BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18103_g1_i2 len=5662 path=[5750:0-641 @70@!:642-1873 7641:1874-1879
23:1880-5661]

Length=5662
                                                                      Score     E

ref|XP_009604196.1|  PREDICTED: protein SHOOT GRAVITROPISM 6 isof...   2397   0.0      
ref|XP_010325956.1|  PREDICTED: protein SHOOT GRAVITROPISM 6           2395   0.0      
ref|XP_006354395.1|  PREDICTED: maestro heat-like repeat-containi...   2362   0.0      
ref|XP_011077289.1|  PREDICTED: protein SHOOT GRAVITROPISM 6           2312   0.0      
ref|XP_010654000.1|  PREDICTED: protein SHOOT GRAVITROPISM 6 isof...   2282   0.0      
gb|EYU38578.1|  hypothetical protein MIMGU_mgv1a000131mg               2257   0.0      
emb|CDP15300.1|  unnamed protein product                               2241   0.0      
ref|XP_008241365.1|  PREDICTED: protein SHOOT GRAVITROPISM 6           2221   0.0      
ref|XP_010098832.1|  hypothetical protein L484_022597                  2219   0.0      
gb|KDP29202.1|  hypothetical protein JCGZ_16591                        2194   0.0      
ref|XP_002519443.1|  conserved hypothetical protein                    2192   0.0      Ricinus communis
ref|XP_007027497.1|  ARM repeat superfamily protein isoform 1          2187   0.0      
ref|XP_011018819.1|  PREDICTED: protein SHOOT GRAVITROPISM 6 isof...   2156   0.0      
ref|XP_011018820.1|  PREDICTED: protein SHOOT GRAVITROPISM 6 isof...   2150   0.0      
ref|XP_006604593.1|  PREDICTED: maestro heat-like repeat-containi...   2142   0.0      
ref|XP_006477758.1|  PREDICTED: maestro heat-like repeat-containi...   2142   0.0      
ref|XP_010267296.1|  PREDICTED: protein SHOOT GRAVITROPISM 6 isof...   2142   0.0      
ref|XP_006477757.1|  PREDICTED: maestro heat-like repeat-containi...   2142   0.0      
ref|XP_007027498.1|  ARM repeat superfamily protein isoform 2          2139   0.0      
ref|XP_006604594.1|  PREDICTED: maestro heat-like repeat-containi...   2138   0.0      
ref|XP_004304491.1|  PREDICTED: HEAT repeat-containing protein 7A...   2130   0.0      
ref|XP_007203208.1|  hypothetical protein PRUPE_ppa000201mg            2123   0.0      
gb|KGN48210.1|  hypothetical protein Csa_6G448680                      2114   0.0      
ref|XP_010267297.1|  PREDICTED: protein SHOOT GRAVITROPISM 6 isof...   2111   0.0      
ref|XP_010267298.1|  PREDICTED: protein SHOOT GRAVITROPISM 6 isof...   2108   0.0      
ref|XP_008462510.1|  PREDICTED: protein SHOOT GRAVITROPISM 6           2106   0.0      
ref|XP_010037121.1|  PREDICTED: protein SHOOT GRAVITROPISM 6 isof...   2105   0.0      
ref|XP_010037123.1|  PREDICTED: protein SHOOT GRAVITROPISM 6 isof...   2103   0.0      
ref|XP_010037122.1|  PREDICTED: protein SHOOT GRAVITROPISM 6 isof...   2099   0.0      
ref|XP_004494015.1|  PREDICTED: maestro heat-like repeat-containi...   2097   0.0      
ref|XP_004494089.1|  PREDICTED: maestro heat-like repeat-containi...   2097   0.0      
ref|XP_004494090.1|  PREDICTED: maestro heat-like repeat-containi...   2095   0.0      
ref|XP_006477759.1|  PREDICTED: maestro heat-like repeat-containi...   2095   0.0      
ref|XP_010546528.1|  PREDICTED: protein SHOOT GRAVITROPISM 6 isof...   2089   0.0      
ref|XP_010546529.1|  PREDICTED: protein SHOOT GRAVITROPISM 6 isof...   2088   0.0      
gb|KHG30714.1|  HEAT repeat-containing 7A                              2075   0.0      
ref|XP_004143286.1|  PREDICTED: LOW QUALITY PROTEIN: HEAT repeat-...   2073   0.0      
ref|XP_010683971.1|  PREDICTED: protein SHOOT GRAVITROPISM 6 isof...   2070   0.0      
ref|XP_010683972.1|  PREDICTED: protein SHOOT GRAVITROPISM 6 isof...   2068   0.0      
gb|AES81930.2|  HEAT repeat 7A-like protein                            2063   0.0      
ref|XP_010654001.1|  PREDICTED: protein SHOOT GRAVITROPISM 6 isof...   2048   0.0      
gb|KHN02293.1|  HEAT repeat-containing protein 7A like                 2045   0.0      
ref|XP_010918718.1|  PREDICTED: protein SHOOT GRAVITROPISM 6           2036   0.0      
emb|CDY63988.1|  BnaA04g21100D                                         2035   0.0      
ref|XP_009604197.1|  PREDICTED: protein SHOOT GRAVITROPISM 6 isof...   2034   0.0      
ref|XP_006410853.1|  hypothetical protein EUTSA_v10016131mg            2028   0.0      
gb|KFK36555.1|  hypothetical protein AALP_AA4G138800                   2025   0.0      
ref|XP_009141609.1|  PREDICTED: LOW QUALITY PROTEIN: protein SHOO...   2024   0.0      
ref|XP_004494016.1|  PREDICTED: maestro heat-like repeat-containi...   2023   0.0      
ref|XP_004494091.1|  PREDICTED: maestro heat-like repeat-containi...   2022   0.0      
ref|XP_010509433.1|  PREDICTED: protein SHOOT GRAVITROPISM 6           2019   0.0      
ref|XP_006296323.1|  hypothetical protein CARUB_v10025495mg            2016   0.0      
ref|NP_181219.4|  uncharacterized protein                              2015   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006442482.1|  hypothetical protein CICLE_v10023867mg            2005   0.0      
ref|XP_010267300.1|  PREDICTED: protein SHOOT GRAVITROPISM 6 isof...   1986   0.0      
ref|XP_010037124.1|  PREDICTED: protein SHOOT GRAVITROPISM 6 isof...   1982   0.0      
gb|KHG26711.1|  HEAT repeat-containing 7A                              1962   0.0      
ref|XP_008387520.1|  PREDICTED: protein SHOOT GRAVITROPISM 6           1957   0.0      
ref|XP_009397255.1|  PREDICTED: protein SHOOT GRAVITROPISM 6 isof...   1912   0.0      
ref|XP_006843104.1|  hypothetical protein AMTR_s00140p00065970         1892   0.0      
ref|XP_006604595.1|  PREDICTED: maestro heat-like repeat-containi...   1870   0.0      
gb|EYU38579.1|  hypothetical protein MIMGU_mgv1a000131mg               1861   0.0      
ref|XP_009768809.1|  PREDICTED: protein SHOOT GRAVITROPISM 6           1856   0.0      
ref|XP_009397332.1|  PREDICTED: protein SHOOT GRAVITROPISM 6 isof...   1837   0.0      
ref|XP_006604597.1|  PREDICTED: maestro heat-like repeat-containi...   1834   0.0      
ref|XP_006604596.1|  PREDICTED: maestro heat-like repeat-containi...   1832   0.0      
ref|XP_008813465.1|  PREDICTED: protein SHOOT GRAVITROPISM 6           1831   0.0      
gb|EPS71954.1|  hypothetical protein M569_02803                        1819   0.0      
ref|XP_010267299.1|  PREDICTED: protein SHOOT GRAVITROPISM 6 isof...   1754   0.0      
ref|XP_004985717.1|  PREDICTED: LOW QUALITY PROTEIN: maestro heat...   1737   0.0      
ref|XP_006651039.1|  PREDICTED: maestro heat-like repeat-containi...   1729   0.0      
gb|EEE58322.1|  hypothetical protein OsJ_09403                         1724   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EEC74518.1|  hypothetical protein OsI_10014                         1724   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_010229217.1|  PREDICTED: LOW QUALITY PROTEIN: protein SHOO...   1711   0.0      
ref|XP_006381368.1|  hypothetical protein POPTR_0006s12240g            1709   0.0      
ref|XP_007027499.1|  ARM repeat superfamily protein isoform 3          1706   0.0      
ref|XP_009341086.1|  PREDICTED: protein SHOOT GRAVITROPISM 6           1690   0.0      
emb|CDY67451.1|  BnaCnng55010D                                         1532   0.0      
ref|XP_007162801.1|  hypothetical protein PHAVU_001G1818000g           1518   0.0      
ref|XP_009397414.1|  PREDICTED: protein SHOOT GRAVITROPISM 6 isof...   1422   0.0      
gb|AAK98733.1|AC090485_12  Hypothetical protein                        1381   0.0      Oryza sativa [red rice]
ref|XP_008665853.1|  PREDICTED: protein SHOOT GRAVITROPISM 6-like      1379   0.0      
ref|XP_010412903.1|  PREDICTED: protein SHOOT GRAVITROPISM 6-like      1286   0.0      
gb|KDO46966.1|  hypothetical protein CISIN_1g0006553mg                 1189   0.0      
ref|XP_003625712.1|  HEAT repeat-containing protein 7A                 1150   0.0      
gb|KDO46965.1|  hypothetical protein CISIN_1g0006553mg                 1143   0.0      
ref|XP_001770412.1|  predicted protein                                 1136   0.0      
gb|KCW48789.1|  hypothetical protein EUGRSUZ_K024311                   1063   0.0      
ref|XP_010507584.1|  PREDICTED: protein SHOOT GRAVITROPISM 6-like      1047   0.0      
gb|KCW48788.1|  hypothetical protein EUGRSUZ_K024312                   1039   0.0      
tpg|DAA43367.1|  TPA: hypothetical protein ZEAMMB73_966343              969   0.0      
ref|XP_002972118.1|  hypothetical protein SELMODRAFT_412624             927   0.0      
ref|XP_002881470.1|  binding protein                                    915   0.0      
gb|AAD20157.1|  unknown protein                                         911   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|ABF93965.1|  HEAT repeat family protein, expressed                   903   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EMT01688.1|  HEAT repeat-containing 7A-like protein                  876   0.0      
gb|AAO00894.1|  Unknown protein                                         879   0.0      Arabidopsis thaliana [mouse-ear cress]
tpg|DAA43368.1|  TPA: hypothetical protein ZEAMMB73_966343              870   0.0      
gb|KDO46964.1|  hypothetical protein CISIN_1g0006553mg                  845   0.0      
ref|XP_001780240.1|  predicted protein                                  860   0.0      
ref|XP_002993045.1|  hypothetical protein SELMODRAFT_162778             613   0.0      
ref|XP_002468504.1|  hypothetical protein SORBIDRAFT_01g047100          572   0.0      Sorghum bicolor [broomcorn]
tpg|DAA43366.1|  TPA: hypothetical protein ZEAMMB73_966343              533   1e-168   
ref|XP_009771492.1|  PREDICTED: protein SHOOT GRAVITROPISM 6-like       472   1e-148   
gb|KDO46957.1|  hypothetical protein CISIN_1g0006552mg                  445   2e-138   
gb|KDO46984.1|  hypothetical protein CISIN_1g018728mg                   311   4e-118   
ref|XP_004344439.1|  conserved hypothetical protein                     415   1e-115   
tpg|DAA43365.1|  TPA: hypothetical protein ZEAMMB73_728051              366   5e-111   
ref|XP_007162803.1|  hypothetical protein PHAVU_001G182000g             360   3e-109   
ref|XP_006442483.1|  hypothetical protein CICLE_v10024523mg             311   1e-98    
ref|XP_002468505.1|  hypothetical protein SORBIDRAFT_01g047105          266   7e-97    Sorghum bicolor [broomcorn]
gb|KDO46985.1|  hypothetical protein CISIN_1g018728mg                   237   1e-95    
ref|XP_798384.3|  PREDICTED: HEAT repeat-containing protein 7A          300   1e-94    Strongylocentrotus purpuratus [purple urchin]
ref|XP_006381369.1|  hypothetical protein POPTR_0006s12250g             319   2e-94    
ref|XP_006381371.1|  hypothetical protein POPTR_0006s12270g             313   2e-92    
gb|KDO46971.1|  hypothetical protein CISIN_1g0006554mg                  305   2e-90    
ref|XP_635367.1|  hypothetical protein DDB_G0291161                     287   7e-89    Dictyostelium discoideum AX4
ref|XP_003622230.1|  HEAT repeat-containing protein 7A                  295   7e-87    
ref|XP_003291776.1|  hypothetical protein DICPUDRAFT_50034              287   9e-85    
gb|ELT91566.1|  hypothetical protein CAPTEDRAFT_173785                  293   1e-83    
ref|XP_003384630.1|  PREDICTED: HEAT repeat-containing protein 7A...    287   3e-83    
dbj|GAM28545.1|  hypothetical protein SAMD00019534_117210               267   2e-82    
ref|XP_009885148.1|  PREDICTED: maestro heat-like repeat-containi...    273   8e-81    
gb|KDO46976.1|  hypothetical protein CISIN_1g0006554mg                  273   3e-79    
gb|KDO46977.1|  hypothetical protein CISIN_1g0006554mg                  270   1e-78    
ref|XP_008489507.1|  PREDICTED: maestro heat-like repeat-containi...    266   1e-78    
ref|XP_001743639.1|  hypothetical protein                               293   7e-77    Monosiga brevicollis MX1
ref|XP_006276285.1|  PREDICTED: maestro heat-like repeat-containi...    246   2e-74    
gb|EFA77696.1|  hypothetical protein PPL_12305                          283   1e-73    Heterostelium album PN500
ref|XP_004997194.1|  hypothetical protein PTSG_01221                    282   2e-73    
ref|XP_002881471.1|  hypothetical protein ARALYDRAFT_321384             252   5e-73    
tpg|DAA43364.1|  TPA: hypothetical protein ZEAMMB73_478475              248   3e-72    
ref|XP_006032526.1|  PREDICTED: maestro heat-like repeat-containi...    236   4e-72    
ref|XP_004656475.1|  PREDICTED: maestro heat-like repeat-containi...    230   6e-72    
ref|XP_008832666.1|  PREDICTED: maestro heat-like repeat-containi...    236   2e-71    
ref|XP_005316100.1|  PREDICTED: maestro heat-like repeat-containi...    229   4e-71    
gb|KDO46983.1|  hypothetical protein CISIN_1g018728mg                   254   4e-71    
ref|XP_004387453.1|  PREDICTED: HEAT repeat-containing protein 7A...    236   6e-71    
gb|ELV13596.1|  HEAT repeat-containing protein 7A                       233   9e-71    
ref|XP_006162530.1|  PREDICTED: maestro heat-like repeat-containi...    232   2e-70    
ref|XP_008832661.1|  PREDICTED: maestro heat-like repeat-containi...    232   2e-70    
ref|XP_008163307.1|  PREDICTED: maestro heat-like repeat-containi...    239   2e-70    
ref|XP_009495134.1|  hypothetical protein H696_02975                    243   3e-70    
ref|XP_006879292.1|  PREDICTED: maestro heat-like repeat-containi...    230   4e-70    
ref|XP_008251762.1|  PREDICTED: maestro heat-like repeat-containi...    226   4e-70    
ref|XP_008359624.1|  PREDICTED: protein SHOOT GRAVITROPISM 6-like       246   7e-70    
ref|XP_005959762.1|  PREDICTED: maestro heat-like repeat-containi...    234   9e-70    
ref|XP_004580940.1|  PREDICTED: uncharacterized protein LOC101525017    233   1e-69    
dbj|GAM26848.1|  hypothetical protein SAMD00019534_100230               264   2e-69    
ref|XP_009270559.1|  PREDICTED: maestro heat-like repeat-containi...    236   2e-69    
ref|XP_005022597.1|  PREDICTED: maestro heat-like repeat-containi...    239   2e-69    
ref|XP_005959761.1|  PREDICTED: maestro heat-like repeat-containi...    233   2e-69    
ref|XP_005291199.1|  PREDICTED: maestro heat-like repeat-containi...    236   2e-69    
ref|XP_008832670.1|  PREDICTED: maestro heat-like repeat-containi...    232   3e-69    
ref|XP_008682341.1|  PREDICTED: maestro heat-like repeat-containi...    224   3e-69    
ref|XP_010565103.1|  PREDICTED: maestro heat-like repeat-containi...    236   3e-69    
ref|XP_004443071.1|  PREDICTED: HEAT repeat-containing protein 7A...    233   3e-69    
ref|XP_006913041.1|  PREDICTED: maestro heat-like repeat-containi...    233   4e-69    
ref|XP_006830837.1|  PREDICTED: maestro heat-like repeat-containi...    233   6e-69    
gb|KFM00585.1|  Maestro heat-like repeat-containing protein famil...    234   1e-68    
ref|XP_009270552.1|  PREDICTED: maestro heat-like repeat-containi...    233   2e-68    
ref|XP_010565102.1|  PREDICTED: maestro heat-like repeat-containi...    233   3e-68    
ref|XP_006830836.1|  PREDICTED: maestro heat-like repeat-containi...    230   4e-68    
ref|XP_009469630.1|  PREDICTED: maestro heat-like repeat-containi...    231   9e-68    
ref|XP_009673742.1|  PREDICTED: maestro heat-like repeat-containi...    232   1e-67    
ref|XP_009673743.1|  PREDICTED: maestro heat-like repeat-containi...    231   2e-67    
ref|XP_005235275.1|  PREDICTED: maestro heat-like repeat-containi...    230   2e-67    
gb|KFV81573.1|  Maestro heat-like repeat-containing protein famil...    230   3e-67    
ref|XP_006211258.1|  PREDICTED: maestro heat-like repeat-containi...    228   4e-67    
ref|XP_005688955.1|  PREDICTED: LOW QUALITY PROTEIN: maestro heat...    223   5e-67    
ref|XP_005443435.1|  PREDICTED: maestro heat-like repeat-containi...    228   6e-67    
ref|XP_001919596.4|  PREDICTED: maestro heat-like repeat-containi...    261   7e-67    Danio rerio [leopard danio]
ref|XP_004697410.1|  PREDICTED: maestro heat-like repeat-containi...    226   7e-67    
ref|XP_009673740.1|  PREDICTED: maestro heat-like repeat-containi...    229   9e-67    
ref|XP_007610765.1|  PREDICTED: maestro heat-like repeat-containi...    215   1e-66    
ref|XP_009673741.1|  PREDICTED: maestro heat-like repeat-containi...    228   1e-66    
gb|AES78448.2|  HEAT repeat 7A-like protein                             236   1e-66    
ref|XP_006989406.1|  PREDICTED: maestro heat-like repeat-containi...    214   2e-66    
ref|XP_006191140.1|  PREDICTED: maestro heat-like repeat-containi...    226   2e-66    
ref|XP_006989408.1|  PREDICTED: maestro heat-like repeat-containi...    214   2e-66    
gb|KFO98921.1|  Maestro heat-like repeat-containing protein famil...    225   2e-66    
ref|XP_010959525.1|  PREDICTED: maestro heat-like repeat-containi...    225   3e-66    
ref|XP_004265276.1|  PREDICTED: HEAT repeat-containing protein 7A...    226   3e-66    
ref|XP_007610768.1|  PREDICTED: maestro heat-like repeat-containi...    213   4e-66    
ref|XP_009673739.1|  PREDICTED: maestro heat-like repeat-containi...    226   4e-66    
ref|XP_008120944.1|  PREDICTED: maestro heat-like repeat-containi...    259   4e-66    
ref|XP_008122457.1|  PREDICTED: LOW QUALITY PROTEIN: maestro heat...    258   5e-66    
ref|XP_005865093.1|  PREDICTED: maestro heat-like repeat-containi...    220   6e-66    
ref|XP_004472109.1|  PREDICTED: maestro heat-like repeat-containi...    220   6e-66    
gb|ERE81373.1|  HEAT repeat-containing protein 7A-like protein          212   6e-66    
ref|XP_006989405.1|  PREDICTED: maestro heat-like repeat-containi...    213   6e-66    
ref|XP_006989404.1|  PREDICTED: maestro heat-like repeat-containi...    213   6e-66    
ref|XP_007610764.1|  PREDICTED: maestro heat-like repeat-containi...    212   7e-66    
ref|XP_006989407.1|  PREDICTED: maestro heat-like repeat-containi...    212   7e-66    
gb|EPQ07034.1|  HEAT repeat-containing protein 7A                       219   8e-66    
ref|XP_007610767.1|  PREDICTED: maestro heat-like repeat-containi...    212   8e-66    
ref|XP_005613420.1|  PREDICTED: LOW QUALITY PROTEIN: maestro heat...    224   1e-65    
ref|XP_005158232.1|  PREDICTED: maestro heat-like repeat-containi...    257   1e-65    
ref|XP_009673738.1|  PREDICTED: maestro heat-like repeat-containi...    224   2e-65    
ref|XP_004316875.1|  PREDICTED: HEAT repeat-containing protein 7A...    224   2e-65    
ref|XP_010997084.1|  PREDICTED: maestro heat-like repeat-containi...    222   2e-65    
ref|XP_009673737.1|  PREDICTED: maestro heat-like repeat-containi...    224   2e-65    
ref|XP_007104807.1|  PREDICTED: maestro heat-like repeat-containi...    226   4e-65    
ref|XP_005354165.1|  PREDICTED: maestro heat-like repeat-containi...    212   9e-65    
ref|XP_005215247.2|  PREDICTED: maestro heat-like repeat-containi...    214   1e-64    
ref|XP_008832671.1|  PREDICTED: maestro heat-like repeat-containi...    213   1e-64    
gb|EPY76315.1|  maestro heat-like repeat-containing protein famil...    222   2e-64    
ref|XP_002157241.2|  PREDICTED: HEAT repeat-containing protein 7A...    250   2e-64    
ref|XP_006775228.1|  PREDICTED: maestro heat-like repeat-containi...    217   3e-64    
ref|XP_005628368.1|  PREDICTED: HEAT repeat containing 7A               214   3e-64    
ref|XP_004078096.1|  PREDICTED: HEAT repeat-containing protein 7A...    251   1e-63    
tpg|DAA22869.1|  TPA: HEAT repeat-containing protein 7A                 210   1e-63    
ref|NP_001095488.1|  maestro heat-like repeat-containing protein ...    210   1e-63    Bos taurus [bovine]
ref|XP_008157918.1|  PREDICTED: maestro heat-like repeat-containi...    211   1e-63    
ref|XP_005215246.2|  PREDICTED: maestro heat-like repeat-containi...    210   2e-63    
ref|XP_008157917.1|  PREDICTED: maestro heat-like repeat-containi...    211   2e-63    
gb|ELK11736.1|  HEAT repeat-containing protein 7A                       211   5e-63    
ref|XP_005564398.1|  PREDICTED: maestro heat-like repeat-containi...    246   2e-62    
ref|XP_004336292.1|  HEAT repeat domain containing protein              247   2e-62    
ref|XP_007439210.1|  PREDICTED: maestro heat-like repeat-containi...    246   2e-62    
ref|XP_005564391.1|  PREDICTED: maestro heat-like repeat-containi...    246   2e-62    
ref|XP_007439211.1|  PREDICTED: maestro heat-like repeat-containi...    246   5e-62    
ref|XP_008000087.1|  PREDICTED: maestro heat-like repeat-containi...    245   5e-62    
ref|XP_008000092.1|  PREDICTED: maestro heat-like repeat-containi...    243   6e-62    
ref|XP_008000081.1|  PREDICTED: maestro heat-like repeat-containi...    245   7e-62    
ref|XP_008000084.1|  PREDICTED: maestro heat-like repeat-containi...    245   7e-62    
gb|EAW82141.1|  hCG1993037, isoform CRA_h                               242   8e-62    
ref|XP_005564390.1|  PREDICTED: maestro heat-like repeat-containi...    244   9e-62    
ref|XP_006716699.1|  PREDICTED: maestro heat-like repeat-containi...    242   1e-61    
gb|EAW82142.1|  hCG1993037, isoform CRA_i                               242   1e-61    
dbj|BAB47462.1|  KIAA1833 protein                                       243   1e-61    Homo sapiens [man]
ref|XP_005564387.1|  PREDICTED: maestro heat-like repeat-containi...    244   1e-61    
ref|XP_004679984.1|  PREDICTED: maestro heat-like repeat-containi...    211   1e-61    
ref|XP_005564396.1|  PREDICTED: maestro heat-like repeat-containi...    243   1e-61    
ref|XP_005564397.1|  PREDICTED: maestro heat-like repeat-containi...    243   1e-61    
ref|XP_005564392.1|  PREDICTED: maestro heat-like repeat-containi...    244   1e-61    
ref|XP_005564393.1|  PREDICTED: maestro heat-like repeat-containi...    244   1e-61    
ref|XP_008971000.1|  PREDICTED: maestro heat-like repeat-containi...    242   1e-61    
ref|XP_009242457.1|  PREDICTED: maestro heat-like repeat-containi...    244   1e-61    
ref|XP_005564395.1|  PREDICTED: maestro heat-like repeat-containi...    244   2e-61    
ref|XP_007488820.1|  PREDICTED: HEAT repeat containing 7A isoform X6    244   2e-61    
ref|XP_008981267.1|  PREDICTED: maestro heat-like repeat-containi...    243   2e-61    
ref|XP_010328156.1|  PREDICTED: maestro heat-like repeat-containi...    243   2e-61    
ref|XP_008000089.1|  PREDICTED: maestro heat-like repeat-containi...    243   2e-61    
gb|EHH64490.1|  HEAT repeat-containing protein 7A                       243   2e-61    
ref|XP_008000079.1|  PREDICTED: maestro heat-like repeat-containi...    243   2e-61    
ref|XP_008000085.1|  PREDICTED: maestro heat-like repeat-containi...    243   2e-61    
ref|XP_008000082.1|  PREDICTED: maestro heat-like repeat-containi...    243   3e-61    
ref|XP_008000080.1|  PREDICTED: maestro heat-like repeat-containi...    243   3e-61    
ref|XP_006716692.1|  PREDICTED: maestro heat-like repeat-containi...    243   3e-61    
ref|XP_008000086.1|  PREDICTED: maestro heat-like repeat-containi...    243   3e-61    
ref|XP_008000088.1|  PREDICTED: maestro heat-like repeat-containi...    243   3e-61    
ref|XP_006716694.1|  PREDICTED: maestro heat-like repeat-containi...    243   3e-61    
ref|XP_008970998.1|  PREDICTED: maestro heat-like repeat-containi...    243   3e-61    
ref|XP_008000090.1|  PREDICTED: maestro heat-like repeat-containi...    242   3e-61    
ref|NP_001275743.1|  maestro heat-like repeat-containing protein ...    243   3e-61    
ref|XP_008970996.1|  PREDICTED: maestro heat-like repeat-containi...    243   4e-61    
gb|EHH28838.1|  HEAT repeat-containing protein 7A                       243   4e-61    
ref|XP_009454499.1|  PREDICTED: LOW QUALITY PROTEIN: maestro heat...    242   4e-61    
ref|XP_010328157.1|  PREDICTED: maestro heat-like repeat-containi...    241   5e-61    
ref|XP_008981270.1|  PREDICTED: maestro heat-like repeat-containi...    242   5e-61    
ref|XP_010726414.1|  PREDICTED: maestro heat-like repeat-containi...    204   5e-61    
ref|XP_006716689.1|  PREDICTED: maestro heat-like repeat-containi...    242   6e-61    
dbj|BAG58577.1|  unnamed protein product                                240   7e-61    Homo sapiens [man]
ref|XP_008981265.1|  PREDICTED: maestro heat-like repeat-containi...    242   7e-61    
ref|XP_006716698.1|  PREDICTED: maestro heat-like repeat-containi...    241   7e-61    
ref|XP_008981266.1|  PREDICTED: maestro heat-like repeat-containi...    242   7e-61    
gb|EAW82139.1|  hCG1993037, isoform CRA_f                               241   7e-61    
ref|XP_002759191.1|  PREDICTED: maestro heat-like repeat-containi...    241   8e-61    Callithrix jacchus [common marmoset]
ref|NP_115826.2|  maestro heat-like repeat-containing protein fam...    241   8e-61    Homo sapiens [man]
ref|XP_010328154.1|  PREDICTED: maestro heat-like repeat-containi...    241   9e-61    
sp|Q8NDA8.3|MROH1_HUMAN  RecName: Full=Maestro heat-like repeat-c...    241   9e-61    Homo sapiens [man]
ref|XP_010373601.1|  PREDICTED: maestro heat-like repeat-containi...    241   1e-60    
ref|XP_006716697.1|  PREDICTED: maestro heat-like repeat-containi...    241   1e-60    
emb|CAD38979.1|  hypothetical protein                                   241   1e-60    Homo sapiens [man]
ref|XP_006716695.1|  PREDICTED: maestro heat-like repeat-containi...    241   1e-60    
ref|XP_007516086.1|  PREDICTED: maestro heat-like repeat-containi...    241   1e-60    
ref|XP_007488819.1|  PREDICTED: HEAT repeat containing 7A isoform X5    241   1e-60    
gb|ELR54885.1|  HEAT repeat-containing protein 7A                       200   2e-60    
ref|XP_005897918.1|  PREDICTED: maestro heat-like repeat-containi...    200   2e-60    
ref|XP_007249774.1|  PREDICTED: maestro heat-like repeat-containi...    240   2e-60    
ref|XP_008970995.1|  PREDICTED: maestro heat-like repeat-containi...    240   2e-60    
ref|XP_008970997.1|  PREDICTED: maestro heat-like repeat-containi...    240   2e-60    
ref|XP_010810148.1|  PREDICTED: maestro heat-like repeat-containi...    199   3e-60    
ref|XP_010600022.1|  PREDICTED: maestro heat-like repeat-containi...    202   3e-60    
ref|XP_006635903.1|  PREDICTED: maestro heat-like repeat-containi...    239   4e-60    
ref|XP_008321451.1|  PREDICTED: maestro heat-like repeat-containi...    239   4e-60    
ref|XP_002108256.1|  hypothetical protein TRIADDRAFT_52558              239   4e-60    
ref|XP_010810146.1|  PREDICTED: maestro heat-like repeat-containi...    198   5e-60    
ref|XP_007249773.1|  PREDICTED: maestro heat-like repeat-containi...    238   8e-60    
ref|XP_005655378.1|  PREDICTED: maestro heat-like repeat-containi...    235   1e-59    
ref|XP_005655379.1|  PREDICTED: maestro heat-like repeat-containi...    235   1e-59    
ref|XP_007488818.1|  PREDICTED: HEAT repeat containing 7A isoform X4    238   1e-59    
ref|XP_008321450.1|  PREDICTED: maestro heat-like repeat-containi...    238   1e-59    
ref|XP_009242456.1|  PREDICTED: maestro heat-like repeat-containi...    233   2e-59    
ref|XP_003760584.1|  PREDICTED: HEAT repeat-containing protein 7A...    235   6e-59    
ref|XP_005450676.1|  PREDICTED: HEAT repeat containing 7A isoform X6    235   8e-59    
ref|XP_007488815.1|  PREDICTED: HEAT repeat containing 7A isoform X1    235   8e-59    
ref|XP_005000943.1|  PREDICTED: maestro heat-like repeat-containi...    235   9e-59    
ref|XP_007488821.1|  PREDICTED: HEAT repeat containing 7A isoform X7    234   9e-59    
ref|XP_006795011.1|  PREDICTED: maestro heat-like repeat-containi...    234   9e-59    
ref|XP_008068180.1|  PREDICTED: maestro heat-like repeat-containi...    235   1e-58    
ref|XP_005000941.1|  PREDICTED: maestro heat-like repeat-containi...    234   2e-58    
ref|XP_010628834.1|  PREDICTED: maestro heat-like repeat-containi...    234   2e-58    
ref|XP_010628836.1|  PREDICTED: maestro heat-like repeat-containi...    234   2e-58    
ref|XP_008970993.1|  PREDICTED: maestro heat-like repeat-containi...    233   2e-58    
gb|EOA99128.1|  HEAT repeat-containing protein KIAA1833                 233   3e-58    
ref|XP_005000942.1|  PREDICTED: maestro heat-like repeat-containi...    233   3e-58    
ref|XP_005000944.1|  PREDICTED: maestro heat-like repeat-containi...    233   3e-58    
ref|XP_005655375.1|  PREDICTED: maestro heat-like repeat-containi...    230   4e-58    
ref|XP_010810144.1|  PREDICTED: maestro heat-like repeat-containi...    192   5e-58    
ref|XP_005450672.1|  PREDICTED: HEAT repeat containing 7A isoform X2    233   5e-58    
ref|XP_004618710.1|  PREDICTED: maestro heat-like repeat-containi...    233   5e-58    
ref|XP_008832667.1|  PREDICTED: maestro heat-like repeat-containi...    232   5e-58    
ref|XP_005996868.1|  PREDICTED: maestro heat-like repeat-containi...    232   6e-58    
ref|XP_009332858.1|  PREDICTED: LOW QUALITY PROTEIN: maestro heat...    198   6e-58    
ref|XP_010628835.1|  PREDICTED: maestro heat-like repeat-containi...    232   7e-58    
ref|XP_004837797.1|  PREDICTED: maestro heat-like repeat-containi...    232   7e-58    
ref|XP_010628827.1|  PREDICTED: maestro heat-like repeat-containi...    232   8e-58    
ref|XP_007249772.1|  PREDICTED: maestro heat-like repeat-containi...    231   8e-58    
ref|XP_005943891.1|  PREDICTED: maestro heat-like repeat-containi...    232   9e-58    
ref|XP_010628837.1|  PREDICTED: maestro heat-like repeat-containi...    231   9e-58    
ref|XP_004906875.1|  PREDICTED: maestro heat-like repeat-containi...    231   1e-57    
ref|XP_008970999.1|  PREDICTED: maestro heat-like repeat-containi...    231   1e-57    
ref|XP_008832669.1|  PREDICTED: maestro heat-like repeat-containi...    190   1e-57    
ref|XP_003463735.1|  PREDICTED: maestro heat-like repeat-containi...    231   1e-57    
ref|XP_004837793.1|  PREDICTED: maestro heat-like repeat-containi...    231   1e-57    
ref|XP_008970991.1|  PREDICTED: maestro heat-like repeat-containi...    231   1e-57    
ref|XP_008970994.1|  PREDICTED: maestro heat-like repeat-containi...    231   1e-57    
ref|XP_007249771.1|  PREDICTED: maestro heat-like repeat-containi...    230   2e-57    
ref|XP_005943888.1|  PREDICTED: maestro heat-like repeat-containi...    229   4e-57    
ref|XP_010810149.1|  PREDICTED: maestro heat-like repeat-containi...    188   5e-57    
ref|XP_004568167.1|  PREDICTED: maestro heat-like repeat-containi...    229   5e-57    
ref|XP_004568170.1|  PREDICTED: maestro heat-like repeat-containi...    229   7e-57    
ref|XP_004400780.1|  PREDICTED: HEAT repeat-containing protein 7A...    229   7e-57    
ref|XP_010810143.1|  PREDICTED: maestro heat-like repeat-containi...    187   8e-57    
ref|XP_010810145.1|  PREDICTED: maestro heat-like repeat-containi...    187   8e-57    
ref|XP_010810139.1|  PREDICTED: maestro heat-like repeat-containi...    187   9e-57    
ref|XP_010810147.1|  PREDICTED: maestro heat-like repeat-containi...    187   1e-56    
ref|XP_007552611.1|  PREDICTED: maestro heat-like repeat-containi...    226   5e-56    
ref|XP_002122217.3|  PREDICTED: maestro heat-like repeat-containi...    224   1e-55    
ref|XP_006943574.1|  PREDICTED: maestro heat-like repeat-containi...    225   1e-55    
ref|XP_009632503.1|  PREDICTED: LOW QUALITY PROTEIN: maestro heat...    224   1e-55    
ref|XP_007610766.1|  PREDICTED: maestro heat-like repeat-containi...    177   2e-55    
ref|XP_007552540.1|  PREDICTED: maestro heat-like repeat-containi...    224   2e-55    
gb|EDM15975.1|  rCG59505                                                224   2e-55    
ref|XP_010882940.1|  PREDICTED: maestro heat-like repeat-containi...    224   2e-55    
ref|XP_005395916.1|  PREDICTED: maestro heat-like repeat-containi...    223   3e-55    
gb|EFB17016.1|  hypothetical protein PANDA_011080                       222   7e-55    
ref|XP_002922138.1|  PREDICTED: HEAT repeat-containing protein 7A...    222   9e-55    
ref|XP_001638533.1|  predicted protein                                  192   1e-54    
gb|KCW48790.1|  hypothetical protein EUGRSUZ_K02432                     201   1e-54    
ref|NP_001155961.1|  HEAT repeat containing 7A isoform 2                219   1e-54    
dbj|BAC65844.1|  mKIAA1833 protein                                      219   2e-54    
ref|XP_010842511.1|  PREDICTED: maestro heat-like repeat-containi...    192   2e-54    
ref|XP_006520838.1|  PREDICTED: HEAT repeat containing 7A isoform X3    221   3e-54    
ref|XP_007464667.1|  PREDICTED: maestro heat-like repeat-containi...    219   5e-54    
gb|EDL29564.1|  mCG134445, isoform CRA_a                                219   5e-54    
ref|XP_006520845.1|  PREDICTED: HEAT repeat containing 7A isoform...    218   6e-54    
ref|XP_006520843.1|  PREDICTED: HEAT repeat containing 7A isoform X8    218   1e-53    
ref|XP_006064694.1|  PREDICTED: maestro heat-like repeat-containi...    218   1e-53    
ref|XP_006064695.1|  PREDICTED: maestro heat-like repeat-containi...    218   1e-53    
ref|XP_006520846.1|  PREDICTED: HEAT repeat containing 7A isoform...    216   1e-53    
ref|XP_006520844.1|  PREDICTED: HEAT repeat containing 7A isoform X9    217   1e-53    
ref|XP_006520836.1|  PREDICTED: HEAT repeat containing 7A isoform X1    218   1e-53    
ref|XP_006520839.1|  PREDICTED: HEAT repeat containing 7A isoform X4    218   2e-53    
ref|XP_006520837.1|  PREDICTED: HEAT repeat containing 7A isoform X2    218   2e-53    
ref|XP_006520841.1|  PREDICTED: HEAT repeat containing 7A isoform X6    218   2e-53    
gb|EDL29565.1|  mCG134445, isoform CRA_b                                217   2e-53    
ref|XP_006520840.1|  PREDICTED: HEAT repeat containing 7A isoform X5    217   3e-53    
ref|NP_780666.3|  HEAT repeat containing 7A isoform 1                   217   3e-53    
ref|XP_004638937.1|  PREDICTED: maestro heat-like repeat-containi...    217   3e-53    
ref|XP_008000091.1|  PREDICTED: maestro heat-like repeat-containi...    216   5e-53    
ref|XP_004826155.1|  PREDICTED: maestro heat-like repeat-containi...    216   6e-53    
ref|XP_004779564.1|  PREDICTED: maestro heat-like repeat-containi...    216   6e-53    
ref|XP_008430285.1|  PREDICTED: maestro heat-like repeat-containi...    214   2e-52    
ref|XP_005799093.1|  PREDICTED: maestro heat-like repeat-containi...    214   2e-52    
ref|XP_007954301.1|  PREDICTED: maestro heat-like repeat-containi...    214   2e-52    
ref|XP_007646450.1|  PREDICTED: maestro heat-like repeat-containi...    213   3e-52    
ref|XP_008430286.1|  PREDICTED: maestro heat-like repeat-containi...    213   5e-52    
ref|XP_008430284.1|  PREDICTED: maestro heat-like repeat-containi...    213   6e-52    
ref|XP_006064690.1|  PREDICTED: maestro heat-like repeat-containi...    212   8e-52    
gb|EAW82135.1|  hCG1993037, isoform CRA_b                               211   1e-51    
ref|XP_004360467.1|  hypothetical protein DFA_04746                     211   1e-51    
ref|XP_008296993.1|  PREDICTED: maestro heat-like repeat-containi...    211   2e-51    
ref|XP_007659988.1|  PREDICTED: maestro heat-like repeat-containi...    210   2e-51    
ref|XP_008296992.1|  PREDICTED: maestro heat-like repeat-containi...    209   9e-51    
gb|KDO46962.1|  hypothetical protein CISIN_1g0006552mg                  188   1e-50    
ref|XP_006064697.1|  PREDICTED: maestro heat-like repeat-containi...    207   1e-50    
ref|XP_006064696.1|  PREDICTED: maestro heat-like repeat-containi...    207   1e-50    
ref|XP_006064691.1|  PREDICTED: maestro heat-like repeat-containi...    207   2e-50    
ref|XP_003966003.1|  PREDICTED: HEAT repeat-containing protein 7A...    207   2e-50    
ref|XP_006064693.1|  PREDICTED: maestro heat-like repeat-containi...    207   2e-50    
gb|EHB16896.1|  HEAT repeat-containing protein 7A                       207   3e-50    
emb|CDY57715.1|  BnaC04g51880D                                          194   3e-50    
ref|XP_009585311.1|  PREDICTED: maestro heat-like repeat-containi...    174   2e-49    
ref|XP_007162802.1|  hypothetical protein PHAVU_001G181900g             186   2e-49    
ref|XP_010565104.1|  PREDICTED: maestro heat-like repeat-containi...    169   4e-49    
ref|XP_003802411.1|  PREDICTED: LOW QUALITY PROTEIN: HEAT repeat-...    203   5e-49    
ref|XP_002808538.1|  PREDICTED: LOW QUALITY PROTEIN: HEAT repeat-...    202   9e-49    
ref|XP_007166985.1|  PREDICTED: LOW QUALITY PROTEIN: maestro heat...    196   1e-46    
ref|XP_010075184.1|  PREDICTED: maestro heat-like repeat-containi...    162   2e-46    
gb|AFW89711.1|  hypothetical protein ZEAMMB73_406173                    183   7e-46    
ref|XP_010516908.1|  PREDICTED: protein SHOOT GRAVITROPISM 6-like       171   2e-45    
ref|XP_009212047.1|  PREDICTED: LOW QUALITY PROTEIN: maestro heat...    188   2e-44    
gb|KFV64779.1|  Maestro heat-like repeat-containing protein famil...    187   3e-44    
gb|EKC24072.1|  HEAT repeat-containing protein 7A                       182   8e-44    
ref|XP_006746379.1|  PREDICTED: maestro heat-like repeat-containi...    185   2e-43    
ref|XP_008569931.1|  PREDICTED: maestro heat-like repeat-containi...    181   3e-42    
ref|XP_008504990.1|  PREDICTED: maestro heat-like repeat-containi...    178   2e-41    
gb|KFM62094.1|  HEAT repeat-containing protein 7A                       172   9e-40    
ref|XP_010095792.1|  hypothetical protein L484_017600                   166   4e-39    
ref|XP_006064692.1|  PREDICTED: maestro heat-like repeat-containi...    170   7e-39    
ref|XP_002406463.1|  heat domain-containing protein, putative           169   9e-39    
ref|XP_003481371.1|  PREDICTED: maestro heat-like repeat-containi...    168   3e-38    
ref|XP_010740642.1|  PREDICTED: LOW QUALITY PROTEIN: maestro heat...    167   6e-38    
ref|XP_002604946.1|  hypothetical protein BRAFLDRAFT_77203              165   2e-37    
ref|XP_002671935.1|  hypothetical protein NAEGRDRAFT_59307              165   3e-37    
ref|XP_006520842.1|  PREDICTED: HEAT repeat containing 7A isoform X7    162   2e-36    
emb|CDJ91151.1|  HEAT domain containing protein                         162   2e-36    
gb|KFD65737.1|  hypothetical protein M514_13667                         161   3e-36    
gb|KFD45456.1|  hypothetical protein M513_13667                         161   3e-36    
gb|EAW82138.1|  hCG1993037, isoform CRA_e                               156   7e-36    
gb|ERG80900.1|  heat repeat-containing protein 7a                       159   2e-35    
ref|XP_008000093.1|  PREDICTED: maestro heat-like repeat-containi...    154   3e-35    
ref|XP_003111374.1|  hypothetical protein CRE_03773                     157   5e-35    
ref|NP_001263449.1|  Protein HPO-27                                     156   1e-34    
ref|XP_005743267.1|  PREDICTED: maestro heat-like repeat-containi...    123   1e-34    
gb|EGT35423.1|  hypothetical protein CAEBREN_28110                      156   2e-34    
ref|XP_009895418.1|  PREDICTED: maestro heat-like repeat-containi...    154   3e-34    
ref|XP_010785898.1|  PREDICTED: maestro heat-like repeat-containi...    154   3e-34    
gb|ETN68843.1|  hypothetical protein NECAME_05432                       154   4e-34    
ref|XP_002639434.1|  Hypothetical protein CBG04027                      154   5e-34    
gb|KHN73012.1|  Maestro heat-like repeat-containing protein famil...    154   6e-34    
gb|AAD20158.1|  unknown protein                                         141   1e-33    
gb|KHJ95445.1|  HEAT repeat protein                                     152   1e-33    
ref|XP_004047725.1|  PREDICTED: HEAT repeat-containing protein 7A...    151   3e-33    
ref|XP_004047727.1|  PREDICTED: HEAT repeat-containing protein 7A...    150   4e-33    
gb|EKC40234.1|  HEAT repeat-containing protein 7A                       150   6e-33    
ref|XP_009079043.1|  PREDICTED: maestro heat-like repeat-containi...    113   4e-32    
emb|CAP24821.2|  Protein CBR-HPO-27                                     147   5e-32    
gb|KHJ43672.1|  HEAT repeat protein                                     147   6e-32    
gb|EYB94084.1|  hypothetical protein Y032_0175g484                      145   2e-31    
gb|EYB94085.1|  hypothetical protein Y032_0175g484                      145   2e-31    
ref|XP_003625711.1|  hypothetical protein MTR_7g102420                  128   3e-30    
emb|CAG12883.1|  unnamed protein product                                140   6e-30    
emb|CAN77521.1|  hypothetical protein VITISV_033070                     130   1e-29    
ref|XP_007884049.1|  PREDICTED: maestro heat-like repeat-containi...    138   4e-29    
ref|WP_028833029.1|  hypothetical protein                               136   2e-28    
ref|XP_001892621.1|  hypothetical protein                               134   6e-28    
emb|CDP91358.1|  Protein BM-HPO-27, isoform b                           134   6e-28    
ref|XP_786316.3|  PREDICTED: HEAT repeat-containing protein 7A ho...    130   3e-27    
gb|EGV92713.1|  HEAT repeat-containing protein 7A                       127   3e-27    
ref|XP_008119033.1|  PREDICTED: maestro heat-like repeat-containi...    130   1e-26    
ref|XP_008119031.1|  PREDICTED: maestro heat-like repeat-containi...    130   1e-26    
ref|XP_009175093.1|  hypothetical protein T265_10454                    130   1e-26    
dbj|GAA56819.1|  HEAT repeat-containing protein 7A homolog              130   1e-26    
ref|XP_004011947.1|  PREDICTED: LOW QUALITY PROTEIN: HEAT repeat-...    129   2e-26    
gb|EGT33401.1|  hypothetical protein CAEBREN_04895                      129   3e-26    
ref|XP_003138262.1|  hypothetical protein LOAG_02677                    129   3e-26    
ref|XP_008661252.1|  PREDICTED: protein SHOOT GRAVITROPISM 6-like       117   4e-26    
gb|EFO25806.2|  hypothetical protein LOAG_02677                         128   4e-26    
ref|XP_009061419.1|  hypothetical protein LOTGIDRAFT_234834             125   2e-25    
ref|XP_009025556.1|  hypothetical protein HELRODRAFT_189222             125   3e-25    
ref|XP_010287146.1|  PREDICTED: LOW QUALITY PROTEIN: maestro heat...    120   1e-24    
ref|XP_007899439.1|  PREDICTED: maestro heat-like repeat-containi...  90.1    3e-24    
gb|KHN18694.1|  hypothetical protein glysoja_021445                     110   4e-24    
ref|XP_005619423.1|  PREDICTED: HEAT repeat family member 7B2 iso...    122   4e-24    
ref|XP_536489.3|  PREDICTED: HEAT repeat family member 7B2 isofor...    122   4e-24    
ref|XP_003625713.1|  hypothetical protein MTR_7g102440                  110   5e-24    
ref|XP_005619424.1|  PREDICTED: HEAT repeat family member 7B2 iso...    121   5e-24    
ref|XP_005110570.1|  PREDICTED: LOW QUALITY PROTEIN: maestro heat...    120   7e-24    
ref|XP_004678531.1|  PREDICTED: maestro heat-like repeat-containi...    120   8e-24    
ref|XP_007520576.1|  PREDICTED: maestro heat-like repeat-containi...    119   2e-23    
ref|XP_010192594.1|  PREDICTED: maestro heat-like repeat-containi...    114   2e-23    
ref|XP_007068915.1|  PREDICTED: maestro heat-like repeat-containi...  80.9    3e-23    
ref|XP_008759027.1|  PREDICTED: maestro heat-like repeat-containi...    119   3e-23    
ref|XP_006928146.1|  PREDICTED: LOW QUALITY PROTEIN: HEAT repeat ...    119   3e-23    
gb|EMP27282.1|  HEAT repeat-containing protein 7A                     80.9    4e-23    
ref|XP_003803046.1|  PREDICTED: HEAT repeat-containing protein 7B1      118   4e-23    
ref|XP_008688768.1|  PREDICTED: maestro heat-like repeat-containi...    118   4e-23    
ref|XP_007095498.1|  PREDICTED: maestro heat-like repeat-containi...    118   5e-23    
ref|XP_007083085.1|  PREDICTED: maestro heat-like repeat-containi...    118   5e-23    
ref|XP_004409198.1|  PREDICTED: HEAT repeat-containing protein 7B2      118   5e-23    
ref|XP_003991341.1|  PREDICTED: HEAT repeat containing 7B1              118   6e-23    
ref|XP_005604350.1|  PREDICTED: HEAT repeat family member 7B2 iso...    118   6e-23    
ref|XP_005604352.1|  PREDICTED: HEAT repeat family member 7B2 iso...    117   6e-23    
ref|XP_008535345.1|  PREDICTED: maestro heat-like repeat-containi...    117   6e-23    
ref|XP_002922653.1|  PREDICTED: HEAT repeat-containing protein 7B...    117   1e-22    
gb|EFB20643.1|  hypothetical protein PANDA_006367                       117   1e-22    
ref|XP_002918008.1|  PREDICTED: protein LOC339766-like                  117   1e-22    
ref|XP_010852021.1|  PREDICTED: maestro heat-like repeat-containi...    117   1e-22    
gb|EFB14078.1|  hypothetical protein PANDA_011635                       117   1e-22    
ref|XP_005110571.1|  PREDICTED: maestro heat-like repeat-containi...  69.7    2e-22    
ref|XP_006520044.1|  PREDICTED: maestro heat-like repeat family m...    115   2e-22    
ref|XP_005889787.1|  PREDICTED: maestro heat-like repeat-containi...    116   2e-22    
ref|XP_004738014.1|  PREDICTED: maestro heat-like repeat-containi...    116   2e-22    
ref|XP_004738016.1|  PREDICTED: maestro heat-like repeat-containi...    116   2e-22    
ref|XP_009993165.1|  PREDICTED: LOW QUALITY PROTEIN: maestro heat...    115   2e-22    
ref|XP_004738015.1|  PREDICTED: maestro heat-like repeat-containi...    115   2e-22    



>ref|XP_009604196.1| PREDICTED: protein SHOOT GRAVITROPISM 6 isoform X1 [Nicotiana 
tomentosiformis]
Length=1730

 Score =  2397 bits (6211),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1237/1527 (81%), Positives = 1366/1527 (89%), Gaps = 8/1527 (1%)
 Frame = +2

Query  617   KYTGQSLQMACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALG  796
             KY  QS    CWQ S+DF LS++LD D++SFLNSAFELLLRVWA+SRDLKVRLS+VEALG
Sbjct  195   KYWCQS----CWQCSIDFPLSSVLDADIMSFLNSAFELLLRVWAISRDLKVRLSSVEALG  250

Query  797   QMVGLITRTQLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFE  976
             QMVGLITRTQLKAALPRL+PTILELYKR+ D AFVATCSLH++LNASLLS +GPPLLD E
Sbjct  251   QMVGLITRTQLKAALPRLIPTILELYKRDHDVAFVATCSLHNVLNASLLSESGPPLLDLE  310

Query  977   Dltvvlstll-lvCSNNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRL  1153
             DLTV+LSTLL +VC +NDKKEHSDF VGLKTYNEVQHCFLT+G VYP DLFVFLLNKC+L
Sbjct  311   DLTVILSTLLPVVCRSNDKKEHSDFSVGLKTYNEVQHCFLTIGLVYPADLFVFLLNKCKL  370

Query  1154  KEEPFTFGSLCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASH  1333
             KEEP   G+LCVLKHLLPRL+E+WHNKRP+LIE VKLL+DE NLGV KALAELIVVMASH
Sbjct  371   KEEPQAVGALCVLKHLLPRLSEAWHNKRPLLIEVVKLLLDELNLGVCKALAELIVVMASH  430

Query  1334  CYLVGSSGELFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTT  1513
             CYLVG SGELFIEYLVRH AM  L   + E SRE +     YYPFVY+K E K    T +
Sbjct  431   CYLVGPSGELFIEYLVRHSAMFGLHRDDTERSRELNSSNDGYYPFVYKKTETKMEVGTLS  490

Query  1514  ELRGVCEKGLLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESN  1693
             ELR +CE GLLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVC+CISELCRRRSS+S 
Sbjct  491   ELRAICETGLLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCKCISELCRRRSSQSG  550

Query  1694  AMLSECKARTDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQD  1873
             A + ECKAR DIP PEELFARLVVLLHNPLARE L TQIL+VL YLAPLFPKN+N FWQD
Sbjct  551   AGVLECKARADIPHPEELFARLVVLLHNPLAREQLATQILTVLCYLAPLFPKNVNLFWQD  610

Query  1874  EL*IPKMKAYVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYE  2053
             E  IPKMKAYVSDTEDLKQDP YQESWDDMII+F+AESLDVIQ+VDW++ LGN F +QYE
Sbjct  611   E--IPKMKAYVSDTEDLKQDPSYQESWDDMIINFIAESLDVIQDVDWIISLGNAFEKQYE  668

Query  2054  LYKSDNEHSALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAA  2233
             LY  D+EHSALLHRCLGILLQKVHDRAYV AKI LMY+QANI +PTNRLGLAKAMGLVAA
Sbjct  669   LYSPDDEHSALLHRCLGILLQKVHDRAYVHAKIYLMYKQANITIPTNRLGLAKAMGLVAA  728

Query  2234  SHLDTVLDKLKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTV  2413
             SHLDTVLDKLK ILDNVG+SI QRI SFFSDRGKMEESDD HAALALMYGYAAKYAP TV
Sbjct  729   SHLDTVLDKLKDILDNVGKSIFQRILSFFSDRGKMEESDDIHAALALMYGYAAKYAPSTV  788

Query  2414  IEARIDALVGTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLD  2593
             IEARIDALVGTNMLSRLLHVRHP AKQAVITAIDLLGQAVI A+ESGISFPLKRRD LLD
Sbjct  789   IEARIDALVGTNMLSRLLHVRHPTAKQAVITAIDLLGQAVINAAESGISFPLKRRDQLLD  848

Query  2594  YILTLMGRDEEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGL  2773
             YILTLMG DEE+GFS+SN E L TQS ALSACTTLVSVEPKLTTETRNL+MKAT+GFFGL
Sbjct  849   YILTLMGSDEEDGFSESNTEHLRTQSFALSACTTLVSVEPKLTTETRNLVMKATVGFFGL  908

Query  2774  PNDPSDVINPLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGC  2953
             PN+P+DVI+PLI NLITLLCTIL+TSGEDGRSRAEQLLHILR +D +VSSSL+YQRKRGC
Sbjct  909   PNEPADVIDPLIGNLITLLCTILITSGEDGRSRAEQLLHILRKVDLYVSSSLDYQRKRGC  968

Query  2954  LAAHELLIKFRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGE  3133
             LAAHELL KFR IC++GYCALGC+G+C+H ++ D A +  LSNLPSAF LPSRDAL LGE
Sbjct  969   LAAHELLFKFRMICISGYCALGCRGTCTHREKTDRALHHTLSNLPSAFALPSRDALRLGE  1028

Query  3134  RIMVYLPRCIDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVV  3313
             R M+YLPR +DT+ EVRKVSVQIL+L+F+IS SLP+P NSS   DIE SY ALSSLEDV+
Sbjct  1029  RTMMYLPRSVDTSSEVRKVSVQILHLYFSISLSLPRPANSSFTNDIESSYSALSSLEDVI  1088

Query  3314  AILRSDASIDPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEF  3493
             AILRSDASIDPSEVFNRVVSSVC LL KDEL AALHGCSGAICDKIKQSAEGAIQAV EF
Sbjct  1089  AILRSDASIDPSEVFNRVVSSVCILLTKDELAAALHGCSGAICDKIKQSAEGAIQAVNEF  1148

Query  3494  VTNRGNELNEIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAA  3673
             VT RGN LNE +++RT+QSLL+AV+HVTEKYLRQE LGAICS+AENT+S++VF EVLAAA
Sbjct  1149  VTKRGNTLNETDIARTTQSLLSAVIHVTEKYLRQEALGAICSLAENTSSRIVFNEVLAAA  1208

Query  3674  GRDMVTKDIHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESS  3853
              +D+ TKDI RLRGGWPIQDAFH FSQH VLS +FL+HV+SVINQ P L GGD    ESS
Sbjct  1209  RKDIATKDISRLRGGWPIQDAFHVFSQHSVLSFTFLDHVMSVINQLPPL-GGDLDHDESS  1267

Query  3854  RNSVDGSIEDDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYG  4033
              ++VD  +ED+++RAA++ALTAFFRGGGK G+K VEQSYASVLATLTLHLG+CHGLA  G
Sbjct  1268  EHAVDSIVEDNIARAAIVALTAFFRGGGKVGKKAVEQSYASVLATLTLHLGSCHGLARTG  1327

Query  4034  DQEPLRALLNAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVP  4213
             + EPLRALL AFQAFCECVGDLEMGKILAR GEQ+ENEKWINLI +L+G ISIKRPKEVP
Sbjct  1328  ELEPLRALLAAFQAFCECVGDLEMGKILARDGEQSENEKWINLIRDLSGCISIKRPKEVP  1387

Query  4214  TICLFLSKSLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRL  4393
              ICL LSK+LDR LR QRE+AAAALSEFLR+SDGFGPLL QMV+ALCRHVSD SPTVRRL
Sbjct  1388  DICLILSKALDRSLRFQRESAAAALSEFLRHSDGFGPLLEQMVQALCRHVSDASPTVRRL  1447

Query  4394  CLRGLVQMPSIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLL  4573
             CLRGLVQMPSIHVLQYTTQILGVILALLDDSDESVQLTAVSCLL+VLESSS DAVEPVLL
Sbjct  1448  CLRGLVQMPSIHVLQYTTQILGVILALLDDSDESVQLTAVSCLLMVLESSSRDAVEPVLL  1507

Query  4574  NLSIRLRNLQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDL  4753
             NLSIRLRNLQVC+N KIRANA+AAFGALS+YG G   DSF EQ+HAAFPRMVLHLH+DDL
Sbjct  1508  NLSIRLRNLQVCMNEKIRANAYAAFGALSTYGTGPQRDSFLEQVHAAFPRMVLHLHEDDL  1567

Query  4754  GVRQACRNTLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDT  4933
              VRQACR+TLKC+APL+EID I ALLNTH FSSDHRSDYEDFLR+LARQLTQ+L  RVDT
Sbjct  1568  SVRQACRSTLKCVAPLMEIDGINALLNTHWFSSDHRSDYEDFLRELARQLTQHLAARVDT  1627

Query  4934  YLSAIIQAFDAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIV  5113
             Y+++IIQAFDAPWPV+QANAVYLCSS+LSLSD+K+ISAL+Y+QVFG+LVGK S STDAIV
Sbjct  1628  YMASIIQAFDAPWPVVQANAVYLCSSVLSLSDDKHISALFYNQVFGMLVGKMSRSTDAIV  1687

Query  5114  RATCSAALGLLLKSPNSSSWRDARLNK  5194
             RATCS+ALGLLLKS N+SSW+D RL++
Sbjct  1688  RATCSSALGLLLKSSNASSWKDVRLDR  1714


 Score =   343 bits (879),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 164/188 (87%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = +1

Query  85   GDSIPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGN  264
            G+S+PA+EAVQV+VSSLADDSP VREASM+ALKDITSLNPLLVLDCCLTVSRGGRRRFGN
Sbjct  7    GNSVPAAEAVQVLVSSLADDSPIVREASMAALKDITSLNPLLVLDCCLTVSRGGRRRFGN  66

Query  265  IAGLFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSH  444
            IAGLFQV+SVAI+ALDKGD+DP ++ KLAKIAT+EVISTKELNADWQRAAAGVLVS+GSH
Sbjct  67   IAGLFQVMSVAIQALDKGDIDPNYLAKLAKIATSEVISTKELNADWQRAAAGVLVSIGSH  126

Query  445  LPDLMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIY  624
            +PDLMMEEIFLH SGSNSALPAMVQILAD+ASSDALQFTP LKGVLA+VVPILGNVR+I+
Sbjct  127  MPDLMMEEIFLHLSGSNSALPAMVQILADFASSDALQFTPHLKGVLAQVVPILGNVRDIH  186

Query  625  RPIFANGL  648
            RPIFAN  
Sbjct  187  RPIFANAF  194



>ref|XP_010325956.1| PREDICTED: protein SHOOT GRAVITROPISM 6 [Solanum lycopersicum]
Length=1731

 Score =  2395 bits (6208),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1231/1519 (81%), Positives = 1364/1519 (90%), Gaps = 5/1519 (0%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             +CWQ SVDF LS+++D D++SFLNSAFELLLRVWA+SRDLKVRLS+VEALGQMVGLITRT
Sbjct  200   SCWQCSVDFPLSSVVDADIMSFLNSAFELLLRVWAISRDLKVRLSSVEALGQMVGLITRT  259

Query  824   QLKAALPRLVPTILELYKREQD-AAFVATCslhsllnasllsnngppllDFEDltvvlst  1000
             QLKAALPRL+PTILELYKR+QD  AFVATCSLH+LLNASLLS NGPPLLDFEDL++ LST
Sbjct  260   QLKAALPRLIPTILELYKRDQDDVAFVATCSLHNLLNASLLSENGPPLLDFEDLSITLST  319

Query  1001  ll-lvCSNNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFG  1177
             LL +VC ++DKKEHSDF VGLKTYNEVQHCFLTVG VYPEDLFVFLLNKC++KEEP   G
Sbjct  320   LLPVVCRSSDKKEHSDFSVGLKTYNEVQHCFLTVGLVYPEDLFVFLLNKCKMKEEPLAVG  379

Query  1178  SLCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSG  1357
             +L VLKHLLPRL+E+WH+KRP+LIE VKLL+DE NLGV KALAELIVVMASHCYLVGSSG
Sbjct  380   ALSVLKHLLPRLSEAWHSKRPLLIEVVKLLLDELNLGVCKALAELIVVMASHCYLVGSSG  439

Query  1358  ELFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEK  1537
             E+FIEYLVRH AM  L   + E SRE +   G YYPFVY+K+E K  AVT +ELR +CEK
Sbjct  440   EMFIEYLVRHSAMFGLHRDDTERSRELNSSPGGYYPFVYKKVEMKMDAVTLSELRAICEK  499

Query  1538  GLLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKA  1717
             GLLLITVTVPEMEHVLWPFLLK+IIPRVYTGAVATVCRCISELCRRRSS+S A + ECKA
Sbjct  500   GLLLITVTVPEMEHVLWPFLLKLIIPRVYTGAVATVCRCISELCRRRSSQSGASVLECKA  559

Query  1718  RTDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMK  1897
             R DIP PEELFARL+VLLHNPLARE L TQIL+VL YLAPLFPKNIN FWQDE  IPKMK
Sbjct  560   RADIPHPEELFARLIVLLHNPLAREQLATQILTVLCYLAPLFPKNINMFWQDE--IPKMK  617

Query  1898  AYVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEH  2077
             AYVSDTEDLKQDP YQESWDDMII+F+AESLDVIQ+VDWV+ LGN F + YELYK D+EH
Sbjct  618   AYVSDTEDLKQDPSYQESWDDMIINFIAESLDVIQDVDWVISLGNAFEKHYELYKPDDEH  677

Query  2078  SALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLD  2257
             SALLHRCLGILLQKVH RAYVRAKIDLMY+QANI +PTNRLGLAKAMGLVAASHLDTVLD
Sbjct  678   SALLHRCLGILLQKVHTRAYVRAKIDLMYKQANITIPTNRLGLAKAMGLVAASHLDTVLD  737

Query  2258  KLKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDAL  2437
             KLK ILDNVGQSI QR  SFFSD+ KMEESDD HAALALMYGYAAKYAP TVIEARIDAL
Sbjct  738   KLKDILDNVGQSIFQRFLSFFSDKAKMEESDDIHAALALMYGYAAKYAPSTVIEARIDAL  797

Query  2438  VGTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGR  2617
             VG NMLSRLLHVRHP AKQAVITAIDLLGQAVI A+ESGISFPLKRRD LLDYILTLMG 
Sbjct  798   VGVNMLSRLLHVRHPTAKQAVITAIDLLGQAVINAAESGISFPLKRRDQLLDYILTLMGT  857

Query  2618  DEEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVI  2797
             DEE+GFS+SNIE L TQSLALSACTTLVSVEPKLTTETRNL+MKATIGFFGLPN+P+DVI
Sbjct  858   DEEDGFSESNIEHLRTQSLALSACTTLVSVEPKLTTETRNLVMKATIGFFGLPNEPADVI  917

Query  2798  NPLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLI  2977
             +PLI NLITLLCTIL+TSGEDGRSRAEQLL ILR +D +VSSSL+YQRKRGCLAAHELL 
Sbjct  918   DPLIGNLITLLCTILITSGEDGRSRAEQLLQILRKVDQYVSSSLDYQRKRGCLAAHELLF  977

Query  2978  KFRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPR  3157
             KFR IC++GYCALGC+G+C+H ++ D A +  LSNLPSAF LPSRDAL LG+R M+YLPR
Sbjct  978   KFRMICISGYCALGCRGTCTHREKTDRAMHHTLSNLPSAFALPSRDALRLGDRTMMYLPR  1037

Query  3158  CIDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILRSDAS  3337
             C+DTN EVRKVSVQIL+L+F+IS SLP+P+NSS   DIELSY ALSSLEDV++ILRSDAS
Sbjct  1038  CVDTNSEVRKVSVQILHLYFSISLSLPRPVNSSFSNDIELSYSALSSLEDVISILRSDAS  1097

Query  3338  IDPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNEL  3517
             IDPSEVFNRVVSSVC LL KDEL AALHGCSGAICDK+KQS+EGAIQAV EFV  RGNEL
Sbjct  1098  IDPSEVFNRVVSSVCILLTKDELAAALHGCSGAICDKVKQSSEGAIQAVNEFVMKRGNEL  1157

Query  3518  NEIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMVTKD  3697
             NE +++RT+QSLL+AV+HV EKYLRQE LGAICS AENT+S++VF EVL AA +D+  KD
Sbjct  1158  NETDIARTTQSLLSAVIHVNEKYLRQEALGAICSFAENTSSRIVFNEVLVAARKDIARKD  1217

Query  3698  IHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSVDGSI  3877
             I RLRGGWPIQDAFH FSQH VLS+ FL+HV+SVINQ P L GGD G  ESS ++VD ++
Sbjct  1218  ISRLRGGWPIQDAFHVFSQHSVLSYLFLDHVMSVINQIPTL-GGDWGHDESSSHAVDTTL  1276

Query  3878  EDDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPLRAL  4057
             ED+++RAA++ALTAFFRGGGK G+K VEQSYASVLATLTL LG+CHGLAS G+ EPLRAL
Sbjct  1277  EDNIARAAIVALTAFFRGGGKVGKKAVEQSYASVLATLTLQLGSCHGLASTGELEPLRAL  1336

Query  4058  LNAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICLFLSK  4237
             L AFQAFCECVGDLEMGKILAR GEQNENEKWINLI +LAG ISIKRPKEVP+ICL LS 
Sbjct  1337  LAAFQAFCECVGDLEMGKILARDGEQNENEKWINLIRDLAGCISIKRPKEVPSICLILSN  1396

Query  4238  SLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQM  4417
             +LDR LR QRE+AAAALSEFLR+SDGFGPLL QMV+ALCRHVSDDSPTVRRLCLRGLVQM
Sbjct  1397  ALDRSLRFQRESAAAALSEFLRHSDGFGPLLEQMVQALCRHVSDDSPTVRRLCLRGLVQM  1456

Query  4418  PSIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSIRLRN  4597
             PSIHVLQYTTQILGVILALLDDSDESVQLTAVSCLL+VLESSS DAVEPVLLNLSIRLRN
Sbjct  1457  PSIHVLQYTTQILGVILALLDDSDESVQLTAVSCLLMVLESSSRDAVEPVLLNLSIRLRN  1516

Query  4598  LQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACRN  4777
             LQ C+N KIRANA+AAFGALS+YG+G   DSF EQ HAAFPRMVLHLH+DDL VRQACRN
Sbjct  1517  LQECMNEKIRANAYAAFGALSTYGSGPQQDSFLEQAHAAFPRMVLHLHEDDLSVRQACRN  1576

Query  4778  TLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSAIIQA  4957
             TLK IAPL+EID I A+ N+H FSSDHR DYEDFLR+LARQLTQ L  RVD Y+++IIQA
Sbjct  1577  TLKSIAPLMEIDGITAVFNSHWFSSDHRGDYEDFLRELARQLTQNLAARVDRYMASIIQA  1636

Query  4958  FDAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATCSAAL  5137
             FDAPWPV+QANAVYLCSS+LSLSD+K+IS+ YY+QVFG+LVGK S STDAIVRATCS+AL
Sbjct  1637  FDAPWPVVQANAVYLCSSVLSLSDDKHISSHYYNQVFGMLVGKMSRSTDAIVRATCSSAL  1696

Query  5138  GLLLKSPNSSSWRDARLNK  5194
             GLLLKS N+SSW+D RL++
Sbjct  1697  GLLLKSSNASSWKDIRLDR  1715


 Score =   332 bits (850),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 160/188 (85%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = +1

Query  85   GDSIPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGN  264
            G+S+PA+EAVQV+VSSLADDS  VREASM+ALK+IT LNPLLVLDCCLTVSRGGRRRFGN
Sbjct  7    GNSVPAAEAVQVLVSSLADDSLIVREASMAALKEITFLNPLLVLDCCLTVSRGGRRRFGN  66

Query  265  IAGLFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSH  444
            IAGLFQV+SVAI+ALDKGDVD  ++ KLAKIAT+EVISTKELNADWQRAAAGVLVS+GSH
Sbjct  67   IAGLFQVMSVAIQALDKGDVDHNYLAKLAKIATSEVISTKELNADWQRAAAGVLVSIGSH  126

Query  445  LPDLMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIY  624
            +PDLMMEEIFLH SGSNSALPAMVQILAD+AS+DALQFTP LKG+LARVVPILGNVR+I+
Sbjct  127  MPDLMMEEIFLHLSGSNSALPAMVQILADFASADALQFTPHLKGILARVVPILGNVRDIH  186

Query  625  RPIFANGL  648
            RPIFAN  
Sbjct  187  RPIFANAF  194



>ref|XP_006354395.1| PREDICTED: maestro heat-like repeat-containing protein family 
member 1-like [Solanum tuberosum]
Length=1725

 Score =  2362 bits (6121),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1229/1519 (81%), Positives = 1358/1519 (89%), Gaps = 5/1519 (0%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             +CWQ SVDF LS+++D D++SFLNSAFELLLRVWA+SRDLKVRLS+VEALGQMVGLITRT
Sbjct  200   SCWQCSVDFPLSSVVDADIMSFLNSAFELLLRVWAISRDLKVRLSSVEALGQMVGLITRT  259

Query  824   QLKAALPRLVPTILELYKREQD-AAFVATCslhsllnasllsnngppllDFEDltvvlst  1000
             QLKAALPRL+PTILELYKR+QD  AFVATCSLH+LLNASLLS NGPPLLDFEDLT+ LST
Sbjct  260   QLKAALPRLIPTILELYKRDQDDVAFVATCSLHNLLNASLLSENGPPLLDFEDLTITLST  319

Query  1001  ll-lvCSNNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFG  1177
             LL +VC ++DKKEHSDF VGLKTYNEVQHCFLTVG VYPEDLFVFLLNKC+LKEEP   G
Sbjct  320   LLPVVCRSSDKKEHSDFSVGLKTYNEVQHCFLTVGLVYPEDLFVFLLNKCKLKEEPLAVG  379

Query  1178  SLCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSG  1357
             +L VLKHLLPRL+E+WH+KRP+LIE VKLL+DE NLGV KALAELIVVMASHCYLVG SG
Sbjct  380   ALSVLKHLLPRLSEAWHSKRPLLIEVVKLLLDELNLGVCKALAELIVVMASHCYLVGPSG  439

Query  1358  ELFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEK  1537
             ELFIEYLVRH AM  +   + E SRE +   G YYPFVY+K+E K  AVT +ELR +CEK
Sbjct  440   ELFIEYLVRHSAMFGMHRDDTERSRELNSSPGGYYPFVYKKVEMKMDAVTLSELRAICEK  499

Query  1538  GLLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKA  1717
             GLLLITVTVPEMEHVLWPFLLK+IIPRVYTGAVATVC+CISELCRRRSS+S A + ECKA
Sbjct  500   GLLLITVTVPEMEHVLWPFLLKLIIPRVYTGAVATVCKCISELCRRRSSQSGAAVLECKA  559

Query  1718  RTDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMK  1897
             R DIP PEELFARL+VLLHNPLARE L TQIL+VL YLAPLFPKNIN FWQDE  IPKMK
Sbjct  560   RADIPHPEELFARLIVLLHNPLAREQLATQILTVLCYLAPLFPKNINMFWQDE--IPKMK  617

Query  1898  AYVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEH  2077
             AYVSDTEDLKQDP YQESWDDMII+F+AESLDVIQ+VDWV+ LGN F + YELYK D+EH
Sbjct  618   AYVSDTEDLKQDPSYQESWDDMIINFIAESLDVIQDVDWVISLGNAFEKHYELYKPDDEH  677

Query  2078  SALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLD  2257
             SALLHRCLGILLQKVH RAYVRAKIDLMY+QANI +PTNRLGLAKAMGLVAASHLDTVLD
Sbjct  678   SALLHRCLGILLQKVHTRAYVRAKIDLMYKQANITIPTNRLGLAKAMGLVAASHLDTVLD  737

