G +GDG  DDT AFK AW  AC  + + ++LAP+   F I STIF+GPCK  L+F
Sbjct  79    DVTSFGAVGDGSCDDTAAFKAAWKAACAVE-SSVVLAPEGGVFKITSTIFSGPCKPGLVF  137

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++G +MPPDGP+ WP+  +K QWLVFYR++G +  G G ++G G+KWW+LPCKPHRG +
Sbjct  138   QLDGVLMPPDGPEEWPEKDSKSQWLVFYRLDGFTFAGKGTVEGNGQKWWDLPCKPHRGPD  197

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G++   PC SP  IRFF S+N+ V  L+I+NSP FH +FD C  V I+ + I +P  SPN
Sbjct  198   GSSSSEPCVSPTMIRFFMSNNIEVGGLRIQNSPQFHMKFDGCEGVSINDIQISSPKLSPN  257

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIH+ NT  V IHNS+VSNGDDCISIG GC ++DI+ +TCGP HGISIGSLG+  S+A
Sbjct  258   TDGIHLGNTRSVAIHNSVVSNGDDCISIGTGCSDIDIQGVTCGPSHGISIGSLGVHNSQA  317

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V ++ IR+SDNG+R+KTWQGG G+VS + F+NI+M+NV N IIVDQYYC +K C
Sbjct  318   CVSNITVRNTVIRDSDNGLRVKTWQGGTGSVSNLLFENIQMENVLNCIIVDQYYCQSKDC  377

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              N+TSAV + DV Y NIKGT+D RS P+  ACSD+V CTN+T+SEVEL P +G  + DPF
Sbjct  378   RNETSAVRVFDVQYRNIKGTYDVRSAPIHFACSDTVACTNITMSEVELLPEEGELVDDPF  437

Query  284   CWNAYGDLKTVTIPPVFCLLEGNP  213
             CWNAYG  +T+TIPP+ CLL+G+P
Sbjct  438   CWNAYGTQETLTIPPIDCLLDGSP  461



>ref|XP_010024842.1| PREDICTED: polygalacturonase At1g48100-like [Eucalyptus grandis]
Length=504

 Score =   475 bits (1222),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 225/379 (59%), Positives = 288/379 (76%), Gaps = 1/379 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V ++G +G+G+ADDT AFK AW  AC  + + ++LAP  ++F I ST F+GPCK  L+F
Sbjct  124   DVTTFGAVGNGLADDTPAFKAAWKAACAVE-SGVVLAPSGYTFAITSTNFSGPCKPGLVF  182

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++G ++ P+GPD WPK  +K+QWL FY++N M++ G G I+G GE WW+LPCKPHRG N
Sbjct  183   QVDGVLLQPNGPDRWPKADSKKQWLRFYQLNNMTLTGKGTIEGNGEPWWDLPCKPHRGPN  242

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             GTTLPGPCDSPV I FF S+NL V  L+I+NSP FH +FD C  V ++ L I +P  SPN
Sbjct  243   GTTLPGPCDSPVMIVFFMSANLAVNRLRIQNSPQFHMKFDVCLGVLVEKLSIYSPKLSPN  302

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHI  T  V I+NS++SNGDDCISIG G  NV I  +TCGP HGISIGSLG   S+A
Sbjct  303   TDGIHIGYTRSVGIYNSMISNGDDCISIGTGSSNVHIEGVTCGPSHGISIGSLGANNSQA  362

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
              VSNI V ++ IR+SDNG+RIKTWQGG G+V+ ++++NIRM NV N IIVDQYYCSNK C
Sbjct  363   WVSNITVRNAVIRDSDNGLRIKTWQGGSGSVTDISYENIRMQNVLNSIIVDQYYCSNKVC  422

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQ+SAVY+S +SY NIKGT++   PP+R ACSD+V CTN+ +SEVEL P  G  + +P+
Sbjct  423   RNQSSAVYVSGLSYRNIKGTYNMIKPPIRFACSDAVGCTNIRISEVELLPHVGDLVDEPY  482

Query  284   CWNAYGDLKTVTIPPVFCL  228
             CWNA+G  +T TIPPV CL
Sbjct  483   CWNAFGVQETPTIPPVACL  501



>gb|KFK36111.1| hypothetical protein AALP_AA4G079500 [Arabis alpina]
Length=466

 Score =   468 bits (1205),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 222/384 (58%), Positives = 294/384 (77%), Gaps = 1/384 (0%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V S+G +GDG  DDT AF+ AW  AC  + + ++LAP+   F I STIF+GPCK  L+F
Sbjct  71    DVTSFGAVGDGSCDDTAAFRDAWKAACAVE-SGVVLAPEGGVFKITSTIFSGPCKPGLVF  129

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q++G +MPPDGP+ WP+  +K QWLVFYR++ ++  G G ++G G+KWW+LPCKPHRG +
Sbjct  130   QLDGVLMPPDGPEEWPEKDSKSQWLVFYRLDSITFAGKGTVEGNGQKWWDLPCKPHRGPD  189

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G++  GPC SP  IRFF S+N+ V+ L+I+NSP FH +FD C  V I+ + I +P  SPN
Sbjct  190   GSSSSGPCVSPTMIRFFMSNNIEVKGLRIQNSPQFHMKFDGCQGVLINEIQISSPKLSPN  249

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIH+ NT  V I+N++VSNGDDCISIG GC ++ I  +TCGP HGISIGSLG+  S+A
Sbjct  250   TDGIHLGNTRSVGIYNTVVSNGDDCISIGTGCSDIAIEGVTCGPSHGISIGSLGVHNSQA  309

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSN+ V ++ IR+SDNG+RIKTWQGG G+VS + F+NI+M+NV N IIVDQYYC +K C
Sbjct  310   CVSNLTVRNTIIRDSDNGLRIKTWQGGTGSVSNLRFENIQMENVLNCIIVDQYYCLSKDC  369

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              N+TSAV + DV Y NIKGT+D RSPP+  ACSD+V CTN+T+SE+EL P +G  + DPF
Sbjct  370   RNETSAVRVYDVEYRNIKGTYDVRSPPIHFACSDTVACTNITMSEIELLPEEGELLDDPF  429

Query  284   CWNAYGDLKTVTIPPVFCLLEGNP  213
             CWNAYG  +T+ IPP+ CLL+G+P
Sbjct  430   CWNAYGTQETLIIPPIDCLLDGSP  453



>ref|XP_008345662.1| PREDICTED: polygalacturonase At1g48100-like [Malus domestica]
Length=497

 Score =   469 bits (1207),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 229/410 (56%), Positives = 293/410 (71%), Gaps = 14/410 (3%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTP--ILLAPKHHSFLIQSTIFTGPCKNPL  1191
             NV+ +G  G+GV DDT AFK  W+  CQ++++   + L P + SFLIQ  +F GPCK+ L
Sbjct  89    NVLDFGAQGNGVKDDTEAFKDTWNAVCQAEISTAVMFLVPNNLSFLIQPIVFEGPCKSRL  148

Query  1190  LFQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRG  1011
             +FQIEGT+MPPDGPD WP N  ++ WL+F  V+ M MQG GL++G+GEKWW+LPCKPH+ 
Sbjct  149   VFQIEGTLMPPDGPDQWPPNTKRQDWLLFKEVHRMLMQGNGLLNGKGEKWWDLPCKPHKN  208

Query  1010  ------VNGTTL-----PGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHI  864
                   +N  ++      G CDSP  IRF   S+L V+ L+++NSP  H RFD+C  V +
Sbjct  209   YMPADDINFVSMLEQGGKGSCDSPSIIRFSKGSDLFVRGLRLENSPKIHIRFDSCEHVSV  268

Query  863   DSLYIKAPPNSPNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHG  684
             +S+ I +P +SPNTDGIHIE+T +  IH+S +S GDDC+SIG GCYNVDI  MTCGP HG
Sbjct  269   ESISIISPEDSPNTDGIHIEDTTNAEIHHSTISTGDDCVSIGTGCYNVDISYMTCGPSHG  328

Query  683   ISIGSLGIKQSRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNP  504
             ISIGSLG   S+ACV+NI V+DS I+NSDNGVRIKTWQGG G VSKVTF +I MD V NP
Sbjct  329   ISIGSLGEGNSQACVTNITVSDSIIKNSDNGVRIKTWQGGSGMVSKVTFKDIHMDTVLNP  388

Query  503   IIVDQYYCSNKACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVE  324
             II++Q+YC  K C+NQTSAV I  V +SNI GT+D+R PP+ LACSDS+PC NLTLS + 
Sbjct  389   IIINQFYCLKKQCSNQTSAVLIDSVQFSNIMGTYDSRKPPIHLACSDSLPCKNLTLSGIH  448

Query  323   LYPSQGHRMLDPFCWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC*F  174
             L P+ G   LDPFC  A+G     + P V CL+ G P+ L N +VD+  F
Sbjct  449   LLPAXGGTHLDPFCSQAFGTKDAFSTPRVPCLMTGYPKGLEN-EVDRSCF  497



>gb|EMT28888.1| Polygalacturonase [Aegilops tauschii]
Length=386

 Score =   461 bits (1187),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 204/327 (62%), Positives = 268/327 (82%), Gaps = 0/327 (0%)
 Frame = -2

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             +++G +MPPDGPD WP +  +RQWL+F  ++G++++G G I+G GE+WWNLPCKPHRG N
Sbjct  51    KVDGVLMPPDGPDCWPPSDNRRQWLIFSNLDGLTLRGAGTIEGNGEEWWNLPCKPHRGPN  110

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G+TL GPCDSP  IRFF SSNL V+ L+++NSP FHFRFD C DV +D L+I++P NSPN
Sbjct  111   GSTLHGPCDSPTLIRFFESSNLVVRGLRVENSPEFHFRFDGCSDVLVDGLFIRSPANSPN  170

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIH+ENT  V I+NS +SNGDDCISIG G Y+VDI+N+TCGPGHGISIGSLG+  S+A
Sbjct  171   TDGIHVENTERVGIYNSKISNGDDCISIGTGSYDVDIQNVTCGPGHGISIGSLGVHNSQA  230

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CV+N+ V ++ IRNSDNG+RIKTWQGG G+VS + FD + M+NVRN II+DQYYC +K C
Sbjct  231   CVANVTVRNAVIRNSDNGLRIKTWQGGMGSVSGIAFDGVTMENVRNCIIIDQYYCQDKRC  290

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQ++AV+++DVSY+N++G++D RS P+  ACSD+VPCTN+T++EVEL P  G  + DP+
Sbjct  291   MNQSTAVHVTDVSYANVRGSYDVRSAPIHFACSDTVPCTNVTMAEVELLPFSGELVDDPY  350

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSL  204
             CW+AYG  +T TIPPV CL +G P+SL
Sbjct  351   CWSAYGAQQTPTIPPVSCLQDGVPESL  377



>gb|KGN45612.1| hypothetical protein Csa_6G000120 [Cucumis sativus]
Length=458

 Score =   463 bits (1191),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 230/395 (58%), Positives = 289/395 (73%), Gaps = 18/395 (5%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V  +G +GDG  DDT AFK AW  AC  + +  LL P +  F I STIF+GPCK  L+F
Sbjct  82    DVTDFGAVGDGCTDDTAAFKAAWKAACAVE-SATLLVPSNLCFKITSTIFSGPCKPGLVF  140

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             +++GT+MPPDGP+SWPK  + RQWLVFYR++ M++ G G I+G G+KWW LPCKPHRG N
Sbjct  141   KVDGTLMPPDGPESWPKADSPRQWLVFYRLDQMTLTGSGTIEGNGQKWWELPCKPHRGPN  200

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G+TLPGPCDSP  IRFF SSNL V  L+I+NSP+FH +FD C  V I+ L I +P  SPN
Sbjct  201   GSTLPGPCDSPALIRFFMSSNLAVNSLRIQNSPMFHMKFDGCEGVLIEKLSISSPKLSPN  260

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRA  645
             TDGIHIENT  V I+NS++SNG                 +TCGP HGISIGSLG+  S+A
Sbjct  261   TDGIHIENTKGVGIYNSMISNG-----------------VTCGPSHGISIGSLGVHNSQA  303

Query  644   CVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKAC  465
             CVSNI V ++ IR+SDNG+RIKTWQGG G+VS + F+NI+M+NVRN IIVDQYYC +K C
Sbjct  304   CVSNITVRNAVIRDSDNGLRIKTWQGGSGSVSDILFENIQMENVRNCIIVDQYYCLSKDC  363

Query  464   TNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPF  285
              NQTSAV+++ V Y NIKGT+D R+ P+  ACSDSV CTN+T+SEVEL P +G  + DPF
Sbjct  364   LNQTSAVFVNQVLYKNIKGTYDVRNTPIHFACSDSVACTNITMSEVELLPHEGELVEDPF  423

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
             CWNA+G  +T+TIPP+ CL EG PQ++       C
Sbjct  424   CWNAFGIQETLTIPPIDCLQEGEPQNVAETSEYSC  458



>ref|XP_003565732.1| PREDICTED: polygalacturonase At1g48100-like [Brachypodium distachyon]
Length=653

 Score =   469 bits (1207),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 219/387 (57%), Positives = 282/387 (73%), Gaps = 15/387 (4%)
 Frame = -2

Query  1322  DTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLFQIEGTIMPPDGPDS  1143
             DT AF+ AW  AC +  +  L+ P    F I ST+F GPCK  L FQI+G +MPPDGP S
Sbjct  261   DTRAFRAAWKAACSAG-SATLVVPSDGVFTITSTVFAGPCKPGLTFQIDGVLMPPDGPAS  319

Query  1142  WPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVNGTTLPGPCDSPVAI  963
             WP+  ++RQW+ FY+ +GM++ G G I+G GE+WWNLPCKPHRG NG+TL  PCDSP  +
Sbjct  320   WPEADSRRQWVTFYKADGMTLNGRGTIEGNGEEWWNLPCKPHRGPNGSTLRVPCDSPALV  379