Query  2258  KLKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDAL  2437
             KLK ILDNVGQSI QR  SFFSD+ KMEESDD HAALALMYGYAAKYAP TVIEARIDAL
Sbjct  738   KLKDILDNVGQSIFQRFLSFFSDKAKMEESDDIHAALALMYGYAAKYAPSTVIEARIDAL  797

Query  2438  VGTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGR  2617
             VG NMLSRLLHVRHP AKQAVITAIDLLGQAVI A+ESGISFPLKRRD LLDYILTLMGR
Sbjct  798   VGVNMLSRLLHVRHPTAKQAVITAIDLLGQAVINAAESGISFPLKRRDQLLDYILTLMGR  857

Query  2618  DEEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVI  2797
             DEE+GFS+SNIE L TQSLALSACTTLVSVEPKLTTETRNL+MKATIGFFGLPN+P+DVI
Sbjct  858   DEEDGFSESNIEHLRTQSLALSACTTLVSVEPKLTTETRNLVMKATIGFFGLPNEPADVI  917

Query  2798  NPLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLI  2977
             +PLI NLITLLCTIL+TSGEDGRSRAEQLL ILR +D +VSSSL+YQRKRGCLAAHELL 
Sbjct  918   DPLIGNLITLLCTILITSGEDGRSRAEQLLQILRKVDQYVSSSLDYQRKRGCLAAHELLF  977

Query  2978  KFRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPR  3157
             KFR IC++GYCALGC+G+C+H ++ D A +  LSNLPSAF LPSRDAL LG+R M+YLPR
Sbjct  978   KFRMICISGYCALGCRGTCTHREKTDRAMHHTLSNLPSAFALPSRDALRLGDRTMMYLPR  1037

Query  3158  CIDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILRSDAS  3337
             C+DTN EVRKVSVQIL+L+F+IS SLP+P+NSS   DIELSY ALSSLEDV++ILRSDAS
Sbjct  1038  CVDTNSEVRKVSVQILHLYFSISLSLPRPVNSSFSNDIELSYSALSSLEDVISILRSDAS  1097

Query  3338  IDPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNEL  3517
             IDPSEVFNRVVSSVC LL KDEL AALHGCSGAICDKIKQSAEGAIQAV EFV  RGNEL
Sbjct  1098  IDPSEVFNRVVSSVCILLTKDELAAALHGCSGAICDKIKQSAEGAIQAVNEFVMKRGNEL  1157

Query  3518  NEIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMVTKD  3697
             NE +++RT+QSLL+AV+HV EKYLRQE LGAICS AENT+S++VF EVL AA +D+  KD
Sbjct  1158  NETDIARTTQSLLSAVIHVNEKYLRQEALGAICSFAENTSSRIVFNEVLVAARKDIARKD  1217

Query  3698  IHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSVDGSI  3877
             I RLRGGWPIQDAFH FSQH VLS+ FL+HV+SVINQ P L GGD    ESS ++VD  +
Sbjct  1218  ISRLRGGWPIQDAFHVFSQHSVLSYIFLDHVMSVINQIPTL-GGDLDHDESSSHAVDAVL  1276

Query  3878  EDDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPLRAL  4057
             ED+++RAA++ALTAFFRGGGK G+K VEQSYASVLATLTL LG+CHGLAS G+ EPLRAL
Sbjct  1277  EDNIARAAIVALTAFFRGGGKVGKKAVEQSYASVLATLTLQLGSCHGLASTGELEPLRAL  1336

Query  4058  LNAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICLFLSK  4237
             L AFQAFCECVGDLEMGKILAR GEQNENEKWINLI +LAG ISIKRPKEVP+IC  LS 
Sbjct  1337  LAAFQAFCECVGDLEMGKILARDGEQNENEKWINLIRDLAGCISIKRPKEVPSICSILSN  1396

Query  4238  SLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQM  4417
             +LDR LR QRE+AAAALSEFLR+SDGFGPLL QMV+ALCRHVSDDSPTVRRLCLRGLVQM
Sbjct  1397  ALDRSLRFQRESAAAALSEFLRHSDGFGPLLEQMVQALCRHVSDDSPTVRRLCLRGLVQM  1456

Query  4418  PSIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSIRLRN  4597
             PSIHVLQYTTQILGVILALLDDSDESVQLTAVSCLL+VLESSS DAVEPVLLNLSIRLRN
Sbjct  1457  PSIHVLQYTTQILGVILALLDDSDESVQLTAVSCLLMVLESSSRDAVEPVLLNLSIRLRN  1516

Query  4598  LQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACRN  4777
             LQ C+N KIRANA+AAFGALS+YG G   DSF EQ HAAFPRMVLHLH+DDL VRQACRN
Sbjct  1517  LQECMNEKIRANAYAAFGALSTYGTGPQRDSFLEQAHAAFPRMVLHLHEDDLSVRQACRN  1576

Query  4778  TLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSAIIQA  4957
             TLK +APL+EID I A+ NTH FSSDHR DYEDFLR+LAR+LTQ L  RVD Y+++IIQA
Sbjct  1577  TLKSVAPLMEIDGITAVFNTHWFSSDHRGDYEDFLRELARRLTQNLAARVDRYMASIIQA  1636

Query  4958  FDAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATCSAAL  5137
             FDAPWPV+QANAVYLCS +LSLSD+K+IS+ YY+QVFG+LVGK S STDAIVRATCS+AL
Sbjct  1637  FDAPWPVVQANAVYLCSCVLSLSDDKHISSHYYNQVFGMLVGKMSRSTDAIVRATCSSAL  1696

Query  5138  GLLLKSPNSSSWRDARLNK  5194
              LLLKS N+SSW+D RL++
Sbjct  1697  SLLLKSSNASSWKDIRLDR  1715


 Score =   333 bits (854),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = +1

Query  85   GDSIPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGN  264
            G+S+PA+EAVQV+VSSLADDS  VREASM+ALK+IT LNPLLVLDCCLTVSRGGRRRFGN
Sbjct  7    GNSVPAAEAVQVLVSSLADDSLIVREASMAALKEITFLNPLLVLDCCLTVSRGGRRRFGN  66

Query  265  IAGLFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSH  444
            IAGLFQV+SVAI+ALDKGDVD  ++ KLAKIAT+EVISTKELNADWQRAAAGVLVS+GSH
Sbjct  67   IAGLFQVMSVAIQALDKGDVDHNYLAKLAKIATSEVISTKELNADWQRAAAGVLVSIGSH  126

Query  445  LPDLMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIY  624
            +PDLMMEEIFLH SGSNSALPAMVQILAD+ASSDALQFTP LKGVLARVVPILGNVR+I+
Sbjct  127  MPDLMMEEIFLHLSGSNSALPAMVQILADFASSDALQFTPHLKGVLARVVPILGNVRDIH  186

Query  625  RPIFANGL  648
            RPIFAN  
Sbjct  187  RPIFANAF  194



>ref|XP_011077289.1| PREDICTED: protein SHOOT GRAVITROPISM 6 [Sesamum indicum]
Length=1726

 Score =  2312 bits (5991),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1182/1521 (78%), Positives = 1331/1521 (88%), Gaps = 8/1521 (1%)
 Frame = +2

Query  629   QSLQMACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVG  808
             +S   ACWQY VD+ L+T +D DV+SFLNSAFELLLRVWA SRDLKVR+S VEALGQMVG
Sbjct  195   KSWCQACWQYGVDYPLTTAIDGDVMSFLNSAFELLLRVWATSRDLKVRISTVEALGQMVG  254

Query  809   LITRTQLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltv  988
             L+TRTQLK+ALPRLVPTILELYK++QD AFVATCSLH+LLNASLLS +GPPLLDFEDLTV
Sbjct  255   LVTRTQLKSALPRLVPTILELYKKDQDVAFVATCSLHNLLNASLLSESGPPLLDFEDLTV  314

Query  989   vlstll-lvCSNNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEP  1165
             +LSTLL +VC +ND K+HSDF VGLKTYNEVQHCFLTVG VYPEDLF FLL KCRLKEEP
Sbjct  315   ILSTLLPVVCIHNDNKQHSDFSVGLKTYNEVQHCFLTVGQVYPEDLFAFLLYKCRLKEEP  374

Query  1166  FTFGSLCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLV  1345
              TFG+L VLKHLLPRL+E+WH KRP+LIE+VK L+DE NL VRKAL+ELIVVMASHCYLV
Sbjct  375   ITFGALSVLKHLLPRLSEAWHAKRPLLIEAVKNLLDESNLAVRKALSELIVVMASHCYLV  434

Query  1346  GSSGELFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRG  1525
             GS GELF+EYLVR+CAM D++  ++ESS+E  R TG+Y PF++RK E K G V  TELR 
Sbjct  435   GSPGELFVEYLVRNCAMTDMDRTDIESSKEYIRPTGSYNPFLHRKSEVKIGGVCPTELRD  494

Query  1526  VCEKGLLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLS  1705
             +CEKGLLLITVT+PEMEHVLWPFLLKMI+PR+YTGAVATVCRCISELCR + ++S+ +LS
Sbjct  495   ICEKGLLLITVTIPEMEHVLWPFLLKMIVPRIYTGAVATVCRCISELCRHKHAQSDMILS  554

Query  1706  ECKARTDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*I  1885
             +CKAR DIP PE+LFARLVVLLHNPLARE LVTQIL+VL +LA LFPKNI  FWQDE  I
Sbjct  555   DCKARNDIPNPEDLFARLVVLLHNPLAREQLVTQILTVLSHLASLFPKNIILFWQDE--I  612

Query  1886  PKMKAYVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKS  2065
             PKMKAYVSD EDLKQDP YQE+WDDMII+F+AESLDVIQ+VDWV+ LGN+FA+QYELY S
Sbjct  613   PKMKAYVSDPEDLKQDPSYQETWDDMIINFVAESLDVIQDVDWVISLGNSFAKQYELYSS  672

Query  2066  DNEHSALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLD  2245
             D+EHSALLHRCLGILLQKVHDR+YVRAKID MY QANIA+P NRLGLAKA+GLVAASHLD
Sbjct  673   DDEHSALLHRCLGILLQKVHDRSYVRAKIDWMYMQANIALPVNRLGLAKAIGLVAASHLD  732

Query  2246  TVLDKLKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEAR  2425
             TVLDKLK ILDNVG SI +RI S FSDR KMEESDD HAALALMYGYAAKYAP TVIEAR
Sbjct  733   TVLDKLKDILDNVGDSIFKRILSIFSDRAKMEESDDVHAALALMYGYAAKYAPSTVIEAR  792

Query  2426  IDALVGTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILT  2605
             IDALVGTNMLSRLL+VRHP AKQAVITAIDLLGQAVIGA+ESG SFPLKRRD+LLDYILT
Sbjct  793   IDALVGTNMLSRLLNVRHPTAKQAVITAIDLLGQAVIGAAESGTSFPLKRRDMLLDYILT  852

Query  2606  LMGRDEEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDP  2785
             LMGRD+E+GFS+SN+ELLHTQ LALSACTTLVSVEPKLTTETRNL++KAT+GFFGLPNDP
Sbjct  853   LMGRDDEDGFSESNLELLHTQCLALSACTTLVSVEPKLTTETRNLVLKATLGFFGLPNDP  912

Query  2786  SDVINPLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAH  2965
              DV+N LI NLITLLC ILVTSGEDGRSRAEQLLHILR IDP+VSSS+EYQRKRGCLAA+
Sbjct  913   PDVMNGLIHNLITLLCAILVTSGEDGRSRAEQLLHILRQIDPYVSSSVEYQRKRGCLAAY  972

Query  2966  ELLIKFRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMV  3145
             E+L KFR ICV+GYC+LGCQGSC+H+KQID A+N N SNLPSAF  PSRDAL LGERIM 
Sbjct  973   EMLHKFRTICVSGYCSLGCQGSCTHNKQIDRASNCNFSNLPSAFVSPSRDALCLGERIMA  1032

Query  3146  YLPRCIDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILR  3325
             YLPRC DTN EVRK S QIL+LFF+IS SLP+  NSS G+DIEL Y ALS+LEDV+AILR
Sbjct  1033  YLPRCADTNPEVRKTSAQILDLFFSISLSLPRSANSSSGLDIELCYGALSALEDVIAILR  1092

Query  3326  SDASIDPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNR  3505
             SDAS+DPSEVFNR+VSSVC L  K+ELV+ALH CS AICDKI+QSAEG+IQAV EF+T R
Sbjct  1093  SDASLDPSEVFNRIVSSVCILFTKNELVSALHVCSTAICDKIRQSAEGSIQAVTEFITKR  1152

Query  3506  GNELNEIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDM  3685
             G ELNE ++SRT+QSLL+A VHVTEKYLRQETL AI S+AENT+S+ VF EVL AA RD+
Sbjct  1153  GRELNEADISRTTQSLLSAAVHVTEKYLRQETLSAISSLAENTSSRTVFDEVLTAAERDI  1212

Query  3686  VTKDIHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSV  3865
              TKD+ RLRGGWPIQ+AFHAFSQH VLS+SFLEHVIS++NQ+P  + GD GKGE+S NS 
Sbjct  1213  STKDVSRLRGGWPIQEAFHAFSQHAVLSYSFLEHVISILNQTPIFQ-GDYGKGENSSNSG  1271

Query  3866  DGSIEDDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEP  4045
             +  +ED++  AAV ALTA FRGGGK G++ VEQ Y SVLATL LHLGTCH         P
Sbjct  1272  ESHVEDNMLNAAVTALTAVFRGGGKVGKRAVEQKYGSVLATLVLHLGTCHRXXX----XP  1327

Query  4046  LRALLNAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICL  4225
             LRALL AF AFCECVGDLEMGKILAR  EQ+E + WI LIG+LA  ISIKRPKEVP ICL
Sbjct  1328  LRALLVAFNAFCECVGDLEMGKILARDREQSEEDAWIGLIGDLAMCISIKRPKEVPMICL  1387

Query  4226  FLSKSLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRG  4405
              L KSLDRP R  REAAAA LSEF+R+SD FG LL QMVE LCRHVSDDSPTVRRLCLRG
Sbjct  1388  ILCKSLDRPTRHLREAAAAVLSEFVRFSDSFGSLLEQMVEGLCRHVSDDSPTVRRLCLRG  1447

Query  4406  LVQMPSIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSI  4585
             LVQMP +HVLQYTTQIL VI+ALLDD DESVQLTAVSCLL VL S+ST AVEP+LLNLS+
Sbjct  1448  LVQMPPVHVLQYTTQILSVIVALLDDPDESVQLTAVSCLLTVLASASTAAVEPILLNLSV  1507

Query  4586  RLRNLQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQ  4765
             RLRNLQ+C+N KIRANAFAAFGALSSYG G   DSF EQ+H AFPR+VLHLHDDD GVR+
Sbjct  1508  RLRNLQICMNTKIRANAFAAFGALSSYGFGPQRDSFLEQVHVAFPRLVLHLHDDDPGVRR  1567

Query  4766  ACRNTLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSA  4945
             ACRN  KCIAPL+E+D + AL NTHRFSSDHR DYEDFLRD+AR  TQ++  RVDTY+++
Sbjct  1568  ACRNAFKCIAPLLEVDGMVALANTHRFSSDHRGDYEDFLRDIARLFTQHMSSRVDTYMAS  1627

Query  4946  IIQAFDAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATC  5125
             IIQAF+APWPVIQANA+YLCSS++S S +++ISA Y+SQVFG+L+GK S S+DAIVRAT 
Sbjct  1628  IIQAFEAPWPVIQANAIYLCSSVISFSSDQHISAFYHSQVFGMLIGKISRSSDAIVRATG  1687

Query  5126  SAALGLLLKSPNSSSWRDARL  5188
             S ALGLLLKSPNSSSW+ ARL
Sbjct  1688  SLALGLLLKSPNSSSWKVARL  1708


 Score =   319 bits (818),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 154/188 (82%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = +1

Query  85   GDSIPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGN  264
            G+SIPA EAVQV+VSSLADDSP VREAS + LKDI SLNPLLVLDCC TVSRGGRRRFGN
Sbjct  7    GNSIPAPEAVQVLVSSLADDSPIVREASAATLKDIASLNPLLVLDCCSTVSRGGRRRFGN  66

Query  265  IAGLFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSH  444
            +AGLFQV+SVAIRALDK DVDP +M KLAKIA AE+ISTKELNADWQRAA+ VLV++G H
Sbjct  67   MAGLFQVMSVAIRALDKDDVDPQYMAKLAKIAAAEIISTKELNADWQRAASSVLVALGLH  126

Query  445  LPDLMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIY  624
            LPDLMMEEIFLH SGSNSALPAMVQIL+D+ASSDALQFTPRLKGVL RV+PILG+V++I+
Sbjct  127  LPDLMMEEIFLHLSGSNSALPAMVQILSDFASSDALQFTPRLKGVLTRVLPILGSVKDIH  186

Query  625  RPIFANGL  648
            RP+FAN  
Sbjct  187  RPVFANAF  194



>ref|XP_010654000.1| PREDICTED: protein SHOOT GRAVITROPISM 6 isoform X1 [Vitis vinifera]
 emb|CBI30178.3| unnamed protein product [Vitis vinifera]
Length=1722

 Score =  2282 bits (5913),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1163/1518 (77%), Positives = 1333/1518 (88%), Gaps = 4/1518 (0%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             A WQYS+DF  ++ LD DV+SFLNSAFELLLRVWA SRDLKVR+S+VEALGQMVGLITR 
Sbjct  200   ASWQYSMDFPSTSPLDADVMSFLNSAFELLLRVWATSRDLKVRVSSVEALGQMVGLITRA  259

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstl  1003
             QLKAALPRLVPTILELYK++ D AF+ATCSLH+LLNASLLS NGPPLLDFE+L V+LSTL
Sbjct  260   QLKAALPRLVPTILELYKKDLDIAFLATCSLHNLLNASLLSENGPPLLDFEELMVILSTL  319

Query  1004  l-lvCSNNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGS  1180
             L +VC NND KE SDF VGLKTYNEVQHCFLTVG VYPEDLF+FLLNKCRL EEP TFG+
Sbjct  320   LPVVCINNDSKEQSDFSVGLKTYNEVQHCFLTVGLVYPEDLFMFLLNKCRLNEEPLTFGA  379

Query  1181  LCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGE  1360
             LCVLKHLLPRL+E+WH+KRP+L+E+VKLL+DE  LGVRKAL+EL+V+MASHCYLVG SGE
Sbjct  380   LCVLKHLLPRLSEAWHSKRPLLVEAVKLLLDEQILGVRKALSELVVIMASHCYLVGPSGE  439

Query  1361  LFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKG  1540
             LF+EYLVR+CA+ D E+  LE+S+E  R   N Y   Y++LE K+GAV  TELR +CEKG
Sbjct  440   LFVEYLVRNCALSDQESYALENSKEVIRSNNNNYGCQYKRLEVKSGAVCLTELRSICEKG  499

Query  1541  LLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKAR  1720
             LLL+T+T+PEMEH+LWPFLLKMIIPR YTGA ATVCRCISELCR  SS +N MLSECKAR
Sbjct  500   LLLLTITIPEMEHILWPFLLKMIIPRAYTGAAATVCRCISELCRHGSSYANTMLSECKAR  559

Query  1721  TDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKA  1900
              DIP PEELFARLVVLLHNPLARE L TQ+L+VL+YLAPLFPKNIN FWQDE  IPKMKA
Sbjct  560   IDIPNPEELFARLVVLLHNPLAREQLATQVLTVLYYLAPLFPKNINLFWQDE--IPKMKA  617

Query  1901  YVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHS  2080
             YVSDT+DLKQDP YQE+WDDMII+FLAESLDVIQ+ +WV+ LGN F+RQYELY SD+EHS
Sbjct  618   YVSDTDDLKQDPSYQETWDDMIINFLAESLDVIQDTEWVISLGNAFSRQYELYTSDDEHS  677

Query  2081  ALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDK  2260
             ALLHRCLGILLQKV DR YV  KI+ MY QANIA P+NRLGLAKAMGLVAASHLDTVL+K
Sbjct  678   ALLHRCLGILLQKVDDRLYVLEKINWMYTQANIAFPSNRLGLAKAMGLVAASHLDTVLEK  737

Query  2261  LKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALV  2440
             LK ILDNVGQSI QRI SFFSDRG+MEESDD HAALALMYGYAA+YAP TVIEARIDALV
Sbjct  738   LKDILDNVGQSIFQRILSFFSDRGRMEESDDIHAALALMYGYAARYAPSTVIEARIDALV  797

Query  2441  GTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRD  2620
             GTNMLSRLLHVRHP AKQAVITAIDLLG+AVI A+ESG SFPLKRRD LLDYILTLMG D
Sbjct  798   GTNMLSRLLHVRHPTAKQAVITAIDLLGRAVINAAESGASFPLKRRDQLLDYILTLMGCD  857

Query  2621  EEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVIN  2800
             +++GF++S++ELLHTQ+LALSACTTLVSVEPKLT ETRN +MKAT+GFF LPN+PSDV++
Sbjct  858   DDDGFAESSLELLHTQALALSACTTLVSVEPKLTIETRNHVMKATLGFFALPNEPSDVVD  917

Query  2801  PLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIK  2980
             PLIDNLITLLC IL+TSGEDGRSRAEQLLHILR ID +VSS LEYQRKR CLA +E+L+K
Sbjct  918   PLIDNLITLLCAILLTSGEDGRSRAEQLLHILRQIDQYVSSPLEYQRKRSCLAVYEMLLK  977

Query  2981  FRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPRC  3160
             F+++CV+GYCALGC GSC+HSK ID   + N SNLPSAF LPSRD+L LG R+++YLPRC
Sbjct  978   FKSVCVSGYCALGCHGSCTHSKHIDRTLHGNFSNLPSAFVLPSRDSLCLGNRVIMYLPRC  1037

Query  3161  IDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILRSDASI  3340
              DTN EVRK+S QIL+LFF+IS SLP+P+ SS G+DIELSY ALSSLEDV+AILRSDASI
Sbjct  1038  ADTNSEVRKISAQILDLFFSISLSLPRPVGSSFGVDIELSYSALSSLEDVIAILRSDASI  1097

Query  3341  DPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNELN  3520
             DPSEVFNRVVSSVC LL KDELVAALH C+GAICDKIKQSAEGAIQAV +FV  RG+ELN
Sbjct  1098  DPSEVFNRVVSSVCVLLTKDELVAALHYCTGAICDKIKQSAEGAIQAVTDFVMKRGHELN  1157

Query  3521  EIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMVTKDI  3700
             E++VSRT+QSLL+A  HVTEKYLRQETL AI S+AENT+SK+VF EVL  A RD+VTKDI
Sbjct  1158  EMDVSRTTQSLLSAAAHVTEKYLRQETLAAISSLAENTSSKIVFNEVLTTAARDIVTKDI  1217

Query  3701  HRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSVDGSIE  3880
              RLRGGWP+QDAF+AFSQH+VLS+ FLEHVISV++QSP +K  D  KG+SS + VD  IE
Sbjct  1218  SRLRGGWPMQDAFYAFSQHIVLSYMFLEHVISVLSQSPIVK-DDPEKGDSSSHRVDSHIE  1276

Query  3881  DDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPLRALL  4060
             D++ +AA+ ALTAFFRGGGK G+K VEQSYASVLA LTL LG+CHGLA+ G+QEPLRALL
Sbjct  1277  DNILQAAIFALTAFFRGGGKIGKKAVEQSYASVLAALTLQLGSCHGLATSGEQEPLRALL  1336

Query  4061  NAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICLFLSKS  4240
              AFQAFCECVGDLEMGKILAR GEQNENEKWINLIG+LAG ISIKRPKEVPTICL L+KS
Sbjct  1337  IAFQAFCECVGDLEMGKILARDGEQNENEKWINLIGDLAGCISIKRPKEVPTICLILTKS  1396

Query  4241  LDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQMP  4420
             LDR    QREAAAAALSEF+RYSDG   LL QMVEALCRH SDDSPTVR LCLRGLVQ+P
Sbjct  1397  LDRHQGFQREAAAAALSEFVRYSDGLDSLLEQMVEALCRHASDDSPTVRCLCLRGLVQIP  1456

Query  4421  SIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSIRLRNL  4600
             SIH+LQYT Q+LGVI+ALL+DSDESVQLTAVSCLL VLESS  DAVEP+L+NLS+R+RNL
Sbjct  1457  SIHILQYTNQVLGVIMALLEDSDESVQLTAVSCLLKVLESSPNDAVEPILINLSVRIRNL  1516

Query  4601  QVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACRNT  4780
             Q+C N K+RANAFA  G+LS+YG G+  ++F EQ+HAAFPR+VLH+HDDDL VR ACR+T
Sbjct  1517  QICTNVKMRANAFAGLGSLSNYGVGAQREAFLEQVHAAFPRLVLHIHDDDLSVRLACRST  1576

Query  4781  LKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSAIIQAF  4960
             LK IAPL+E++ + AL NTH F+SDHRSDYEDF+RDL++Q +  L  RVDTY+++ IQAF
Sbjct  1577  LKRIAPLMELEGMFALFNTHSFNSDHRSDYEDFVRDLSKQFSLRLSSRVDTYMASTIQAF  1636

Query  4961  DAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATCSAALG  5140
             DAPWP IQANA+Y  SSMLS+SD+++I ALYY++VFG+L+ K S+S D IVRATCS+ALG
Sbjct  1637  DAPWPTIQANAIYFSSSMLSVSDDQHILALYYTRVFGMLISKMSHSADEIVRATCSSALG  1696

Query  5141  LLLKSPNSSSWRDARLNK  5194
             LLLKS N   WR + L++
Sbjct  1697  LLLKSTNLLQWRASGLDR  1714


 Score =   305 bits (781),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 145/188 (77%), Positives = 170/188 (90%), Gaps = 0/188 (0%)
 Frame = +1

Query  85   GDSIPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGN  264
            G+SIPA EAVQV+VSSL D+S  VR ASM+AL+DI ++NPLLVL+CC  VSRGGRRRFGN
Sbjct  7    GNSIPAPEAVQVLVSSLGDESHVVRAASMAALRDIAAINPLLVLECCCAVSRGGRRRFGN  66

Query  265  IAGLFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSH  444
            ++GLFQV++ A+RAL+K DVDP FM KLAKIATAE+IS+KEL+ADWQRAAAG+LVS+GSH
Sbjct  67   MSGLFQVMASAVRALEKRDVDPPFMAKLAKIATAEMISSKELSADWQRAAAGLLVSIGSH  126

Query  445  LPDLMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIY  624
            LPDLMMEEIFLH  G NSALPAMVQILAD+AS+DALQFTPRLKGVL+RV+PILGNVR+ +
Sbjct  127  LPDLMMEEIFLHLPGPNSALPAMVQILADFASADALQFTPRLKGVLSRVLPILGNVRDAH  186

Query  625  RPIFANGL  648
            RPIFAN  
Sbjct  187  RPIFANAF  194



>gb|EYU38578.1| hypothetical protein MIMGU_mgv1a000131mg [Erythranthe guttata]
Length=1696

 Score =  2257 bits (5848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1158/1522 (76%), Positives = 1310/1522 (86%), Gaps = 35/1522 (2%)
 Frame = +2

Query  629   QSLQMACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVG  808
             +S   ACWQYSVDF L T LD DV+SFLNSAFELLLRVWA SRDLKVR+S VEALGQMVG
Sbjct  195   KSWCQACWQYSVDFPLYTALDGDVMSFLNSAFELLLRVWATSRDLKVRVSTVEALGQMVG  254

Query  809   LITRTQLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltv  988
             L+TRTQLK+ALPRLVPTILELYK++ DAAFVA+CSLH+LLNASLLS +GPPL+DFEDLTV
Sbjct  255   LVTRTQLKSALPRLVPTILELYKKDHDAAFVASCSLHNLLNASLLSESGPPLMDFEDLTV  314

Query  989   vlstll-lvCSNNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEP  1165
             +LSTLL +VC +ND K+HSDF VGLKTYNEVQHCFLTVG VYPED+FVFLL+KCRLKEEP
Sbjct  315   ILSTLLPVVCIHNDSKQHSDFSVGLKTYNEVQHCFLTVGQVYPEDMFVFLLHKCRLKEEP  374

Query  1166  FTFGSLCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLV  1345
              TFG+L VLKHLLPRL+E+WH KRP+L+ESVK L+DE+NL V KAL+ELIVVMASHCYLV
Sbjct  375   LTFGALSVLKHLLPRLSEAWHAKRPLLVESVKNLLDENNLAVCKALSELIVVMASHCYLV  434

Query  1346  GSSGELFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRG  1525
             G  GELF+EYLVRHCA+                                 G V  T+LR 
Sbjct  435   GPPGELFVEYLVRHCAV-------------------------------NIGGVCPTDLRE  463

Query  1526  VCEKGLLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLS  1705
             +CEKGLLLITVT+PEMEHVLWPFLLKMIIPR+YT AVATVCRCISELCR + ++S+ +LS
Sbjct  464   ICEKGLLLITVTIPEMEHVLWPFLLKMIIPRIYTDAVATVCRCISELCRHKHTQSDTILS  523

Query  1706  ECKARTDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*I  1885
             +CKAR D+P PE+LFARLVVLLHNPLARE LV QIL+VL +LA LFPKNI  FWQDE  I
Sbjct  524   DCKARFDVPNPEDLFARLVVLLHNPLAREQLVPQILTVLLHLASLFPKNIVVFWQDE--I  581

Query  1886  PKMKAYVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKS  2065
             PKMKAYVSD EDLKQDP YQE+WDDM+I+F+AESLDVIQ+VDWV+ LGN+FA+QYELY S
Sbjct  582   PKMKAYVSDPEDLKQDPSYQETWDDMVINFVAESLDVIQDVDWVISLGNSFAKQYELYSS  641

Query  2066  DNEHSALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLD  2245
             ++EHSALLHRCLGILLQKVHDR YV AKIDLMY QANIA+P NRLGLAKAMGLVAASHLD
Sbjct  642   EDEHSALLHRCLGILLQKVHDRTYVHAKIDLMYMQANIALPVNRLGLAKAMGLVAASHLD  701

Query  2246  TVLDKLKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEAR  2425
             TVLDKLK ILD VG SI +RI SFFSD  KMEESDD HAALALMYGYAAKYAP TVIEAR
Sbjct  702   TVLDKLKDILDTVGDSIFKRIMSFFSDSAKMEESDDVHAALALMYGYAAKYAPSTVIEAR  761

Query  2426  IDALVGTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILT  2605
             IDALVGTNMLSRLL+VRHP AKQAVITAIDLLGQAVIGA+ESGISFPLKRRD+LLDYILT
Sbjct  762   IDALVGTNMLSRLLNVRHPTAKQAVITAIDLLGQAVIGAAESGISFPLKRRDMLLDYILT  821

Query  2606  LMGRDEEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDP  2785
             LMGRD+E+G SDSN+ELLHTQSLALSACTTLVSVEPKLTTETRNL++KAT+GFFGLPNDP
Sbjct  822   LMGRDDEDGLSDSNLELLHTQSLALSACTTLVSVEPKLTTETRNLVLKATLGFFGLPNDP  881

Query  2786  SDVINPLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAH  2965
              DV++ LI NLITLLC ILVTSGEDGRSR EQLLHILR IDP+VSSS+EYQR+RGCLAA+
Sbjct  882   PDVMDGLIHNLITLLCAILVTSGEDGRSRTEQLLHILRQIDPYVSSSVEYQRQRGCLAAY  941

Query  2966  ELLIKFRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMV  3145
             E+L KFR +CV GYC+LGCQGSC+HS++ D A+N N SNLPSAF  PSRDAL +GERIMV
Sbjct  942   EMLHKFRTVCVGGYCSLGCQGSCTHSRRFDRASNYNFSNLPSAFVSPSRDALCIGERIMV  1001

Query  3146  YLPRCIDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILR  3325
             YLPRC DTN EVRK S QI++LFF++S SLP+  NSS G+DIEL Y ALS+LEDV+AILR
Sbjct  1002  YLPRCADTNSEVRKTSAQIVDLFFSVSLSLPRSSNSSFGLDIELCYTALSALEDVIAILR  1061

Query  3326  SDASIDPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNR  3505
             SDAS+DPSEVFNRVVSSVC L  KDELVAALH CS AICDKI+QSAEGAIQ+V+EF+T R
Sbjct  1062  SDASLDPSEVFNRVVSSVCVLFTKDELVAALHVCSAAICDKIRQSAEGAIQSVIEFITKR  1121

Query  3506  GNELNEIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDM  3685
             G ELNE ++SRT+QSLL+AV+HVTEKYLRQETL AI S+AENT+S++VF EVLAAA RD+
Sbjct  1122  GKELNEADISRTTQSLLSAVIHVTEKYLRQETLHAISSLAENTSSRIVFGEVLAAAERDI  1181

Query  3686  VTKDIHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSV  3865
              TKD+ RLRGGWPIQDAFHAFSQH VLS SFL+HV S++NQ+P  +GG  GKGE+     
Sbjct  1182  ATKDVSRLRGGWPIQDAFHAFSQHAVLSCSFLDHVTSILNQTPVFQGG-PGKGENPNIFG  1240

Query  3866  DGSIEDDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEP  4045
             +   ED+V  AA+ ALTAFFRGGGK G++ VEQSY SV ATL LHLGTCH LA+ G  EP
Sbjct  1241  ESLEEDNVLHAAITALTAFFRGGGKIGKRAVEQSYGSVFATLVLHLGTCHCLANSGQHEP  1300

Query  4046  LRALLNAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICL  4225
             LRALL AF AFCECVGDLEMGKI+AR  EQNE + WI LIG+LAG ISIKRPKE+PTIC 
Sbjct  1301  LRALLVAFNAFCECVGDLEMGKIVARDSEQNEEDAWIGLIGDLAGCISIKRPKEIPTICS  1360

Query  4226  FLSKSLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRG  4405
              L KSLDR  +  REAAAAALSEF+R+SD  G LL QMVE L RHVSDDSP VRRLCLRG
Sbjct  1361  ILCKSLDRSPKYMREAAAAALSEFVRFSDSLGSLLEQMVEGLTRHVSDDSPNVRRLCLRG  1420

Query  4406  LVQMPSIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSI  4585
             LVQMPS+HV+QYTTQIL VI+ALLDD DESVQLTAVSCLL VL +SSTDAVEPVLLNLS+
Sbjct  1421  LVQMPSVHVVQYTTQILSVIVALLDDPDESVQLTAVSCLLTVLATSSTDAVEPVLLNLSV  1480

Query  4586  RLRNLQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQ  4765
             RLRNLQ+C+NAKIRANAFAAFGALS YG G   D+F EQ+HAAFPR+VLHLHDDDLGVR+
Sbjct  1481  RLRNLQICMNAKIRANAFAAFGALSKYGFGPQRDTFLEQVHAAFPRLVLHLHDDDLGVRR  1540

Query  4766  ACRNTLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSA  4945
             ACRNT K I+PL+E + I AL NTHR SSDHR+DYEDFLRD+ARQ TQ++  RVDTY+ +
Sbjct  1541  ACRNTFKSISPLMEFNGITALANTHRLSSDHRADYEDFLRDIARQFTQHMSSRVDTYMGS  1600

Query  4946  IIQAFDAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATC  5125
             IIQAF+APWPVIQANA+YLCSS+++ S +++ISALY+SQVFG+L+GK S STDAIVRAT 
Sbjct  1601  IIQAFEAPWPVIQANAIYLCSSVIASSSDQHISALYHSQVFGMLMGKISRSTDAIVRATG  1660

Query  5126  SAALGLLLKSPNSSSWRDARLN  5191
             S ALGLLLKS NSSSW+ ARL+
Sbjct  1661  SLALGLLLKSANSSSWKVARLD  1682


 Score =   310 bits (795),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 150/188 (80%), Positives = 168/188 (89%), Gaps = 0/188 (0%)
 Frame = +1

Query  85   GDSIPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGN  264
            G+SIPA EAVQV+VSSLADDSP VREAS + LKDI  LNPLLVLDCC TVSRGGRRR+GN
Sbjct  7    GNSIPAPEAVQVLVSSLADDSPMVREASTATLKDIAHLNPLLVLDCCSTVSRGGRRRYGN  66

Query  265  IAGLFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSH  444
            IAGLFQV+SVAIRALDK DVDP +M KLAKIA +E+ISTKELNADWQRAA+ VLV++G H
Sbjct  67   IAGLFQVMSVAIRALDKDDVDPHYMAKLAKIAASEIISTKELNADWQRAASSVLVALGLH  126

Query  445  LPDLMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIY  624
            LPDLMM+EI LH SGSNSALPAMVQILAD+ASSDA+QFT RLK VL RV+PILGNV++I+
Sbjct  127  LPDLMMDEILLHLSGSNSALPAMVQILADFASSDAVQFTARLKSVLTRVLPILGNVKDIH  186

Query  625  RPIFANGL  648
            RPIFAN  
Sbjct  187  RPIFANAF  194



>emb|CDP15300.1| unnamed protein product [Coffea canephora]
Length=1719

 Score =  2241 bits (5807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1159/1528 (76%), Positives = 1326/1528 (87%), Gaps = 22/1528 (1%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             ACW YSVD+ L +ILD DV SFLNSAFELLLRVWA SRDLKVR + +EALGQMVGLITR 
Sbjct  200   ACWLYSVDYPLFSILDADVTSFLNSAFELLLRVWASSRDLKVRSTTIEALGQMVGLITRA  259

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstl  1003
             QLK ALPRLVPTIL++YK++Q++A VATC+LH+LLNASLLS +GPPLLDFED+TV+LSTL
Sbjct  260   QLKMALPRLVPTILDMYKKDQESALVATCTLHNLLNASLLSESGPPLLDFEDITVILSTL  319

Query  1004  l-lvCSNNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGS  1180
             L +VC +ND KE SDF VGLKTYNEVQHCFL VG +YPEDLF+FLLNKCRLKEEP TFG+
Sbjct  320   LPVVCISNDSKELSDFSVGLKTYNEVQHCFLAVGLMYPEDLFMFLLNKCRLKEEPLTFGA  379

Query  1181  LCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGE  1360
             LCVLKHLLPRL+E+WH KRP L+E+VKLL+DEH+LG RKALAELIVVMASHCYL+G  GE
Sbjct  380   LCVLKHLLPRLSEAWHGKRPSLVEAVKLLLDEHSLGARKALAELIVVMASHCYLIGQPGE  439

Query  1361  LFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKG  1540
             LF+E+LVR+C++ D  N      +E  R +G +Y F Y+KLE KAGA + TELR +CEKG
Sbjct  440   LFVEFLVRNCSIEDAVN-----PKEVVRRSGTHYAFPYKKLEVKAGAFSPTELRAICEKG  494

Query  1541  LLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKAR  1720
             LLLIT+T+PEME VLWPFLLKMIIPRVYT AVATVCRCISE CRRRSS+SN+MLSEC AR
Sbjct  495   LLLITITIPEMELVLWPFLLKMIIPRVYTDAVATVCRCISEFCRRRSSQSNSMLSECNAR  554

Query  1721  TDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKA  1900
             TDIP PEELFARL+VLLHNPLARE L TQIL VL++LAPLFPKN++ FWQDE  IPKMKA
Sbjct  555   TDIPHPEELFARLLVLLHNPLAREQLATQILMVLYHLAPLFPKNVSLFWQDE--IPKMKA  612

Query  1901  YVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHS  2080
             YV DT+DLK+DP YQE+WDDMII+FLAESLDVIQ++DWV+ LGN FA+QYELY S++EHS
Sbjct  613   YVGDTDDLKEDPFYQETWDDMIINFLAESLDVIQDIDWVISLGNAFAKQYELYTSEDEHS  672

Query  2081  ALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDK  2260
             ALLHRCLGILLQKVHDR YV AKIDLMY+QANI+ P NRLGLAKAMGLVAASHLDTVL+K
Sbjct  673   ALLHRCLGILLQKVHDRTYVCAKIDLMYKQANISFPKNRLGLAKAMGLVAASHLDTVLEK  732

Query  2261  LKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALV  2440
             LK ILDNVGQS  QRI SFFSDR KMEESDD HAALALMYGYAAKYAP TVIEARIDALV
Sbjct  733   LKDILDNVGQSFFQRILSFFSDRAKMEESDDIHAALALMYGYAAKYAPTTVIEARIDALV  792

Query  2441  GTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRD  2620
             GTNMLSRLLHVRHP AKQAVITAI+LLGQAV  AS+ G SFPLKRRD LLDYILTLMGRD
Sbjct  793   GTNMLSRLLHVRHPIAKQAVITAINLLGQAVYSASQCGTSFPLKRRDQLLDYILTLMGRD  852

Query  2621  EEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVIN  2800
              E+ F DS  ELL TQSLALSACTTLVSVEPKLTTETRNL++KAT+GFFGLPNDPSDV+N
Sbjct  853   GEDDFFDSTRELLCTQSLALSACTTLVSVEPKLTTETRNLVLKATLGFFGLPNDPSDVVN  912

Query  2801  PLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIK  2980
             PLIDNLITLLCTILVT GEDGRSRAEQLLHILR +DP+VSS++EYQR+RGC AAHE+L K
Sbjct  913   PLIDNLITLLCTILVTGGEDGRSRAEQLLHILRQLDPYVSSAVEYQRERGCRAAHEMLHK  972

Query  2981  FRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPRC  3160
             FR +C++GYCA GC+GSC+H K +D   +RN SNLPSAF LPSRDALSLGERIMVYLPRC
Sbjct  973   FRTLCISGYCAFGCRGSCTHGKHVDPVVHRNYSNLPSAFVLPSRDALSLGERIMVYLPRC  1032

Query  3161  IDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILRSDASI  3340
              DT  EVRK+S QIL+LFF+IS SLP+P+NS+LG+D+ELSY AL+SLEDV+AILRSDASI
Sbjct  1033  ADTIPEVRKLSAQILDLFFSISLSLPRPVNSNLGLDLELSYSALTSLEDVIAILRSDASI  1092

Query  3341  DPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNELN  3520
             DPSEVFNRVV SV  LL KDEL AALHGCS AICDK+KQSAE  IQAVVEF+T RGNELN
Sbjct  1093  DPSEVFNRVVCSVSILLTKDELAAALHGCSTAICDKVKQSAESGIQAVVEFITKRGNELN  1152

Query  3521  EIEVSRTSQSLLTAVVHVTEKYLRQETLGA------------ICSVAENTTSKVVFTEVL  3664
             E ++SRT+QSLL+A VHV+EKYLR+ETL A            I ++AENT+S +VF EVL
Sbjct  1153  ETDISRTTQSLLSATVHVSEKYLREETLCAVSLYTNFCRQLGISALAENTSSGIVFNEVL  1212

Query  3665  AAAGRDMVTKDIHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKG  3844
             AAAGRD+ TKD+ RLRGGWP+QDAF+AFSQH+VLS++FLEHVI+++NQ+P LK GD G+G
Sbjct  1213  AAAGRDITTKDVSRLRGGWPVQDAFYAFSQHVVLSYTFLEHVIAIVNQTPLLK-GDLGRG  1271

Query  3845  ESSRNSVDGSIEDDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchgla  4024
             E+  +S D  +E DV +AAV+ALTAFFRGGGK GRK VEQ+YASVLATL LH G+CHGLA
Sbjct  1272  ETPSHSGDNQLE-DVLQAAVVALTAFFRGGGKIGRKAVEQNYASVLATLVLHFGSCHGLA  1330

Query  4025  SYGDQEPLRALLNAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPK  4204
             S+G  EPL ++L AF AFC+CVGDLEMGKIL R G+  ENEKWIN++G+LA  ISIKRPK
Sbjct  1331  SFGQHEPLHSMLIAFHAFCDCVGDLEMGKILTRDGKHTENEKWINVVGDLACCISIKRPK  1390

Query  4205  EVPTICLFLSKSLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTV  4384
             E+P+ICL +SKSL+R  R  REAAAAALSEFLRYSDGFG LL QMVE L RHVSDDSPTV
Sbjct  1391  EIPSICLIVSKSLERFERFHREAAAAALSEFLRYSDGFGSLLEQMVELLSRHVSDDSPTV  1450

Query  4385  RRLCLRGLVQMPSIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEP  4564
             RRLCLRGLVQMPSIH+LQYTTQILGVILALLDD +ESVQLTAVSCLL+VLESSS DAVEP
Sbjct  1451  RRLCLRGLVQMPSIHILQYTTQILGVILALLDDPEESVQLTAVSCLLMVLESSSKDAVEP  1510

Query  4565  VLLNLSIRLRNLQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHD  4744
             +LLNLS+RLRNLQ+C+N  IR NAF AFGALS Y  GS  ++F EQ+HA FPR+VLHLHD
Sbjct  1511  ILLNLSVRLRNLQICMNTNIRRNAFVAFGALSGYAVGSHHEAFLEQVHAVFPRLVLHLHD  1570

Query  4745  DDLGVRQACRNTLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPR  4924
             DDLGVRQACR T + IAPL+EI+ + AL NT+ F SDHRSDYEDFLRDLA+QL+Q+L  R
Sbjct  1571  DDLGVRQACRTTFRSIAPLMEIEGVVALSNTNWFGSDHRSDYEDFLRDLAKQLSQHLDSR  1630

Query  4925  VDTYLSAIIQAFDAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTD  5104
             +D+Y+ +IIQAFDAPWPV+QANAVYLCSSML+LS+++ IS LY +QV G+L+ K S S D
Sbjct  1631  IDSYMVSIIQAFDAPWPVVQANAVYLCSSMLALSEDQRISPLYCNQVLGMLISKMSRSAD  1690

Query  5105  AIVRATCSAALGLLLKSPNSSSWRDARL  5188
             AIVRATCS+AL LLLKS N +SW+  RL
Sbjct  1691  AIVRATCSSALSLLLKSVNLASWKAVRL  1718


 Score =   287 bits (734),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 144/188 (77%), Positives = 166/188 (88%), Gaps = 0/188 (0%)
 Frame = +1

Query  85   GDSIPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGN  264
            G S+PA EA+QV+VSSL D+SP VR+ASM+ALK+I  LNPLLVLDCC  VSRGGRRRFGN
Sbjct  7    GHSMPAPEAIQVLVSSLGDESPMVRDASMAALKEIAPLNPLLVLDCCSLVSRGGRRRFGN  66

Query  265  IAGLFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSH  444
            I GLFQV+SVAIRALDK DVDP +M KLAKIATAE+I++KE  ADWQRAAAGVLV++G H
Sbjct  67   IGGLFQVMSVAIRALDKRDVDPPYMTKLAKIATAEMITSKEFQADWQRAAAGVLVAIGLH  126

Query  445  LPDLMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIY  624
            LPDLMMEE+FL  SGS+S++PAMVQ+LAD+AS DALQFTPRLK VLARV+PILGNVR+I 
Sbjct  127  LPDLMMEEVFLLLSGSSSSMPAMVQVLADFASFDALQFTPRLKVVLARVLPILGNVRDIN  186

Query  625  RPIFANGL  648
            RPIFAN  
Sbjct  187  RPIFANAF  194



>ref|XP_008241365.1| PREDICTED: protein SHOOT GRAVITROPISM 6 [Prunus mume]
Length=1723

 Score =  2221 bits (5756),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1132/1519 (75%), Positives = 1312/1519 (86%), Gaps = 9/1519 (1%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             A WQYS+D    ++LD D++SFLNS FELLLRVWA SRDLKVR+S+VEALGQMVGLITRT
Sbjct  200   AVWQYSLDIPSHSLLDGDIMSFLNSVFELLLRVWAASRDLKVRISSVEALGQMVGLITRT  259

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstl  1003
             QLKAALPRLVPTILELYKR+QD AF+ATCSLH+LL+ASLLS +GPPLLDFE+LTV+LSTL
Sbjct  260   QLKAALPRLVPTILELYKRDQDVAFLATCSLHNLLHASLLSESGPPLLDFEELTVILSTL  319

Query  1004  l-lvCSNNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGS  1180
             L +VC NND KEHSDF VGLKTYNEVQ CFLTVG VYPEDLFVFL+NKCRLKEEP TFG+
Sbjct  320   LPVVCINNDNKEHSDFSVGLKTYNEVQRCFLTVGLVYPEDLFVFLINKCRLKEEPLTFGA  379

Query  1181  LCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGE  1360
             LCVLKHLLPRL+E+WH+KR  L+E+V+ L+D+ +LGVRK L+ELIVVMASHCYL+G SGE
Sbjct  380   LCVLKHLLPRLSEAWHSKRHNLVEAVQFLLDDQDLGVRKVLSELIVVMASHCYLIGPSGE  439

Query  1361  LFIEYLVRHCAMPDLENVELESSRESSRFTGNY-YPFVYRKLEFKAGAVTTTELRGVCEK  1537
             LF+EYLVRHCA+ D ++ +LE S++ S   GN   PF Y++LE K G +   ELR +CEK
Sbjct  440   LFVEYLVRHCALTDKDSNDLERSKDVS---GNPDIPFQYKRLEVKIGTLCPAELRAICEK  496

Query  1538  GLLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKA  1717
             GLLL+T+T+PEMEH+LWPFLLKMIIP+ YTGAVA VCRCISELCR RS+ SN ML+ECKA
Sbjct  497   GLLLLTITIPEMEHILWPFLLKMIIPQAYTGAVAMVCRCISELCRHRSN-SNTMLAECKA  555

Query  1718  RTDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMK  1897
             R DIP PEELF RLVVLLH+PLARE L +QIL+VL YLAPLFPKNIN FWQDE  IPK+K
Sbjct  556   RADIPNPEELFVRLVVLLHDPLAREQLASQILTVLCYLAPLFPKNINLFWQDE--IPKLK  613

Query  1898  AYVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEH  2077
             AYVSDTEDL+QDP YQE+WDDMII+F AESLDVIQ+ DWV+ LGN   +QY LY SD+EH
Sbjct  614   AYVSDTEDLRQDPCYQETWDDMIINFFAESLDVIQDSDWVIPLGNAITKQYGLYTSDDEH  673

Query  2078  SALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLD  2257
             SALLHRC G+ LQKV+DRAYVR KID MY+QANI +PTNRLGLAKAMGL+AASHLDTVL+
Sbjct  674   SALLHRCFGVFLQKVNDRAYVRDKIDWMYKQANITIPTNRLGLAKAMGLIAASHLDTVLE  733

Query  2258  KLKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDAL  2437
             KLKGILDNV QSI +R  SFFSD  K E+SDD HAALALMYGYAAKYAP TVIEARIDAL
Sbjct  734   KLKGILDNVEQSIFRRFLSFFSDDFKTEDSDDIHAALALMYGYAAKYAPSTVIEARIDAL  793

Query  2438  VGTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGR  2617
             VGTNMLSRLLHVRHP AKQAVITAIDLLG+AVI A+E+G SFPLKRRD +LDYILTLMGR
Sbjct  794   VGTNMLSRLLHVRHPTAKQAVITAIDLLGRAVINAAENGSSFPLKRRDQMLDYILTLMGR  853

Query  2618  DEEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVI  2797
             D+ E FSD+++ELL TQ+ ALSACTTLVSVEPKLT ETRN ++KAT+GFF LPNDP DV+
Sbjct  854   DDSESFSDTSLELLGTQARALSACTTLVSVEPKLTIETRNHVLKATLGFFALPNDPIDVV  913

Query  2798  NPLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLI  2977
             NPLIDNLITLLC IL+TSGEDGRSRAEQL HILR ID +VSS ++YQR+RGCLA HE+L+
Sbjct  914   NPLIDNLITLLCAILLTSGEDGRSRAEQLSHILRQIDQYVSSPMDYQRRRGCLAVHEMLL  973

Query  2978  KFRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPR  3157
             KFR +C+  +CALGCQGSC+H KQ D   + N SNLPSAF LPSR+ALSLG+R+++YLPR
Sbjct  974   KFRTVCITAHCALGCQGSCTHKKQFDRNLHGNFSNLPSAFVLPSREALSLGDRVIMYLPR  1033

Query  3158  CIDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILRSDAS  3337
             C DTN EVR VS QIL+  F+IS SLP+P  SS G+DIELSY ALSSLEDV+AILRSDAS
Sbjct  1034  CADTNSEVRTVSAQILDQLFSISLSLPRPETSSYGVDIELSYSALSSLEDVIAILRSDAS  1093

Query  3338  IDPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNEL  3517
             IDPSEVFNR++SSVC LL K+EL+A LHGC+ AICDKIKQSAEGAIQAV+EFVT RGNEL
Sbjct  1094  IDPSEVFNRIISSVCILLTKNELIATLHGCTSAICDKIKQSAEGAIQAVIEFVTRRGNEL  1153

Query  3518  NEIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMVTKD  3697
             +E +VSRT+Q+LL A  HVTEK+LRQETL AI S+AE+T+SKVVF EVLA +GRD+VTKD
Sbjct  1154  SEADVSRTTQALLMAATHVTEKHLRQETLAAISSLAESTSSKVVFNEVLATSGRDIVTKD  1213

Query  3698  IHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSVDGSI  3877
             I RLRGGWP+QDAF+AFSQH VLS  FL+HVI V  Q P  K GDS KG++  + VDG +
Sbjct  1214  ISRLRGGWPMQDAFYAFSQHTVLSSLFLKHVIGVFGQYPIPK-GDSVKGDNPSHLVDGQM  1272

Query  3878  EDDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPLRAL  4057
             EDD+ +AA++A+TAFFRGGGK G+K V+Q+YASVLA LTL LG CHGLAS G  +PLRAL
Sbjct  1273  EDDILQAAIIAVTAFFRGGGKIGKKAVQQNYASVLAELTLQLGACHGLASCGQHDPLRAL  1332

Query  4058  LNAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICLFLSK  4237
             L AFQAFCECVGDLEMGKILAR GE NENE+WINLIG++A  ISIKRPKEV +IC+ LSK
Sbjct  1333  LTAFQAFCECVGDLEMGKILARDGEHNENERWINLIGDIASCISIKRPKEVQSICVILSK  1392

Query  4238  SLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQM  4417
             SL+R  R QREAAAAALSEF+RYSDGFG LL Q+VE LCRHVSD+SPTVRRLCLRGLVQ+
Sbjct  1393  SLNRHQRYQREAAAAALSEFVRYSDGFGSLLEQIVEVLCRHVSDESPTVRRLCLRGLVQI  1452

Query  4418  PSIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSIRLRN  4597
             PSIH+LQYTTQ+LGVILALLDDSDESVQLTAVSCLL +LESS  DAVEP+LLNLS+RLRN
Sbjct  1453  PSIHMLQYTTQVLGVILALLDDSDESVQLTAVSCLLTMLESSPDDAVEPILLNLSVRLRN  1512

Query  4598  LQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACRN  4777
             LQ+C+N K+RANAFAAFGALS+YG G+  ++F EQ+HAA PR+VLHLHDDD+ VRQACR+
Sbjct  1513  LQICMNPKMRANAFAAFGALSNYGIGAQHEAFLEQVHAAIPRLVLHLHDDDVSVRQACRS  1572

Query  4778  TLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSAIIQA  4957
             TLK IAPL+E++ +  L N H F+ DHR+DYEDF+RDL +Q  Q+L  RVDTY+++ IQA
Sbjct  1573  TLKRIAPLLEMEGLLPLFNMHCFNHDHRTDYEDFVRDLTKQFAQHLPSRVDTYMASTIQA  1632

Query  4958  FDAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATCSAAL  5137
             FDAPWP+IQANAVY  S MLSLSD+++I  LYY+QVFG LVGK S S DA+VRATCSAAL
Sbjct  1633  FDAPWPIIQANAVYFSSCMLSLSDDQHILTLYYAQVFGTLVGKMSKSADAVVRATCSAAL  1692

Query  5138  GLLLKSPNSSSWRDARLNK  5194
             GLLLK   SSSW+ AR+++
Sbjct  1693  GLLLKFSKSSSWKAARVDR  1711


 Score =   292 bits (747),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 137/185 (74%), Positives = 164/185 (89%), Gaps = 0/185 (0%)
 Frame = +1

Query  94   IPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGNIAG  273
            IPA EAVQV+VSSLAD+SP VREAS+++LKDI +L+PLLVLDCC   SRGGRRRFGN+AG
Sbjct  10   IPALEAVQVLVSSLADESPMVREASIASLKDIAALSPLLVLDCCSASSRGGRRRFGNMAG  69

Query  274  LFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLPD  453
            +FQV++  +RALDK +VDP FM K+AKIATAE+IS+KELN DWQRAA+G+LVS+G H PD
Sbjct  70   VFQVMAYGVRALDKDEVDPLFMSKIAKIATAEIISSKELNTDWQRAASGLLVSIGLHFPD  129

Query  454  LMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIYRPI  633
            LMMEEIFLH  G NSALPAMVQILAD+A +DALQFTPRLK VL+RV+PILG+VR+++RPI
Sbjct  130  LMMEEIFLHLPGPNSALPAMVQILADFAYADALQFTPRLKNVLSRVLPILGSVRDVHRPI  189

Query  634  FANGL  648
            FAN  
Sbjct  190  FANAF  194



>ref|XP_010098832.1| hypothetical protein L484_022597 [Morus notabilis]
 gb|EXB75920.1| hypothetical protein L484_022597 [Morus notabilis]
Length=1769

 Score =  2219 bits (5751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1137/1572 (72%), Positives = 1330/1572 (85%), Gaps = 64/1572 (4%)
 Frame = +2

Query  647   CW-----QYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGL  811
             CW     QY++DF   + LD D++SFLNSAFELLLRVWA SRDLKVR+S+VEALGQMVGL
Sbjct  196   CWCQAVLQYNMDFPSHSPLDGDIMSFLNSAFELLLRVWASSRDLKVRISSVEALGQMVGL  255

Query  812   ITRTQLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvv  991
             ITRTQLKAALPRLVPTILELYK++QD AFVATCSLH+LLNA+LLS +GPPLLDFE+LTV+
Sbjct  256   ITRTQLKAALPRLVPTILELYKKDQDIAFVATCSLHNLLNATLLSESGPPLLDFEELTVI  315

Query  992   lstll-lvCSNNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPF  1168
              STLL +VC N D KE+S++ VGLKTYNEVQHCFLTVG VYPEDLF+FLLNKCRLKEEP 
Sbjct  316   SSTLLPVVCINIDSKENSNYSVGLKTYNEVQHCFLTVGLVYPEDLFMFLLNKCRLKEEPL  375

Query  1169  TFGSLCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVG  1348
             TFG+LCVLKHLLPRL+E+WHNKRP+L+E+VKLL+DE NLGVRKAL+ELIVVMASHCYLVG
Sbjct  376   TFGALCVLKHLLPRLSEAWHNKRPLLVEAVKLLLDEQNLGVRKALSELIVVMASHCYLVG  435

Query  1349  SSGELFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGV  1528
              SGE F+EYLVRHCA+ D +  +L+S +E S  +       +++LE K GA+  TELR +
Sbjct  436   PSGESFVEYLVRHCALTDQDGSDLQSLKEVSTSSK-----AHKRLEVKTGAICVTELRAI  490

Query  1529  CEKGLLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSE  1708
             CEKGLLL+T+T+PEMEH+LWPFLLKMIIPRVYTGAVATVCRCISELCR RS  S+AML+E
Sbjct  491   CEKGLLLLTITIPEMEHILWPFLLKMIIPRVYTGAVATVCRCISELCRHRSFNSSAMLNE  550

Query  1709  CKARTDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IP  1888
             CKAR D+P PEELFARLVVLLH+PLA++ L TQIL+VL YLAPLFPKNIN FWQDE  IP
Sbjct  551   CKARADLPNPEELFARLVVLLHDPLAKDQLATQILTVLCYLAPLFPKNINLFWQDE--IP  608

Query  1889  KMKAYVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSD  2068
             KMKAY+SDTEDLKQDP YQE+WDDMI++FLAESLDVIQ+  WV+ LGN F +QYELY SD
Sbjct  609   KMKAYISDTEDLKQDPSYQETWDDMIVNFLAESLDVIQDAVWVISLGNAFTKQYELYTSD  668

Query  2069  NEHSALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDT  2248
             +EHSALLHRC G+LLQKV+DRAYV +KID MY+QANI++PTNRLGLAKAMGLVAASHLDT
Sbjct  669   DEHSALLHRCFGMLLQKVNDRAYVCSKIDWMYKQANISIPTNRLGLAKAMGLVAASHLDT  728

Query  2249  VLDKLKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARI  2428
             VLDKLK ILDNVGQSI QR  S FSD  K EESDD HAALALMYGYAAKYAP TVIE RI
Sbjct  729   VLDKLKDILDNVGQSIFQRFLSLFSDSFKREESDDIHAALALMYGYAAKYAPSTVIEGRI  788

Query  2429  DALVGTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTL  2608
             DALVGTNM+S+LLHVRHP AKQAVITAIDLLG+AVI A+E+G SFPLKRRD++LDYILTL
Sbjct  789   DALVGTNMVSQLLHVRHPTAKQAVITAIDLLGRAVINAAENGASFPLKRRDIMLDYILTL  848

Query  2609  MGRDEE-EGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDP  2785
             MGRD+  EGF+DS +ELLHTQ+LALSACTTLVSVEPKLT ETRN ++KAT+GFF LPNDP
Sbjct  849   MGRDDNNEGFADSTLELLHTQALALSACTTLVSVEPKLTIETRNHVLKATLGFFALPNDP  908

Query  2786  SDVINPLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAH  2965
             +DV+NPLIDNL+ LLC IL+TSGEDGRSRAEQLLHILR ID +VSS ++YQR+RGCLA +
Sbjct  909   ADVVNPLIDNLVMLLCAILLTSGEDGRSRAEQLLHILRQIDLYVSSPVDYQRRRGCLAVN  968

Query  2966  ELLIKFRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMV  3145
             E+L+KFR +C++GYCALGCQGSC+HSKQID   + N SNLPSA+ LPSR AL LG+R+++
Sbjct  969   EMLLKFRMVCISGYCALGCQGSCTHSKQIDRTLHGNFSNLPSAYVLPSRGALCLGDRVIM  1028

Query  3146  YLPRCIDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILR  3325
             YLPRC DTN +VRK+S QIL+  F++S SLP+P  SS G DIEL+Y ALSSLEDV+AILR
Sbjct  1029  YLPRCADTNSDVRKISAQILDQLFSVSLSLPRPAASSFGTDIELAYRALSSLEDVIAILR  1088

Query  3326  SDASIDPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNR  3505
             SDASIDPSEVFNR+VSSVC LL KDELVA L GCS AICDKIKQSAEGAIQAV+EFVT R
Sbjct  1089  SDASIDPSEVFNRIVSSVCILLTKDELVATLQGCSAAICDKIKQSAEGAIQAVIEFVTKR  1148

Query  3506  GNELNEIEVSRTSQSLLTAVVHVTEKYLRQETLGA-------------------------  3610
             GNEL E +VSR++Q+LL+A +HVT+K+LR ETLGA                         
Sbjct  1149  GNELTETDVSRSAQALLSATIHVTDKHLRLETLGAPVYVTVSFLMVDLFETIRVFYFSFF  1208

Query  3611  ------------------------ICSVAENTTSKVVFTEVLAAAGRDMVTKDIHRLRGG  3718
                                     I S+AENT++KVVF EVLA AGRD++ KDI RLRGG
Sbjct  1209  FPGGRGGLGVRDLDLCSCYLNDLKISSLAENTSTKVVFNEVLALAGRDIIMKDISRLRGG  1268

Query  3719  WPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSVDGSIEDDVSRA  3898
             WP+QDAF+AFSQH VLS  FLEHVI V+ Q+P  K GDS K E+S  SVDG I+ ++ +A
Sbjct  1269  WPMQDAFYAFSQHTVLSFVFLEHVICVLKQTPVPK-GDSEKAENSSESVDGQIDSNILQA  1327

Query  3899  AVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPLRALLNAFQAF  4078
             A++ALTAFFRGGGK G+K VEQ+YASVLA LTL LG+CH LAS G Q+PLRALL AFQAF
Sbjct  1328  AMIALTAFFRGGGKVGKKAVEQNYASVLAELTLQLGSCHILASSGQQDPLRALLTAFQAF  1387

Query  4079  CECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICLFLSKSLDRPLR  4258
             C+CVGDLEMGKIL R GEQNENE+WINL+G+LAG ISIKRPKEV +ICL L+KSLDR  +
Sbjct  1388  CDCVGDLEMGKILTRDGEQNENERWINLLGDLAGCISIKRPKEVQSICLLLTKSLDRHQK  1447

Query  4259  VQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQMPSIHVLQ  4438
              QREA AAALSEF+RYS GFG LL +MVE LC+HVSD+SPTVRRLCLRGLVQ+PSIH+L+
Sbjct  1448  YQREATAAALSEFVRYSGGFGSLLEEMVEVLCQHVSDESPTVRRLCLRGLVQIPSIHILR  1507

Query  4439  YTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSIRLRNLQVCLNA  4618
             YT Q+LGVILALLDDSDESVQLTAVSCLL +LES+  DAVEPV++NLS+RLRNLQVC+NA
Sbjct  1508  YTAQVLGVILALLDDSDESVQLTAVSCLLTILESAPNDAVEPVVINLSVRLRNLQVCMNA  1567

Query  4619  KIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACRNTLKCIAP  4798
             K+RANAFAAFGALS+YG G   ++F EQIH AFPR+VLHLHDDD+GVR+ACRNTLK I  
Sbjct  1568  KMRANAFAAFGALSNYGVGVHREAFLEQIHVAFPRLVLHLHDDDIGVRKACRNTLKRIVH  1627

Query  4799  LIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSAIIQAFDAPWPV  4978
             L E++ + A+LNTH F+SDHRSDYE+F+RDL++Q+ Q+L  RVDTY+++I+QAFDAPWPV
Sbjct  1628  LFELEGLCAILNTHGFNSDHRSDYENFVRDLSKQVAQHLPSRVDTYMASIVQAFDAPWPV  1687

Query  4979  IQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATCSAALGLLLKSP  5158
             IQANA+YL SS+LS S ++++ A+YY+QVFGVLVGK S S+DA+VRATCS+ALGLLLKS 
Sbjct  1688  IQANAIYLSSSILSFSADQHVLAIYYTQVFGVLVGKMSRSSDAVVRATCSSALGLLLKSI  1747

Query  5159  NSSSWRDARLNK  5194
             NS SWR  R ++
Sbjct  1748  NSLSWRADRPDR  1759


 Score =   292 bits (747),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 138/188 (73%), Positives = 166/188 (88%), Gaps = 0/188 (0%)
 Frame = +1

Query  85   GDSIPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGN  264
            G SIPA EAVQV+VSSLAD+SP VREASM++L++I +LNPLLVLDCC  VSRGGRRRFGN
Sbjct  7    GISIPAPEAVQVLVSSLADESPMVREASMASLEEIAALNPLLVLDCCSAVSRGGRRRFGN  66

Query  265  IAGLFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSH  444
            +AG+FQV++  +RALDK D+DP+FM KLAKIATAE+IS+KEL+ DWQRAA+ +LVS+GSH
Sbjct  67   MAGVFQVMAFGVRALDKKDLDPSFMAKLAKIATAEMISSKELSTDWQRAASWLLVSIGSH  126

Query  445  LPDLMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIY  624
              DLMMEEIFLHF G +S LPAMVQ LAD+A +DALQFTPR+K VL+RV+PILGNVR+I+
Sbjct  127  FADLMMEEIFLHFPGPSSGLPAMVQTLADFAFADALQFTPRVKSVLSRVLPILGNVRDIH  186

Query  625  RPIFANGL  648
            RPIFAN  
Sbjct  187  RPIFANAF  194



>gb|KDP29202.1| hypothetical protein JCGZ_16591 [Jatropha curcas]
Length=1708

 Score =  2194 bits (5684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1135/1518 (75%), Positives = 1295/1518 (85%), Gaps = 25/1518 (2%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             A WQY++DF   + LD  V+SFLNSAFELLLRVWA SRDLK+R S+VEALGQMVGLITRT
Sbjct  200   AVWQYNMDFPSHSPLDAGVMSFLNSAFELLLRVWATSRDLKIRTSSVEALGQMVGLITRT  259

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstl  1003
             QLKAALPRLVPT+LELYK++QD A +ATCSLH+LLNASLLS  GPPLLDFEDLTV+LSTL
Sbjct  260   QLKAALPRLVPTVLELYKKDQDIALLATCSLHNLLNASLLSETGPPLLDFEDLTVILSTL  319

Query  1004  l-lvCSNNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGS  1180
             L ++C NND KEHSDF VGLKTYNEVQ CFLTVG VYP+DLF FLLNKCRLKEE  TFG+
Sbjct  320   LPVICINNDSKEHSDFSVGLKTYNEVQRCFLTVGLVYPDDLFTFLLNKCRLKEESLTFGA  379

Query  1181  LCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGE  1360
             L VLKHLLPR +E+WHNKRP+L+E+VK L+DE NLGVR+AL+ELIVVMASHCYLVGSSGE
Sbjct  380   LSVLKHLLPRSSEAWHNKRPLLVEAVKSLLDEQNLGVRRALSELIVVMASHCYLVGSSGE  439

Query  1361  LFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKG  1540
             LFIEYLVRHCA+ DL++ + E+S+                   K+G     ELR +CEKG
Sbjct  440   LFIEYLVRHCALSDLDSNDPENSK------------------VKSGRFCPIELRAICEKG  481

Query  1541  LLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKAR  1720
             LLLIT+T+PEMEHVLWPFLL MIIPR+YTGAVATVCRCISELCR RSS  + MLSE KAR
Sbjct  482   LLLITITIPEMEHVLWPFLLNMIIPRIYTGAVATVCRCISELCRHRSSTISGMLSEFKAR  541

Query  1721  TDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKA  1900
              D P PEELFARL+VLLH+PLARE L TQIL VL YLAPLFP+NIN FWQDE  IPKMKA
Sbjct  542   ADSPSPEELFARLLVLLHDPLAREQLATQILMVLCYLAPLFPRNINLFWQDE--IPKMKA  599

Query  1901  YVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHS  2080
             YVSDTEDLKQDP YQE+WDDMII+FLAESLDVIQ+ DWV+ LGN F  QY+LY +D+EH+
Sbjct  600   YVSDTEDLKQDPSYQETWDDMIINFLAESLDVIQDTDWVISLGNAFTNQYDLYTTDDEHA  659

Query  2081  ALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDK  2260
             ALLHRCLG+LLQKV +RAYV++KID MY+ +NIA+P NRLGLAKAMGLVAASHLDTVL+K
Sbjct  660   ALLHRCLGMLLQKVDNRAYVQSKIDWMYKHSNIAIPANRLGLAKAMGLVAASHLDTVLEK  719

Query  2261  LKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALV  2440
             LK IL NVGQSI QR+ SFFSD  K EESDD HAALALMYGYAA+YAP TVIEARIDALV
Sbjct  720   LKDILANVGQSIFQRLLSFFSDSYKTEESDDIHAALALMYGYAARYAPSTVIEARIDALV  779

Query  2441  GTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRD  2620
             GTNMLSRLLHVRHP AKQAVITAIDLLG+AVI A+E+G SFPLKRRD LLDYILTLMGRD
Sbjct  780   GTNMLSRLLHVRHPTAKQAVITAIDLLGRAVINAAENGASFPLKRRDQLLDYILTLMGRD  839

Query  2621  EEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVIN  2800
             + +G  DS++ELLHTQ+LALSACTTLVSVEPKLT ETRN +MKAT+GFF LPN+P +V+N
Sbjct  840   DNDGLGDSSLELLHTQALALSACTTLVSVEPKLTIETRNHVMKATLGFFALPNEPVEVVN  899

Query  2801  PLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIK  2980
             PLIDNLITLLC IL+TSGEDGRSRAEQLLHILR ID +VSSS+E QR+RGCLAAHE+L+K
Sbjct  900   PLIDNLITLLCAILLTSGEDGRSRAEQLLHILRQIDQYVSSSVECQRRRGCLAAHEMLLK  959

Query  2981  FRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPRC  3160
             FR +CV+GYCALGC GSC+HSKQID   + N +NLPSAF LPSR++L LGER+++YLPRC
Sbjct  960   FRMLCVSGYCALGCHGSCTHSKQIDRTLHGNFANLPSAFVLPSRESLCLGERVIMYLPRC  1019

Query  3161  IDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILRSDASI  3340
              DTN EVRKVS QIL+  F+IS SLPKP+ SS  +DIEL+Y ALSSLEDV+AILRSDASI
Sbjct  1020  ADTNSEVRKVSAQILDQLFSISLSLPKPLGSSSSVDIELAYSALSSLEDVIAILRSDASI  1079

Query  3341  DPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNELN  3520
             DPSEVFNR+VSSVC LL K+ELV  L GC+ AICDKIKQSAEGAIQAV+EFV+ RG EL+
Sbjct  1080  DPSEVFNRIVSSVCILLTKNELVGTLQGCTAAICDKIKQSAEGAIQAVIEFVSKRGMELS  1139

Query  3521  EIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMVTKDI  3700
             E +VSR +QSL++AVVHVTEK+LR ETLGAI S+AENT SK+VF EVLA A RD+VTKDI
Sbjct  1140  ETDVSRITQSLVSAVVHVTEKHLRLETLGAISSLAENTRSKIVFDEVLATAARDIVTKDI  1199

Query  3701  HRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSVDGSIE  3880
              RLRGGWP+Q+AF+AFSQH VLS  FLEH+ISV+N +P +K    G  +SS +  DG I 
Sbjct  1200  SRLRGGWPMQEAFYAFSQHPVLSFQFLEHLISVLNLTPVIK----GDLDSSSHFADGQIG  1255

Query  3881  DDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPLRALL  4060
             DD+ +AA+ ALTAFFRGGGK G+K VEQSYASVLA L L  G+CHGLAS G  E LRALL
Sbjct  1256  DDILQAAMFALTAFFRGGGKVGKKAVEQSYASVLAALILQFGSCHGLASSGQHELLRALL  1315

Query  4061  NAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICLFLSKS  4240
              AFQAFCECVGDLEMGKILAR GEQNE EKWINLIG+LAGSISIKRPKEV TI L L+KS
Sbjct  1316  TAFQAFCECVGDLEMGKILARDGEQNEKEKWINLIGDLAGSISIKRPKEVQTISLILTKS  1375

Query  4241  LDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQMP  4420
             LDR  + QREAAAAALSEF+RYS GF  LL +MVEALCRHVSD+SPTVR LCLRGLVQ+P
Sbjct  1376  LDRHQKFQREAAAAALSEFVRYSGGFSSLLEEMVEALCRHVSDESPTVRSLCLRGLVQIP  1435