Query  962   RFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPNTDGIHIENTYDVTI  783
             RFF S+N+TVQ L+I+NSP FH +FD C  V ID L+I +P  SPNTDG+H+ENT  V I
Sbjct  380   RFFASNNVTVQGLRIENSPQFHLKFDGCEQVRIDGLFISSPALSPNTDGVHVENTSSVQI  439

Query  782   HNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRACVSNIKVTDSTIRN  603
             +NS ++NGDDCISIGAGC  V I N+TCG GHGISIGSLG++ +RACVSN+ V ++ I +
Sbjct  440   YNSRINNGDDCISIGAGCSGVHIENVTCGHGHGISIGSLGVRNTRACVSNVTVRNARILD  499

Query  602   SDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKACTNQTSAVYISDVSY  423
             SDNGVRIKTWQGG G+VS V F  +RM+NVRN I++DQYYC+   C NQTSAV ++ V+Y
Sbjct  500   SDNGVRIKTWQGGAGSVSAVEFVGVRMENVRNCIVIDQYYCTGGGCANQTSAVRVAGVTY  559

Query  422   SNIKGTF-------DARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLD-------PF  285
              +I+GT+          +PP+R ACSDSV CT +T+ +VEL P+ G   L+       P+
Sbjct  560   RDIRGTYRPSGSGHGEAAPPIRFACSDSVACTGITMDDVELLPAGGGGSLEAPLGHQPPY  619

Query  284   CWNAYGDLKTVTIPPVFCLLEGNPQSL  204
             CWNAYG + T+T+PPV CL EG P+SL
Sbjct  620   CWNAYGVMATLTVPPVNCLQEGRPESL  646



>emb|CDX95284.1| BnaC09g15860D [Brassica napus]
Length=404

 Score =   454 bits (1167),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 226/386 (59%), Positives = 270/386 (70%), Gaps = 31/386 (8%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSD--LTPILLAPKHHSFLIQSTIFTGPCKNPL  1191
             +V S+G IGD   DDT AF  AWD AC +    + +LL P    FL++ T F GPC+  L
Sbjct  46    DVTSFGAIGDCRTDDTSAFNMAWDTACMTTGVDSAVLLVPYTFCFLVKPTSFNGPCRTRL  105

Query  1190  LFQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRG  1011
               QI+G I+ PDGP SW  N  KRQWL+FY                            RG
Sbjct  106   TLQIDGIIVSPDGPKSWAWNF-KRQWLMFY----------------------------RG  136

Query  1010  VNGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNS  831
             VNGTT PGPCDSPVA+R F SS + ++ L  KNS  FH RFDNC DV +DS+ I AP +S
Sbjct  137   VNGTTQPGPCDSPVAVRIFQSSKVKIKGLAFKNSAQFHVRFDNCDDVVVDSVTINAPASS  196

Query  830   PNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQS  651
             PNTDGIHIENT++V I NS++SNGDDC+SIGAGC+NVDI+N+TCGP HGISIGSLG+  S
Sbjct  197   PNTDGIHIENTHNVQIRNSVISNGDDCVSIGAGCFNVDIKNITCGPSHGISIGSLGVHNS  256

Query  650   RACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNK  471
              A VSNI VT+STI NSDNGVRIKTWQGG G VS++ F NI M NVRN I++DQYYC  K
Sbjct  257   SAWVSNITVTNSTIWNSDNGVRIKTWQGGSGLVSRIVFRNILMVNVRNAIMIDQYYCQTK  316

Query  470   ACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLD  291
              C NQTSAV ISDV Y+NIKG++D RSPPM   CSDS PCTNL L +V+L+P +G    +
Sbjct  317   NCANQTSAVIISDVLYANIKGSYDLRSPPMHFGCSDSFPCTNLRLEDVDLFPYKGQLFEN  376

Query  290   PFCWNAYGDLKTVTIPPVFCLLEGNP  213
             PFCWNAYG ++TVT+PP+ CLLE  P
Sbjct  377   PFCWNAYGSMQTVTVPPINCLLEALP  402



>tpg|DAA54465.1| TPA: polygalacturonase [Zea mays]
Length=502

 Score =   454 bits (1168),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 223/394 (57%), Positives = 295/394 (75%), Gaps = 7/394 (2%)
 Frame = -2

Query  1364  NVMSYGGIGDG--VADDTLAFKRAWDEACQSDLTP-ILLAPKHHSFLIQSTIFTGPCKNP  1194
             +V ++G  GDG  V DDT AF+ AW  AC SD     LL P    F I STIF+GPCK  
Sbjct  102   DVRAFGASGDGSCVDDDTAAFRAAWKAACSSDSAAATLLVPSDGVFTIASTIFSGPCKPD  161

Query  1193  LLFQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHR  1014
             L FQI+G +MPPDGP SWP   +++QW+VFY+ + +++ G G I+G GE+WW+LPCKPHR
Sbjct  162   LTFQIDGVLMPPDGPASWPATDSRKQWIVFYKADRLTLAGEGTIEGNGEEWWDLPCKPHR  221

Query  1013  GVNGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPN  834
             G NG+TL GPCDSP  IRFF+S+++TV  L+I+NSP FH RFD+C  V +D L++ +P +
Sbjct  222   GPNGSTLRGPCDSPALIRFFSSNDVTVCGLRIENSPQFHLRFDDCERVRVDGLFVSSPAS  281

Query  833   SPNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQ  654
             SPNTDG+H+ENT  V I NS + NGDDC+SIGAGC +V + N+TCG GHGISIGSLG+  
Sbjct  282   SPNTDGVHVENTKSVQILNSRIYNGDDCVSIGAGCSDVHVENITCGHGHGISIGSLGVHN  341

Query  653   SRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSN  474
             + ACVSN+ V +  I +SDNGVRIKTWQGG GAVS V F  ++M NV+N I++DQYYC  
Sbjct  342   THACVSNVTVRNVRILDSDNGVRIKTWQGGAGAVSAVEFTGVQMQNVKNCIVIDQYYCLG  401

Query  473   KACTNQTSAVYISDVSYSNIKGTFDARS-PPMRLACSDSVPCTNLTLSEVELYPS---QG  306
               C NQTSAV ++ V+Y +I GT++ ++  P+RLACSD+V CT++T+S VEL P+    G
Sbjct  402   HGCANQTSAVRVAGVAYRDIHGTYNPQAGAPIRLACSDAVACTDITMSGVELLPAGGDDG  461

Query  305   HRMLDPFCWNAYGDLKTVTIPPVFCLLEGNPQSL  204
               + DP+CWNAYG ++T+T+PPV+CLLEG+P+SL
Sbjct  462   ALLADPYCWNAYGVMETLTLPPVYCLLEGSPESL  495



>ref|NP_001132604.2| uncharacterized protein LOC100194076 [Zea mays]
 gb|ACG42119.1| polygalacturonase [Zea mays]
Length=502

 Score =   454 bits (1168),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 223/394 (57%), Positives = 295/394 (75%), Gaps = 7/394 (2%)
 Frame = -2

Query  1364  NVMSYGGIGDG--VADDTLAFKRAWDEACQSDLTP-ILLAPKHHSFLIQSTIFTGPCKNP  1194
             +V ++G  GDG  V DDT AF+ AW  AC SD     LL P    F I STIF+GPCK  
Sbjct  102   DVRAFGASGDGSCVDDDTAAFRAAWKAACSSDSAAATLLVPSDGVFTIASTIFSGPCKPD  161

Query  1193  LLFQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHR  1014
             L FQI+G +MPPDGP SWP   +++QW+VFY+ + +++ G G I+G GE+WW+LPCKPHR
Sbjct  162   LTFQIDGVLMPPDGPASWPATDSRKQWIVFYKADRLTLAGEGTIEGNGEEWWDLPCKPHR  221

Query  1013  GVNGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPN  834
             G NG+TL GPCDSP  IRFF+S+++TV  L+I+NSP FH RFD+C  V +D L++ +P +
Sbjct  222   GPNGSTLRGPCDSPALIRFFSSNDVTVCGLRIENSPQFHLRFDDCERVRVDGLFVSSPAS  281

Query  833   SPNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQ  654
             SPNTDG+H+ENT  V I NS + NGDDC+SIGAGC +V + N+TCG GHGISIGSLG+  
Sbjct  282   SPNTDGVHVENTKSVQILNSRIYNGDDCVSIGAGCSDVHVENITCGHGHGISIGSLGVHN  341

Query  653   SRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSN  474
             + ACVSN+ V +  I +SDNGVRIKTWQGG GAVS V F  ++M NV+N I++DQYYC  
Sbjct  342   THACVSNVTVRNVRILDSDNGVRIKTWQGGAGAVSAVEFTGVQMQNVKNCIVIDQYYCLG  401

Query  473   KACTNQTSAVYISDVSYSNIKGTFDARS-PPMRLACSDSVPCTNLTLSEVELYPS---QG  306
               C NQTSAV ++ V+Y +I GT++ ++  P+RLACSD+V CT++T+S VEL P+    G
Sbjct  402   HGCANQTSAVRVAGVAYRDIHGTYNPQAGAPIRLACSDAVACTDITMSGVELLPAGGDDG  461

Query  305   HRMLDPFCWNAYGDLKTVTIPPVFCLLEGNPQSL  204
               + DP+CWNAYG ++T+T+PPV+CLLEG+P+SL
Sbjct  462   ALLADPYCWNAYGVMETLTLPPVYCLLEGSPESL  495



>ref|XP_002455572.1| hypothetical protein SORBIDRAFT_03g013310 [Sorghum bicolor]
 gb|EES00692.1| hypothetical protein SORBIDRAFT_03g013310 [Sorghum bicolor]
Length=693

 Score =   460 bits (1183),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 219/423 (52%), Positives = 293/423 (69%), Gaps = 36/423 (9%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLT-PILLAPKHHSFLIQSTIFTGPCKNPLL  1188
             +V ++G  G+   +DT AF+ AW  AC S+ T   LL P    F I STIF GPCK+ L 
Sbjct  264   DVRAFGASGNASGNDTRAFRAAWKAACSSNTTTATLLVPSDGVFTISSTIFAGPCKSALT  323

Query  1187  FQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGV  1008
             FQI+G +MPPDGP SWP + +++QW+VFY+ +GM++ G G I+G GE+WW+LPCKPHRG 
Sbjct  324   FQIDGVLMPPDGPASWPASDSRKQWIVFYKADGMTLAGEGTIEGNGEEWWDLPCKPHRGP  383

Query  1007  NGTTLPGPCDSPVA------------------------IRFFTSSNLTVQDLKIKNSPLF  900
             NG+TLPGPCDSP                          +RFF+S+++ V+ L+I+NSP F
Sbjct  384   NGSTLPGPCDSPAVSKLADHMDFTLFFVHVLGLTLFLLVRFFSSNDVAVRGLRIENSPQF  443

Query  899   HFRFDNCHDVHIDSLYIKAPPNSPNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNV  720
             H +FD C  V +D L++ +P +SPNTDG+H+ENT  V I NS + NGDDC+SIGAGC +V
Sbjct  444   HLKFDACDRVRVDGLFVSSPASSPNTDGVHVENTTSVQILNSRIYNGDDCVSIGAGCSDV  503

Query  719   DIRNMTCGPGHGISIGSLGIKQSRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVT  540
              I N+TCG GHGISIGSLG+  +RACVSN+ V ++ I +SDNGVRIKTWQGG GAVS V 
Sbjct  504   HIENITCGHGHGISIGSLGVHNTRACVSNVTVRNARIVDSDNGVRIKTWQGGTGAVSAVE  563

Query  539   FDNIRMDNVRNPIIVDQYYCSNKACTNQTSAVYISDVSYSNIKGTFD--ARSPPMRLACS  366
             F  ++M NV+N I++DQYYC    C NQTSAV ++ V+Y +I+GT++  A   P+RLACS
Sbjct  564   FAGVQMQNVKNCIVIDQYYCLGSGCANQTSAVRVAGVTYRDIRGTYNPQAAGAPIRLACS  623

Query  365   DSVPCTNLTLSEVE---------LYPSQGHRMLDPFCWNAYGDLKTVTIPPVFCLLEGNP  213
             D+V CT++T+S VE              G  + DP+CWNAYG ++T+T+PPV+CL EG P
Sbjct  624   DAVACTDITMSGVELLPASGGGGGGGRAGALLADPYCWNAYGVMETLTLPPVYCLQEGRP  683

Query  212   QSL  204
             +SL
Sbjct  684   ESL  686



>ref|XP_002455574.1| hypothetical protein SORBIDRAFT_03g013330 [Sorghum bicolor]
 gb|EES00694.1| hypothetical protein SORBIDRAFT_03g013330 [Sorghum bicolor]
Length=548

 Score =   454 bits (1167),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 215/405 (53%), Positives = 287/405 (71%), Gaps = 33/405 (8%)
 Frame = -2

Query  1319  TLAFKRAWDEACQSD-LTPILLAPKHHSFLIQSTIFTGPCKNPLLFQIEGTIMPPDGPDS  1143
             T AF+ AW  AC SD  T  LL P    F I STIF+GPCK  L FQI+G +MPPDGP S
Sbjct  137   TPAFRAAWKAACSSDSATATLLVPSDGVFTITSTIFSGPCKPDLTFQIDGVLMPPDGPAS  196

Query  1142  WPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVNGTTLPGPCDSPVAI  963
             WP   +++QW+VFY+ + +++ G G I+G GE+WW+LPCKPHRG NG+TLPGPCDSP  I
Sbjct  197   WPATDSRKQWIVFYKADRLTLAGEGTIEGNGEEWWDLPCKPHRGPNGSTLPGPCDSPALI  256

Query  962   RFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPNTDGIHIENTYDVTI  783
             RFF S+++TV  L+I+NSP FH RFD+C  V +D L++ +P +SPNTDG+H+ENT  V I
Sbjct  257   RFFLSNDVTVCGLRIENSPQFHLRFDDCERVRVDGLFVSSPASSPNTDGVHVENTTSVQI  316

Query  782   HNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGI--------------------------  681
              NS + NGDDC+SIGAGC +V + N+TCG GHGI                          
Sbjct  317   LNSRIYNGDDCVSIGAGCSDVHVENITCGHGHGIRYLSVSHSATCFHGGTSPDAAKLCSH  376

Query  680   --SIGSLGIKQSRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRN  507
               SIGSLG+  + ACVSNI V ++ I +SDNG+RIKTWQGG GAV+ V F  ++M NV++
Sbjct  377   RRSIGSLGVHNTHACVSNITVRNARILDSDNGLRIKTWQGGTGAVTAVEFAGVQMQNVKS  436

Query  506   PIIVDQYYCSNKACTNQTSAVYISDVSYSNIKGTFDARS-PPMRLACSDSVPCTNLTLSE  330
              I++DQYYC    C NQTSAV ++ V+Y +I GT++ ++  P+RLACSD+V CT++T+S 
Sbjct  437   CIVIDQYYCLGHGCANQTSAVRVAGVTYRDIHGTYNPQAGAPIRLACSDAVACTDITMSG  496

Query  329   VELYPS---QGHRMLDPFCWNAYGDLKTVTIPPVFCLLEGNPQSL  204
             VEL P+   +G  + DP+CWNAYG ++T+T+PPV+CLLEG+P+SL
Sbjct  497   VELLPAGGDEGALLADPYCWNAYGVMETLTLPPVYCLLEGSPESL  541



>ref|XP_010322290.1| PREDICTED: polygalacturonase At1g48100 isoform X2 [Solanum lycopersicum]
Length=368

 Score =   436 bits (1122),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 205/293 (70%), Positives = 246/293 (84%), Gaps = 2/293 (1%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V S+G +GDGV DDT  FK AWD ACQ   + ++  P  +SF+IQSTIFTGPC++ L+F
Sbjct  74    DVRSFGAVGDGVTDDTEGFKAAWDAACQVQ-SAVIHVPLGYSFMIQSTIFTGPCQSGLVF  132

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             Q+EGTIMPPDGP+SWP   +KRQWLVFYRVN +S+QGGG+IDGRGE+WWNLPCKPH+G  
Sbjct  133   QLEGTIMPPDGPESWPSKTSKRQWLVFYRVNELSLQGGGVIDGRGEEWWNLPCKPHKGPK  192

Query  1004  GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPN  825
             G+TLPGPCDSP+AIRFF SSNLTVQ +K+KNSP F+FRFDNC +VHI+SL+I AP  SPN
Sbjct  193   GSTLPGPCDSPIAIRFFMSSNLTVQGIKMKNSPQFNFRFDNCKNVHIESLHITAPIWSPN  252

Query  824   TDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGP-GHGISIGSLGIKQSR  648
             TDGIHIE T +V I++S++SNGDDC+SIGAGCY+VDIRN+TCGP GHGISIGSLG   SR
Sbjct  253   TDGIHIEQTSNVEIYDSLISNGDDCVSIGAGCYDVDIRNLTCGPGGHGISIGSLGNHNSR  312

Query  647   ACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQ  489
             ACVSNI V DS I+ SDNGVRIKTWQGGFGAVS V+F NI MDN+ N  ++ +
Sbjct  313   ACVSNITVRDSVIKQSDNGVRIKTWQGGFGAVSGVSFLNIHMDNILNTQVLKE  365



>ref|NP_001042921.1| Os01g0329300 [Oryza sativa Japonica Group]
 dbj|BAD54709.1| putative polygalacturonase PG2 [Oryza sativa Japonica Group]
 dbj|BAF04835.1| Os01g0329300 [Oryza sativa Japonica Group]
Length=759

 Score =   447 bits (1150),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 215/407 (53%), Positives = 285/407 (70%), Gaps = 21/407 (5%)
 Frame = -2

Query  1364  NVMSYGGIGDGVA--DDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPL  1191
             +V ++G  G+G +   DT AF+ AW  AC ++   +L+ P    F I STIF GPCK  L
Sbjct  347   DVRAFGATGNGSSADGDTRAFRAAWKAACSAESATVLV-PSDGVFTITSTIFAGPCKPGL  405

Query  1190  LFQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRG  1011
              FQI+G +MPPDGP SWP    +RQW+VFYR +GM++ G G I+G GE+WWNLPCKPHRG
Sbjct  406   TFQIDGVLMPPDGPASWPAADGRRQWIVFYRADGMTLSGKGTIEGNGEEWWNLPCKPHRG  465

Query  1010  VNGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNS  831
              NG+TLPGPC+SP  I+F  SS+++VQ L+++NSP FH +FD C  V +D L + +P +S
Sbjct  466   PNGSTLPGPCESPALIKFVASSDVSVQGLRMENSPQFHLKFDGCSRVLVDGLVVSSPASS  525

Query  830   PNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQS  651
             PNTDG+H+ENT  V I NS +SNGDDC+SIG GC  V + N+TC  GHGISIG LG + +
Sbjct  526   PNTDGVHVENTSSVRILNSRISNGDDCVSIGGGCSGVRVENVTCVHGHGISIGGLGARGA  585

Query  650   RACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYC---  480
             RACVSN+ V  + + +SDNGVRIKTWQGG G+VS V FD ++M NVR  I++DQYYC   
Sbjct  586   RACVSNVTVRGARVVDSDNGVRIKTWQGGAGSVSGVVFDAVQMVNVRGCIVIDQYYCDAH  645

Query  479   --SNKACTNQTSAVYISDVSYSNIKGTFDAR---SPPMRLACSDSVPCTNLTLSEVELYP  315
               +   C NQT+AV +  V+Y  I+GT++ R     P+R ACSD+V CT +T+++VEL P
Sbjct  646   GGAGAGCANQTAAVRVDGVAYRGIRGTYNPRGGGGAPVRFACSDTVACTGITMTDVELLP  705

Query  314   ----------SQGHRMLDPFCWNAYGDLKTVTIPPVFCLLEGNPQSL  204
                       S G ++ DP+CWNAYG ++T+T PPV CL EG P+SL
Sbjct  706   AGGGDEGGGASAGAKLADPYCWNAYGVMETLTQPPVHCLQEGRPESL  752



>gb|ACN29256.1| unknown [Zea mays]
Length=332

 Score =   416 bits (1070),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 188/325 (58%), Positives = 253/325 (78%), Gaps = 4/325 (1%)
 Frame = -2

Query  1166  MPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVNGTTLPG  987
             MPPDGP SWP   +++QW+VFY+ + +++ G G I+G GE+WW+LPCKPHRG NG+TL G
Sbjct  1     MPPDGPASWPATDSRKQWIVFYKADRLTLAGEGTIEGNGEEWWDLPCKPHRGPNGSTLRG  60

Query  986   PCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPNTDGIHI  807
             PCDSP  IRFF+S+++TV  L+I+NSP FH RFD+C  V +D L++ +P +SPNTDG+H+
Sbjct  61    PCDSPALIRFFSSNDVTVCGLRIENSPQFHLRFDDCERVRVDGLFVSSPASSPNTDGVHV  120

Query  806   ENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSRACVSNIK  627
             ENT  V I NS + NGDDC+SIGAGC +V + N+TCG GHGISIGSLG+  + ACVSN+ 
Sbjct  121   ENTKSVQILNSRIYNGDDCVSIGAGCSDVHVENITCGHGHGISIGSLGVHNTHACVSNVT  180

Query  626   VTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKACTNQTSA  447
             V +  I +SDNGVRIKTWQGG GAVS V F  ++M NV+N I++DQYYC    C NQTSA
Sbjct  181   VRNVRILDSDNGVRIKTWQGGAGAVSAVEFTGVQMQNVKNCIVIDQYYCLGHGCANQTSA  240

Query  446   VYISDVSYSNIKGTFDARS-PPMRLACSDSVPCTNLTLSEVELYPS---QGHRMLDPFCW  279
             V ++ V+Y +I GT++ ++  P+RLACSD+V CT++T+S VEL P+    G  + DP+CW
Sbjct  241   VRVAGVAYRDIHGTYNPQAGAPIRLACSDAVACTDITMSGVELLPAGGDDGALLADPYCW  300

Query  278   NAYGDLKTVTIPPVFCLLEGNPQSL  204
             NAYG ++T+T+PPV+CLLEG+P+SL
Sbjct  301   NAYGVMETLTLPPVYCLLEGSPESL  325



>gb|EEE54470.1| hypothetical protein OsJ_01569 [Oryza sativa Japonica Group]
Length=760

 Score =   428 bits (1100),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 211/408 (52%), Positives = 280/408 (69%), Gaps = 22/408 (5%)
 Frame = -2

Query  1364  NVMSYGGIGDGVA--DDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPL  1191
             +V ++G  G+G +   DT AF+ AW  AC ++   +L+ P    F I STIF GPCK  L
Sbjct  347   DVRAFGATGNGSSADGDTRAFRAAWKAACSAESATVLV-PSDGVFTITSTIFAGPCKPGL  405

Query  1190  LFQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRG  1011
              FQI+G +MPPDGP SWP    +RQW+VFYR +GM++ G G I+G GE+WWNLPCKPHRG
Sbjct  406   TFQIDGVLMPPDGPASWPAADGRRQWIVFYRADGMTLSGKGTIEGNGEEWWNLPCKPHRG  465

Query  1010  VNGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNS  831
              NG+TLPGPC+SP  I+F  SS+++VQ L+++NSP FH +FD C  V +D L + +P +S
Sbjct  466   PNGSTLPGPCESPALIKFVASSDVSVQGLRMENSPQFHLKFDGCSRVLVDGLVVSSPASS  525

Query  830   PNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQS  651
             PNTDG+H+ENT  V I NS +SNGDDC+SIG GC  V + N+TC  GHGISIG LG + +
Sbjct  526   PNTDGVHVENTSSVRILNSRISNGDDCVSIGGGCSGVRVENVTCVHGHGISIGGLGARGA  585

Query  650   RACVSNI-KVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYC--  480
             RACVSN+ +   +  R    GVRIKTWQGG G+VS V FD ++M NVR  I++D YYC  
Sbjct  586   RACVSNVTRARRARRRTPTTGVRIKTWQGGAGSVSGVVFDAVQMVNVRGCIVIDPYYCDA  645

Query  479   ---SNKACTNQTSAVYISDVSYSNIKGTFDAR---SPPMRLACSDSVPCTNLTLSEVELY  318
                +   C NQT+AV +  V+Y  I+GT++ R     P+R ACSD+V CT +T+++VEL 
Sbjct  646   HGGAGAGCANQTAAVRVDGVAYRGIRGTYNPRGGGGAPVRFACSDTVACTGITMTDVELL  705

Query  317   P----------SQGHRMLDPFCWNAYGDLKTVTIPPVFCLLEGNPQSL  204
             P          S G ++ DP+CWNAYG ++T+T PPV CL EG P+SL
Sbjct  706   PAGGGDEGGGASAGAKLADPYCWNAYGVMETLTQPPVHCLQEGRPESL  753



>ref|XP_008364018.1| PREDICTED: polygalacturonase At1g48100-like [Malus domestica]
Length=341

 Score =   400 bits (1028),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 196/342 (57%), Positives = 245/342 (72%), Gaps = 12/342 (4%)
 Frame = -2

Query  1166  MPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRG------VN  1005
             MPPDGPD WP N  ++ WL+F  V+ M MQG GL++GRGEKWW+LPCKPH+       +N
Sbjct  1     MPPDGPDQWPPNTKRQDWLLFKEVHRMLMQGNGLLNGRGEKWWDLPCKPHKNYMPADDIN  60

Query  1004  GTTL-----PGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAP  840
               ++      G CDSP  IRF   S+L V+ L+++NSP  H RFD+C  V ++S+ I +P
Sbjct  61    FVSMLEQGGKGSCDSPSIIRFSKGSDLFVRGLRLENSPKIHIRFDSCEHVSVESISIISP  120

Query  839   PNSPNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGI  660
              +SPNTDGIHIE+T +  IH+S +S GDDC+SIG GCYNVDI  MTCGP HGISIGSLG 
Sbjct  121   EDSPNTDGIHIEDTTNAEIHHSTISTGDDCVSIGTGCYNVDISYMTCGPSHGISIGSLGE  180

Query  659   KQSRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYC  480
               S+ACV+NI V+DS I+NSDNGVRIKTWQGG G VSKVTF +I MD V NPII++Q+YC
Sbjct  181   GNSQACVTNITVSDSIIKNSDNGVRIKTWQGGSGMVSKVTFKDIHMDTVLNPIIINQFYC  240

Query  479   SNKACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHR  300
               K C+NQTSAV I  V +SNI GT+D+R PP+ LACSDS+PC NLTLS + L P+ G  
Sbjct  241   LKKQCSNQTSAVLIDSVXFSNIMGTYDSRKPPIHLACSDSLPCKNLTLSGIHLLPAXGGT  300

Query  299   MLDPFCWNAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC*F  174
              LDPFC  A+G     + P V CL+ G P+ L N +VD+  F
Sbjct  301   HLDPFCSQAFGTKDAFSTPRVPCLMTGYPKGLEN-EVDRSCF  341



>tpg|DAA54467.1| TPA: hypothetical protein ZEAMMB73_770856 [Zea mays]
Length=367

 Score =   399 bits (1026),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 188/360 (52%), Positives = 253/360 (70%), Gaps = 39/360 (11%)
 Frame = -2