Query  4421  SIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSIRLRNL  4600
             SIH+ QYT Q LGVI+ALLDDSDESVQLTAVSCLL VLESS  DAVEP+LLNLS+RLRNL
Sbjct  1436  SIHIYQYTPQTLGVIVALLDDSDESVQLTAVSCLLTVLESSPNDAVEPILLNLSVRLRNL  1495

Query  4601  QVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACRNT  4780
             Q+C+N KIRA AFAAFGALSSYG G+  + F EQIHAA PR+VLHLHDDD+ VR ACRNT
Sbjct  1496  QICMNTKIRATAFAAFGALSSYGVGAQREIFLEQIHAATPRLVLHLHDDDISVRHACRNT  1555

Query  4781  LKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSAIIQAF  4960
             LK IAPL++I+ + +L N+H  +SDHRSDYE FLRD  R LTQYL  RVD+Y+++ IQA 
Sbjct  1556  LKHIAPLMKIEGLASLSNSHCCNSDHRSDYEGFLRDFTRLLTQYLPSRVDSYMASTIQAI  1615

Query  4961  DAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATCSAALG  5140
             DAPWP+IQANA+YL SS+LSLSD+  I ALYY+QVFG+LVGK + S DA+VRATCS+ALG
Sbjct  1616  DAPWPIIQANAIYLASSILSLSDDPRILALYYAQVFGMLVGKMNQSADAVVRATCSSALG  1675

Query  5141  LLLKSPNSSSWRDARLNK  5194
             LLL+S NS SWR ARL++
Sbjct  1676  LLLRSTNSLSWRTARLDR  1693


 Score =   301 bits (772),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 143/185 (77%), Positives = 169/185 (91%), Gaps = 0/185 (0%)
 Frame = +1

Query  94   IPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGNIAG  273
            IPA EA+QV+VSSLAD+S  VREASMS+LKD++SLNPLLVLDCC TVSRGGRR+FGN+AG
Sbjct  10   IPAPEAIQVLVSSLADESSIVREASMSSLKDLSSLNPLLVLDCCCTVSRGGRRQFGNLAG  69

Query  274  LFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLPD  453
            +F+V+++ +RAL K DVDPA+M KLAKIATAE+IS+KELNADWQRAAAG+LVS+G HLPD
Sbjct  70   VFEVMAMGVRALAKQDVDPAYMAKLAKIATAEMISSKELNADWQRAAAGLLVSIGLHLPD  129

Query  454  LMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIYRPI  633
            LMMEEIFLH SG +SA PAMVQ LAD+AS+DALQFTPRLKGVL+RV+PILGNVR+ +RPI
Sbjct  130  LMMEEIFLHLSGPSSASPAMVQTLADFASADALQFTPRLKGVLSRVLPILGNVRDAHRPI  189

Query  634  FANGL  648
            FAN  
Sbjct  190  FANAF  194



>ref|XP_002519443.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42857.1| conserved hypothetical protein [Ricinus communis]
Length=1722

 Score =  2192 bits (5681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1142/1518 (75%), Positives = 1300/1518 (86%), Gaps = 12/1518 (1%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             A WQY+VDF     LD  V+SFLNSAFELLLRVWA SRDLKVR S+VEALGQMVGLITRT
Sbjct  202   AVWQYNVDFPSQCPLDAAVMSFLNSAFELLLRVWATSRDLKVRTSSVEALGQMVGLITRT  261

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstl  1003
             QLKAALPRLVPTILELYK++QD A +ATCSLH+LLNASLLS  GPPLLDFEDLTV+LSTL
Sbjct  262   QLKAALPRLVPTILELYKKDQDIALLATCSLHNLLNASLLSETGPPLLDFEDLTVILSTL  321

Query  1004  l-lvCSNNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGS  1180
             L +VC N+D KE SDF VGLKTYNEVQ CFLTVG VYP+DLF FLLNKCRLKEE  TFG+
Sbjct  322   LPVVCINSDSKEQSDFSVGLKTYNEVQRCFLTVGLVYPDDLFTFLLNKCRLKEESLTFGA  381

Query  1181  LCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGE  1360
             LCVLKHLLPR +E+WHNKRP+L+E VK L+DE NLGVR+AL+ELIVVMASHCYLVG SGE
Sbjct  382   LCVLKHLLPRSSEAWHNKRPLLVEVVKSLLDEQNLGVRRALSELIVVMASHCYLVGPSGE  441

Query  1361  LFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKG  1540
             LFIEYLVRHCA+ DLE  + ++S+  S  T          L+ K  +    ELRG+CEKG
Sbjct  442   LFIEYLVRHCALSDLERNDPDNSKVDSGSTCF--------LQVKLRSFCPIELRGICEKG  493

Query  1541  LLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKAR  1720
             LLL+T+T+PEME++LWPFLL MIIPR+YTGAVATVCRCISELCR RSS    MLSECKAR
Sbjct  494   LLLLTITIPEMEYILWPFLLTMIIPRIYTGAVATVCRCISELCRHRSSNIGGMLSECKAR  553

Query  1721  TDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKA  1900
              DIP PEELFARL+VLLH+PLARE L T IL+VL YLAPL PKNIN FWQDE  IPKMKA
Sbjct  554   PDIPSPEELFARLLVLLHDPLAREQLATHILTVLCYLAPLLPKNINMFWQDE--IPKMKA  611

Query  1901  YVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHS  2080
             YVSDTEDLK DP YQE+WDDMII+FLAESLDVIQ+ DWV+ LGN F  QYELY  D+EH+
Sbjct  612   YVSDTEDLKLDPSYQETWDDMIINFLAESLDVIQDTDWVISLGNAFTNQYELYTPDDEHA  671

Query  2081  ALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDK  2260
             ALLHRCLG+LLQKV +RAYV+ KID MY+QANIA+PTNRLGLAKAMGLVAASHLDTVL+K
Sbjct  672   ALLHRCLGMLLQKVDNRAYVQNKIDWMYKQANIAIPTNRLGLAKAMGLVAASHLDTVLEK  731

Query  2261  LKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALV  2440
             LK IL NVGQSI QR+ S FSD  K EESDD HAALALMYGYAA+YAP TVIEARIDALV
Sbjct  732   LKEILANVGQSIFQRLLSLFSDSYKTEESDDIHAALALMYGYAARYAPSTVIEARIDALV  791

Query  2441  GTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRD  2620
             GTNMLSRLLHVRH  AKQAVITAIDLLG+AVI A+E+G SFPLKRRD LLDYILTLMGRD
Sbjct  792   GTNMLSRLLHVRHHTAKQAVITAIDLLGRAVINAAENGASFPLKRRDQLLDYILTLMGRD  851

Query  2621  EEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVIN  2800
             + + F+DS++ELLHTQ+LALSACTTLVSVEPKLT ETRN +MKAT+GFF LPN+P DV+N
Sbjct  852   DNDDFADSSLELLHTQALALSACTTLVSVEPKLTIETRNHVMKATLGFFALPNEPVDVVN  911

Query  2801  PLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIK  2980
             PLIDNLITLLC IL+TSGEDGRSRAEQLLHILR ID +VSS +EYQR+RGCLA HE+LIK
Sbjct  912   PLIDNLITLLCAILLTSGEDGRSRAEQLLHILRQIDHYVSSPVEYQRRRGCLAVHEMLIK  971

Query  2981  FRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPRC  3160
             FR +CV+GYCA GC G+C+HSKQID   + N SNLPSAF LPSR+AL LGERI +YLPRC
Sbjct  972   FRMLCVSGYCAFGCHGNCTHSKQIDRTLHSNFSNLPSAFVLPSREALCLGERIFMYLPRC  1031

Query  3161  IDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILRSDASI  3340
              DTN EVRKVS QIL+  F+IS SLPKP  SS G+D+EL Y ALSSLEDV+A+LRSDASI
Sbjct  1032  ADTNSEVRKVSAQILDKLFSISLSLPKPGGSSFGVDMELLYSALSSLEDVIAMLRSDASI  1091

Query  3341  DPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNELN  3520
             DPSEVFNR++SSVC LL K+ELV  LHGC+GAICDKIK SAEGAIQAV+EFV+ RG EL+
Sbjct  1092  DPSEVFNRIISSVCVLLTKNELVVTLHGCTGAICDKIKPSAEGAIQAVIEFVSKRGKELS  1151

Query  3521  EIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMVTKDI  3700
             E +VSRT+QSLL+AVVHVTEK+LR ETLGAI S+AE+T+ K+VF EVLA A RD+VTKDI
Sbjct  1152  ETDVSRTTQSLLSAVVHVTEKHLRLETLGAISSLAESTSPKIVFDEVLATAARDIVTKDI  1211

Query  3701  HRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSVDGSIE  3880
              RLRGGWP+Q+AF+AFSQH+VLS  FLEH+ SV+NQSP +K GD  KG+SS +  DG IE
Sbjct  1212  SRLRGGWPMQEAFYAFSQHIVLSFQFLEHLTSVLNQSPVIK-GDLEKGDSSSHFADGQIE  1270

Query  3881  DDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPLRALL  4060
             DD+ +AAVLALTAFFRGGGK G+K VEQ+YASVLA L L  G+CHGLAS G  EPLRALL
Sbjct  1271  DDILQAAVLALTAFFRGGGKVGKKAVEQNYASVLAALILQFGSCHGLASSGRHEPLRALL  1330

Query  4061  NAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICLFLSKS  4240
              AFQAFCECVGDLEMGKILAR GEQNE  KWI LIG +AG+ISIKRPKEV TI L L+KS
Sbjct  1331  TAFQAFCECVGDLEMGKILARDGEQNEKVKWITLIGGVAGNISIKRPKEVQTISLILTKS  1390

Query  4241  LDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQMP  4420
             L+R    QREAAAA+LSEF+RYS GF  LL +MVEALCRHVSD+SPTVR LCLRGLVQ+P
Sbjct  1391  LNRHQSFQREAAAASLSEFVRYSGGFTSLLDEMVEALCRHVSDESPTVRCLCLRGLVQIP  1450

Query  4421  SIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSIRLRNL  4600
             SIH+ QYTTQIL VI+ALLDDSDESVQLTAVSCLL VLESS  DAV+P+LLNLS+RLRNL
Sbjct  1451  SIHICQYTTQILSVIVALLDDSDESVQLTAVSCLLTVLESSPNDAVDPILLNLSVRLRNL  1510

Query  4601  QVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACRNT  4780
             Q+C+N KIRA AFAAFGALSSYGAG+  + F EQIHAA PR+VLHLHDDD+ VRQACRNT
Sbjct  1511  QICMNTKIRATAFAAFGALSSYGAGTQHEIFLEQIHAAIPRLVLHLHDDDISVRQACRNT  1570

Query  4781  LKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSAIIQAF  4960
             LK IAPL+E++ + AL N+H F+S++RSDYEDFLRD  +Q +Q+L  RVDTY+++ IQA 
Sbjct  1571  LKRIAPLVEMEGLAALFNSHCFTSENRSDYEDFLRDFTKQFSQHLPSRVDTYMASAIQAL  1630

Query  4961  DAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATCSAALG  5140
             +APWPVIQANA+YL SS+LSLSD+++I ALYY+QVFG+LVGK S S DA++RATCS+ALG
Sbjct  1631  EAPWPVIQANAIYLASSLLSLSDDQHILALYYAQVFGLLVGKMSRSADAVIRATCSSALG  1690

Query  5141  LLLKSPNSSSWRDARLNK  5194
             LLLKS N  SWR ARL++
Sbjct  1691  LLLKSTNFLSWRAARLDR  1708


 Score =   292 bits (748),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 137/188 (73%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = +1

Query  85   GDSIPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGN  264
            G SIPA +AVQV+VSSLAD+S  VR+ASM++LK+++SLNPLLVLDCC  VSRGGRRRFGN
Sbjct  9    GTSIPAPDAVQVLVSSLADESLIVRQASMASLKELSSLNPLLVLDCCSAVSRGGRRRFGN  68

Query  265  IAGLFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSH  444
            +AG+FQV+++ ++ALDK  VDP++M KLAKIAT+E+IS+K+LNADWQRAAAG+LVS+GSH
Sbjct  69   MAGVFQVMAIGVKALDKRYVDPSYMAKLAKIATSEMISSKDLNADWQRAAAGLLVSIGSH  128

Query  445  LPDLMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIY  624
            LPDLM++EIF H SG++SALPAMVQILAD+AS+DALQFTPRLKGVL+RV+PILG++R+ +
Sbjct  129  LPDLMIDEIFSHLSGASSALPAMVQILADFASADALQFTPRLKGVLSRVLPILGSLRDAH  188

Query  625  RPIFANGL  648
            RPIFAN  
Sbjct  189  RPIFANAF  196



>ref|XP_007027497.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY07999.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
Length=1712

 Score =  2187 bits (5666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1121/1518 (74%), Positives = 1291/1518 (85%), Gaps = 22/1518 (1%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             A WQY+VDF   + LD DV+SFLNSAFELLLRVWA SRDLKVR+S+VEALGQMVGLITRT
Sbjct  201   AVWQYNVDFPSDSPLDGDVMSFLNSAFELLLRVWAASRDLKVRISSVEALGQMVGLITRT  260

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstl  1003
             QLKAALPRLVPTILELYKREQD A +AT SL++LLNASLLS  GPPLLDFE+LTV+LSTL
Sbjct  261   QLKAALPRLVPTILELYKREQDIALIATYSLYNLLNASLLSETGPPLLDFEELTVILSTL  320

Query  1004  l-lvCSNNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGS  1180
             L ++C NND KEHSDF VGLKTYNEVQ CFLTVGSVYPEDLF FLLNKCRLKEEP TFG+
Sbjct  321   LPVICMNNDSKEHSDFSVGLKTYNEVQRCFLTVGSVYPEDLFTFLLNKCRLKEEPLTFGA  380

Query  1181  LCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGE  1360
             LCVLKHLLPR +E+WHNKRP+L+++VK L+DE NLG+ KAL+ELIVVMASHCYLVG   E
Sbjct  381   LCVLKHLLPRSSEAWHNKRPLLLDAVKSLLDEQNLGIGKALSELIVVMASHCYLVGPYAE  440

Query  1361  LFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKG  1540
             LF+EYLV HCA+ + +  +LESS                  + K G+V  TELR +CEKG
Sbjct  441   LFVEYLVCHCALSEHDRHDLESS------------------QVKIGSVCPTELRAICEKG  482

Query  1541  LLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKAR  1720
             LLL+T+T+PEMEH+LWPFLLKMIIP+ YTGAVATVCRCI+ELCR RSS +N MLS+CKAR
Sbjct  483   LLLLTITIPEMEHILWPFLLKMIIPQAYTGAVATVCRCIAELCRHRSSYNNNMLSDCKAR  542

Query  1721  TDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKA  1900
             +DIP PEELFARLVVLLHNPLARE L TQIL+VL YLAPLFP+NIN FWQDE  IPKMKA
Sbjct  543   SDIPNPEELFARLVVLLHNPLAREQLATQILTVLCYLAPLFPRNINLFWQDE--IPKMKA  600

Query  1901  YVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHS  2080
             YVSD EDL+ DP YQE+WDDMII+FLAESLDVIQ+ DWV+ LGN F +QY LY  D+EHS
Sbjct  601   YVSDPEDLELDPSYQETWDDMIINFLAESLDVIQDTDWVISLGNAFTKQYSLYAPDDEHS  660

Query  2081  ALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDK  2260
             ALLHR LGILLQKV+DR YVR KID MY+QANIA+PTNRLGLAKAMGLVAASHLD VLDK
Sbjct  661   ALLHRGLGILLQKVNDRGYVRGKIDWMYKQANIAIPTNRLGLAKAMGLVAASHLDAVLDK  720

Query  2261  LKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALV  2440
             LK ILDNVGQSI QR  +FFS+  + E+SDD HAALALMYGYAA+YAP  VIEARIDALV
Sbjct  721   LKDILDNVGQSIFQRFLAFFSESYRTEDSDDVHAALALMYGYAARYAPSMVIEARIDALV  780

Query  2441  GTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRD  2620
             GTNMLSRLLHV HP AKQAVITAIDLLG+AVI A+E+G  FPLKRRD LLDYILTLMGRD
Sbjct  781   GTNMLSRLLHVHHPTAKQAVITAIDLLGRAVINAAENGAPFPLKRRDQLLDYILTLMGRD  840

Query  2621  EEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVIN  2800
             E +GF+DS++ELLHTQ+LAL+ACTTLVSVEPKLT ETRN +MKAT+GFF LPNDP DVIN
Sbjct  841   ETDGFADSSLELLHTQALALNACTTLVSVEPKLTIETRNHVMKATLGFFALPNDPIDVIN  900

Query  2801  PLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIK  2980
             PLIDNLITLLC IL+TSGEDGRSRAEQLLHILR ID +VSSS+EYQR+RGCLA +E+L+K
Sbjct  901   PLIDNLITLLCAILLTSGEDGRSRAEQLLHILRQIDQYVSSSVEYQRRRGCLAVYEMLVK  960

Query  2981  FRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPRC  3160
             FR +CV+GYCALGC+GSC+HSKQID   + N SNLPSAF LPSR+ALSLG+R+++YLPRC
Sbjct  961   FRMLCVSGYCALGCRGSCTHSKQIDRTLHGNFSNLPSAFVLPSREALSLGDRVIMYLPRC  1020

Query  3161  IDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILRSDASI  3340
              DTN EVRK+S QIL+  F+IS SLP+P+ SS+G DIELSY ALSSLEDV+AILRSDASI
Sbjct  1021  ADTNSEVRKISAQILDQLFSISLSLPRPLGSSVGGDIELSYGALSSLEDVIAILRSDASI  1080

Query  3341  DPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNELN  3520
             DPSEVFNR+V+SVC LL KDELV  LHGC  AICDKIKQSAEGAIQAV+EFVT RG EL+
Sbjct  1081  DPSEVFNRIVASVCVLLTKDELVGTLHGCMPAICDKIKQSAEGAIQAVIEFVTKRGIELS  1140

Query  3521  EIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMVTKDI  3700
             E +VSRT+QSLL+AVVHVTEK LR E LGAI S++ENT +K+VF EVLAAAGRD+VTKDI
Sbjct  1141  ETDVSRTTQSLLSAVVHVTEKQLRLEVLGAISSLSENTNAKIVFNEVLAAAGRDIVTKDI  1200

Query  3701  HRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSVDGSIE  3880
              RLRGGWP+QDAFHAFSQH+VLS  FLEH+ISV+NQ+   K  D GKGE+S    +  +E
Sbjct  1201  SRLRGGWPMQDAFHAFSQHIVLSVLFLEHLISVLNQTHFTK-SDPGKGENSSLLSETQLE  1259

Query  3881  DDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPLRALL  4060
             D++ +AA+ ALTAFF+GGGK G++ VEQSY+SVLA L L  G+CHGLAS G  EPLRALL
Sbjct  1260  DEILQAAIFALTAFFKGGGKVGKRAVEQSYSSVLAALILQFGSCHGLASSGQHEPLRALL  1319

Query  4061  NAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICLFLSKS  4240
              +FQAFCECVGDLEMGK LAR GEQNE EKWINLIG+LAG ISIKRPKEV  IC   +KS
Sbjct  1320  TSFQAFCECVGDLEMGKFLARDGEQNEKEKWINLIGDLAGCISIKRPKEVQNICKIFTKS  1379

Query  4241  LDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQMP  4420
             L+R  + QREAAAAALSEF+ YS GF  LL +MVE LCRHVSD+SP VR LCLRGLV++P
Sbjct  1380  LNRQEKTQREAAAAALSEFVCYSSGFSSLLEEMVEVLCRHVSDESPAVRCLCLRGLVKIP  1439

Query  4421  SIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSIRLRNL  4600
             S+H+ QYT Q+LGVIL+LLDD DESVQLTAVSCLL +L+SS  DAVEP+LLNLS+RLRNL
Sbjct  1440  SVHIYQYTNQVLGVILSLLDDLDESVQLTAVSCLLTILDSSPNDAVEPILLNLSVRLRNL  1499

Query  4601  QVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACRNT  4780
             Q+ +N K+RA+AFAAFGALS+YG G+  D+F EQIHA  PR++LHLHDDDL VR ACRNT
Sbjct  1500  QISMNVKMRADAFAAFGALSNYGVGAHKDAFIEQIHATLPRLILHLHDDDLAVRHACRNT  1559

Query  4781  LKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSAIIQAF  4960
             LK  A L+EI+ + AL N+H  +SDHRSDYEDF+RD  RQ  Q+L  RVDTY+ + IQAF
Sbjct  1560  LKRFATLMEIEGLLALFNSHSINSDHRSDYEDFVRDFTRQFVQHLSSRVDTYMVSTIQAF  1619

Query  4961  DAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATCSAALG  5140
             DAPWP+IQANA+Y+ SS+LSLS++++I ALY++QVFG+LV K S S DA+VRAT S+A G
Sbjct  1620  DAPWPIIQANAIYVSSSILSLSNDQHILALYFTQVFGLLVSKMSRSADAVVRATSSSAFG  1679

Query  5141  LLLKSPNSSSWRDARLNK  5194
             LLLKS NS SWR ARL +
Sbjct  1680  LLLKSTNSISWRVARLER  1697


 Score =   305 bits (782),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 144/188 (77%), Positives = 171/188 (91%), Gaps = 0/188 (0%)
 Frame = +1

Query  85   GDSIPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGN  264
            G S+PA EAVQV+VSSLAD+SP VREASM++LKDI+ LNPLLVLDCC  VSRGGRRRFGN
Sbjct  8    GGSLPAPEAVQVIVSSLADESPMVREASMASLKDISPLNPLLVLDCCSAVSRGGRRRFGN  67

Query  265  IAGLFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSH  444
            +AG+FQV++  +RALDK D+D ++M KLAKIATAE+IS+KELNADWQRAAA +LVS+GSH
Sbjct  68   MAGVFQVMAFGVRALDKKDIDASYMGKLAKIATAEIISSKELNADWQRAAASLLVSIGSH  127

Query  445  LPDLMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIY  624
            LPDLM+EEIFLH SG +SALPAMVQILAD+AS+DA+QFTPRLKGVL+RV+PILGNVR+ +
Sbjct  128  LPDLMIEEIFLHLSGPSSALPAMVQILADFASADAMQFTPRLKGVLSRVLPILGNVRDAH  187

Query  625  RPIFANGL  648
            RPIFAN  
Sbjct  188  RPIFANAF  195



>ref|XP_011018819.1| PREDICTED: protein SHOOT GRAVITROPISM 6 isoform X1 [Populus euphratica]
Length=1696

 Score =  2156 bits (5587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1109/1517 (73%), Positives = 1286/1517 (85%), Gaps = 23/1517 (2%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             A WQY++DF   + LD DV+SFLNSAFELLLRVWA SRDLKVR S+VEALGQM GLITRT
Sbjct  200   AAWQYNMDFPSLSPLDADVMSFLNSAFELLLRVWATSRDLKVRTSSVEALGQMFGLITRT  259

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstl  1003
             QLK ALPRLVPTILELYK++QD A +ATCSL++LLNASLLS  GPPLLDFEDLTV+LSTL
Sbjct  260   QLKTALPRLVPTILELYKKDQDIALLATCSLYNLLNASLLSETGPPLLDFEDLTVILSTL  319

Query  1004  l-lvCSNNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGS  1180
             L +VC NND KE+SDF VGLKTYNEVQ CFLTVG VYP+DLF FLLNKCRLKEE  TFG+
Sbjct  320   LPVVCFNNDIKENSDFSVGLKTYNEVQRCFLTVGLVYPDDLFTFLLNKCRLKEESLTFGA  379

Query  1181  LCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGE  1360
             LCVLKHLLPR +E+WH+KRP+L+E+VK L+DE N GVRKAL+ELIVVMASHCYLVG S E
Sbjct  380   LCVLKHLLPRSSEAWHSKRPLLVEAVKSLLDEQNFGVRKALSELIVVMASHCYLVGPSAE  439

Query  1361  LFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKG  1540
             LFIEYLV HCA+ D    + E+S+                   + GA   T+LR VCEKG
Sbjct  440   LFIEYLVSHCALSDHNRNDPENSK------------------VRIGAFCPTKLRAVCEKG  481

Query  1541  LLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKAR  1720
             LLL+T+T+PEMEH+LWPFLLKMIIPR +T A ATVCRCISELCR RSS SN+M+SECK R
Sbjct  482   LLLLTITIPEMEHILWPFLLKMIIPRSFTAATATVCRCISELCRNRSSNSNSMVSECKGR  541

Query  1721  TDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKA  1900
              DIP PEELFARL+VLLH+PL+ E L TQIL+VL YLAPLFPKNIN FWQDE  IPKMKA
Sbjct  542   ADIPSPEELFARLLVLLHDPLSMEQLATQILTVLCYLAPLFPKNINLFWQDE--IPKMKA  599

Query  1901  YVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHS  2080
             YVSDT+DLK DP YQE+WDDMII+FLAESLDVIQ+ DWV+ LGN F  QYELY SD+EHS
Sbjct  600   YVSDTDDLKLDPSYQETWDDMIINFLAESLDVIQDTDWVISLGNAFTYQYELYTSDDEHS  659

Query  2081  ALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDK  2260
             ALLHRCLG+LLQKV DRAYVR KID MY+QA+I  P NRLGLAKAMGLVAASHLDTVL+K
Sbjct  660   ALLHRCLGMLLQKVDDRAYVRNKIDWMYKQASIGNPANRLGLAKAMGLVAASHLDTVLEK  719

Query  2261  LKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALV  2440
             LK ILDNV QSI QR+ S FSD  + EESDD HAALALMYGYAA+YAP TVIEARIDAL+
Sbjct  720   LKDILDNVEQSIFQRLLSLFSDSYRTEESDDIHAALALMYGYAARYAPSTVIEARIDALL  779

Query  2441  GTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRD  2620
             GTNMLSRLLHVRHP AKQAVITAIDLLG+AVI A+ESG SFPLK+RD +LDYILTLMGRD
Sbjct  780   GTNMLSRLLHVRHPTAKQAVITAIDLLGRAVINAAESGASFPLKKRDQMLDYILTLMGRD  839

Query  2621  EEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVIN  2800
             ++ GF DS++ELLHTQ+LALSACTTLVSVEPKLT ETRN IMKAT+GFF LPN+P DV++
Sbjct  840   DD-GFVDSSLELLHTQALALSACTTLVSVEPKLTIETRNYIMKATLGFFALPNEPVDVVS  898

Query  2801  PLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIK  2980
             PLI+NLITLLC IL+TSGEDGRSRAEQLLHI+R+ID +VSSS+E+QRKRGCLA +E+L+K
Sbjct  899   PLIENLITLLCAILLTSGEDGRSRAEQLLHIMRHIDQYVSSSVEHQRKRGCLAVYEMLLK  958

Query  2981  FRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPRC  3160
             FR +C++G+CALGC GSC+H K+ D   +  +SNLPSAF LPSR+AL LGER++ YLPRC
Sbjct  959   FRMLCISGHCALGCHGSCTHRKRTDRTLHSTISNLPSAFVLPSREALCLGERVIKYLPRC  1018

Query  3161  IDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILRSDASI  3340
              DTN EVRKVS QIL+  F+++ SLPKP + SL +DIEL Y ALSSLEDV+AILRSDASI
Sbjct  1019  ADTNSEVRKVSAQILDQLFSLALSLPKPASFSLNVDIELPYSALSSLEDVIAILRSDASI  1078

Query  3341  DPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNELN  3520
             DPSEVFNR+VSS C LL KDELVA L GCS AICDKIK SAEGAIQA++EFV  RG EL+
Sbjct  1079  DPSEVFNRIVSSTCLLLTKDELVATLQGCSAAICDKIKPSAEGAIQAIIEFVMKRGKELS  1138

Query  3521  EIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMVTKDI  3700
             E +VSRT+QSLL+AVVHVTEK+LR ETLGAI S+AE+T+S +VF EVLA AG+D+VTKDI
Sbjct  1139  ETDVSRTTQSLLSAVVHVTEKHLRLETLGAIASLAESTSSNIVFDEVLATAGKDVVTKDI  1198

Query  3701  HRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSVDGSIE  3880
              RLRGGWP+QDAF+AFSQH VLS  FLEH+IS +NQ+P ++  D  KG++S +  DG IE
Sbjct  1199  SRLRGGWPMQDAFYAFSQHTVLSFQFLEHLISFLNQTPVVR-SDLEKGDTSSHLADGQIE  1257

Query  3881  DDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPLRALL  4060
             DD+ +AA++ALTAFFRGGGK G+K VEQSYASV++ LTL  G+CHGLAS G  EPLRALL
Sbjct  1258  DDILQAAMIALTAFFRGGGKVGKKAVEQSYASVVSALTLQFGSCHGLASSGQHEPLRALL  1317

Query  4061  NAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICLFLSKS  4240
              AFQAFCECVGDLEMGKILAR GEQ E E+WINLIGELAGSISIKRPKEV TIC+ L+++
Sbjct  1318  TAFQAFCECVGDLEMGKILARDGEQIEKERWINLIGELAGSISIKRPKEVRTICVILTEA  1377

Query  4241  LDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQMP  4420
             L+R  + QREAAAAALSEF+ YS GF  LL QMVEALCRHVSD+SPTVRRLCLRGLVQ+P
Sbjct  1378  LNRHQKFQREAAAAALSEFVPYSGGFDSLLEQMVEALCRHVSDESPTVRRLCLRGLVQIP  1437

Query  4421  SIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSIRLRNL  4600
             S+H+ Q+T QILG+I+ALLDD DESVQLTAVSCLL++LESS  DAVEP+LLNLS+RLRNL
Sbjct  1438  SLHIYQHTIQILGIIVALLDDLDESVQLTAVSCLLMILESSPDDAVEPILLNLSVRLRNL  1497

Query  4601  QVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACRNT  4780
             Q+ ++ K+RA+AFAAFGALS YG G+  + F EQIH A PR+VLHLHDDDL VRQACRNT
Sbjct  1498  QISMDVKMRADAFAAFGALSKYGVGAQREIFLEQIHTAIPRLVLHLHDDDLSVRQACRNT  1557

Query  4781  LKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSAIIQAF  4960
             LK +APL+E++    L N+H F+SDHRSDY+DF+RDL +Q  Q+L  RVDTY+++ IQAF
Sbjct  1558  LKRLAPLMEMEESTTLFNSHCFTSDHRSDYQDFVRDLTKQFIQHLPSRVDTYMASTIQAF  1617

Query  4961  DAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATCSAALG  5140
             DAPWP+IQANA+YL S ++SLSD++ I ALY +QVFG L+GK S S DAIVRA CS+ALG
Sbjct  1618  DAPWPIIQANAIYLVSCLVSLSDDQRILALYQTQVFGTLMGKMSRSPDAIVRAACSSALG  1677

Query  5141  LLLKSPNSSSWRDARLN  5191
             LLLKS NS  WR ARL+
Sbjct  1678  LLLKSTNSLVWRTARLD  1694


 Score =   304 bits (779),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = +1

Query  85   GDSIPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGN  264
            G+SI ASEAVQV+VSSLAD+SP+VR++SM++LK+I SLNPLLVLDCC  VSRGGRRRFGN
Sbjct  7    GNSIAASEAVQVLVSSLADESPTVRQSSMASLKEIASLNPLLVLDCCYAVSRGGRRRFGN  66

Query  265  IAGLFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSH  444
            +AG+FQV+++ + AL +GDVDP+FM KLAKIAT E+IS+KELNADWQRAAAG+LVS+GSH
Sbjct  67   MAGVFQVMALGVSALKEGDVDPSFMAKLAKIATTEMISSKELNADWQRAAAGLLVSIGSH  126

Query  445  LPDLMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIY  624
            LPDLM+EEIFLH SG +SALPAMVQILAD+A ++A+QF PRLKGVL+RV+PILGNVR+++
Sbjct  127  LPDLMIEEIFLHLSGPSSALPAMVQILADFALANAIQFIPRLKGVLSRVLPILGNVRDVH  186

Query  625  RPIFANGL  648
            RPIFAN  
Sbjct  187  RPIFANAF  194



>ref|XP_011018820.1| PREDICTED: protein SHOOT GRAVITROPISM 6 isoform X2 [Populus euphratica]
Length=1695

 Score =  2150 bits (5572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1108/1517 (73%), Positives = 1285/1517 (85%), Gaps = 24/1517 (2%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             A WQY++DF   + LD DV+SFLNSAFELLLRVWA SRDLKVR S+VEALGQM GLITRT
Sbjct  200   AAWQYNMDFPSLSPLDADVMSFLNSAFELLLRVWATSRDLKVRTSSVEALGQMFGLITRT  259

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstl  1003
             QLK ALPRLVPTILELYK++QD A +ATCSL++LLNASLLS  GPPLLDFEDLTV+LSTL
Sbjct  260   QLKTALPRLVPTILELYKKDQDIALLATCSLYNLLNASLLSETGPPLLDFEDLTVILSTL  319

Query  1004  l-lvCSNNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGS  1180
             L +VC NND KE+SDF VGLKTYNEVQ CFLTVG VYP+DLF FLLNKCRLKEE  TFG+
Sbjct  320   LPVVCFNNDIKENSDFSVGLKTYNEVQRCFLTVGLVYPDDLFTFLLNKCRLKEESLTFGA  379

Query  1181  LCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGE  1360
             LCVLKHLLPR +E+WH+KRP+L+E+VK L+DE N GVRKAL+ELIVVMASHCYLVG S E
Sbjct  380   LCVLKHLLPRSSEAWHSKRPLLVEAVKSLLDEQNFGVRKALSELIVVMASHCYLVGPSAE  439

Query  1361  LFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKG  1540
             LFIEYLV HCA+ D    + E+S+                   + GA   T+LR VCEKG
Sbjct  440   LFIEYLVSHCALSDHNRNDPENSK------------------VRIGAFCPTKLRAVCEKG  481

Query  1541  LLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKAR  1720
             LLL+T+T+PEMEH+LWPFLLKMIIPR +T A ATVCRCISELCR RSS SN+M+SECK R
Sbjct  482   LLLLTITIPEMEHILWPFLLKMIIPRSFTAATATVCRCISELCRNRSSNSNSMVSECKGR  541

Query  1721  TDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKA  1900
              DIP PEELFARL+VLLH+PL+ E L TQIL+VL YLAPLFPKNIN FWQDE  IPKMKA
Sbjct  542   ADIPSPEELFARLLVLLHDPLSMEQLATQILTVLCYLAPLFPKNINLFWQDE--IPKMKA  599

Query  1901  YVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHS  2080
             YVSDT+DLK DP YQE+WDDMII+FLAESLDVIQ+ DWV+ LGN F  QYELY SD+EHS
Sbjct  600   YVSDTDDLKLDPSYQETWDDMIINFLAESLDVIQDTDWVISLGNAFTYQYELYTSDDEHS  659

Query  2081  ALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDK  2260
             ALLHRCLG+LLQKV DRAYVR KID MY+QA+I  P NRLGLAKAMGLVAASHLDTVL+K
Sbjct  660   ALLHRCLGMLLQKVDDRAYVRNKIDWMYKQASIGNPANRLGLAKAMGLVAASHLDTVLEK  719

Query  2261  LKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALV  2440
             LK ILDNV QSI QR+ S FSD  + EESDD HAALALMYGYAA+YAP TVIEARIDAL+
Sbjct  720   LKDILDNVEQSIFQRLLSLFSDSYRTEESDDIHAALALMYGYAARYAPSTVIEARIDALL  779

Query  2441  GTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRD  2620
             GTNMLSRLLHVRHP AKQAVITAIDLLG+AVI A+ESG SFPLK+RD +LDYILTLMGRD
Sbjct  780   GTNMLSRLLHVRHPTAKQAVITAIDLLGRAVINAAESGASFPLKKRDQMLDYILTLMGRD  839

Query  2621  EEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVIN  2800
             ++ GF DS++ELLHTQ+LALSACTTLVSVEPKLT ETRN IMKAT+GFF LPN+P DV++
Sbjct  840   DD-GFVDSSLELLHTQALALSACTTLVSVEPKLTIETRNYIMKATLGFFALPNEPVDVVS  898

Query  2801  PLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIK  2980
             PLI+NLITLLC IL+TSGEDGRSRAEQLLHI+R+ID +VSSS+E+QRKRGCLA +E+L+K
Sbjct  899   PLIENLITLLCAILLTSGEDGRSRAEQLLHIMRHIDQYVSSSVEHQRKRGCLAVYEMLLK  958

Query  2981  FRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPRC  3160
             FR +C++G+CALGC GSC+H K+ D   +  +SNLPSAF LPSR+AL LGER++ YLPRC
Sbjct  959   FRMLCISGHCALGCHGSCTHRKRTDRTLHSTISNLPSAFVLPSREALCLGERVIKYLPRC  1018

Query  3161  IDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILRSDASI  3340
              DTN EVRKVS QIL+  F+++ SLPKP + SL +DIEL Y ALSSLEDV+AILRSDASI
Sbjct  1019  ADTNSEVRKVSAQILDQLFSLALSLPKPASFSLNVDIELPYSALSSLEDVIAILRSDASI  1078

Query  3341  DPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNELN  3520
             DPSEVFNR+VSS C LL KDELVA L GCS AICDKIK SAEGAIQA++EFV  RG EL+
Sbjct  1079  DPSEVFNRIVSSTCLLLTKDELVATLQGCSAAICDKIKPSAEGAIQAIIEFVMKRGKELS  1138

Query  3521  EIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMVTKDI  3700
             E +VSRT+QSLL+AVVHVTEK+LR ETLGAI S+AE+T+S +VF EVLA AG+D+VTKDI
Sbjct  1139  ETDVSRTTQSLLSAVVHVTEKHLRLETLGAIASLAESTSSNIVFDEVLATAGKDVVTKDI  1198

Query  3701  HRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSVDGSIE  3880
              RLRGGWP+QDAF+AFSQH VLS  FLEH+IS +NQ+P ++  D  KG++S +  DG IE
Sbjct  1199  SRLRGGWPMQDAFYAFSQHTVLSFQFLEHLISFLNQTPVVR-SDLEKGDTSSHLADGQIE  1257

Query  3881  DDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPLRALL  4060
             DD+ +AA++ALTAFFRGGGK G+K VEQSYASV++ LTL  G+CHGLAS G  EPLRALL
Sbjct  1258  DDILQAAMIALTAFFRGGGKVGKKAVEQSYASVVSALTLQFGSCHGLASSGQHEPLRALL  1317

Query  4061  NAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICLFLSKS  4240
              AFQAFCECVGDLEMGKILAR GEQ E E+WINLIGELAGSISIKRPKEV TIC+ L+++
Sbjct  1318  TAFQAFCECVGDLEMGKILARDGEQIEKERWINLIGELAGSISIKRPKEVRTICVILTEA  1377

Query  4241  LDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQMP  4420
             L+R  + QREAAAAALSEF+ YS GF  LL QMVEALCRHVSD+SPTVRRLCLRGLVQ+P
Sbjct  1378  LNRHQKFQREAAAAALSEFVPYSGGFDSLLEQMVEALCRHVSDESPTVRRLCLRGLVQIP  1437

Query  4421  SIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSIRLRNL  4600
             S+H+ Q+T QILG+I+ALLDD DESVQLTAVSCLL++LESS  DAVEP+LLNLS+RLRNL
Sbjct  1438  SLHIYQHTIQILGIIVALLDDLDESVQLTAVSCLLMILESSPDDAVEPILLNLSVRLRNL  1497

Query  4601  QVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACRNT  4780
             Q+ ++ K+RA+AFAAFGALS YG G+  + F EQIH A PR+VLHLHDDDL VRQACRNT
Sbjct  1498  QISMDVKMRADAFAAFGALSKYGVGAQREIFLEQIHTAIPRLVLHLHDDDLSVRQACRNT  1557

Query  4781  LKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSAIIQAF  4960
             LK +APL+E++    L N+H F+SDHR DY+DF+RDL +Q  Q+L  RVDTY+++ IQAF
Sbjct  1558  LKRLAPLMEMEESTTLFNSHCFTSDHR-DYQDFVRDLTKQFIQHLPSRVDTYMASTIQAF  1616

Query  4961  DAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATCSAALG  5140
             DAPWP+IQANA+YL S ++SLSD++ I ALY +QVFG L+GK S S DAIVRA CS+ALG
Sbjct  1617  DAPWPIIQANAIYLVSCLVSLSDDQRILALYQTQVFGTLMGKMSRSPDAIVRAACSSALG  1676

Query  5141  LLLKSPNSSSWRDARLN  5191
             LLLKS NS  WR ARL+
Sbjct  1677  LLLKSTNSLVWRTARLD  1693


 Score =   304 bits (778),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = +1

Query  85   GDSIPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGN  264
            G+SI ASEAVQV+VSSLAD+SP+VR++SM++LK+I SLNPLLVLDCC  VSRGGRRRFGN
Sbjct  7    GNSIAASEAVQVLVSSLADESPTVRQSSMASLKEIASLNPLLVLDCCYAVSRGGRRRFGN  66

Query  265  IAGLFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSH  444
            +AG+FQV+++ + AL +GDVDP+FM KLAKIAT E+IS+KELNADWQRAAAG+LVS+GSH
Sbjct  67   MAGVFQVMALGVSALKEGDVDPSFMAKLAKIATTEMISSKELNADWQRAAAGLLVSIGSH  126

Query  445  LPDLMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIY  624
            LPDLM+EEIFLH SG +SALPAMVQILAD+A ++A+QF PRLKGVL+RV+PILGNVR+++
Sbjct  127  LPDLMIEEIFLHLSGPSSALPAMVQILADFALANAIQFIPRLKGVLSRVLPILGNVRDVH  186

Query  625  RPIFANGL  648
            RPIFAN  
Sbjct  187  RPIFANAF  194



>ref|XP_006604593.1| PREDICTED: maestro heat-like repeat-containing protein family 
member 1-like isoform X1 [Glycine max]
Length=1710

 Score =  2142 bits (5550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1120/1519 (74%), Positives = 1286/1519 (85%), Gaps = 22/1519 (1%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             A WQYS+DF      D DV+SFLNSAFELLLRVWA SRDLKVR+++VEALGQMVGLITRT
Sbjct  197   AAWQYSIDFPSHFPQDGDVMSFLNSAFELLLRVWAASRDLKVRVASVEALGQMVGLITRT  256

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstl  1003
             QLK ALPRL+PTIL+LYK++QD AF+ATCSLH+LLNASLLS +GPP+LDFEDLT+VLSTL
Sbjct  257   QLKTALPRLIPTILDLYKKDQDIAFLATCSLHNLLNASLLSESGPPMLDFEDLTLVLSTL  316

Query  1004  llvCS-NNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGS  1180
             L V S NND K+ SDFPVGLK YNEVQHCFLTVG VYP+DLF+FL+NKCRL+EEP TFGS
Sbjct  317   LPVVSFNNDSKDQSDFPVGLKMYNEVQHCFLTVGLVYPDDLFLFLVNKCRLREEPLTFGS  376

Query  1181  LCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGE  1360
             LC+LKHLLPRL+E+WH+K P+L+E+VK L++E NLGVRKAL+ELIVVMASHCYLVGSSGE
Sbjct  377   LCILKHLLPRLSEAWHSKIPLLVEAVKSLLEEQNLGVRKALSELIVVMASHCYLVGSSGE  436

Query  1361  LFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKG  1540
             LFIEYLVRHCA+ D    +LES+               +++E K GAVT  ELR VCEKG
Sbjct  437   LFIEYLVRHCAITDQNRSDLESTPN-------------KRIEMKIGAVTPGELRAVCEKG  483

Query  1541  LLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKAR  1720
             LLL+T+T+PEMEH+LWPFLL+MIIP  YTGAVATVCRCISEL R RS  SN MLSECK R
Sbjct  484   LLLVTITIPEMEHILWPFLLRMIIPLTYTGAVATVCRCISELWRHRSY-SNDMLSECKTR  542

Query  1721  TDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKA  1900
              DIP  EEL ARL+VLLHNPLARE L TQIL+VL  LAPLFPKNIN FWQDE  IPKMKA
Sbjct  543   PDIPSAEELLARLLVLLHNPLAREQLATQILTVLCLLAPLFPKNINLFWQDE--IPKMKA  600

Query  1901  YVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHS  2080
             YVSDTEDLKQDP YQ++WDDMII+FLAESLDVIQ+ DWV+ LGN FA+ YELY SD++H+
Sbjct  601   YVSDTEDLKQDPSYQDTWDDMIINFLAESLDVIQDADWVMSLGNVFAKHYELYASDDQHT  660

Query  2081  ALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDK  2260
             ALLHRCLGILLQKV+DRAYV  KID MY+QANIA PTNRLGLAKAMGLVAASHLDTVL+K
Sbjct  661   ALLHRCLGILLQKVNDRAYVCDKIDWMYKQANIANPTNRLGLAKAMGLVAASHLDTVLEK  720

Query  2261  LKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALV  2440
             LK ILDNVGQSI QRI S FSD  + EESDD HAALALMYGYAAKYAP TVIEARI+ALV
Sbjct  721   LKDILDNVGQSIFQRILSLFSDSFRTEESDDIHAALALMYGYAAKYAPSTVIEARINALV  780

Query  2441  GTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRD  2620
             GTNMLSRLLHVR P+AKQAVITAIDLLG AVI A+ESG  FPLKRRD LLDYILTLMGRD
Sbjct  781   GTNMLSRLLHVRLPKAKQAVITAIDLLGNAVINAAESGSPFPLKRRDQLLDYILTLMGRD  840

Query  2621  EEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVIN  2800
             +E+GF+D N +LL TQ+LA+SACTTLVSVEPKLT ETR+ +MKAT+GFF +PNDP DV+N
Sbjct  841   DEDGFADYN-DLLRTQALAISACTTLVSVEPKLTVETRSHVMKATLGFFAIPNDPVDVVN  899

Query  2801  PLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIK  2980
             PLIDNLITLLC IL+T GEDGRSRAE L+ ILR ID FV S +EYQRKRGCLA HE+L+K
Sbjct  900   PLIDNLITLLCAILLTGGEDGRSRAELLMLILRQIDQFVCSPVEYQRKRGCLAVHEMLLK  959

Query  2981  FRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPRC  3160
             FR ICV+GYCALGC+GSC+H+KQ+D     N S LPSAF LPSR+AL LG+R+++YLPRC
Sbjct  960   FRMICVSGYCALGCRGSCAHNKQMDRTLYGNFSKLPSAFVLPSREALCLGDRVIMYLPRC  1019

Query  3161  IDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGI-DIELSYIALSSLEDVVAILRSDAS  3337
              DTN EVRK+S QIL+L F+IS SLP+P  SS+   DIELSY ALSSLEDV+AILR+D S
Sbjct  1020  ADTNSEVRKISAQILDLLFSISLSLPRPAGSSISAEDIELSYSALSSLEDVIAILRNDTS  1079

Query  3338  IDPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNEL  3517
             IDPSEVFNR+VSS+C LL K+ELVA LHGCS AICDKIKQSAEGAIQAVVEFVT RG EL
Sbjct  1080  IDPSEVFNRIVSSLCILLTKEELVATLHGCSVAICDKIKQSAEGAIQAVVEFVTKRGREL  1139

Query  3518  NEIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMVTKD  3697
              EI++SRT+QSL++A VH T+K+LR ETLGAI S+AENT+ + VF EVLAAAGRD +TKD
Sbjct  1140  TEIDISRTTQSLISATVHATDKHLRVETLGAISSLAENTSPRTVFDEVLAAAGRDTITKD  1199

Query  3698  IHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSVDGSI  3877
             I RLRGGWP+QDAF+AFSQH+VLS  FLEHVISV++Q P LKG D  + E S+  VD   
Sbjct  1200  ISRLRGGWPMQDAFYAFSQHMVLSVLFLEHVISVLSQIPILKG-DVERLEDSQ--VDSHT  1256

Query  3878  EDDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPLRAL  4057
             ED   +AA+ ALTAFFRGGGK G++ VEQ+YASVL+ LTL LG+CHGL   G  EPLR L
Sbjct  1257  EDGKLQAAIFALTAFFRGGGKVGKRAVEQNYASVLSELTLQLGSCHGLTYSGQHEPLRNL  1316

Query  4058  LNAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICLFLSK  4237
             L AFQAFCECVGDLEMGKILAR GE  ENE+WI+LIG++AG ISIKRPKEV  ICLF   
Sbjct  1317  LTAFQAFCECVGDLEMGKILARDGELLENERWISLIGDIAGCISIKRPKEVQNICLFFQN  1376

Query  4238  SLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQM  4417
             SLDRP + QREAAAAALSEF+RYS G G LL QMVE LCRHVSD+S TVRRLCLRGLVQ+
Sbjct  1377  SLDRPQKYQREAAAAALSEFVRYSGGLGSLLEQMVEVLCRHVSDESSTVRRLCLRGLVQI  1436

Query  4418  PSIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSIRLRN  4597
             P IH+L+YT Q+LGVILALLDD DESVQLTAVSCLL++L SS  DAVEP+LLNLSIRLRN
Sbjct  1437  PLIHILKYTAQVLGVILALLDDLDESVQLTAVSCLLMILNSSPDDAVEPILLNLSIRLRN  1496

Query  4598  LQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACRN  4777
             LQ  +NAK+RA +FA FGALS YG G + ++F EQ+HAA PR+VLHLHD+D  VR ACRN
Sbjct  1497  LQTSMNAKMRATSFAVFGALSKYGIGVLSEAFVEQVHAAVPRLVLHLHDEDFSVRLACRN  1556

Query  4778  TLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSAIIQA  4957
             TLK + PL+EI+ + A+LNTH F SDHRSDYEDFLRD+A+Q TQ+L  RVD+Y+++ +QA
Sbjct  1557  TLKQVCPLMEIEGMLAVLNTHSFLSDHRSDYEDFLRDIAKQFTQHLPSRVDSYMASTVQA  1616

Query  4958  FDAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATCSAAL  5137
             FDAPWP+IQANA+Y CSSMLSLSDN++I A+Y+SQVFG+LVGK S S DA+VRAT SAAL
Sbjct  1617  FDAPWPIIQANAIYFCSSMLSLSDNQHILAVYHSQVFGMLVGKLSRSPDAVVRATSSAAL  1676

Query  5138  GLLLKSPNSSSWRDARLNK  5194
             GLLLKS +  SWR   L++
Sbjct  1677  GLLLKSSHLCSWRAVELDR  1695


 Score =   295 bits (754),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 138/186 (74%), Positives = 166/186 (89%), Gaps = 0/186 (0%)
 Frame = +1

Query  91   SIPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGNIA  270
            SIPASEAVQV++S LADD+ SVREASMS+LKDI +LNPLLVLDCC  VSRGGRRRFGN+A
Sbjct  6    SIPASEAVQVLLSLLADDTSSVREASMSSLKDIAALNPLLVLDCCAVVSRGGRRRFGNMA  65

Query  271  GLFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLP  450
            G+FQV++  +RALDK DVD AFM KLAKIATAE+IS+KELN+DWQRAA  +LV++GSHLP
Sbjct  66   GVFQVMAFGVRALDKKDVDSAFMAKLAKIATAELISSKELNSDWQRAATSLLVAIGSHLP  125

Query  451  DLMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIYRP  630
            DLMMEEI+LH SG+NSAL +MVQILA++AS+D LQF P  KGVL+R++PILGNVR+++RP
Sbjct  126  DLMMEEIYLHLSGANSALQSMVQILAEFASTDPLQFIPHWKGVLSRILPILGNVRDMHRP  185

Query  631  IFANGL  648
            IFAN  
Sbjct  186  IFANAF  191



>ref|XP_006477758.1| PREDICTED: maestro heat-like repeat-containing protein family 
member 1-like isoform X2 [Citrus sinensis]
Length=1698

 Score =  2142 bits (5550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1102/1518 (73%), Positives = 1278/1518 (84%), Gaps = 23/1518 (2%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             A WQYSVDF   + LD D++SFLNSAFELLLRVWA SRDLKVR+S V+ALGQMVGLITR+
Sbjct  188   AAWQYSVDFPSHSFLDGDIMSFLNSAFELLLRVWATSRDLKVRVSTVDALGQMVGLITRS  247

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstl  1003
             QLK ALP+LVP+ILELYK++QD A VATCSLH+LLNASLLS  GPPLLD EDLTV+LSTL
Sbjct  248   QLKGALPKLVPSILELYKKDQDTALVATCSLHNLLNASLLSETGPPLLDVEDLTVILSTL  307

Query  1004  l-lvCSNNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGS  1180
             L +VC  ND KEHS F VGLKTYNEVQ CFLTVG VYP+DLF+FLLNKCRLKEE  + G+
Sbjct  308   LPVVCIYNDSKEHSSFSVGLKTYNEVQRCFLTVGLVYPDDLFMFLLNKCRLKEEHLSVGA  367

Query  1181  LCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGE  1360
             L VLKHLLPR +E+WH+KRP+L+E+VK L+DE NL V+KA++ELIVVMASHCYL+G SGE
Sbjct  368   LYVLKHLLPRSSEAWHSKRPLLLEAVKSLLDEQNLAVQKAISELIVVMASHCYLIGPSGE  427

Query  1361  LFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKG  1540
             LF+EYLVRHCA+ D +    ESS+                   K GA   TELR +CEKG
Sbjct  428   LFVEYLVRHCALSDQKKYVNESSK------------------VKIGAFCPTELRAICEKG  469

Query  1541  LLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKAR  1720
             LLL+T+T+PEM+H+LWP LLKMIIPR YT A ATVCRCISELCR RSS SN MLSECKAR
Sbjct  470   LLLLTITIPEMQHILWPLLLKMIIPRAYTSAAATVCRCISELCRHRSSSSNVMLSECKAR  529

Query  1721  TDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKA  1900
              DIP PEELFARLVVLLH+PLARE   TQIL VL+YL+PLFPKNI+ FWQDE  IPKMKA
Sbjct  530   DDIPNPEELFARLVVLLHDPLAREQQATQILMVLYYLSPLFPKNIDLFWQDE--IPKMKA  587

Query  1901  YVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHS  2080
             YVSDTEDLK DP YQE+WDDMII+FLAESLDV+Q  DW++ LGN F  QY LY  D++HS
Sbjct  588   YVSDTEDLKLDPSYQETWDDMIINFLAESLDVVQETDWLISLGNAFTEQYVLYTPDDDHS  647

Query  2081  ALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDK  2260
             ALLHRCLGILLQKV DR YV  KID MY+QANIA+PTNRLGLAKAMGLVAASHLD VL+ 
Sbjct  648   ALLHRCLGILLQKVADRNYVCDKIDWMYKQANIAIPTNRLGLAKAMGLVAASHLDAVLEM  707

Query  2261  LKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALV  2440
             LKGILDN+GQS+ QR+ SFFS+  +MEESDD HAALALMYGYAAKYAP TVIEARIDALV
Sbjct  708   LKGILDNIGQSLFQRLLSFFSNSYRMEESDDIHAALALMYGYAAKYAPSTVIEARIDALV  767

Query  2441  GTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRD  2620
             GTNMLSRLLHVRH  AKQAVITAIDLLG+AVI A+E+G SFPLK+RD LLDYILTLMGR+
Sbjct  768   GTNMLSRLLHVRHHTAKQAVITAIDLLGRAVINAAENGASFPLKKRDQLLDYILTLMGRE  827

Query  2621  EEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVIN  2800
             E + F+DS+IELLHTQ+LALSACTTLV+VEPKLT ETRN +MKAT+GFF LPNDP DV+N
Sbjct  828   ENDSFADSSIELLHTQALALSACTTLVTVEPKLTIETRNHVMKATLGFFALPNDPIDVVN  887

Query  2801  PLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIK  2980
             PLIDNLITLLC IL+TSGEDGRSRA+QLLHILR ID +VSS +EYQR+R CLA +E+L+K
Sbjct  888   PLIDNLITLLCAILLTSGEDGRSRADQLLHILRQIDQYVSSPIEYQRRRSCLAVYEMLLK  947

Query  2981  FRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPRC  3160
             FR +CV GYCALGC GSC+H KQID A   N SNLPSA+ LPSR+AL LG R+++YLPRC
Sbjct  948   FRTLCVIGYCALGCHGSCTHIKQIDRAVLGNFSNLPSAYVLPSREALCLGNRVIMYLPRC  1007

Query  3161  IDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILRSDASI  3340
              DT+ EVRK+S QIL+  F+IS SLP+P+ SS GID+ELSY ALSSLEDV+AILRSDASI
Sbjct  1008  ADTDSEVRKISAQILDQLFSISLSLPRPVGSSSGIDLELSYGALSSLEDVIAILRSDASI  1067

Query  3341  DPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNELN  3520
             DPSEVFNR+VSSVC LL KDELVA LH C+ AICD+ KQSAEGAIQAV+EFVT RGNEL+
Sbjct  1068  DPSEVFNRIVSSVCILLTKDELVATLHSCTTAICDRTKQSAEGAIQAVIEFVTKRGNELS  1127

Query  3521  EIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMVTKDI  3700
             E +VSRT+QSLL+A VH+T+K+LR ETLGAI  +AENT SK+VF EVLA AG+D+VTKDI
Sbjct  1128  ETDVSRTTQSLLSAAVHITDKHLRLETLGAISCLAENTNSKIVFNEVLATAGKDIVTKDI  1187

Query  3701  HRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSVDGSIE  3880
              RLRGGWP+QDAFHAFSQH VLS  FLEH+IS +NQ+P +K GD  KG+ S +S D  I+
Sbjct  1188  SRLRGGWPMQDAFHAFSQHAVLSFLFLEHLISALNQTPFIK-GDMEKGDYSSHSADTWID  1246

Query  3881  DDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPLRALL  4060
             DD+ +AA+LALTAFFRGGGK G+K VE+SYA VLA LTL LG+CHGLAS G  EPLRA+L
Sbjct  1247  DDILQAAILALTAFFRGGGKVGKKAVEKSYAPVLAALTLQLGSCHGLASSGQHEPLRAIL  1306

Query  4061  NAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICLFLSKS  4240
              +FQAFCECVGDLEM KILAR GEQN+ EKWINLIG++AG +SIKRPKEV TICL L+KS
Sbjct  1307  TSFQAFCECVGDLEMRKILARDGEQNDKEKWINLIGDVAGCVSIKRPKEVQTICLILTKS  1366

Query  4241  LDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQMP  4420
             ++R  R QREAAAAALSEF+RYS GF  LL QMVEALCRHVSD+SPTVR LCLRGLVQ+P
Sbjct  1367  INRQQRFQREAAAAALSEFVRYSGGFDSLLEQMVEALCRHVSDESPTVRGLCLRGLVQIP  1426

Query  4421  SIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSIRLRNL  4600
             SIH+ QY TQ+L VILALLDD DESVQLTAVSCLL +L+SSS DAVEP+LLNLS+RLRNL
Sbjct  1427  SIHIHQYATQVLSVILALLDDLDESVQLTAVSCLLTILKSSSKDAVEPILLNLSVRLRNL  1486

Query  4601  QVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACRNT  4780
             QV +N K+R NAFAAFGALS++G GS  ++F EQIHA  PR++LH++DDDL VRQACRNT
Sbjct  1487  QVSMNVKMRRNAFAAFGALSNFGVGSQREAFLEQIHAMLPRLILHIYDDDLSVRQACRNT  1546

Query  4781  LKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSAIIQAF  4960
             LK +AP +EI  +  + N+H F+SDHRSDYE F+RDL RQ  Q+   R+D+Y+ + IQAF
Sbjct  1547  LKQVAPFMEI-GVYGIFNSHCFNSDHRSDYETFVRDLTRQFVQHFPSRIDSYMGSTIQAF  1605

Query  4961  DAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATCSAALG  5140
             +APWP+IQANA+Y  SS+L L D+++I +L+Y+QVFG+LV K S S DAIVRATCS++LG
Sbjct  1606  EAPWPIIQANAIYFSSSILCLCDDQHILSLFYTQVFGLLVVKLSQSADAIVRATCSSSLG  1665

Query  5141  LLLKSPNSSSWRDARLNK  5194
              LLKS NS SWR  RL +
Sbjct  1666  WLLKSINSHSWRSTRLER  1683


 Score =   275 bits (703),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 132/188 (70%), Positives = 160/188 (85%), Gaps = 14/188 (7%)
 Frame = +1

Query  85   GDSIPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGN  264
            G SIPA EAVQ +VSSLAD+SP VREASM++LKDI +L              GGRRRFGN
Sbjct  9    GISIPAPEAVQFLVSSLADESPIVREASMASLKDIAAL--------------GGRRRFGN  54

Query  265  IAGLFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSH  444
            +AG+FQV++ A+RALD+ D+DPAFM KL++IATAE+IS+KELN DWQRAA+ +LVS+GSH
Sbjct  55   MAGIFQVMAFAVRALDENDIDPAFMSKLSRIATAEMISSKELNTDWQRAASALLVSIGSH  114

Query  445  LPDLMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIY  624
            LPDLMMEEIFL+ SG+NSALPAMVQILAD+AS+DALQFTPRLKGVL RV+PILGN+R+++
Sbjct  115  LPDLMMEEIFLYLSGTNSALPAMVQILADFASADALQFTPRLKGVLLRVLPILGNIRDVH  174

Query  625  RPIFANGL  648
            RPIFAN  
Sbjct  175  RPIFANAF  182



>ref|XP_010267296.1| PREDICTED: protein SHOOT GRAVITROPISM 6 isoform X1 [Nelumbo nucifera]
Length=1711

 Score =  2142 bits (5549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1100/1517 (73%), Positives = 1305/1517 (86%), Gaps = 6/1517 (0%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             A WQYS DF  + +LD+DV+SFLNSAFELLLRVWA SRDLKVR+S+VEALGQMVGLITR 
Sbjct  200   AAWQYSGDFPSNALLDSDVMSFLNSAFELLLRVWANSRDLKVRVSSVEALGQMVGLITRL  259

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstl  1003
             QLKAALPRLV TILELYK++Q+ AF+ATCSLH++LNASLLS +GPPLLDFE+LTV+L+TL
Sbjct  260   QLKAALPRLVQTILELYKKDQEVAFLATCSLHNVLNASLLSEDGPPLLDFEELTVILATL  319

Query  1004  l-lvCSNNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGS  1180
             L +VC N++ KEHSDF VGLKTYNEVQHCFLTVG VY EDLF+FLLNKCRLKEEP+T+G+
Sbjct  320   LPVVCINSENKEHSDFSVGLKTYNEVQHCFLTVGLVYSEDLFMFLLNKCRLKEEPYTYGA  379

Query  1181  LCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGE  1360
             LCVLKHLLPRL+E+WH KRP+L+E+VKLL+DE +LG+RKAL+ELIVVMAS+CY+VG SGE
Sbjct  380   LCVLKHLLPRLSEAWHAKRPLLVEAVKLLLDEQSLGIRKALSELIVVMASNCYVVGPSGE  439

Query  1361  LFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKG  1540
             LF+EYLV HCA+ D E    E+S++  R + +++ F  ++LE K GA    ELR +CEKG
Sbjct  440   LFVEYLVHHCAISDQELNNFENSKDV-RSSISFHAFQQKRLEVKIGAACPAELRSICEKG  498

Query  1541  LLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKAR  1720
             LLL+T+T+PEME+VLWPFLLKMI+PR YTGA ATVCRCISELCR RSS ++++L++CKAR
Sbjct  499   LLLLTITIPEMEYVLWPFLLKMIVPRKYTGAAATVCRCISELCRHRSSYASSVLTDCKAR  558

Query  1721  TDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKA  1900
             TDIP PE+LFARLVVLLH+PLARE L TQIL+VL YL PLFP+N++ FWQDE  IPKMKA
Sbjct  559   TDIPNPEDLFARLVVLLHDPLAREQLATQILTVLCYLGPLFPRNVSLFWQDE--IPKMKA  616

Query  1901  YVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHS  2080
             YVSDTEDLKQDP YQE+WD+MII+FLAESLDVIQ+ +W++ LGN F +QYELY SD+EH+
Sbjct  617   YVSDTEDLKQDPAYQETWDNMIINFLAESLDVIQDPEWLISLGNAFTKQYELYTSDDEHT  676

Query  2081  ALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDK  2260
             ALLHRCLG+LLQK+ DRAYVR KID MYRQANI+VPTNRLGLAK MGLVA+SHLDTVL+K
Sbjct  677   ALLHRCLGMLLQKIDDRAYVREKIDWMYRQANISVPTNRLGLAKGMGLVASSHLDTVLEK  736

Query  2261  LKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALV  2440
             LK ILDNVG +  QR  S FS+R KME++DD HAALALMYGYAA+YAP TVIEARIDALV
Sbjct  737   LKDILDNVGLNFFQRFLSLFSERVKMEDADDIHAALALMYGYAARYAPSTVIEARIDALV  796

Query  2441  GTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRD  2620
             GTNMLSRLLHVR   AKQAVITAIDLLG+AVI A+ESG SFPLKRRD LLDYILTLMGRD
Sbjct  797   GTNMLSRLLHVRCHTAKQAVITAIDLLGRAVINAAESGASFPLKRRDQLLDYILTLMGRD  856

Query  2621  EEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVIN  2800
             + + F+DS++ELL TQSLALSACTTLVSVEPKLT ETRN +MKAT+GFF LP+DPSD+++
Sbjct  857   DTDSFADSSLELLRTQSLALSACTTLVSVEPKLTIETRNHVMKATLGFFALPSDPSDIVD  916

Query  2801  PLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIK  2980
             PLI+NLITLLC IL+TSGEDGRSRAEQLLHILR ID ++SSS+E+QRKRGC+A HE+L+K
Sbjct  917   PLINNLITLLCAILLTSGEDGRSRAEQLLHILRQIDLYISSSMEHQRKRGCIAVHEMLLK  976

Query  2981  FRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPRC  3160
             FRA+C +GYC LGC GSC H+KQID   + N SNLPSAF LPSR +L LGER++VYLPRC
Sbjct  977   FRALCSSGYCTLGCHGSCVHTKQIDRMLHGNFSNLPSAFVLPSRASLCLGERVIVYLPRC  1036

Query  3161  IDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILRSDASI  3340
              DT+ EVRKVS QIL++ F+IS SLP+P  S++  + ELSY ALSSLEDV+AILRSD SI
Sbjct  1037  ADTSAEVRKVSAQILDILFSISLSLPRPAESNISFNAELSYGALSSLEDVIAILRSDTSI  1096

Query  3341  DPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNELN  3520
             D SEVFNRV+SSVC LL KDELV  LHGC+ AICDK++QSAEGAIQAVVEFVT RG ELN
Sbjct  1097  DQSEVFNRVLSSVCNLLTKDELVGTLHGCTAAICDKVRQSAEGAIQAVVEFVTRRGIELN  1156

Query  3521  EIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMVTKDI  3700
             E++VSRT+ +LL+A + V EK+LR E LGAI  +AENT+S+VVF EVLA AGRD++ KDI
Sbjct  1157  EMDVSRTTHALLSATLLVPEKHLRHEILGAISCLAENTSSQVVFNEVLAVAGRDILRKDI  1216

Query  3701  HRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSVDGSIE  3880
              RLRGGWP+QDAF+ FSQH VLS  FLEHV+S++N +P  K  DS KG S  N  D  IE
Sbjct  1217  SRLRGGWPMQDAFYVFSQHTVLSVLFLEHVVSILNHTPIPK-ADSEKGGSC-NLFDTQIE  1274

Query  3881  DDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPLRALL  4060
             D++ +AA+LALTA FRGGGK G+K+VEQSYA+VL+TLTLHLG+CHGLA    QE LR LL
Sbjct  1275  DNILQAALLALTALFRGGGKVGKKSVEQSYAAVLSTLTLHLGSCHGLAGSDQQESLRTLL  1334

Query  4061  NAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICLFLSKS  4240
              AFQAFCECVGDLEMGKILAR GEQNENEKW+ LIG+LAG ISIKRPKEVP IC+ L K+
Sbjct  1335  AAFQAFCECVGDLEMGKILARDGEQNENEKWVTLIGDLAGCISIKRPKEVPAICINLCKA  1394

Query  4241  LDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQMP  4420
             L+     QRE+AAAALSEF+RYSD  G LL Q+VEA+CRHVSD+SPTVRRLCLRGLVQ+P
Sbjct  1395  LNGHQTYQRESAAAALSEFVRYSDRVGSLLEQLVEAMCRHVSDESPTVRRLCLRGLVQIP  1454

Query  4421  SIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSIRLRNL  4600
             S+H+LQYTTQILGVILALL+D DESV+LTAVSCLL VLESS  DAV+PVLL+LSIRLRNL
Sbjct  1455  SVHILQYTTQILGVILALLEDPDESVELTAVSCLLTVLESSPNDAVDPVLLSLSIRLRNL  1514

Query  4601  QVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACRNT  4780
             Q C+N K+RANAFAAFGALS YG G+  ++F EQ+HA+ PR++LH+HDDDL VRQACRNT
Sbjct  1515  QSCMNDKMRANAFAAFGALSKYGVGAQHEAFLEQVHASLPRLILHVHDDDLSVRQACRNT  1574

Query  4781  LKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSAIIQAF  4960
             L+ I PL+E+D++ A  NTH F+SDHRSDYEDF+RDL RQL Q   PR+DTY+++ +QAF
Sbjct  1575  LRQIVPLMEVDSMTARFNTHYFNSDHRSDYEDFIRDLTRQLCQNFSPRIDTYMASAVQAF  1634

Query  4961  DAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATCSAALG  5140
             DAPWP+IQANA+Y  S MLSLSD++ IS  +++QVFG+L GK S S DA+VRATC +ALG
Sbjct  1635  DAPWPIIQANAIYFSSCMLSLSDDQRISTPFFAQVFGMLTGKMSRSPDAVVRATCLSALG  1694

Query  5141  LLLKSPNSSSWRDARLN  5191
             +LLKS NS+SWR +RL+
Sbjct  1695  MLLKSSNSTSWRTSRLD  1711


 Score =   300 bits (768),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 170/188 (90%), Gaps = 0/188 (0%)
 Frame = +1

Query  85   GDSIPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGN  264
            G ++PA EAVQV+VSSLAD++P VREAS +ALKDI +LNPLLVLDCC TVSRGGRRRFGN
Sbjct  7    GSTVPAPEAVQVLVSSLADEAPMVREASTAALKDIAALNPLLVLDCCSTVSRGGRRRFGN  66

Query  265  IAGLFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSH  444
            +AG+FQV++ A+RALDK DVDP F+ KLAKIATAE+IS+KELN+DWQRAA+ +LVS+GSH
Sbjct  67   MAGVFQVMAFAVRALDKKDVDPPFVAKLAKIATAEMISSKELNSDWQRAASSLLVSIGSH  126

Query  445  LPDLMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIY  624
            LPDLMM+EIFLH SG+NS LPAMVQILAD+AS++A QFTP+LKGVL+RV+PILGNVR+  
Sbjct  127  LPDLMMDEIFLHLSGTNSTLPAMVQILADFASAEASQFTPQLKGVLSRVLPILGNVRDAQ  186

Query  625  RPIFANGL  648
            RPIFA+  
Sbjct  187  RPIFAHAF  194



>ref|XP_006477757.1| PREDICTED: maestro heat-like repeat-containing protein family 
member 1-like isoform X1 [Citrus sinensis]
Length=1712

 Score =  2142 bits (5549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1102/1518 (73%), Positives = 1278/1518 (84%), Gaps = 23/1518 (2%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             A WQYSVDF   + LD D++SFLNSAFELLLRVWA SRDLKVR+S V+ALGQMVGLITR+
Sbjct  202   AAWQYSVDFPSHSFLDGDIMSFLNSAFELLLRVWATSRDLKVRVSTVDALGQMVGLITRS  261

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstl  1003
             QLK ALP+LVP+ILELYK++QD A VATCSLH+LLNASLLS  GPPLLD EDLTV+LSTL
Sbjct  262   QLKGALPKLVPSILELYKKDQDTALVATCSLHNLLNASLLSETGPPLLDVEDLTVILSTL  321

Query  1004  l-lvCSNNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGS  1180
             L +VC  ND KEHS F VGLKTYNEVQ CFLTVG VYP+DLF+FLLNKCRLKEE  + G+
Sbjct  322   LPVVCIYNDSKEHSSFSVGLKTYNEVQRCFLTVGLVYPDDLFMFLLNKCRLKEEHLSVGA  381

Query  1181  LCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGE  1360
             L VLKHLLPR +E+WH+KRP+L+E+VK L+DE NL V+KA++ELIVVMASHCYL+G SGE
Sbjct  382   LYVLKHLLPRSSEAWHSKRPLLLEAVKSLLDEQNLAVQKAISELIVVMASHCYLIGPSGE  441

Query  1361  LFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKG  1540
             LF+EYLVRHCA+ D +    ESS+                   K GA   TELR +CEKG
Sbjct  442   LFVEYLVRHCALSDQKKYVNESSK------------------VKIGAFCPTELRAICEKG  483

Query  1541  LLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKAR  1720
             LLL+T+T+PEM+H+LWP LLKMIIPR YT A ATVCRCISELCR RSS SN MLSECKAR
Sbjct  484   LLLLTITIPEMQHILWPLLLKMIIPRAYTSAAATVCRCISELCRHRSSSSNVMLSECKAR  543

Query  1721  TDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKA  1900
              DIP PEELFARLVVLLH+PLARE   TQIL VL+YL+PLFPKNI+ FWQDE  IPKMKA
Sbjct  544   DDIPNPEELFARLVVLLHDPLAREQQATQILMVLYYLSPLFPKNIDLFWQDE--IPKMKA  601

Query  1901  YVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHS  2080
             YVSDTEDLK DP YQE+WDDMII+FLAESLDV+Q  DW++ LGN F  QY LY  D++HS
Sbjct  602   YVSDTEDLKLDPSYQETWDDMIINFLAESLDVVQETDWLISLGNAFTEQYVLYTPDDDHS  661

Query  2081  ALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDK  2260
             ALLHRCLGILLQKV DR YV  KID MY+QANIA+PTNRLGLAKAMGLVAASHLD VL+ 
Sbjct  662   ALLHRCLGILLQKVADRNYVCDKIDWMYKQANIAIPTNRLGLAKAMGLVAASHLDAVLEM  721

Query  2261  LKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALV  2440
             LKGILDN+GQS+ QR+ SFFS+  +MEESDD HAALALMYGYAAKYAP TVIEARIDALV
Sbjct  722   LKGILDNIGQSLFQRLLSFFSNSYRMEESDDIHAALALMYGYAAKYAPSTVIEARIDALV  781

Query  2441  GTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRD  2620
             GTNMLSRLLHVRH  AKQAVITAIDLLG+AVI A+E+G SFPLK+RD LLDYILTLMGR+
Sbjct  782   GTNMLSRLLHVRHHTAKQAVITAIDLLGRAVINAAENGASFPLKKRDQLLDYILTLMGRE  841