Query  1166  MPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVNGTTLPG  987
             MPPDGP SWP   +++QW+VFY+ + +++ G G I+G GE+WW+LPCKPHRG NG+TL G
Sbjct  1     MPPDGPASWPATDSRKQWIVFYKADRLTLAGEGTIEGNGEEWWDLPCKPHRGPNGSTLRG  60

Query  986   PCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPNTDGIHI  807
             PCDSP  IRFF+S+++TV  L+I+NSP FH RFD+C  V +D L++ +P +SPNTDG+H+
Sbjct  61    PCDSPALIRFFSSNDVTVCGLRIENSPQFHLRFDDCERVRVDGLFVSSPASSPNTDGVHV  120

Query  806   ENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGI------------------  681
             ENT  V I NS + NGDDC+SIGAGC +V + N+TCG GHGI                  
Sbjct  121   ENTKSVQILNSRIYNGDDCVSIGAGCSDVHVENITCGHGHGIRYLSVCHSLTHQRASMAR  180

Query  680   -----------------SIGSLGIKQSRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAV  552
                              SIGSLG+  + ACVSN+ V +  I +SDNGVRIKTWQGG GAV
Sbjct  181   GTVCSEPDAASCCCHPRSIGSLGVHNTHACVSNVTVRNVRILDSDNGVRIKTWQGGAGAV  240

Query  551   SKVTFDNIRMDNVRNPIIVDQYYCSNKACTNQTSAVYISDVSYSNIKGTFDARS-PPMRL  375
             S V F  ++M NV+N I++DQYYC    C NQTSAV ++ V+Y +I GT++ ++  P+RL
Sbjct  241   SAVEFTGVQMQNVKNCIVIDQYYCLGHGCANQTSAVRVAGVAYRDIHGTYNPQAGAPIRL  300

Query  374   ACSDSVPCTNLTLSEVELYPS---QGHRMLDPFCWNAYGDLKTVTIPPVFCLLEGNPQSL  204
             ACSD+V CT++T+S VEL P+    G  + DP+CWNAYG ++T+T+PPV+CLLEG+P+SL
Sbjct  301   ACSDAVACTDITMSGVELLPAGGDDGALLADPYCWNAYGVMETLTLPPVYCLLEGSPESL  360



>gb|EEC70551.1| hypothetical protein OsI_01700 [Oryza sativa Indica Group]
Length=783

 Score =   412 bits (1059),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 194/363 (53%), Positives = 258/363 (71%), Gaps = 11/363 (3%)
 Frame = -2

Query  1364  NVMSYGGIGDGVA--DDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPL  1191
             +V ++G  G+G +   DT AF+ AW  AC ++   +L+ P    F I STIF GPCK  L
Sbjct  347   DVRAFGATGNGSSADGDTRAFRAAWKAACSAESATVLV-PSDGVFTITSTIFAGPCKPGL  405

Query  1190  LFQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRG  1011
              FQI+G +MPPDGP SWP    +RQW+VFYR +GM++ G G I+G GE+WWNLPCKPHRG
Sbjct  406   TFQIDGVLMPPDGPASWPAADGRRQWIVFYRADGMTLSGKGTIEGNGEEWWNLPCKPHRG  465

Query  1010  VNGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNS  831
              NG+TLPGPC+SP  I+F  SS+++VQ L+++NSP FH +FD C  V +D L + +P +S
Sbjct  466   PNGSTLPGPCESPALIKFVASSDVSVQGLRMENSPQFHLKFDGCSRVLVDGLVVSSPASS  525

Query  830   PNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQS  651
             PNTDG+H+ENT  V I NS +SNGDDC+SIG GC  V + N+TC  GHGISIG LG + +
Sbjct  526   PNTDGVHVENTSSVRILNSRISNGDDCVSIGGGCSGVRVENVTCVHGHGISIGGLGARGA  585

Query  650   RACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYC---  480
             RACVSN+ V  + + +SDNGVRIKTWQGG G+VS V FD ++M NVR  I++DQYYC   
Sbjct  586   RACVSNVTVRGARVVDSDNGVRIKTWQGGAGSVSGVVFDAVQMVNVRGCIVIDQYYCDAH  645

Query  479   --SNKACTNQTSAVYISDVSYSNIKGTFDAR---SPPMRLACSDSVPCTNLTLSEVELYP  315
               +   C NQT+AV +  V+Y  I+GT++ R     P+R ACSD+V CT +T+++VEL P
Sbjct  646   GGAGAGCANQTAAVRVDGVAYRGIRGTYNPRGGGGAPVRFACSDTVACTGITMTDVELLP  705

Query  314   SQG  306
             + G
Sbjct  706   AGG  708



>emb|CDY67535.1| BnaAnng24580D [Brassica napus]
Length=311

 Score =   392 bits (1006),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 183/273 (67%), Positives = 225/273 (82%), Gaps = 1/273 (0%)
 Frame = -2

Query  995  LPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPNTDG  816
            + GPCDSP+A+RFF SSNLTV+ L+IKNSP FHFRFD C  VH++SL+I APP SPNTDG
Sbjct  36   VAGPCDSPIALRFFMSSNLTVEGLQIKNSPQFHFRFDGCQGVHVESLHITAPPLSPNTDG  95

Query  815  IHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPG-HGISIGSLGIKQSRACV  639
            IHIEN+  VTI+NS++SNGDDC+SIG+G Y+VDIRN+TCGPG HGISIGSLG   S ACV
Sbjct  96   IHIENSNSVTIYNSVISNGDDCVSIGSGSYDVDIRNLTCGPGGHGISIGSLGNHNSHACV  155

Query  638  SNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKACTN  459
            SNI V DS I+ SDNGVRIKTWQGGFG+VS VTF+NI +++VRNPII+DQYYC  K C N
Sbjct  156  SNITVRDSVIKYSDNGVRIKTWQGGFGSVSGVTFNNIHVESVRNPIIIDQYYCMTKDCAN  215

Query  458  QTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPFCW  279
            +TSAV++SD++Y  IKGT+D RSPPM   CSD+VPCTNLTLS +EL P +G  ++DPFCW
Sbjct  216  KTSAVFVSDITYQGIKGTYDIRSPPMHFGCSDAVPCTNLTLSGIELLPEKGEIVVDPFCW  275

Query  278  NAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
            NAYG ++ ++IPPV+CL+   P +L    VD+C
Sbjct  276  NAYGIVEELSIPPVWCLMSDPPTALQGALVDKC  308



>emb|CDY67338.1| BnaCnng54560D [Brassica napus]
Length=311

 Score =   389 bits (999),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 181/273 (66%), Positives = 226/273 (83%), Gaps = 1/273 (0%)
 Frame = -2

Query  995  LPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSPNTDG  816
            + GPCDSP+A+RFF SSNLTV+ L+IKNSP FHFRFD C  VH++SL+I APP SPNTDG
Sbjct  36   VAGPCDSPIALRFFMSSNLTVEGLQIKNSPQFHFRFDGCQGVHVESLHITAPPLSPNTDG  95

Query  815  IHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPG-HGISIGSLGIKQSRACV  639
            IHIEN+  VTI+NS++SNGDDC+SIG+G Y+VDIRN+TCGPG HGISIGSLG   S ACV
Sbjct  96   IHIENSNSVTIYNSVISNGDDCVSIGSGSYDVDIRNLTCGPGGHGISIGSLGNHNSHACV  155

Query  638  SNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKACTN  459
            SNI V DS I+ S+NGVRIKTWQGGFG+VS VTF+NI +++VRNPII+DQYYC  K C N
Sbjct  156  SNITVRDSVIKYSNNGVRIKTWQGGFGSVSGVTFNNIHVESVRNPIIIDQYYCMTKDCAN  215

Query  458  QTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLDPFCW  279
            +TSAV++SD++Y  IKGT+D RSPPM   CSD+VPCTNLTLS +EL P++G  ++DPFCW
Sbjct  216  KTSAVFVSDITYQGIKGTYDIRSPPMHFGCSDAVPCTNLTLSGIELLPAKGEIVVDPFCW  275

Query  278  NAYGDLKTVTIPPVFCLLEGNPQSLPNVDVDQC  180
            NAYG ++ ++IPPV+CL+   P +L    V++C
Sbjct  276  NAYGIVEELSIPPVWCLMSDPPTALQGALVNKC  308



>gb|KCW58651.1| hypothetical protein EUGRSUZ_H01308 [Eucalyptus grandis]
Length=246

 Score =   372 bits (954),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 173/245 (71%), Positives = 205/245 (84%), Gaps = 0/245 (0%)
 Frame = -2

Query  914  NSPLFHFRFDNCHDVHIDSLYIKAPPNSPNTDGIHIENTYDVTIHNSIVSNGDDCISIGA  735
            NSP FHFRFD C +V I+SL IKAP  SPNTDGIHIEN+ +V I+NS++SNGDDC+SIGA
Sbjct  2    NSPQFHFRFDGCRNVLIESLSIKAPSQSPNTDGIHIENSNNVGIYNSMISNGDDCVSIGA  61

Query  734  GCYNVDIRNMTCGPGHGISIGSLGIKQSRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGA  555
              Y+VDIRN+TCGP HGISIGSLG++ S ACVSNI VTDS I++SDNGVRIKTWQGG GA
Sbjct  62   STYDVDIRNITCGPSHGISIGSLGVRNSHACVSNITVTDSVIKHSDNGVRIKTWQGGSGA  121

Query  554  VSKVTFDNIRMDNVRNPIIVDQYYCSNKACTNQTSAVYISDVSYSNIKGTFDARSPPMRL  375
            VS VTF+NI MD VRNPII+DQYYC  K C NQTSAVY+SD+ YSNIKGT+DARSPPM  
Sbjct  122  VSHVTFNNIHMDTVRNPIIIDQYYCLAKNCANQTSAVYVSDILYSNIKGTYDARSPPMHF  181

Query  374  ACSDSVPCTNLTLSEVELYPSQGHRMLDPFCWNAYGDLKTVTIPPVFCLLEGNPQSLPNV  195
             CSD++PCTNLTLS++EL P+QG  +L+PFCWNAYG ++T+TIPP  CL+EG P+ +   
Sbjct  182  GCSDAIPCTNLTLSDIELLPAQGQFVLNPFCWNAYGIMETLTIPPAMCLVEGMPEKIIQT  241

Query  194  DVDQC  180
            DVD C
Sbjct  242  DVDHC  246



>ref|NP_196969.1| pectin lyase-like superfamily protein [Arabidopsis thaliana]
 emb|CAB87632.1| polygalacturonase-like protein [Arabidopsis thaliana]
 gb|AED92058.1| pectin lyase-like superfamily protein [Arabidopsis thaliana]
Length=435

 Score =   375 bits (964),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 186/398 (47%), Positives = 259/398 (65%), Gaps = 17/398 (4%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTG-PCKNPLL  1188
             NV+ +G  GDG +DDT AF+ AW  AC+   +  LL P   +FL+    F G  CK  ++
Sbjct  52    NVLDHGAKGDGTSDDTKAFEDAWQVACKVAAS-TLLVPSGSTFLVGPVSFLGKECKEKIV  110

Query  1187  FQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGV  1008
             FQ+EG I+ P    +W   L   QW+ F  + G++++G G+IDGRG  WWN        +
Sbjct  111   FQLEGKIIAPTSASAWGSGLL--QWIEFKALQGITIKGKGIIDGRGSVWWN-------DM  161

Query  1007  NGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNSP  828
              GT +P     P A+RF+ S+ +TV  + I+NSP  H +FDNC  + +      +P +SP
Sbjct  162   MGTKMPRT--KPTALRFYGSNGVTVSGITIQNSPQTHLKFDNCISIQVSDFTTSSPGDSP  219

Query  827   NTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQSR  648
             NTDGIH++N+ D  I+ S ++ GDDCISI  GC N++I ++ CGPGHGISIG LG   ++
Sbjct  220   NTDGIHLQNSQDAVIYRSTLACGDDCISIQTGCSNINIHDVDCGPGHGISIGGLGKDNTK  279

Query  647   ACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNKA  468
             ACVSNI V D T+  + NGVRIK+WQGG G+V +V F NI++ NV NPII+DQYYC    
Sbjct  280   ACVSNITVRDVTMHETTNGVRIKSWQGGSGSVKQVMFSNIQVSNVANPIIIDQYYCDGGG  339

Query  467   CTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGH-RMLD  291
             C N+TSAV +S+++Y NIKGT+     P+R ACSDS+PCT ++LS +EL P+ G    LD
Sbjct  340   CHNETSAVAVSNINYINIKGTYTKE--PVRFACSDSLPCTGISLSTIELKPATGKASSLD  397

Query  290   PFCWNAYGDLKTVTIPPVFCL-LEGNPQSLPNVDVDQC  180
             PFCW A+G+LKT T+PP+ CL  E +P++    + D C
Sbjct  398   PFCWKAHGELKTKTLPPIQCLKTEKSPEAASRSNNDAC  435



>ref|XP_001755315.1| predicted protein [Physcomitrella patens]
 gb|EDQ79795.1| predicted protein [Physcomitrella patens]
Length=416

 Score =   370 bits (949),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 183/399 (46%), Positives = 256/399 (64%), Gaps = 20/399 (5%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +VM++  +GDG+ DDT AF+  W  ACQS+ + +++ P ++ F++    F GPCK+ L F
Sbjct  8     DVMAFNAVGDGITDDTKAFQATWRAACQSE-SSVMVVPAYYVFVVGQITFKGPCKHNLTF  66

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGVN  1005
             QIEG I+PP     W K   K QW+ FY+  GM ++G G I+G GE WW+ PCK  R   
Sbjct  67    QIEGVIIPPTDLAVWNKLSNKVQWIGFYKQVGMMLRGSGAINGLGEVWWSQPCKVCRITP  126

Query  1004  GTTLPGP---------------CDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDV  870
                   P               C SP A++F+   N++V+D+ I++SP  H +FDNC  V
Sbjct  127   TNCCEKPRRISRLIAADHGRQRCASPTALKFYGCINVSVRDITIQDSPQMHLKFDNCQQV  186

Query  869   HIDSLYIKAPPNSPNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPG  690
              + ++ I +P  SPNTDGIH++NT    + N +++ GDDCIS+  G  +V IR++ CGPG
Sbjct  187   EVFNVSILSPGWSPNTDGIHLQNTGYALLQNLVIAAGDDCISLQTGTTDVTIRDVVCGPG  246

Query  689   HGISIGSLGIKQSRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVR  510
             HGISIG LG   S+ACVSNI V D  I+++ NGVRIKTWQGG G V  VTFD + + NV+
Sbjct  247   HGISIGGLGQGGSQACVSNITVQDVLIKDTQNGVRIKTWQGGSGVVQHVTFDTVTVVNVQ  306

Query  509   NPIIVDQYYCSNKACTNQTSAVYISDVSYSNIKGTFD-ARS-PPMRLACSDSVPCTNLTL  336
             NPI+++Q+YC  K C N T+AV ISD++YSNI+GT+D AR   P+  ACSD+VPC N+ +
Sbjct  307   NPIVINQFYCDAKECQNDTAAVLISDIAYSNIRGTYDQARCHAPVYFACSDTVPCRNIKV  366

Query  335   SEVELYPSQGHRMLD-PFCWNAYGDLKTVTIPPVFCLLE  222
               VEL P+Q +     PFCWN+YG    +  PP  CL++
Sbjct  367   DNVELLPAQANFFTSRPFCWNSYGASDPLCYPP-LCLID  404



>ref|XP_010492279.1| PREDICTED: polygalacturonase At1g48100-like [Camelina sativa]
Length=456

 Score =   370 bits (951),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 185/412 (45%), Positives = 261/412 (63%), Gaps = 24/412 (6%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGP-CKNPLL  1188
             NV+ +G  GDG +DDT AF+ AW+EAC+   + +L+ P   +FL+    F G  CK  ++
Sbjct  52    NVLDHGAKGDGTSDDTKAFEDAWEEACKVAASTLLI-PSDSTFLVGPVSFLGKGCKENIV  110

Query  1187  FQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNL-----PCK  1023
             FQ++G I+ P    +W   L   QW+ F  + G++++G G+IDGRG  WWN      P  
Sbjct  111   FQLDGKIIAPTSSSAWGSGLL--QWIEFKSLTGITIKGKGIIDGRGSVWWNKSPDYDPAD  168

Query  1022  PHRGVN---------GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDV  870
                            GT +P     P A+RF+ S+ +TV  + I+NSP  H +FDNC  +
Sbjct  169   ESESTTTNDMVKEQLGTKMPKT--KPTALRFYGSNGVTVNGITIQNSPQTHLKFDNCMSI  226

Query  869   HIDSLYIKAPPNSPNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPG  690
              +      +P +SPNTDGIH++N+ D  I+ S ++ GDDCISI  GC N+ I ++ CGPG
Sbjct  227   QVSDFTTSSPGDSPNTDGIHLQNSQDAVIYRSTLACGDDCISIQTGCSNIYIHDVDCGPG  286

Query  689   HGISIGSLGIKQSRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVR  510
             HGISIG LG   ++ACVSNI V D T+  + NGVRIK+WQGG G+V +V F NI++ NV 
Sbjct  287   HGISIGGLGKDNTKACVSNITVRDVTMHETTNGVRIKSWQGGSGSVKQVMFSNIQVSNVA  346

Query  509   NPIIVDQYYCSNKACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSE  330
             NPII+DQYYC    C N+TSAV +S+++Y NIKGT+  +  P+R ACSDS+PCT ++LS 
Sbjct  347   NPIIIDQYYCDGGGCHNETSAVAVSNINYINIKGTYTKQ--PIRFACSDSLPCTGISLST  404

Query  329   VELYPS-QGHRMLDPFCWNAYGDLKTVTIPPVFCL-LEGNPQSLPNVDVDQC  180
             +EL P+ +     DPFCW A+G+LKT TIPP+ CL  E +P++    + D C
Sbjct  405   IELKPATEKASSFDPFCWEAHGELKTQTIPPIQCLKTEKSPEAASQSNNDAC  456



>gb|EYU44763.1| hypothetical protein MIMGU_mgv1a018728mg, partial [Erythranthe 
guttata]
Length=430

 Score =   367 bits (943),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 185/399 (46%), Positives = 257/399 (64%), Gaps = 20/399 (5%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGP-CKNPLL  1188
             NV+ YG  GDG+ADDT AF  AW +AC+   + I+L P    FL++   F+GP C + ++
Sbjct  23    NVLKYGAKGDGIADDTNAFGGAWADACKVQGS-IMLVPSGSVFLVKPISFSGPNCMSNIV  81

Query  1187  FQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGV  1008
             FQ+EG I+ P    +W   L   QWL F ++ G++++G G+IDG+G  WW L        
Sbjct  82    FQLEGKIIAPTNSGAWGSGL--LQWLEFTKLKGITIRGKGIIDGQGSIWWKLTTNSAVES  139

Query  1007  NGTTLPG----------PCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDS  858
               + LP           P   P A+RF+ S+++TV  + I+NSP  H +FD C  V +  
Sbjct  140   ESSYLPNSINTEANGGMPSTKPTALRFYGSTDVTVTGITIQNSPQTHLKFDGCTGVQVSG  199

Query  857   LYIKAPPNSPNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGIS  678
             + I +P NSPNTDGIH++N+ +V I  + ++ GDDCISI  GC N+ +RN+ CGPGHGIS
Sbjct  200   VSISSPGNSPNTDGIHLQNSQNVVIQATTLACGDDCISIQTGCSNIYVRNVNCGPGHGIS  259

Query  677   IGSLGIKQSRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPII  498
             IG LG   ++ACVSN+ V DS I+N+ NG+RIK+WQGG G+V  V F NI++  V NPII
Sbjct  260   IGGLGKDGTKACVSNVTVRDSIIQNTLNGIRIKSWQGGSGSVKGVLFVNIQVSEVENPII  319

Query  497   VDQYYC-SNKACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVEL  321
             +DQYYC  +  C N+TSAV IS VSY +IKGT+ A   P+ LACSDS+PC  +TLS + L
Sbjct  320   IDQYYCDGHNNCPNKTSAVAISGVSYQSIKGTYTAN--PVHLACSDSIPCAGITLSTIAL  377

Query  320   YPSQ---GHRMLDPFCWNAYGDLKTVTIPPVFCLLEGNP  213
              PS     +   +P+CW A+G+++T T PPV CL +G P
Sbjct  378   NPSTKGVKNNNNNPYCWRAFGEIQTATTPPVSCLQKGGP  416



>ref|XP_010420111.1| PREDICTED: polygalacturonase At1g48100-like [Camelina sativa]
Length=455

 Score =   366 bits (940),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 182/403 (45%), Positives = 260/403 (65%), Gaps = 24/403 (6%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTG-PCKNPLL  1188
             NV+ +G  GDG +DDT AF+ AW+EAC+   +  LL P   +FL+    F G  CK  ++
Sbjct  52    NVLDHGAKGDGTSDDTKAFEDAWEEACKVAAS-TLLVPSGSTFLVGPVSFLGKECKENIV  110

Query  1187  FQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNL-----PCK  1023
             FQ++G I+ P    +W   L   QW+ F  + G++++G G+IDG+G  WWN      P  
Sbjct  111   FQLDGKIIAPTSSSAWGSGLL--QWIEFKSLKGITVKGKGIIDGQGSVWWNKSPDYDPAD  168

Query  1022  PHRGVN---------GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDV  870
               + +          GT +P     P A+RF+ S+ +TV  + I+NSP  H +FDNC  +
Sbjct  169   ESQSITKNDMVKEQLGTKMPKT--KPTALRFYGSNGVTVNGITIQNSPQTHLKFDNCMSI  226

Query  869   HIDSLYIKAPPNSPNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPG  690
              +      +P +SPNTDGIH++N+ D  I+ S ++ GDDCISI  GC N+ I ++ CGPG
Sbjct  227   QVSDFTTSSPGDSPNTDGIHLQNSQDAVIYRSTLACGDDCISIQTGCSNIYIHDVDCGPG  286

Query  689   HGISIGSLGIKQSRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVR  510
             HGISIG LG   ++ACVSNI V D T+  + NGVRIK+WQGG G+V +V F NI++ +V 
Sbjct  287   HGISIGGLGKDNTKACVSNITVRDVTMHETTNGVRIKSWQGGSGSVKQVMFSNIQVSDVA  346

Query  509   NPIIVDQYYCSNKACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSE  330
             NPII+DQYYC    C N+TSAV +S+++Y NIKGT+  +  P+R ACSDS+PCT ++LS 
Sbjct  347   NPIIIDQYYCDGGGCHNETSAVAVSNINYINIKGTYTKQ--PIRFACSDSLPCTGISLST  404

Query  329   VELYPS-QGHRMLDPFCWNAYGDLKTVTIPPVFCL-LEGNPQS  207
             +EL P+ +    LDPFCW A+G+LKT T+PP+ CL  E +P++
Sbjct  405   IELKPATEKASSLDPFCWEAHGELKTQTLPPIQCLKTEKSPEA  447



>ref|XP_006470302.1| PREDICTED: polygalacturonase At1g48100-like [Citrus sinensis]
Length=473

 Score =   366 bits (940),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 180/390 (46%), Positives = 254/390 (65%), Gaps = 13/390 (3%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGP-CKNPLL  1188
             NV+SYG  GDG  DDT AF+ AW  AC+ +    ++ P    FL+    F+GP C+  +L
Sbjct  77    NVLSYGAKGDGRTDDTKAFEAAWVAACKIE-GATMVVPSGSVFLVGPISFSGPTCQPNIL  135

Query  1187  FQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGV  1008
             FQ++G I+ P    +W   +   QWL F ++ G+++ G G+IDG+G  WW+     +   
Sbjct  136   FQLDGKIIAPTNSGAWGSGI--LQWLEFSKLKGLTLTGKGIIDGQGSVWWHDAPSSYGTA  193

Query  1007  N---GTTLPG--PCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKA  843
             +    + L G  P   P A+RF+ SS +TV  + I+NS   H +FD+C  V +      +
Sbjct  194   DDSASSALKGNMPGTKPTALRFYGSSGVTVAGITIQNSQQTHLKFDDCTAVQVSDFTASS  253

Query  842   PPNSPNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLG  663
             P +SPNTDGIH++N+ DVTIH+S ++ GDDCISI  GC N+D+ N+ CGPGHGISIGSLG
Sbjct  254   PGDSPNTDGIHLQNSQDVTIHSSTLACGDDCISIQTGCSNIDVHNVNCGPGHGISIGSLG  313

Query  662   IKQSRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYY  483
                ++ACVS I V D T+ ++  GVRIKTWQGG G V +VTF NI++++V++PI++DQYY
Sbjct  314   KDNTKACVSKITVRDVTMHDTMTGVRIKTWQGGSGLVQQVTFSNIQVNDVKSPIVIDQYY  373

Query  482   CSNKACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGH  303
             C   +C N++SAV +S+++Y NI+GT+  +  P   ACSD +PCT ++LS V L P Q  
Sbjct  374   CEKSSCHNESSAVQVSNIAYVNIRGTYTEQ--PAHFACSDILPCTGISLSTVALKPVQSA  431

Query  302   RMLDPFCWNAYGDLKTVTIPPVFCLLEGNP  213
             R   PFCW AYG+LKT T PP+ CL  G P
Sbjct  432   RQ--PFCWEAYGELKTATDPPINCLQRGMP  459



>gb|ABV25002.1| polygalacturonase 5 [Oncidium hybrid cultivar]
Length=484

 Score =   367 bits (941),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 178/391 (46%), Positives = 256/391 (65%), Gaps = 12/391 (3%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGP-CKNPLL  1188
             NV+ +G  GDGV DDT AF+ AW  ACQ + + + + P  ++FLI    F+GP C+  ++
Sbjct  91    NVLDFGAKGDGVTDDTKAFEDAWMSACQVEASTVQI-PSDYTFLIGPISFSGPYCQPNII  149

Query  1187  FQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGV  1008
             FQ++GTI+ P     W   L    W+ F ++ G+++QG G I+GRG  WW+ P      +
Sbjct  150   FQLDGTIVAPTISKIWSSGLL--WWIEFTKLKGITIQGSGTIEGRGSVWWSQPEPNDESI  207

Query  1007  N---GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPP  837
             +   G+ +P     P A+RF+ S N+TV  + I+NSP  H +FDNC  VH+ ++ + +P 
Sbjct  208   SEELGSKMPSI--KPTALRFYGSYNVTVTGITIQNSPQCHLKFDNCEAVHVYNMSVTSPG  265

Query  836   NSPNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIK  657
             +S NTDGIH++N+ DV IH+  +S GDDC+SI  GC  V I N+ CGPGHGISIG LG  
Sbjct  266   DSLNTDGIHLQNSKDVVIHHCNLSCGDDCVSIQTGCNGVKIHNVNCGPGHGISIGGLGRD  325

Query  656   QSRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCS  477
              ++ACVSNI V D  +  +  GVRIKTWQGG G+V  + F NIR+  V+ PI++DQ+YC 
Sbjct  326   NTKACVSNITVQDVNMYGTMTGVRIKTWQGGSGSVQSIRFSNIRVSEVQTPIVIDQFYCD  385