Query  2621  EEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVIN  2800
             E + F+DS+IELLHTQ+LALSACTTLV+VEPKLT ETRN +MKAT+GFF LPNDP DV+N
Sbjct  842   ENDSFADSSIELLHTQALALSACTTLVTVEPKLTIETRNHVMKATLGFFALPNDPIDVVN  901

Query  2801  PLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIK  2980
             PLIDNLITLLC IL+TSGEDGRSRA+QLLHILR ID +VSS +EYQR+R CLA +E+L+K
Sbjct  902   PLIDNLITLLCAILLTSGEDGRSRADQLLHILRQIDQYVSSPIEYQRRRSCLAVYEMLLK  961

Query  2981  FRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPRC  3160
             FR +CV GYCALGC GSC+H KQID A   N SNLPSA+ LPSR+AL LG R+++YLPRC
Sbjct  962   FRTLCVIGYCALGCHGSCTHIKQIDRAVLGNFSNLPSAYVLPSREALCLGNRVIMYLPRC  1021

Query  3161  IDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILRSDASI  3340
              DT+ EVRK+S QIL+  F+IS SLP+P+ SS GID+ELSY ALSSLEDV+AILRSDASI
Sbjct  1022  ADTDSEVRKISAQILDQLFSISLSLPRPVGSSSGIDLELSYGALSSLEDVIAILRSDASI  1081

Query  3341  DPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNELN  3520
             DPSEVFNR+VSSVC LL KDELVA LH C+ AICD+ KQSAEGAIQAV+EFVT RGNEL+
Sbjct  1082  DPSEVFNRIVSSVCILLTKDELVATLHSCTTAICDRTKQSAEGAIQAVIEFVTKRGNELS  1141

Query  3521  EIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMVTKDI  3700
             E +VSRT+QSLL+A VH+T+K+LR ETLGAI  +AENT SK+VF EVLA AG+D+VTKDI
Sbjct  1142  ETDVSRTTQSLLSAAVHITDKHLRLETLGAISCLAENTNSKIVFNEVLATAGKDIVTKDI  1201

Query  3701  HRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSVDGSIE  3880
              RLRGGWP+QDAFHAFSQH VLS  FLEH+IS +NQ+P +K GD  KG+ S +S D  I+
Sbjct  1202  SRLRGGWPMQDAFHAFSQHAVLSFLFLEHLISALNQTPFIK-GDMEKGDYSSHSADTWID  1260

Query  3881  DDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPLRALL  4060
             DD+ +AA+LALTAFFRGGGK G+K VE+SYA VLA LTL LG+CHGLAS G  EPLRA+L
Sbjct  1261  DDILQAAILALTAFFRGGGKVGKKAVEKSYAPVLAALTLQLGSCHGLASSGQHEPLRAIL  1320

Query  4061  NAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICLFLSKS  4240
              +FQAFCECVGDLEM KILAR GEQN+ EKWINLIG++AG +SIKRPKEV TICL L+KS
Sbjct  1321  TSFQAFCECVGDLEMRKILARDGEQNDKEKWINLIGDVAGCVSIKRPKEVQTICLILTKS  1380

Query  4241  LDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQMP  4420
             ++R  R QREAAAAALSEF+RYS GF  LL QMVEALCRHVSD+SPTVR LCLRGLVQ+P
Sbjct  1381  INRQQRFQREAAAAALSEFVRYSGGFDSLLEQMVEALCRHVSDESPTVRGLCLRGLVQIP  1440

Query  4421  SIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSIRLRNL  4600
             SIH+ QY TQ+L VILALLDD DESVQLTAVSCLL +L+SSS DAVEP+LLNLS+RLRNL
Sbjct  1441  SIHIHQYATQVLSVILALLDDLDESVQLTAVSCLLTILKSSSKDAVEPILLNLSVRLRNL  1500

Query  4601  QVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACRNT  4780
             QV +N K+R NAFAAFGALS++G GS  ++F EQIHA  PR++LH++DDDL VRQACRNT
Sbjct  1501  QVSMNVKMRRNAFAAFGALSNFGVGSQREAFLEQIHAMLPRLILHIYDDDLSVRQACRNT  1560

Query  4781  LKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSAIIQAF  4960
             LK +AP +EI  +  + N+H F+SDHRSDYE F+RDL RQ  Q+   R+D+Y+ + IQAF
Sbjct  1561  LKQVAPFMEI-GVYGIFNSHCFNSDHRSDYETFVRDLTRQFVQHFPSRIDSYMGSTIQAF  1619

Query  4961  DAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATCSAALG  5140
             +APWP+IQANA+Y  SS+L L D+++I +L+Y+QVFG+LV K S S DAIVRATCS++LG
Sbjct  1620  EAPWPIIQANAIYFSSSILCLCDDQHILSLFYTQVFGLLVVKLSQSADAIVRATCSSSLG  1679

Query  5141  LLLKSPNSSSWRDARLNK  5194
              LLKS NS SWR  RL +
Sbjct  1680  WLLKSINSHSWRSTRLER  1697


 Score =   313 bits (801),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 145/188 (77%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = +1

Query  85   GDSIPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGN  264
            G SIPA EAVQ +VSSLAD+SP VREASM++LKDI +LNPLLVLDCCL VSRGGRRRFGN
Sbjct  9    GISIPAPEAVQFLVSSLADESPIVREASMASLKDIAALNPLLVLDCCLAVSRGGRRRFGN  68

Query  265  IAGLFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSH  444
            +AG+FQV++ A+RALD+ D+DPAFM KL++IATAE+IS+KELN DWQRAA+ +LVS+GSH
Sbjct  69   MAGIFQVMAFAVRALDENDIDPAFMSKLSRIATAEMISSKELNTDWQRAASALLVSIGSH  128

Query  445  LPDLMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIY  624
            LPDLMMEEIFL+ SG+NSALPAMVQILAD+AS+DALQFTPRLKGVL RV+PILGN+R+++
Sbjct  129  LPDLMMEEIFLYLSGTNSALPAMVQILADFASADALQFTPRLKGVLLRVLPILGNIRDVH  188

Query  625  RPIFANGL  648
            RPIFAN  
Sbjct  189  RPIFANAF  196



>ref|XP_007027498.1| ARM repeat superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY08000.1| ARM repeat superfamily protein isoform 2 [Theobroma cacao]
Length=1769

 Score =  2139 bits (5542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1101/1518 (73%), Positives = 1267/1518 (83%), Gaps = 48/1518 (3%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             A WQY+VDF   + LD DV+SFLNSAFELLLRVWA SRDLKVR+S+VEALGQMVGLITRT
Sbjct  284   AVWQYNVDFPSDSPLDGDVMSFLNSAFELLLRVWAASRDLKVRISSVEALGQMVGLITRT  343

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstl  1003
             QLKAALPRLVPTILELYKREQD A +AT SL++LLNASLLS  GPPLLDFE+LTV+LSTL
Sbjct  344   QLKAALPRLVPTILELYKREQDIALIATYSLYNLLNASLLSETGPPLLDFEELTVILSTL  403

Query  1004  l-lvCSNNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGS  1180
             L ++C NND KEHSDF VGLKTYNEVQ CFLTVGSVYPEDLF FLLNKCRLKEEP TFG+
Sbjct  404   LPVICMNNDSKEHSDFSVGLKTYNEVQRCFLTVGSVYPEDLFTFLLNKCRLKEEPLTFGA  463

Query  1181  LCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGE  1360
             LCVLKHLLPR +E+WHNKRP+L+++VK L+DE NLG+ KAL+ELIVVMASHCYLVG   E
Sbjct  464   LCVLKHLLPRSSEAWHNKRPLLLDAVKSLLDEQNLGIGKALSELIVVMASHCYLVGPYAE  523

Query  1361  LFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKG  1540
             LF+EYLV HCA+ + +  +LESS                  + K G+V  TELR +CEKG
Sbjct  524   LFVEYLVCHCALSEHDRHDLESS------------------QVKIGSVCPTELRAICEKG  565

Query  1541  LLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKAR  1720
             LLL+T+T+PEMEH+LWPFLLKMIIP+ YTGAVATVCRCI+ELCR RSS +N MLS+CKAR
Sbjct  566   LLLLTITIPEMEHILWPFLLKMIIPQAYTGAVATVCRCIAELCRHRSSYNNNMLSDCKAR  625

Query  1721  TDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKA  1900
             +DIP PEELFARLVVLLHNPLARE L TQIL+VL YLAPLFP+NIN FWQDE  IPKMKA
Sbjct  626   SDIPNPEELFARLVVLLHNPLAREQLATQILTVLCYLAPLFPRNINLFWQDE--IPKMKA  683

Query  1901  YVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHS  2080
             YVSD EDL+ DP YQE+WDDMII+FLAESLDVIQ+ DWV+ LGN F +QY LY  D+EHS
Sbjct  684   YVSDPEDLELDPSYQETWDDMIINFLAESLDVIQDTDWVISLGNAFTKQYSLYAPDDEHS  743

Query  2081  ALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDK  2260
             ALLHR LGILLQKV+DR YVR KID MY+QANIA+PTNRLGLAKAMGLVAASHLD VLDK
Sbjct  744   ALLHRGLGILLQKVNDRGYVRGKIDWMYKQANIAIPTNRLGLAKAMGLVAASHLDAVLDK  803

Query  2261  LKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALV  2440
             LK ILDNVGQSI QR  +FFS+  + E+SDD HAALALMYGYAA+YAP  VIEARIDALV
Sbjct  804   LKDILDNVGQSIFQRFLAFFSESYRTEDSDDVHAALALMYGYAARYAPSMVIEARIDALV  863

Query  2441  GTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRD  2620
             GTNMLSRLLHV HP AKQAVITAIDLLG+AVI A+E+G  FPLKRRD LLDYILTLMGRD
Sbjct  864   GTNMLSRLLHVHHPTAKQAVITAIDLLGRAVINAAENGAPFPLKRRDQLLDYILTLMGRD  923

Query  2621  EEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVIN  2800
             E +GF+DS++ELLHTQ+LAL+ACTTLVSVEPKLT ETRN +MKAT+GFF LPNDP DVIN
Sbjct  924   ETDGFADSSLELLHTQALALNACTTLVSVEPKLTIETRNHVMKATLGFFALPNDPIDVIN  983

Query  2801  PLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIK  2980
             PLIDNLITLLC IL+TSGEDGRSRAEQLLHILR ID +VSSS+EYQR+RGCLA +E+L+K
Sbjct  984   PLIDNLITLLCAILLTSGEDGRSRAEQLLHILRQIDQYVSSSVEYQRRRGCLAVYEMLVK  1043

Query  2981  FRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPRC  3160
             FR +CV+GYCALGC+GSC+HSKQID   + N SNLPSAF LPSR+ALSLG+R+++YLPRC
Sbjct  1044  FRMLCVSGYCALGCRGSCTHSKQIDRTLHGNFSNLPSAFVLPSREALSLGDRVIMYLPRC  1103

Query  3161  IDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILRSDASI  3340
              DTN EVRK+S QIL+  F+IS SLP+P+ SS+G DIELSY ALSSLEDV+AILRSDASI
Sbjct  1104  ADTNSEVRKISAQILDQLFSISLSLPRPLGSSVGGDIELSYGALSSLEDVIAILRSDASI  1163

Query  3341  DPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNELN  3520
             DPSEVFNR+V+SVC LL KDELV  LHGC  AICDKIKQSAEGAIQAV+EFVT RG EL+
Sbjct  1164  DPSEVFNRIVASVCVLLTKDELVGTLHGCMPAICDKIKQSAEGAIQAVIEFVTKRGIELS  1223

Query  3521  EIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMVTKDI  3700
             E +VSRT+QSLL+AVVHVTEK LR E LGAI S++ENT +K+VF EVLAAAGRD+VTKDI
Sbjct  1224  ETDVSRTTQSLLSAVVHVTEKQLRLEVLGAISSLSENTNAKIVFNEVLAAAGRDIVTKDI  1283

Query  3701  HRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSVDGSIE  3880
              RLRGGWP+QDAFHAFSQH+VLS  FLEH+ISV+NQ+   K  D GKGE+S    +  +E
Sbjct  1284  SRLRGGWPMQDAFHAFSQHIVLSVLFLEHLISVLNQTHFTK-SDPGKGENSSLLSETQLE  1342

Query  3881  DDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPLRALL  4060
             D++ +AA+ ALTAFF+GGGK G++ VEQSY+SVLA L L  G+CHGLAS G  EPLRALL
Sbjct  1343  DEILQAAIFALTAFFKGGGKVGKRAVEQSYSSVLAALILQFGSCHGLASSGQHEPLRALL  1402

Query  4061  NAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICLFLSKS  4240
              +FQAFCECVGDLEMGK LAR GEQNE EKWINLIG+LAG ISIKRPKEV  IC   +KS
Sbjct  1403  TSFQAFCECVGDLEMGKFLARDGEQNEKEKWINLIGDLAGCISIKRPKEVQNICKIFTKS  1462

Query  4241  LDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQMP  4420
             L+R  + QREAAAAALSEF+ YS GF  LL +MVE LCRHVSD+SP VR LCLRGLV++P
Sbjct  1463  LNRQEKTQREAAAAALSEFVCYSSGFSSLLEEMVEVLCRHVSDESPAVRCLCLRGLVKIP  1522

Query  4421  SIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSIRLRNL  4600
             S+H+ QYT Q+LGVIL+LLDD DESVQLTAVSCL                         L
Sbjct  1523  SVHIYQYTNQVLGVILSLLDDLDESVQLTAVSCL-------------------------L  1557

Query  4601  QVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACRNT  4780
              + +N K+RA+AFAAFGALS+YG G+  D+F EQIHA  PR++LHLHDDDL VR ACRNT
Sbjct  1558  TISMNVKMRADAFAAFGALSNYGVGAHKDAFIEQIHATLPRLILHLHDDDLAVRHACRNT  1617

Query  4781  LKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSAIIQAF  4960
             LK  A L+EI+ + AL N+H  +SDHR DYEDF+RD  RQ  Q+L  RVDTY+ + IQAF
Sbjct  1618  LKRFATLMEIEGLLALFNSHSINSDHR-DYEDFVRDFTRQFVQHLSSRVDTYMVSTIQAF  1676

Query  4961  DAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATCSAALG  5140
             DAPWP+IQANA+Y+ SS+LSLS++++I ALY++QVFG+LV K S S DA+VRAT S+A G
Sbjct  1677  DAPWPIIQANAIYVSSSILSLSNDQHILALYFTQVFGLLVSKMSRSADAVVRATSSSAFG  1736

Query  5141  LLLKSPNSSSWRDARLNK  5194
             LLLKS NS SWR ARL +
Sbjct  1737  LLLKSTNSISWRVARLER  1754


 Score =   305 bits (780),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 144/188 (77%), Positives = 171/188 (91%), Gaps = 0/188 (0%)
 Frame = +1

Query  85   GDSIPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGN  264
            G S+PA EAVQV+VSSLAD+SP VREASM++LKDI+ LNPLLVLDCC  VSRGGRRRFGN
Sbjct  91   GGSLPAPEAVQVIVSSLADESPMVREASMASLKDISPLNPLLVLDCCSAVSRGGRRRFGN  150

Query  265  IAGLFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSH  444
            +AG+FQV++  +RALDK D+D ++M KLAKIATAE+IS+KELNADWQRAAA +LVS+GSH
Sbjct  151  MAGVFQVMAFGVRALDKKDIDASYMGKLAKIATAEIISSKELNADWQRAAASLLVSIGSH  210

Query  445  LPDLMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIY  624
            LPDLM+EEIFLH SG +SALPAMVQILAD+AS+DA+QFTPRLKGVL+RV+PILGNVR+ +
Sbjct  211  LPDLMIEEIFLHLSGPSSALPAMVQILADFASADAMQFTPRLKGVLSRVLPILGNVRDAH  270

Query  625  RPIFANGL  648
            RPIFAN  
Sbjct  271  RPIFANAF  278



>ref|XP_006604594.1| PREDICTED: maestro heat-like repeat-containing protein family 
member 1-like isoform X2 [Glycine max]
Length=1583

 Score =  2138 bits (5539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1120/1519 (74%), Positives = 1286/1519 (85%), Gaps = 22/1519 (1%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             A WQYS+DF      D DV+SFLNSAFELLLRVWA SRDLKVR+++VEALGQMVGLITRT
Sbjct  70    AAWQYSIDFPSHFPQDGDVMSFLNSAFELLLRVWAASRDLKVRVASVEALGQMVGLITRT  129

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstl  1003
             QLK ALPRL+PTIL+LYK++QD AF+ATCSLH+LLNASLLS +GPP+LDFEDLT+VLSTL
Sbjct  130   QLKTALPRLIPTILDLYKKDQDIAFLATCSLHNLLNASLLSESGPPMLDFEDLTLVLSTL  189

Query  1004  llvCS-NNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGS  1180
             L V S NND K+ SDFPVGLK YNEVQHCFLTVG VYP+DLF+FL+NKCRL+EEP TFGS
Sbjct  190   LPVVSFNNDSKDQSDFPVGLKMYNEVQHCFLTVGLVYPDDLFLFLVNKCRLREEPLTFGS  249

Query  1181  LCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGE  1360
             LC+LKHLLPRL+E+WH+K P+L+E+VK L++E NLGVRKAL+ELIVVMASHCYLVGSSGE
Sbjct  250   LCILKHLLPRLSEAWHSKIPLLVEAVKSLLEEQNLGVRKALSELIVVMASHCYLVGSSGE  309

Query  1361  LFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKG  1540
             LFIEYLVRHCA+ D    +LES+               +++E K GAVT  ELR VCEKG
Sbjct  310   LFIEYLVRHCAITDQNRSDLESTPN-------------KRIEMKIGAVTPGELRAVCEKG  356

Query  1541  LLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKAR  1720
             LLL+T+T+PEMEH+LWPFLL+MIIP  YTGAVATVCRCISEL R RS  SN MLSECK R
Sbjct  357   LLLVTITIPEMEHILWPFLLRMIIPLTYTGAVATVCRCISELWRHRSY-SNDMLSECKTR  415

Query  1721  TDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKA  1900
              DIP  EEL ARL+VLLHNPLARE L TQIL+VL  LAPLFPKNIN FWQDE  IPKMKA
Sbjct  416   PDIPSAEELLARLLVLLHNPLAREQLATQILTVLCLLAPLFPKNINLFWQDE--IPKMKA  473

Query  1901  YVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHS  2080
             YVSDTEDLKQDP YQ++WDDMII+FLAESLDVIQ+ DWV+ LGN FA+ YELY SD++H+
Sbjct  474   YVSDTEDLKQDPSYQDTWDDMIINFLAESLDVIQDADWVMSLGNVFAKHYELYASDDQHT  533

Query  2081  ALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDK  2260
             ALLHRCLGILLQKV+DRAYV  KID MY+QANIA PTNRLGLAKAMGLVAASHLDTVL+K
Sbjct  534   ALLHRCLGILLQKVNDRAYVCDKIDWMYKQANIANPTNRLGLAKAMGLVAASHLDTVLEK  593

Query  2261  LKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALV  2440
             LK ILDNVGQSI QRI S FSD  + EESDD HAALALMYGYAAKYAP TVIEARI+ALV
Sbjct  594   LKDILDNVGQSIFQRILSLFSDSFRTEESDDIHAALALMYGYAAKYAPSTVIEARINALV  653

Query  2441  GTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRD  2620
             GTNMLSRLLHVR P+AKQAVITAIDLLG AVI A+ESG  FPLKRRD LLDYILTLMGRD
Sbjct  654   GTNMLSRLLHVRLPKAKQAVITAIDLLGNAVINAAESGSPFPLKRRDQLLDYILTLMGRD  713

Query  2621  EEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVIN  2800
             +E+GF+D N +LL TQ+LA+SACTTLVSVEPKLT ETR+ +MKAT+GFF +PNDP DV+N
Sbjct  714   DEDGFADYN-DLLRTQALAISACTTLVSVEPKLTVETRSHVMKATLGFFAIPNDPVDVVN  772

Query  2801  PLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIK  2980
             PLIDNLITLLC IL+T GEDGRSRAE L+ ILR ID FV S +EYQRKRGCLA HE+L+K
Sbjct  773   PLIDNLITLLCAILLTGGEDGRSRAELLMLILRQIDQFVCSPVEYQRKRGCLAVHEMLLK  832

Query  2981  FRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPRC  3160
             FR ICV+GYCALGC+GSC+H+KQ+D     N S LPSAF LPSR+AL LG+R+++YLPRC
Sbjct  833   FRMICVSGYCALGCRGSCAHNKQMDRTLYGNFSKLPSAFVLPSREALCLGDRVIMYLPRC  892

Query  3161  IDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGI-DIELSYIALSSLEDVVAILRSDAS  3337
              DTN EVRK+S QIL+L F+IS SLP+P  SS+   DIELSY ALSSLEDV+AILR+D S
Sbjct  893   ADTNSEVRKISAQILDLLFSISLSLPRPAGSSISAEDIELSYSALSSLEDVIAILRNDTS  952

Query  3338  IDPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNEL  3517
             IDPSEVFNR+VSS+C LL K+ELVA LHGCS AICDKIKQSAEGAIQAVVEFVT RG EL
Sbjct  953   IDPSEVFNRIVSSLCILLTKEELVATLHGCSVAICDKIKQSAEGAIQAVVEFVTKRGREL  1012

Query  3518  NEIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMVTKD  3697
              EI++SRT+QSL++A VH T+K+LR ETLGAI S+AENT+ + VF EVLAAAGRD +TKD
Sbjct  1013  TEIDISRTTQSLISATVHATDKHLRVETLGAISSLAENTSPRTVFDEVLAAAGRDTITKD  1072

Query  3698  IHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSVDGSI  3877
             I RLRGGWP+QDAF+AFSQH+VLS  FLEHVISV++Q P LKG D  + E S+  VD   
Sbjct  1073  ISRLRGGWPMQDAFYAFSQHMVLSVLFLEHVISVLSQIPILKG-DVERLEDSQ--VDSHT  1129

Query  3878  EDDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPLRAL  4057
             ED   +AA+ ALTAFFRGGGK G++ VEQ+YASVL+ LTL LG+CHGL   G  EPLR L
Sbjct  1130  EDGKLQAAIFALTAFFRGGGKVGKRAVEQNYASVLSELTLQLGSCHGLTYSGQHEPLRNL  1189

Query  4058  LNAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICLFLSK  4237
             L AFQAFCECVGDLEMGKILAR GE  ENE+WI+LIG++AG ISIKRPKEV  ICLF   
Sbjct  1190  LTAFQAFCECVGDLEMGKILARDGELLENERWISLIGDIAGCISIKRPKEVQNICLFFQN  1249

Query  4238  SLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQM  4417
             SLDRP + QREAAAAALSEF+RYS G G LL QMVE LCRHVSD+S TVRRLCLRGLVQ+
Sbjct  1250  SLDRPQKYQREAAAAALSEFVRYSGGLGSLLEQMVEVLCRHVSDESSTVRRLCLRGLVQI  1309

Query  4418  PSIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSIRLRN  4597
             P IH+L+YT Q+LGVILALLDD DESVQLTAVSCLL++L SS  DAVEP+LLNLSIRLRN
Sbjct  1310  PLIHILKYTAQVLGVILALLDDLDESVQLTAVSCLLMILNSSPDDAVEPILLNLSIRLRN  1369

Query  4598  LQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACRN  4777
             LQ  +NAK+RA +FA FGALS YG G + ++F EQ+HAA PR+VLHLHD+D  VR ACRN
Sbjct  1370  LQTSMNAKMRATSFAVFGALSKYGIGVLSEAFVEQVHAAVPRLVLHLHDEDFSVRLACRN  1429

Query  4778  TLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSAIIQA  4957
             TLK + PL+EI+ + A+LNTH F SDHRSDYEDFLRD+A+Q TQ+L  RVD+Y+++ +QA
Sbjct  1430  TLKQVCPLMEIEGMLAVLNTHSFLSDHRSDYEDFLRDIAKQFTQHLPSRVDSYMASTVQA  1489

Query  4958  FDAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATCSAAL  5137
             FDAPWP+IQANA+Y CSSMLSLSDN++I A+Y+SQVFG+LVGK S S DA+VRAT SAAL
Sbjct  1490  FDAPWPIIQANAIYFCSSMLSLSDNQHILAVYHSQVFGMLVGKLSRSPDAVVRATSSAAL  1549

Query  5138  GLLLKSPNSSSWRDARLNK  5194
             GLLLKS +  SWR   L++
Sbjct  1550  GLLLKSSHLCSWRAVELDR  1568


 Score =   102 bits (253),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  457  MMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIYRPIF  636
            MMEEI+LH SG+NSAL +MVQILA++AS+D LQF P  KGVL+R++PILGNVR+++RPIF
Sbjct  1    MMEEIYLHLSGANSALQSMVQILAEFASTDPLQFIPHWKGVLSRILPILGNVRDMHRPIF  60

Query  637  ANGL  648
            AN  
Sbjct  61   ANAF  64



>ref|XP_004304491.1| PREDICTED: HEAT repeat-containing protein 7A-like [Fragaria vesca 
subsp. vesca]
Length=1706

 Score =  2130 bits (5520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1099/1530 (72%), Positives = 1283/1530 (84%), Gaps = 40/1530 (3%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             A WQY++D      LD+D++SFLNS FELLLRVWA SRDLKVR S+VEALGQMVGLI RT
Sbjct  200   AVWQYNLDNPSYPSLDSDIMSFLNSVFELLLRVWAASRDLKVRSSSVEALGQMVGLIPRT  259

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstl  1003
             QLKAALPRLVPTIL+LYKR+QD +F+ATCSLH+LLNAS+LS++GPPLL+FE+L++VLSTL
Sbjct  260   QLKAALPRLVPTILDLYKRDQDISFLATCSLHNLLNASVLSDSGPPLLEFEELSIVLSTL  319

Query  1004  l-lvCSNNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGS  1180
             L +VC +ND KE+SDF VGLKTYNEVQ CFLTVG VYPEDLFVFLLNKC LKEE   FG+
Sbjct  320   LPVVCIHNDNKENSDFSVGLKTYNEVQRCFLTVGLVYPEDLFVFLLNKCNLKEELLVFGA  379

Query  1181  LCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGE  1360
             LCVLKHLLPRL+E+WHNKRP+L+E+V+ L+DE NLGVRKAL+ELIVVMASHCYLVG SGE
Sbjct  380   LCVLKHLLPRLSEAWHNKRPLLVEAVRSLLDEQNLGVRKALSELIVVMASHCYLVGPSGE  439

Query  1361  LFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKG  1540
             LF+EYLVRHCA+ D +  + E S+                       V   ELR + EK 
Sbjct  440   LFVEYLVRHCALTDKDRHDFERSK-----------------------VCPMELRAISEKS  476

Query  1541  LLLITVTVPEME-------------HVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRS  1681
             LLL+T+T+PEME             H+LWPFLLKMIIP+ YTGAVA VCRCISELCR RS
Sbjct  477   LLLLTITIPEMEVSIYRHLNIIFVQHILWPFLLKMIIPQAYTGAVAMVCRCISELCRHRS  536

Query  1682  SESNAMLSECKARTDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINS  1861
             S S+ M+ +CKAR DIP PEELF RLVVLLH+PLARE L +QIL+VL YLAPLFPKN+  
Sbjct  537   SNSDTMVKDCKARADIPNPEELFVRLVVLLHDPLAREQLASQILTVLCYLAPLFPKNVGL  596

Query  1862  FWQDEL*IPKMKAYVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFA  2041
             FWQDE  IPK+KAYVSDTEDLKQDP YQE+WDDMII+F AESLDVI +V WV+ LGN   
Sbjct  597   FWQDE--IPKLKAYVSDTEDLKQDPSYQETWDDMIINFFAESLDVIHDVAWVISLGNAVT  654

Query  2042  RQYELYKSDNEHSALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMG  2221
             +QY LY +D+EHSALLHRC G+LLQKV+DRAYVR KID MY+QA+I +PTNRLGLAKAMG
Sbjct  655   KQYGLYTADDEHSALLHRCFGVLLQKVNDRAYVRDKIDWMYKQADITIPTNRLGLAKAMG  714

Query  2222  LVAASHLDTVLDKLKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYA  2401
             LVAASHLDTVL+KLKGILDNVGQSI +R  S FSD  K EESDD HAALALMYGYAAKYA
Sbjct  715   LVAASHLDTVLEKLKGILDNVGQSIFRRFLSIFSDDFKTEESDDIHAALALMYGYAAKYA  774

Query  2402  PPTVIEARIDALVGTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRD  2581
             P TVIEARIDALVGTNMLSRLLHVR+P AKQAVITAIDLLG+AVI A+E+G SFPLK+RD
Sbjct  775   PSTVIEARIDALVGTNMLSRLLHVRNPTAKQAVITAIDLLGRAVINAAENGSSFPLKKRD  834

Query  2582  LLLDYILTLMGRDEEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIG  2761
              LLDYILTLMGRD++E  SDS +ELL TQ+ ALSACTTLVSVEPKLT ETRN ++KAT+G
Sbjct  835   QLLDYILTLMGRDDDENLSDSTLELLDTQARALSACTTLVSVEPKLTIETRNHVLKATLG  894

Query  2762  FFGLPNDPSDVINPLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQR  2941
             FF LPNDP+DV++PLIDNLITLLC IL+TSGEDGRSRAEQLLHILR ID +VSS+ +YQR
Sbjct  895   FFALPNDPADVVDPLIDNLITLLCAILLTSGEDGRSRAEQLLHILRQIDQYVSSAADYQR  954

Query  2942  KRGCLAAHELLIKFRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDAL  3121
             +RGCLA HE+L+KFR +C+ G+CALGCQGSC+H K ID   + N SNLPSAF LPSR+AL
Sbjct  955   RRGCLAVHEMLLKFRTVCITGHCALGCQGSCTHIKPIDRNLHGNFSNLPSAFVLPSREAL  1014

Query  3122  SLGERIMVYLPRCIDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSL  3301
             SLG+R++ YLPRC DTN EVRKVS QIL+  F+IS SL +P  SS G+DIELSY ALSSL
Sbjct  1015  SLGDRVITYLPRCADTNAEVRKVSAQILDQLFSISLSLQRPATSSYGVDIELSYSALSSL  1074

Query  3302  EDVVAILRSDASIDPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQA  3481
             EDV+AILRSDASIDPSEVFNRV+SSVC LL K+ELVA LHGC+ AICDK+KQSAEGAIQA
Sbjct  1075  EDVIAILRSDASIDPSEVFNRVISSVCLLLTKNELVATLHGCTAAICDKVKQSAEGAIQA  1134

Query  3482  VVEFVTNRGNELNEIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEV  3661
             V+EFVT RGNEL+EI+VSRT+Q+LLTA  HVTEK+LRQETL AI S+AE+T+SKVVF EV
Sbjct  1135  VIEFVTTRGNELSEIDVSRTTQALLTATGHVTEKHLRQETLAAISSLAESTSSKVVFNEV  1194

Query  3662  LAAAGRDMVTKDIHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGK  3841
             LA AGRD+VTKDI RLRGGWP+QDAF+AFSQH VLS SFLEHVI V++Q P LK  DS K
Sbjct  1195  LATAGRDIVTKDISRLRGGWPMQDAFYAFSQHTVLSSSFLEHVICVLDQYPVLK-ADSEK  1253

Query  3842  GESSRNSVDGSIEDDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchgl  4021
             G+ S  SVDG I+D+V  AA++ALTA FRGGG+ G+K V+Q+YASVLA LTL LG+CHGL
Sbjct  1254  GDYSSPSVDGHIDDEVLHAAIVALTAIFRGGGRIGKKAVQQNYASVLAELTLQLGSCHGL  1313

Query  4022  aSYGDQEPLRALLNAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRP  4201
             A  G  EPLRALL AFQ FCECVGDLEMGKILAR GEQNENE+WINLIG++AG ISIKRP
Sbjct  1314  AKCGQHEPLRALLTAFQVFCECVGDLEMGKILARDGEQNENERWINLIGDIAGCISIKRP  1373

Query  4202  KEVPTICLFLSKSLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPT  4381
             KEV  IC+  SKSL+R  R QREAAAAALSEF+RYSD FG LL QMVE LCRHV+D+SPT
Sbjct  1374  KEVQRICVIFSKSLNRHQRYQREAAAAALSEFIRYSDSFGSLLEQMVEVLCRHVTDESPT  1433

Query  4382  VRRLCLRGLVQMPSIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVE  4561
             VRRLCLRGLVQ+PSI +LQYT+Q+LGVILALLDDSDESVQLTAVSCLL +LESS  DAV+
Sbjct  1434  VRRLCLRGLVQIPSIQMLQYTSQVLGVILALLDDSDESVQLTAVSCLLTMLESSPNDAVD  1493

Query  4562  PVLLNLSIRLRNLQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLH  4741
             P+LL+LS+RLRNLQ+ +N K+RANAF+A G+L +YG G+  ++F EQ+HA  PR+VLHLH
Sbjct  1494  PILLSLSVRLRNLQISMNPKMRANAFSALGSLCNYGTGAQHEAFLEQVHAIIPRLVLHLH  1553

Query  4742  DDDLGVRQACRNTLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGP  4921
             D+D+ VRQACR+TL+ IAPL++++ +  L N H F+ DHR+DYEDF+R+L +Q  Q+L  
Sbjct  1554  DNDVIVRQACRSTLRRIAPLLDMEGLFPLFNMHCFNQDHRTDYEDFVRELTKQFAQHLPS  1613

Query  4922  RVDTYLSAIIQAFDAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNST  5101
             RVD+Y+++ IQA DAPWP+IQANA+Y  S MLSLSD+++I  +YY QVFG LVGK + ST
Sbjct  1614  RVDSYMASAIQALDAPWPIIQANAIYFSSCMLSLSDDQHILTIYYPQVFGTLVGKLNKST  1673

Query  5102  DAIVRATCSAALGLLLKSPNSSSWRDARLN  5191
             DA VRATCS ALGLLLKS  S SW+ A ++
Sbjct  1674  DASVRATCSLALGLLLKSSKSISWKAAPVD  1703


 Score =   287 bits (735),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 137/185 (74%), Positives = 162/185 (88%), Gaps = 0/185 (0%)
 Frame = +1

Query  94   IPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGNIAG  273
            I A EAVQV+VS LAD+SP+VREAS+++LKDI SL+P+LVLDCC  VSRGGRRRFGN+AG
Sbjct  10   IAAPEAVQVLVSLLADESPNVREASIASLKDIASLSPVLVLDCCSAVSRGGRRRFGNMAG  69

Query  274  LFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLPD  453
            +FQV+S  + ALD  DVDP FM KLAKIATAE+IS+KELN DWQRAA+G+LVS+G HLPD
Sbjct  70   VFQVMSYGVGALDNKDVDPPFMTKLAKIATAEIISSKELNTDWQRAASGLLVSIGLHLPD  129

Query  454  LMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIYRPI  633
            LMM+EIFLH  G NS+LPAMVQILAD+A +DALQFTPRLK VL+RV+PILGNVR+ +RPI
Sbjct  130  LMMDEIFLHLPGPNSSLPAMVQILADFALADALQFTPRLKHVLSRVLPILGNVRDAHRPI  189

Query  634  FANGL  648
            FAN  
Sbjct  190  FANAF  194



>ref|XP_007203208.1| hypothetical protein PRUPE_ppa000201mg [Prunus persica]
 gb|EMJ04407.1| hypothetical protein PRUPE_ppa000201mg [Prunus persica]
Length=1472

 Score =  2123 bits (5502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1095/1467 (75%), Positives = 1269/1467 (87%), Gaps = 9/1467 (1%)
 Frame = +2

Query  800   MVGLITRTQLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFED  979
             MVGLITRTQLKAALPRLVPTILELYKR+QD AF+ATCSLH+LL+ASLLS +GPPLLDFE+
Sbjct  1     MVGLITRTQLKAALPRLVPTILELYKRDQDVAFLATCSLHNLLHASLLSESGPPLLDFEE  60

Query  980   ltvvlstll-lvCSNNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLK  1156
             LTV+LSTLL +VC NND KEHSDF VGLKTYNEVQ CFLTVG VYPEDLFVFL+NKCRLK
Sbjct  61    LTVILSTLLPVVCINNDNKEHSDFSVGLKTYNEVQRCFLTVGLVYPEDLFVFLINKCRLK  120

Query  1157  EEPFTFGSLCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHC  1336
             EEP TFG+LCVLKHLLPRL+E+WH+KR  L+E+V+ L+D+ +LGVRK L+ELIVVMASHC
Sbjct  121   EEPLTFGALCVLKHLLPRLSEAWHSKRHNLVEAVQFLLDDQDLGVRKVLSELIVVMASHC  180

Query  1337  YLVGSSGELFIEYLVRHCAMPDLENVELESSRESSRFTGN-YYPFVYRKLEFKAGAVTTT  1513
             YL+GSSGELF+EYLVRHCA+ + ++ +LE S+++S   GN   PF Y++LE K G +   
Sbjct  181   YLIGSSGELFVEYLVRHCALTNKDSNDLERSKDAS---GNPNIPFQYKRLEVKIGTLCPA  237

Query  1514  ELRGVCEKGLLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESN  1693
             ELR +CEKGLLL+T+T+PEMEH+LWPFLLKMIIP+ YTGAVA VCRCISELCR   S SN
Sbjct  238   ELRAICEKGLLLLTITIPEMEHILWPFLLKMIIPQAYTGAVAMVCRCISELCRH-GSNSN  296

Query  1694  AMLSECKARTDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQD  1873
              ML+ECKAR DIP PEELF RLVVLLH+PLARE L +QIL+VL YLAPLFPKNIN FWQD
Sbjct  297   TMLAECKARADIPNPEELFVRLVVLLHDPLAREQLASQILTVLCYLAPLFPKNINLFWQD  356

Query  1874  EL*IPKMKAYVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYE  2053
             E  IPK+KAYVSDTEDL+QDP YQE+WDDMII+F AESLDVIQ+ DWV+ LGN   +QY 
Sbjct  357   E--IPKLKAYVSDTEDLRQDPSYQETWDDMIINFFAESLDVIQDSDWVIPLGNAITKQYG  414

Query  2054  LYKSDNEHSALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAA  2233
             LY SD+EHSALLHRC G+ LQKV+DRAYVR KID MY+QANI +PTNRLGLAKAMGLVAA
Sbjct  415   LYTSDDEHSALLHRCFGVFLQKVNDRAYVRDKIDWMYKQANITIPTNRLGLAKAMGLVAA  474

Query  2234  SHLDTVLDKLKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTV  2413
             SHLDTVL+KLKGILDNV QSI +R  SFFSD  K EESDD HAALALMYGYAAKYAP TV
Sbjct  475   SHLDTVLEKLKGILDNVEQSIFRRFLSFFSDDFKTEESDDIHAALALMYGYAAKYAPSTV  534

Query  2414  IEARIDALVGTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLD  2593
             IEARIDALVGTNMLSRLLHVRHP AKQAVITAIDLLG+AVI A+E+G SFPLKRRD +LD
Sbjct  535   IEARIDALVGTNMLSRLLHVRHPTAKQAVITAIDLLGRAVINAAENGSSFPLKRRDQMLD  594

Query  2594  YILTLMGRDEEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGL  2773
             YILTLMGRD+ E FSDS++ELL TQ+ ALSACTTLVSVEPKLT ETRN ++KAT+GFF L
Sbjct  595   YILTLMGRDDSESFSDSSLELLDTQARALSACTTLVSVEPKLTIETRNHVLKATLGFFAL  654

Query  2774  PNDPSDVINPLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGC  2953
             PNDP DV+N LIDNLITLLC IL+TSGEDGRSRAEQLLHILR ID +VSS ++YQR+RGC
Sbjct  655   PNDPIDVVNRLIDNLITLLCAILLTSGEDGRSRAEQLLHILRQIDQYVSSPMDYQRRRGC  714

Query  2954  LAAHELLIKFRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGE  3133
             LA HE+L+KFR +C+  +CALGCQGSC+H+KQ D   + N SNLPSAF LPSR+ALSLG+
Sbjct  715   LAVHEMLLKFRTVCITAHCALGCQGSCTHNKQFDRNLHGNFSNLPSAFVLPSREALSLGD  774

Query  3134  RIMVYLPRCIDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVV  3313
             R+++YLPRC DTN EVR VS QIL+  F+IS SLP+P  SS G+DIELSY ALSSLEDV+
Sbjct  775   RVIMYLPRCADTNSEVRTVSAQILDQLFSISLSLPRPETSSYGVDIELSYSALSSLEDVI  834

Query  3314  AILRSDASIDPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEF  3493
             AILRSDASIDPSEVFNR++SSVC LL K+EL+A LHGC+ AICDKIKQSAEGAIQAV+EF
Sbjct  835   AILRSDASIDPSEVFNRIISSVCILLTKNELIATLHGCTSAICDKIKQSAEGAIQAVIEF  894

Query  3494  VTNRGNELNEIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAA  3673
             VT RG EL+E +VSRT+Q+LL A  HVTEK+LRQETL AI S+AE+T+SKVVF EVLA +
Sbjct  895   VTRRGKELSEADVSRTTQALLMAATHVTEKHLRQETLAAISSLAESTSSKVVFNEVLATS  954

Query  3674  GRDMVTKDIHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESS  3853
             GRD+VTKDI RLRGGWP+QDAF+AFSQH VLS  FLEHVI V  Q P  K GDS KG++ 
Sbjct  955   GRDIVTKDISRLRGGWPMQDAFYAFSQHTVLSSLFLEHVIGVFGQYPIHK-GDSVKGDNP  1013

Query  3854  RNSVDGSIEDDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYG  4033
              + VDG +EDD+ +AA++A+TAFFRGGGK G+K V+Q+YASVLA LTL LGTCHGLAS G
Sbjct  1014  SHLVDGQMEDDILQAAIIAVTAFFRGGGKIGKKAVQQNYASVLAELTLQLGTCHGLASCG  1073

Query  4034  DQEPLRALLNAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVP  4213
               +PLRALL AFQAFCECVGDLEMGKILAR GE NENE+WINLIG++AG ISIKRPKEV 
Sbjct  1074  QHDPLRALLTAFQAFCECVGDLEMGKILARDGEHNENERWINLIGDIAGCISIKRPKEVQ  1133

Query  4214  TICLFLSKSLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRL  4393
             +I + LSKSL+R  R QREAAAAALSEF+RYSDGFG LL Q+VE LCRHVSD+SPTVRRL
Sbjct  1134  SISVILSKSLNRHQRYQREAAAAALSEFVRYSDGFGSLLEQIVEVLCRHVSDESPTVRRL  1193

Query  4394  CLRGLVQMPSIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLL  4573
             CLRGLVQ+PSIH+LQYTTQ+LGVILALLDDSDESVQLTAVSCLL +LE+S  DAVEP+LL
Sbjct  1194  CLRGLVQIPSIHMLQYTTQVLGVILALLDDSDESVQLTAVSCLLTMLEASPNDAVEPILL  1253

Query  4574  NLSIRLRNLQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDL  4753
             +LS+RLRNLQVC+N K+RANAFAAFGALS+YG G+  ++F EQ+HAA PR+VLHLHDDD+
Sbjct  1254  SLSVRLRNLQVCMNPKMRANAFAAFGALSNYGIGAQHEAFLEQVHAAIPRLVLHLHDDDV  1313

Query  4754  GVRQACRNTLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDT  4933
              VRQACR+TLK IAPL+E++ +  L N H F+ DHR+DYEDF+RDL +Q  Q+L  RVDT
Sbjct  1314  SVRQACRSTLKRIAPLLEMEGLLPLFNMHCFNHDHRTDYEDFVRDLTKQFAQHLPSRVDT  1373

Query  4934  YLSAIIQAFDAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIV  5113
             Y+++ IQAFDAPWP+IQANA+Y  S MLSLSD+++I  LYY+QVFG LVGK S S DA+V
Sbjct  1374  YMASTIQAFDAPWPIIQANAIYFSSCMLSLSDDQHILTLYYAQVFGTLVGKMSKSADAVV  1433

Query  5114  RATCSAALGLLLKSPNSSSWRDARLNK  5194
             RATCS+ALGLLLK   SSSW+ AR+++
Sbjct  1434  RATCSSALGLLLKFSKSSSWKAARVDR  1460



>gb|KGN48210.1| hypothetical protein Csa_6G448680 [Cucumis sativus]
Length=1682

 Score =  2114 bits (5477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1100/1518 (72%), Positives = 1288/1518 (85%), Gaps = 8/1518 (1%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             A WQ+SVDF   + +D DV+SFLNSAFELLLRVWA S DLKVR+S+VEALGQ+V LITR 
Sbjct  166   AAWQHSVDFPSHSSIDGDVMSFLNSAFELLLRVWAASSDLKVRISSVEALGQIVSLITRA  225

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstl  1003
             QLKAALPRL+PTILELYK+ QD AFV TCSLH++LN SL S +GPPLLDFEDLTV+LSTL
Sbjct  226   QLKAALPRLIPTILELYKKGQDVAFVTTCSLHNVLNTSLHSESGPPLLDFEDLTVILSTL  285

Query  1004  l-lvCSNNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGS  1180
             L +VC NN+ K+ SD   GLKTYNEVQ CFLTVG +YPEDLF+FLLNKCRLKEEP TFG+
Sbjct  286   LPVVCVNNESKD-SDLSTGLKTYNEVQRCFLTVGLIYPEDLFMFLLNKCRLKEEPLTFGA  344

Query  1181  LCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGE  1360
             LCVLKHLLPRL+E+WH KRP+L E+VK L+DE NLGVRKAL+ELIVVMASHCYLVGSSGE
Sbjct  345   LCVLKHLLPRLSEAWHGKRPLLTEAVKSLLDEQNLGVRKALSELIVVMASHCYLVGSSGE  404

Query  1361  LFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKG  1540
             +F+EYLVRHCA+  ++  +  +S+E +   G Y PF Y+++E K G V+  +LR + EKG
Sbjct  405   MFVEYLVRHCAI-KIDRNDPGASKELAGLNGGYIPFQYKRMEVKMGTVSPVKLREISEKG  463

Query  1541  LLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKAR  1720
             LLL+T+T+PEMEH+LWPFLLKMIIPR YTGA ATVCRCISELCR   S  ++MLSECK R
Sbjct  464   LLLLTITIPEMEHILWPFLLKMIIPRRYTGATATVCRCISELCRH-GSYGDSMLSECKTR  522

Query  1721  TDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKA  1900
             +DIP PEELFARLVVLLH+PLARE L TQIL+VL YLAPLFPKNIN FWQDE  IPKMKA
Sbjct  523   SDIPNPEELFARLVVLLHDPLAREQLATQILTVLCYLAPLFPKNINLFWQDE--IPKMKA  580

Query  1901  YVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHS  2080
             Y+SD+EDLKQ+PLYQE+WDDMII+FLAESLDVIQ+ +WV+ LGN F+ QYELY SD+EHS
Sbjct  581   YISDSEDLKQNPLYQETWDDMIINFLAESLDVIQDTNWVISLGNAFSNQYELYVSDDEHS  640

Query  2081  ALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDK  2260
             ALLHRCLGILLQK++DRAYV  KIDLMY+QANIAVPTNRLGLAKAMGLVA+SHLDTVL+K
Sbjct  641   ALLHRCLGILLQKINDRAYVHDKIDLMYKQANIAVPTNRLGLAKAMGLVASSHLDTVLEK  700

Query  2261  LKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALV  2440
             LK ILDN+G S  QR  SFFSD  K EESDD HAALALMYGYAAKYAP TVIEARIDALV
Sbjct  701   LKDILDNMGHSFFQRFLSFFSDGFKKEESDDIHAALALMYGYAAKYAPSTVIEARIDALV  760

Query  2441  GTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRD  2620
             GTNMLSRLL+V HP AKQAVITAIDLLG+AVI A+E+G +FPLKRRD LLDYILTLMGRD
Sbjct  761   GTNMLSRLLNVYHPTAKQAVITAIDLLGRAVINAAENGSTFPLKRRDQLLDYILTLMGRD  820

Query  2621  EEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVIN  2800
             +  GFSDSN ELL TQ+LALSACTTLVS+EPKLT ETRNLIMKAT+GFF L ++P++V+N
Sbjct  821   DNGGFSDSNFELLRTQALALSACTTLVSLEPKLTIETRNLIMKATLGFFTLSSEPAEVVN  880

Query  2801  PLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIK  2980
             PLIDNLITLLCTIL+TSGEDGRSRAEQLLHILR IDP+VSS +E QR+RGCLA HE+L+K
Sbjct  881   PLIDNLITLLCTILLTSGEDGRSRAEQLLHILRQIDPYVSSPVECQRRRGCLAVHEMLVK  940

Query  2981  FRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPRC  3160
             FR +C++GYCALGC G C+H++Q+D         LPSAF LPSR+AL LGER++ YLPRC
Sbjct  941   FRMVCISGYCALGCHGICTHNRQMDRNLQGICPKLPSAFMLPSREALCLGERVITYLPRC  1000

Query  3161  IDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILRSDASI  3340
              D N EVRK S QIL+  F+IS +LP+P  S  G DIELSY ALSSLEDV+AILRSD SI
Sbjct  1001  ADLNSEVRKFSAQILDQLFSISLALPRPAASKFGEDIELSYTALSSLEDVIAILRSDTSI  1060

Query  3341  DPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNELN  3520
             DPSEVFNR+VSSVC LL KDELVA LHGCSGAICDKIKQSAEGAIQAV+EFVT RGNEL+
Sbjct  1061  DPSEVFNRIVSSVCILLTKDELVATLHGCSGAICDKIKQSAEGAIQAVIEFVTKRGNELS  1120

Query  3521  EIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMVTKDI  3700
             E+E++RT+Q+LL+AVVHVTEK++R ETLGAI S+AENT  KVVF EVLA AGRD++TKDI
Sbjct  1121  EMEIARTTQALLSAVVHVTEKHIRLETLGAISSLAENTNPKVVFDEVLATAGRDIITKDI  1180

Query  3701  HRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSVDGSIE  3880
              RLRGGWPIQDAF+ FSQH VLS SFLEHV+SV+NQ P L  G   + E S +  D  IE
Sbjct  1181  SRLRGGWPIQDAFYVFSQHTVLSFSFLEHVLSVLNQVP-LNQGSQDRAEFSSHGPD-HIE  1238

Query  3881  DDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPLRALL  4060
             +D+S+AA+++LTAFFRGGGK G+K VEQ+YA VLA L L LG+CH  AS G  E LRALL
Sbjct  1239  NDISQAAIVSLTAFFRGGGKVGKKAVEQNYALVLAELILQLGSCHHHASLGQHEKLRALL  1298

Query  4061  NAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICLFLSKS  4240
              AFQAFCECVGDLEMGKILAR GE NENE+WINLIG+LAG ISIKRPKEV  ICL +SKS
Sbjct  1299  TAFQAFCECVGDLEMGKILARDGEHNENERWINLIGDLAGCISIKRPKEVQHICLIMSKS  1358

Query  4241  LDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQMP  4420
             ++   R QREAA AALSEF+RYS   G LL Q+VE  CRHVSD+SPTVRRLCLRGLVQ+P
Sbjct  1359  VNGHQRYQREAATAALSEFVRYSGHVGSLLEQIVEVFCRHVSDESPTVRRLCLRGLVQIP  1418

Query  4421  SIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSIRLRNL  4600
              I ++QYT Q+LGVILALLDD DESVQ TA+SCLL++LE+S  DAVEP+LLNLS+RLR+L
Sbjct  1419  VIQIIQYTAQVLGVILALLDDVDESVQSTALSCLLMILEASPNDAVEPILLNLSVRLRHL  1478

Query  4601  QVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACRNT  4780
             Q C+N  IRANAF AFG LS+YG G   ++F EQ+HA  PR+VLH++DDD+ VRQACR+T
Sbjct  1479  QSCMNTVIRANAFTAFGVLSTYGVGQQSEAFLEQVHATIPRLVLHVYDDDISVRQACRST  1538

Query  4781  LKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSAIIQAF  4960
              K IAPL+E++ +P L N H F+SDHR+DY DF+RD ++Q++QYL  RVD+Y++  I+AF
Sbjct  1539  FKRIAPLVEVEELPTLFNMHFFNSDHRNDYVDFVRDFSKQISQYLPSRVDSYMAMTIKAF  1598

Query  4961  DAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATCSAALG  5140
             DAPWP+IQANA+Y  SSML+L+D+++I +L+Y+QVFG+LVGK S S +AIVRATCS+ALG
Sbjct  1599  DAPWPMIQANAIYFSSSMLALTDDQHILSLHYTQVFGLLVGKMSRSGEAIVRATCSSALG  1658

Query  5141  LLLKSPNSSSWRDARLNK  5194
             LLLKS NS SWR AR+++
Sbjct  1659  LLLKSSNSLSWRTARMDR  1676


 Score =   260 bits (664),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 142/160 (89%), Gaps = 0/160 (0%)
 Frame = +1

Query  169  MSALKDITSLNPLLVLDCCLTVSRGGRRRFGNIAGLFQVISVAIRALDKGDVDPAFMMKL  348
            M++LKDI +LNPLLVLDCC  VSRGGRRRFGN+AG F V+S  +RALD+ DVDPAFM KL
Sbjct  1    MASLKDIATLNPLLVLDCCYAVSRGGRRRFGNMAGAFLVMSFGVRALDEEDVDPAFMSKL  60

Query  349  AKIATAEVISTKELNADWQRAAAGVLVSVGSHLPDLMMEEIFLHFSGSNSALPAMVQILA  528
            AKI+T E+IS+KELN +WQRAAA +LVS+GSHLPDLMMEEI+LH  G +SALPAMVQILA
Sbjct  61   AKISTTEIISSKELNTEWQRAAAQLLVSIGSHLPDLMMEEIYLHLGGPSSALPAMVQILA  120

Query  529  DYASSDALQFTPRLKGVLARVVPILGNVREIYRPIFANGL  648
            D+ASSDALQFTPRLK VL+RV+PILGNVR+ +RPIFAN +
Sbjct  121  DFASSDALQFTPRLKDVLSRVLPILGNVRDAHRPIFANAI  160



>ref|XP_010267297.1| PREDICTED: protein SHOOT GRAVITROPISM 6 isoform X2 [Nelumbo nucifera]
Length=1700

 Score =  2111 bits (5470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1089/1517 (72%), Positives = 1294/1517 (85%), Gaps = 17/1517 (1%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             A WQYS DF  + +LD+DV+SFLNSAFELLLRVWA SRDLKVR+S+VEALGQMVGLITR 
Sbjct  200   AAWQYSGDFPSNALLDSDVMSFLNSAFELLLRVWANSRDLKVRVSSVEALGQMVGLITRL  259

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstl  1003
             QLKAALPRLV TILELYK++Q+ AF+ATCSLH++LNASLLS +GPPLLDFE+LTV+L+TL
Sbjct  260   QLKAALPRLVQTILELYKKDQEVAFLATCSLHNVLNASLLSEDGPPLLDFEELTVILATL  319

Query  1004  l-lvCSNNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGS  1180
             L +VC N++ KEHSDF VGLKTYNEVQHCFLTVG VY EDLF+FLLNKCRLKEEP+T+G+
Sbjct  320   LPVVCINSENKEHSDFSVGLKTYNEVQHCFLTVGLVYSEDLFMFLLNKCRLKEEPYTYGA  379

Query  1181  LCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGE  1360
             LCVLKHLLPRL+E+WH KRP+L+E+VKLL+DE +LG+RKAL+ELIVVMAS+CY+VG SGE
Sbjct  380   LCVLKHLLPRLSEAWHAKRPLLVEAVKLLLDEQSLGIRKALSELIVVMASNCYVVGPSGE  439

Query  1361  LFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKG  1540
             LF+EYLV HCA+ D E    E+S++  R + +++ F  ++LE K GA    ELR +CEKG
Sbjct  440   LFVEYLVHHCAISDQELNNFENSKDV-RSSISFHAFQQKRLEVKIGAACPAELRSICEKG  498

Query  1541  LLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKAR  1720
             LLL+T+T+PEME+VLWPFLLKMI+PR YTGA ATVCRCISELCR RSS ++++L++CKAR
Sbjct  499   LLLLTITIPEMEYVLWPFLLKMIVPRKYTGAAATVCRCISELCRHRSSYASSVLTDCKAR  558

Query  1721  TDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKA  1900
             TDIP PE+LFARLVVLLH+PLARE L TQIL+VL YL PLFP+N++ FWQDE  IPKMKA
Sbjct  559   TDIPNPEDLFARLVVLLHDPLAREQLATQILTVLCYLGPLFPRNVSLFWQDE--IPKMKA  616

Query  1901  YVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHS  2080
             YVSDTEDLKQDP YQE+WD+MII+FLAESLDVIQ+ +W++ LGN F +QYELY SD+EH+
Sbjct  617   YVSDTEDLKQDPAYQETWDNMIINFLAESLDVIQDPEWLISLGNAFTKQYELYTSDDEHT  676

Query  2081  ALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDK  2260
             ALLHRCLG+LLQK+ DRAYVR KID MYRQANI+VPTNRLGLAK MGLVA+SHLDTVL+K
Sbjct  677   ALLHRCLGMLLQKIDDRAYVREKIDWMYRQANISVPTNRLGLAKGMGLVASSHLDTVLEK  736

Query  2261  LKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALV  2440
             LK ILDNVG +  QR  S FS+R KME++DD HAALALMYGYAA+YAP TVIEARIDALV
Sbjct  737   LKDILDNVGLNFFQRFLSLFSERVKMEDADDIHAALALMYGYAARYAPSTVIEARIDALV  796

Query  2441  GTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRD  2620
             GTNMLSRLLHVR   AKQAVITAIDLLG+AVI A+ESG SFPLKRRD LLDYILTLMGRD
Sbjct  797   GTNMLSRLLHVRCHTAKQAVITAIDLLGRAVINAAESGASFPLKRRDQLLDYILTLMGRD  856

Query  2621  EEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVIN  2800
             + + F+DS++ELL TQSLALSACTTLVSVEPKLT ETRN +MKAT+GFF LP+DPSD+++
Sbjct  857   DTDSFADSSLELLRTQSLALSACTTLVSVEPKLTIETRNHVMKATLGFFALPSDPSDIVD  916

Query  2801  PLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIK  2980
             PLI+NLITLLC IL+TSGEDGRSRAEQLLHILR ID ++SSS+E+QRKRGC+A HE+L+K
Sbjct  917   PLINNLITLLCAILLTSGEDGRSRAEQLLHILRQIDLYISSSMEHQRKRGCIAVHEMLLK  976

Query  2981  FRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPRC  3160
             FRA+C +GYC LGC GSC H+KQID   + N SNLPSAF LPSR +L LGER++VYLPRC
Sbjct  977   FRALCSSGYCTLGCHGSCVHTKQIDRMLHGNFSNLPSAFVLPSRASLCLGERVIVYLPRC  1036

Query  3161  IDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILRSDASI  3340
              DT+ EVRKVS QIL++ F+IS SLP+P  S++  + ELSY ALSSLEDV+AILRSD SI
Sbjct  1037  ADTSAEVRKVSAQILDILFSISLSLPRPAESNISFNAELSYGALSSLEDVIAILRSDTSI  1096

Query  3341  DPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNELN  3520
             D SEVFNRV+SSVC LL KDELV  LHGC+ AICDK++QSAEGAIQAVVEFVT RG ELN
Sbjct  1097  DQSEVFNRVLSSVCNLLTKDELVGTLHGCTAAICDKVRQSAEGAIQAVVEFVTRRGIELN  1156

Query  3521  EIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMVTKDI  3700
             E++VSRT+ +LL+A + V EK+LR E LGAI  +AENT+S+VVF EVLA AGRD++ KDI
Sbjct  1157  EMDVSRTTHALLSATLLVPEKHLRHEILGAISCLAENTSSQVVFNEVLAVAGRDILRKDI  1216

Query  3701  HRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSVDGSIE  3880
              RLRGGWP+QDAF+ FSQH VLS  FLEHV+S++N +P  K  DS KG S  N  D  IE
Sbjct  1217  SRLRGGWPMQDAFYVFSQHTVLSVLFLEHVVSILNHTPIPK-ADSEKGGSC-NLFDTQIE  1274

Query  3881  DDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPLRALL  4060
             D++ +AA+LALTA FRGGGK G+K+VEQSYA+VL+TLTLHLG+CHGLA    QE LR LL
Sbjct  1275  DNILQAALLALTALFRGGGKVGKKSVEQSYAAVLSTLTLHLGSCHGLAGSDQQESLRTLL  1334

Query  4061  NAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICLFLSKS  4240
              AFQAFCECVGDLEMGKILAR GEQNENEKW+ LIG+LAG ISIKRPKEVP IC+ L K+
Sbjct  1335  AAFQAFCECVGDLEMGKILARDGEQNENEKWVTLIGDLAGCISIKRPKEVPAICINLCKA  1394

Query  4241  LDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQMP  4420
             L+     QRE+AAAALSEF+RYSD  G LL Q+VEA+CRHVSD+SPT+           P
Sbjct  1395  LNGHQTYQRESAAAALSEFVRYSDRVGSLLEQLVEAMCRHVSDESPTI-----------P  1443

Query  4421  SIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSIRLRNL  4600
             S+H+LQYTTQILGVILALL+D DESV+LTAVSCLL VLESS  DAV+PVLL+LSIRLRNL
Sbjct  1444  SVHILQYTTQILGVILALLEDPDESVELTAVSCLLTVLESSPNDAVDPVLLSLSIRLRNL  1503

Query  4601  QVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACRNT  4780
             Q C+N K+RANAFAAFGALS YG G+  ++F EQ+HA+ PR++LH+HDDDL VRQACRNT
Sbjct  1504  QSCMNDKMRANAFAAFGALSKYGVGAQHEAFLEQVHASLPRLILHVHDDDLSVRQACRNT  1563

Query  4781  LKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSAIIQAF  4960
             L+ I PL+E+D++ A  NTH F+SDHRSDYEDF+RDL RQL Q   PR+DTY+++ +QAF
Sbjct  1564  LRQIVPLMEVDSMTARFNTHYFNSDHRSDYEDFIRDLTRQLCQNFSPRIDTYMASAVQAF  1623

Query  4961  DAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATCSAALG  5140
             DAPWP+IQANA+Y  S MLSLSD++ IS  +++QVFG+L GK S S DA+VRATC +ALG
Sbjct  1624  DAPWPIIQANAIYFSSCMLSLSDDQRISTPFFAQVFGMLTGKMSRSPDAVVRATCLSALG  1683

Query  5141  LLLKSPNSSSWRDARLN  5191
             +LLKS NS+SWR +RL+
Sbjct  1684  MLLKSSNSTSWRTSRLD  1700


 Score =   300 bits (768),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 170/188 (90%), Gaps = 0/188 (0%)
 Frame = +1

Query  85   GDSIPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGN  264
            G ++PA EAVQV+VSSLAD++P VREAS +ALKDI +LNPLLVLDCC TVSRGGRRRFGN
Sbjct  7    GSTVPAPEAVQVLVSSLADEAPMVREASTAALKDIAALNPLLVLDCCSTVSRGGRRRFGN  66

Query  265  IAGLFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSH  444
            +AG+FQV++ A+RALDK DVDP F+ KLAKIATAE+IS+KELN+DWQRAA+ +LVS+GSH
Sbjct  67   MAGVFQVMAFAVRALDKKDVDPPFVAKLAKIATAEMISSKELNSDWQRAASSLLVSIGSH  126

Query  445  LPDLMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIY  624
            LPDLMM+EIFLH SG+NS LPAMVQILAD+AS++A QFTP+LKGVL+RV+PILGNVR+  
Sbjct  127  LPDLMMDEIFLHLSGTNSTLPAMVQILADFASAEASQFTPQLKGVLSRVLPILGNVRDAQ  186

Query  625  RPIFANGL  648
            RPIFA+  
Sbjct  187  RPIFAHAF  194



>ref|XP_010267298.1| PREDICTED: protein SHOOT GRAVITROPISM 6 isoform X3 [Nelumbo nucifera]
Length=1681

 Score =  2108 bits (5461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1080/1516 (71%), Positives = 1279/1516 (84%), Gaps = 34/1516 (2%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             A WQYS DF  + +LD+DV+SFLNSAFELLLRVWA SRDLKVR+S+VEALGQMVGLITR 
Sbjct  200   AAWQYSGDFPSNALLDSDVMSFLNSAFELLLRVWANSRDLKVRVSSVEALGQMVGLITRL  259

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstl  1003
             QLKAALPRLV TILELYK++Q+ AF+ATCSLH++LNASLLS +GPPLLDFE         
Sbjct  260   QLKAALPRLVQTILELYKKDQEVAFLATCSLHNVLNASLLSEDGPPLLDFE---------  310

Query  1004  llvCSNNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGSL  1183
                                 TYNEVQHCFLTVG VY EDLF+FLLNKCRLKEEP+T+G+L
Sbjct  311   --------------------TYNEVQHCFLTVGLVYSEDLFMFLLNKCRLKEEPYTYGAL  350

Query  1184  CVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGEL  1363
             CVLKHLLPRL+E+WH KRP+L+E+VKLL+DE +LG+RKAL+ELIVVMAS+CY+VG SGEL
Sbjct  351   CVLKHLLPRLSEAWHAKRPLLVEAVKLLLDEQSLGIRKALSELIVVMASNCYVVGPSGEL  410

Query  1364  FIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKGL  1543
             F+EYLV HCA+ D E    E+S++  R + +++ F  ++LE K GA    ELR +CEKGL
Sbjct  411   FVEYLVHHCAISDQELNNFENSKD-VRSSISFHAFQQKRLEVKIGAACPAELRSICEKGL  469

Query  1544  LLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKART  1723
             LL+T+T+PEME+VLWPFLLKMI+PR YTGA ATVCRCISELCR RSS ++++L++CKART
Sbjct  470   LLLTITIPEMEYVLWPFLLKMIVPRKYTGAAATVCRCISELCRHRSSYASSVLTDCKART  529

Query  1724  DIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKAY  1903
             DIP PE+LFARLVVLLH+PLARE L TQIL+VL YL PLFP+N++ FWQDE  IPKMKAY
Sbjct  530   DIPNPEDLFARLVVLLHDPLAREQLATQILTVLCYLGPLFPRNVSLFWQDE--IPKMKAY  587

Query  1904  VSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHSA  2083
             VSDTEDLKQDP YQE+WD+MII+FLAESLDVIQ+ +W++ LGN F +QYELY SD+EH+A
Sbjct  588   VSDTEDLKQDPAYQETWDNMIINFLAESLDVIQDPEWLISLGNAFTKQYELYTSDDEHTA  647

Query  2084  LLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDKL  2263
             LLHRCLG+LLQK+ DRAYVR KID MYRQANI+VPTNRLGLAK MGLVA+SHLDTVL+KL
Sbjct  648   LLHRCLGMLLQKIDDRAYVREKIDWMYRQANISVPTNRLGLAKGMGLVASSHLDTVLEKL  707

Query  2264  KGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALVG  2443
             K ILDNVG +  QR  S FS+R KME++DD HAALALMYGYAA+YAP TVIEARIDALVG
Sbjct  708   KDILDNVGLNFFQRFLSLFSERVKMEDADDIHAALALMYGYAARYAPSTVIEARIDALVG  767

Query  2444  TNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRDE  2623
             TNMLSRLLHVR   AKQAVITAIDLLG+AVI A+ESG SFPLKRRD LLDYILTLMGRD+
Sbjct  768   TNMLSRLLHVRCHTAKQAVITAIDLLGRAVINAAESGASFPLKRRDQLLDYILTLMGRDD  827

Query  2624  EEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVINP  2803
              + F+DS++ELL TQSLALSACTTLVSVEPKLT ETRN +MKAT+GFF LP+DPSD+++P
Sbjct  828   TDSFADSSLELLRTQSLALSACTTLVSVEPKLTIETRNHVMKATLGFFALPSDPSDIVDP  887

Query  2804  LIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIKF  2983
             LI+NLITLLC IL+TSGEDGRSRAEQLLHILR ID ++SSS+E+QRKRGC+A HE+L+KF
Sbjct  888   LINNLITLLCAILLTSGEDGRSRAEQLLHILRQIDLYISSSMEHQRKRGCIAVHEMLLKF  947

Query  2984  RAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPRCI  3163
             RA+C +GYC LGC GSC H+KQID   + N SNLPSAF LPSR +L LGER++VYLPRC 
Sbjct  948   RALCSSGYCTLGCHGSCVHTKQIDRMLHGNFSNLPSAFVLPSRASLCLGERVIVYLPRCA  1007

Query  3164  DTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILRSDASID  3343
             DT+ EVRKVS QIL++ F+IS SLP+P  S++  + ELSY ALSSLEDV+AILRSD SID
Sbjct  1008  DTSAEVRKVSAQILDILFSISLSLPRPAESNISFNAELSYGALSSLEDVIAILRSDTSID  1067

Query  3344  PSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNELNE  3523
              SEVFNRV+SSVC LL KDELV  LHGC+ AICDK++QSAEGAIQAVVEFVT RG ELNE
Sbjct  1068  QSEVFNRVLSSVCNLLTKDELVGTLHGCTAAICDKVRQSAEGAIQAVVEFVTRRGIELNE  1127

Query  3524  IEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMVTKDIH  3703
             ++VSRT+ +LL+A + V EK+LR E LGAI  +AENT+S+VVF EVLA AGRD++ KDI 
Sbjct  1128  MDVSRTTHALLSATLLVPEKHLRHEILGAISCLAENTSSQVVFNEVLAVAGRDILRKDIS  1187

Query  3704  RLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSVDGSIED  3883
             RLRGGWP+QDAF+ FSQH VLS  FLEHV+S++N +P  K  DS KG S  N  D  IED
Sbjct  1188  RLRGGWPMQDAFYVFSQHTVLSVLFLEHVVSILNHTPIPK-ADSEKGGSC-NLFDTQIED  1245

Query  3884  DVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPLRALLN  4063
             ++ +AA+LALTA FRGGGK G+K+VEQSYA+VL+TLTLHLG+CHGLA    QE LR LL 
Sbjct  1246  NILQAALLALTALFRGGGKVGKKSVEQSYAAVLSTLTLHLGSCHGLAGSDQQESLRTLLA  1305

Query  4064  AFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICLFLSKSL  4243
             AFQAFCECVGDLEMGKILAR GEQNENEKW+ LIG+LAG ISIKRPKEVP IC+ L K+L
Sbjct  1306  AFQAFCECVGDLEMGKILARDGEQNENEKWVTLIGDLAGCISIKRPKEVPAICINLCKAL  1365

Query  4244  DRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQMPS  4423
             +     QRE+AAAALSEF+RYSD  G LL Q+VEA+CRHVSD+SPTVRRLCLRGLVQ+PS
Sbjct  1366  NGHQTYQRESAAAALSEFVRYSDRVGSLLEQLVEAMCRHVSDESPTVRRLCLRGLVQIPS  1425

Query  4424  IHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSIRLRNLQ  4603
             +H+LQYTTQILGVILALL+D DESV+LTAVSCLL VLESS  DAV+PVLL+LSIRLRNLQ
Sbjct  1426  VHILQYTTQILGVILALLEDPDESVELTAVSCLLTVLESSPNDAVDPVLLSLSIRLRNLQ  1485

Query  4604  VCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACRNTL  4783
              C+N K+RANAFAAFGALS YG G+  ++F EQ+HA+ PR++LH+HDDDL VRQACRNTL
Sbjct  1486  SCMNDKMRANAFAAFGALSKYGVGAQHEAFLEQVHASLPRLILHVHDDDLSVRQACRNTL  1545

Query  4784  KCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSAIIQAFD  4963
             + I PL+E+D++ A  NTH F+SDHRSDYEDF+RDL RQL Q   PR+DTY+++ +QAFD
Sbjct  1546  RQIVPLMEVDSMTARFNTHYFNSDHRSDYEDFIRDLTRQLCQNFSPRIDTYMASAVQAFD  1605

Query  4964  APWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATCSAALGL  5143
             APWP+IQANA+Y  S MLSLSD++ IS  +++QVFG+L GK S S DA+VRATC +ALG+
Sbjct  1606  APWPIIQANAIYFSSCMLSLSDDQRISTPFFAQVFGMLTGKMSRSPDAVVRATCLSALGM  1665

Query  5144  LLKSPNSSSWRDARLN  5191
             LLKS NS+SWR +RL+
Sbjct  1666  LLKSSNSTSWRTSRLD  1681


 Score =   300 bits (768),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 170/188 (90%), Gaps = 0/188 (0%)
 Frame = +1

Query  85   GDSIPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGN  264
            G ++PA EAVQV+VSSLAD++P VREAS +ALKDI +LNPLLVLDCC TVSRGGRRRFGN
Sbjct  7    GSTVPAPEAVQVLVSSLADEAPMVREASTAALKDIAALNPLLVLDCCSTVSRGGRRRFGN  66

Query  265  IAGLFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSH  444
            +AG+FQV++ A+RALDK DVDP F+ KLAKIATAE+IS+KELN+DWQRAA+ +LVS+GSH
Sbjct  67   MAGVFQVMAFAVRALDKKDVDPPFVAKLAKIATAEMISSKELNSDWQRAASSLLVSIGSH  126

Query  445  LPDLMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIY  624
            LPDLMM+EIFLH SG+NS LPAMVQILAD+AS++A QFTP+LKGVL+RV+PILGNVR+  
Sbjct  127  LPDLMMDEIFLHLSGTNSTLPAMVQILADFASAEASQFTPQLKGVLSRVLPILGNVRDAQ  186

Query  625  RPIFANGL  648
            RPIFA+  
Sbjct  187  RPIFAHAF  194



>ref|XP_008462510.1| PREDICTED: protein SHOOT GRAVITROPISM 6 [Cucumis melo]
Length=1716

 Score =  2106 bits (5457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1099/1518 (72%), Positives = 1285/1518 (85%), Gaps = 8/1518 (1%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             A WQ+SVDF   + +D DV+SFLNSAFELLLRVWA S DLKVR+S VEALGQ+VGLITR 
Sbjct  200   AAWQHSVDFPSHSSIDGDVMSFLNSAFELLLRVWAASSDLKVRISTVEALGQIVGLITRA  259

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstl  1003
             QLKAALPRL+PT+LELYK+ QD AFV TCSLH++LN SL S +GPPLLDFEDLTV+LSTL
Sbjct  260   QLKAALPRLIPTMLELYKKGQDVAFVTTCSLHNVLNTSLHSESGPPLLDFEDLTVILSTL  319

Query  1004  l-lvCSNNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGS  1180
             L +VC NN+ K+ SD  +GLKTYNEVQ CFLTVG +YPEDLF+FLLNKCRLKEEP TFG+
Sbjct  320   LPVVCVNNESKD-SDLSIGLKTYNEVQRCFLTVGLIYPEDLFMFLLNKCRLKEEPLTFGA  378

Query  1181  LCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGE  1360
             LCVLKHLLPRL+E+WH KRP+L E+VK L+DE NLGVRKAL+EL VVMASHCYLVGSSGE
Sbjct  379   LCVLKHLLPRLSEAWHGKRPLLTEAVKSLLDEQNLGVRKALSELTVVMASHCYLVGSSGE  438

Query  1361  LFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKG  1540
             +F+EYLVRHCA+  ++  +  +S+E     G Y PF Y+++E K G V++ +LR + EKG
Sbjct  439   MFVEYLVRHCAI-KVDRNDPGTSKELPGLNGGYIPFQYKRMEVKMGTVSSIKLREISEKG  497

Query  1541  LLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKAR  1720
             LLL+T+T+PEMEH+LWPFLLKMIIPR YTGA ATVCRCISELCR   S  ++MLSECK R
Sbjct  498   LLLLTITIPEMEHILWPFLLKMIIPRRYTGATATVCRCISELCRH-GSYGDSMLSECKTR  556

Query  1721  TDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKA  1900
             +DIP PEELFARLVVLLH+PLARE L TQIL+VL YLAPLFPKNIN FWQDE  IPKMKA
Sbjct  557   SDIPNPEELFARLVVLLHDPLAREQLATQILTVLCYLAPLFPKNINLFWQDE--IPKMKA  614

Query  1901  YVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHS  2080
             Y+SD EDLKQ+PLYQE+WDDMII+FLAESLDVIQ+ +WV+ LGN F+ QYELY SD+EHS
Sbjct  615   YISDPEDLKQNPLYQETWDDMIINFLAESLDVIQDTNWVISLGNAFSNQYELYVSDDEHS  674

Query  2081  ALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDK  2260
             ALLHRCLGILLQK++DR YV  KIDLMY+QANIAVPTNRLGLAKAMGLVA+SHLDTVL+K
Sbjct  675   ALLHRCLGILLQKINDRPYVHDKIDLMYKQANIAVPTNRLGLAKAMGLVASSHLDTVLEK  734

Query  2261  LKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALV  2440
             LK ILDN+G S  QR  SFFSD  K EESDD HAALALMYGYAAKYAP TVIEARIDALV
Sbjct  735   LKDILDNMGHSFFQRFLSFFSDGFKKEESDDIHAALALMYGYAAKYAPSTVIEARIDALV  794

Query  2441  GTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRD  2620
             GTNMLSRLL+V HP AKQAVITAIDLLG+AVI A+E+G +FPLKRRD LLDYILTLMGRD
Sbjct  795   GTNMLSRLLNVYHPTAKQAVITAIDLLGRAVISAAENGSTFPLKRRDQLLDYILTLMGRD  854

Query  2621  EEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVIN  2800
             +  GFSDSN E L TQ+LALSACTTLVS+EPKLT ETRNLIMKAT+GFF L ++P++V+N
Sbjct  855   DNGGFSDSNFEFLRTQALALSACTTLVSLEPKLTIETRNLIMKATLGFFTLSSEPAEVVN  914

Query  2801  PLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIK  2980
             PLIDNLITLLCTIL+TSGEDGRSRAEQLLHILR ID +VSS +E QR+RGCLA HE+L+K
Sbjct  915   PLIDNLITLLCTILLTSGEDGRSRAEQLLHILRQIDQYVSSPVECQRRRGCLAVHEMLVK  974

Query  2981  FRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPRC  3160
             FR +C++GYCALGC G C+H++QID         LPSAF LPSR+AL LGER++ YLPRC
Sbjct  975   FRMVCISGYCALGCHGICTHNRQIDLNLQGICPKLPSAFMLPSREALCLGERVITYLPRC  1034

Query  3161  IDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILRSDASI  3340
              D N EVRK+S QIL+  F+IS +LP+P  S  G DIELSY ALSSLEDV+AILRSD SI
Sbjct  1035  ADLNSEVRKISAQILDQLFSISLALPRPAASKFGEDIELSYSALSSLEDVIAILRSDTSI  1094

Query  3341  DPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNELN  3520
             DPSEVFNR+VSSVC LL KDELVA LHGCSGAICDKIKQSAEGAIQAV+EFVT RGNEL+
Sbjct  1095  DPSEVFNRIVSSVCILLTKDELVATLHGCSGAICDKIKQSAEGAIQAVIEFVTKRGNELS  1154

Query  3521  EIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMVTKDI  3700
             E E++RT+Q+LL+AVVHVTEK++R ETLGAI S+AENT+ KVVF EVLA AGRD+VTKDI
Sbjct  1155  ETEIARTTQALLSAVVHVTEKHIRLETLGAISSLAENTSPKVVFDEVLATAGRDIVTKDI  1214

Query  3701  HRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSVDGSIE  3880
              RLRGGWPIQDAF+ FSQH VLS SFLEHV+SV+NQ P L  G   + + S +  D  IE
Sbjct  1215  SRLRGGWPIQDAFYVFSQHTVLSFSFLEHVLSVLNQVP-LNQGSQDRADFSSHGPD-HIE  1272

Query  3881  DDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPLRALL  4060
             +D+S+AA+++LTAFFRGGGK G+K VEQ+YA VLA L L LG+CH  AS G  E LRALL
Sbjct  1273  NDISQAAIVSLTAFFRGGGKVGKKAVEQNYALVLAELILQLGSCHHHASLGQHEQLRALL  1332

Query  4061  NAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICLFLSKS  4240
              AFQAFCECVGDLEMGKILAR GE NENE+WINLIG+LAG ISIKRPKEV  ICL LSKS
Sbjct  1333  TAFQAFCECVGDLEMGKILARDGEHNENERWINLIGDLAGCISIKRPKEVQHICLILSKS  1392

Query  4241  LDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQMP  4420
             ++R  R QREAA AALSEF+RYS     LL Q+VE  CRHVSD+SPTVRRLCLRGLVQ+P
Sbjct  1393  VNRHQRYQREAATAALSEFVRYSGHVSSLLEQIVEVFCRHVSDESPTVRRLCLRGLVQIP  1452

Query  4421  SIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSIRLRNL  4600
              I +LQYT Q+LGVILALLDD DESVQ TA+SCLL++LE+S  DAVEP+LLNLS+RLR+L
Sbjct  1453  VIQILQYTAQVLGVILALLDDVDESVQSTALSCLLMILEASPNDAVEPILLNLSVRLRHL  1512

Query  4601  QVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACRNT  4780
             Q C+N  IRANAF AFG LS+YG G   ++F EQ+HA  PR+VLH++DDD+ VRQACR+T
Sbjct  1513  QSCMNTVIRANAFTAFGVLSNYGVGQQSEAFIEQVHATIPRLVLHVYDDDVSVRQACRST  1572

Query  4781  LKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSAIIQAF  4960
              K IAPL+E++ +P L N H F+SDHR+DY DF+RD ++Q++QYL  RVD+Y++  I+AF
Sbjct  1573  FKRIAPLVEVEELPTLFNMHFFNSDHRNDYVDFVRDFSKQISQYLPSRVDSYMATTIKAF  1632

Query  4961  DAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATCSAALG  5140
             DAPWP+IQANA+Y  SSML+L+D+++I +L+Y+QVFG+LVGK S S +AIVRATCS+ALG
Sbjct  1633  DAPWPMIQANAIYFSSSMLALTDDQHILSLHYTQVFGLLVGKMSRSGEAIVRATCSSALG  1692

Query  5141  LLLKSPNSSSWRDARLNK  5194
             LLLKS NS SWR AR+++
Sbjct  1693  LLLKSSNSLSWRTARMDR  1710


 Score =   301 bits (771),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 142/188 (76%), Positives = 167/188 (89%), Gaps = 0/188 (0%)
 Frame = +1

Query  85   GDSIPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGN  264
             +SIPA EAVQ++VSSLAD+SP VREASM++LKDI +LNPLLVLDCC  VSRGGRRRFGN
Sbjct  7    ANSIPAPEAVQILVSSLADESPVVREASMASLKDIATLNPLLVLDCCYAVSRGGRRRFGN  66

Query  265  IAGLFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSH  444
            +AG F V+S  +RALDK DVDPAFM KLAKI+T E+IS+KELN +WQRAAA +LVS+GSH
Sbjct  67   MAGAFLVMSFGVRALDKEDVDPAFMSKLAKISTTEIISSKELNTEWQRAAAQLLVSIGSH  126

Query  445  LPDLMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIY  624
            LPDLMMEE++LH  G +SALPAMVQILAD+ASSDALQFTPRLK VL+RV+PILGNVR+ +
Sbjct  127  LPDLMMEELYLHLGGPSSALPAMVQILADFASSDALQFTPRLKDVLSRVLPILGNVRDAH  186

Query  625  RPIFANGL  648
            RPIFAN +
Sbjct  187  RPIFANAI  194



>ref|XP_010037121.1| PREDICTED: protein SHOOT GRAVITROPISM 6 isoform X1 [Eucalyptus 
grandis]
Length=1719

 Score =  2105 bits (5455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1068/1523 (70%), Positives = 1279/1523 (84%), Gaps = 21/1523 (1%)
 Frame = +2

Query  647   CW-----QYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGL  811
             CW      Y ++F   +IL+ DV+SFLNSAFELLLRVWA SRDLKVR ++VEALGQMVGL
Sbjct  196   CWCQATRLYVMEFPSHSILEADVMSFLNSAFELLLRVWAASRDLKVRTTSVEALGQMVGL  255

Query  812   ITRTQLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvv  991
             I RTQLK ALP+LVPT+L+LYKR+Q+ A++ATCSL+++L +SL+S +GPPLLDFEDLTV+
Sbjct  256   INRTQLKGALPKLVPTVLDLYKRDQETAYLATCSLYNVLYSSLMSESGPPLLDFEDLTVI  315

Query  992   lstll-lvCSNNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPF  1168
             LSTLL +VC NN+ KE +DF VGLKTYNEVQ CFLTVGSVYPEDLF FL++KCRLKEE  
Sbjct  316   LSTLLPVVCVNNEGKERADFSVGLKTYNEVQRCFLTVGSVYPEDLFGFLMSKCRLKEESL  375

Query  1169  TFGSLCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVG  1348
             TFG++CVLKHL+PRL+E WH+KR  L+E+VK L+DE +L VRKAL+ELIVVMASHCYLVG
Sbjct  376   TFGAICVLKHLVPRLSEVWHSKRLSLVEAVKSLLDEQSLSVRKALSELIVVMASHCYLVG  435

Query  1349  SSGELFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGV  1528
              SGELF+EYLVRHCA+ D E    ESS+E             R+LE K G V   ELR +
Sbjct  436   PSGELFVEYLVRHCALSDYERTAHESSKEIQN----------RRLEVKIGVVNPAELRAI  485

Query  1529  CEKGLLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRS-SESNAMLS  1705
             CEKGLLL+T+T+PEMEH+LWPFLLKMIIPR+YT AVATVCRCISELCR ++ + +  +LS
Sbjct  486   CEKGLLLLTITIPEMEHILWPFLLKMIIPRMYTSAVATVCRCISELCRHQTYNNTETVLS  545

Query  1706  ECKARTDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*I  1885
             +CKAR DIP PEELFARLVVLLH+PL R+ L T IL+VL+YLAPLFP+N+N FWQDE  I
Sbjct  546   DCKARPDIPSPEELFARLVVLLHDPLERKQLATHILAVLYYLAPLFPRNVNLFWQDE--I  603

Query  1886  PKMKAYVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKS  2065
             PKMKAYVSDTEDLK DP YQE+WDDMII+FLAESLDVIQ++DWV+ LGN+F RQYELY S
Sbjct  604   PKMKAYVSDTEDLKLDPSYQETWDDMIINFLAESLDVIQDIDWVISLGNSFTRQYELYTS  663

Query  2066  DNEHSALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLD  2245
             D+EHSALLHRCLG+LLQKV DRAYV  KI  MY+QANI+ PTNRLGLAKAMGLVAASHLD
Sbjct  664   DDEHSALLHRCLGVLLQKVDDRAYVHDKIAWMYKQANISNPTNRLGLAKAMGLVAASHLD  723

Query  2246  TVLDKLKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEAR  2425
             TVL+KLK ILDNV QS +QR  SFFSD  K  ESDD HAALALMYGYAA+YAP TVI+AR
Sbjct  724   TVLEKLKDILDNVCQSFVQRFLSFFSDSFKGMESDDIHAALALMYGYAARYAPSTVIQAR  783

Query  2426  IDALVGTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILT  2605
             IDALVGTNMLSRLLHV+HP AKQAVITAIDLLG+AVI A+ESG  FPLKRRD LLDYILT
Sbjct  784   IDALVGTNMLSRLLHVQHPTAKQAVITAIDLLGRAVINAAESGAPFPLKRRDQLLDYILT  843

Query  2606  LMGRDEEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDP  2785
             LMGRD+ +G++DSN+ELL TQ+LALSACTTLVSVEPKLT ETRN ++KAT+GFF LPNDP
Sbjct  844   LMGRDDNDGWTDSNLELLRTQALALSACTTLVSVEPKLTIETRNYVLKATLGFFALPNDP  903

Query  2786  SDVINPLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAH  2965
              DV+NPLI+NLI LLC IL+TSGEDGRSRAEQLLHILR ID +V+S ++YQRKRGCLAA+
Sbjct  904   IDVVNPLINNLIDLLCAILLTSGEDGRSRAEQLLHILRQIDKYVASPVDYQRKRGCLAAY  963

Query  2966  ELLIKFRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMV  3145
             ++L KFR +C  GYC+LGC G+C+HSKQID     N S+LP+A+ LPSR+ LSLG+R++ 
Sbjct  964   KMLTKFRMLCATGYCSLGCHGTCTHSKQIDRGLLGNFSSLPTAYVLPSREGLSLGDRVIA  1023

Query  3146  YLPRCIDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILR  3325
             YLPRC DT  EVRK+S +IL+  F+IS SLP+P+ +S+ +D+E SY ALSSLEDV+AILR
Sbjct  1024  YLPRCADTESEVRKISAEILDQLFSISLSLPRPVTASV-VDVESSYSALSSLEDVIAILR  1082

Query  3326  SDASIDPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNR  3505
             SDASIDPSEVFNR+VSSVC LL KDEL++ L GC+ AICDKIKQSAEGAIQAV EFV+ R
Sbjct  1083  SDASIDPSEVFNRIVSSVCGLLTKDELLSTLFGCTTAICDKIKQSAEGAIQAVTEFVSKR  1142

Query  3506  GNELNEIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDM  3685
             G ELNE +VSRT+QSLL+A  HV EK LR ETL AICS+AENT+SK VF EV+AAAGRD+
Sbjct  1143  GAELNENDVSRTTQSLLSAANHVAEKQLRLETLSAICSLAENTSSKAVFNEVVAAAGRDI  1202

Query  3686  VTKDIHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSV  3865
             VTKDI RLRGGWP+QDAF+AFSQH +L++SFLEH+IS+INQSP  K  D  K E S   +
Sbjct  1203  VTKDISRLRGGWPMQDAFYAFSQHTMLAYSFLEHIISIINQSPGSK-DDLFKVEVSSCGL  1261

Query  3866  DGSIEDDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEP  4045
             +G ++++  +AA++ALT+FFRGGGK GRK VEQSY+ VL  L + LG+ H LA  G  EP
Sbjct  1262  EGHLDNEFLQAAIVALTSFFRGGGKVGRKAVEQSYSHVLTELIIQLGSSHVLAGAGQHEP  1321

Query  4046  LRALLNAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICL  4225
             L+ALL AF+AFCECVGDLEMGKILAR GEQNE+EKW+ LIG+LAGSISIKRPKEV +IC+
Sbjct  1322  LQALLAAFRAFCECVGDLEMGKILARDGEQNEDEKWVTLIGDLAGSISIKRPKEVQSICI  1381

Query  4226  FLSKSLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRG  4405
              LS SL+R  + QREAAAAALSEF+RYS GF  +L QMVEA+CRHVSD+SPTVRRLCLRG
Sbjct  1382  ILSSSLNRNHKYQREAAAAALSEFIRYSGGFDSVLEQMVEAMCRHVSDESPTVRRLCLRG  1441

Query  4406  LVQMPSIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSI  4585
             LVQ+PS+H++QYT Q+LGVILALLDD+DESVQLTAVSCLL +L+S+  +AVEP+LLNLS 
Sbjct  1442  LVQIPSVHIVQYTAQVLGVILALLDDTDESVQLTAVSCLLTILDSAQIEAVEPILLNLSK  1501

Query  4586  RLRNLQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQ  4765
             RLRNLQ+ ++ K+RA+A AAFGALS+Y  G   ++F EQ+HA  PR+V HL+DD+ G+RQ
Sbjct  1502  RLRNLQISMDVKMRADAIAAFGALSNYAIGPQREAFVEQVHAVLPRLVFHLYDDNHGIRQ  1561

Query  4766  ACRNTLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSA  4945
             ACR+TLK +APL E +      N   F+SDHRSDYEDF+R+LA+Q TQ+L  RVDTY+++
Sbjct  1562  ACRSTLKQVAPLFETEGFSMPFNVQNFNSDHRSDYEDFVRNLAKQFTQHLSSRVDTYMAS  1621

Query  4946  IIQAFDAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATC  5125
              IQAFDAPWP+IQANA+Y   S+LSLSD+++I  +YY+QVF +LVGK S S+ A+VRATC
Sbjct  1622  TIQAFDAPWPLIQANAIYFACSLLSLSDDQHILTVYYTQVFSLLVGKMSRSSHAVVRATC  1681

Query  5126  SAALGLLLKSPNSSSWRDARLNK  5194
              +ALGLLLKS NS SWR+ RL++
Sbjct  1682  FSALGLLLKSTNSRSWREVRLDR  1704


 Score =   313 bits (801),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 150/188 (80%), Positives = 171/188 (91%), Gaps = 0/188 (0%)
 Frame = +1

Query  85   GDSIPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGN  264
            G SIPASEAVQV+VSSLADDSP VREASM++LKDI +LNPLLVL+CC TVSRGGRRRF N
Sbjct  7    GVSIPASEAVQVLVSSLADDSPLVREASMASLKDIATLNPLLVLECCYTVSRGGRRRFTN  66

Query  265  IAGLFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSH  444
            +AG FQV+SV ++AL + DVD  FM KLAKIATAE+IS+KELNADWQRAAAG+LVS+GSH
Sbjct  67   MAGAFQVMSVGVQALSERDVDQTFMSKLAKIATAEMISSKELNADWQRAAAGLLVSIGSH  126

Query  445  LPDLMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIY  624
            LPDLMMEE+FLH SG +SALPAM+QILADYAS+DALQFTPRLKGVL+RV+PILGNVR+ Y
Sbjct  127  LPDLMMEEVFLHLSGPSSALPAMIQILADYASADALQFTPRLKGVLSRVLPILGNVRDPY  186

Query  625  RPIFANGL  648
            RPIFAN  
Sbjct  187  RPIFANAF  194



>ref|XP_010037123.1| PREDICTED: protein SHOOT GRAVITROPISM 6 isoform X3 [Eucalyptus 
grandis]
Length=1561

 Score =  2103 bits (5449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1068/1523 (70%), Positives = 1279/1523 (84%), Gaps = 21/1523 (1%)
 Frame = +2

Query  647   CW-----QYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGL  811
             CW      Y ++F   +IL+ DV+SFLNSAFELLLRVWA SRDLKVR ++VEALGQMVGL
Sbjct  38    CWCQATRLYVMEFPSHSILEADVMSFLNSAFELLLRVWAASRDLKVRTTSVEALGQMVGL  97

Query  812   ITRTQLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvv  991
             I RTQLK ALP+LVPT+L+LYKR+Q+ A++ATCSL+++L +SL+S +GPPLLDFEDLTV+
Sbjct  98    INRTQLKGALPKLVPTVLDLYKRDQETAYLATCSLYNVLYSSLMSESGPPLLDFEDLTVI  157

Query  992   lstll-lvCSNNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPF  1168
             LSTLL +VC NN+ KE +DF VGLKTYNEVQ CFLTVGSVYPEDLF FL++KCRLKEE  
Sbjct  158   LSTLLPVVCVNNEGKERADFSVGLKTYNEVQRCFLTVGSVYPEDLFGFLMSKCRLKEESL  217

Query  1169  TFGSLCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVG  1348
             TFG++CVLKHL+PRL+E WH+KR  L+E+VK L+DE +L VRKAL+ELIVVMASHCYLVG
Sbjct  218   TFGAICVLKHLVPRLSEVWHSKRLSLVEAVKSLLDEQSLSVRKALSELIVVMASHCYLVG  277

Query  1349  SSGELFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGV  1528
              SGELF+EYLVRHCA+ D E    ESS+E             R+LE K G V   ELR +
Sbjct  278   PSGELFVEYLVRHCALSDYERTAHESSKEIQN----------RRLEVKIGVVNPAELRAI  327

Query  1529  CEKGLLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRS-SESNAMLS  1705
             CEKGLLL+T+T+PEMEH+LWPFLLKMIIPR+YT AVATVCRCISELCR ++ + +  +LS
Sbjct  328   CEKGLLLLTITIPEMEHILWPFLLKMIIPRMYTSAVATVCRCISELCRHQTYNNTETVLS  387

Query  1706  ECKARTDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*I  1885
             +CKAR DIP PEELFARLVVLLH+PL R+ L T IL+VL+YLAPLFP+N+N FWQDE  I
Sbjct  388   DCKARPDIPSPEELFARLVVLLHDPLERKQLATHILAVLYYLAPLFPRNVNLFWQDE--I  445

Query  1886  PKMKAYVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKS  2065
             PKMKAYVSDTEDLK DP YQE+WDDMII+FLAESLDVIQ++DWV+ LGN+F RQYELY S
Sbjct  446   PKMKAYVSDTEDLKLDPSYQETWDDMIINFLAESLDVIQDIDWVISLGNSFTRQYELYTS  505

Query  2066  DNEHSALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLD  2245
             D+EHSALLHRCLG+LLQKV DRAYV  KI  MY+QANI+ PTNRLGLAKAMGLVAASHLD
Sbjct  506   DDEHSALLHRCLGVLLQKVDDRAYVHDKIAWMYKQANISNPTNRLGLAKAMGLVAASHLD  565

Query  2246  TVLDKLKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEAR  2425
             TVL+KLK ILDNV QS +QR  SFFSD  K  ESDD HAALALMYGYAA+YAP TVI+AR
Sbjct  566   TVLEKLKDILDNVCQSFVQRFLSFFSDSFKGMESDDIHAALALMYGYAARYAPSTVIQAR  625

Query  2426  IDALVGTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILT  2605
             IDALVGTNMLSRLLHV+HP AKQAVITAIDLLG+AVI A+ESG  FPLKRRD LLDYILT
Sbjct  626   IDALVGTNMLSRLLHVQHPTAKQAVITAIDLLGRAVINAAESGAPFPLKRRDQLLDYILT  685

Query  2606  LMGRDEEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDP  2785
             LMGRD+ +G++DSN+ELL TQ+LALSACTTLVSVEPKLT ETRN ++KAT+GFF LPNDP
Sbjct  686   LMGRDDNDGWTDSNLELLRTQALALSACTTLVSVEPKLTIETRNYVLKATLGFFALPNDP  745

Query  2786  SDVINPLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAH  2965
              DV+NPLI+NLI LLC IL+TSGEDGRSRAEQLLHILR ID +V+S ++YQRKRGCLAA+
Sbjct  746   IDVVNPLINNLIDLLCAILLTSGEDGRSRAEQLLHILRQIDKYVASPVDYQRKRGCLAAY  805

Query  2966  ELLIKFRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMV  3145
             ++L KFR +C  GYC+LGC G+C+HSKQID     N S+LP+A+ LPSR+ LSLG+R++ 
Sbjct  806   KMLTKFRMLCATGYCSLGCHGTCTHSKQIDRGLLGNFSSLPTAYVLPSREGLSLGDRVIA  865

Query  3146  YLPRCIDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILR  3325
             YLPRC DT  EVRK+S +IL+  F+IS SLP+P+ +S+ +D+E SY ALSSLEDV+AILR
Sbjct  866   YLPRCADTESEVRKISAEILDQLFSISLSLPRPVTASV-VDVESSYSALSSLEDVIAILR  924

Query  3326  SDASIDPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNR  3505
             SDASIDPSEVFNR+VSSVC LL KDEL++ L GC+ AICDKIKQSAEGAIQAV EFV+ R
Sbjct  925   SDASIDPSEVFNRIVSSVCGLLTKDELLSTLFGCTTAICDKIKQSAEGAIQAVTEFVSKR  984

Query  3506  GNELNEIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDM  3685
             G ELNE +VSRT+QSLL+A  HV EK LR ETL AICS+AENT+SK VF EV+AAAGRD+
Sbjct  985   GAELNENDVSRTTQSLLSAANHVAEKQLRLETLSAICSLAENTSSKAVFNEVVAAAGRDI  1044

Query  3686  VTKDIHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSV  3865
             VTKDI RLRGGWP+QDAF+AFSQH +L++SFLEH+IS+INQSP  K  D  K E S   +
Sbjct  1045  VTKDISRLRGGWPMQDAFYAFSQHTMLAYSFLEHIISIINQSPGSK-DDLFKVEVSSCGL  1103

Query  3866  DGSIEDDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEP  4045
             +G ++++  +AA++ALT+FFRGGGK GRK VEQSY+ VL  L + LG+ H LA  G  EP
Sbjct  1104  EGHLDNEFLQAAIVALTSFFRGGGKVGRKAVEQSYSHVLTELIIQLGSSHVLAGAGQHEP  1163

Query  4046  LRALLNAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICL  4225
             L+ALL AF+AFCECVGDLEMGKILAR GEQNE+EKW+ LIG+LAGSISIKRPKEV +IC+
Sbjct  1164  LQALLAAFRAFCECVGDLEMGKILARDGEQNEDEKWVTLIGDLAGSISIKRPKEVQSICI  1223

Query  4226  FLSKSLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRG  4405
              LS SL+R  + QREAAAAALSEF+RYS GF  +L QMVEA+CRHVSD+SPTVRRLCLRG
Sbjct  1224  ILSSSLNRNHKYQREAAAAALSEFIRYSGGFDSVLEQMVEAMCRHVSDESPTVRRLCLRG  1283

Query  4406  LVQMPSIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSI  4585
             LVQ+PS+H++QYT Q+LGVILALLDD+DESVQLTAVSCLL +L+S+  +AVEP+LLNLS 
Sbjct  1284  LVQIPSVHIVQYTAQVLGVILALLDDTDESVQLTAVSCLLTILDSAQIEAVEPILLNLSK  1343

Query  4586  RLRNLQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQ  4765
             RLRNLQ+ ++ K+RA+A AAFGALS+Y  G   ++F EQ+HA  PR+V HL+DD+ G+RQ
Sbjct  1344  RLRNLQISMDVKMRADAIAAFGALSNYAIGPQREAFVEQVHAVLPRLVFHLYDDNHGIRQ  1403

Query  4766  ACRNTLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSA  4945
             ACR+TLK +APL E +      N   F+SDHRSDYEDF+R+LA+Q TQ+L  RVDTY+++
Sbjct  1404  ACRSTLKQVAPLFETEGFSMPFNVQNFNSDHRSDYEDFVRNLAKQFTQHLSSRVDTYMAS  1463

Query  4946  IIQAFDAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATC  5125
              IQAFDAPWP+IQANA+Y   S+LSLSD+++I  +YY+QVF +LVGK S S+ A+VRATC
Sbjct  1464  TIQAFDAPWPLIQANAIYFACSLLSLSDDQHILTVYYTQVFSLLVGKMSRSSHAVVRATC  1523

Query  5126  SAALGLLLKSPNSSSWRDARLNK  5194
              +ALGLLLKS NS SWR+ RL++
Sbjct  1524  FSALGLLLKSTNSRSWREVRLDR  1546


 Score = 59.3 bits (142),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +1

Query  556  FTPRLKGVLARVVPILGNVREIYRPIFANGL  648
            FTPRLKGVL+RV+PILGNVR+ YRPIFAN  
Sbjct  6    FTPRLKGVLSRVLPILGNVRDPYRPIFANAF  36



>ref|XP_010037122.1| PREDICTED: protein SHOOT GRAVITROPISM 6 isoform X2 [Eucalyptus 
grandis]
Length=1718

 Score =  2099 bits (5439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1067/1523 (70%), Positives = 1278/1523 (84%), Gaps = 22/1523 (1%)
 Frame = +2

Query  647   CW-----QYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGL  811
             CW      Y ++F   +IL+ DV+SFLNSAFELLLRVWA SRDLKVR ++VEALGQMVGL
Sbjct  196   CWCQATRLYVMEFPSHSILEADVMSFLNSAFELLLRVWAASRDLKVRTTSVEALGQMVGL  255

Query  812   ITRTQLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvv  991
             I RTQLK ALP+LVPT+L+LYKR+Q+ A++ATCSL+++L +SL+S +GPPLLDFEDLTV+
Sbjct  256   INRTQLKGALPKLVPTVLDLYKRDQETAYLATCSLYNVLYSSLMSESGPPLLDFEDLTVI  315

Query  992   lstll-lvCSNNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPF  1168
             LSTLL +VC NN+ KE +DF VGLKTYNEVQ CFLTVGSVYPEDLF FL++KCRLKEE  
Sbjct  316   LSTLLPVVCVNNEGKERADFSVGLKTYNEVQRCFLTVGSVYPEDLFGFLMSKCRLKEESL  375

Query  1169  TFGSLCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVG  1348
             TFG++CVLKHL+PRL+E WH+KR  L+E+VK L+DE +L VRKAL+ELIVVMASHCYLVG
Sbjct  376   TFGAICVLKHLVPRLSEVWHSKRLSLVEAVKSLLDEQSLSVRKALSELIVVMASHCYLVG  435

Query  1349  SSGELFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGV  1528
              SGELF+EYLVRHCA+ D E    ESS+E             R+LE K G V   ELR +
Sbjct  436   PSGELFVEYLVRHCALSDYERTAHESSKEIQN----------RRLEVKIGVVNPAELRAI  485

Query  1529  CEKGLLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRS-SESNAMLS  1705
             CEKGLLL+T+T+PEMEH+LWPFLLKMIIPR+YT AVATVCRCISELCR ++ + +  +LS
Sbjct  486   CEKGLLLLTITIPEMEHILWPFLLKMIIPRMYTSAVATVCRCISELCRHQTYNNTETVLS  545

Query  1706  ECKARTDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*I  1885
             +CKAR DIP PEELFARLVVLLH+PL R+ L T IL+VL+YLAPLFP+N+N FWQDE  I
Sbjct  546   DCKARPDIPSPEELFARLVVLLHDPLERKQLATHILAVLYYLAPLFPRNVNLFWQDE--I  603

Query  1886  PKMKAYVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKS  2065
             PKMKAYVSDTEDLK DP YQE+WDDMII+FLAESLDVIQ++DWV+ LGN+F RQYELY S
Sbjct  604   PKMKAYVSDTEDLKLDPSYQETWDDMIINFLAESLDVIQDIDWVISLGNSFTRQYELYTS  663

Query  2066  DNEHSALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLD  2245
             D+EHSALLHRCLG+LLQKV DRAYV  KI  MY+QANI+ PTNRLGLAKAMGLVAASHLD
Sbjct  664   DDEHSALLHRCLGVLLQKVDDRAYVHDKIAWMYKQANISNPTNRLGLAKAMGLVAASHLD  723

Query  2246  TVLDKLKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEAR  2425
             TVL+KLK ILDNV QS +QR  SFFSD  K  ESDD HAALALMYGYAA+YAP TVI+AR
Sbjct  724   TVLEKLKDILDNVCQSFVQRFLSFFSDSFKGMESDDIHAALALMYGYAARYAPSTVIQAR  783

Query  2426  IDALVGTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILT  2605
             IDALVGTNMLSRLLHV+HP AKQAVITAIDLLG+AVI A+ESG  FPLKRRD LLDYILT
Sbjct  784   IDALVGTNMLSRLLHVQHPTAKQAVITAIDLLGRAVINAAESGAPFPLKRRDQLLDYILT  843

Query  2606  LMGRDEEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDP  2785
             LMGRD+ +G++DSN+ELL TQ+LALSACTTLVSVEPKLT ETRN ++KAT+GFF LPNDP
Sbjct  844   LMGRDDNDGWTDSNLELLRTQALALSACTTLVSVEPKLTIETRNYVLKATLGFFALPNDP  903

Query  2786  SDVINPLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAH  2965
              DV+NPLI+NLI LLC IL+TSGEDGRSRAEQLLHILR ID +V+S ++YQRKRGCLAA+
Sbjct  904   IDVVNPLINNLIDLLCAILLTSGEDGRSRAEQLLHILRQIDKYVASPVDYQRKRGCLAAY  963

Query  2966  ELLIKFRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMV  3145
             ++L KFR +C  GYC+LGC G+C+HSKQID     N S+LP+A+ LPSR+ LSLG+R++ 
Sbjct  964   KMLTKFRMLCATGYCSLGCHGTCTHSKQIDRGLLGNFSSLPTAYVLPSREGLSLGDRVIA  1023

Query  3146  YLPRCIDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILR  3325
             YLPRC DT  EVRK+S +IL+  F+IS SLP+P+ +S+ +D+E SY ALSSLEDV+AILR
Sbjct  1024  YLPRCADTESEVRKISAEILDQLFSISLSLPRPVTASV-VDVESSYSALSSLEDVIAILR  1082

Query  3326  SDASIDPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNR  3505
             SDASIDPSEVFNR+VSSVC LL KDEL++ L GC+ AICDKIKQSAEGAIQAV EFV+ R
Sbjct  1083  SDASIDPSEVFNRIVSSVCGLLTKDELLSTLFGCTTAICDKIKQSAEGAIQAVTEFVSKR  1142

Query  3506  GNELNEIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDM  3685
             G ELNE +VSRT+QSLL+A  HV EK LR ETL AICS+AENT+SK VF EV+AAAGRD+
Sbjct  1143  GAELNENDVSRTTQSLLSAANHVAEKQLRLETLSAICSLAENTSSKAVFNEVVAAAGRDI  1202

Query  3686  VTKDIHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSV  3865
             VTKDI RLRGGWP+QDAF+AFSQH +L++SFLEH+IS+INQSP  K  D  K E S   +
Sbjct  1203  VTKDISRLRGGWPMQDAFYAFSQHTMLAYSFLEHIISIINQSPGSK-DDLFKVEVSSCGL  1261

Query  3866  DGSIEDDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEP  4045
             +G ++++  +AA++ALT+FFRGGGK GRK VEQSY+ VL  L + LG+ H LA  G  EP
Sbjct  1262  EGHLDNEFLQAAIVALTSFFRGGGKVGRKAVEQSYSHVLTELIIQLGSSHVLAGAGQHEP  1321

Query  4046  LRALLNAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICL  4225
             L+ALL AF+AFCECVGDLEMGKILAR GEQNE+EKW+ LIG+LAGSISIKRPKEV +IC+
Sbjct  1322  LQALLAAFRAFCECVGDLEMGKILARDGEQNEDEKWVTLIGDLAGSISIKRPKEVQSICI  1381

Query  4226  FLSKSLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRG  4405
              LS SL+R  + QREAAAAALSEF+RYS GF  +L QMVEA+CRHVSD+SPTVRRLCLRG
Sbjct  1382  ILSSSLNRNHKYQREAAAAALSEFIRYSGGFDSVLEQMVEAMCRHVSDESPTVRRLCLRG  1441

Query  4406  LVQMPSIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSI  4585
             LVQ+PS+H++QYT Q+LGVILALLDD+DESVQLTAVSCLL +L+S+  +AVEP+LLNLS 
Sbjct  1442  LVQIPSVHIVQYTAQVLGVILALLDDTDESVQLTAVSCLLTILDSAQIEAVEPILLNLSK  1501

Query  4586  RLRNLQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQ  4765
             RLRNLQ+ ++ K+RA+A AAFGALS+Y  G   ++F EQ+HA  PR+V HL+DD+ G+RQ
Sbjct  1502  RLRNLQISMDVKMRADAIAAFGALSNYAIGPQREAFVEQVHAVLPRLVFHLYDDNHGIRQ  1561

Query  4766  ACRNTLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSA  4945
             ACR+TLK +APL E +      N   F+SDHR DYEDF+R+LA+Q TQ+L  RVDTY+++
Sbjct  1562  ACRSTLKQVAPLFETEGFSMPFNVQNFNSDHR-DYEDFVRNLAKQFTQHLSSRVDTYMAS  1620

Query  4946  IIQAFDAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATC  5125
              IQAFDAPWP+IQANA+Y   S+LSLSD+++I  +YY+QVF +LVGK S S+ A+VRATC
Sbjct  1621  TIQAFDAPWPLIQANAIYFACSLLSLSDDQHILTVYYTQVFSLLVGKMSRSSHAVVRATC  1680

Query  5126  SAALGLLLKSPNSSSWRDARLNK  5194
              +ALGLLLKS NS SWR+ RL++
Sbjct  1681  FSALGLLLKSTNSRSWREVRLDR  1703


 Score =   313 bits (801),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 150/188 (80%), Positives = 171/188 (91%), Gaps = 0/188 (0%)
 Frame = +1

Query  85   GDSIPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGN  264
            G SIPASEAVQV+VSSLADDSP VREASM++LKDI +LNPLLVL+CC TVSRGGRRRF N
Sbjct  7    GVSIPASEAVQVLVSSLADDSPLVREASMASLKDIATLNPLLVLECCYTVSRGGRRRFTN  66

Query  265  IAGLFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSH  444
            +AG FQV+SV ++AL + DVD  FM KLAKIATAE+IS+KELNADWQRAAAG+LVS+GSH
Sbjct  67   MAGAFQVMSVGVQALSERDVDQTFMSKLAKIATAEMISSKELNADWQRAAAGLLVSIGSH  126

Query  445  LPDLMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIY  624
            LPDLMMEE+FLH SG +SALPAM+QILADYAS+DALQFTPRLKGVL+RV+PILGNVR+ Y
Sbjct  127  LPDLMMEEVFLHLSGPSSALPAMIQILADYASADALQFTPRLKGVLSRVLPILGNVRDPY  186

Query  625  RPIFANGL  648
            RPIFAN  
Sbjct  187  RPIFANAF  194



>ref|XP_004494015.1| PREDICTED: maestro heat-like repeat-containing protein family 
member 1-like isoform X1 [Cicer arietinum]
Length=1710

 Score =  2097 bits (5434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1097/1521 (72%), Positives = 1285/1521 (84%), Gaps = 23/1521 (2%)
 Frame = +2

Query  638   QMACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLIT  817
             Q AC QYS+DF     LD DV+SFLNSAFELLLRVWA+SRDLKVR+++VEALGQMVGLIT
Sbjct  196   QAAC-QYSIDFPSHFPLDGDVMSFLNSAFELLLRVWAVSRDLKVRVASVEALGQMVGLIT  254

Query  818   RTQLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvls  997
             RTQLKAALPRLVPTIL+LYK++ D AF+ATCSLH+LLNASLLS +GPP+LDFEDLT++L+
Sbjct  255   RTQLKAALPRLVPTILDLYKKDLDIAFLATCSLHNLLNASLLSESGPPMLDFEDLTLILA  314

Query  998   tlllvCS-NNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTF  1174
             TL+ V S NN+ K+ +DF VGLK YNEVQHCFLTVG VYP+DLF+FL+NKCRLKEE  TF
Sbjct  315   TLIHVVSMNNESKDQTDFSVGLKMYNEVQHCFLTVGLVYPDDLFLFLVNKCRLKEEASTF  374

Query  1175  GSLCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSS  1354
             G+LCVLKHLLPRL+E WH+K P+L+E+VK L++EHNLGVRKAL+ELIVVMASHCYLVGS 
Sbjct  375   GALCVLKHLLPRLSEGWHSKIPLLVEAVKSLLEEHNLGVRKALSELIVVMASHCYLVGSP  434

Query  1355  GELFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCE  1534
             GELFIEYL+R+CA+ D    +L+S+               ++ E K G V+  ELR VCE
Sbjct  435   GELFIEYLIRNCALTDQNQSDLDSTPN-------------KRKEMKIGTVSPGELRAVCE  481

Query  1535  KGLLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECK  1714
             KGLLL+T+T+PEMEH+LWPFLLKMIIPR YTGAVA VCRCISEL R RS  S+ MLSECK
Sbjct  482   KGLLLVTITIPEMEHILWPFLLKMIIPRTYTGAVAMVCRCISELWRHRSYGSD-MLSECK  540

Query  1715  ARTDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKM  1894
              R DIP  EEL AR VVLLH+PLARE L TQIL+VL  LAPLFPKNIN FWQDE  IPKM
Sbjct  541   TRLDIPTAEELLARFVVLLHDPLAREKLATQILTVLCLLAPLFPKNINLFWQDE--IPKM  598

Query  1895  KAYVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNE  2074
             KAYVSDT+DLKQDP YQ++WDDMI++FLAESLDVIQ+ DW++ LGN FA+ YELY SD+E
Sbjct  599   KAYVSDTDDLKQDPSYQDTWDDMIVNFLAESLDVIQDADWIMSLGNVFAKHYELYTSDDE  658

Query  2075  HSALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVL  2254
             H+ALLHRCLGILLQKV+DR YV  K+D MY+Q+NIA+PTNRLGLAKAMGLVAASHLDTVL
Sbjct  659   HAALLHRCLGILLQKVNDRVYVHDKMDWMYKQSNIAIPTNRLGLAKAMGLVAASHLDTVL  718

Query  2255  DKLKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDA  2434
             +KLK I+DNVG++I+QRI S FSD  + EESDD HAALALMYGYAAKYAP +VIEARI+A
Sbjct  719   EKLKDIIDNVGRTIIQRILSLFSDSFRTEESDDIHAALALMYGYAAKYAPSSVIEARINA  778

Query  2435  LVGTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMG  2614
             LVGTNMLSRLLHVRHP AKQAVITAIDLLG AVI A+ESG  FPLKRRD LLDYILTLMG
Sbjct  779   LVGTNMLSRLLHVRHPIAKQAVITAIDLLGNAVINAAESGAPFPLKRRDQLLDYILTLMG  838

Query  2615  RDEEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDV  2794
             RD+ +GF+D N ELL TQ+LA+SACTTLVSVEPKLT ETRN +MKAT+GFF + NDP +V
Sbjct  839   RDDNDGFADLN-ELLRTQALAISACTTLVSVEPKLTVETRNYVMKATLGFFAIQNDPVEV  897

Query  2795  INPLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELL  2974
             +NPLIDNL++LLC IL+T GEDGRSRAE L+  +R ID FVSS +EYQRKRGCLA HE+L
Sbjct  898   VNPLIDNLVSLLCAILLTGGEDGRSRAELLMLTVRQIDQFVSSPVEYQRKRGCLAVHEML  957

Query  2975  IKFRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLP  3154
             +KF+ +CV+GYCALGC G+CSH+KQID A   N S LPSAF LPSR+AL LG+R+ +YLP
Sbjct  958   LKFQMVCVSGYCALGCHGNCSHTKQIDRALYGNFSKLPSAFVLPSREALCLGDRVTMYLP  1017

Query  3155  RCIDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGI-DIELSYIALSSLEDVVAILRSD  3331
             RC DTN EVRK+S QIL+L F+IS SLPKP   S+   DIELSY ALSSLEDV+A+LR+D
Sbjct  1018  RCADTNSEVRKISAQILDLLFSISLSLPKPPGLSISAEDIELSYSALSSLEDVIAMLRND  1077

Query  3332  ASIDPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGN  3511
              SIDPSEVFNR++SS+C LL KDELVA LHGCS AICDKIKQSAEGAIQAVVEFVT RG+
Sbjct  1078  TSIDPSEVFNRIISSLCILLTKDELVAMLHGCSVAICDKIKQSAEGAIQAVVEFVTRRGS  1137

Query  3512  ELNEIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMVT  3691
             EL EI++SRT+QSL++A VH T+K+LR ETLGAI S+AENT++K VF EVLAAAGRD++T
Sbjct  1138  ELTEIDISRTTQSLISATVHATDKHLRVETLGAIASLAENTSAKTVFDEVLAAAGRDIIT  1197

Query  3692  KDIHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSVDG  3871
             KDI RLRGGWP+QDAF+AFSQHLVLS  FLEHVISV++Q P  K  D  + E S+  V  
Sbjct  1198  KDISRLRGGWPMQDAFYAFSQHLVLSVLFLEHVISVLSQIPIPKC-DVDRVEDSQ--VHT  1254

Query  3872  SIEDDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPLR  4051
               ED    AA+ ALTAFFRGGGK G++ VEQ+YASVL+ L L LG+CHGL   G  +PLR
Sbjct  1255  HTEDGNLEAAIFALTAFFRGGGKVGKRAVEQNYASVLSELMLQLGSCHGLTYSGHLDPLR  1314

Query  4052  ALLNAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICLFL  4231
              LL AFQAFCECVGDLEMGKILAR GE +ENE+WINLIG++AG ISIKRPKE+  IC FL
Sbjct  1315  NLLTAFQAFCECVGDLEMGKILARDGELSENERWINLIGDIAGCISIKRPKEIQNICQFL  1374

Query  4232  SKSLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLV  4411
              +SLDRP + QREAAAAALSEF+RYS G G LL QMVE LCR VSD+S TVRR CLRGLV
Sbjct  1375  KRSLDRPQKYQREAAAAALSEFVRYSGGLGSLLEQMVEVLCRRVSDESSTVRRFCLRGLV  1434

Query  4412  QMPSIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSIRL  4591
             Q+PSIH+L++TTQ+LGVILALLDDSDESVQLTAVSCLL++LESS  DAVEP+LLNL+IRL
Sbjct  1435  QIPSIHILKFTTQVLGVILALLDDSDESVQLTAVSCLLMILESSPDDAVEPILLNLAIRL  1494

Query  4592  RNLQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQAC  4771
             RNLQ  +NAK+RA++FA FGALS+YG G++ + F EQ+HAA PR+VLHLHD+D+ VR AC
Sbjct  1495  RNLQTSMNAKMRASSFAVFGALSNYGIGTLREPFVEQVHAAVPRLVLHLHDEDVSVRLAC  1554

Query  4772  RNTLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSAII  4951
             RNTL+ + PL+EID + ALLNT  F SDHRSDYEDFLRD+A+Q TQ+L  RVDTY+++ +
Sbjct  1555  RNTLRRVFPLMEIDGLLALLNTPSFLSDHRSDYEDFLRDIAKQFTQHLLSRVDTYMASTV  1614

Query  4952  QAFDAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATCSA  5131
             QAFDAPWP+IQANA+YLCSS+LSLSDN++I A Y++QVFG+LVGK S S DA+VRA CSA
Sbjct  1615  QAFDAPWPIIQANAMYLCSSLLSLSDNQHILADYHTQVFGMLVGKMSRSPDAVVRAACSA  1674

Query  5132  ALGLLLKSPNSSSWRDARLNK  5194
             ALGLLLKS NS SWR   L++
Sbjct  1675  ALGLLLKSSNSCSWRAVHLDR  1695


 Score =   264 bits (675),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 131/186 (70%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = +1

Query  91   SIPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGNIA  270
            SIPA EA+QV++S LADDS SVR++SMS+LKD+ SLNP+LVL+CC +VSRGGRRRFGN+A
Sbjct  6    SIPAPEAIQVLLSLLADDSSSVRKSSMSSLKDLASLNPVLVLECCASVSRGGRRRFGNMA  65

Query  271  GLFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLP  450
            G+FQV++  +RALD+ DVD AFM KLAKIAT+E++S+KELN+DWQRAA  +LV++GSHLP
Sbjct  66   GVFQVMAFGVRALDERDVDSAFMTKLAKIATSEMVSSKELNSDWQRAAISLLVAIGSHLP  125

Query  451  DLMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIYRP  630
            DL+MEEIFLH SG+NSAL AMVQILA++ASS  L F PR KGVL+R++PILGNVR+I+RP
Sbjct  126  DLVMEEIFLHLSGTNSALQAMVQILAEFASSSPLLFIPRWKGVLSRILPILGNVRDIHRP  185

Query  631  IFANGL  648
             FAN  
Sbjct  186  TFANAF  191



>ref|XP_004494089.1| PREDICTED: maestro heat-like repeat-containing protein family 
member 1-like isoform X1 [Cicer arietinum]
Length=1703

 Score =  2097 bits (5432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1094/1519 (72%), Positives = 1279/1519 (84%), Gaps = 22/1519 (1%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             A WQYS+DF     LD DV+SFLNSAFELLLRVWA SRDLKV +++VEALGQMVGLITRT
Sbjct  197   AAWQYSIDFPSHFPLDGDVMSFLNSAFELLLRVWAASRDLKVHVASVEALGQMVGLITRT  256

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstl  1003
             QLKAALPRLVPTIL+LYK++ D AF+ATCSLH+LLNASLLS +GPP+LDFEDLT++L TL
Sbjct  257   QLKAALPRLVPTILDLYKKDLDIAFLATCSLHNLLNASLLSESGPPMLDFEDLTLILVTL  316

Query  1004  llvCS-NNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGS  1180
             L V S NN+ K+ +DF VGLK YNEVQHCFLTVG VYP+DLF+FL+NKC+LKEE  TFG+
Sbjct  317   LPVVSMNNESKDQTDFSVGLKMYNEVQHCFLTVGLVYPDDLFLFLVNKCKLKEEASTFGA  376

Query  1181  LCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGE  1360
             LCVLKHLLPRL+E WH+K P+L+E+VK L++EHNLGVRKAL+ELIVVMASHCYLVGS GE
Sbjct  377   LCVLKHLLPRLSEGWHSKIPLLVEAVKSLLEEHNLGVRKALSELIVVMASHCYLVGSPGE  436

Query  1361  LFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKG  1540
             LFIEYL+R+CA+ D    +L+S+               ++ E K G V+  ELR VCEKG
Sbjct  437   LFIEYLIRNCALTDQNQSDLDSTPN-------------KRKEMKIGTVSPGELRAVCEKG  483

Query  1541  LLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKAR  1720
             LLL+T+T+PEMEH+LWPFLLK IIPR YTGAVA VCRCISEL R RS  S+ MLSECK R
Sbjct  484   LLLVTITIPEMEHILWPFLLKTIIPRTYTGAVAMVCRCISELWRHRSYGSD-MLSECKTR  542

Query  1721  TDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKA  1900
              DIP  EEL AR VVLLH+PLARE L TQIL+VL  LAPLFPKNIN FWQDE  IPKMKA
Sbjct  543   LDIPTAEELLARFVVLLHDPLAREKLATQILTVLCLLAPLFPKNINLFWQDE--IPKMKA  600

Query  1901  YVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHS  2080
             YVSDT+DLKQDP YQ++WDDMI++FLAESLDVIQ+ DW++ LGN FA+ YELY SD+EH+
Sbjct  601   YVSDTDDLKQDPSYQDTWDDMIVNFLAESLDVIQDADWIMSLGNVFAKHYELYTSDDEHA  660

Query  2081  ALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDK  2260
             ALLHRCLGILLQKV+DR YV  K+D MY+Q+NIA+PTNRLGLAKAMGLVAASHLDTVL+K
Sbjct  661   ALLHRCLGILLQKVNDRVYVHDKMDWMYKQSNIAIPTNRLGLAKAMGLVAASHLDTVLEK  720

Query  2261  LKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALV  2440
             LK I+DNVG++I+QRI S FSD  + EESDD HAALALMYGYAAKYAP +VIEARI+ALV
Sbjct  721   LKDIIDNVGRTIIQRILSLFSDSFRTEESDDIHAALALMYGYAAKYAPSSVIEARINALV  780

Query  2441  GTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRD  2620
             GTNMLSRLLHVRHP AKQAVITAIDLLG AVI A+ESG  FPLKRRD LLDYILTLMGRD
Sbjct  781   GTNMLSRLLHVRHPIAKQAVITAIDLLGNAVINAAESGAPFPLKRRDQLLDYILTLMGRD  840

Query  2621  EEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVIN  2800
             + +GF+D N ELL TQ+LA+SACTTLVSVEPKLT ETRN +MKAT+GFF + NDP +V+N
Sbjct  841   DNDGFADLN-ELLRTQALAISACTTLVSVEPKLTVETRNYVMKATLGFFAIQNDPVEVVN  899

Query  2801  PLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIK  2980
             PLIDNL++LLC IL+T GEDGRSRAE L+  +R ID FVSS +EYQRKRGCLA HE+L+K
Sbjct  900   PLIDNLVSLLCAILLTGGEDGRSRAELLMLTVRQIDQFVSSPVEYQRKRGCLAVHEMLLK  959

Query  2981  FRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPRC  3160
             F+ +CV+GYCALGC G+CSH+KQID A   N S LPSAF LPSR+AL LG+R+ +YLPRC
Sbjct  960   FQMVCVSGYCALGCHGNCSHTKQIDRALYGNFSKLPSAFVLPSREALCLGDRVTMYLPRC  1019

Query  3161  IDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGI-DIELSYIALSSLEDVVAILRSDAS  3337
              DTN EVRK+S QIL+L F+IS SLPKP   S+   DIELSY ALSSLEDV+A+LR+D S
Sbjct  1020  ADTNSEVRKISAQILDLLFSISLSLPKPPGLSISAEDIELSYSALSSLEDVIAMLRNDTS  1079

Query  3338  IDPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNEL  3517
             IDPSEVFNR++SS+C LL KDELVA LHGCS AICDKIKQSAEGAIQAVVEFVT RG+EL
Sbjct  1080  IDPSEVFNRIISSLCILLTKDELVAMLHGCSVAICDKIKQSAEGAIQAVVEFVTRRGSEL  1139

Query  3518  NEIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMVTKD  3697
              EI++SRT+QSL++A VH T+K+LR ETLGAI S+AENT++K VF EVLA AGRD++TKD
Sbjct  1140  TEIDISRTTQSLISATVHATDKHLRVETLGAIASLAENTSAKTVFDEVLATAGRDIITKD  1199

Query  3698  IHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSVDGSI  3877
             I RLRGGWP+QDAF+AFSQHLVLS  FLEHVISV++Q P LK  D  + E S+  V    
Sbjct  1200  ISRLRGGWPMQDAFYAFSQHLVLSELFLEHVISVLSQIPILKC-DVDRVEDSQ--VHTHT  1256

Query  3878  EDDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPLRAL  4057
             ED    AA+ ALTAFFRGGGK G++ VEQ+YASVL+ L L LG+CHGL   G  EPLR L
Sbjct  1257  EDGNLEAAIFALTAFFRGGGKVGKRAVEQNYASVLSELMLQLGSCHGLTYSGHLEPLRNL  1316

Query  4058  LNAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICLFLSK  4237
             L AFQAFCECVGDLEMGKILAR GE +ENE+WINLIG++AG ISIKRPKE+  IC FL +
Sbjct  1317  LTAFQAFCECVGDLEMGKILARDGELSENERWINLIGDIAGCISIKRPKEIQNICQFLKR  1376

Query  4238  SLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQM  4417
             SLDRP + QREAAAAALSEF+RYS G G LL QMVE LCR VSD+S TV+R CLRGLVQ+
Sbjct  1377  SLDRPQKYQREAAAAALSEFVRYSGGLGSLLEQMVEVLCRRVSDESSTVQRFCLRGLVQI  1436

Query  4418  PSIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSIRLRN  4597
             PSIH+L++TTQ+LGVILALLDDSDESVQLTAVSCLL++LESS  DAVEP+LLNL+IRLRN
Sbjct  1437  PSIHILKFTTQVLGVILALLDDSDESVQLTAVSCLLMILESSPDDAVEPILLNLAIRLRN  1496

Query  4598  LQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACRN  4777
             LQ  +NAK+RA++FA FGALS+YG G++ + F EQ+HAA PR+VLHLHD+D+ VR ACRN
Sbjct  1497  LQTSMNAKMRASSFAVFGALSNYGTGTLREPFVEQVHAAVPRLVLHLHDEDVSVRLACRN  1556

Query  4778  TLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSAIIQA  4957
             TL+ + PL+EID + ALLNT  F SDHRSDYEDFLRD+A+Q TQ+L  RVDTY+++ +QA
Sbjct  1557  TLRRVFPLMEIDGLLALLNTPSFLSDHRSDYEDFLRDIAKQFTQHLLSRVDTYMASTVQA  1616

Query  4958  FDAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATCSAAL  5137
             FDAPWP+IQANA+YLCSS+LSLSDN +I A Y++QVFG+LVGK S S DA+VRA CSAAL
Sbjct  1617  FDAPWPIIQANAMYLCSSLLSLSDNHHILADYHTQVFGMLVGKMSRSPDAVVRAACSAAL  1676

Query  5138  GLLLKSPNSSSWRDARLNK  5194
             GLLLKS NS SWR   L++
Sbjct  1677  GLLLKSSNSCSWRAVHLDR  1695


 Score =   263 bits (672),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 131/186 (70%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = +1

Query  91   SIPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGNIA  270
            SIPA EA+QV++S LADDS SVR++SMS+LKD+ SLNP+LVL+CC +VSRGGRRRFGN+A
Sbjct  6    SIPAPEAIQVLLSLLADDSSSVRKSSMSSLKDLASLNPVLVLECCASVSRGGRRRFGNMA  65

Query  271  GLFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLP  450
            G+FQV++  +RALD+ DVD AFM KLAKIAT+E+ S+KELN+DWQRAA  +LV++GSHLP
Sbjct  66   GVFQVMAFGVRALDERDVDSAFMTKLAKIATSEMTSSKELNSDWQRAAISLLVAIGSHLP  125

Query  451  DLMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIYRP  630
            DL+MEEIFLH SG+NSAL AMVQILA++ASS  L F PR KGVL+R++PILGNVR+I+RP
Sbjct  126  DLVMEEIFLHLSGTNSALQAMVQILAEFASSSPLLFIPRWKGVLSRILPILGNVRDIHRP  185

Query  631  IFANGL  648
             FAN  
Sbjct  186  TFANAF  191



>ref|XP_004494090.1| PREDICTED: maestro heat-like repeat-containing protein family 
member 1-like isoform X2 [Cicer arietinum]
Length=1575

 Score =  2095 bits (5428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1094/1519 (72%), Positives = 1279/1519 (84%), Gaps = 22/1519 (1%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             A WQYS+DF     LD DV+SFLNSAFELLLRVWA SRDLKV +++VEALGQMVGLITRT
Sbjct  69    AAWQYSIDFPSHFPLDGDVMSFLNSAFELLLRVWAASRDLKVHVASVEALGQMVGLITRT  128

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstl  1003
             QLKAALPRLVPTIL+LYK++ D AF+ATCSLH+LLNASLLS +GPP+LDFEDLT++L TL
Sbjct  129   QLKAALPRLVPTILDLYKKDLDIAFLATCSLHNLLNASLLSESGPPMLDFEDLTLILVTL  188

Query  1004  llvCS-NNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGS  1180
             L V S NN+ K+ +DF VGLK YNEVQHCFLTVG VYP+DLF+FL+NKC+LKEE  TFG+
Sbjct  189   LPVVSMNNESKDQTDFSVGLKMYNEVQHCFLTVGLVYPDDLFLFLVNKCKLKEEASTFGA  248

Query  1181  LCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGE  1360
             LCVLKHLLPRL+E WH+K P+L+E+VK L++EHNLGVRKAL+ELIVVMASHCYLVGS GE
Sbjct  249   LCVLKHLLPRLSEGWHSKIPLLVEAVKSLLEEHNLGVRKALSELIVVMASHCYLVGSPGE  308

Query  1361  LFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKG  1540
             LFIEYL+R+CA+ D    +L+S+               ++ E K G V+  ELR VCEKG
Sbjct  309   LFIEYLIRNCALTDQNQSDLDSTPN-------------KRKEMKIGTVSPGELRAVCEKG  355

Query  1541  LLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKAR  1720
             LLL+T+T+PEMEH+LWPFLLK IIPR YTGAVA VCRCISEL R RS  S+ MLSECK R
Sbjct  356   LLLVTITIPEMEHILWPFLLKTIIPRTYTGAVAMVCRCISELWRHRSYGSD-MLSECKTR  414

Query  1721  TDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKA  1900
              DIP  EEL AR VVLLH+PLARE L TQIL+VL  LAPLFPKNIN FWQDE  IPKMKA
Sbjct  415   LDIPTAEELLARFVVLLHDPLAREKLATQILTVLCLLAPLFPKNINLFWQDE--IPKMKA  472

Query  1901  YVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHS  2080
             YVSDT+DLKQDP YQ++WDDMI++FLAESLDVIQ+ DW++ LGN FA+ YELY SD+EH+
Sbjct  473   YVSDTDDLKQDPSYQDTWDDMIVNFLAESLDVIQDADWIMSLGNVFAKHYELYTSDDEHA  532

Query  2081  ALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDK  2260
             ALLHRCLGILLQKV+DR YV  K+D MY+Q+NIA+PTNRLGLAKAMGLVAASHLDTVL+K
Sbjct  533   ALLHRCLGILLQKVNDRVYVHDKMDWMYKQSNIAIPTNRLGLAKAMGLVAASHLDTVLEK  592

Query  2261  LKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALV  2440
             LK I+DNVG++I+QRI S FSD  + EESDD HAALALMYGYAAKYAP +VIEARI+ALV
Sbjct  593   LKDIIDNVGRTIIQRILSLFSDSFRTEESDDIHAALALMYGYAAKYAPSSVIEARINALV  652

Query  2441  GTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRD  2620
             GTNMLSRLLHVRHP AKQAVITAIDLLG AVI A+ESG  FPLKRRD LLDYILTLMGRD
Sbjct  653   GTNMLSRLLHVRHPIAKQAVITAIDLLGNAVINAAESGAPFPLKRRDQLLDYILTLMGRD  712

Query  2621  EEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVIN  2800
             + +GF+D N ELL TQ+LA+SACTTLVSVEPKLT ETRN +MKAT+GFF + NDP +V+N
Sbjct  713   DNDGFADLN-ELLRTQALAISACTTLVSVEPKLTVETRNYVMKATLGFFAIQNDPVEVVN  771

Query  2801  PLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIK  2980
             PLIDNL++LLC IL+T GEDGRSRAE L+  +R ID FVSS +EYQRKRGCLA HE+L+K
Sbjct  772   PLIDNLVSLLCAILLTGGEDGRSRAELLMLTVRQIDQFVSSPVEYQRKRGCLAVHEMLLK  831

Query  2981  FRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPRC  3160
             F+ +CV+GYCALGC G+CSH+KQID A   N S LPSAF LPSR+AL LG+R+ +YLPRC
Sbjct  832   FQMVCVSGYCALGCHGNCSHTKQIDRALYGNFSKLPSAFVLPSREALCLGDRVTMYLPRC  891

Query  3161  IDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGI-DIELSYIALSSLEDVVAILRSDAS  3337
              DTN EVRK+S QIL+L F+IS SLPKP   S+   DIELSY ALSSLEDV+A+LR+D S
Sbjct  892   ADTNSEVRKISAQILDLLFSISLSLPKPPGLSISAEDIELSYSALSSLEDVIAMLRNDTS  951

Query  3338  IDPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNEL  3517
             IDPSEVFNR++SS+C LL KDELVA LHGCS AICDKIKQSAEGAIQAVVEFVT RG+EL
Sbjct  952   IDPSEVFNRIISSLCILLTKDELVAMLHGCSVAICDKIKQSAEGAIQAVVEFVTRRGSEL  1011

Query  3518  NEIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMVTKD  3697
              EI++SRT+QSL++A VH T+K+LR ETLGAI S+AENT++K VF EVLA AGRD++TKD
Sbjct  1012  TEIDISRTTQSLISATVHATDKHLRVETLGAIASLAENTSAKTVFDEVLATAGRDIITKD  1071

Query  3698  IHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSVDGSI  3877
             I RLRGGWP+QDAF+AFSQHLVLS  FLEHVISV++Q P LK  D  + E S+  V    
Sbjct  1072  ISRLRGGWPMQDAFYAFSQHLVLSELFLEHVISVLSQIPILKC-DVDRVEDSQ--VHTHT  1128

Query  3878  EDDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPLRAL  4057
             ED    AA+ ALTAFFRGGGK G++ VEQ+YASVL+ L L LG+CHGL   G  EPLR L
Sbjct  1129  EDGNLEAAIFALTAFFRGGGKVGKRAVEQNYASVLSELMLQLGSCHGLTYSGHLEPLRNL  1188

Query  4058  LNAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICLFLSK  4237
             L AFQAFCECVGDLEMGKILAR GE +ENE+WINLIG++AG ISIKRPKE+  IC FL +
Sbjct  1189  LTAFQAFCECVGDLEMGKILARDGELSENERWINLIGDIAGCISIKRPKEIQNICQFLKR  1248

Query  4238  SLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQM  4417
             SLDRP + QREAAAAALSEF+RYS G G LL QMVE LCR VSD+S TV+R CLRGLVQ+
Sbjct  1249  SLDRPQKYQREAAAAALSEFVRYSGGLGSLLEQMVEVLCRRVSDESSTVQRFCLRGLVQI  1308

Query  4418  PSIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSIRLRN  4597
             PSIH+L++TTQ+LGVILALLDDSDESVQLTAVSCLL++LESS  DAVEP+LLNL+IRLRN
Sbjct  1309  PSIHILKFTTQVLGVILALLDDSDESVQLTAVSCLLMILESSPDDAVEPILLNLAIRLRN  1368

Query  4598  LQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACRN  4777
             LQ  +NAK+RA++FA FGALS+YG G++ + F EQ+HAA PR+VLHLHD+D+ VR ACRN
Sbjct  1369  LQTSMNAKMRASSFAVFGALSNYGTGTLREPFVEQVHAAVPRLVLHLHDEDVSVRLACRN  1428

Query  4778  TLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSAIIQA  4957
             TL+ + PL+EID + ALLNT  F SDHRSDYEDFLRD+A+Q TQ+L  RVDTY+++ +QA
Sbjct  1429  TLRRVFPLMEIDGLLALLNTPSFLSDHRSDYEDFLRDIAKQFTQHLLSRVDTYMASTVQA  1488

Query  4958  FDAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATCSAAL  5137
             FDAPWP+IQANA+YLCSS+LSLSDN +I A Y++QVFG+LVGK S S DA+VRA CSAAL
Sbjct  1489  FDAPWPIIQANAMYLCSSLLSLSDNHHILADYHTQVFGMLVGKMSRSPDAVVRAACSAAL  1548

Query  5138  GLLLKSPNSSSWRDARLNK  5194
             GLLLKS NS SWR   L++
Sbjct  1549  GLLLKSSNSCSWRAVHLDR  1567


 Score = 99.0 bits (245),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  460  MEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIYRPIFA  639
            MEEIFLH SG+NSAL AMVQILA++ASS  L F PR KGVL+R++PILGNVR+I+RP FA
Sbjct  1    MEEIFLHLSGTNSALQAMVQILAEFASSSPLLFIPRWKGVLSRILPILGNVRDIHRPTFA  60

Query  640  NGL  648
            N  
Sbjct  61   NAF  63



>ref|XP_006477759.1| PREDICTED: maestro heat-like repeat-containing protein family 
member 1-like isoform X3 [Citrus sinensis]
Length=1685

 Score =  2095 bits (5427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1084/1518 (71%), Positives = 1256/1518 (83%), Gaps = 50/1518 (3%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             A WQYSVDF   + LD D++SFLNSAFELLLRVWA SRDLKVR+S V+ALGQMVGLITR+
Sbjct  202   AAWQYSVDFPSHSFLDGDIMSFLNSAFELLLRVWATSRDLKVRVSTVDALGQMVGLITRS  261

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstl  1003
             QLK ALP+LVP+ILELYK++QD A VATCSLH+LLNASLLS  GPPLLD EDLTV+LSTL
Sbjct  262   QLKGALPKLVPSILELYKKDQDTALVATCSLHNLLNASLLSETGPPLLDVEDLTVILSTL  321

Query  1004  l-lvCSNNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGS  1180
             L +VC  ND KEHS F VGLKTYNEVQ CFLTVG VYP+DLF+FLLNKCRLKEE  + G+
Sbjct  322   LPVVCIYNDSKEHSSFSVGLKTYNEVQRCFLTVGLVYPDDLFMFLLNKCRLKEEHLSVGA  381

Query  1181  LCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGE  1360
             L VLKHLLPR +E+WH+KRP+L+E+VK L+DE NL V+KA++ELIVVMASHCYL+G SGE
Sbjct  382   LYVLKHLLPRSSEAWHSKRPLLLEAVKSLLDEQNLAVQKAISELIVVMASHCYLIGPSGE  441

Query  1361  LFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKG  1540
             LF+EYLVRHCA+ D +    ESS+                   K GA   TELR +CEKG
Sbjct  442   LFVEYLVRHCALSDQKKYVNESSK------------------VKIGAFCPTELRAICEKG  483

Query  1541  LLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKAR  1720
             LLL+T+T+PEM+H+LWP LLKMIIPR YT A ATVCRCISELCR RSS SN MLSECKAR
Sbjct  484   LLLLTITIPEMQHILWPLLLKMIIPRAYTSAAATVCRCISELCRHRSSSSNVMLSECKAR  543

Query  1721  TDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKA  1900
              DIP PEELFARLVVLLH+PLARE   TQIL VL+YL+PLFPKNI+ FWQDE  IPKMKA
Sbjct  544   DDIPNPEELFARLVVLLHDPLAREQQATQILMVLYYLSPLFPKNIDLFWQDE--IPKMKA  601

Query  1901  YVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHS  2080
             YVSDTEDLK DP YQE+WDDMII+FLAESLDV+Q  DW++ LGN F  QY LY  D++HS
Sbjct  602   YVSDTEDLKLDPSYQETWDDMIINFLAESLDVVQETDWLISLGNAFTEQYVLYTPDDDHS  661

Query  2081  ALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDK  2260
             ALLHRCLGILLQKV DR YV  KID MY+QANIA+PTNRLGLAKAMGLVAASHLD VL+ 
Sbjct  662   ALLHRCLGILLQKVADRNYVCDKIDWMYKQANIAIPTNRLGLAKAMGLVAASHLDAVLEM  721

Query  2261  LKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALV  2440
             LKGILDN+GQS+ QR+ SFFS+  +MEESDD HAALALMYGYAAKYAP TVIEARIDALV
Sbjct  722   LKGILDNIGQSLFQRLLSFFSNSYRMEESDDIHAALALMYGYAAKYAPSTVIEARIDALV  781

Query  2441  GTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRD  2620
             GTNMLSRLLHVRH  AKQAVITAIDLLG+AVI A+E+G SFPLK+RD LLDYILTLMGR+
Sbjct  782   GTNMLSRLLHVRHHTAKQAVITAIDLLGRAVINAAENGASFPLKKRDQLLDYILTLMGRE  841

Query  2621  EEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVIN  2800
             E + F+DS+IELLHTQ+LALSACTTLV+VEPKLT ETRN +MKAT+GFF LPNDP DV+N
Sbjct  842   ENDSFADSSIELLHTQALALSACTTLVTVEPKLTIETRNHVMKATLGFFALPNDPIDVVN  901

Query  2801  PLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIK  2980
             PLIDNLITLLC IL+TSGEDGRSRA+QLLHILR ID +VSS +EYQR+R CLA +E+L+K
Sbjct  902   PLIDNLITLLCAILLTSGEDGRSRADQLLHILRQIDQYVSSPIEYQRRRSCLAVYEMLLK  961

Query  2981  FRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPRC  3160
             FR +CV GYCALGC GSC+H KQID A   N SNLPSA+ LPSR+AL LG R+++YLPRC
Sbjct  962   FRTLCVIGYCALGCHGSCTHIKQIDRAVLGNFSNLPSAYVLPSREALCLGNRVIMYLPRC  1021

Query  3161  IDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILRSDASI  3340
              DT+ EVRK+S QIL+  F+IS SLP+P+ SS GID+ELSY ALSSLEDV+AILRSDASI
Sbjct  1022  ADTDSEVRKISAQILDQLFSISLSLPRPVGSSSGIDLELSYGALSSLEDVIAILRSDASI  1081

Query  3341  DPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNELN  3520
             DPSEVFNR+VSSVC LL KDELVA LH C+ AICD+ KQSAEGAIQAV+EFVT RGNEL+
Sbjct  1082  DPSEVFNRIVSSVCILLTKDELVATLHSCTTAICDRTKQSAEGAIQAVIEFVTKRGNELS  1141

Query  3521  EIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMVTKDI  3700
             E +VSRT+QSLL+A VH+T+K+LR ETLGAI  +AENT SK+VF EVLA AG+D+VTKDI
Sbjct  1142  ETDVSRTTQSLLSAAVHITDKHLRLETLGAISCLAENTNSKIVFNEVLATAGKDIVTKDI  1201

Query  3701  HRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSVDGSIE  3880
              RLRGGWP+QDAFH                            GD  KG+ S +S D  I+
Sbjct  1202  SRLRGGWPMQDAFH----------------------------GDMEKGDYSSHSADTWID  1233

Query  3881  DDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPLRALL  4060
             DD+ +AA+LALTAFFRGGGK G+K VE+SYA VLA LTL LG+CHGLAS G  EPLRA+L
Sbjct  1234  DDILQAAILALTAFFRGGGKVGKKAVEKSYAPVLAALTLQLGSCHGLASSGQHEPLRAIL  1293

Query  4061  NAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICLFLSKS  4240
              +FQAFCECVGDLEM KILAR GEQN+ EKWINLIG++AG +SIKRPKEV TICL L+KS
Sbjct  1294  TSFQAFCECVGDLEMRKILARDGEQNDKEKWINLIGDVAGCVSIKRPKEVQTICLILTKS  1353

Query  4241  LDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQMP  4420
             ++R  R QREAAAAALSEF+RYS GF  LL QMVEALCRHVSD+SPTVR LCLRGLVQ+P
Sbjct  1354  INRQQRFQREAAAAALSEFVRYSGGFDSLLEQMVEALCRHVSDESPTVRGLCLRGLVQIP  1413

Query  4421  SIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSIRLRNL  4600
             SIH+ QY TQ+L VILALLDD DESVQLTAVSCLL +L+SSS DAVEP+LLNLS+RLRNL
Sbjct  1414  SIHIHQYATQVLSVILALLDDLDESVQLTAVSCLLTILKSSSKDAVEPILLNLSVRLRNL  1473

Query  4601  QVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACRNT  4780
             QV +N K+R NAFAAFGALS++G GS  ++F EQIHA  PR++LH++DDDL VRQACRNT
Sbjct  1474  QVSMNVKMRRNAFAAFGALSNFGVGSQREAFLEQIHAMLPRLILHIYDDDLSVRQACRNT  1533

Query  4781  LKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSAIIQAF  4960
             LK +AP +EI  +  + N+H F+SDHRSDYE F+RDL RQ  Q+   R+D+Y+ + IQAF
Sbjct  1534  LKQVAPFMEI-GVYGIFNSHCFNSDHRSDYETFVRDLTRQFVQHFPSRIDSYMGSTIQAF  1592