Query  476   NKACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGH-R  300
               +C NQT+AV +S ++Y +IKGT+  +  P+ LACSD  PC++++L+E+EL P Q H  
Sbjct  386   RSSCKNQTAAVALSGIAYESIKGTYTVK--PVHLACSDGTPCSDISLTEIELQPMQEHYH  443

Query  299   MLDPFCWNAYGDLKTVTIPPVFCLLEGNPQS  207
             M DPFCW  +G+L T T+PP+ C+  G P S
Sbjct  444   MYDPFCWQTFGELYTPTVPPILCMQNGKPTS  474



>gb|ABV25001.1| polygalacturonase 4 [Oncidium hybrid cultivar]
Length=483

 Score =   367 bits (941),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 179/391 (46%), Positives = 256/391 (65%), Gaps = 12/391 (3%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGP-CKNPLL  1188
             NV+ +G  GDGV DDT AF+ AW  ACQ + + + + P  ++FL+    F+GP C+  ++
Sbjct  90    NVLDFGAKGDGVTDDTKAFEDAWMSACQVEASTMQI-PSDYTFLVGPISFSGPYCQPNII  148

Query  1187  FQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPC---KPH  1017
             FQ++GTI+ P     W   L    W+ F ++ G+++QG G I+GRG  WW+ P    +P 
Sbjct  149   FQLDGTIVAPTNSKIWSSGLL--WWIEFTKLKGITIQGSGTIEGRGSVWWSQPEPNDEPI  206

Query  1016  RGVNGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPP  837
                 G+ +P     P A+RF+ S N+TV  + I+NSP  H +FDNC  VH+ ++ + +P 
Sbjct  207   SEELGSKMPSI--KPAALRFYGSYNVTVTGITIQNSPQCHLKFDNCEAVHVYNMSVTSPG  264

Query  836   NSPNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIK  657
             +S NTDGIH++N+ DV IH+  +S GDDC+SI  GC  V I N+ CGPGHGISIG LG  
Sbjct  265   DSLNTDGIHLQNSKDVVIHHCNLSCGDDCVSIQTGCNGVKIHNVNCGPGHGISIGGLGRD  324

Query  656   QSRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCS  477
              ++ACVSNI V D  +  +  GVRIKTWQGG G+V  + F NIR+  V+ PI++DQ+YC 
Sbjct  325   NTKACVSNITVQDVNMYGTMTGVRIKTWQGGSGSVQSIRFSNIRVSEVQTPIVIDQFYCD  384

Query  476   NKACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGH-R  300
               +C NQT+AV +S ++Y +IKGT+  +  P+ LACSD  PC++++L+E+EL P Q H  
Sbjct  385   RSSCKNQTAAVALSGIAYESIKGTYTVK--PVHLACSDGTPCSDISLTEIELQPMQEHYH  442

Query  299   MLDPFCWNAYGDLKTVTIPPVFCLLEGNPQS  207
             M DPFCW  +G+L T T+PP+ CL  G P S
Sbjct  443   MYDPFCWQTFGELYTPTVPPILCLQNGKPTS  473



>gb|ABV24998.1| polygalacturonase 1 [Oncidium hybrid cultivar]
Length=482

 Score =   366 bits (939),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 178/391 (46%), Positives = 255/391 (65%), Gaps = 12/391 (3%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGP-CKNPLL  1188
             NV+ +G  GDGV DDT AF+ AW  ACQ + + + + P  ++FL+    F+GP C+  ++
Sbjct  89    NVLDFGAKGDGVTDDTKAFEDAWMSACQVEASTMQI-PSDYTFLVGPISFSGPYCQPNII  147

Query  1187  FQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPC---KPH  1017
             FQ++GTI+ P     W   L    W+ F ++ G+++QG G I+GRG  WW+ P    +P 
Sbjct  148   FQLDGTIVAPTNSKIWSSGLL--WWIEFTKLKGITIQGNGTIEGRGSVWWSQPEPNDEPI  205

Query  1016  RGVNGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPP  837
                 G  +P     P A+RF+ S N+TV  + I+NSP  H +FDNC  VH+ ++ + +P 
Sbjct  206   SEELGKKMPSI--KPTALRFYGSYNVTVTGITIQNSPQCHLKFDNCEAVHVYNMSVTSPG  263

Query  836   NSPNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIK  657
             +S NTDGIH++N+ DV IH+  +S GDDC+SI  GC  V I N+ CGPGHGISIG LG  
Sbjct  264   DSLNTDGIHLQNSKDVAIHHCNLSCGDDCVSIQTGCNGVKIHNVNCGPGHGISIGGLGRD  323

Query  656   QSRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCS  477
              ++ACVSNI V D  +  +  GVRIKTWQGG G+V  + F NIR+  V+ PI++DQ+YC 
Sbjct  324   NTKACVSNITVQDVNMYGTMTGVRIKTWQGGSGSVQSIRFSNIRVSEVQTPIVIDQFYCD  383

Query  476   NKACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGH-R  300
               +C NQT+AV +S ++Y +IKGT+  +  P+ LACSD  PC++++L+E+EL P Q H  
Sbjct  384   RSSCKNQTAAVALSSIAYESIKGTYTVK--PVHLACSDGTPCSDISLTEIELQPMQEHYH  441

Query  299   MLDPFCWNAYGDLKTVTIPPVFCLLEGNPQS  207
             M DPFCW  +G+L T T+PP+ C+  G P S
Sbjct  442   MYDPFCWQTFGELYTPTVPPILCMQNGKPTS  472



>gb|ABV24999.1| polygalacturonase 2 [Oncidium hybrid cultivar]
Length=483

 Score =   366 bits (939),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 178/391 (46%), Positives = 255/391 (65%), Gaps = 12/391 (3%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGP-CKNPLL  1188
             NV  +G  GDGV DDT AF+ AW  ACQ + + + + P  ++F +    F+GP C+  ++
Sbjct  90    NVPDFGAKGDGVTDDTKAFEDAWMSACQVEASTMQI-PSDYTFFVGPISFSGPYCQPNII  148

Query  1187  FQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPC---KPH  1017
             FQ++GTI+ P     W   L    W+ F ++ G+++QG G I+GRG  WW+ P    +P 
Sbjct  149   FQLDGTIVAPTNSKIWSSGLL--WWIEFTKLKGITIQGSGTIEGRGSVWWSQPEPNDEPI  206

Query  1016  RGVNGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPP  837
                 G+ +P     P A+RF+ S N+TV  + I+NSP  H +FDNC  VH+ ++ + +P 
Sbjct  207   SEELGSKMPSI--KPTALRFYGSYNVTVTGITIQNSPQCHLKFDNCEAVHVYNMSVTSPG  264

Query  836   NSPNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIK  657
             +SPNTDGIH++N+ DV IH+  +S GDDC+SI  GC  V I N+ CGPGHGISIG LG  
Sbjct  265   DSPNTDGIHLQNSKDVVIHHCNLSCGDDCVSIQTGCNGVKIHNVNCGPGHGISIGGLGRD  324

Query  656   QSRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCS  477
              ++ACVSNI V D  +  +  GVRIKTWQGG G+V  + F NIR+  V+ PI++DQ+YC 
Sbjct  325   NTKACVSNITVQDVNMYGTMTGVRIKTWQGGSGSVQSIRFSNIRVSEVQTPIVIDQFYCD  384

Query  476   NKACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGH-R  300
               +C NQT+AV +S ++Y +IKGT+  +  P+ LACSD  PC++++L+E+EL P Q H  
Sbjct  385   RSSCKNQTAAVALSGIAYESIKGTYTVK--PVHLACSDGTPCSDISLTEIELQPMQEHYH  442

Query  299   MLDPFCWNAYGDLKTVTIPPVFCLLEGNPQS  207
             M DPFCW  +G+L T T+PP+ C+  G P S
Sbjct  443   MYDPFCWQTFGELYTPTVPPILCMQNGKPTS  473



>ref|XP_006399978.1| hypothetical protein EUTSA_v10013501mg [Eutrema salsugineum]
 gb|ESQ41431.1| hypothetical protein EUTSA_v10013501mg [Eutrema salsugineum]
Length=456

 Score =   364 bits (934),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 178/393 (45%), Positives = 252/393 (64%), Gaps = 19/393 (5%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTG-PCKNPLL  1188
             NV+ YG  GDG +DDT AF+ AW EAC+ + +  LL P   +FL+    F G  CK  ++
Sbjct  52    NVLDYGAKGDGTSDDTKAFEDAWKEACKVEGS-TLLVPSGSTFLVGPVSFLGKECKENIV  110

Query  1187  FQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNL-----PCK  1023
             FQ+EG I+ P    +W   L   QW+ F  + G++++G G+IDGRG  WWN      P  
Sbjct  111   FQLEGKIIAPTSSSAWGSGLL--QWIEFKSLKGITIKGKGIIDGRGSVWWNKSPDYDPVD  168

Query  1022  PHRGV-------NGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHI  864
                 +       +  +   P   P A+RF+ S+ +TV  + I+NSP  H +FDNC  + +
Sbjct  169   ESESITRNDMMKDQLSTKMPRTKPTALRFYGSNGVTVNGITIQNSPQTHLKFDNCISIQV  228

Query  863   DSLYIKAPPNSPNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHG  684
                   +P +SPNTDGIH++N+ D  I+ S ++ GDDCISI  GC N+ I ++ CGPGHG
Sbjct  229   SDFTTSSPGDSPNTDGIHLQNSQDAVIYRSTLACGDDCISIQTGCSNIYIHDVDCGPGHG  288

Query  683   ISIGSLGIKQSRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNP  504
             ISIG LG ++++ACVSNI V D T+  + NGVRIK+WQGG G+V ++ F NI++  V NP
Sbjct  289   ISIGGLGKEKTKACVSNITVRDVTMHETTNGVRIKSWQGGSGSVKQIMFSNIQVSEVANP  348

Query  503   IIVDQYYCSNKACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVE  324
             II+DQYYC    C N TSAV +S+++Y NIKGT+     P+R ACS+S+PCT ++LS +E
Sbjct  349   IIIDQYYCDGGGCHNDTSAVAVSNINYINIKGTYTKE--PVRFACSESLPCTGISLSTIE  406

Query  323   LYPS-QGHRMLDPFCWNAYGDLKTVTIPPVFCL  228
             L P+ +   + DPFCW A+G+LKT T+PP+ CL
Sbjct  407   LKPATEKASLRDPFCWEAHGELKTKTLPPIQCL  439



>ref|XP_011098761.1| PREDICTED: polygalacturonase At1g48100 [Sesamum indicum]
Length=462

 Score =   364 bits (934),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 183/395 (46%), Positives = 253/395 (64%), Gaps = 18/395 (5%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGP-CKNPLL  1188
             NV++YG  GDG+ADDT AF+ AW +ACQ +   ++L P    FL++   F+GP C + ++
Sbjct  59    NVLNYGAKGDGIADDTNAFEAAWTDACQ-EQGSVMLVPSGSVFLVKPISFSGPNCMSNIV  117

Query  1187  FQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWN--LPCKPHR  1014
             FQ++G I+ P    +W   L   QWL F ++ G++++G G IDG+G  WW+      P  
Sbjct  118   FQLDGKIIAPRSSGAWGSGL--LQWLEFTKLKGITIRGKGSIDGQGSVWWDDYSTANPTD  175

Query  1013  GVNGTTLPG----------PCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHI  864
               +    P           P   P A+RF+ S+++TV  + I+NSP  H +FD+C  V +
Sbjct  176   ESDAAGSPDWASAEAKGGMPSTRPTALRFYGSTDVTVTGITIQNSPQTHLKFDDCIGVQV  235

Query  863   DSLYIKAPPNSPNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHG  684
               + I +P +SPNTDGIH++N+ DV IH + ++ GDDCISI  GC  V + N+ CGPGHG
Sbjct  236   FGISISSPGDSPNTDGIHLQNSQDVVIHTTSLACGDDCISIQTGCSGVYVHNVNCGPGHG  295

Query  683   ISIGSLGIKQSRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNP  504
             ISIG LG   ++ACVSNI V DSTI+N+ NGVRIKTWQGG G+V  V F NI++  V  P
Sbjct  296   ISIGGLGKDGTKACVSNITVRDSTIQNTLNGVRIKTWQGGSGSVQGVMFSNIQVSEVETP  355

Query  503   IIVDQYYCSNKACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVE  324
             II+DQ+YC+   C N+TSAV +S VSY +IKGT+     P+  ACSDS PC  +TLS + 
Sbjct  356   IIIDQFYCNGHTCPNKTSAVAVSGVSYQSIKGTYTVN--PVSFACSDSTPCAGITLSSIV  413

Query  323   LYPSQGHRMLDPFCWNAYGDLKTVTIPPVFCLLEG  219
             L PS   +  +PFCW AYG+L+T T PP+ CL  G
Sbjct  414   LNPSSEAKNDNPFCWKAYGELQTATTPPIDCLQTG  448



>gb|ABV25000.1| polygalacturonase 3 [Oncidium hybrid cultivar]
Length=483

 Score =   364 bits (935),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 178/391 (46%), Positives = 254/391 (65%), Gaps = 12/391 (3%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGP-CKNPLL  1188
             NV+ +G  GDGV DDT AF+ AW  ACQ + + + + P  ++F +    F+GP C+  ++
Sbjct  90    NVLDFGAKGDGVTDDTKAFEDAWMSACQVEASTMQI-PSDYTFFVGPISFSGPYCQPNII  148

Query  1187  FQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPC---KPH  1017
             FQ++GTI+ P     W   L    W+ F ++ G+++QG G I+GRG  WW+ P    +P 
Sbjct  149   FQLDGTIVAPTNSKIWSSGLL--WWIEFTKLKGITIQGNGTIEGRGSVWWSQPEPNDEPI  206