Query  4961  DAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATCSAALG  5140
             +APWP+IQANA+Y  SS+L L D+++I +L+Y+QVFG+LV K S S DAIVRATCS++LG
Sbjct  1593  EAPWPIIQANAIYFSSSILCLCDDQHILSLFYTQVFGLLVVKLSQSADAIVRATCSSSLG  1652

Query  5141  LLLKSPNSSSWRDARLNK  5194
              LLKS NS SWR  RL +
Sbjct  1653  WLLKSINSHSWRSTRLER  1670


 Score =   312 bits (800),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 145/188 (77%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = +1

Query  85   GDSIPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGN  264
            G SIPA EAVQ +VSSLAD+SP VREASM++LKDI +LNPLLVLDCCL VSRGGRRRFGN
Sbjct  9    GISIPAPEAVQFLVSSLADESPIVREASMASLKDIAALNPLLVLDCCLAVSRGGRRRFGN  68

Query  265  IAGLFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSH  444
            +AG+FQV++ A+RALD+ D+DPAFM KL++IATAE+IS+KELN DWQRAA+ +LVS+GSH
Sbjct  69   MAGIFQVMAFAVRALDENDIDPAFMSKLSRIATAEMISSKELNTDWQRAASALLVSIGSH  128

Query  445  LPDLMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIY  624
            LPDLMMEEIFL+ SG+NSALPAMVQILAD+AS+DALQFTPRLKGVL RV+PILGN+R+++
Sbjct  129  LPDLMMEEIFLYLSGTNSALPAMVQILADFASADALQFTPRLKGVLLRVLPILGNIRDVH  188

Query  625  RPIFANGL  648
            RPIFAN  
Sbjct  189  RPIFANAF  196



>ref|XP_010546528.1| PREDICTED: protein SHOOT GRAVITROPISM 6 isoform X1 [Tarenaya 
hassleriana]
Length=1704

 Score =  2089 bits (5413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1074/1518 (71%), Positives = 1271/1518 (84%), Gaps = 29/1518 (2%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             A W Y+ D    + LD DV+SFLNSAFELLLRVWA SRD KVR+S+VEALGQMVGLITRT
Sbjct  200   AVWMYTTDLVSDSPLDGDVMSFLNSAFELLLRVWATSRDHKVRVSSVEALGQMVGLITRT  259

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstl  1003
             QLK+ALPRL+PTILELYK++ + A +ATCSL++LLNASLLS +GPPLL+FEDL +VLSTL
Sbjct  260   QLKSALPRLIPTILELYKKDHNVALLATCSLYNLLNASLLSESGPPLLEFEDLAIVLSTL  319

Query  1004  l-lvCSNNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGS  1180
             L ++C  ++ KE SD  VGLKTYNEVQ CFLTVG +YPEDLF FLLNKC+LKEEP TFGS
Sbjct  320   LPVICITSENKESSDMSVGLKTYNEVQRCFLTVGFIYPEDLFTFLLNKCKLKEEPLTFGS  379

Query  1181  LCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGE  1360
             LCVLKHLLPRL+E+WH KRP+L+E+V+ L+DE NLGVRKAL+ELIVVMASHCYL+GSSGE
Sbjct  380   LCVLKHLLPRLSEAWHLKRPLLVEAVRSLLDEQNLGVRKALSELIVVMASHCYLIGSSGE  439

Query  1361  LFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKG  1540
             +F+EYLVRHCA+ D +  E                      + K G    T LR VCEKG
Sbjct  440   MFVEYLVRHCAISDTDIDE----------------------KAKKGPFNPTALRAVCEKG  477

Query  1541  LLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKAR  1720
             LLL+TVT+PEME++LWPFLLKMI+PR YTGAVAT+CRCISELCRRRS+ +N+MLSECKAR
Sbjct  478   LLLLTVTIPEMEYILWPFLLKMIVPRRYTGAVATICRCISELCRRRST-ANSMLSECKAR  536

Query  1721  TDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKA  1900
             +DIP PEE+F RLVVLLHNPLARE L TQIL+VL YL+PLFPKNI+ FWQDE  IPKMKA
Sbjct  537   SDIPSPEEIFTRLVVLLHNPLAREQLATQILTVLGYLSPLFPKNIDLFWQDE--IPKMKA  594

Query  1901  YVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHS  2080
             YV DTEDLK DP YQE+WD MII+FLAESLDVIQ+ DW++ LGN+FA+QY LY SD+EH+
Sbjct  595   YVFDTEDLKLDPSYQETWDAMIINFLAESLDVIQDADWIICLGNSFAKQYILYTSDDEHA  654

Query  2081  ALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDK  2260
             ALLHRCLGILLQKV+DRAYVR KID MY+QA+I+   NRLGLAKAMGLVAASHLDTVL+K
Sbjct  655   ALLHRCLGILLQKVNDRAYVRDKIDWMYKQADISNSANRLGLAKAMGLVAASHLDTVLEK  714

Query  2261  LKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALV  2440
             LK ILDNVGQSI QRI SFF D  K E+SDD HAALALMYGYAAKYAP +VIEARIDALV
Sbjct  715   LKEILDNVGQSIFQRILSFFYDSYKTEDSDDIHAALALMYGYAAKYAPSSVIEARIDALV  774

Query  2441  GTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRD  2620
             GTNML+RLLHVR   AKQAVITAIDLLG+AVI ASESG SFPLKRRD LLDYILTLMGRD
Sbjct  775   GTNMLARLLHVRQQAAKQAVITAIDLLGRAVISASESGSSFPLKRRDQLLDYILTLMGRD  834

Query  2621  EEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVIN  2800
             E EGF++S++ELLHTQ LAL+ACTTLVSVEPKLT ETRN +MKAT+GFF LPNDP+DVIN
Sbjct  835   ENEGFAESSLELLHTQVLALNACTTLVSVEPKLTVETRNRVMKATLGFFALPNDPADVIN  894

Query  2801  PLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIK  2980
             PLIDNL+TLLC IL+TSGEDGRSRAEQLLH+LR +D +VSS ++YQRKRGC+A HE+L+K
Sbjct  895   PLIDNLVTLLCAILLTSGEDGRSRAEQLLHLLRQLDQYVSSPIDYQRKRGCVAVHEMLLK  954

Query  2981  FRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPRC  3160
             FR +CV+GYC LGC G+C H K +D     N S+LPS F LPSR++L LG+R++ YLPRC
Sbjct  955   FRKLCVSGYCPLGCSGNCPHRKPVDRNLQGNFSSLPSTFLLPSRESLCLGDRVITYLPRC  1014

Query  3161  IDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILRSDASI  3340
              DTN EVRKVS QIL+  F+IS +LPK + SS  +D E SY ALSSLEDV+A+LRSDASI
Sbjct  1015  ADTNSEVRKVSPQILDQLFSISLTLPKTVVSS-ALDTEDSYKALSSLEDVIAMLRSDASI  1073

Query  3341  DPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNELN  3520
             DPSEVFNR+VSSV  LL++DELVAAL GC+ AICDKI+QSAEGAIQAV EFV+ RG++L+
Sbjct  1074  DPSEVFNRIVSSVSVLLSEDELVAALQGCTSAICDKIRQSAEGAIQAVTEFVSKRGSQLS  1133

Query  3521  EIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMVTKDI  3700
             E ++SRT+QSLL+A VH+T+K+LR E LGAI ++AE+T S +VF EVLA AGRD+VTKDI
Sbjct  1134  ENDISRTTQSLLSAAVHITDKHLRSEALGAISALAESTQSSIVFNEVLATAGRDIVTKDI  1193

Query  3701  HRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSVDGSIE  3880
              R+RGGWP+QDAF+AFSQH  LS  FLEH+ISV+NQ+  +K GD+ KGE+S ++ +  IE
Sbjct  1194  TRMRGGWPMQDAFYAFSQHAELSVLFLEHLISVLNQNSLVK-GDAHKGENSSSAGETQIE  1252

Query  3881  DDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPLRALL  4060
             +D+ +AA+ ALTAFFRGGGK G++ VEQSY+SV+A LTL LG+CHGLAS G Q+PLR LL
Sbjct  1253  EDILQAAIFALTAFFRGGGKVGKRAVEQSYSSVVAALTLQLGSCHGLASSGQQDPLRVLL  1312

Query  4061  NAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICLFLSKS  4240
              +FQ FC+CVGDLEMGKILAR GEQ E EKW+ LIG++AG ISIKRPKEV  IC+ L+KS
Sbjct  1313  TSFQTFCDCVGDLEMGKILARDGEQREKEKWVELIGDIAGCISIKRPKEVRNICMILTKS  1372

Query  4241  LDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQMP  4420
             L+R  R QREAAAAALSEF+RYS  F  LL QMVE+LCRHVSDDSPTVRRLCLRGLVQ+P
Sbjct  1373  LNRSERFQREAAAAALSEFVRYSGDFNSLLEQMVESLCRHVSDDSPTVRRLCLRGLVQIP  1432

Query  4421  SIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSIRLRNL  4600
             S  + QYTTQ+L VILALLDD DESVQLTAVSCLL V ES+  DAVEP L+NLS+RLRNL
Sbjct  1433  SACMNQYTTQVLSVILALLDDLDESVQLTAVSCLLTVTESAPNDAVEPFLMNLSVRLRNL  1492

Query  4601  QVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACRNT  4780
             QV +N+K+RANAFAAFGALS+Y  G   ++F EQ+H+  PR+V+HLHDDD GVRQACR  
Sbjct  1493  QVSMNSKMRANAFAAFGALSNYAIGEHREAFVEQVHSTLPRLVVHLHDDDPGVRQACRGA  1552

Query  4781  LKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSAIIQAF  4960
              K IAPL++++  P+L  +  FSSDHRS YEDF+RDLAR   Q    RVDTYL++ IQAF
Sbjct  1553  FKRIAPLMDMECPPSLFESRSFSSDHRSGYEDFVRDLARHFVQQ-SVRVDTYLASTIQAF  1611

Query  4961  DAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATCSAALG  5140
             D PWPVIQANA++  ++MLSLS++++I +LYY QVFGVLV K   STDA+VRA+CS+ALG
Sbjct  1612  DTPWPVIQANAIHFATTMLSLSEDQHIISLYYPQVFGVLVSKMGRSTDAVVRASCSSALG  1671

Query  5141  LLLKSPNSSSWRDARLNK  5194
             LLLKS  S+SWR +RL++
Sbjct  1672  LLLKSTKSTSWRISRLDR  1689


 Score =   300 bits (768),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 142/185 (77%), Positives = 167/185 (90%), Gaps = 0/185 (0%)
 Frame = +1

Query  94   IPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGNIAG  273
            IPA +AVQV+V+SLADDS +VR ASM++LK+I SLNPLLVLDCC TVSRGGRRRFGN+AG
Sbjct  10   IPAPDAVQVLVTSLADDSSTVRGASMASLKEIASLNPLLVLDCCYTVSRGGRRRFGNMAG  69

Query  274  LFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLPD  453
            +FQV++ ++RAL+K DVD  FM KLAKIATAE+IS+KELNADWQR A+G+LVS+GSHLPD
Sbjct  70   VFQVMAFSVRALEKKDVDATFMGKLAKIATAEIISSKELNADWQRQASGLLVSIGSHLPD  129

Query  454  LMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIYRPI  633
            LMMEEIFLH SG  SA PAMVQILAD+AS+DALQFTPRLK VL+RV+PILGNVR+I+RPI
Sbjct  130  LMMEEIFLHLSGPGSAAPAMVQILADFASADALQFTPRLKDVLSRVLPILGNVRDIHRPI  189

Query  634  FANGL  648
            FAN  
Sbjct  190  FANAF  194



>ref|XP_010546529.1| PREDICTED: protein SHOOT GRAVITROPISM 6 isoform X2 [Tarenaya 
hassleriana]
Length=1542

 Score =  2088 bits (5410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1074/1518 (71%), Positives = 1271/1518 (84%), Gaps = 29/1518 (2%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             A W Y+ D    + LD DV+SFLNSAFELLLRVWA SRD KVR+S+VEALGQMVGLITRT
Sbjct  38    AVWMYTTDLVSDSPLDGDVMSFLNSAFELLLRVWATSRDHKVRVSSVEALGQMVGLITRT  97

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstl  1003
             QLK+ALPRL+PTILELYK++ + A +ATCSL++LLNASLLS +GPPLL+FEDL +VLSTL
Sbjct  98    QLKSALPRLIPTILELYKKDHNVALLATCSLYNLLNASLLSESGPPLLEFEDLAIVLSTL  157

Query  1004  l-lvCSNNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGS  1180
             L ++C  ++ KE SD  VGLKTYNEVQ CFLTVG +YPEDLF FLLNKC+LKEEP TFGS
Sbjct  158   LPVICITSENKESSDMSVGLKTYNEVQRCFLTVGFIYPEDLFTFLLNKCKLKEEPLTFGS  217

Query  1181  LCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGE  1360
             LCVLKHLLPRL+E+WH KRP+L+E+V+ L+DE NLGVRKAL+ELIVVMASHCYL+GSSGE
Sbjct  218   LCVLKHLLPRLSEAWHLKRPLLVEAVRSLLDEQNLGVRKALSELIVVMASHCYLIGSSGE  277

Query  1361  LFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKG  1540
             +F+EYLVRHCA+ D +  E                      + K G    T LR VCEKG
Sbjct  278   MFVEYLVRHCAISDTDIDE----------------------KAKKGPFNPTALRAVCEKG  315

Query  1541  LLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKAR  1720
             LLL+TVT+PEME++LWPFLLKMI+PR YTGAVAT+CRCISELCRRRS+ +N+MLSECKAR
Sbjct  316   LLLLTVTIPEMEYILWPFLLKMIVPRRYTGAVATICRCISELCRRRST-ANSMLSECKAR  374

Query  1721  TDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKA  1900
             +DIP PEE+F RLVVLLHNPLARE L TQIL+VL YL+PLFPKNI+ FWQDE  IPKMKA
Sbjct  375   SDIPSPEEIFTRLVVLLHNPLAREQLATQILTVLGYLSPLFPKNIDLFWQDE--IPKMKA  432

Query  1901  YVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHS  2080
             YV DTEDLK DP YQE+WD MII+FLAESLDVIQ+ DW++ LGN+FA+QY LY SD+EH+
Sbjct  433   YVFDTEDLKLDPSYQETWDAMIINFLAESLDVIQDADWIICLGNSFAKQYILYTSDDEHA  492

Query  2081  ALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDK  2260
             ALLHRCLGILLQKV+DRAYVR KID MY+QA+I+   NRLGLAKAMGLVAASHLDTVL+K
Sbjct  493   ALLHRCLGILLQKVNDRAYVRDKIDWMYKQADISNSANRLGLAKAMGLVAASHLDTVLEK  552

Query  2261  LKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALV  2440
             LK ILDNVGQSI QRI SFF D  K E+SDD HAALALMYGYAAKYAP +VIEARIDALV
Sbjct  553   LKEILDNVGQSIFQRILSFFYDSYKTEDSDDIHAALALMYGYAAKYAPSSVIEARIDALV  612

Query  2441  GTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRD  2620
             GTNML+RLLHVR   AKQAVITAIDLLG+AVI ASESG SFPLKRRD LLDYILTLMGRD
Sbjct  613   GTNMLARLLHVRQQAAKQAVITAIDLLGRAVISASESGSSFPLKRRDQLLDYILTLMGRD  672

Query  2621  EEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVIN  2800
             E EGF++S++ELLHTQ LAL+ACTTLVSVEPKLT ETRN +MKAT+GFF LPNDP+DVIN
Sbjct  673   ENEGFAESSLELLHTQVLALNACTTLVSVEPKLTVETRNRVMKATLGFFALPNDPADVIN  732

Query  2801  PLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIK  2980
             PLIDNL+TLLC IL+TSGEDGRSRAEQLLH+LR +D +VSS ++YQRKRGC+A HE+L+K
Sbjct  733   PLIDNLVTLLCAILLTSGEDGRSRAEQLLHLLRQLDQYVSSPIDYQRKRGCVAVHEMLLK  792

Query  2981  FRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPRC  3160
             FR +CV+GYC LGC G+C H K +D     N S+LPS F LPSR++L LG+R++ YLPRC
Sbjct  793   FRKLCVSGYCPLGCSGNCPHRKPVDRNLQGNFSSLPSTFLLPSRESLCLGDRVITYLPRC  852

Query  3161  IDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILRSDASI  3340
              DTN EVRKVS QIL+  F+IS +LPK + SS  +D E SY ALSSLEDV+A+LRSDASI
Sbjct  853   ADTNSEVRKVSPQILDQLFSISLTLPKTVVSS-ALDTEDSYKALSSLEDVIAMLRSDASI  911

Query  3341  DPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNELN  3520
             DPSEVFNR+VSSV  LL++DELVAAL GC+ AICDKI+QSAEGAIQAV EFV+ RG++L+
Sbjct  912   DPSEVFNRIVSSVSVLLSEDELVAALQGCTSAICDKIRQSAEGAIQAVTEFVSKRGSQLS  971

Query  3521  EIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMVTKDI  3700
             E ++SRT+QSLL+A VH+T+K+LR E LGAI ++AE+T S +VF EVLA AGRD+VTKDI
Sbjct  972   ENDISRTTQSLLSAAVHITDKHLRSEALGAISALAESTQSSIVFNEVLATAGRDIVTKDI  1031

Query  3701  HRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSVDGSIE  3880
              R+RGGWP+QDAF+AFSQH  LS  FLEH+ISV+NQ+  +K GD+ KGE+S ++ +  IE
Sbjct  1032  TRMRGGWPMQDAFYAFSQHAELSVLFLEHLISVLNQNSLVK-GDAHKGENSSSAGETQIE  1090

Query  3881  DDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPLRALL  4060
             +D+ +AA+ ALTAFFRGGGK G++ VEQSY+SV+A LTL LG+CHGLAS G Q+PLR LL
Sbjct  1091  EDILQAAIFALTAFFRGGGKVGKRAVEQSYSSVVAALTLQLGSCHGLASSGQQDPLRVLL  1150

Query  4061  NAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICLFLSKS  4240
              +FQ FC+CVGDLEMGKILAR GEQ E EKW+ LIG++AG ISIKRPKEV  IC+ L+KS
Sbjct  1151  TSFQTFCDCVGDLEMGKILARDGEQREKEKWVELIGDIAGCISIKRPKEVRNICMILTKS  1210

Query  4241  LDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQMP  4420
             L+R  R QREAAAAALSEF+RYS  F  LL QMVE+LCRHVSDDSPTVRRLCLRGLVQ+P
Sbjct  1211  LNRSERFQREAAAAALSEFVRYSGDFNSLLEQMVESLCRHVSDDSPTVRRLCLRGLVQIP  1270

Query  4421  SIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSIRLRNL  4600
             S  + QYTTQ+L VILALLDD DESVQLTAVSCLL V ES+  DAVEP L+NLS+RLRNL
Sbjct  1271  SACMNQYTTQVLSVILALLDDLDESVQLTAVSCLLTVTESAPNDAVEPFLMNLSVRLRNL  1330

Query  4601  QVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACRNT  4780
             QV +N+K+RANAFAAFGALS+Y  G   ++F EQ+H+  PR+V+HLHDDD GVRQACR  
Sbjct  1331  QVSMNSKMRANAFAAFGALSNYAIGEHREAFVEQVHSTLPRLVVHLHDDDPGVRQACRGA  1390

Query  4781  LKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSAIIQAF  4960
              K IAPL++++  P+L  +  FSSDHRS YEDF+RDLAR   Q    RVDTYL++ IQAF
Sbjct  1391  FKRIAPLMDMECPPSLFESRSFSSDHRSGYEDFVRDLARHFVQQ-SVRVDTYLASTIQAF  1449

Query  4961  DAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATCSAALG  5140
             D PWPVIQANA++  ++MLSLS++++I +LYY QVFGVLV K   STDA+VRA+CS+ALG
Sbjct  1450  DTPWPVIQANAIHFATTMLSLSEDQHIISLYYPQVFGVLVSKMGRSTDAVVRASCSSALG  1509

Query  5141  LLLKSPNSSSWRDARLNK  5194
             LLLKS  S+SWR +RL++
Sbjct  1510  LLLKSTKSTSWRISRLDR  1527


 Score = 57.8 bits (138),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +1

Query  556  FTPRLKGVLARVVPILGNVREIYRPIFANGL  648
            FTPRLK VL+RV+PILGNVR+I+RPIFAN  
Sbjct  2    FTPRLKDVLSRVLPILGNVRDIHRPIFANAF  32



>gb|KHG30714.1| HEAT repeat-containing 7A [Gossypium arboreum]
Length=1692

 Score =  2075 bits (5376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1078/1518 (71%), Positives = 1261/1518 (83%), Gaps = 35/1518 (2%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             A WQY+VDF  ++++D DV+SFLNSAFELLLRVWA SRDLKVR+S+VEALGQMVGLITRT
Sbjct  201   AVWQYNVDFPSNSLIDGDVMSFLNSAFELLLRVWAASRDLKVRVSSVEALGQMVGLITRT  260

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstl  1003
             QLK ALPRL+PTILEL K++QD A +AT SL++LLN SLLS  GPPLL+FE+LTV+LSTL
Sbjct  261   QLKTALPRLIPTILELCKKDQDIALIATSSLYNLLNVSLLSETGPPLLEFEELTVILSTL  320

Query  1004  l-lvCSNNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGS  1180
             L ++C +ND KEHSDF VGLKTYNEVQ CFLTVGS+YPEDLF FLLNKCRLKEEP TFG+
Sbjct  321   LPVICMDNDGKEHSDFSVGLKTYNEVQRCFLTVGSIYPEDLFSFLLNKCRLKEEPLTFGA  380

Query  1181  LCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGE  1360
             LCVLKHLLPR +E+WHNKRP+L+++VK L++E +LG+RKAL+ELIVVMASHCYLVG + E
Sbjct  381   LCVLKHLLPRSSEAWHNKRPLLVDAVKSLLEEQSLGIRKALSELIVVMASHCYLVGPTAE  440

Query  1361  LFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKG  1540
             LF+EYLVRHCA+ + + ++LESS+                   K G +  TELR +CEKG
Sbjct  441   LFVEYLVRHCALSEQDRIDLESSQA------------------KVGLICPTELRAICEKG  482

Query  1541  LLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKAR  1720
             LLL+T+T+PEMEHVLWPFLLKMIIPR YTGAVA VCRCI+ELCR RSS +N ML +CK R
Sbjct  483   LLLLTITIPEMEHVLWPFLLKMIIPRAYTGAVAMVCRCIAELCRYRSSFNNNMLDDCKDR  542

Query  1721  TDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKA  1900
             +DIP PEELFARLVVLLHNPL RE   TQIL+VL YLAP+FP+NIN FWQDE       A
Sbjct  543   SDIPNPEELFARLVVLLHNPLVREQRATQILTVLCYLAPMFPRNINLFWQDE-------A  595

Query  1901  YVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHS  2080
             YVSD EDLK DP YQE+WDDMII+FLAESLDVIQ+ DWV+ LGN F +QY LY  D+EHS
Sbjct  596   YVSDPEDLKLDPSYQETWDDMIINFLAESLDVIQDTDWVISLGNAFTKQYALYTPDDEHS  655

Query  2081  ALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDK  2260
             ALLHRCLGILLQKV+DRAYVR KID MY+QANI +PTNRLGLAKA+GLVAASHLDTVLDK
Sbjct  656   ALLHRCLGILLQKVNDRAYVRGKIDWMYKQANITIPTNRLGLAKAIGLVAASHLDTVLDK  715

Query  2261  LKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALV  2440
             LK ILDNVGQSI Q          + EESDD HAALALMYGYAA+YAP  VIEARIDALV
Sbjct  716   LKNILDNVGQSIFQSY--------RTEESDDVHAALALMYGYAARYAPSMVIEARIDALV  767

Query  2441  GTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRD  2620
             GTNMLS+LLHVRHP AKQAVITAIDLLG+AVI A+E+G  FPLKRRD LLDYILTLMGRD
Sbjct  768   GTNMLSKLLHVRHPTAKQAVITAIDLLGRAVINAAENGAPFPLKRRDQLLDYILTLMGRD  827

Query  2621  EEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVIN  2800
             E + F+DS++ELL TQ+LAL+ACTTLVSVEPKLT ETRN +MKAT+GFF LPNDP  VIN
Sbjct  828   ESDDFADSSLELLRTQALALNACTTLVSVEPKLTIETRNRVMKATLGFFALPNDPIGVIN  887

Query  2801  PLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIK  2980
             PLIDNLITLLC IL+TSGEDGRSRAEQLLHILR ID +VSS ++YQR+RGCLA +E+L+K
Sbjct  888   PLIDNLITLLCAILLTSGEDGRSRAEQLLHILRQIDQYVSSHVDYQRRRGCLAVYEMLVK  947

Query  2981  FRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPRC  3160
             FR +CV+GYCALGC+GSC+HSKQID   + N SNLPSAF  PSR+ALSLG+R+++YLPRC
Sbjct  948   FRMLCVSGYCALGCRGSCTHSKQIDRTLHGNFSNLPSAFVSPSREALSLGDRVIMYLPRC  1007

Query  3161  IDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILRSDASI  3340
              DT+ EVRK+S QIL+  F+IS SLPKP+ SS+G DIEL Y ALSSLEDV+AILRSD+SI
Sbjct  1008  ADTDSEVRKLSAQILDQLFSISLSLPKPLGSSVGGDIELCYGALSSLEDVIAILRSDSSI  1067

Query  3341  DPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNELN  3520
             DPSEVFNR+V+SVC LL KDELV  LHGC  AIC++IKQSAEGAI AV+EFVT RG EL+
Sbjct  1068  DPSEVFNRIVNSVCILLTKDELVDTLHGCMPAICNRIKQSAEGAILAVIEFVTKRGAELS  1127

Query  3521  EIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMVTKDI  3700
             E  +SRT+QSLL+A  HVTEK LR E LGAI S++ENT  KVVF EVL AA RD+VTKDI
Sbjct  1128  EANISRTAQSLLSAAGHVTEKQLRLEVLGAISSLSENTNEKVVFNEVLTAAARDIVTKDI  1187

Query  3701  HRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSVDGSIE  3880
              RLRGGW +QDAFHAFSQH+VLS  FLEH+ISV+NQ+   K  D GKGE+S    +  + 
Sbjct  1188  SRLRGGWSMQDAFHAFSQHIVLSVLFLEHLISVLNQTRVTK-SDPGKGENSILLSETQLA  1246

Query  3881  DDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPLRALL  4060
             D++ +AA+ ALTAFFRGGGK G++ VEQ Y+SVLA L L  G CHGLA+ G  EPLRALL
Sbjct  1247  DEILQAAIFALTAFFRGGGKVGKRAVEQRYSSVLAALILQFGKCHGLANSGQHEPLRALL  1306

Query  4061  NAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICLFLSKS  4240
              AFQAFCECVGDLEMGKILAR  EQNE EKWINLIG+LAG IS+KRPKEV  +C   +KS
Sbjct  1307  TAFQAFCECVGDLEMGKILARDSEQNEKEKWINLIGDLAGCISMKRPKEVENLCKIFTKS  1366

Query  4241  LDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQMP  4420
             L+     QREAAAAALSEF+ YS GF   L +MVE LCRHVSD+SPTVR LCLRGLV++P
Sbjct  1367  LNLQENFQREAAAAALSEFVCYSSGFSSTLEEMVEVLCRHVSDESPTVRCLCLRGLVKIP  1426

Query  4421  SIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSIRLRNL  4600
             S+H+ Q+TTQ+LGVILALLDD DESVQLTAVSCLL++LE+S  DAVEP+LLNLS+RLRNL
Sbjct  1427  SVHIYQHTTQVLGVILALLDDLDESVQLTAVSCLLMILETSPKDAVEPILLNLSVRLRNL  1486

Query  4601  QVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACRNT  4780
             Q+ +N K+RA+AFAAFGALS+YG G+  D+F EQIHA  PR++LHLHDDDL VR ACRNT
Sbjct  1487  QISMNVKMRADAFAAFGALSNYGIGAHKDAFLEQIHATLPRLILHLHDDDLAVRYACRNT  1546

Query  4781  LKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSAIIQAF  4960
             LK  APL+EI+ + AL ++HR +SDHRS YEDF+RD  RQ  Q+L  RVDT++++ IQA 
Sbjct  1547  LKRFAPLMEIEGLLALFDSHRINSDHRSAYEDFVRDFTRQFVQHLSSRVDTFMASTIQAL  1606

Query  4961  DAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATCSAALG  5140
             +APWP+IQANA+Y+ SS+LSLSD+ NI ALY++QVFG+LVGK S S DA+VRA  S A  
Sbjct  1607  NAPWPIIQANAIYVSSSILSLSDDPNILALYHAQVFGMLVGKMSRSADAVVRARSSLAFS  1666

Query  5141  LLLKSPNSSSWRDARLNK  5194
             LLLKS N  SWR ARL++
Sbjct  1667  LLLKSTNLISWRAARLDQ  1684


 Score =   295 bits (756),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 140/185 (76%), Positives = 166/185 (90%), Gaps = 0/185 (0%)
 Frame = +1

Query  94   IPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGNIAG  273
            IPA EAVQV+VSSLAD+SP VREASM++LKDI+ LNPLLVLDCC  VSRGGRRRFGN+AG
Sbjct  11   IPAPEAVQVLVSSLADESPMVREASMASLKDISPLNPLLVLDCCSAVSRGGRRRFGNMAG  70

Query  274  LFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLPD  453
            +FQV++  +RALDK D+D +++ KLAKIATAE+IS+KELNADWQRAAA +LV++GSHLPD
Sbjct  71   VFQVMAFGVRALDKNDIDASYIGKLAKIATAEIISSKELNADWQRAAASLLVAIGSHLPD  130

Query  454  LMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIYRPI  633
            LMMEEIFLH SG +SAL AM+QILAD+AS+DALQF PRLKGVL+RV+PILGNVR+  RPI
Sbjct  131  LMMEEIFLHLSGPSSALAAMIQILADFASADALQFAPRLKGVLSRVLPILGNVRDAQRPI  190

Query  634  FANGL  648
            FAN  
Sbjct  191  FANAF  195



>ref|XP_004143286.1| PREDICTED: LOW QUALITY PROTEIN: HEAT repeat-containing protein 
7A homolog [Cucumis sativus]
 ref|XP_004156267.1| PREDICTED: LOW QUALITY PROTEIN: HEAT repeat-containing protein 
7A homolog [Cucumis sativus]
Length=1712

 Score =  2073 bits (5372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1092/1531 (71%), Positives = 1277/1531 (83%), Gaps = 38/1531 (2%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             A WQ+SVDF   + +D DV+SFLNSAFELLLRVWA S DLKVR+S+VEALGQ+V LITR 
Sbjct  200   AAWQHSVDFPSHSSIDGDVMSFLNSAFELLLRVWAASSDLKVRISSVEALGQIVSLITRA  259

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstl  1003
             QLKAALPRL+PTILELYK+ QD AFV TCSLH++LN SL S +GPPLLDFEDLTV+LSTL
Sbjct  260   QLKAALPRLIPTILELYKKGQDVAFVTTCSLHNVLNTSLHSESGPPLLDFEDLTVILSTL  319

Query  1004  l-lvCSNNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGS  1180
             L +VC NN+ K+ SD   GLKTYNEVQ CFLTVG +YPEDLF+FLLNKCRLKEEP TFG+
Sbjct  320   LPVVCVNNESKD-SDLSTGLKTYNEVQRCFLTVGLIYPEDLFMFLLNKCRLKEEPLTFGA  378

Query  1181  LCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGE  1360
             LCVLKHLLPRL+E+WH KRP+L E+VK L+DE NLGVRKAL+ELIVVMASHCYLVGSSGE
Sbjct  379   LCVLKHLLPRLSEAWHGKRPLLTEAVKSLLDEQNLGVRKALSELIVVMASHCYLVGSSGE  438

Query  1361  LFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKG  1540
             +F+EYLVRHCA+  ++  +  +S+E +                    V+  +LR + EKG
Sbjct  439   MFVEYLVRHCAI-KIDRNDPGASKELAGLN-----------------VSPVKLREISEKG  480

Query  1541  LLLITVTVPEME-------------HVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRS  1681
             LLL+T+T+PEME             H+LWPFLLKMIIPR YTGA ATVCRCISELCR   
Sbjct  481   LLLLTITIPEMEVFLIKYFSXLTLQHILWPFLLKMIIPRRYTGATATVCRCISELCRH-G  539

Query  1682  SESNAMLSECKARTDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINS  1861
             S  ++MLSECK R+DIP PEELFARLVVLLH+PLARE L TQIL+VL YLAPLFPKNIN 
Sbjct  540   SYGDSMLSECKTRSDIPNPEELFARLVVLLHDPLAREQLATQILTVLCYLAPLFPKNINL  599

Query  1862  FWQDEL*IPKMKAYVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFA  2041
             FWQDE  IPKMKAY+SD+EDLKQ+PLYQE+WDDMII+FLAESLDVIQ+ +WV+ LGN F+
Sbjct  600   FWQDE--IPKMKAYISDSEDLKQNPLYQETWDDMIINFLAESLDVIQDTNWVISLGNAFS  657

Query  2042  RQYELYKSDNEHSALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMG  2221
              QYELY SD+EHSALLHRCLGILLQK++DRAYV  KIDLMY+QANIAVPTNRLGLAKAMG
Sbjct  658   NQYELYVSDDEHSALLHRCLGILLQKINDRAYVHDKIDLMYKQANIAVPTNRLGLAKAMG  717

Query  2222  LVAASHLDTVLDKLKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYA  2401
             LVA+SHLDTVL+KLK ILDN+G S  QR  SFFSD  K EESDD HAALALMYGYAAKYA
Sbjct  718   LVASSHLDTVLEKLKDILDNMGHSFFQRFLSFFSDGFKKEESDDIHAALALMYGYAAKYA  777

Query  2402  PPTVIEARIDALVGTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRD  2581
             P TVIEARIDALVGTNMLSRLL+V HP AKQAVITAIDLLG+AVI A+E+G +FPLKRRD
Sbjct  778   PSTVIEARIDALVGTNMLSRLLNVYHPTAKQAVITAIDLLGRAVINAAENGSTFPLKRRD  837

Query  2582  LLLDYILTLMGRDEEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIG  2761
              LLDYILTLMGRD+  GFSDSN ELL TQ+LALSACTTLVS+EPKLT ETRNLIMKAT+G
Sbjct  838   QLLDYILTLMGRDDNGGFSDSNFELLRTQALALSACTTLVSLEPKLTIETRNLIMKATLG  897

Query  2762  FFGLPNDPSDVINPLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQR  2941
             FF L ++P++V+NPLIDNLITLLCTIL+TSGEDGRSRAEQLLHILR IDP+VSS +E QR
Sbjct  898   FFTLSSEPAEVVNPLIDNLITLLCTILLTSGEDGRSRAEQLLHILRQIDPYVSSPVECQR  957

Query  2942  KRGCLAAHELLIKFRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDAL  3121
             +RGCLA HE+L+KFR +C++GYCALGC G C+H++Q+D         LPSAF LPSR+AL
Sbjct  958   RRGCLAVHEMLVKFRMVCISGYCALGCHGICTHNRQMDRNLQGICPKLPSAFMLPSREAL  1017

Query  3122  SLGERIMVYLPRCIDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSL  3301
              LGER++ YLPRC D N EVRK S QIL+  F+IS +LP+P  S  G DIELSY ALSSL
Sbjct  1018  CLGERVITYLPRCADLNSEVRKFSAQILDQLFSISLALPRPAASKFGEDIELSYTALSSL  1077

Query  3302  EDVVAILRSDASIDPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQA  3481
             EDV+AILRSD SIDPSEVFNR+VSSVC LL KDELVA LHGCSGAICDKIKQSAEGAIQA
Sbjct  1078  EDVIAILRSDTSIDPSEVFNRIVSSVCILLTKDELVATLHGCSGAICDKIKQSAEGAIQA  1137

Query  3482  VVEFVTNRGNELNEIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEV  3661
             V+EFVT RGNEL+E+E++RT+Q+LL+AVVHVTEK++R ETLGAI S+AENT  KVVF EV
Sbjct  1138  VIEFVTKRGNELSEMEIARTTQALLSAVVHVTEKHIRLETLGAISSLAENTNPKVVFDEV  1197

Query  3662  LAAAGRDMVTKDIHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGK  3841
             LA AGRD++TKDI RLRGGWPIQDAF+ FSQH VLS SFLEHV+SV+NQ P L  G   +
Sbjct  1198  LATAGRDIITKDISRLRGGWPIQDAFYVFSQHTVLSFSFLEHVLSVLNQVP-LNQGSQDR  1256

Query  3842  GESSRNSVDGSIEDDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchgl  4021
              E S +  D  IE+D+S+AA+++LTAFFRGGGK G+K VEQ+YA VLA L L LG+CH  
Sbjct  1257  AEFSSHGPD-HIENDISQAAIVSLTAFFRGGGKVGKKAVEQNYALVLAELILQLGSCHHH  1315

Query  4022  aSYGDQEPLRALLNAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRP  4201
             AS G  E LRALL AFQAFCECVGDLEMGKILAR GE NENE+WINLIG+LAG ISIKRP
Sbjct  1316  ASLGQHEKLRALLTAFQAFCECVGDLEMGKILARDGEHNENERWINLIGDLAGCISIKRP  1375

Query  4202  KEVPTICLFLSKSLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPT  4381
             KEV  ICL +SKS++   R QREAA AALSEF+RYS   G LL Q+VE  CRHVSD+SPT
Sbjct  1376  KEVQHICLIMSKSVNGHQRYQREAATAALSEFVRYSGHVGSLLEQIVEVFCRHVSDESPT  1435

Query  4382  VRRLCLRGLVQMPSIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVE  4561
             VRRLCLRGLVQ+P I ++QYT Q+LGVILALLDD DESVQ TA+SCLL++LE+S  DAVE
Sbjct  1436  VRRLCLRGLVQIPVIQIIQYTAQVLGVILALLDDVDESVQSTALSCLLMILEASPNDAVE  1495

Query  4562  PVLLNLSIRLRNLQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLH  4741
             P+LLNLS+RLR+LQ C+N  IRANAF AFG LS+YG G   ++F EQ+HA  PR+VLH++
Sbjct  1496  PILLNLSVRLRHLQSCMNTVIRANAFTAFGVLSTYGVGQQSEAFLEQVHATIPRLVLHVY  1555

Query  4742  DDDLGVRQACRNTLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGP  4921
             DDD+ VRQACR+T K IAPL+E++ +P L N H F+SDHR+DY DF+RD ++Q++QYL  
Sbjct  1556  DDDISVRQACRSTFKRIAPLVEVEELPTLFNMHFFNSDHRNDYVDFVRDFSKQISQYLPS  1615

Query  4922  RVDTYLSAIIQAFDAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNST  5101
             RVD+Y++  I+AFDAPWP+IQANA+Y  SSML+L+D+++I +L+Y+QVFG+LVGK S S 
Sbjct  1616  RVDSYMAMTIKAFDAPWPMIQANAIYFSSSMLALTDDQHILSLHYTQVFGLLVGKMSRSG  1675

Query  5102  DAIVRATCSAALGLLLKSPNSSSWRDARLNK  5194
             +AIVRATCS+ALGLLLKS NS SWR AR+++
Sbjct  1676  EAIVRATCSSALGLLLKSSNSLSWRTARMDR  1706


 Score =   303 bits (775),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 143/188 (76%), Positives = 168/188 (89%), Gaps = 0/188 (0%)
 Frame = +1

Query  85   GDSIPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGN  264
            G+SIPA EAVQ++VSSLAD+SP VREASM++LKDI +LNPLLVLDCC  VSRGGRRRFGN
Sbjct  7    GNSIPAPEAVQILVSSLADESPVVREASMASLKDIATLNPLLVLDCCYAVSRGGRRRFGN  66

Query  265  IAGLFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSH  444
            +AG F V+S  +RALD+ DVDPAFM KLAKI+T E+IS+KELN +WQRAAA +LVS+GSH
Sbjct  67   MAGAFLVMSFGVRALDEEDVDPAFMSKLAKISTTEIISSKELNTEWQRAAAQLLVSIGSH  126

Query  445  LPDLMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIY  624
            LPDLMMEEI+LH  G +SALPAMVQILAD+ASSDALQFTPRLK VL+RV+PILGNVR+ +
Sbjct  127  LPDLMMEEIYLHLGGPSSALPAMVQILADFASSDALQFTPRLKDVLSRVLPILGNVRDAH  186

Query  625  RPIFANGL  648
            RPIFAN +
Sbjct  187  RPIFANAI  194



>ref|XP_010683971.1| PREDICTED: protein SHOOT GRAVITROPISM 6 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=1710

 Score =  2070 bits (5364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1073/1522 (70%), Positives = 1259/1522 (83%), Gaps = 17/1522 (1%)
 Frame = +2

Query  647   CW-----QYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGL  811
             CW      YS +F  S +LD DV+SFLNSAFEL LRVWA SRDLKVR+S VEALGQMVGL
Sbjct  196   CWCQATSLYSTEFP-SHVLDADVMSFLNSAFELFLRVWASSRDLKVRMSTVEALGQMVGL  254

Query  812   ITRTQLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvv  991
              TR QLK ALPRL+PT+LELYK  QD A+VATCSLH +LNASLLS  GPPLL+FED+TVV
Sbjct  255   STRLQLKTALPRLIPTMLELYKNNQDIAYVATCSLHHVLNASLLSETGPPLLEFEDITVV  314

Query  992   lstll-lvCSNNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPF  1168
             LSTLL +V  +ND KE   F VGLKTYNEVQ CFLTVG VYPED+FVFLLNKCRLKEE  
Sbjct  315   LSTLLPVVLMHNDVKEQPKFSVGLKTYNEVQRCFLTVGMVYPEDIFVFLLNKCRLKEEAL  374

Query  1169  TFGSLCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVG  1348
             TFG+LCVLKHLLPRL+E+WHN RP+L++ V  L+DE NLGVRKAL+ELIVVMASHCYL+G
Sbjct  375   TFGALCVLKHLLPRLSEAWHNNRPMLVDVVNSLLDEQNLGVRKALSELIVVMASHCYLIG  434

Query  1349  SSGELFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGV  1528
             SSGELF+EYLVRHCA+PD E  +LESS        +++   YR+ E K G V+  ELR V
Sbjct  435   SSGELFVEYLVRHCALPDREEHQLESS-------SSFHALTYRRFEAKVGKVSVAELRSV  487

Query  1529  CEKGLLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSE  1708
             CEKGLLL+T+T+PEMEHVLWPFLLKMI+PR YTGAV++VCRCI+ELCR RS   + MLSE
Sbjct  488   CEKGLLLLTITIPEMEHVLWPFLLKMIVPRAYTGAVSSVCRCIAELCRHRSGSGSMMLSE  547

Query  1709  CKARTDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IP  1888
             CKARTDIP  EELF RLVVLLH+PLAREH  T ILSVL +L PLFPKNI+ FWQDE  IP
Sbjct  548   CKARTDIPSSEELFVRLVVLLHDPLAREHRATHILSVLNFLGPLFPKNISLFWQDE--IP  605

Query  1889  KMKAYVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSD  2068
             KMKAYVSDTEDLKQDP  +E+WDDMII+FLAESLDV Q+VDWV+ LG+ FA+QYELY S 
Sbjct  606   KMKAYVSDTEDLKQDPSCRETWDDMIINFLAESLDVGQDVDWVIGLGDVFAKQYELYTSV  665

Query  2069  NEHSALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDT  2248
             +EHSALLHRCLG+LLQKV D+ YVR KIDLMY+QANIA+PTNR+GLAK MGLVAASHLD 
Sbjct  666   DEHSALLHRCLGMLLQKVDDKVYVRDKIDLMYKQANIAIPTNRIGLAKGMGLVAASHLDM  725

Query  2249  VLDKLKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARI  2428
             VL+KLK ILDNVGQS+ QR  SFF D+ ++EESDD HA LALMYGYAA+YAP  VIEARI
Sbjct  726   VLEKLKEILDNVGQSLFQRFLSFFIDKARVEESDDIHAGLALMYGYAARYAPSNVIEARI  785

Query  2429  DALVGTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTL  2608
             DALVGTNMLSRLLHV HP AKQAVITAIDLLG+AVI A ++G  FPLKRRD LLDYILTL
Sbjct  786   DALVGTNMLSRLLHVYHPVAKQAVITAIDLLGKAVIQAGDNGAPFPLKRRDQLLDYILTL  845

Query  2609  MGRDEEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPS  2788
             MG D ++ F D+ +E+L TQ+LALSACTTLVSVEPKLT ETRN I+KA +GFF LP++P+
Sbjct  846   MGHDNDDEFIDTGVEILRTQALALSACTTLVSVEPKLTMETRNYILKAVLGFFALPSEPA  905

Query  2789  DVINPLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHE  2968
             +V+NPLIDNLITLLCTIL+TSGEDGRSR EQLLHILR IDP+VSS+LE+QR RGC AAHE
Sbjct  906   EVVNPLIDNLITLLCTILLTSGEDGRSRTEQLLHILRQIDPYVSSALEHQRTRGCQAAHE  965

Query  2969  LLIKFRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVY  3148
             +L+KF  +C +G+C LGC GSC H K ID     N  N P+ F LPSR+ALSLG+R++VY
Sbjct  966   MLVKFHKLCTSGFCPLGCHGSCVHGKHIDRNLLGNFQNFPTVFVLPSREALSLGDRVIVY  1025

Query  3149  LPRCIDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILRS  3328
             LPRC DTN EVRK S QIL+LFF+I+ SLP+P NS+L  ++E+ Y ALSSLEDV+A+L+S
Sbjct  1026  LPRCADTNAEVRKFSSQILDLFFSIALSLPRPTNSNLNANVEIYYGALSSLEDVIAMLKS  1085

Query  3329  DASIDPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRG  3508
             DASID SEVFNRV+SS+C LL KDELVA LHGC+ AICDKIKQSAEG IQAV+EFV  R 
Sbjct  1086  DASIDSSEVFNRVISSICILLTKDELVAVLHGCTTAICDKIKQSAEGCIQAVIEFVMKRK  1145

Query  3509  NELNEIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMV  3688
             +ELNE +VSRT+QSLL+AV HVTEKYLRQETL AIC++AENT+S++VF EVLA AGRD+V
Sbjct  1146  SELNESDVSRTTQSLLSAVSHVTEKYLRQETLSAICALAENTSSEIVFNEVLATAGRDIV  1205

Query  3689  TKDIHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSVD  3868
             TKDI RLRGGWP+QDAF AFSQH VLS  FLEHVISV   +P +    + KG+ S + V+
Sbjct  1206  TKDISRLRGGWPMQDAFCAFSQHSVLSILFLEHVISVPTHTP-VNRNIAEKGDGSSHGVN  1264

Query  3869  GSIEDDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPL  4048
                E+++ +A++ ALTAFFRGGGK G+K V+QSYASVLA LTL LG+CHGLAS G  EPL
Sbjct  1265  KFCENEILQASIFALTAFFRGGGKVGKKAVQQSYASVLAALTLQLGSCHGLASSGQPEPL  1324

Query  4049  RALLNAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICLF  4228
             RALL AFQAFCECVGDLEMGKILAR GEQ++ EKW+NLIG++AG +SIKRPKEVP ICL 
Sbjct  1325  RALLIAFQAFCECVGDLEMGKILARDGEQSQIEKWVNLIGDIAGCVSIKRPKEVPAICLI  1384

Query  4229  LSKSLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGL  4408
             LSKSLD     +REAAAAALSEF+RYSDG+  LL QMVEALCRHVSDD  +VR LCLRGL
Sbjct  1385  LSKSLDEHQNFEREAAAAALSEFVRYSDGYDCLLEQMVEALCRHVSDDLASVRGLCLRGL  1444

Query  4409  VQMPSIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSIR  4588
             VQ+PSIH+ QY  Q+LGVILALL+DSDESVQ TA S L++VL+SS  ++VEPVLLNL++R
Sbjct  1445  VQIPSIHIHQYAAQVLGVILALLEDSDESVQQTAASSLIMVLDSSPGESVEPVLLNLAVR  1504

Query  4589  LRNLQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQA  4768
             +RNLQV +N KIRA + AAFGALS++  G+  D+F EQ+HA  PR+VLHLHDDD+ +R+A
Sbjct  1505  VRNLQVSMNTKIRATSIAAFGALSNFADGTQHDAFLEQVHAVLPRLVLHLHDDDISIREA  1564

Query  4769  CRNTLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSAI  4948
             CR TLK IA  +++     LL TH F SDHRSDYEDF+R+L R  TQ+L  R+ +Y++  
Sbjct  1565  CRKTLKQIASFVDVQGTSPLLTTHYFLSDHRSDYEDFVRNLTRHFTQHLASRIGSYMATA  1624

Query  4949  IQAFDAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATCS  5128
             IQAFDAPWP+IQANA+Y CS MLS +D++ I ALYYSQVFG+LV K S+STDA+VRA CS
Sbjct  1625  IQAFDAPWPIIQANAMYFCSRMLSQTDDQRILALYYSQVFGMLVSKLSHSTDALVRAACS  1684

Query  5129  AALGLLLKSPNSSSWRDARLNK  5194
              +LG+LLKS  S SW  ARL++
Sbjct  1685  LSLGILLKSSYSHSWTSARLDQ  1706


 Score =   296 bits (759),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 139/188 (74%), Positives = 169/188 (90%), Gaps = 0/188 (0%)
 Frame = +1

Query  85   GDSIPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGN  264
            G SIPA EAVQV+VSSLAD+S  VREASM++LKDI++LNPLLVLDCC  VSRGGRRRFGN
Sbjct  7    GSSIPAPEAVQVLVSSLADESSVVREASMASLKDISALNPLLVLDCCAAVSRGGRRRFGN  66

Query  265  IAGLFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSH  444
            +AGLFQV++  +RAL+KG+ D  FM KLAKIAT+E+IS+KELNADWQRAA+G+LVS+GSH
Sbjct  67   MAGLFQVMAFGVRALNKGNADHTFMSKLAKIATSEMISSKELNADWQRAASGLLVSIGSH  126

Query  445  LPDLMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIY  624
             PDLMMEEIF+H +G++SALPAMVQILAD+AS+DALQF PRLK VL+RV+PILG+VR+++
Sbjct  127  FPDLMMEEIFVHLTGASSALPAMVQILADFASADALQFAPRLKEVLSRVLPILGSVRDVH  186

Query  625  RPIFANGL  648
            R IFAN  
Sbjct  187  RSIFANAF  194



>ref|XP_010683972.1| PREDICTED: protein SHOOT GRAVITROPISM 6 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=1548

 Score =  2068 bits (5357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1073/1522 (70%), Positives = 1259/1522 (83%), Gaps = 17/1522 (1%)
 Frame = +2

Query  647   CW-----QYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGL  811
             CW      YS +F  S +LD DV+SFLNSAFEL LRVWA SRDLKVR+S VEALGQMVGL
Sbjct  34    CWCQATSLYSTEFP-SHVLDADVMSFLNSAFELFLRVWASSRDLKVRMSTVEALGQMVGL  92

Query  812   ITRTQLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvv  991
              TR QLK ALPRL+PT+LELYK  QD A+VATCSLH +LNASLLS  GPPLL+FED+TVV
Sbjct  93    STRLQLKTALPRLIPTMLELYKNNQDIAYVATCSLHHVLNASLLSETGPPLLEFEDITVV  152

Query  992   lstll-lvCSNNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPF  1168
             LSTLL +V  +ND KE   F VGLKTYNEVQ CFLTVG VYPED+FVFLLNKCRLKEE  
Sbjct  153   LSTLLPVVLMHNDVKEQPKFSVGLKTYNEVQRCFLTVGMVYPEDIFVFLLNKCRLKEEAL  212

Query  1169  TFGSLCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVG  1348
             TFG+LCVLKHLLPRL+E+WHN RP+L++ V  L+DE NLGVRKAL+ELIVVMASHCYL+G
Sbjct  213   TFGALCVLKHLLPRLSEAWHNNRPMLVDVVNSLLDEQNLGVRKALSELIVVMASHCYLIG  272

Query  1349  SSGELFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGV  1528
             SSGELF+EYLVRHCA+PD E  +LESS        +++   YR+ E K G V+  ELR V
Sbjct  273   SSGELFVEYLVRHCALPDREEHQLESS-------SSFHALTYRRFEAKVGKVSVAELRSV  325

Query  1529  CEKGLLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSE  1708
             CEKGLLL+T+T+PEMEHVLWPFLLKMI+PR YTGAV++VCRCI+ELCR RS   + MLSE
Sbjct  326   CEKGLLLLTITIPEMEHVLWPFLLKMIVPRAYTGAVSSVCRCIAELCRHRSGSGSMMLSE  385

Query  1709  CKARTDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IP  1888
             CKARTDIP  EELF RLVVLLH+PLAREH  T ILSVL +L PLFPKNI+ FWQDE  IP
Sbjct  386   CKARTDIPSSEELFVRLVVLLHDPLAREHRATHILSVLNFLGPLFPKNISLFWQDE--IP  443

Query  1889  KMKAYVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSD  2068
             KMKAYVSDTEDLKQDP  +E+WDDMII+FLAESLDV Q+VDWV+ LG+ FA+QYELY S 
Sbjct  444   KMKAYVSDTEDLKQDPSCRETWDDMIINFLAESLDVGQDVDWVIGLGDVFAKQYELYTSV  503

Query  2069  NEHSALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDT  2248
             +EHSALLHRCLG+LLQKV D+ YVR KIDLMY+QANIA+PTNR+GLAK MGLVAASHLD 
Sbjct  504   DEHSALLHRCLGMLLQKVDDKVYVRDKIDLMYKQANIAIPTNRIGLAKGMGLVAASHLDM  563

Query  2249  VLDKLKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARI  2428
             VL+KLK ILDNVGQS+ QR  SFF D+ ++EESDD HA LALMYGYAA+YAP  VIEARI
Sbjct  564   VLEKLKEILDNVGQSLFQRFLSFFIDKARVEESDDIHAGLALMYGYAARYAPSNVIEARI  623

Query  2429  DALVGTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTL  2608
             DALVGTNMLSRLLHV HP AKQAVITAIDLLG+AVI A ++G  FPLKRRD LLDYILTL
Sbjct  624   DALVGTNMLSRLLHVYHPVAKQAVITAIDLLGKAVIQAGDNGAPFPLKRRDQLLDYILTL  683

Query  2609  MGRDEEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPS  2788
             MG D ++ F D+ +E+L TQ+LALSACTTLVSVEPKLT ETRN I+KA +GFF LP++P+
Sbjct  684   MGHDNDDEFIDTGVEILRTQALALSACTTLVSVEPKLTMETRNYILKAVLGFFALPSEPA  743

Query  2789  DVINPLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHE  2968
             +V+NPLIDNLITLLCTIL+TSGEDGRSR EQLLHILR IDP+VSS+LE+QR RGC AAHE
Sbjct  744   EVVNPLIDNLITLLCTILLTSGEDGRSRTEQLLHILRQIDPYVSSALEHQRTRGCQAAHE  803

Query  2969  LLIKFRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVY  3148
             +L+KF  +C +G+C LGC GSC H K ID     N  N P+ F LPSR+ALSLG+R++VY
Sbjct  804   MLVKFHKLCTSGFCPLGCHGSCVHGKHIDRNLLGNFQNFPTVFVLPSREALSLGDRVIVY  863

Query  3149  LPRCIDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILRS  3328
             LPRC DTN EVRK S QIL+LFF+I+ SLP+P NS+L  ++E+ Y ALSSLEDV+A+L+S
Sbjct  864   LPRCADTNAEVRKFSSQILDLFFSIALSLPRPTNSNLNANVEIYYGALSSLEDVIAMLKS  923

Query  3329  DASIDPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRG  3508
             DASID SEVFNRV+SS+C LL KDELVA LHGC+ AICDKIKQSAEG IQAV+EFV  R 
Sbjct  924   DASIDSSEVFNRVISSICILLTKDELVAVLHGCTTAICDKIKQSAEGCIQAVIEFVMKRK  983

Query  3509  NELNEIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMV  3688
             +ELNE +VSRT+QSLL+AV HVTEKYLRQETL AIC++AENT+S++VF EVLA AGRD+V
Sbjct  984   SELNESDVSRTTQSLLSAVSHVTEKYLRQETLSAICALAENTSSEIVFNEVLATAGRDIV  1043

Query  3689  TKDIHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSVD  3868
             TKDI RLRGGWP+QDAF AFSQH VLS  FLEHVISV   +P +    + KG+ S + V+
Sbjct  1044  TKDISRLRGGWPMQDAFCAFSQHSVLSILFLEHVISVPTHTP-VNRNIAEKGDGSSHGVN  1102

Query  3869  GSIEDDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPL  4048
                E+++ +A++ ALTAFFRGGGK G+K V+QSYASVLA LTL LG+CHGLAS G  EPL
Sbjct  1103  KFCENEILQASIFALTAFFRGGGKVGKKAVQQSYASVLAALTLQLGSCHGLASSGQPEPL  1162

Query  4049  RALLNAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICLF  4228
             RALL AFQAFCECVGDLEMGKILAR GEQ++ EKW+NLIG++AG +SIKRPKEVP ICL 
Sbjct  1163  RALLIAFQAFCECVGDLEMGKILARDGEQSQIEKWVNLIGDIAGCVSIKRPKEVPAICLI  1222

Query  4229  LSKSLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGL  4408
             LSKSLD     +REAAAAALSEF+RYSDG+  LL QMVEALCRHVSDD  +VR LCLRGL
Sbjct  1223  LSKSLDEHQNFEREAAAAALSEFVRYSDGYDCLLEQMVEALCRHVSDDLASVRGLCLRGL  1282

Query  4409  VQMPSIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSIR  4588
             VQ+PSIH+ QY  Q+LGVILALL+DSDESVQ TA S L++VL+SS  ++VEPVLLNL++R
Sbjct  1283  VQIPSIHIHQYAAQVLGVILALLEDSDESVQQTAASSLIMVLDSSPGESVEPVLLNLAVR  1342

Query  4589  LRNLQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQA  4768
             +RNLQV +N KIRA + AAFGALS++  G+  D+F EQ+HA  PR+VLHLHDDD+ +R+A
Sbjct  1343  VRNLQVSMNTKIRATSIAAFGALSNFADGTQHDAFLEQVHAVLPRLVLHLHDDDISIREA  1402

Query  4769  CRNTLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSAI  4948
             CR TLK IA  +++     LL TH F SDHRSDYEDF+R+L R  TQ+L  R+ +Y++  
Sbjct  1403  CRKTLKQIASFVDVQGTSPLLTTHYFLSDHRSDYEDFVRNLTRHFTQHLASRIGSYMATA  1462

Query  4949  IQAFDAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATCS  5128
             IQAFDAPWP+IQANA+Y CS MLS +D++ I ALYYSQVFG+LV K S+STDA+VRA CS
Sbjct  1463  IQAFDAPWPIIQANAMYFCSRMLSQTDDQRILALYYSQVFGMLVSKLSHSTDALVRAACS  1522

Query  5129  AALGLLLKSPNSSSWRDARLNK  5194
              +LG+LLKS  S SW  ARL++
Sbjct  1523  LSLGILLKSSYSHSWTSARLDQ  1544



>gb|AES81930.2| HEAT repeat 7A-like protein [Medicago truncatula]
Length=1714

 Score =  2063 bits (5344),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1091/1519 (72%), Positives = 1275/1519 (84%), Gaps = 22/1519 (1%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             A WQYS DF  +   D DV+SFLNSAFELLLRVWA SRDLKVR+++VEALGQMVGLITRT
Sbjct  197   AAWQYSTDFPSNLPQDGDVMSFLNSAFELLLRVWAASRDLKVRVASVEALGQMVGLITRT  256

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstl  1003
             QLKAALPRLVPTILELYK++ D AF+ATCSLH+LLNASLLS +GPP+LDFEDLT+ L TL
Sbjct  257   QLKAALPRLVPTILELYKKDLDVAFLATCSLHNLLNASLLSESGPPMLDFEDLTLTLGTL  316

Query  1004  llvCS-NNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGS  1180
             L V S N++ K+ +DF VGLK YNEVQHCFLTVG VYP+DLF+FL+NKCRLKEE  TFG+
Sbjct  317   LPVISMNSESKDQTDFSVGLKMYNEVQHCFLTVGLVYPDDLFLFLVNKCRLKEEASTFGA  376

Query  1181  LCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGE  1360
             LCVLKHLLPRL+E+WH K P+L+E+VK L++EHNLGVRKAL+ELIVVMASHCYLVGSSGE
Sbjct  377   LCVLKHLLPRLSEAWHGKIPLLVEAVKSLLEEHNLGVRKALSELIVVMASHCYLVGSSGE  436

Query  1361  LFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKG  1540
             LFIEYL+RHCA+ D    +L+S                +++E K GAVT  ELR VCEKG
Sbjct  437   LFIEYLIRHCALTDKNQSDLDS-------------IPNKRIEMKIGAVTPGELRTVCEKG  483

Query  1541  LLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKAR  1720
             LLL+T+T+PEMEH+LWPFLLKMIIP+ YTGAVA VCRCISEL R RS  S+ MLSECK R
Sbjct  484   LLLVTITIPEMEHILWPFLLKMIIPQTYTGAVAMVCRCISELWRHRSYGSD-MLSECKTR  542

Query  1721  TDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKA  1900
              DIP  EEL AR VVLLH+PLARE L TQIL+VL  LAPLFPKNIN FWQDE  IPKMKA
Sbjct  543   PDIPTAEELLARFVVLLHDPLAREQLATQILTVLCLLAPLFPKNINLFWQDE--IPKMKA  600

Query  1901  YVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHS  2080
             YVSDT+DLKQDP YQ++WDDMII+FLAESLDVIQ+ DW++ LGN FA+ YELY SD+EH+
Sbjct  601   YVSDTDDLKQDPSYQDTWDDMIINFLAESLDVIQDADWIMSLGNVFAKHYELYTSDDEHA  660

Query  2081  ALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDK  2260
             ALLHRCLGILLQKV+DRAYV  K++ MY+ +NIA+P NRLGLAKAMGLVAASHLDTVL+K
Sbjct  661   ALLHRCLGILLQKVNDRAYVHDKMNWMYKHSNIAIPINRLGLAKAMGLVAASHLDTVLEK  720

Query  2261  LKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALV  2440
             LK I+DNVGQ+I+QRI S FSD  +  ESDD HAALALMYGYAAKYAP +VIEARI+ALV
Sbjct  721   LKDIIDNVGQTIIQRILSLFSDSYRTVESDDIHAALALMYGYAAKYAPSSVIEARINALV  780

Query  2441  GTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRD  2620
             GTNMLSRLLHVRHP AKQAVITAIDLLG AVI A+ESG  FPLKRRD LLDYILTLMGRD
Sbjct  781   GTNMLSRLLHVRHPIAKQAVITAIDLLGNAVINAAESGAPFPLKRRDQLLDYILTLMGRD  840

Query  2621  EEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVIN  2800
             + +GF D N ELL TQ+LA+SACTTLV+VEPKLT ETRN +MKAT+GFF + NDP +V+ 
Sbjct  841   DNDGFVDYN-ELLRTQALAISACTTLVTVEPKLTVETRNYVMKATLGFFAIQNDPVEVVT  899

Query  2801  PLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIK  2980
             PLIDNLI+LLC IL+T GEDGRSRAE L+ ILR ID FVSS +EYQRKRGCLA HE+L+K
Sbjct  900   PLIDNLISLLCAILLTGGEDGRSRAELLMLILRQIDQFVSSPVEYQRKRGCLAVHEMLLK  959

Query  2981  FRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPRC  3160
             FR +CV+GYCALG  G+ +H+KQID     N S LPSAF LP+R+AL LG+R+++YLPRC
Sbjct  960   FRMVCVSGYCALGSHGNSAHTKQIDRTLYGNFSKLPSAFVLPNREALCLGDRVIMYLPRC  1019

Query  3161  IDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGI-DIELSYIALSSLEDVVAILRSDAS  3337
              DTN EVRK+S QIL+  F+IS SLPKP   S+   DIELSY ALSSLEDV+A+LR+D S
Sbjct  1020  ADTNSEVRKISAQILDQLFSISLSLPKPPGLSISAEDIELSYRALSSLEDVIAMLRNDTS  1079

Query  3338  IDPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNEL  3517
             IDPSEVFNR++SS+C LL +DELVA LHGCS AICDKIKQSAEGAIQAVVEFVT RG+EL
Sbjct  1080  IDPSEVFNRIISSLCILLTRDELVAMLHGCSVAICDKIKQSAEGAIQAVVEFVTRRGSEL  1139

Query  3518  NEIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMVTKD  3697
              EI++SRT+QSL++A VH T+K+LR ETLGAI  +AE+T++K VF EVLA AG+D+VTKD
Sbjct  1140  TEIDISRTTQSLISATVHATDKHLRVETLGAIACLAESTSAKTVFDEVLATAGKDIVTKD  1199

Query  3698  IHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSVDGSI  3877
             I RLRGGWP+QDAF+AFSQH+VLS  FLEHVISVI+Q P LK  D  + E S+  V    
Sbjct  1200  ISRLRGGWPMQDAFYAFSQHMVLSVLFLEHVISVISQIPILKC-DVDRVEDSQ--VHNHT  1256

Query  3878  EDDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPLRAL  4057
             ED    AA+ ALTAFFRGGGK G++ VEQ+YASVL+ L L LG+CHGLAS G  EPLR L
Sbjct  1257  EDGKLEAAIFALTAFFRGGGKVGKRAVEQNYASVLSELMLQLGSCHGLASSGHLEPLRNL  1316

Query  4058  LNAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICLFLSK  4237
             L AFQAFCECVGDLEMGKILAR GE +ENE+WINLIG++AG ISIKRPKE+  IC FL +
Sbjct  1317  LTAFQAFCECVGDLEMGKILARDGELSENERWINLIGDIAGCISIKRPKEIQNICQFLKR  1376

Query  4238  SLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQM  4417
             SLDRP + QREAAAAALSEF+RYS G G LL QMV+ +CR VSD+S TVRR CLRGLVQ+
Sbjct  1377  SLDRPQKYQREAAAAALSEFVRYSGGLGSLLEQMVDVVCRRVSDESSTVRRFCLRGLVQI  1436

Query  4418  PSIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSIRLRN  4597
             PSIH+L+YT Q+LGVILALLDDSDESVQLTAVSCLL++LESS  DAVEP+LLNL +RLRN
Sbjct  1437  PSIHILKYTAQVLGVILALLDDSDESVQLTAVSCLLMILESSPDDAVEPILLNLLLRLRN  1496

Query  4598  LQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACRN  4777
             LQ  +NAK+RA++FA FGALS+YG G + ++F EQ+HAA PR+VLHLHD+D+ VR ACRN
Sbjct  1497  LQTSMNAKMRASSFAVFGALSNYGIGELKEAFVEQVHAAIPRLVLHLHDEDVSVRLACRN  1556

Query  4778  TLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSAIIQA  4957
             TL+ + PL+EI+ + ALLNT  F SDHRSDYEDFLRD+A+Q TQ+L  RVDTY+++ +QA
Sbjct  1557  TLRRVFPLMEIEGLLALLNTPSFLSDHRSDYEDFLRDIAKQFTQHLLSRVDTYMASTVQA  1616

Query  4958  FDAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATCSAAL  5137
             FDAPWP+IQANA+YL SSMLSLSDN++I A Y++QVFG+LVGK S S DA+VRATCSAAL
Sbjct  1617  FDAPWPIIQANAMYLSSSMLSLSDNQHILADYHTQVFGMLVGKMSRSPDAVVRATCSAAL  1676

Query  5138  GLLLKSPNSSSWRDARLNK  5194
             GLLLKS NS SWR   L++
Sbjct  1677  GLLLKSSNSCSWRAVHLDR  1695


 Score =   260 bits (665),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = +1

Query  91   SIPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGNIA  270
            SIPA EA+QV++S LADDS SVR++SMS+L D+ +LNP+LVL+CC  VSRGGRRRFGNIA
Sbjct  6    SIPAPEAIQVLLSLLADDSSSVRKSSMSSLNDLAALNPVLVLECCAAVSRGGRRRFGNIA  65

Query  271  GLFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLP  450
            G+FQV++V +RALD+ DVD AFM KLAKIAT+E+IS+KELN+DWQRAA  +LV++GSHLP
Sbjct  66   GVFQVMAVGVRALDERDVDSAFMAKLAKIATSEMISSKELNSDWQRAATSLLVAIGSHLP  125

Query  451  DLMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIYRP  630
            DL+MEEIFLH +G++SAL AMVQILA++ASS  L F PR KGVL+R++PILGNVR+++RP
Sbjct  126  DLVMEEIFLHLTGTSSALQAMVQILAEFASSSPLLFIPRWKGVLSRILPILGNVRDMHRP  185

Query  631  IFANGL  648
             FAN  
Sbjct  186  TFANAF  191



>ref|XP_010654001.1| PREDICTED: protein SHOOT GRAVITROPISM 6 isoform X2 [Vitis vinifera]
Length=1556

 Score =  2048 bits (5305),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1053/1346 (78%), Positives = 1191/1346 (88%), Gaps = 4/1346 (0%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             A WQYS+DF  ++ LD DV+SFLNSAFELLLRVWA SRDLKVR+S+VEALGQMVGLITR 
Sbjct  200   ASWQYSMDFPSTSPLDADVMSFLNSAFELLLRVWATSRDLKVRVSSVEALGQMVGLITRA  259

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstl  1003
             QLKAALPRLVPTILELYK++ D AF+ATCSLH+LLNASLLS NGPPLLDFE+L V+LSTL
Sbjct  260   QLKAALPRLVPTILELYKKDLDIAFLATCSLHNLLNASLLSENGPPLLDFEELMVILSTL  319

Query  1004  l-lvCSNNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGS  1180
             L +VC NND KE SDF VGLKTYNEVQHCFLTVG VYPEDLF+FLLNKCRL EEP TFG+
Sbjct  320   LPVVCINNDSKEQSDFSVGLKTYNEVQHCFLTVGLVYPEDLFMFLLNKCRLNEEPLTFGA  379

Query  1181  LCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGE  1360
             LCVLKHLLPRL+E+WH+KRP+L+E+VKLL+DE  LGVRKAL+EL+V+MASHCYLVG SGE
Sbjct  380   LCVLKHLLPRLSEAWHSKRPLLVEAVKLLLDEQILGVRKALSELVVIMASHCYLVGPSGE  439

Query  1361  LFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKG  1540
             LF+EYLVR+CA+ D E+  LE+S+E  R   N Y   Y++LE K+GAV  TELR +CEKG
Sbjct  440   LFVEYLVRNCALSDQESYALENSKEVIRSNNNNYGCQYKRLEVKSGAVCLTELRSICEKG  499

Query  1541  LLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKAR  1720
             LLL+T+T+PEMEH+LWPFLLKMIIPR YTGA ATVCRCISELCR  SS +N MLSECKAR
Sbjct  500   LLLLTITIPEMEHILWPFLLKMIIPRAYTGAAATVCRCISELCRHGSSYANTMLSECKAR  559

Query  1721  TDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKA  1900
              DIP PEELFARLVVLLHNPLARE L TQ+L+VL+YLAPLFPKNIN FWQDE  IPKMKA
Sbjct  560   IDIPNPEELFARLVVLLHNPLAREQLATQVLTVLYYLAPLFPKNINLFWQDE--IPKMKA  617

Query  1901  YVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHS  2080
             YVSDT+DLKQDP YQE+WDDMII+FLAESLDVIQ+ +WV+ LGN F+RQYELY SD+EHS
Sbjct  618   YVSDTDDLKQDPSYQETWDDMIINFLAESLDVIQDTEWVISLGNAFSRQYELYTSDDEHS  677

Query  2081  ALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDK  2260
             ALLHRCLGILLQKV DR YV  KI+ MY QANIA P+NRLGLAKAMGLVAASHLDTVL+K
Sbjct  678   ALLHRCLGILLQKVDDRLYVLEKINWMYTQANIAFPSNRLGLAKAMGLVAASHLDTVLEK  737

Query  2261  LKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALV  2440
             LK ILDNVGQSI QRI SFFSDRG+MEESDD HAALALMYGYAA+YAP TVIEARIDALV
Sbjct  738   LKDILDNVGQSIFQRILSFFSDRGRMEESDDIHAALALMYGYAARYAPSTVIEARIDALV  797

Query  2441  GTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRD  2620
             GTNMLSRLLHVRHP AKQAVITAIDLLG+AVI A+ESG SFPLKRRD LLDYILTLMG D
Sbjct  798   GTNMLSRLLHVRHPTAKQAVITAIDLLGRAVINAAESGASFPLKRRDQLLDYILTLMGCD  857

Query  2621  EEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVIN  2800
             +++GF++S++ELLHTQ+LALSACTTLVSVEPKLT ETRN +MKAT+GFF LPN+PSDV++
Sbjct  858   DDDGFAESSLELLHTQALALSACTTLVSVEPKLTIETRNHVMKATLGFFALPNEPSDVVD  917

Query  2801  PLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIK  2980
             PLIDNLITLLC IL+TSGEDGRSRAEQLLHILR ID +VSS LEYQRKR CLA +E+L+K
Sbjct  918   PLIDNLITLLCAILLTSGEDGRSRAEQLLHILRQIDQYVSSPLEYQRKRSCLAVYEMLLK  977

Query  2981  FRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPRC  3160
             F+++CV+GYCALGC GSC+HSK ID   + N SNLPSAF LPSRD+L LG R+++YLPRC
Sbjct  978   FKSVCVSGYCALGCHGSCTHSKHIDRTLHGNFSNLPSAFVLPSRDSLCLGNRVIMYLPRC  1037

Query  3161  IDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILRSDASI  3340
              DTN EVRK+S QIL+LFF+IS SLP+P+ SS G+DIELSY ALSSLEDV+AILRSDASI
Sbjct  1038  ADTNSEVRKISAQILDLFFSISLSLPRPVGSSFGVDIELSYSALSSLEDVIAILRSDASI  1097

Query  3341  DPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNELN  3520
             DPSEVFNRVVSSVC LL KDELVAALH C+GAICDKIKQSAEGAIQAV +FV  RG+ELN
Sbjct  1098  DPSEVFNRVVSSVCVLLTKDELVAALHYCTGAICDKIKQSAEGAIQAVTDFVMKRGHELN  1157

Query  3521  EIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMVTKDI  3700
             E++VSRT+QSLL+A  HVTEKYLRQETL AI S+AENT+SK+VF EVL  A RD+VTKDI
Sbjct  1158  EMDVSRTTQSLLSAAAHVTEKYLRQETLAAISSLAENTSSKIVFNEVLTTAARDIVTKDI  1217

Query  3701  HRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSVDGSIE  3880
              RLRGGWP+QDAF+AFSQH+VLS+ FLEHVISV++QSP +K  D  KG+SS + VD  IE
Sbjct  1218  SRLRGGWPMQDAFYAFSQHIVLSYMFLEHVISVLSQSPIVK-DDPEKGDSSSHRVDSHIE  1276

Query  3881  DDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPLRALL  4060
             D++ +AA+ ALTAFFRGGGK G+K VEQSYASVLA LTL LG+CHGLA+ G+QEPLRALL
Sbjct  1277  DNILQAAIFALTAFFRGGGKIGKKAVEQSYASVLAALTLQLGSCHGLATSGEQEPLRALL  1336

Query  4061  NAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICLFLSKS  4240
              AFQAFCECVGDLEMGKILAR GEQNENEKWINLIG+LAG ISIKRPKEVPTICL L+KS
Sbjct  1337  IAFQAFCECVGDLEMGKILARDGEQNENEKWINLIGDLAGCISIKRPKEVPTICLILTKS  1396

Query  4241  LDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQMP  4420
             LDR    QREAAAAALSEF+RYSDG   LL QMVEALCRH SDDSPTVR LCLRGLVQ+P
Sbjct  1397  LDRHQGFQREAAAAALSEFVRYSDGLDSLLEQMVEALCRHASDDSPTVRCLCLRGLVQIP  1456

Query  4421  SIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSIRLRNL  4600
             SIH+LQYT Q+LGVI+ALL+DSDESVQLTAVSCLL VLESS  DAVEP+L+NLS+R+RNL
Sbjct  1457  SIHILQYTNQVLGVIMALLEDSDESVQLTAVSCLLKVLESSPNDAVEPILINLSVRIRNL  1516

Query  4601  QVCLNAKIRANAFAAFGALSSYGAGS  4678
             Q+C N K+RANAFA  G+LS+YG G+
Sbjct  1517  QICTNVKMRANAFAGLGSLSNYGVGA  1542


 Score =   305 bits (781),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 145/188 (77%), Positives = 170/188 (90%), Gaps = 0/188 (0%)
 Frame = +1

Query  85   GDSIPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGN  264
            G+SIPA EAVQV+VSSL D+S  VR ASM+AL+DI ++NPLLVL+CC  VSRGGRRRFGN
Sbjct  7    GNSIPAPEAVQVLVSSLGDESHVVRAASMAALRDIAAINPLLVLECCCAVSRGGRRRFGN  66

Query  265  IAGLFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSH  444
            ++GLFQV++ A+RAL+K DVDP FM KLAKIATAE+IS+KEL+ADWQRAAAG+LVS+GSH
Sbjct  67   MSGLFQVMASAVRALEKRDVDPPFMAKLAKIATAEMISSKELSADWQRAAAGLLVSIGSH  126

Query  445  LPDLMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIY  624
            LPDLMMEEIFLH  G NSALPAMVQILAD+AS+DALQFTPRLKGVL+RV+PILGNVR+ +
Sbjct  127  LPDLMMEEIFLHLPGPNSALPAMVQILADFASADALQFTPRLKGVLSRVLPILGNVRDAH  186

Query  625  RPIFANGL  648
            RPIFAN  
Sbjct  187  RPIFANAF  194



>gb|KHN02293.1| HEAT repeat-containing protein 7A like [Glycine soja]
Length=1755

 Score =  2045 bits (5299),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1088/1519 (72%), Positives = 1257/1519 (83%), Gaps = 43/1519 (3%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             A WQYS+DF      D DV+SFLNSAFELLLRVWA SRDLKVR+++VEALGQMVGLITRT
Sbjct  263   AAWQYSIDFPSHFPQDGDVMSFLNSAFELLLRVWAASRDLKVRVASVEALGQMVGLITRT  322

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstl  1003
             QLK ALPRL+PTIL+LYK++QD AF+ATCSLH+LLNASLLS +GPP+LDFEDLT+VLSTL
Sbjct  323   QLKTALPRLIPTILDLYKKDQDIAFLATCSLHNLLNASLLSESGPPMLDFEDLTLVLSTL  382

Query  1004  llvCS-NNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGS  1180
             L V S NND K+ SDFPVGLK YNEVQHCFLTVG VYP+DLF+FL+NKCRL+EEP TFGS
Sbjct  383   LPVVSFNNDSKDQSDFPVGLKMYNEVQHCFLTVGLVYPDDLFLFLVNKCRLREEPLTFGS  442

Query  1181  LCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGE  1360
             LC+LKHLLPRL+E+WH+K P+L+E+VK L++E NLGVRKAL+ELIVVMASHCYLVGSSGE
Sbjct  443   LCILKHLLPRLSEAWHSKIPLLVEAVKSLLEEQNLGVRKALSELIVVMASHCYLVGSSGE  502

Query  1361  LFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKG  1540
             LFIEYLVRHCA+ D    +LES+               +++E K GAVT  ELR VCEKG
Sbjct  503   LFIEYLVRHCAITDQNRSDLESTPN-------------KRIEMKIGAVTPGELRAVCEKG  549

Query  1541  LLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKAR  1720
             LLL+T+T+PEMEH+LWPFLL+MIIP  YTGAVATVCRCISEL R RS  SN MLSECK R
Sbjct  550   LLLVTITIPEMEHILWPFLLRMIIPLTYTGAVATVCRCISELWRHRSY-SNDMLSECKTR  608

Query  1721  TDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKA  1900
              DIP  EEL ARL+VLLHNPLARE L TQIL+                      IPKMKA
Sbjct  609   PDIPSAEELLARLLVLLHNPLAREQLATQILT----------------------IPKMKA  646

Query  1901  YVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHS  2080
             YVSDTEDLKQDP YQ++WDDMII+FLAESLDVIQ+ DWV+ LGN FA+ YELY SD++H+
Sbjct  647   YVSDTEDLKQDPSYQDTWDDMIINFLAESLDVIQDADWVMSLGNVFAKHYELYASDDQHT  706

Query  2081  ALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDK  2260
             ALLHRCLGILLQKV+DRAYV  KID MY+QANIA PTNRLGLAKAMGLVAASHLDTVL+K
Sbjct  707   ALLHRCLGILLQKVNDRAYVCDKIDWMYKQANIANPTNRLGLAKAMGLVAASHLDTVLEK  766

Query  2261  LKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALV  2440
             LK ILDNVGQSI QRI S FSD  + EESDD HAALALMYGYAAKYAP TVIEARI+ALV
Sbjct  767   LKDILDNVGQSIFQRILSLFSDSFRTEESDDIHAALALMYGYAAKYAPSTVIEARINALV  826

Query  2441  GTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRD  2620
             GTNMLSRLLHVR P+AKQAVITAIDLLG AVI A+ESG  FPLKRRD LLDYILTLMGRD
Sbjct  827   GTNMLSRLLHVRLPKAKQAVITAIDLLGNAVINAAESGSPFPLKRRDQLLDYILTLMGRD  886

Query  2621  EEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVIN  2800
             +E+GF+D N +LL TQ+LA+SACTTLVSVEPKLT ETR+ +MKAT+GFF +PNDP DV+N
Sbjct  887   DEDGFADYN-DLLRTQALAISACTTLVSVEPKLTVETRSHVMKATLGFFAIPNDPVDVVN  945

Query  2801  PLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIK  2980
             PLIDNLITLLC IL+T GEDGRSRAE L+ ILR ID FV S +EYQRKRGCLA HE+L+K
Sbjct  946   PLIDNLITLLCAILLTGGEDGRSRAELLMLILRQIDQFVCSPVEYQRKRGCLAVHEMLLK  1005

Query  2981  FRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPRC  3160
             FR ICV+GYCALGC+GSC+H+KQ+D     N S LPSAF LPSR+AL LG+R+++YLPRC
Sbjct  1006  FRMICVSGYCALGCRGSCAHNKQMDRTLYGNFSKLPSAFVLPSREALCLGDRVIMYLPRC  1065

Query  3161  IDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGI-DIELSYIALSSLEDVVAILRSDAS  3337
              DTN EVRK+S QIL+L F+IS SLP+P  SS+   DIELSY ALSSLEDV+AILR+ +S
Sbjct  1066  ADTNSEVRKISAQILDLLFSISLSLPRPAGSSISAEDIELSYSALSSLEDVIAILRNVSS  1125

Query  3338  IDPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNEL  3517
             +     +   + + C L N  +LVA LHGCS AICDKIKQSAEGAIQAVVEFVT RG EL
Sbjct  1126  LITLFHYLAFIINNC-LGNHVQLVATLHGCSVAICDKIKQSAEGAIQAVVEFVTKRGREL  1184

Query  3518  NEIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMVTKD  3697
              EI++SRT+QSL++A VH T+K+LR ETLGAI S+AENT+ + VF EVLAAAGRD +TKD
Sbjct  1185  TEIDISRTTQSLISATVHATDKHLRVETLGAISSLAENTSPRTVFDEVLAAAGRDTITKD  1244

Query  3698  IHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSVDGSI  3877
             I RLRGGWP+QDAF+AFSQH+VLS  FLEHVISV++Q P LKG D  + E S+  VD   
Sbjct  1245  ISRLRGGWPMQDAFYAFSQHMVLSVLFLEHVISVLSQIPILKG-DVERLEDSQ--VDSHT  1301

Query  3878  EDDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPLRAL  4057
             ED   +AA+ ALTAFFRGGGK G++ VEQ+YASVL+ LTL LG+CHGL   G  EPLR L
Sbjct  1302  EDGKLQAAIFALTAFFRGGGKVGKRAVEQNYASVLSELTLQLGSCHGLTYSGQHEPLRNL  1361

Query  4058  LNAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICLFLSK  4237
             L AFQAFCECVGDLEMGKILAR GE  ENE+WI+LIG++AG ISIKRPKEV  ICLF   
Sbjct  1362  LTAFQAFCECVGDLEMGKILARDGELLENERWISLIGDIAGCISIKRPKEVQNICLFFQN  1421

Query  4238  SLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQM  4417
             SLDRP + QREAAAAALSEF+RYS G G LL QMVE LCRHVSD+S TVRRLCLRGLVQ+
Sbjct  1422  SLDRPQKYQREAAAAALSEFVRYSGGLGSLLEQMVEVLCRHVSDESSTVRRLCLRGLVQI  1481

Query  4418  PSIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSIRLRN  4597
             P IH+L+YT Q+LGVILALLDD DESVQLTAVSCLL++L SS  DAVEP+LLNLSIRLRN
Sbjct  1482  PLIHILKYTAQVLGVILALLDDLDESVQLTAVSCLLMILNSSPDDAVEPILLNLSIRLRN  1541

Query  4598  LQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACRN  4777
             LQ  +NAK+RA +FA FGALS YG G + ++F EQ+HAA PR+VLHLHD+D  VR ACRN
Sbjct  1542  LQTSMNAKMRATSFAVFGALSKYGIGVLSEAFVEQVHAAVPRLVLHLHDEDFSVRLACRN  1601

Query  4778  TLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSAIIQA  4957
             TLK + PL+EI+ + A+LNTH F SDHRSDYEDFLRD+A+Q TQ+L  RVD+Y+++ +QA
Sbjct  1602  TLKQVCPLMEIEGMLAVLNTHSFLSDHRSDYEDFLRDIAKQFTQHLPSRVDSYMASTVQA  1661

Query  4958  FDAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATCSAAL  5137
             FDAPWP+IQANA+Y CSSMLSLSDN++I A+Y+SQVFG+LVGK S S DA+VRAT SAAL
Sbjct  1662  FDAPWPIIQANAIYFCSSMLSLSDNQHILAVYHSQVFGMLVGKLSRSPDAVVRATSSAAL  1721

Query  5138  GLLLKSPNSSSWRDARLNK  5194
             GLLLKS +  SWR   L++
Sbjct  1722  GLLLKSSHLCSWRAVELDR  1740


 Score =   244 bits (622),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = +1

Query  199  NPLLVLDCCLTVSRGGRRRFGNIAGLFQVISVAIRALDKGDVDPAFMMKLAKIATAEVIS  378
            NPLLVLDCC  VSRGGRRRFGN+AG+FQV++  +RALDK DVD AFM KLAKIATAE+IS
Sbjct  108  NPLLVLDCCAVVSRGGRRRFGNMAGVFQVMAFGVRALDKKDVDSAFMAKLAKIATAELIS  167

Query  379  TKELNADWQRAAAGVLVSVGSHLPDLMMEEIFLHFSGSNSALPAMVQILADYASSDALQF  558
            +KELN+DWQRAA  +LV++GSHLPDLMMEEI+LH SG+NSAL +MVQILA++AS+D LQF
Sbjct  168  SKELNSDWQRAATSLLVAIGSHLPDLMMEEIYLHLSGANSALQSMVQILAEFASTDPLQF  227

Query  559  TPRLKGVLARVVPILGNVREIYRPIFANGL  648
             P  KGVL+R++PILGNVR+++RPIFAN  
Sbjct  228  IPHWKGVLSRILPILGNVRDMHRPIFANAF  257



>ref|XP_010918718.1| PREDICTED: protein SHOOT GRAVITROPISM 6 [Elaeis guineensis]
Length=1721

 Score =  2036 bits (5274),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1030/1518 (68%), Positives = 1250/1518 (82%), Gaps = 4/1518 (0%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             A WQY  DF    +LD+DV+SF+NS FELLLRVWA SRDLKVRLS+VEALGQMVGL+TR+
Sbjct  198   AAWQYIGDFPSDPLLDSDVMSFMNSVFELLLRVWASSRDLKVRLSSVEALGQMVGLVTRS  257

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvl-st  1000
             QLKAALPRL+PTIL+LYK++ + AF+A+CSLH+LL A LLS +GPPLLDFE+L V+L + 
Sbjct  258   QLKAALPRLIPTILDLYKKDHEIAFLASCSLHNLLTACLLSESGPPLLDFEELKVILCTL  317

Query  1001  lllvCSNNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGS  1180
             + +VC NN   + S+F +GLKTYNE+QHCFL +GSVYP+DL VFLL+ C+ K+EP   G+
Sbjct  318   IPVVCVNNSNDDCSNFSMGLKTYNEIQHCFLVIGSVYPDDLCVFLLDICQSKDEPSIIGA  377

Query  1181  LCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGE  1360
             LCV+KHLLPRL E+WH KR +L+E VK L+DE + GVRKALAELIV+MASHCYL G   E
Sbjct  378   LCVIKHLLPRLLETWHGKRTLLVEVVKSLLDEQSWGVRKALAELIVIMASHCYLSGPPAE  437

Query  1361  LFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKG  1540
             LFIEYLVRHCA  + E  + ++S+E +  +G + PF Y+KLE   G V   +LR +CEKG
Sbjct  438   LFIEYLVRHCATTEDEVRDFKASKEVTWRSGPFQPFQYKKLEVMMGPVCPVKLRAICEKG  497

Query  1541  LLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKAR  1720
             LLL+ +T+PEME++LWPF+LKMIIP+ YTGAVATVC+CI+ELCR RSS ++   SE    
Sbjct  498   LLLLAITIPEMEYILWPFILKMIIPKKYTGAVATVCKCITELCRHRSSRNSFTFSESNTS  557

Query  1721  TDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKA  1900
              DIP PE+LFARLVVLLH+PLAR  L TQIL+VL YL PLFPKN++ FWQDE  +PKMKA
Sbjct  558   NDIPNPEDLFARLVVLLHDPLARAQLATQILTVLCYLGPLFPKNLSLFWQDE--VPKMKA  615

Query  1901  YVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHS  2080
             Y+SD EDLKQD  YQE+WDDMII+FLAESLDV+++ +WV+ LG  FARQY LY + +EHS
Sbjct  616   YISDPEDLKQDSSYQETWDDMIINFLAESLDVVRDTEWVISLGKAFARQYALYAAADEHS  675

Query  2081  ALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDK  2260
             ALLHRCLG+LLQKV DR YVR KI+ MY+ A+I+VPTNRLGLAK MGLVAASHLDTVL+K
Sbjct  676   ALLHRCLGMLLQKVDDRIYVREKIEWMYKHADISVPTNRLGLAKGMGLVAASHLDTVLEK  735

Query  2261  LKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALV  2440
             LK ILDNVG S  QR  SFFS R K+E++DDT+AALALMYGYAA+YAP TVIEARIDALV
Sbjct  736   LKNILDNVGYSRFQRFLSFFSSRSKVEDADDTYAALALMYGYAARYAPITVIEARIDALV  795

Query  2441  GTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRD  2620
             GTNMLSRLLHV++P AKQAVITAIDLLG+AVI ASE G+SFPLKRRD +LDY+LTLMGRD
Sbjct  796   GTNMLSRLLHVQNPTAKQAVITAIDLLGRAVINASEMGVSFPLKRRDQMLDYVLTLMGRD  855

Query  2621  EEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVIN  2800
             E E F DS+IE LHTQSLALS+CTTLVS+EP+L  ETRN +MKAT+ FF LP DPSD+++
Sbjct  856   ESEDFVDSSIEFLHTQSLALSSCTTLVSIEPRLPMETRNRVMKATLSFFALPRDPSDIVD  915

Query  2801  PLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIK  2980
             PLI NLITLLC IL+TSGEDGRSRAEQLLHILR +D +VSS +E+QR+RGCLA +ELL+K
Sbjct  916   PLISNLITLLCAILLTSGEDGRSRAEQLLHILRQVDSYVSSPMEHQRRRGCLAVYELLLK  975

Query  2981  FRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPRC  3160
             FRA+C  G C  GC  SC+HSKQID A  RN +NLPSAF LPSRD+LSLGERI+ YLPRC
Sbjct  976   FRALCSGGVCGFGCHSSCTHSKQIDRATQRNFANLPSAFVLPSRDSLSLGERIIAYLPRC  1035

Query  3161  IDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILRSDASI  3340
              DT+ EVRKV+VQI+ LFF+IS SLPK + SS  +D+E+SY ALSSLEDV++ILR DASI
Sbjct  1036  TDTSSEVRKVAVQIVGLFFSISLSLPKLVVSSSDLDLEVSYSALSSLEDVISILRRDASI  1095

Query  3341  DPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNELN  3520
             D SEVFNRV+SSVC LL KDELV ALH C+ AICDKIKQSA+GAIQAV+EF+T RGNELN
Sbjct  1096  DQSEVFNRVLSSVCVLLTKDELVIALHTCTAAICDKIKQSADGAIQAVIEFITKRGNELN  1155

Query  3521  EIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMVTKDI  3700
             E++V+RT+QSLL+A V V +K+ RQE L AI  +AENT S+VVF EVLAAAGRD+VTKD+
Sbjct  1156  EVDVARTTQSLLSATVSVIDKHSRQEVLNAISCLAENTNSRVVFNEVLAAAGRDIVTKDV  1215

Query  3701  HRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSVDGSIE  3880
              R+RGGWP+QDAF+AFSQH+VLS  FLE+V+SV+N++P LK  D  KG+ + + V+   +
Sbjct  1216  SRIRGGWPMQDAFYAFSQHVVLSVLFLEYVVSVLNRTPVLK-NDIDKGDHTTHPVELPND  1274

Query  3881  DDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPLRALL  4060
             + V +AA+LALTA FRGGGK G+K VEQSY+SVL+ LTL LG+ HGL+  G QE  RALL
Sbjct  1275  EHVLQAAILALTALFRGGGKTGKKAVEQSYSSVLSALTLQLGSWHGLSGLGQQEHSRALL  1334

Query  4061  NAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICLFLSKS  4240
              AFQ+FC+CVGD+EMGKILARGGE ++ EKWI+LI ++A   SIKRPKEV  IC+ LSK+
Sbjct  1335  TAFQSFCDCVGDIEMGKILARGGEHDDKEKWIDLIQDIANCTSIKRPKEVQPICMILSKA  1394

Query  4241  LDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQMP  4420
             L R  R QREAAAAALSEF+R+SDG   LL  MVEA+C HVSD+SPTVR LCLRGLVQ+P
Sbjct  1395  LSRHQRFQREAAAAALSEFIRHSDGVPSLLEHMVEAMCLHVSDESPTVRSLCLRGLVQIP  1454

Query  4421  SIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSIRLRNL  4600
               H+ +Y  Q+LGV++ALL+D+DESVQLTAV CLL VL SS  DAV+PVL+NLS+RLRNL
Sbjct  1455  DCHMPKYIAQVLGVVVALLEDADESVQLTAVQCLLTVLNSSPKDAVDPVLINLSVRLRNL  1514

Query  4601  QVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACRNT  4780
             Q+ +NAK+R+NAFAA+GALS YG GS   +F EQ+HA FPR++LHLHDDD+ VRQACRNT
Sbjct  1515  QISMNAKMRSNAFAAYGALSMYGIGSQHQAFLEQVHAIFPRLILHLHDDDVSVRQACRNT  1574

Query  4781  LKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSAIIQAF  4960
             L+ +APL+E+D   AL +   F+S+HRSDYEDF+RDL RQL Q L  RVD YL++ IQAF
Sbjct  1575  LRQLAPLMEVDGFSALFSKQVFNSEHRSDYEDFIRDLTRQLCQLLASRVDKYLASAIQAF  1634

Query  4961  DAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATCSAALG  5140
             DAPWPVIQANA+Y    MLSLSD++   A Y+SQVF +LVGK S S DA+VRATCS ALG
Sbjct  1635  DAPWPVIQANAIYFSCCMLSLSDDQRTLAPYFSQVFALLVGKMSRSPDAVVRATCSFALG  1694

Query  5141  LLLKSPNSSSWRDARLNK  5194
             +LLKS N  +W  ++L++
Sbjct  1695  MLLKSSNPLTWMVSQLDR  1712


 Score =   298 bits (763),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 138/186 (74%), Positives = 168/186 (90%), Gaps = 0/186 (0%)
 Frame = +1

Query  91   SIPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGNIA  270
            S+PA EAVQV+V+SL D+SP VREAS++ALK+I  LNPL+VLDCC  +SRGGRRRFGN+A
Sbjct  7    SLPAQEAVQVLVASLVDESPVVREASLAALKEIAPLNPLMVLDCCSAISRGGRRRFGNMA  66

Query  271  GLFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLP  450
            G+F V++ A+RA+D+ DVDPA+M KLAK+ATAE+I++KELNADWQRAAAG+LVS+GSH+P
Sbjct  67   GVFLVMACAVRAMDRKDVDPAYMAKLAKLATAEMITSKELNADWQRAAAGLLVSIGSHVP  126

Query  451  DLMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIYRP  630
            DLMMEEIFLH SG+NSALPAMVQILADYAS++ALQFTPRLK VL RV+PILGNVR+  RP
Sbjct  127  DLMMEEIFLHLSGTNSALPAMVQILADYASAEALQFTPRLKDVLLRVLPILGNVRDAQRP  186

Query  631  IFANGL  648
            +FAN  
Sbjct  187  VFANAF  192



>emb|CDY63988.1| BnaA04g21100D, partial [Brassica napus]
Length=1624

 Score =  2035 bits (5273),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1046/1521 (69%), Positives = 1252/1521 (82%), Gaps = 32/1521 (2%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             A W Y  D +  + LD+DV+SFLNS FELLLRVW  SRD KVR+S VEALGQMVGLITRT
Sbjct  117   AVWLYITDLTSDSPLDSDVMSFLNSVFELLLRVWTTSRDHKVRVSTVEALGQMVGLITRT  176

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstl  1003
             QLK+ALPRL+P ILELYK++ D A +ATCSL++LLNASLLS +GPPLL+FEDLT+VLSTL
Sbjct  177   QLKSALPRLIPAILELYKKDHDDALLATCSLYNLLNASLLSESGPPLLEFEDLTIVLSTL  236

Query  1004  llvCS-NNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGS  1180
             L V S N++ K HS   VG K YNEVQ CFLTVG VYPEDLF FLLNKC+LKE+  TFG+
Sbjct  237   LPVISINSENKRHSGSSVGRKAYNEVQRCFLTVGLVYPEDLFTFLLNKCKLKEDHLTFGA  296

Query  1181  LCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGE  1360
             LCVLKHLLPRL E+WH+KRP+LIE+ + L+DE +L VRKAL+ELIVVMASHCYLVG SGE
Sbjct  297   LCVLKHLLPRLLEAWHSKRPLLIEAARSLLDEQSLAVRKALSELIVVMASHCYLVGPSGE  356

Query  1361  LFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKG  1540
             LF+EYLVRH A+ +++N                       L+ K   ++ T+LR VC KG
Sbjct  357   LFVEYLVRHSAIGEIDN-----------------------LKAKGEPISPTQLRAVCGKG  393

Query  1541  LLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKAR  1720
             LLL+TVT+PEME++LWPFLLKMI+P+VYTGAVATVCRCISELCRRRSS +  ML ECKAR
Sbjct  394   LLLLTVTIPEMEYILWPFLLKMIVPKVYTGAVATVCRCISELCRRRSS-TTPMLIECKAR  452

Query  1721  TDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKA  1900
              DIP PEELF RLVVLLHNPLA+E L TQIL+VL YL+PLFPKNI+ FWQDE  IPKMKA
Sbjct  453   ADIPSPEELFTRLVVLLHNPLAKEQLATQILTVLNYLSPLFPKNISMFWQDE--IPKMKA  510

Query  1901  YVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHS  2080
             YV DTEDLK DP YQE+WDDMII+FLAESLDV  + DWV+ LGN FA+QY LY  D++H+
Sbjct  511   YVFDTEDLKLDPSYQENWDDMIINFLAESLDVTHDADWVISLGNAFAKQYNLYTPDDDHA  570

Query  2081  ALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDK  2260
             ALLHRC+GILLQKV+DRAYVR KID MY QA+I++P NRLGLAKAMGLVAASHLDTVL+K
Sbjct  571   ALLHRCMGILLQKVNDRAYVRDKIDWMYEQADISIPANRLGLAKAMGLVAASHLDTVLEK  630

Query  2261  LKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALV  2440
             LK ILDNVGQSI QRI S FS+  K E+SDD HAALALMYGYAAKYAP +VIEARIDALV
Sbjct  631   LKVILDNVGQSIFQRILSLFSESYKTEDSDDIHAALALMYGYAAKYAPSSVIEARIDALV  690

Query  2441  GTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRD  2620
             GTNMLSRLLHVR   AKQAVITAIDLLG+AVI ASESG +FPLKRRD++LDY+LTLMGRD
Sbjct  691   GTNMLSRLLHVRQQTAKQAVITAIDLLGRAVINASESGATFPLKRRDMMLDYVLTLMGRD  750

Query  2621  EEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVIN  2800
             E EGF++S++ELLHTQ+LAL+ACTTLVSVEPKLT ETRN +MKAT+GFF LPNDPSDVI 
Sbjct  751   ENEGFAESSLELLHTQALALNACTTLVSVEPKLTVETRNRVMKATLGFFALPNDPSDVIG  810

Query  2801  PLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIK  2980
             PLIDNL++LLC IL+TSGEDGRSRAEQLLH+LR +D +VSS ++YQRKRGC+A HE+L+K
Sbjct  811   PLIDNLVSLLCAILLTSGEDGRSRAEQLLHLLRQLDQYVSSPVDYQRKRGCMAVHEMLLK  870

Query  2981  FRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPRC  3160
             FR +CV GYCALGC G C H K +D +   N S LPS F  P R+ L LG+R++ YLPRC
Sbjct  871   FRKLCVAGYCALGCSGDCPHRKYVDRSMQGNFSTLPSVFLFPDREVLCLGDRVITYLPRC  930

Query  3161  IDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILRSDASI  3340
              DTN EVRK+S QIL+ FF+IS SLPK   SS G+D E SY ALSSLEDV+AIL+SDASI
Sbjct  931   ADTNSEVRKISAQILDQFFSISLSLPKAALSS-GLDSEKSYKALSSLEDVIAILKSDASI  989

Query  3341  DPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNELN  3520
             DPSEVFNR+VSS+C LL  DELVAALH C+ AICDKI+QSAEGAIQAV EFV+ RG++LN
Sbjct  990   DPSEVFNRIVSSICALLTVDELVAALHSCTPAICDKIRQSAEGAIQAVTEFVSRRGSQLN  1049

Query  3521  EIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMVTKDI  3700
             + ++SRT+QSLL+A VH+TEK LR E +GAI ++AENT S +VF+EVLA AG+D+VTKDI
Sbjct  1050  DNDISRTTQSLLSAAVHITEKSLRVEAIGAISALAENTQSSIVFSEVLATAGKDIVTKDI  1109

Query  3701  HRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGG---DSGKGESSRNSVDG  3871
              R+RGGWP+QDAF+AFSQH  LS SF+EH+ISV+N+S  +K     DS KG+++ +S + 
Sbjct  1110  TRMRGGWPMQDAFYAFSQHTELSVSFMEHLISVLNRSSLVKADSHKDSHKGDNTSSSSET  1169

Query  3872  SIEDDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPLR  4051
              +ED++ +AA+ ALTAFFRGGGK G+K VE+SY+SV+  LTL LG+CHGLAS G Q+PLR
Sbjct  1170  HVEDELLQAAIFALTAFFRGGGKTGKKAVEKSYSSVVGALTLQLGSCHGLASAGQQDPLR  1229

Query  4052  ALLNAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICLFL  4231
              LL +FQAFCECVGDLEMGKILAR GEQ E EKW++LIG++AG ISIKRPKEV  IC+ L
Sbjct  1230  VLLTSFQAFCECVGDLEMGKILARSGEQREKEKWVDLIGDIAGCISIKRPKEVQHICIIL  1289

Query  4232  SKSLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLV  4411
             +K+L+RP R QREAAAAALSEF+RYS  F  ++ +MVEALCRHVSDDSPTVRRLCLRGLV
Sbjct  1290  TKALNRPQRFQREAAAAALSEFIRYSGDFSSVMEEMVEALCRHVSDDSPTVRRLCLRGLV  1349

Query  4412  QMPSIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSIRL  4591
             QMPS  +  YTTQ++GVILALLDD DESVQLTAVSCLL+V ES+S DAVEP+LLNLS+RL
Sbjct  1350  QMPSACMNHYTTQVIGVILALLDDLDESVQLTAVSCLLMVTESASNDAVEPILLNLSVRL  1409

Query  4592  RNLQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQAC  4771
             RNLQ+ ++ K+RANAFAAFGALS Y  G   + F EQIH+  PR+V+HLHDDD  +RQAC
Sbjct  1410  RNLQISMDPKMRANAFAAFGALSKYATGGQREGFVEQIHSTLPRLVVHLHDDDPSIRQAC  1469

Query  4772  RNTLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSAII  4951
             R TLK  APL++I     L ++  F SDHR+DYE+F+R+L+R L  +   RVDTY+++ I
Sbjct  1470  RVTLKQFAPLMDIQNDSTLFDSRAFGSDHRNDYENFVRELSRHLV-HESERVDTYMASTI  1528

Query  4952  QAFDAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATCSA  5131
             QAFDAPWPVIQANA++  ++MLSLS+++++ + YY QVF  LV K + S D++VRA CS+
Sbjct  1529  QAFDAPWPVIQANAIHFSTTMLSLSEDQHMFSHYYPQVFETLVNKMTRSQDSVVRAACSS  1588

Query  5132  ALGLLLKSPNSSSWRDARLNK  5194
             A GLLL+S  S+ WR ARL++
Sbjct  1589  AFGLLLRSTKSTLWRGARLDR  1609


 Score =   184 bits (467),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = +1

Query  316  GDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLPDLMMEEIFLHFSGSN  495
            G+ D AFM KLAKIATAE+IS+KELNADWQR A+G+LVS+G+H PDLMMEE+FLH SG  
Sbjct  1    GESDEAFMGKLAKIATAEIISSKELNADWQRQASGLLVSIGTHFPDLMMEELFLHLSGPA  60

Query  496  SALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIYRPIFANGL  648
            SA PAMVQILAD+ASSDALQFTPRLK VL+RV+PILGNVR+++RPIFAN  
Sbjct  61   SASPAMVQILADFASSDALQFTPRLKDVLSRVLPILGNVRDVHRPIFANAF  111



>ref|XP_009604197.1| PREDICTED: protein SHOOT GRAVITROPISM 6 isoform X2 [Nicotiana 
tomentosiformis]
Length=1514

 Score =  2034 bits (5269),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1052/1299 (81%), Positives = 1155/1299 (89%), Gaps = 8/1299 (1%)
 Frame = +2

Query  617   KYTGQSLQMACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALG  796
             KY  QS    CWQ S+DF LS++LD D++SFLNSAFELLLRVWA+SRDLKVRLS+VEALG
Sbjct  195   KYWCQS----CWQCSIDFPLSSVLDADIMSFLNSAFELLLRVWAISRDLKVRLSSVEALG  250

Query  797   QMVGLITRTQLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFE  976
             QMVGLITRTQLKAALPRL+PTILELYKR+ D AFVATCSLH++LNASLLS +GPPLLD E
Sbjct  251   QMVGLITRTQLKAALPRLIPTILELYKRDHDVAFVATCSLHNVLNASLLSESGPPLLDLE  310

Query  977   Dltvvlstll-lvCSNNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRL  1153
             DLTV+LSTLL +VC +NDKKEHSDF VGLKTYNEVQHCFLT+G VYP DLFVFLLNKC+L
Sbjct  311   DLTVILSTLLPVVCRSNDKKEHSDFSVGLKTYNEVQHCFLTIGLVYPADLFVFLLNKCKL  370

Query  1154  KEEPFTFGSLCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASH  1333
             KEEP   G+LCVLKHLLPRL+E+WHNKRP+LIE VKLL+DE NLGV KALAELIVVMASH
Sbjct  371   KEEPQAVGALCVLKHLLPRLSEAWHNKRPLLIEVVKLLLDELNLGVCKALAELIVVMASH  430

Query  1334  CYLVGSSGELFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTT  1513
             CYLVG SGELFIEYLVRH AM  L   + E SRE +     YYPFVY+K E K    T +
Sbjct  431   CYLVGPSGELFIEYLVRHSAMFGLHRDDTERSRELNSSNDGYYPFVYKKTETKMEVGTLS  490

Query  1514  ELRGVCEKGLLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESN  1693
             ELR +CE GLLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVC+CISELCRRRSS+S 
Sbjct  491   ELRAICETGLLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCKCISELCRRRSSQSG  550

Query  1694  AMLSECKARTDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQD  1873
             A + ECKAR DIP PEELFARLVVLLHNPLARE L TQIL+VL YLAPLFPKN+N FWQD
Sbjct  551   AGVLECKARADIPHPEELFARLVVLLHNPLAREQLATQILTVLCYLAPLFPKNVNLFWQD  610

Query  1874  EL*IPKMKAYVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYE  2053
             E  IPKMKAYVSDTEDLKQDP YQESWDDMII+F+AESLDVIQ+VDW++ LGN F +QYE
Sbjct  611   E--IPKMKAYVSDTEDLKQDPSYQESWDDMIINFIAESLDVIQDVDWIISLGNAFEKQYE  668

Query  2054  LYKSDNEHSALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAA  2233
             LY  D+EHSALLHRCLGILLQKVHDRAYV AKI LMY+QANI +PTNRLGLAKAMGLVAA
Sbjct  669   LYSPDDEHSALLHRCLGILLQKVHDRAYVHAKIYLMYKQANITIPTNRLGLAKAMGLVAA  728

Query  2234  SHLDTVLDKLKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTV  2413
             SHLDTVLDKLK ILDNVG+SI QRI SFFSDRGKMEESDD HAALALMYGYAAKYAP TV
Sbjct  729   SHLDTVLDKLKDILDNVGKSIFQRILSFFSDRGKMEESDDIHAALALMYGYAAKYAPSTV  788

Query  2414  IEARIDALVGTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLD  2593
             IEARIDALVGTNMLSRLLHVRHP AKQAVITAIDLLGQAVI A+ESGISFPLKRRD LLD
Sbjct  789   IEARIDALVGTNMLSRLLHVRHPTAKQAVITAIDLLGQAVINAAESGISFPLKRRDQLLD  848

Query  2594  YILTLMGRDEEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGL  2773
             YILTLMG DEE+GFS+SN E L TQS ALSACTTLVSVEPKLTTETRNL+MKAT+GFFGL
Sbjct  849   YILTLMGSDEEDGFSESNTEHLRTQSFALSACTTLVSVEPKLTTETRNLVMKATVGFFGL  908

Query  2774  PNDPSDVINPLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGC  2953
             PN+P+DVI+PLI NLITLLCTIL+TSGEDGRSRAEQLLHILR +D +VSSSL+YQRKRGC
Sbjct  909   PNEPADVIDPLIGNLITLLCTILITSGEDGRSRAEQLLHILRKVDLYVSSSLDYQRKRGC  968

Query  2954  LAAHELLIKFRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGE  3133
             LAAHELL KFR IC++GYCALGC+G+C+H ++ D A +  LSNLPSAF LPSRDAL LGE
Sbjct  969   LAAHELLFKFRMICISGYCALGCRGTCTHREKTDRALHHTLSNLPSAFALPSRDALRLGE  1028

Query  3134  RIMVYLPRCIDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVV  3313
             R M+YLPR +DT+ EVRKVSVQIL+L+F+IS SLP+P NSS   DIE SY ALSSLEDV+
Sbjct  1029  RTMMYLPRSVDTSSEVRKVSVQILHLYFSISLSLPRPANSSFTNDIESSYSALSSLEDVI  1088

Query  3314  AILRSDASIDPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEF  3493
             AILRSDASIDPSEVFNRVVSSVC LL KDEL AALHGCSGAICDKIKQSAEGAIQAV EF
Sbjct  1089  AILRSDASIDPSEVFNRVVSSVCILLTKDELAAALHGCSGAICDKIKQSAEGAIQAVNEF  1148

Query  3494  VTNRGNELNEIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAA  3673
             VT RGN LNE +++RT+QSLL+AV+HVTEKYLRQE LGAICS+AENT+S++VF EVLAAA
Sbjct  1149  VTKRGNTLNETDIARTTQSLLSAVIHVTEKYLRQEALGAICSLAENTSSRIVFNEVLAAA  1208

Query  3674  GRDMVTKDIHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESS  3853
              +D+ TKDI RLRGGWPIQDAFH FSQH VLS +FL+HV+SVINQ P L GGD    ESS
Sbjct  1209  RKDIATKDISRLRGGWPIQDAFHVFSQHSVLSFTFLDHVMSVINQLPPL-GGDLDHDESS  1267

Query  3854  RNSVDGSIEDDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYG  4033
              ++VD  +ED+++RAA++ALTAFFRGGGK G+K VEQSYASVLATLTLHLG+CHGLA  G
Sbjct  1268  EHAVDSIVEDNIARAAIVALTAFFRGGGKVGKKAVEQSYASVLATLTLHLGSCHGLARTG  1327

Query  4034  DQEPLRALLNAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVP  4213
             + EPLRALL AFQAFCECVGDLEMGKILAR GEQ+ENEKWINLI +L+G ISIKRPKEVP
Sbjct  1328  ELEPLRALLAAFQAFCECVGDLEMGKILARDGEQSENEKWINLIRDLSGCISIKRPKEVP  1387

Query  4214  TICLFLSKSLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRL  4393
              ICL LSK+LDR LR QRE+AAAALSEFLR+SDGFGPLL QMV+ALCRHVSD SPTVRRL
Sbjct  1388  DICLILSKALDRSLRFQRESAAAALSEFLRHSDGFGPLLEQMVQALCRHVSDASPTVRRL  1447

Query  4394  CLRGLVQMPSIHVLQYTTQILGVILALLDDSDESVQLTA  4510
             CLRGLVQMPSIHVLQYTTQILGVILALLDDSDESVQLTA
Sbjct  1448  CLRGLVQMPSIHVLQYTTQILGVILALLDDSDESVQLTA  1486


 Score =   342 bits (878),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 164/188 (87%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = +1

Query  85   GDSIPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGN  264
            G+S+PA+EAVQV+VSSLADDSP VREASM+ALKDITSLNPLLVLDCCLTVSRGGRRRFGN
Sbjct  7    GNSVPAAEAVQVLVSSLADDSPIVREASMAALKDITSLNPLLVLDCCLTVSRGGRRRFGN  66

Query  265  IAGLFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSH  444
            IAGLFQV+SVAI+ALDKGD+DP ++ KLAKIAT+EVISTKELNADWQRAAAGVLVS+GSH
Sbjct  67   IAGLFQVMSVAIQALDKGDIDPNYLAKLAKIATSEVISTKELNADWQRAAAGVLVSIGSH  126

Query  445  LPDLMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIY  624
            +PDLMMEEIFLH SGSNSALPAMVQILAD+ASSDALQFTP LKGVLA+VVPILGNVR+I+
Sbjct  127  MPDLMMEEIFLHLSGSNSALPAMVQILADFASSDALQFTPHLKGVLAQVVPILGNVRDIH  186

Query  625  RPIFANGL  648
            RPIFAN  
Sbjct  187  RPIFANAF  194



>ref|XP_006410853.1| hypothetical protein EUTSA_v10016131mg [Eutrema salsugineum]
 gb|ESQ52306.1| hypothetical protein EUTSA_v10016131mg [Eutrema salsugineum]
Length=1673

 Score =  2028 bits (5254),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1046/1518 (69%), Positives = 1247/1518 (82%), Gaps = 32/1518 (2%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             A W Y  D +  + LD+DV+SFLNS FELLLRVWA SRD KVR+S VEALGQMVGLITRT
Sbjct  172   AVWLYITDLTSDSPLDSDVMSFLNSVFELLLRVWATSRDHKVRVSTVEALGQMVGLITRT  231

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstl  1003
             QLK+ALPRL+P ILELYK++ D A +ATCSL++LLNASLLS++GPPLLDFEDLT+VLSTL
Sbjct  232   QLKSALPRLIPAILELYKKDHDDALLATCSLYNLLNASLLSDSGPPLLDFEDLTIVLSTL  291

Query  1004  llvCS-NNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGS  1180
             L V S ++  K  S   +G K YNEVQ CFLTVG VYPEDLF FLLNKC+LKE+P TFG+
Sbjct  292   LPVISFSSVNKRCSGISMGRKAYNEVQRCFLTVGLVYPEDLFTFLLNKCKLKEDPLTFGA  351

Query  1181  LCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGE  1360
             LCVLKHLLPRL E+WH+KRP+L+++ + L+DE +L VRKAL+ELIVVMASHCYLVG SGE
Sbjct  352   LCVLKHLLPRLFEAWHSKRPLLVDATRSLLDEQSLAVRKALSELIVVMASHCYLVGPSGE  411

Query  1361  LFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKG  1540
             LF+EYLVRH A+ + +N                       L+ K  AV+ T+LR VC KG
Sbjct  412   LFVEYLVRHSAIGETDN-----------------------LKAKGEAVSPTQLRAVCGKG  448

Query  1541  LLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKAR  1720
             LLL+TVT+PEME++LWPFLLKMIIP+ YTGAVA+VCRCISELCRRRSS +  ML ECKAR
Sbjct  449   LLLLTVTIPEMEYILWPFLLKMIIPKEYTGAVASVCRCISELCRRRSS-TTPMLIECKAR  507

Query  1721  TDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKA  1900
              DIP PEELF RLVVLLHNPLA+E L TQIL+VL YL+PLFPKNI+ FWQDE  IPKMKA
Sbjct  508   ADIPSPEELFTRLVVLLHNPLAKEQLATQILTVLGYLSPLFPKNISMFWQDE--IPKMKA  565

Query  1901  YVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHS  2080
             YV DTEDLK DP  QE+WDDMII+FLAESLDV Q+ DWV+ LGN FA+QY LY  D++H+
Sbjct  566   YVFDTEDLKLDPSSQENWDDMIINFLAESLDVTQDSDWVISLGNAFAKQYILYTPDDDHA  625

Query  2081  ALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDK  2260
             ALLHRC+GILLQKV+DRAYVR KID +Y QA+I++P NRLGLAKAMGLVAASHLDTVL+K
Sbjct  626   ALLHRCMGILLQKVNDRAYVRDKIDWIYEQADISIPANRLGLAKAMGLVAASHLDTVLEK  685

Query  2261  LKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALV  2440
             LK ILDNVGQSI QRI S FS+  K E+SDD HAALALMYGYAAKYAP +VIEARIDALV
Sbjct  686   LKVILDNVGQSIFQRILSLFSESYKTEDSDDIHAALALMYGYAAKYAPSSVIEARIDALV  745

Query  2441  GTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRD  2620
             GTNMLSRLLHVR   AKQAVITAIDLLG+AVI ASESG +FPLKRRD +LDYILTLMGRD
Sbjct  746   GTNMLSRLLHVRQQTAKQAVITAIDLLGRAVINASESGATFPLKRRDQMLDYILTLMGRD  805

Query  2621  EEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVIN  2800
             E EGF++S++E+LHTQ+LAL+ACTTLVSVEPKLT ETRN +MKAT+GFF LPNDPSDVI+
Sbjct  806   ENEGFAESSLEVLHTQALALNACTTLVSVEPKLTVETRNRVMKATLGFFALPNDPSDVIS  865

Query  2801  PLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIK  2980
             PLIDNL+TLLC IL+TSGEDGRSRAEQLLH+LR +D +VSS ++YQRKRGC+A HE+L+K
Sbjct  866   PLIDNLVTLLCAILLTSGEDGRSRAEQLLHLLRQLDQYVSSPIDYQRKRGCVAVHEMLLK  925

Query  2981  FRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPRC  3160
             FR +CV GYCALGC G C H K +D +   N SNLPS F  P R+ L LG+R++ YLPRC
Sbjct  926   FRKLCVAGYCALGCSGDCPHRKFVDRSMQGNFSNLPSVFLFPDREVLCLGDRVITYLPRC  985

Query  3161  IDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILRSDASI  3340
              DTN EVRK+S QIL+ FF+IS SLPK + SS G+D E SY ALSSLEDV+AIL+SDASI
Sbjct  986   ADTNSEVRKISAQILDQFFSISLSLPKAVLSS-GLDSEDSYKALSSLEDVIAILKSDASI  1044

Query  3341  DPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNELN  3520
             DPSEVFNR+VSS+C LL +DELVAALH C+ AICDKI+QSAEGAIQAV EFV+ RG+ L+
Sbjct  1045  DPSEVFNRIVSSICALLTEDELVAALHSCTAAICDKIRQSAEGAIQAVTEFVSRRGSHLS  1104

Query  3521  EIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMVTKDI  3700
             + ++SRT+QSLL+A VH+TEK LR E +GAI ++AENT S +VF EVLA AGRD+VTKDI
Sbjct  1105  DTDISRTTQSLLSAAVHITEKNLRVEAIGAISALAENTQSSIVFNEVLATAGRDIVTKDI  1164

Query  3701  HRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSVDGSIE  3880
              R+RGGWP+QD F+AFSQH  LS  F+EH+ISV+N+S  +KG    KG+S+  S +  +E
Sbjct  1165  TRMRGGWPMQDIFYAFSQHTELSILFMEHLISVLNRSSLVKG---DKGDSTSPSSETHVE  1221

Query  3881  DDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPLRALL  4060
             DD+ +AA+ ALTAFFRGGGK G+K VE+SY+SV+  LTL LG+CHGLAS G Q+PLR LL
Sbjct  1222  DDILQAAIFALTAFFRGGGKIGKKAVEKSYSSVVGALTLQLGSCHGLASSGQQDPLRVLL  1281

Query  4061  NAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICLFLSKS  4240
              +FQAFCECVGD EMGKILAR GEQ E EKW++ IG++AG ISIKRPKEV  IC+ L+K+
Sbjct  1282  TSFQAFCECVGDFEMGKILARNGEQTEKEKWVDFIGDIAGCISIKRPKEVRHICMILTKA  1341

Query  4241  LDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQMP  4420
             L+RP R QREAAAAALSEF+RYS  F  ++ +MVEALCRHVSDDSPTVRRLCLRGLVQMP
Sbjct  1342  LNRPQRFQREAAAAALSEFIRYSGDFSSVMEEMVEALCRHVSDDSPTVRRLCLRGLVQMP  1401

Query  4421  SIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSIRLRNL  4600
             S  +  YTTQ++GVILALLDD DESVQLTAVSCLL+V ES+S DAVEP+L+NLS RLRNL
Sbjct  1402  SACMNHYTTQVIGVILALLDDLDESVQLTAVSCLLMVTESASNDAVEPILMNLSFRLRNL  1461

Query  4601  QVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACRNT  4780
             QV +N K+RANAFAAFGALS Y +G   + F EQIH+  PR+V+HLHDDD  +RQACR T
Sbjct  1462  QVSMNPKMRANAFAAFGALSKYASGGQREGFVEQIHSTLPRLVVHLHDDDASIRQACRGT  1521

Query  4781  LKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSAIIQAF  4960
             LK   PL++I     L ++  F+SD R+DYE+F+RDL+R L Q    RVDTY+++ IQAF
Sbjct  1522  LKRFVPLMDIKNQSTLYDSRAFNSDDRTDYENFVRDLSRYLVQE-SERVDTYMASTIQAF  1580

Query  4961  DAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATCSAALG  5140
             DAPWPV+QANA++  ++MLSLS++++I +LYY QVF  LV K + S D++VRA CSAA G
Sbjct  1581  DAPWPVVQANAIHFSTTMLSLSEDQHIISLYYPQVFETLVSKMTRSQDSVVRAACSAAFG  1640

Query  5141  LLLKSPNSSSWRDARLNK  5194
             LLL+S  S+ WR ARL++
Sbjct  1641  LLLRSTKSTLWRGARLDR  1658


 Score =   248 bits (633),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 143/188 (76%), Gaps = 28/188 (15%)
 Frame = +1

Query  85   GDSIPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGN  264
            G SIPA EAVQ++VSSLADDS  VREASM++L+DI SLNPLLVLDCC  VSRGGRRRFGN
Sbjct  7    GSSIPAPEAVQLLVSSLADDSSVVREASMASLRDIASLNPLLVLDCCYAVSRGGRRRFGN  66

Query  265  IAGLFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSH  444
            +AG+FQV++ ++                            ELNADWQR A+G+LVS+G+H
Sbjct  67   MAGVFQVMAFSV----------------------------ELNADWQRQASGLLVSIGTH  98

Query  445  LPDLMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIY  624
             PDLMMEEIFLH SG  SA PAMVQILAD+ASSDALQFTPRLK VL+RV+PILGNVR+++
Sbjct  99   FPDLMMEEIFLHLSGPASAAPAMVQILADFASSDALQFTPRLKDVLSRVLPILGNVRDVH  158

Query  625  RPIFANGL  648
            RPIFAN  
Sbjct  159  RPIFANAF  166



>gb|KFK36555.1| hypothetical protein AALP_AA4G138800 [Arabis alpina]
Length=1702

 Score =  2025 bits (5246),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1043/1518 (69%), Positives = 1251/1518 (82%), Gaps = 31/1518 (2%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             A W Y  D +  + LD DV+SFLNS FELLLRVW  SRD KVR+S VEALGQMVGLITRT
Sbjct  200   AVWLYITDLTSDSPLDDDVMSFLNSVFELLLRVWTASRDHKVRVSTVEALGQMVGLITRT  259

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstl  1003
             +LK+ALPRL+P ILELYK++ D A +ATCSLH+LLNASLLS +GPPLLDFEDLT+VL+TL
Sbjct  260   KLKSALPRLIPAILELYKKDHDEALLATCSLHNLLNASLLSESGPPLLDFEDLTIVLATL  319

Query  1004  llvCS-NNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGS  1180
             L V   +++ K  SD  V  KTYNEVQ CFLTVG VYPEDLF FLLNKC+LKE+P TFG+
Sbjct  320   LPVIGISSESKRCSDISVTRKTYNEVQRCFLTVGLVYPEDLFTFLLNKCKLKEDPLTFGA  379

Query  1181  LCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGE  1360
             LCVLKHLLPRL E+WH K+P+L+E  K L+DE +L VRKAL+ELIVVMASHCYLVGSSGE
Sbjct  380   LCVLKHLLPRLFEAWHPKQPLLVECAKSLLDEQSLSVRKALSELIVVMASHCYLVGSSGE  439

Query  1361  LFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKG  1540
             LF+EYLVRH A+ +++N                       L+ K  +V+ TELR VC KG
Sbjct  440   LFVEYLVRHSAIGEIDN-----------------------LKAKGESVSPTELRAVCGKG  476

Query  1541  LLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKAR  1720
             LLL+TVT+PEME++LWPFLLKMI+PRVYTGAVA+VCRCISELCRRRSS +  ML ECKAR
Sbjct  477   LLLLTVTIPEMEYILWPFLLKMIVPRVYTGAVASVCRCISELCRRRSS-TTPMLIECKAR  535

Query  1721  TDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKA  1900
              DIP PEELF RLVVLLHNPLA+E L TQIL+VL YL+PLFPKNI+ FWQDE  IPKMKA
Sbjct  536   ADIPSPEELFTRLVVLLHNPLAKEQLATQILTVLGYLSPLFPKNISMFWQDE--IPKMKA  593

Query  1901  YVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHS  2080
             YV DTEDLK DP YQE+WDDMII+FLAESLDV Q+ DW++ LGN FA+QY LY  D++H+
Sbjct  594   YVFDTEDLKLDPSYQETWDDMIINFLAESLDVTQDADWIISLGNAFAKQYSLYTPDDDHA  653

Query  2081  ALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDK  2260
             ALLHRC+GILLQKV+DRAYVR KID +Y QA+I++P NRLGLAKAMGLVAASHLDTVL+K
Sbjct  654   ALLHRCMGILLQKVNDRAYVREKIDWIYGQADISIPANRLGLAKAMGLVAASHLDTVLEK  713

Query  2261  LKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALV  2440
             LK I+DNVGQSILQRI S FS+  K E+SDD HAALALMYGYAAKYAP +VIEARIDALV
Sbjct  714   LKIIVDNVGQSILQRILSLFSESYKTEDSDDIHAALALMYGYAAKYAPSSVIEARIDALV  773

Query  2441  GTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRD  2620
             GTNMLSRLLHVR   AKQAVITAIDLLG+AVI ASE+G +FPLKRRD +L+YILTLMGRD
Sbjct  774   GTNMLSRLLHVRKQTAKQAVITAIDLLGRAVINASETGATFPLKRRDQMLEYILTLMGRD  833

Query  2621  EEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVIN  2800
             E EGF++S++E+LHTQ+LAL+ACTTLVSVEPKLT ETRN +MKAT+GFF LPNDPSDVI+
Sbjct  834   ENEGFAESSLEVLHTQALALNACTTLVSVEPKLTIETRNRVMKATLGFFALPNDPSDVIS  893

Query  2801  PLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIK  2980
             PLIDNL+TLLC IL+TSGEDGRSRAEQLLH+LR +D +VSS ++YQRKRGC+A HE+L+K
Sbjct  894   PLIDNLVTLLCAILLTSGEDGRSRAEQLLHLLRQLDQYVSSPIDYQRKRGCVAVHEMLLK  953

Query  2981  FRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPRC  3160
             FR +CV GYCALGC G C H K  D +   N SNLPS F  P R+ L LG+R++ YLPRC
Sbjct  954   FRKLCVGGYCALGCSGDCPHRKYADRSMVGNYSNLPSVFVFPDREVLCLGDRVITYLPRC  1013

Query  3161  IDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILRSDASI  3340
              DTN EVRKVS QIL+ FF+IS SLPK   S+ G+D E SY ALSSLEDV+AIL+SDASI
Sbjct  1014  ADTNSEVRKVSAQILDQFFSISLSLPKAALSN-GLDSEDSYKALSSLEDVIAILKSDASI  1072

Query  3341  DPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNELN  3520
             DPSEVFNR+VSS+C LL ++ELVAALHGC+ AICDKI+QSAEGAIQAV EFV++RG++L+
Sbjct  1073  DPSEVFNRIVSSICALLTENELVAALHGCTAAICDKIRQSAEGAIQAVTEFVSSRGSQLS  1132

Query  3521  EIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMVTKDI  3700
             + ++SRT+QSLL+A  H+TEK LR E +GAI ++AENT S +VF EVLA AG+D+VTKDI
Sbjct  1133  DNDISRTTQSLLSAAGHITEKNLRVEAIGAISALAENTQSSIVFNEVLATAGKDIVTKDI  1192

Query  3701  HRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSVDGSIE  3880
              R+RGGWP+QDAF+ FSQH  LS SF+EH+IS++N+   +   DS KGE++ +S +  +E
Sbjct  1193  TRMRGGWPMQDAFYVFSQHTELSVSFMEHLISILNRISLV--SDSHKGENTSSSSETHVE  1250

Query  3881  DDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPLRALL  4060
             DD+ +AA+ ALTAFFRGGGK G+K VE+SY+SV+  LTL LG+CHGLAS G Q+PLR LL
Sbjct  1251  DDILQAAIFALTAFFRGGGKIGKKAVEKSYSSVVGALTLQLGSCHGLASSGQQDPLRVLL  1310

Query  4061  NAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICLFLSKS  4240
              +FQAFCECVGD EMGKILAR GEQ E EKW++LIG++AG ISIKRPKEV  IC+ L+K+
Sbjct  1311  TSFQAFCECVGDFEMGKILARNGEQREKEKWVDLIGDIAGCISIKRPKEVRHICMILTKA  1370

Query  4241  LDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQMP  4420
             L+RP R QREAAAAALSEF+RYS  F  ++ +MVEALCRHVSDDSPTVRRLCLRGLVQMP
Sbjct  1371  LNRPQRFQREAAAAALSEFIRYSGDFSSVMEEMVEALCRHVSDDSPTVRRLCLRGLVQMP  1430

Query  4421  SIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSIRLRNL  4600
             S  +  YTTQ++GVILALLDD DESVQLTAVSCLL+V ES+S +AVEP+LLNLS+RLRNL
Sbjct  1431  SACMNHYTTQVIGVILALLDDLDESVQLTAVSCLLMVTESASNEAVEPILLNLSVRLRNL  1490

Query  4601  QVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACRNT  4780
             QV ++ K+RANAF+AFGALS Y  G   + F EQIH+  PR+V+HLHDDD  +RQACR T
Sbjct  1491  QVSMDPKMRANAFSAFGALSKYAMGGQREGFVEQIHSTLPRLVVHLHDDDASIRQACRGT  1550

Query  4781  LKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSAIIQAF  4960
             LK  APL++I+    L ++  FSSD R+DYE+F+RD +R L Q    RVDTY+++ IQAF
Sbjct  1551  LKRFAPLLDIENHSTLYDSRAFSSDDRTDYENFVRDFSRHLIQE-SERVDTYMASTIQAF  1609

Query  4961  DAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATCSAALG  5140
             DAPWPVIQANA++  ++MLSLS++++I +LYY QVF  LV K + S D++VRA CS+A G
Sbjct  1610  DAPWPVIQANAIHFATTMLSLSEDQHIISLYYPQVFETLVSKMTRSQDSVVRAACSSAFG  1669

Query  5141  LLLKSPNSSSWRDARLNK  5194
             LLL+S  S+ WR ARL++
Sbjct  1670  LLLRSTKSTLWRGARLDR  1687


 Score =   280 bits (717),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 167/188 (89%), Gaps = 0/188 (0%)
 Frame = +1

Query  85   GDSIPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGN  264
            G SIPA EAVQ++VSSL+DDS  V+EASM++LKDI SLNPLLVLDCC  VSRGGRRRFGN
Sbjct  7    GSSIPAPEAVQLLVSSLSDDSSVVKEASMASLKDIASLNPLLVLDCCYAVSRGGRRRFGN  66

Query  265  IAGLFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSH  444
            +AG+FQV++ ++ AL+KG+ D  FM KLAKIATAE+IS+KELNADWQR A+G+LVS+G+H
Sbjct  67   MAGVFQVMAFSVGALEKGESDEVFMGKLAKIATAEIISSKELNADWQRQASGLLVSIGTH  126

Query  445  LPDLMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIY  624
             PDLMMEEIFLH SG  +A PAMVQILAD+ASSDALQFTPRLKGVL+RV+PILGNVR+I+
Sbjct  127  FPDLMMEEIFLHLSGPATASPAMVQILADFASSDALQFTPRLKGVLSRVLPILGNVRDIH  186

Query  625  RPIFANGL  648
            RPIFAN  
Sbjct  187  RPIFANAF  194



>ref|XP_009141609.1| PREDICTED: LOW QUALITY PROTEIN: protein SHOOT GRAVITROPISM 6 
[Brassica rapa]
Length=1734

 Score =  2024 bits (5245),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1047/1548 (68%), Positives = 1252/1548 (81%), Gaps = 59/1548 (4%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             A W Y  D +  + LD+DV+SFLNS FELLLRVW  SRD KVR+S VEALGQMVGLITRT
Sbjct  200   AVWLYITDLTSDSPLDSDVMSFLNSVFELLLRVWTTSRDHKVRVSTVEALGQMVGLITRT  259

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstl  1003
             QLK+ALPRL+P ILELYK++ D A +ATCSL++LLNASLLS +GPPLL+FEDLT+VLSTL
Sbjct  260   QLKSALPRLIPAILELYKKDHDDALLATCSLYNLLNASLLSESGPPLLEFEDLTIVLSTL  319

Query  1004  llvCS-NNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGS  1180
             L V S N++ K HS   VG K YNEVQ CFLTVG VYPEDLF FLLNKC+LKE+  TFG+
Sbjct  320   LPVISINSENKRHSGSSVGRKAYNEVQRCFLTVGLVYPEDLFTFLLNKCKLKEDHLTFGA  379

Query  1181  LCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGE  1360
             LCVLKHLLPRL E+WH+KRP+LIE+ + L+DE +L VRKAL+ELIVVMASHCYLVG SGE
Sbjct  380   LCVLKHLLPRLLEAWHSKRPLLIEAARSLLDEQSLAVRKALSELIVVMASHCYLVGPSGE  439

Query  1361  LFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKG  1540
             LF+EYLVRH A+ +++N                       L+ K   ++ T+LR VC KG
Sbjct  440   LFVEYLVRHSAIGEIDN-----------------------LKAKGEPISPTQLRAVCGKG  476

Query  1541  LLLITVTVPEME---------------------------HVLWPFLLKMIIPRVYTGAVA  1639
             LLL+TVT+PEME                           ++LWPFLLKMI+P+VYTGAVA
Sbjct  477   LLLLTVTIPEMEVLTFXKKNDAIYXKNSDSNAKGDLKLQYILWPFLLKMIVPKVYTGAVA  536

Query  1640  TVCRCISELCRRRSSESNAMLSECKARTDIPKPEELFARLVVLLHNPLAREHLVTQILSV  1819
             TVCRCISELCRRRSS +  ML ECKAR DIP PEELF RLVVLLHNPLA+E L TQIL+V
Sbjct  537   TVCRCISELCRRRSS-TTPMLIECKARADIPSPEELFTRLVVLLHNPLAKEQLATQILTV  595

Query  1820  LWYLAPLFPKNINSFWQDEL*IPKMKAYVSDTEDLKQDPLYQESWDDMIISFLAESLDVI  1999
             L YL+PLFPKNI+ FWQDE  IPKMKAYV DTEDLK DP YQE+WDDMII+FLAESLDV 
Sbjct  596   LNYLSPLFPKNISMFWQDE--IPKMKAYVYDTEDLKLDPSYQENWDDMIINFLAESLDVT  653

Query  2000  QNVDWVLLLGNTFARQYELYKSDNEHSALLHRCLGILLQKVHDRAYVRAKIDLMYRQANI  2179
              + DWV+ LGN FA+QY LY  D++H+ALLHRC+GILLQKV+DRAYVR KID MY QA+I
Sbjct  654   HDADWVISLGNAFAKQYNLYTPDDDHAALLHRCMGILLQKVNDRAYVRDKIDWMYEQADI  713

Query  2180  AVPTNRLGLAKAMGLVAASHLDTVLDKLKGILDNVGQSILQRIFSFFSDRGKMEESDDTH  2359
             ++P NRLGLAKAMGLVAASHLDTVL+KLK ILDNVGQSI QRI S FS+  K E+SDD H
Sbjct  714   SIPANRLGLAKAMGLVAASHLDTVLEKLKVILDNVGQSIFQRILSLFSESYKTEDSDDIH  773

Query  2360  AALALMYGYAAKYAPPTVIEARIDALVGTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIG  2539
             AALALMYGYAAKYAP +VIEARIDALVGTNMLSRLLHVR   AKQAVITAIDLLG+AVI 
Sbjct  774   AALALMYGYAAKYAPSSVIEARIDALVGTNMLSRLLHVRQQTAKQAVITAIDLLGRAVIN  833

Query  2540  ASESGISFPLKRRDLLLDYILTLMGRDEEEGFSDSNIELLHTQSLALSACTTLVSVEPKL  2719
             ASESG +FPLKRRD++LDY+LTLMGRDE EGF++S++ELLHTQ+LAL+ACTTLVSVEPKL
Sbjct  834   ASESGATFPLKRRDMMLDYVLTLMGRDENEGFAESSLELLHTQALALNACTTLVSVEPKL  893

Query  2720  TTETRNLIMKATIGFFGLPNDPSDVINPLIDNLITLLCTILVTSGEDGRSRAEQLLHILR  2899
             T ETRN +MKAT+GFF LPNDPSDVI PLIDNL++LLC IL+TSGEDGRSRAEQLLH+LR
Sbjct  894   TVETRNRVMKATLGFFALPNDPSDVIGPLIDNLVSLLCAILLTSGEDGRSRAEQLLHLLR  953

Query  2900  NIDPFVSSSLEYQRKRGCLAAHELLIKFRAICVNGYCALGCQGSCSHSKQIDHAANRNLS  3079
              +D +VSS ++YQRKRGC+A HE+L+KFR +CV GYCALGC G C H K +D +   N S
Sbjct  954   QLDQYVSSPVDYQRKRGCMAVHEMLLKFRKLCVAGYCALGCSGDCPHRKYVDRSMQGNFS  1013

Query  3080  NLPSAFFLPSRDALSLGERIMVYLPRCIDTNYEVRKVSVQILNLFFNISFSLPKPINSSL  3259
             NLPS F  P R+ L LG+R++ YLPRC DTN EVRK+S QIL+ FF+IS SLPK   SS 
Sbjct  1014  NLPSVFLFPDREVLCLGDRVITYLPRCADTNSEVRKISAQILDQFFSISLSLPKAALSS-  1072

Query  3260  GIDIELSYIALSSLEDVVAILRSDASIDPSEVFNRVVSSVCTLLNKDELVAALHGCSGAI  3439
             G+D E SY ALSSLEDV+AIL+SDASIDPSEVFNR+VSS+C LL  DELVAALH C+ AI
Sbjct  1073  GLDSEESYKALSSLEDVIAILKSDASIDPSEVFNRIVSSICALLTVDELVAALHSCTPAI  1132

Query  3440  CDKIKQSAEGAIQAVVEFVTNRGNELNEIEVSRTSQSLLTAVVHVTEKYLRQETLGAICS  3619
             CDKI+QSAEGAIQAV EFV+ RG++LN+ ++SRT+QSLL+A VH+TEK LR E +GAI +
Sbjct  1133  CDKIRQSAEGAIQAVTEFVSRRGSQLNDNDISRTTQSLLSAAVHITEKSLRVEAIGAISA  1192

Query  3620  VAENTTSKVVFTEVLAAAGRDMVTKDIHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISV  3799
             +AENT S +VF+EVLA AG+D+VTKDI R+RGGWP+QDAF+AFSQH  LS SF+EH+ISV
Sbjct  1193  LAENTQSSIVFSEVLATAGKDIVTKDITRMRGGWPMQDAFYAFSQHTELSVSFMEHLISV  1252

Query  3800  INQSPALKGG---DSGKGESSRNSVDGSIEDDVSRAAVLALTAffrgggkfgrkTVEQSY  3970
             +N+S  +K     DS KG+++ +S +  +ED++ +AA+ ALTAFFRGGGK G+K VE+SY
Sbjct  1253  LNRSSLVKADSHKDSHKGDNTSSSSETHVEDELLQAAIFALTAFFRGGGKTGKKAVEKSY  1312

Query  3971  ASVlatltlhlgtchglaSYGDQEPLRALLNAFQAFCECVGDLEMGKILARGGEQNENEK  4150
             +SV+  LTL LG+CHGLAS G Q+PLR LL +FQAFCECVGDLEMGKILAR GEQ E EK
Sbjct  1313  SSVVGALTLQLGSCHGLASTGQQDPLRVLLTSFQAFCECVGDLEMGKILARNGEQREKEK  1372

Query  4151  WINLIGELAGSISIKRPKEVPTICLFLSKSLDRPLRVQREAAAAALSEFLRYSDGFGPLL  4330
             W++LIG++AG ISIKRPKEV  IC+ L+K+L+RP R QREAAAAALSEF+RYS  F  ++
Sbjct  1373  WVDLIGDIAGCISIKRPKEVQHICIILTKALNRPQRFQREAAAAALSEFIRYSGDFSSVM  1432

Query  4331  GQMVEALCRHVSDDSPTVRRLCLRGLVQMPSIHVLQYTTQILGVILALLDDSDESVQLTA  4510
              +MVEALCRHVSDDSPTVRRLCLRGLVQMPS  +  YTTQ++GVILALLDD DESVQLTA
Sbjct  1433  EEMVEALCRHVSDDSPTVRRLCLRGLVQMPSACMNHYTTQVIGVILALLDDLDESVQLTA  1492

Query  4511  vsclllvlesssTDAVEPVLLNLSIRLRNLQVCLNAKIRANAFAAFGALSSYGAGSILDS  4690
             VSCLL+V ES+S DAVEP+LLNLS+RLRNLQ+ ++ K+RANAFAAFGALS Y  G   + 
Sbjct  1493  VSCLLMVTESASNDAVEPILLNLSVRLRNLQISMDPKMRANAFAAFGALSKYATGGQREG  1552

Query  4691  FREQIHAAFPRMVLHLHDDDLGVRQACRNTLKCIAPLIEIDAIPALLNTHRFSSDHRSDY  4870
             F EQIH+  PR+V+HLHDDD  +RQACR TLK  APL++I     L ++  F SDHR+DY
Sbjct  1553  FVEQIHSTLPRLVVHLHDDDPSIRQACRVTLKQFAPLMDIQNDSTLFDSRAFGSDHRNDY  1612

Query  4871  EDFLRDLARQLTQYLGPRVDTYLSAIIQAFDAPWPVIQANAVYLCSSMLSLSDNKNISAL  5050
             E+F+R+L+R L  +   RVDTY+++ IQAFDAPWPVIQANA++  ++MLSLS+++++   
Sbjct  1613  ENFVRELSRHLV-HESERVDTYMASTIQAFDAPWPVIQANAIHFSTTMLSLSEDQHMFFH  1671

Query  5051  YYSQVFGVLVGKASNSTDAIVRATCSAALGLLLKSPNSSSWRDARLNK  5194
             YY QVF  LV K + S D++VRA CS+A GLLL+S  S+ WR ARL++
Sbjct  1672  YYPQVFETLVNKMTRSQDSVVRAACSSAFGLLLRSTKSTLWRGARLDR  1719


 Score =   296 bits (758),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 140/188 (74%), Positives = 166/188 (88%), Gaps = 0/188 (0%)
 Frame = +1

Query  85   GDSIPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGN  264
            G SIPA EAVQ++VSSLADDS  VREASM++L+DI SLNPLLVLDCC  VSRGGRRRFGN
Sbjct  7    GSSIPAPEAVQLLVSSLADDSSVVREASMASLRDIASLNPLLVLDCCYAVSRGGRRRFGN  66

Query  265  IAGLFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSH  444
            +AG+FQV++ ++ AL+ G+ D AFM KLAKIATAE+IS+KELNADWQR A+G+LVS+G+H
Sbjct  67   MAGVFQVMAFSVGALETGESDEAFMGKLAKIATAEIISSKELNADWQRQASGLLVSIGTH  126

Query  445  LPDLMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIY  624
             PDLMMEE+FLH SG  SA PAMVQILAD+ASSDALQFTPRLK VL+RV+PILGNVR+++
Sbjct  127  FPDLMMEELFLHLSGPASASPAMVQILADFASSDALQFTPRLKDVLSRVLPILGNVRDVH  186

Query  625  RPIFANGL  648
            RPIFAN  
Sbjct  187  RPIFANAF  194



>ref|XP_004494016.1| PREDICTED: maestro heat-like repeat-containing protein family 
member 1-like isoform X2 [Cicer arietinum]
Length=1462

 Score =  2023 bits (5241),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1057/1467 (72%), Positives = 1239/1467 (84%), Gaps = 22/1467 (1%)
 Frame = +2

Query  800   MVGLITRTQLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFED  979
             MVGLITRTQLKAALPRLVPTIL+LYK++ D AF+ATCSLH+LLNASLLS +GPP+LDFED
Sbjct  1     MVGLITRTQLKAALPRLVPTILDLYKKDLDIAFLATCSLHNLLNASLLSESGPPMLDFED  60

Query  980   ltvvlstlllvCS-NNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLK  1156
             LT++L+TL+ V S NN+ K+ +DF VGLK YNEVQHCFLTVG VYP+DLF+FL+NKCRLK
Sbjct  61    LTLILATLIHVVSMNNESKDQTDFSVGLKMYNEVQHCFLTVGLVYPDDLFLFLVNKCRLK  120

Query  1157  EEPFTFGSLCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHC  1336
             EE  TFG+LCVLKHLLPRL+E WH+K P+L+E+VK L++EHNLGVRKAL+ELIVVMASHC
Sbjct  121   EEASTFGALCVLKHLLPRLSEGWHSKIPLLVEAVKSLLEEHNLGVRKALSELIVVMASHC  180

Query  1337  YLVGSSGELFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTE  1516
             YLVGS GELFIEYL+R+CA+ D    +L+S+               ++ E K G V+  E
Sbjct  181   YLVGSPGELFIEYLIRNCALTDQNQSDLDSTPN-------------KRKEMKIGTVSPGE  227

Query  1517  LRGVCEKGLLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNA  1696
             LR VCEKGLLL+T+T+PEMEH+LWPFLLKMIIPR YTGAVA VCRCISEL R RS  S+ 
Sbjct  228   LRAVCEKGLLLVTITIPEMEHILWPFLLKMIIPRTYTGAVAMVCRCISELWRHRSYGSD-  286

Query  1697  MLSECKARTDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDE  1876
             MLSECK R DIP  EEL AR VVLLH+PLARE L TQIL+VL  LAPLFPKNIN FWQDE
Sbjct  287   MLSECKTRLDIPTAEELLARFVVLLHDPLAREKLATQILTVLCLLAPLFPKNINLFWQDE  346

Query  1877  L*IPKMKAYVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYEL  2056
               IPKMKAYVSDT+DLKQDP YQ++WDDMI++FLAESLDVIQ+ DW++ LGN FA+ YEL
Sbjct  347   --IPKMKAYVSDTDDLKQDPSYQDTWDDMIVNFLAESLDVIQDADWIMSLGNVFAKHYEL  404