Query  1016  RGVNGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPP  837
                 G  +P     P A+RF+ S N+TV  + I+NSP  H +FDNC  VH+ ++ + +P 
Sbjct  207   SEELGKKMPSI--KPTALRFYGSYNVTVTGITIQNSPQCHLKFDNCEAVHVYNMSVTSPG  264

Query  836   NSPNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIK  657
             +S NTDGIH++N+ DV IH+  +S GDDC+SI  GC  V I N+ CGPGHGISIG LG  
Sbjct  265   DSLNTDGIHLQNSKDVVIHHRNLSCGDDCVSIQTGCNGVKIHNVNCGPGHGISIGGLGRD  324

Query  656   QSRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCS  477
              ++ACVSNI V D  +  +  GVRIKTWQGG G+V  + F NIR+  V+ PI++DQ+YC 
Sbjct  325   NTKACVSNITVRDVNMYGTMTGVRIKTWQGGSGSVQSIRFSNIRVSEVQTPIVIDQFYCD  384

Query  476   NKACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGH-R  300
               +C NQT+AV +S ++Y +IKGT+  +  P+ LACSD  PC++++L+E+EL P Q H  
Sbjct  385   RSSCKNQTAAVALSGIAYESIKGTYTVK--PVHLACSDGTPCSDISLTEIELQPMQEHYH  442

Query  299   MLDPFCWNAYGDLKTVTIPPVFCLLEGNPQS  207
             M DPFCW  +G+L T T+PP+ CL  G P S
Sbjct  443   MYDPFCWQTFGELYTPTVPPILCLQNGKPTS  473



>ref|XP_010453593.1| PREDICTED: polygalacturonase At1g48100-like [Camelina sativa]
Length=455

 Score =   363 bits (932),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 183/403 (45%), Positives = 256/403 (64%), Gaps = 24/403 (6%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTG-PCKNPLL  1188
             NV+  G  GDG +DDT AF+ AW EAC+   +  LL P   +FL+    F G  CK  ++
Sbjct  52    NVLDNGAKGDGTSDDTKAFEDAWREACKVAAS-TLLVPSGSTFLVGPVSFLGKECKENIV  110

Query  1187  FQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNL-----PCK  1023
             FQ++G I+ P    +W   L   QW+ F  + G++++G G+IDGRG  WWN      P  
Sbjct  111   FQLDGKIIAPTSSSAWGSGLL--QWIEFKSLTGITIKGKGIIDGRGSVWWNKSPDYDPAD  168

Query  1022  PHRGVN---------GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDV  870
                            GT +P     P A+RF+ S+ +TV  + I+NSP  H +FDNC  +
Sbjct  169   ESESTTESDMVKEQLGTKMPKT--KPTALRFYGSNGVTVNGITIQNSPQTHLKFDNCMSI  226

Query  869   HIDSLYIKAPPNSPNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPG  690
              +      +P +SPNTDGIH++N+ D  I+ S ++ GDDCISI  GC N+ I ++ CGPG
Sbjct  227   QVSDFTTSSPGDSPNTDGIHLQNSQDAVIYRSTLACGDDCISIQTGCSNIYIHDVDCGPG  286

Query  689   HGISIGSLGIKQSRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVR  510
             HGISIG LG   ++ACVSNI V D T+  + NGVRIK+WQGG G+V +V F NI++ +V 
Sbjct  287   HGISIGGLGKDNTKACVSNITVRDVTMHETTNGVRIKSWQGGSGSVKQVMFSNIQVSDVA  346

Query  509   NPIIVDQYYCSNKACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSE  330
             NPII+DQYYC    C N+TSAV +S+++Y NIKGT+  +  P+R ACSDS+PCT ++LS 
Sbjct  347   NPIIIDQYYCDGGGCHNETSAVAVSNINYINIKGTYTKQ--PIRFACSDSLPCTGISLST  404

Query  329   VELYPS-QGHRMLDPFCWNAYGDLKTVTIPPVFCL-LEGNPQS  207
             +EL P+ +    LDPFCW A+G+LKT T+PP+ CL  E +P++
Sbjct  405   IELKPATEKASSLDPFCWEAHGELKTQTLPPIQCLKTEKSPEA  447



>ref|XP_006290192.1| hypothetical protein CARUB_v10003877mg [Capsella rubella]
 gb|EOA23090.1| hypothetical protein CARUB_v10003877mg [Capsella rubella]
Length=440

 Score =   362 bits (929),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 181/403 (45%), Positives = 256/403 (64%), Gaps = 21/403 (5%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGP-CKNPLL  1188
             NV++YG  GDG +DDT AF+ AW EAC+      LL P   +FL+    F G  CK  ++
Sbjct  51    NVLNYGAKGDGTSDDTKAFENAWVEACKV-AGSTLLVPSGSTFLVGPVSFLGKGCKEKIV  109

Query  1187  FQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNL-----PCK  1023
             FQ++G I+ P    +W   L   QW+ F  + G++++G G+IDGRG  WWN      P  
Sbjct  110   FQLDGKIIAPTSSSAWGSGLL--QWIEFKTLTGITIKGKGIIDGRGSVWWNKSPAYDPAD  167

Query  1022  PHRGVNGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKA  843
                 +            +A+RF+ S+ +TV  + I+NSP  H +FD+C ++ +      +
Sbjct  168   ESESIT--------KKDMALRFYGSNGVTVNGITIQNSPQTHLKFDSCVNIQVSDFTTSS  219

Query  842   PPNSPNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLG  663
             P +SPNTDGIH++N+ D  I+ S ++ GDDCISI  GC N+ I ++ CGPGHGISIG LG
Sbjct  220   PGDSPNTDGIHLQNSKDAVIYRSTLACGDDCISIQTGCSNIYIHDVDCGPGHGISIGGLG  279

Query  662   IKQSRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYY  483
                ++ACVSNI V D T+  + NGVRIK+WQGG G+V +V F NI++ NV NPII+DQYY
Sbjct  280   KYNTKACVSNITVRDVTMHETTNGVRIKSWQGGSGSVKQVMFSNIQVSNVANPIIIDQYY  339

Query  482   CSNKACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGH  303
             C    C N+TSAV +S+++Y NIKGT+  +  P+R ACSDS+PCT L+LS + L P+   
Sbjct  340   CDGGGCHNETSAVAVSNINYINIKGTYTKQ--PIRFACSDSLPCTGLSLSNIALKPATDK  397

Query  302   -RMLDPFCWNAYGDLKTVTIPPVFCL-LEGNPQSLPNVDVDQC  180
              R LDPFCW A+G++KT T+PP+ CL  + +P +    + D C
Sbjct  398   ARSLDPFCWEAHGEVKTQTLPPIKCLKTKKSPGAASQSNNDAC  440



>gb|ABV25003.1| polygalacturonase 6 [Oncidium hybrid cultivar]
Length=483

 Score =   363 bits (932),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 176/391 (45%), Positives = 254/391 (65%), Gaps = 12/391 (3%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGP-CKNPLL  1188
             NV+ +G  GDGV DDT AF+ AW  ACQ + + + + P  ++FL+    F+GP C+  ++
Sbjct  90    NVLDFGAKGDGVTDDTKAFEDAWMSACQVEASTMQI-PSDYTFLVGPISFSGPYCQPNII  148

Query  1187  FQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGV  1008
             FQ++GTI+ P     W   L    W+ F ++ G+++QG G I+GRG  WW+ P      +
Sbjct  149   FQLDGTIVAPTNSKIWSSGLL--WWIEFTKLKGITIQGSGTIEGRGSVWWSQPEPNDESI  206

Query  1007  N---GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPP  837
             +   G+ +P     P A+RF+ S N+TV  + I+NSP  H +FDNC  VH+ ++ + +P 
Sbjct  207   SEELGSKMPSI--KPTALRFYGSYNVTVTGITIQNSPQCHLKFDNCEAVHVYNMSVTSPG  264

Query  836   NSPNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIK  657
             +  NTDGIH++N+ DV IH+  +S GDDC+SI  GC  V I N+ CGPGHGISIG LG  
Sbjct  265   DILNTDGIHLQNSKDVVIHHCNLSCGDDCVSIQTGCNGVKIHNVNCGPGHGISIGGLGRD  324

Query  656   QSRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCS  477
              ++ACVSNI V D  +  +  GVRIKTWQGG G+V  + F NIR+  V+ PI++DQ+YC 
Sbjct  325   NTKACVSNITVQDVNMYGTMTGVRIKTWQGGSGSVQSIRFSNIRVSEVQTPIVIDQFYCD  384

Query  476   NKACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGH-R  300
               +C NQT+AV +S ++Y +IKGT+  +  P+ LACSD  PC++ +L+E+EL P Q H  
Sbjct  385   RSSCKNQTAAVALSGIAYESIKGTYTVK--PVHLACSDGTPCSDTSLTEIELQPMQEHYH  442

Query  299   MLDPFCWNAYGDLKTVTIPPVFCLLEGNPQS  207
             M DPFCW  +G+L T T+PP+ C+  G P S
Sbjct  443   MYDPFCWQTFGELYTPTVPPILCMQNGKPTS  473



>ref|XP_003552026.1| PREDICTED: polygalacturonase At1g48100-like isoform X1 [Glycine 
max]
 gb|KHN23203.1| Polygalacturonase [Glycine soja]
Length=538

 Score =   364 bits (935),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 185/409 (45%), Positives = 260/409 (64%), Gaps = 30/409 (7%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGP-CKNPLL  1188
             NV+ +G  GDG +DDT AF+ AW EAC+ + +  +L P  ++F +    F+GP CK  ++
Sbjct  123   NVLDFGAKGDGKSDDTKAFQEAWAEACKIE-SSTMLVPADYAFFVGPISFSGPYCKPSIV  181

Query  1187  FQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWN---------  1035
             FQ++GTI+ P  P +W K L   QWL F ++ G+++QG G+IDGRG  WW          
Sbjct  182   FQLDGTIVAPTSPKAWGKGLL--QWLEFSKLVGITIQGNGIIDGRGSVWWQDNQYDDPID  239

Query  1034  ------LPCKPHRGVNGTTLP--------GPCDSPVAIRFFTSSNLTVQDLKIKNSPLFH  897
                   +P     G     LP         P   P A+RF+ S N TV  + I+NSP  H
Sbjct  240   DEEKLIVPLNHTVGSPSPPLPIQSEMGGKMPSVKPTALRFYGSFNPTVTGITIQNSPQCH  299

Query  896   FRFDNCHDVHIDSLYIKAPPNSPNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVD  717
              +FDNC+ V +  + I +P +SPNTDGIH++N+ DV I++S ++ GDDCISI  GC N+ 
Sbjct  300   LKFDNCNGVMVHDVTISSPGDSPNTDGIHLQNSKDVLIYSSSMACGDDCISIQTGCSNIY  359

Query  716   IRNMTCGPGHGISIGSLGIKQSRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTF  537
             + N+ CGPGHGISIGSLG   +RACVSNI V D  + N+ NGVRIKTWQGG G+V  V F
Sbjct  360   VHNVNCGPGHGISIGSLGKDNTRACVSNITVRDVNMHNTMNGVRIKTWQGGSGSVQGVLF  419

Query  536   DNIRMDNVRNPIIVDQYYCSNKACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSV  357
              NI++  V  PI++DQ+YC  + C NQTSAV ++ ++Y  I+GT+  +  P+  ACSD++
Sbjct  420   SNIQVSEVELPIVIDQFYCDKRTCKNQTSAVSLAGINYERIRGTYTVK--PVHFACSDNL  477

Query  356   PCTNLTLSEVELYPSQ-GHRMLDPFCWNAYGDLKTVTIPPVFCLLEGNP  213
             PC +++L+ VEL P Q  + + +PFCW  YG+LKT T+PP+ CL  G P
Sbjct  478   PCVDVSLTSVELKPIQEQYHLYNPFCWQTYGELKTPTVPPIDCLQIGKP  526



>ref|XP_002963148.1| hypothetical protein SELMODRAFT_78038 [Selaginella moellendorffii]
 gb|EFJ36611.1| hypothetical protein SELMODRAFT_78038 [Selaginella moellendorffii]
Length=455

 Score =   362 bits (928),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 182/387 (47%), Positives = 258/387 (67%), Gaps = 15/387 (4%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGPCKNPLLF  1185
             +V+S+G  GDGV DDT AF  AW++AC+ + + ++  P +  FL++  +F+GPC+N L+F
Sbjct  71    DVLSFGAKGDGVTDDTHAFLAAWNQACKVE-SSMVEVPANFVFLVKPLVFSGPCQNNLVF  129

Query  1184  QIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGG--GLIDGRGEKWWNLPCKPHRG  1011
             Q++GTI+ P    +W    +  QW+ F RV+G+ +QG   G I+G G  WWN  CK    
Sbjct  130   QVDGTIVAPTSAKAW-NGTSLLQWIEFARVHGLLLQGSCTGAINGNGPAWWNSSCKAKS-  187

Query  1010  VNGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNS  831
                   P P     A+RF+ SSN+ VQ L I NSP  H +FD+C  V ++++ I +P  S
Sbjct  188   ------PAPAQ---AVRFYGSSNVVVQHLAIVNSPQTHLKFDSCQGVVVNNVTISSPYTS  238

Query  830   PNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQS  651
             PNTDGIH+++T    + +S VS GDDC+SI  GC N++I +M CGPGHGISIG LG   +
Sbjct  239   PNTDGIHLQDTRYAAVRSSRVSTGDDCVSIQTGCSNIEIFDMMCGPGHGISIGGLGRGGT  298

Query  650   RACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNK  471
             +ACVS++ V D  +  S NGVRIKTWQGG G+VS V F NI + NV NPI++DQ+YC  +
Sbjct  299   KACVSDVSVHDVVVHTSQNGVRIKTWQGGSGSVSSVHFHNIAVLNVSNPIVIDQFYCDGR  358

Query  470   ACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGHRMLD  291
             +C NQTS V ISDVSY NI+GT+  +S  +  ACSDSVPC  + ++ VEL  ++G+  + 
Sbjct  359   SCHNQTSGVSISDVSYKNIRGTYTQKS-NIHFACSDSVPCVGIVVANVELLSARGYDDIP  417

Query  290   PFCWNAYGDLKTVTIPPVFCLLEGNPQ  210
              FCWN+YG++ + T+P V CL +G P+
Sbjct  418   AFCWNSYGEIFSPTVPQVTCLQQGKPK  444



>gb|KHN26888.1| Polygalacturonase [Glycine soja]
Length=538

 Score =   364 bits (935),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 186/409 (45%), Positives = 260/409 (64%), Gaps = 30/409 (7%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGP-CKNPLL  1188
             NV+ +G  GDG +DDT AF+ AW EAC+ + +  +L P  + F +    F+GP CK  ++
Sbjct  123   NVLDFGAKGDGKSDDTKAFQEAWAEACKVE-SSTMLVPADYVFFVGPISFSGPYCKPSIV  181

Query  1187  FQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWN---------  1035
             FQ++GTI+ P  P++W K L   QWL F ++ G+++QG G+IDGRG  WW          
Sbjct  182   FQLDGTIVAPTSPNAWGKGLL--QWLEFSKLVGITIQGNGIIDGRGSVWWQDNPYDDPID  239

Query  1034  ------LPCKPHRGVNGTTLP--------GPCDSPVAIRFFTSSNLTVQDLKIKNSPLFH  897
                   +P     G     LP         P   P A+RF+ S N TV  + I+NSP  H
Sbjct  240   DEEKLIVPLNHTIGSPSPPLPIQSEMGGKMPSVKPTALRFYGSFNPTVTGITIQNSPQCH  299

Query  896   FRFDNCHDVHIDSLYIKAPPNSPNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVD  717
              +FD+C+ V + ++ I +P +SPNTDGIH++N+ DV I+ S ++ GDDCISI  GC NV 
Sbjct  300   LKFDSCNGVMVHNVTISSPGDSPNTDGIHLQNSKDVLIYGSTMACGDDCISIQTGCSNVY  359

Query  716   IRNMTCGPGHGISIGSLGIKQSRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTF  537
             + N+ CGPGHGISIGSLG   +RACVSNI V D  + N+ NGVRIKTWQGG G+V  V F
Sbjct  360   VHNVNCGPGHGISIGSLGKDNTRACVSNITVRDVNMHNTMNGVRIKTWQGGSGSVQGVLF  419

Query  536   DNIRMDNVRNPIIVDQYYCSNKACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSV  357
              NI++  V  PI++DQ+YC  + C NQTSAV ++ ++Y  I+GT+  +  P+  ACSDS+
Sbjct  420   SNIQVSEVELPIVIDQFYCDKRTCKNQTSAVSLAGINYERIRGTYTVK--PVHFACSDSL  477

Query  356   PCTNLTLSEVELYPSQ-GHRMLDPFCWNAYGDLKTVTIPPVFCLLEGNP  213
             PC +++L+ VEL P Q  + + +PFCW  YG+LKT T+PP+ CL  G P
Sbjct  478   PCVDVSLTSVELKPIQEKYHLYNPFCWQTYGELKTPTVPPIDCLQIGKP  526



>ref|XP_009121648.1| PREDICTED: polygalacturonase At1g48100 isoform X1 [Brassica rapa]
Length=439

 Score =   360 bits (925),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 178/389 (46%), Positives = 251/389 (65%), Gaps = 17/389 (4%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTG-PCKNPLL  1188
             NV+ YG  GDG +DDT AF+ AW+EAC+      LL P   +FL+    F G  CK  ++
Sbjct  44    NVLDYGAKGDGTSDDTKAFEDAWNEACKV-AASTLLVPSGSTFLVGPVSFLGKECKENIV  102

Query  1187  FQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNL-----PCK  1023
             FQ++G I+ P     W   L   QW+ F  + G++++G G+IDG+G  WWN      P  
Sbjct  103   FQLDGKIIAPTSSSVWGSGLL--QWMEFKSLTGITIKGKGVIDGQGSVWWNKSPDYDPAD  160

Query  1022  PH---RGVNGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLY  852
              +   +   GT +PG    P A+RF+ S+ + V  + I+NSP  H +FDNC ++ +    
Sbjct  161   ENDMMKDRKGTKMPGT--KPTALRFYGSNGVMVNGITIQNSPQTHLKFDNCVNIQVSDFT  218

Query  851   IKAPPNSPNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIG  672
               +P +SPNTDGIH++N+ D  I+ S ++ GDDCISI  GC N+ I ++ CGPGHGISIG
Sbjct  219   TSSPGDSPNTDGIHLQNSQDAVIYRSTLACGDDCISIQTGCSNIYIHDVDCGPGHGISIG  278

Query  671   SLGIKQSRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVD  492
              LG + ++ACVSNI V D T+  + NGVRIK+WQGG G+V +V F NI++  V NPI++D
Sbjct  279   GLGKENTKACVSNITVRDVTMHETTNGVRIKSWQGGSGSVKQVMFSNIQVSEVANPIVID  338

Query  491   QYYCSNKACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPS  312
             QYYC    C N+TSAV +S+++Y NIKGT+     P+R ACSDS+PCT ++LS +EL P+
Sbjct  339   QYYCDGGGCHNETSAVAVSNINYINIKGTYTRE--PVRFACSDSLPCTGISLSTIELKPA  396

Query  311   QGH-RMLDPFCWNAYGDLKTVTIPPVFCL  228
                    +PFCW A+G+LKT T+PP+ CL
Sbjct  397   TDKASSSEPFCWEAHGELKTETLPPIQCL  425



>emb|CDY09873.1| BnaC09g42880D [Brassica napus]
Length=439

 Score =   360 bits (924),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 178/389 (46%), Positives = 252/389 (65%), Gaps = 17/389 (4%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTG-PCKNPLL  1188
             NV+ YG  GDG +DDT AF+ AW+EAC+      LL P   +FL+    F G  CK  ++
Sbjct  44    NVLDYGAKGDGTSDDTKAFEDAWNEACKV-AASTLLVPSGSTFLVGPVSFLGKECKENIV  102

Query  1187  FQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNL-----PCK  1023
             FQ++G I+ P    +W   L   QW+ F  + G++++G G+IDG+G  WWN      P  
Sbjct  103   FQLDGKIIAPKSSRAWGSGLL--QWIEFKSLIGITIKGKGVIDGQGSVWWNKSPDYDPAD  160

Query  1022  PH---RGVNGTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLY  852
              +   +   GT +PG    P A+RF+ S+ + V  + I+NSP  H +FDNC ++ +    
Sbjct  161   DNDMMKDQKGTKMPGA--KPTALRFYGSNGVMVNGITIQNSPQTHLKFDNCVNIQVSDFT  218

Query  851   IKAPPNSPNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIG  672
               +P +SPNTDGIH++N+ D  I+ S ++ GDDCISI  GC N+ I ++ CGPGHGISIG
Sbjct  219   TSSPGDSPNTDGIHLQNSQDAVIYRSTLACGDDCISIQTGCSNIYIHDVDCGPGHGISIG  278

Query  671   SLGIKQSRACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVD  492
              LG + ++ACVSNI V D T+  + NGVRIK+WQGG G+V +V F NI++  V NPI++D
Sbjct  279   GLGKENTKACVSNITVRDVTMHETTNGVRIKSWQGGSGSVKQVMFSNIQVSEVANPIVID  338

Query  491   QYYCSNKACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPS  312
             QYYC    C N+TSAV +S+++Y NIKGT+     P+R ACSDS+PCT ++LS +EL P+
Sbjct  339   QYYCDGGGCHNETSAVAVSNINYINIKGTYTRE--PVRFACSDSLPCTGISLSTIELKPA  396

Query  311   QGH-RMLDPFCWNAYGDLKTVTIPPVFCL  228
                    +PFCW A+G+LKT T+PP+ CL
Sbjct  397   TDKASSSEPFCWEAHGELKTETLPPIQCL  425



>ref|XP_010925884.1| PREDICTED: polygalacturonase At1g48100-like [Elaeis guineensis]
Length=483

 Score =   361 bits (927),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 183/389 (47%), Positives = 258/389 (66%), Gaps = 8/389 (2%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGP-CKNPLL  1188
             NV+ +G  GDGV+DDT AF+ AW  AC+ + +  ++ P    FL+    F+GP C+  ++
Sbjct  90    NVLDFGAKGDGVSDDTKAFEAAWAAACKVEAS-TMVVPAEFQFLVGPISFSGPFCQPNIV  148

Query  1187  FQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGV  1008
             FQ++GTI+ P    +W   L   QWL F ++ G+++QG G I+GRG  WW         +
Sbjct  149   FQLDGTIIAPTSSTAWGSGLL--QWLEFTKLRGITIQGSGTIEGRGSIWWTGSESDVDPI  206

Query  1007  NGT-TLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNS  831
             N   +   P   P A+RF+ S N+TV  + I+NSP  H +FD C  V + ++ I +P +S
Sbjct  207   NARLSAKMPQIKPTALRFYGSYNVTVTGITIQNSPQCHLKFDYCEAVQVFNMTISSPGDS  266

Query  830   PNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQS  651
             PNTDGIH++N+ DV+IH++ +  GDDCISI  GC NV I N+ CGPGHGISIG LG   +
Sbjct  267   PNTDGIHLQNSIDVSIHHTDLGCGDDCISIQTGCSNVYIHNVNCGPGHGISIGGLGKDNT  326

Query  650   RACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNK  471
             +ACVSNI V D  + N+  GVRIKTWQGG G+V  + F NI++  V+ PII+DQ+YC  +
Sbjct  327   KACVSNITVRDVNMHNTMTGVRIKTWQGGSGSVQSIRFANIKVSEVQTPIIIDQFYCDRR  386

Query  470   ACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQ-GHRML  294
             +C NQT+AV +S ++Y NIKGTF  +  P+  ACSDS+PC++++L+EVEL P Q  + M 
Sbjct  387   SCKNQTAAVALSSIAYENIKGTFTVK--PVHFACSDSMPCSDISLTEVELEPLQEQYHMY  444

Query  293   DPFCWNAYGDLKTVTIPPVFCLLEGNPQS  207
             +PFCW  YG+L T T+PP+FCL  G P S
Sbjct  445   EPFCWQVYGELYTPTVPPIFCLQTGKPTS  473



>ref|XP_008812598.1| PREDICTED: polygalacturonase At1g48100-like [Phoenix dactylifera]
Length=480

 Score =   361 bits (926),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 182/389 (47%), Positives = 260/389 (67%), Gaps = 8/389 (2%)
 Frame = -2

Query  1364  NVMSYGGIGDGVADDTLAFKRAWDEACQSDLTPILLAPKHHSFLIQSTIFTGP-CKNPLL  1188
             +V+ +G  GDGV DDT AF+ AW  AC+ + + +++ P    FL+    F+GP C++ ++
Sbjct  87    DVLDFGAKGDGVTDDTKAFEAAWAAACKVEASTMVI-PAESQFLVGPISFSGPYCQHNIV  145

Query  1187  FQIEGTIMPPDGPDSWPKNLTKRQWLVFYRVNGMSMQGGGLIDGRGEKWWNLPCKPHRGV  1008
             FQ++GTI+ P    +W   L   QWL F ++NG++++G G+I+GRG  WW         +
Sbjct  146   FQLDGTIIAPTSSKAWGSGLL--QWLEFTKLNGITIRGSGIIEGRGSVWWTHSESDVDPI  203

Query  1007  N-GTTLPGPCDSPVAIRFFTSSNLTVQDLKIKNSPLFHFRFDNCHDVHIDSLYIKAPPNS  831
             N   +   P   P A+RF+ S N+TV  + I+NS   H +FD C  V + ++ I +P +S
Sbjct  204   NVKLSAKMPQIKPTALRFYGSFNVTVTGITIQNSQQCHLKFDYCEGVQVFNMTISSPGDS  263

Query  830   PNTDGIHIENTYDVTIHNSIVSNGDDCISIGAGCYNVDIRNMTCGPGHGISIGSLGIKQS  651
             PNTDGIH++N+ +V+IH++ +  GDDC+SI  GC NV I N+ CGPGHGISIG LG   +
Sbjct  264   PNTDGIHLQNSREVSIHHTNLGCGDDCVSIQTGCSNVYIHNVNCGPGHGISIGGLGRDNT  323

Query  650   RACVSNIKVTDSTIRNSDNGVRIKTWQGGFGAVSKVTFDNIRMDNVRNPIIVDQYYCSNK  471
             +ACVSNI V D  I N+  GVRIKTWQGG G+V  + F NI++  V+ PII+DQ+YC  +
Sbjct  324   KACVSNITVRDVNIHNTMTGVRIKTWQGGAGSVQSIRFTNIKVSEVQTPIIIDQFYCDRR  383

Query  470   ACTNQTSAVYISDVSYSNIKGTFDARSPPMRLACSDSVPCTNLTLSEVELYPSQGH-RML  294
             +C NQTSAV +S ++Y NIKGTF  +  P+  ACSDS+PC++++L+EVEL P Q H  M 
Sbjct  384   SCKNQTSAVALSSIAYENIKGTFTVK--PVHFACSDSMPCSDISLTEVELEPLQEHYHMY  441

Query  293   DPFCWNAYGDLKTVTIPPVFCLLEGNPQS  207
             +PFCW AYG+L T T+PP+ CL  G P S
Sbjct  442   EPFCWKAYGELYTPTVPPIICLQTGKPTS  470



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4125412501398