Query  2057  YKSDNEHSALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAAS  2236
             Y SD+EH+ALLHRCLGILLQKV+DR YV  K+D MY+Q+NIA+PTNRLGLAKAMGLVAAS
Sbjct  405   YTSDDEHAALLHRCLGILLQKVNDRVYVHDKMDWMYKQSNIAIPTNRLGLAKAMGLVAAS  464

Query  2237  HLDTVLDKLKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVI  2416
             HLDTVL+KLK I+DNVG++I+QRI S FSD  + EESDD HAALALMYGYAAKYAP +VI
Sbjct  465   HLDTVLEKLKDIIDNVGRTIIQRILSLFSDSFRTEESDDIHAALALMYGYAAKYAPSSVI  524

Query  2417  EARIDALVGTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDY  2596
             EARI+ALVGTNMLSRLLHVRHP AKQAVITAIDLLG AVI A+ESG  FPLKRRD LLDY
Sbjct  525   EARINALVGTNMLSRLLHVRHPIAKQAVITAIDLLGNAVINAAESGAPFPLKRRDQLLDY  584

Query  2597  ILTLMGRDEEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLP  2776
             ILTLMGRD+ +GF+D N ELL TQ+LA+SACTTLVSVEPKLT ETRN +MKAT+GFF + 
Sbjct  585   ILTLMGRDDNDGFADLN-ELLRTQALAISACTTLVSVEPKLTVETRNYVMKATLGFFAIQ  643

Query  2777  NDPSDVINPLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCL  2956
             NDP +V+NPLIDNL++LLC IL+T GEDGRSRAE L+  +R ID FVSS +EYQRKRGCL
Sbjct  644   NDPVEVVNPLIDNLVSLLCAILLTGGEDGRSRAELLMLTVRQIDQFVSSPVEYQRKRGCL  703

Query  2957  AAHELLIKFRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGER  3136
             A HE+L+KF+ +CV+GYCALGC G+CSH+KQID A   N S LPSAF LPSR+AL LG+R
Sbjct  704   AVHEMLLKFQMVCVSGYCALGCHGNCSHTKQIDRALYGNFSKLPSAFVLPSREALCLGDR  763

Query  3137  IMVYLPRCIDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGI-DIELSYIALSSLEDVV  3313
             + +YLPRC DTN EVRK+S QIL+L F+IS SLPKP   S+   DIELSY ALSSLEDV+
Sbjct  764   VTMYLPRCADTNSEVRKISAQILDLLFSISLSLPKPPGLSISAEDIELSYSALSSLEDVI  823

Query  3314  AILRSDASIDPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEF  3493
             A+LR+D SIDPSEVFNR++SS+C LL KDELVA LHGCS AICDKIKQSAEGAIQAVVEF
Sbjct  824   AMLRNDTSIDPSEVFNRIISSLCILLTKDELVAMLHGCSVAICDKIKQSAEGAIQAVVEF  883

Query  3494  VTNRGNELNEIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAA  3673
             VT RG+EL EI++SRT+QSL++A VH T+K+LR ETLGAI S+AENT++K VF EVLAAA
Sbjct  884   VTRRGSELTEIDISRTTQSLISATVHATDKHLRVETLGAIASLAENTSAKTVFDEVLAAA  943

Query  3674  GRDMVTKDIHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESS  3853
             GRD++TKDI RLRGGWP+QDAF+AFSQHLVLS  FLEHVISV++Q P  K  D  + E S
Sbjct  944   GRDIITKDISRLRGGWPMQDAFYAFSQHLVLSVLFLEHVISVLSQIPIPKC-DVDRVEDS  1002

Query  3854  RNSVDGSIEDDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYG  4033
             +  V    ED    AA+ ALTAFFRGGGK G++ VEQ+YASVL+ L L LG+CHGL   G
Sbjct  1003  Q--VHTHTEDGNLEAAIFALTAFFRGGGKVGKRAVEQNYASVLSELMLQLGSCHGLTYSG  1060

Query  4034  DQEPLRALLNAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVP  4213
               +PLR LL AFQAFCECVGDLEMGKILAR GE +ENE+WINLIG++AG ISIKRPKE+ 
Sbjct  1061  HLDPLRNLLTAFQAFCECVGDLEMGKILARDGELSENERWINLIGDIAGCISIKRPKEIQ  1120

Query  4214  TICLFLSKSLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRL  4393
              IC FL +SLDRP + QREAAAAALSEF+RYS G G LL QMVE LCR VSD+S TVRR 
Sbjct  1121  NICQFLKRSLDRPQKYQREAAAAALSEFVRYSGGLGSLLEQMVEVLCRRVSDESSTVRRF  1180

Query  4394  CLRGLVQMPSIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLL  4573
             CLRGLVQ+PSIH+L++TTQ+LGVILALLDDSDESVQLTAVSCLL++LESS  DAVEP+LL
Sbjct  1181  CLRGLVQIPSIHILKFTTQVLGVILALLDDSDESVQLTAVSCLLMILESSPDDAVEPILL  1240

Query  4574  NLSIRLRNLQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDL  4753
             NL+IRLRNLQ  +NAK+RA++FA FGALS+YG G++ + F EQ+HAA PR+VLHLHD+D+
Sbjct  1241  NLAIRLRNLQTSMNAKMRASSFAVFGALSNYGIGTLREPFVEQVHAAVPRLVLHLHDEDV  1300

Query  4754  GVRQACRNTLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDT  4933
              VR ACRNTL+ + PL+EID + ALLNT  F SDHRSDYEDFLRD+A+Q TQ+L  RVDT
Sbjct  1301  SVRLACRNTLRRVFPLMEIDGLLALLNTPSFLSDHRSDYEDFLRDIAKQFTQHLLSRVDT  1360

Query  4934  YLSAIIQAFDAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIV  5113
             Y+++ +QAFDAPWP+IQANA+YLCSS+LSLSDN++I A Y++QVFG+LVGK S S DA+V
Sbjct  1361  YMASTVQAFDAPWPIIQANAMYLCSSLLSLSDNQHILADYHTQVFGMLVGKMSRSPDAVV  1420

Query  5114  RATCSAALGLLLKSPNSSSWRDARLNK  5194
             RA CSAALGLLLKS NS SWR   L++
Sbjct  1421  RAACSAALGLLLKSSNSCSWRAVHLDR  1447



>ref|XP_004494091.1| PREDICTED: maestro heat-like repeat-containing protein family 
member 1-like isoform X3 [Cicer arietinum]
Length=1455

 Score =  2022 bits (5239),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1056/1467 (72%), Positives = 1236/1467 (84%), Gaps = 22/1467 (1%)
 Frame = +2

Query  800   MVGLITRTQLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFED  979
             MVGLITRTQLKAALPRLVPTIL+LYK++ D AF+ATCSLH+LLNASLLS +GPP+LDFED
Sbjct  1     MVGLITRTQLKAALPRLVPTILDLYKKDLDIAFLATCSLHNLLNASLLSESGPPMLDFED  60

Query  980   ltvvlstlllvCS-NNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLK  1156
             LT++L TLL V S NN+ K+ +DF VGLK YNEVQHCFLTVG VYP+DLF+FL+NKC+LK
Sbjct  61    LTLILVTLLPVVSMNNESKDQTDFSVGLKMYNEVQHCFLTVGLVYPDDLFLFLVNKCKLK  120

Query  1157  EEPFTFGSLCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHC  1336
             EE  TFG+LCVLKHLLPRL+E WH+K P+L+E+VK L++EHNLGVRKAL+ELIVVMASHC
Sbjct  121   EEASTFGALCVLKHLLPRLSEGWHSKIPLLVEAVKSLLEEHNLGVRKALSELIVVMASHC  180

Query  1337  YLVGSSGELFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTE  1516
             YLVGS GELFIEYL+R+CA+ D    +L+S+               ++ E K G V+  E
Sbjct  181   YLVGSPGELFIEYLIRNCALTDQNQSDLDSTPN-------------KRKEMKIGTVSPGE  227

Query  1517  LRGVCEKGLLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNA  1696
             LR VCEKGLLL+T+T+PEMEH+LWPFLLK IIPR YTGAVA VCRCISEL R RS  S+ 
Sbjct  228   LRAVCEKGLLLVTITIPEMEHILWPFLLKTIIPRTYTGAVAMVCRCISELWRHRSYGSD-  286

Query  1697  MLSECKARTDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDE  1876
             MLSECK R DIP  EEL AR VVLLH+PLARE L TQIL+VL  LAPLFPKNIN FWQDE
Sbjct  287   MLSECKTRLDIPTAEELLARFVVLLHDPLAREKLATQILTVLCLLAPLFPKNINLFWQDE  346

Query  1877  L*IPKMKAYVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYEL  2056
               IPKMKAYVSDT+DLKQDP YQ++WDDMI++FLAESLDVIQ+ DW++ LGN FA+ YEL
Sbjct  347   --IPKMKAYVSDTDDLKQDPSYQDTWDDMIVNFLAESLDVIQDADWIMSLGNVFAKHYEL  404

Query  2057  YKSDNEHSALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAAS  2236
             Y SD+EH+ALLHRCLGILLQKV+DR YV  K+D MY+Q+NIA+PTNRLGLAKAMGLVAAS
Sbjct  405   YTSDDEHAALLHRCLGILLQKVNDRVYVHDKMDWMYKQSNIAIPTNRLGLAKAMGLVAAS  464

Query  2237  HLDTVLDKLKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVI  2416
             HLDTVL+KLK I+DNVG++I+QRI S FSD  + EESDD HAALALMYGYAAKYAP +VI
Sbjct  465   HLDTVLEKLKDIIDNVGRTIIQRILSLFSDSFRTEESDDIHAALALMYGYAAKYAPSSVI  524

Query  2417  EARIDALVGTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDY  2596
             EARI+ALVGTNMLSRLLHVRHP AKQAVITAIDLLG AVI A+ESG  FPLKRRD LLDY
Sbjct  525   EARINALVGTNMLSRLLHVRHPIAKQAVITAIDLLGNAVINAAESGAPFPLKRRDQLLDY  584

Query  2597  ILTLMGRDEEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLP  2776
             ILTLMGRD+ +GF+D N ELL TQ+LA+SACTTLVSVEPKLT ETRN +MKAT+GFF + 
Sbjct  585   ILTLMGRDDNDGFADLN-ELLRTQALAISACTTLVSVEPKLTVETRNYVMKATLGFFAIQ  643

Query  2777  NDPSDVINPLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCL  2956
             NDP +V+NPLIDNL++LLC IL+T GEDGRSRAE L+  +R ID FVSS +EYQRKRGCL
Sbjct  644   NDPVEVVNPLIDNLVSLLCAILLTGGEDGRSRAELLMLTVRQIDQFVSSPVEYQRKRGCL  703

Query  2957  AAHELLIKFRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGER  3136
             A HE+L+KF+ +CV+GYCALGC G+CSH+KQID A   N S LPSAF LPSR+AL LG+R
Sbjct  704   AVHEMLLKFQMVCVSGYCALGCHGNCSHTKQIDRALYGNFSKLPSAFVLPSREALCLGDR  763

Query  3137  IMVYLPRCIDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGI-DIELSYIALSSLEDVV  3313
             + +YLPRC DTN EVRK+S QIL+L F+IS SLPKP   S+   DIELSY ALSSLEDV+
Sbjct  764   VTMYLPRCADTNSEVRKISAQILDLLFSISLSLPKPPGLSISAEDIELSYSALSSLEDVI  823

Query  3314  AILRSDASIDPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEF  3493
             A+LR+D SIDPSEVFNR++SS+C LL KDELVA LHGCS AICDKIKQSAEGAIQAVVEF
Sbjct  824   AMLRNDTSIDPSEVFNRIISSLCILLTKDELVAMLHGCSVAICDKIKQSAEGAIQAVVEF  883

Query  3494  VTNRGNELNEIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAA  3673
             VT RG+EL EI++SRT+QSL++A VH T+K+LR ETLGAI S+AENT++K VF EVLA A
Sbjct  884   VTRRGSELTEIDISRTTQSLISATVHATDKHLRVETLGAIASLAENTSAKTVFDEVLATA  943

Query  3674  GRDMVTKDIHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESS  3853
             GRD++TKDI RLRGGWP+QDAF+AFSQHLVLS  FLEHVISV++Q P LK  D  + E S
Sbjct  944   GRDIITKDISRLRGGWPMQDAFYAFSQHLVLSELFLEHVISVLSQIPILKC-DVDRVEDS  1002

Query  3854  RNSVDGSIEDDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYG  4033
             +  V    ED    AA+ ALTAFFRGGGK G++ VEQ+YASVL+ L L LG+CHGL   G
Sbjct  1003  Q--VHTHTEDGNLEAAIFALTAFFRGGGKVGKRAVEQNYASVLSELMLQLGSCHGLTYSG  1060

Query  4034  DQEPLRALLNAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVP  4213
               EPLR LL AFQAFCECVGDLEMGKILAR GE +ENE+WINLIG++AG ISIKRPKE+ 
Sbjct  1061  HLEPLRNLLTAFQAFCECVGDLEMGKILARDGELSENERWINLIGDIAGCISIKRPKEIQ  1120

Query  4214  TICLFLSKSLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRL  4393
              IC FL +SLDRP + QREAAAAALSEF+RYS G G LL QMVE LCR VSD+S TV+R 
Sbjct  1121  NICQFLKRSLDRPQKYQREAAAAALSEFVRYSGGLGSLLEQMVEVLCRRVSDESSTVQRF  1180

Query  4394  CLRGLVQMPSIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLL  4573
             CLRGLVQ+PSIH+L++TTQ+LGVILALLDDSDESVQLTAVSCLL++LESS  DAVEP+LL
Sbjct  1181  CLRGLVQIPSIHILKFTTQVLGVILALLDDSDESVQLTAVSCLLMILESSPDDAVEPILL  1240

Query  4574  NLSIRLRNLQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDL  4753
             NL+IRLRNLQ  +NAK+RA++FA FGALS+YG G++ + F EQ+HAA PR+VLHLHD+D+
Sbjct  1241  NLAIRLRNLQTSMNAKMRASSFAVFGALSNYGTGTLREPFVEQVHAAVPRLVLHLHDEDV  1300

Query  4754  GVRQACRNTLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDT  4933
              VR ACRNTL+ + PL+EID + ALLNT  F SDHRSDYEDFLRD+A+Q TQ+L  RVDT
Sbjct  1301  SVRLACRNTLRRVFPLMEIDGLLALLNTPSFLSDHRSDYEDFLRDIAKQFTQHLLSRVDT  1360

Query  4934  YLSAIIQAFDAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIV  5113
             Y+++ +QAFDAPWP+IQANA+YLCSS+LSLSDN +I A Y++QVFG+LVGK S S DA+V
Sbjct  1361  YMASTVQAFDAPWPIIQANAMYLCSSLLSLSDNHHILADYHTQVFGMLVGKMSRSPDAVV  1420

Query  5114  RATCSAALGLLLKSPNSSSWRDARLNK  5194
             RA CSAALGLLLKS NS SWR   L++
Sbjct  1421  RAACSAALGLLLKSSNSCSWRAVHLDR  1447



>ref|XP_010509433.1| PREDICTED: protein SHOOT GRAVITROPISM 6 [Camelina sativa]
Length=1703

 Score =  2019 bits (5232),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1039/1518 (68%), Positives = 1247/1518 (82%), Gaps = 30/1518 (2%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             A W Y  D +  + LD+DV+SFLNS FELLLRVWA+SRD KVR+S VEALGQMVGLITRT
Sbjct  200   AVWLYITDLTSDSPLDSDVMSFLNSVFELLLRVWAISRDHKVRVSTVEALGQMVGLITRT  259

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstl  1003
             QLK+ALPRL+P ILELYKR+ D A +ATCSLH+LLNASL S +GPPLL+FEDLT+VLSTL
Sbjct  260   QLKSALPRLIPAILELYKRDHDDALLATCSLHNLLNASLHSESGPPLLEFEDLTIVLSTL  319

Query  1004  llvCS-NNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGS  1180
             L V   NN+++  SD  VG KTYNEVQ CFLTVG VYPEDLF FLLNKC+LKE+P TFG+
Sbjct  320   LPVIGVNNERRRCSDISVGRKTYNEVQRCFLTVGLVYPEDLFTFLLNKCKLKEDPLTFGA  379

Query  1181  LCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGE  1360
             LC+LKHLLPRL E+WH+KR +L+++   L+DE +L VRKAL+ELIVVMASHCYL G SGE
Sbjct  380   LCILKHLLPRLFEAWHSKRTLLVDTASSLLDEQSLAVRKALSELIVVMASHCYLAGPSGE  439

Query  1361  LFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKG  1540
             LF+EYLVRH A+ + EN                       L+ K   ++  +LR VC KG
Sbjct  440   LFVEYLVRHSAIGESEN-----------------------LKAKGEPISPAQLRAVCGKG  476

Query  1541  LLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKAR  1720
             LLL+TVT+PEME++LWPFLLKMIIP+VYTGAVA+VCRCISELCRRRSS +  ML ECKAR
Sbjct  477   LLLLTVTIPEMEYILWPFLLKMIIPKVYTGAVASVCRCISELCRRRSS-TTPMLIECKAR  535

Query  1721  TDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKA  1900
              DIP PEELF RLVVLLHNPLA++ L +QIL+VL YL+PLFPKNI+ FWQDE  IPKMKA
Sbjct  536   ADIPSPEELFTRLVVLLHNPLAKDQLASQILTVLGYLSPLFPKNISMFWQDE--IPKMKA  593

Query  1901  YVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHS  2080
             YV DTEDL+ DP YQE+WDDMII+FLAESLDV Q+VDWV+ LGN+FA+QY LY  D++H+
Sbjct  594   YVFDTEDLQLDPTYQETWDDMIINFLAESLDVTQDVDWVISLGNSFAKQYILYSPDDDHA  653

Query  2081  ALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDK  2260
             ALLHRC+GILLQKV+DRAYVR KID MY QA+I++P NRLGLAKAMGLVAASHLDTVL+K
Sbjct  654   ALLHRCIGILLQKVNDRAYVRDKIDWMYEQADISIPANRLGLAKAMGLVAASHLDTVLEK  713

Query  2261  LKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALV  2440
             LK I+DNVGQSI QRI S FS+  K E SDD HAALALMYGYAAKYAP +VIEARIDALV
Sbjct  714   LKIIVDNVGQSIFQRILSLFSESYKTENSDDIHAALALMYGYAAKYAPSSVIEARIDALV  773

Query  2441  GTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRD  2620
             GTNMLSRLLHVR   AKQAVITAIDLLG+AVI A+ESG +FPLKRRD +LDYILTLMGRD
Sbjct  774   GTNMLSRLLHVRQQTAKQAVITAIDLLGRAVINAAESGATFPLKRRDQMLDYILTLMGRD  833

Query  2621  EEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVIN  2800
             E EGF++S++E+LHTQ+LAL+ACTTLVSVEPKLT ETRN +MKAT+GFF LPNDPSDVI+
Sbjct  834   ENEGFAESSLEVLHTQALALNACTTLVSVEPKLTIETRNRVMKATLGFFALPNDPSDVIS  893

Query  2801  PLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIK  2980
             PLIDNL+TLLC IL+TSGEDGRSRAEQLLH+LR +D +VSS ++YQRKRGC+A HE+L+K
Sbjct  894   PLIDNLVTLLCAILLTSGEDGRSRAEQLLHLLRQLDQYVSSPIDYQRKRGCVAVHEMLLK  953

Query  2981  FRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPRC  3160
             FR +CV GYCALGC G C H K  D +   N SNLPS F  P R+ L LG+R++ YLPRC
Sbjct  954   FRKLCVGGYCALGCSGDCPHRKYADRSMQGNFSNLPSVFLFPDREVLCLGDRVITYLPRC  1013

Query  3161  IDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILRSDASI  3340
              DTN EVRK+S QIL+ FF+IS SLPK   SS G+D E SY ALSSLEDV+AIL+ DASI
Sbjct  1014  ADTNSEVRKISAQILDQFFSISLSLPKAALSS-GLDSEESYKALSSLEDVIAILKRDASI  1072

Query  3341  DPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNELN  3520
             DPSEVFNR+VSS+C LL  +ELVAAL+ C+ AICDKI+QSAEGAIQAV EFV+ RG++L+
Sbjct  1073  DPSEVFNRIVSSICALLTGNELVAALNSCTAAICDKIRQSAEGAIQAVTEFVSRRGSQLS  1132

Query  3521  EIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMVTKDI  3700
             + ++SRT+QSLL+A VH+T+K LR E +GAI ++AENT   +VF EVLA AGRD+VTKDI
Sbjct  1133  DNDISRTTQSLLSAAVHITDKNLRVEAIGAISTLAENTQPSIVFNEVLATAGRDIVTKDI  1192

Query  3701  HRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSVDGSIE  3880
              R+RGGWP+QD F AFSQH  LS  F+EH+IS++N+S  +K GDS KGE++ +S +  +E
Sbjct  1193  TRMRGGWPMQDVFFAFSQHTELSVLFMEHLISILNRSSLVK-GDSHKGENTSSSTETHVE  1251

Query  3881  DDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPLRALL  4060
             DD+ +AA+ ALTAFFRGGGK G+K VE+SY+SV+  LTL LG+CHGLAS G Q+PLR LL
Sbjct  1252  DDILQAAIFALTAFFRGGGKIGKKAVEKSYSSVVGALTLQLGSCHGLASSGQQDPLRVLL  1311

Query  4061  NAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICLFLSKS  4240
              +FQAFCECVGDLEMGKILAR GEQ E EKW++LIG++AG ISIKRPKEV  IC  L+K+
Sbjct  1312  TSFQAFCECVGDLEMGKILARNGEQREKEKWVDLIGDIAGCISIKRPKEVRHICSILTKA  1371

Query  4241  LDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQMP  4420
             L+RP R QREAAAAALSEF+RYS  +  ++ +MVEALCRHVSDDSPTVRRLCLRGLVQMP
Sbjct  1372  LNRPQRFQREAAAAALSEFIRYSGDYSSVMEEMVEALCRHVSDDSPTVRRLCLRGLVQMP  1431

Query  4421  SIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSIRLRNL  4600
             S  +  YTTQ++GVILALLDD DESVQLTAVSCLL+V ES+S DAVEP+LLNLS+RLRNL
Sbjct  1432  SACMNHYTTQVIGVILALLDDLDESVQLTAVSCLLMVTESASNDAVEPILLNLSVRLRNL  1491

Query  4601  QVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACRNT  4780
             QV ++ K+RANAFAA GALS Y  G   + F EQIH++ PR+V+HLHDDDL +RQACR T
Sbjct  1492  QVSMDPKMRANAFAALGALSKYAIGGQREGFVEQIHSSLPRLVVHLHDDDLSIRQACRAT  1551

Query  4781  LKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSAIIQAF  4960
             LK +A L++I     L ++  F SD R+DYE+F+RDL++ L Q    RVDTY+++ IQAF
Sbjct  1552  LKRLASLVDIINYSTLYDSRAFGSDDRTDYENFVRDLSKHLVQE-SERVDTYMASTIQAF  1610

Query  4961  DAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATCSAALG  5140
             DAPWPVIQANA++  ++MLSLS++++I +LYY QVF  LV K + S D++VRA CS+A G
Sbjct  1611  DAPWPVIQANAIHFSTTMLSLSEDQHIISLYYPQVFETLVSKMTRSQDSVVRAACSSAFG  1670

Query  5141  LLLKSPNSSSWRDARLNK  5194
             LLL+S  S+ WR ARL++
Sbjct  1671  LLLRSSRSTLWRGARLDR  1688


 Score =   293 bits (750),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 138/188 (73%), Positives = 165/188 (88%), Gaps = 0/188 (0%)
 Frame = +1

Query  85   GDSIPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGN  264
            G SIPA EAVQ++VSSLADDS  VREASM++L+DI SLNPLLVLDCC  VSRGGRRRFGN
Sbjct  7    GSSIPAPEAVQLLVSSLADDSSVVREASMASLRDIASLNPLLVLDCCYAVSRGGRRRFGN  66

Query  265  IAGLFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSH  444
            +AG+FQV++ ++ AL+KG+ D  FM KLAKIATAE+IS+KELNADWQR A+G+LVS+G+H
Sbjct  67   MAGVFQVMAFSVGALEKGESDAVFMGKLAKIATAEIISSKELNADWQRQASGLLVSIGTH  126

Query  445  LPDLMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIY  624
             PDLMM+EIFLH SG  +A PAMVQILAD+A+SDALQFTPRLK VL+RV PILGNVR+++
Sbjct  127  FPDLMMDEIFLHLSGPATAAPAMVQILADFATSDALQFTPRLKDVLSRVSPILGNVRDLH  186

Query  625  RPIFANGL  648
            RPIFAN  
Sbjct  187  RPIFANAF  194



>ref|XP_006296323.1| hypothetical protein CARUB_v10025495mg [Capsella rubella]
 gb|EOA29221.1| hypothetical protein CARUB_v10025495mg [Capsella rubella]
Length=1708

 Score =  2016 bits (5224),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1042/1523 (68%), Positives = 1253/1523 (82%), Gaps = 35/1523 (2%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             A W Y  D +  + LD+DV+SFLNS FELLLRVWA+SRD KVR+S VEALGQMVGLITRT
Sbjct  200   AVWLYITDLTSDSPLDSDVMSFLNSVFELLLRVWAVSRDHKVRVSTVEALGQMVGLITRT  259

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstl  1003
             QLK+ALPRL+P ILELYK++ D A +ATCSLHSLLNASLLS +GPPLLDFEDLT+VLSTL
Sbjct  260   QLKSALPRLIPAILELYKKDHDDALLATCSLHSLLNASLLSESGPPLLDFEDLTIVLSTL  319

Query  1004  llvCS-NNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGS  1180
             L V   N++ K  S   VG KTYNEVQ CFLTVG VYPEDLF FLLNKC+LKE+P TFG+
Sbjct  320   LPVIGINSESKRCSGISVGRKTYNEVQRCFLTVGLVYPEDLFTFLLNKCKLKEDPLTFGA  379

Query  1181  LCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGE  1360
             LC+LKHLLPRL E+WH+KRP+L+++ + L+DE +L VRKAL+ELIVVMASHCYL G SGE
Sbjct  380   LCILKHLLPRLFEAWHSKRPLLVDTARSLLDEQSLAVRKALSELIVVMASHCYLAGPSGE  439

Query  1361  LFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKG  1540
             LF+EYLV H A+ + EN                       L+ K   V+ ++LR VC KG
Sbjct  440   LFVEYLVHHSAIGESEN-----------------------LKAKGEPVSPSQLRAVCGKG  476

Query  1541  LLLITVTVPEMEH-----VLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLS  1705
             LLL+TVT+PEME+     +LWPFLLKMIIP++YTGAVA+VCRCISELCRRRSS +  ML 
Sbjct  477   LLLLTVTIPEMEYMKLQYILWPFLLKMIIPKIYTGAVASVCRCISELCRRRSS-TTPMLI  535

Query  1706  ECKARTDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*I  1885
             ECKAR DIP PEELF RLVVLLHNPLA++ L +QIL+VL YL+PLFPKNI+ FWQDE  I
Sbjct  536   ECKARADIPSPEELFTRLVVLLHNPLAKDQLASQILTVLGYLSPLFPKNISMFWQDE--I  593

Query  1886  PKMKAYVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKS  2065
             PKMKAYV DTEDL+ DP YQE+WDDMII+FLAESLDV Q+ DWV+ LGN FA+QY LY  
Sbjct  594   PKMKAYVFDTEDLQLDPTYQETWDDMIINFLAESLDVTQDADWVISLGNAFAKQYILYTP  653

Query  2066  DNEHSALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLD  2245
             D++H+ALLHRC+GILLQKV+DRAYVR KID MY QA+I++P NRLGLAKAMGLVAASHLD
Sbjct  654   DDDHAALLHRCIGILLQKVNDRAYVRDKIDWMYEQADISIPANRLGLAKAMGLVAASHLD  713

Query  2246  TVLDKLKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEAR  2425
             TVL+KLK I+DNVGQSI QRI S FS+  K E+SDD HAALALMYGYAAKYAP +VIEAR
Sbjct  714   TVLEKLKIIVDNVGQSIFQRILSLFSESYKTEDSDDIHAALALMYGYAAKYAPSSVIEAR  773

Query  2426  IDALVGTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILT  2605
             IDALVGTNMLSRLLHVR   AKQAVITAIDLLG+AVI A+E+G +FPLKRRD +LDYILT
Sbjct  774   IDALVGTNMLSRLLHVRQQTAKQAVITAIDLLGRAVINAAETGATFPLKRRDQMLDYILT  833

Query  2606  LMGRDEEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDP  2785
             LMGRDE EGF++S++E+LHTQ+LAL+ACTTLVSVEPKLT ETRN +MKAT+GFF LPNDP
Sbjct  834   LMGRDENEGFAESSLEVLHTQALALNACTTLVSVEPKLTIETRNRVMKATLGFFALPNDP  893

Query  2786  SDVINPLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAH  2965
             SDVI+PLIDNL+TLLC IL+TSGEDGRSRAEQLLH+LR +D +VSS ++YQRKRGC+A H
Sbjct  894   SDVISPLIDNLVTLLCAILLTSGEDGRSRAEQLLHLLRQLDQYVSSPIDYQRKRGCVAVH  953

Query  2966  ELLIKFRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMV  3145
             E+L+KFR +CV GYCALGC G C H K  D +   N SNLPS F  P R+ L LG+RI+ 
Sbjct  954   EMLLKFRKLCVGGYCALGCSGDCPHRKYADRSMQGNFSNLPSVFLFPDREVLCLGDRIIT  1013

Query  3146  YLPRCIDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILR  3325
             YLPRC DTN EVRK+S QIL+ FF+IS SLPK + SS G+D E SY ALSSLEDV+AIL+
Sbjct  1014  YLPRCADTNSEVRKISAQILDQFFSISLSLPKAVLSS-GLDSEDSYKALSSLEDVIAILK  1072

Query  3326  SDASIDPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNR  3505
             SDASIDPSEVFNR+VSS+C LL +DELVAAL+ C+ AICDKI+QSAEGAIQAV EFV+ R
Sbjct  1073  SDASIDPSEVFNRIVSSICALLTEDELVAALNSCTAAICDKIRQSAEGAIQAVTEFVSRR  1132

Query  3506  GNELNEIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDM  3685
             G++L+E +++RT+QSLL+A VH+T+K LR E +GAI ++AENT   +VF EVLA AGRD+
Sbjct  1133  GSQLSENDIARTTQSLLSAAVHITDKNLRVEAIGAISALAENTQPAIVFNEVLATAGRDI  1192

Query  3686  VTKDIHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSV  3865
             VTKDI R+RGGWP+QDAF+AFSQH  LS  F+EH+IS++N+S  +K GDS KGE+S +S 
Sbjct  1193  VTKDITRMRGGWPMQDAFYAFSQHTELSVLFMEHLISILNRSSLVK-GDSHKGENSSSSS  1251

Query  3866  DGSIEDDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEP  4045
             +  +EDD+ +AA+ ALTAFFRGGGK G+K VE+SY+S++  LTL LG+CHGLAS G Q+P
Sbjct  1252  ETHVEDDILQAAIFALTAFFRGGGKIGKKAVEKSYSSLVGALTLQLGSCHGLASSGQQDP  1311

Query  4046  LRALLNAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICL  4225
             LR LL +FQAFCECVGDLEMGKILAR GEQ E EKW++LIG++AG ISIKRPKEV  ICL
Sbjct  1312  LRVLLTSFQAFCECVGDLEMGKILARNGEQREKEKWVDLIGDIAGCISIKRPKEVRHICL  1371

Query  4226  FLSKSLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRG  4405
              L+K+L+RP R QREAAAAALSEF+RYS  F  ++ +MVEALCRHVSDDSPTVRRLCLRG
Sbjct  1372  ILTKALNRPQRFQREAAAAALSEFIRYSGDFSSVMEKMVEALCRHVSDDSPTVRRLCLRG  1431

Query  4406  LVQMPSIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSI  4585
             LVQMPS  +  YTTQ++GV LALLDD DESVQLTAVSCLL+V+ES+S DAVEP+LLNLS+
Sbjct  1432  LVQMPSACMNHYTTQVIGVTLALLDDLDESVQLTAVSCLLMVIESASNDAVEPILLNLSV  1491

Query  4586  RLRNLQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQ  4765
             RLRNLQV ++ K+RANAF+A GALS Y  G   + F EQIH++ PR+++HLHDDD  +R+
Sbjct  1492  RLRNLQVSMDPKMRANAFSALGALSKYAIGGQREGFVEQIHSSLPRLIVHLHDDDPSIRK  1551

Query  4766  ACRNTLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSA  4945
             ACR TLK  APL++I    AL +T  F SD R+DYE+F+RDL++ L Q    RVDTY+++
Sbjct  1552  ACRVTLKQFAPLVDIINYSALYDTRAFGSDDRTDYENFVRDLSKHLVQE-SERVDTYMAS  1610

Query  4946  IIQAFDAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATC  5125
              IQAFDAPWPVIQANA++  ++MLSLS++++I +LYY QVF  LV K + S D++VRA C
Sbjct  1611  TIQAFDAPWPVIQANAIHFSTTMLSLSEDQHIISLYYPQVFETLVSKMTRSQDSVVRAAC  1670

Query  5126  SAALGLLLKSPNSSSWRDARLNK  5194
             S+A GLLL+S  S+ WR ARL++
Sbjct  1671  SSAFGLLLRSSRSTLWRGARLDR  1693


 Score =   296 bits (758),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 139/188 (74%), Positives = 167/188 (89%), Gaps = 0/188 (0%)
 Frame = +1

Query  85   GDSIPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGN  264
            G SIPA EAVQ++VSSLADDS  VREASM++L+DI SLNPLLVLDCC  VSRGGRRRFGN
Sbjct  7    GSSIPAPEAVQLLVSSLADDSSVVREASMASLRDIASLNPLLVLDCCYAVSRGGRRRFGN  66

Query  265  IAGLFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSH  444
            +AG+FQV++ ++ AL++G+ D  FM KLAKIATAE+IS+KELNADWQR A+G+LVS+G+H
Sbjct  67   MAGVFQVMAFSVGALEEGESDAVFMGKLAKIATAEIISSKELNADWQRQASGLLVSIGTH  126

Query  445  LPDLMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIY  624
             PDLMMEEIFLH SG  +A PAMVQILAD+A+SDALQFTPRLKGVL+RV+PILGNVR+++
Sbjct  127  FPDLMMEEIFLHLSGPATASPAMVQILADFATSDALQFTPRLKGVLSRVLPILGNVRDLH  186

Query  625  RPIFANGL  648
            RPIFAN  
Sbjct  187  RPIFANAF  194



>ref|NP_181219.4| uncharacterized protein [Arabidopsis thaliana]
 sp|F4IP13.1|SHGR6_ARATH RecName: Full=Protein SHOOT GRAVITROPISM 6 [Arabidopsis thaliana]
 gb|AEC09300.1| uncharacterized protein AT2G36810 [Arabidopsis thaliana]
Length=1716

 Score =  2015 bits (5221),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1040/1530 (68%), Positives = 1252/1530 (82%), Gaps = 43/1530 (3%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             A W Y  D +  + LD+DV+SFLNS FELLLRVWA+SRD KVR+S V+ALGQMVGLITRT
Sbjct  200   AVWLYITDLTSDSPLDSDVMSFLNSVFELLLRVWAVSRDHKVRVSTVDALGQMVGLITRT  259

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstl  1003
             QLK+ALPRL+P ILELYK++ D A +ATCSLH+LLNASLLS +GPPLLDFEDLT+VLSTL
Sbjct  260   QLKSALPRLIPAILELYKKDHDDALLATCSLHNLLNASLLSESGPPLLDFEDLTIVLSTL  319

Query  1004  llvCS-NNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGS  1180
             L V   NN++K  SD  VG KTYNEVQ CFLTVG VYPEDLF FLLNKC+LKE+P TFG+
Sbjct  320   LPVIGINNERKRFSDISVGRKTYNEVQRCFLTVGLVYPEDLFTFLLNKCKLKEDPLTFGA  379

Query  1181  LCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGE  1360
             LC+LKHLLPRL E+WH+KRP+L+++   L+DE +L VRKAL+ELIVVMASHCYLVG SGE
Sbjct  380   LCILKHLLPRLFEAWHSKRPLLVDTASSLLDEQSLAVRKALSELIVVMASHCYLVGPSGE  439

Query  1361  LFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKG  1540
             LF+EYLVRH A+ + ++                       L+ K   V+ T+LR VC KG
Sbjct  440   LFVEYLVRHSAIGESDH-----------------------LKAKGELVSPTQLRAVCGKG  476

Query  1541  LLLITVTVPEME-------------HVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRS  1681
             LLL+TVT+PEME             ++LWPFLLKMIIP+VYTGAVA+VCRCI+ELCRRRS
Sbjct  477   LLLLTVTIPEMELSDFNAKEYMKLQYILWPFLLKMIIPKVYTGAVASVCRCITELCRRRS  536

Query  1682  SESNAMLSECKARTDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINS  1861
             S +  ML ECKAR DIP PEELF RLVVLLHNPLA+E L +QIL+VL YL+PLFPKNI+ 
Sbjct  537   S-TTPMLIECKARADIPNPEELFTRLVVLLHNPLAKEQLASQILTVLGYLSPLFPKNISM  595

Query  1862  FWQDEL*IPKMKAYVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFA  2041
             FWQDE  IPKMKAYV DTEDLK DP YQE+WDDMII+FLAESLDV Q+ DWV+ LGN+FA
Sbjct  596   FWQDE--IPKMKAYVYDTEDLKLDPTYQETWDDMIINFLAESLDVTQDADWVISLGNSFA  653

Query  2042  RQYELYKSDNEHSALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMG  2221
             +QY LY  D++H+ALLHRC+GILLQKV+DRAYVR KID MY QA+I++P NRLGLAKAMG
Sbjct  654   KQYILYAPDDDHAALLHRCIGILLQKVNDRAYVRDKIDWMYEQADISIPANRLGLAKAMG  713

Query  2222  LVAASHLDTVLDKLKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYA  2401
             LVAASHLDTVL+KLK I+DNVGQSI QRI S FS+  K E+SDD HAALALMYGYAAKYA
Sbjct  714   LVAASHLDTVLEKLKIIVDNVGQSIFQRILSLFSESYKTEDSDDIHAALALMYGYAAKYA  773

Query  2402  PPTVIEARIDALVGTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRD  2581
             P +VIEARIDALVGTNMLSRLLHVR   AKQAVITAIDLLG+AVI A+E+G +FPLKRRD
Sbjct  774   PSSVIEARIDALVGTNMLSRLLHVRQQTAKQAVITAIDLLGRAVINAAETGATFPLKRRD  833

Query  2582  LLLDYILTLMGRDEEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIG  2761
              +LDYILTLMGRDE EGF++S++E+LHTQ+LAL+ACTTLVSVEPKLT ETRN +MKAT+G
Sbjct  834   QMLDYILTLMGRDENEGFAESSLEVLHTQALALNACTTLVSVEPKLTIETRNRVMKATLG  893

Query  2762  FFGLPNDPSDVINPLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQR  2941
             FF LPNDPSDVI+PLIDNL+TLLC IL+TSGEDGRSRAEQLLH+LR +D +VSS ++YQR
Sbjct  894   FFALPNDPSDVISPLIDNLVTLLCAILLTSGEDGRSRAEQLLHLLRQLDQYVSSPIDYQR  953

Query  2942  KRGCLAAHELLIKFRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDAL  3121
             KRGC+A HE+L+KFR +CV GYCALGC G C H K  D +   N SNLPS F  P R+ L
Sbjct  954   KRGCVAVHEMLLKFRKLCVGGYCALGCSGDCPHRKYADRSMQGNFSNLPSVFLFPDREVL  1013

Query  3122  SLGERIMVYLPRCIDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSL  3301
              LG+R++ YLPRC DTN EVRK+S QIL+ FF+IS SLPK + +S G+D E SY ALSSL
Sbjct  1014  CLGDRVITYLPRCADTNSEVRKISAQILDQFFSISLSLPKAVLTS-GLDSEDSYKALSSL  1072

Query  3302  EDVVAILRSDASIDPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQA  3481
             EDV+AIL+SDASIDPSEVFNR+VSS+C+LL + ELVAALH C+ AICDKI+QSAEGAIQA
Sbjct  1073  EDVIAILKSDASIDPSEVFNRIVSSICSLLTEHELVAALHSCTAAICDKIRQSAEGAIQA  1132

Query  3482  VVEFVTNRGNELNEIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEV  3661
             V EFV+ RG++L++ ++SRT+ SLL+A VH+T+K LR E +GAI ++AENT S +VF EV
Sbjct  1133  VTEFVSRRGSQLSDNDISRTTHSLLSAAVHITDKNLRVEAIGAISALAENTQSSIVFNEV  1192

Query  3662  LAAAGRDMVTKDIHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGK  3841
             LA AG+D+VTKDI R+RGGWP+QDAF+AFSQH  LS  F+EH+IS++N+S  +K  DS K
Sbjct  1193  LATAGKDIVTKDITRMRGGWPMQDAFYAFSQHTELSVLFMEHLISILNRSSLVK-SDSHK  1251

Query  3842  GESSRNSVDGSIEDDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchgl  4021
             GE++ +S +  +EDD+ +AA+ ALTAFFRGGGK G+K VE+SY+SV+  LTL LG+CHGL
Sbjct  1252  GENTSSSSETHVEDDILQAAIFALTAFFRGGGKIGKKAVEKSYSSVVGALTLQLGSCHGL  1311

Query  4022  aSYGDQEPLRALLNAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRP  4201
             AS G Q+PLR LL +FQAFCECVGDLEMGKILAR GEQ E EKW+ LIG++AG ISIKRP
Sbjct  1312  ASSGQQDPLRVLLTSFQAFCECVGDLEMGKILARNGEQIEKEKWVGLIGDIAGCISIKRP  1371

Query  4202  KEVPTICLFLSKSLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPT  4381
             KEV  IC+ L+K+L+RP R QREAAAAALSEF+RYS  F  ++ +MVEALCRHVSDDSPT
Sbjct  1372  KEVRHICMILTKALNRPQRFQREAAAAALSEFIRYSGDFSSVMEEMVEALCRHVSDDSPT  1431

Query  4382  VRRLCLRGLVQMPSIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVE  4561
             VRRLCLRGLVQMPS  +  YTTQ++GVILALLDD DESVQLTAVSCLL+V ES+S DAVE
Sbjct  1432  VRRLCLRGLVQMPSACMSHYTTQVIGVILALLDDLDESVQLTAVSCLLMVTESASNDAVE  1491

Query  4562  PVLLNLSIRLRNLQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLH  4741
             P+LLNLS+RLRNLQV ++ K+RANAF+A GALS Y  G   + F EQIH+  PR+V+HLH
Sbjct  1492  PILLNLSVRLRNLQVSMDPKMRANAFSALGALSKYATGGQREGFVEQIHSTLPRLVVHLH  1551

Query  4742  DDDLGVRQACRNTLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGP  4921
             DDD  +RQACR TLK  APL++I     L ++  F S+ R+DYE+F+RDL++ L Q    
Sbjct  1552  DDDPSIRQACRVTLKRFAPLVDIINYSTLYDSRAFGSEDRTDYENFVRDLSKHLVQE-SE  1610

Query  4922  RVDTYLSAIIQAFDAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNST  5101
             RVDTY+++ IQAFDAPWPVIQANA++  ++MLSLS++++I +LYY QVF  LV K + S 
Sbjct  1611  RVDTYMASTIQAFDAPWPVIQANAIHFSTTMLSLSEDQHIISLYYPQVFETLVSKMTRSQ  1670

Query  5102  DAIVRATCSAALGLLLKSPNSSSWRDARLN  5191
             D++VRA CS+A GLLL+S  S+ WR ARL+
Sbjct  1671  DSVVRAACSSAFGLLLRSSKSTLWRGARLD  1700


 Score =   298 bits (763),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 166/188 (88%), Gaps = 0/188 (0%)
 Frame = +1

Query  85   GDSIPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGN  264
            G SIPA EAVQ++VSSLADDS  VREASM++L+DI SLNPLLVLDCC  VSRGGRRRFGN
Sbjct  7    GSSIPAPEAVQLLVSSLADDSSVVREASMASLRDIASLNPLLVLDCCYAVSRGGRRRFGN  66

Query  265  IAGLFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSH  444
            +AG+FQV++ ++ AL+KG+ D  FM KLAKIATAE+IS+KELNADWQR A+G+LVS+G+H
Sbjct  67   MAGVFQVMAFSVGALEKGESDSVFMGKLAKIATAEIISSKELNADWQRQASGLLVSIGTH  126

Query  445  LPDLMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIY  624
             PDLMMEEIFLH SG  +A PAMVQILAD+ASSDALQFTPRLKGVL++V PILGNVR+I+
Sbjct  127  FPDLMMEEIFLHLSGPATAAPAMVQILADFASSDALQFTPRLKGVLSKVSPILGNVRDIH  186

Query  625  RPIFANGL  648
            RPIFAN  
Sbjct  187  RPIFANAF  194



>ref|XP_006442482.1| hypothetical protein CICLE_v10023867mg, partial [Citrus clementina]
 gb|ESR55722.1| hypothetical protein CICLE_v10023867mg, partial [Citrus clementina]
Length=1400

 Score =  2005 bits (5195),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1005/1394 (72%), Positives = 1167/1394 (84%), Gaps = 22/1394 (2%)
 Frame = +2

Query  1013  CSNNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGSLCVL  1192
             C  ND KEHS F VGLKTYNEVQ CFLTVG VYP+DLF+FLLNKCRLKEE  + G+L VL
Sbjct  14    CIYNDSKEHSSFSVGLKTYNEVQRCFLTVGLVYPDDLFMFLLNKCRLKEEHLSVGALYVL  73

Query  1193  KHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGELFIE  1372
             KHLLPR +E+WH+KRP+L+E+VK L+DE NL V+KA++ELIVVMASHCYL+G SGELF+E
Sbjct  74    KHLLPRSSEAWHSKRPLLLEAVKSLLDEQNLAVQKAISELIVVMASHCYLIGPSGELFVE  133

Query  1373  YLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKGLLLI  1552
             YLVRHCA+ D +    ESS+                   K GA   TELR +CEKGLLL+
Sbjct  134   YLVRHCALSDQKKYVNESSK------------------VKIGAFCPTELRAICEKGLLLL  175

Query  1553  TVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKARTDIP  1732
             T+T+PEM+H+LWPFLLKMIIPR YT A ATVCRCISELCR RSS SN MLSECKAR DIP
Sbjct  176   TITIPEMQHILWPFLLKMIIPRAYTSAAATVCRCISELCRHRSSSSNVMLSECKARDDIP  235

Query  1733  KPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKAYVSD  1912
              PEELFARLVVLLH+PLARE   TQIL VL+YL+PLFP NI+ FWQDE  IPKMKAYVSD
Sbjct  236   NPEELFARLVVLLHDPLAREQQATQILMVLYYLSPLFPTNIDLFWQDE--IPKMKAYVSD  293

Query  1913  TEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHSALLH  2092
             TEDLK DP YQE+WDDMII+FLAESLDV+Q  DW++ LGN F  QY LY  D++HSALLH
Sbjct  294   TEDLKLDPSYQETWDDMIINFLAESLDVVQETDWLISLGNAFTEQYVLYTPDDDHSALLH  353

Query  2093  RCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDKLKGI  2272
             RCLGILLQKV DR YV  KID MY+QANI++P NRLGLAKAMGLVAASHLD VL+ LKGI
Sbjct  354   RCLGILLQKVADRNYVCDKIDWMYKQANISIPANRLGLAKAMGLVAASHLDAVLEMLKGI  413

Query  2273  LDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALVGTNM  2452
             LDN+GQS+ QR+ SFFSD  +MEESDD HAALALMYGYAAKYAP TVIEARIDALVGTNM
Sbjct  414   LDNIGQSLFQRLLSFFSDSYRMEESDDIHAALALMYGYAAKYAPSTVIEARIDALVGTNM  473

Query  2453  LSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRDEEEG  2632
             LSRLLHVRH  AKQAVITAIDLLG+AVI A+E+G SFPLK+RD LLDYILTLMGR+E + 
Sbjct  474   LSRLLHVRHHTAKQAVITAIDLLGRAVINAAENGASFPLKKRDQLLDYILTLMGREENDS  533

Query  2633  FSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVINPLID  2812
             F+DS+IELLHTQ+LALSACTTLV+VEPKLT ETRN +MKAT+GFF LPNDP DV+NPLID
Sbjct  534   FADSSIELLHTQALALSACTTLVTVEPKLTIETRNHVMKATLGFFALPNDPIDVVNPLID  593

Query  2813  NLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIKFRAI  2992
             NLITLLC IL+TSGEDGRSRA+QLLHILR ID +VSS +EYQR+R CLA +E+L+KFR +
Sbjct  594   NLITLLCAILLTSGEDGRSRADQLLHILRQIDQYVSSPVEYQRRRSCLAVYEMLLKFRTL  653

Query  2993  CVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPRCIDTN  3172
             CV GYCALGC GSC+H KQID A   N SNLPSA+ LPSR+AL LG R+++YLPRC DT+
Sbjct  654   CVIGYCALGCHGSCTHIKQIDRAVLGNFSNLPSAYVLPSREALCLGNRVIMYLPRCADTD  713

Query  3173  YEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILRSDASIDPSE  3352
              EVRK+S QIL+  F+IS SLP+P+ SS GID+ELSY ALSSLEDV+AILRSDASIDPSE
Sbjct  714   SEVRKISAQILDQLFSISLSLPRPVGSSSGIDLELSYGALSSLEDVIAILRSDASIDPSE  773

Query  3353  VFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNELNEIEV  3532
             VFNR+VSSVC LL KDELVA LH C+ AICD+ KQSAEGAIQAVVEFVT RGNEL+E +V
Sbjct  774   VFNRIVSSVCILLTKDELVATLHSCTTAICDRTKQSAEGAIQAVVEFVTKRGNELSETDV  833

Query  3533  SRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMVTKDIHRLR  3712
             SRT+QSLL+A VH+T+K+LR ETLGAI  +AENT SK+VF EVLA AG+D+VTKDI RLR
Sbjct  834   SRTTQSLLSAAVHITDKHLRLETLGAISCLAENTNSKIVFNEVLATAGKDIVTKDISRLR  893

Query  3713  GGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSVDGSIEDDVS  3892
             GGWP+QDAFHAFSQH VLS  FLEH+IS +NQ+P +K GD  KG+ S +S D  I+DD+ 
Sbjct  894   GGWPMQDAFHAFSQHAVLSFLFLEHLISALNQTPFVK-GDMEKGDYSSHSADTWIDDDIL  952

Query  3893  RAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPLRALLNAFQ  4072
             +AA+LALTAFFRGGGK G+K VE+SYA VLA LTL LG+CHGLAS G  EPLRA+L +FQ
Sbjct  953   QAAILALTAFFRGGGKVGKKAVEKSYAPVLAALTLQLGSCHGLASSGQHEPLRAILTSFQ  1012

Query  4073  AFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICLFLSKSLDRP  4252
             AFCECVGDLEM KILAR GEQN+ EKWINLIG++AG + IKRPKEV TICL L+KS++R 
Sbjct  1013  AFCECVGDLEMRKILARDGEQNDKEKWINLIGDVAGCVYIKRPKEVQTICLILTKSINRQ  1072

Query  4253  LRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQMPSIHV  4432
              R QREAAAAALSEF+RYS GF  LL QMVEALCRHVSD+SPTVR LCLRGLVQ+PSIH+
Sbjct  1073  QRFQREAAAAALSEFVRYSGGFDSLLEQMVEALCRHVSDESPTVRGLCLRGLVQIPSIHI  1132

Query  4433  LQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSIRLRNLQVCL  4612
              QY TQ+L VILALLDD DESVQLTAVSCLL +L+SSS DAVEP+LLNLS+RLRNLQV +
Sbjct  1133  HQYATQVLSVILALLDDLDESVQLTAVSCLLTILKSSSKDAVEPILLNLSVRLRNLQVSM  1192

Query  4613  NAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACRNTLKCI  4792
             N K+R NAFAAFGALS++G GS  ++F EQIHA  PR++LH++DDDL VRQACRNTLK +
Sbjct  1193  NVKMRRNAFAAFGALSNFGVGSQQEAFLEQIHAMLPRLILHIYDDDLSVRQACRNTLKQV  1252

Query  4793  APLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSAIIQAFDAPW  4972
             AP +EI  +  + N+H F+SDHRSDYE F+RDL RQ  Q+   R+D+Y+ + IQAF+APW
Sbjct  1253  APFMEI-GVYGIFNSHCFNSDHRSDYETFVRDLTRQFVQHFPSRIDSYMGSTIQAFEAPW  1311

Query  4973  PVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATCSAALGLLLK  5152
             P+IQANA+Y  SS+L L D+++I +L+Y+QVFG+LV K S S DAIVRATCS++LG LLK
Sbjct  1312  PIIQANAIYFSSSILCLCDDQHILSLFYTQVFGLLVVKLSRSADAIVRATCSSSLGWLLK  1371

Query  5153  SPNSSSWRDARLNK  5194
             S NS SWR  RL +
Sbjct  1372  SINSHSWRSTRLER  1385



>ref|XP_010267300.1| PREDICTED: protein SHOOT GRAVITROPISM 6 isoform X5 [Nelumbo nucifera]
Length=1374

 Score =  1986 bits (5145),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 993/1377 (72%), Positives = 1179/1377 (86%), Gaps = 5/1377 (0%)
 Frame = +2

Query  1061  KTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGSLCVLKHLLPRLAESWHNKRP  1240
             KTYNEVQHCFLTVG VY EDLF+FLLNKCRLKEEP+T+G+LCVLKHLLPRL+E+WH KRP
Sbjct  3     KTYNEVQHCFLTVGLVYSEDLFMFLLNKCRLKEEPYTYGALCVLKHLLPRLSEAWHAKRP  62

Query  1241  ILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGELFIEYLVRHCAMPDLENVEL  1420
             +L+E+VKLL+DE +LG+RKAL+ELIVVMAS+CY+VG SGELF+EYLV HCA+ D E    
Sbjct  63    LLVEAVKLLLDEQSLGIRKALSELIVVMASNCYVVGPSGELFVEYLVHHCAISDQELNNF  122

Query  1421  ESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKGLLLITVTVPEMEHVLWPFLL  1600
             E+S++  R + +++ F  ++LE K GA    ELR +CEKGLLL+T+T+PEME+VLWPFLL
Sbjct  123   ENSKDV-RSSISFHAFQQKRLEVKIGAACPAELRSICEKGLLLLTITIPEMEYVLWPFLL  181

Query  1601  KMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKARTDIPKPEELFARLVVLLHNP  1780
             KMI+PR YTGA ATVCRCISELCR RSS ++++L++CKARTDIP PE+LFARLVVLLH+P
Sbjct  182   KMIVPRKYTGAAATVCRCISELCRHRSSYASSVLTDCKARTDIPNPEDLFARLVVLLHDP  241

Query  1781  LAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKAYVSDTEDLKQDPLYQESWDD  1960
             LARE L TQIL+VL YL PLFP+N++ FWQDE  IPKMKAYVSDTEDLKQDP YQE+WD+
Sbjct  242   LAREQLATQILTVLCYLGPLFPRNVSLFWQDE--IPKMKAYVSDTEDLKQDPAYQETWDN  299

Query  1961  MIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHSALLHRCLGILLQKVHDRAYV  2140
             MII+FLAESLDVIQ+ +W++ LGN F +QYELY SD+EH+ALLHRCLG+LLQK+ DRAYV
Sbjct  300   MIINFLAESLDVIQDPEWLISLGNAFTKQYELYTSDDEHTALLHRCLGMLLQKIDDRAYV  359

Query  2141  RAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDKLKGILDNVGQSILQRIFSFF  2320
             R KID MYRQANI+VPTNRLGLAK MGLVA+SHLDTVL+KLK ILDNVG +  QR  S F
Sbjct  360   REKIDWMYRQANISVPTNRLGLAKGMGLVASSHLDTVLEKLKDILDNVGLNFFQRFLSLF  419

Query  2321  SDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALVGTNMLSRLLHVRHPRAKQAV  2500
             S+R KME++DD HAALALMYGYAA+YAP TVIEARIDALVGTNMLSRLLHVR   AKQAV
Sbjct  420   SERVKMEDADDIHAALALMYGYAARYAPSTVIEARIDALVGTNMLSRLLHVRCHTAKQAV  479

Query  2501  ITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRDEEEGFSDSNIELLHTQSLAL  2680
             ITAIDLLG+AVI A+ESG SFPLKRRD LLDYILTLMGRD+ + F+DS++ELL TQSLAL
Sbjct  480   ITAIDLLGRAVINAAESGASFPLKRRDQLLDYILTLMGRDDTDSFADSSLELLRTQSLAL  539

Query  2681  SACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVINPLIDNLITLLCTILVTSGED  2860
             SACTTLVSVEPKLT ETRN +MKAT+GFF LP+DPSD+++PLI+NLITLLC IL+TSGED
Sbjct  540   SACTTLVSVEPKLTIETRNHVMKATLGFFALPSDPSDIVDPLINNLITLLCAILLTSGED  599

Query  2861  GRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIKFRAICVNGYCALGCQGSCSH  3040
             GRSRAEQLLHILR ID ++SSS+E+QRKRGC+A HE+L+KFRA+C +GYC LGC GSC H
Sbjct  600   GRSRAEQLLHILRQIDLYISSSMEHQRKRGCIAVHEMLLKFRALCSSGYCTLGCHGSCVH  659

Query  3041  SKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPRCIDTNYEVRKVSVQILNLFFN  3220
             +KQID   + N SNLPSAF LPSR +L LGER++VYLPRC DT+ EVRKVS QIL++ F+
Sbjct  660   TKQIDRMLHGNFSNLPSAFVLPSRASLCLGERVIVYLPRCADTSAEVRKVSAQILDILFS  719

Query  3221  ISFSLPKPINSSLGIDIELSYIALSSLEDVVAILRSDASIDPSEVFNRVVSSVCTLLNKD  3400
             IS SLP+P  S++  + ELSY ALSSLEDV+AILRSD SID SEVFNRV+SSVC LL KD
Sbjct  720   ISLSLPRPAESNISFNAELSYGALSSLEDVIAILRSDTSIDQSEVFNRVLSSVCNLLTKD  779

Query  3401  ELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNELNEIEVSRTSQSLLTAVVHVTE  3580
             ELV  LHGC+ AICDK++QSAEGAIQAVVEFVT RG ELNE++VSRT+ +LL+A + V E
Sbjct  780   ELVGTLHGCTAAICDKVRQSAEGAIQAVVEFVTRRGIELNEMDVSRTTHALLSATLLVPE  839

Query  3581  KYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMVTKDIHRLRGGWPIQDAFHAFSQHL  3760
             K+LR E LGAI  +AENT+S+VVF EVLA AGRD++ KDI RLRGGWP+QDAF+ FSQH 
Sbjct  840   KHLRHEILGAISCLAENTSSQVVFNEVLAVAGRDILRKDISRLRGGWPMQDAFYVFSQHT  899

Query  3761  VLSHSFLEHVISVINQSPALKGGDSGKGESSRNSVDGSIEDDVSRAAVLALTAffrgggk  3940
             VLS  FLEHV+S++N +P  K  DS KG S  N  D  IED++ +AA+LALTA FRGGGK
Sbjct  900   VLSVLFLEHVVSILNHTPIPK-ADSEKGGSC-NLFDTQIEDNILQAALLALTALFRGGGK  957

Query  3941  fgrkTVEQSYASVlatltlhlgtchglaSYGDQEPLRALLNAFQAFCECVGDLEMGKILA  4120
              G+K+VEQSYA+VL+TLTLHLG+CHGLA    QE LR LL AFQAFCECVGDLEMGKILA
Sbjct  958   VGKKSVEQSYAAVLSTLTLHLGSCHGLAGSDQQESLRTLLAAFQAFCECVGDLEMGKILA  1017

Query  4121  RGGEQNENEKWINLIGELAGSISIKRPKEVPTICLFLSKSLDRPLRVQREAAAAALSEFL  4300
             R GEQNENEKW+ LIG+LAG ISIKRPKEVP IC+ L K+L+     QRE+AAAALSEF+
Sbjct  1018  RDGEQNENEKWVTLIGDLAGCISIKRPKEVPAICINLCKALNGHQTYQRESAAAALSEFV  1077

Query  4301  RYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQMPSIHVLQYTTQILGVILALLD  4480
             RYSD  G LL Q+VEA+CRHVSD+SPTVRRLCLRGLVQ+PS+H+LQYTTQILGVILALL+
Sbjct  1078  RYSDRVGSLLEQLVEAMCRHVSDESPTVRRLCLRGLVQIPSVHILQYTTQILGVILALLE  1137

Query  4481  DSDESVQLTAvsclllvlesssTDAVEPVLLNLSIRLRNLQVCLNAKIRANAFAAFGALS  4660
             D DESV+LTAVSCLL VLESS  DAV+PVLL+LSIRLRNLQ C+N K+RANAFAAFGALS
Sbjct  1138  DPDESVELTAVSCLLTVLESSPNDAVDPVLLSLSIRLRNLQSCMNDKMRANAFAAFGALS  1197

Query  4661  SYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACRNTLKCIAPLIEIDAIPALLNTH  4840
              YG G+  ++F EQ+HA+ PR++LH+HDDDL VRQACRNTL+ I PL+E+D++ A  NTH
Sbjct  1198  KYGVGAQHEAFLEQVHASLPRLILHVHDDDLSVRQACRNTLRQIVPLMEVDSMTARFNTH  1257

Query  4841  RFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSAIIQAFDAPWPVIQANAVYLCSSMLS  5020
              F+SDHRSDYEDF+RDL RQL Q   PR+DTY+++ +QAFDAPWP+IQANA+Y  S MLS
Sbjct  1258  YFNSDHRSDYEDFIRDLTRQLCQNFSPRIDTYMASAVQAFDAPWPIIQANAIYFSSCMLS  1317

Query  5021  LSDNKNISALYYSQVFGVLVGKASNSTDAIVRATCSAALGLLLKSPNSSSWRDARLN  5191
             LSD++ IS  +++QVFG+L GK S S DA+VRATC +ALG+LLKS NS+SWR +RL+
Sbjct  1318  LSDDQRISTPFFAQVFGMLTGKMSRSPDAVVRATCLSALGMLLKSSNSTSWRTSRLD  1374



>ref|XP_010037124.1| PREDICTED: protein SHOOT GRAVITROPISM 6 isoform X4 [Eucalyptus 
grandis]
Length=1421

 Score =  1982 bits (5134),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 994/1411 (70%), Positives = 1185/1411 (84%), Gaps = 16/1411 (1%)
 Frame = +2

Query  968   DFEDltvvlstll-lvCSNNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNK  1144
             DFEDLTV+LSTLL +VC NN+ KE +DF VGLKTYNEVQ CFLTVGSVYPEDLF FL++K
Sbjct  10    DFEDLTVILSTLLPVVCVNNEGKERADFSVGLKTYNEVQRCFLTVGSVYPEDLFGFLMSK  69

Query  1145  CRLKEEPFTFGSLCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVM  1324
             CRLKEE  TFG++CVLKHL+PRL+E WH+KR  L+E+VK L+DE +L VRKAL+ELIVVM
Sbjct  70    CRLKEESLTFGAICVLKHLVPRLSEVWHSKRLSLVEAVKSLLDEQSLSVRKALSELIVVM  129

Query  1325  ASHCYLVGSSGELFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAV  1504
             ASHCYLVG SGELF+EYLVRHCA+ D E    ESS+E             R+LE K G V
Sbjct  130   ASHCYLVGPSGELFVEYLVRHCALSDYERTAHESSKEIQN----------RRLEVKIGVV  179

Query  1505  TTTELRGVCEKGLLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRS-  1681
                ELR +CEKGLLL+T+T+PEMEH+LWPFLLKMIIPR+YT AVATVCRCISELCR ++ 
Sbjct  180   NPAELRAICEKGLLLLTITIPEMEHILWPFLLKMIIPRMYTSAVATVCRCISELCRHQTY  239

Query  1682  SESNAMLSECKARTDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINS  1861
             + +  +LS+CKAR DIP PEELFARLVVLLH+PL R+ L T IL+VL+YLAPLFP+N+N 
Sbjct  240   NNTETVLSDCKARPDIPSPEELFARLVVLLHDPLERKQLATHILAVLYYLAPLFPRNVNL  299

Query  1862  FWQDEL*IPKMKAYVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFA  2041
             FWQDE  IPKMKAYVSDTEDLK DP YQE+WDDMII+FLAESLDVIQ++DWV+ LGN+F 
Sbjct  300   FWQDE--IPKMKAYVSDTEDLKLDPSYQETWDDMIINFLAESLDVIQDIDWVISLGNSFT  357

Query  2042  RQYELYKSDNEHSALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMG  2221
             RQYELY SD+EHSALLHRCLG+LLQKV DRAYV  KI  MY+QANI+ PTNRLGLAKAMG
Sbjct  358   RQYELYTSDDEHSALLHRCLGVLLQKVDDRAYVHDKIAWMYKQANISNPTNRLGLAKAMG  417

Query  2222  LVAASHLDTVLDKLKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYA  2401
             LVAASHLDTVL+KLK ILDNV QS +QR  SFFSD  K  ESDD HAALALMYGYAA+YA
Sbjct  418   LVAASHLDTVLEKLKDILDNVCQSFVQRFLSFFSDSFKGMESDDIHAALALMYGYAARYA  477

Query  2402  PPTVIEARIDALVGTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRD  2581
             P TVI+ARIDALVGTNMLSRLLHV+HP AKQAVITAIDLLG+AVI A+ESG  FPLKRRD
Sbjct  478   PSTVIQARIDALVGTNMLSRLLHVQHPTAKQAVITAIDLLGRAVINAAESGAPFPLKRRD  537

Query  2582  LLLDYILTLMGRDEEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIG  2761
              LLDYILTLMGRD+ +G++DSN+ELL TQ+LALSACTTLVSVEPKLT ETRN ++KAT+G
Sbjct  538   QLLDYILTLMGRDDNDGWTDSNLELLRTQALALSACTTLVSVEPKLTIETRNYVLKATLG  597

Query  2762  FFGLPNDPSDVINPLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQR  2941
             FF LPNDP DV+NPLI+NLI LLC IL+TSGEDGRSRAEQLLHILR ID +V+S ++YQR
Sbjct  598   FFALPNDPIDVVNPLINNLIDLLCAILLTSGEDGRSRAEQLLHILRQIDKYVASPVDYQR  657

Query  2942  KRGCLAAHELLIKFRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDAL  3121
             KRGCLAA+++L KFR +C  GYC+LGC G+C+HSKQID     N S+LP+A+ LPSR+ L
Sbjct  658   KRGCLAAYKMLTKFRMLCATGYCSLGCHGTCTHSKQIDRGLLGNFSSLPTAYVLPSREGL  717

Query  3122  SLGERIMVYLPRCIDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSL  3301
             SLG+R++ YLPRC DT  EVRK+S +IL+  F+IS SLP+P+ +S+ +D+E SY ALSSL
Sbjct  718   SLGDRVIAYLPRCADTESEVRKISAEILDQLFSISLSLPRPVTASV-VDVESSYSALSSL  776

Query  3302  EDVVAILRSDASIDPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQA  3481
             EDV+AILRSDASIDPSEVFNR+VSSVC LL KDEL++ L GC+ AICDKIKQSAEGAIQA
Sbjct  777   EDVIAILRSDASIDPSEVFNRIVSSVCGLLTKDELLSTLFGCTTAICDKIKQSAEGAIQA  836

Query  3482  VVEFVTNRGNELNEIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEV  3661
             V EFV+ RG ELNE +VSRT+QSLL+A  HV EK LR ETL AICS+AENT+SK VF EV
Sbjct  837   VTEFVSKRGAELNENDVSRTTQSLLSAANHVAEKQLRLETLSAICSLAENTSSKAVFNEV  896

Query  3662  LAAAGRDMVTKDIHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGK  3841
             +AAAGRD+VTKDI RLRGGWP+QDAF+AFSQH +L++SFLEH+IS+INQSP  K  D  K
Sbjct  897   VAAAGRDIVTKDISRLRGGWPMQDAFYAFSQHTMLAYSFLEHIISIINQSPGSK-DDLFK  955

Query  3842  GESSRNSVDGSIEDDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchgl  4021
              E S   ++G ++++  +AA++ALT+FFRGGGK GRK VEQSY+ VL  L + LG+ H L
Sbjct  956   VEVSSCGLEGHLDNEFLQAAIVALTSFFRGGGKVGRKAVEQSYSHVLTELIIQLGSSHVL  1015

Query  4022  aSYGDQEPLRALLNAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRP  4201
             A  G  EPL+ALL AF+AFCECVGDLEMGKILAR GEQNE+EKW+ LIG+LAGSISIKRP
Sbjct  1016  AGAGQHEPLQALLAAFRAFCECVGDLEMGKILARDGEQNEDEKWVTLIGDLAGSISIKRP  1075

Query  4202  KEVPTICLFLSKSLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPT  4381
             KEV +IC+ LS SL+R  + QREAAAAALSEF+RYS GF  +L QMVEA+CRHVSD+SPT
Sbjct  1076  KEVQSICIILSSSLNRNHKYQREAAAAALSEFIRYSGGFDSVLEQMVEAMCRHVSDESPT  1135

Query  4382  VRRLCLRGLVQMPSIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVE  4561
             VRRLCLRGLVQ+PS+H++QYT Q+LGVILALLDD+DESVQLTAVSCLL +L+S+  +AVE
Sbjct  1136  VRRLCLRGLVQIPSVHIVQYTAQVLGVILALLDDTDESVQLTAVSCLLTILDSAQIEAVE  1195

Query  4562  PVLLNLSIRLRNLQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLH  4741
             P+LLNLS RLRNLQ+ ++ K+RA+A AAFGALS+Y  G   ++F EQ+HA  PR+V HL+
Sbjct  1196  PILLNLSKRLRNLQISMDVKMRADAIAAFGALSNYAIGPQREAFVEQVHAVLPRLVFHLY  1255

Query  4742  DDDLGVRQACRNTLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGP  4921
             DD+ G+RQACR+TLK +APL E +      N   F+SDHRSDYEDF+R+LA+Q TQ+L  
Sbjct  1256  DDNHGIRQACRSTLKQVAPLFETEGFSMPFNVQNFNSDHRSDYEDFVRNLAKQFTQHLSS  1315

Query  4922  RVDTYLSAIIQAFDAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNST  5101
             RVDTY+++ IQAFDAPWP+IQANA+Y   S+LSLSD+++I  +YY+QVF +LVGK S S+
Sbjct  1316  RVDTYMASTIQAFDAPWPLIQANAIYFACSLLSLSDDQHILTVYYTQVFSLLVGKMSRSS  1375

Query  5102  DAIVRATCSAALGLLLKSPNSSSWRDARLNK  5194
              A+VRATC +ALGLLLKS NS SWR+ RL++
Sbjct  1376  HAVVRATCFSALGLLLKSTNSRSWREVRLDR  1406



>gb|KHG26711.1| HEAT repeat-containing 7A [Gossypium arboreum]
Length=1704

 Score =  1962 bits (5084),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1041/1533 (68%), Positives = 1224/1533 (80%), Gaps = 79/1533 (5%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             A WQY++DF   + +D DV+SFLNSAFELLLRVWA SRDLKVR+S+VEALGQMVGLITR+
Sbjct  201   AVWQYNIDFPSESPIDGDVMSFLNSAFELLLRVWAASRDLKVRVSSVEALGQMVGLITRS  260

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstl  1003
              LKAALPRLVPTILELY+++QD   +AT SL++LLNASLL   GPPLLDFE+L+V+LSTL
Sbjct  261   HLKAALPRLVPTILELYRKDQDIELIATYSLYNLLNASLLPETGPPLLDFEELSVILSTL  320

Query  1004  l-lvCSNNDKKEHSDFPVGLK---------------TYNEVQHCFLTVGSVYPEDLFVFL  1135
             L ++C N+D KE S F V LK               TYNEVQ CFL+VGSVYPEDLF FL
Sbjct  321   LPVICMNSDSKECSKFSVALKVPFLFPHHNFYTALQTYNEVQRCFLSVGSVYPEDLFSFL  380

Query  1136  LNKCRLKEEPFTFGSLCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELI  1315
             LNKCRLKEEP TFG+LCVLKHLLPR +E+WHNKR +L+++VKLL+DE NL +RKAL+ELI
Sbjct  381   LNKCRLKEEPLTFGALCVLKHLLPRSSEAWHNKRHLLVDTVKLLLDEQNLDIRKALSELI  440

Query  1316  VVMASHCYLVGSSGELFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKA  1495
             VVMASHCYLVG S ELFIEYLV                                    K 
Sbjct  441   VVMASHCYLVGPSAELFIEYLV------------------------------------KT  464

Query  1496  GAVTTTELRGVCEKGLLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRR  1675
              +    ELR +CEKGLLL+T+T+PEME                      VCRCI+ELCR 
Sbjct  465   RSTCPKELRAICEKGLLLVTITIPEME----------------------VCRCIAELCRH  502

Query  1676  RSSESNAMLSECKARTDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNI  1855
             RSS ++ ++ + KAR DIP PEELFARLVVLLHNPLARE   T IL VL YLAPLFP++I
Sbjct  503   RSSYNHNIVGDYKARDDIPSPEELFARLVVLLHNPLAREQRATHILKVLSYLAPLFPRSI  562

Query  1856  NSFWQDEL*IPKMKAYVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNT  2035
             N FWQDE  I KMKAY+SD EDLK DP YQE+WD+MII+FLAESLDVI + DW+L LGN 
Sbjct  563   NLFWQDE--IQKMKAYISDPEDLKLDPSYQETWDEMIINFLAESLDVIHDNDWMLSLGNA  620

Query  2036  FARQYELYKSDNEHSALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKA  2215
             F +QY LY  D+EHSA+LHRCLG+LLQKV+DRAYVR KID MY+QANIA+P NRLGLAK+
Sbjct  621   FTKQYALYTPDDEHSAVLHRCLGMLLQKVNDRAYVRGKIDWMYKQANIAIPINRLGLAKS  680

Query  2216  MGLVAASHLDTVLDKLKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAK  2395
             MGLVAASHLDTVLDKLK ILDNVGQSI QR  +FFS+  + EESDD HAALALMYGYAA+
Sbjct  681   MGLVAASHLDTVLDKLKDILDNVGQSIFQRFLAFFSESYRTEESDDVHAALALMYGYAAR  740

Query  2396  YAPPTVIEARIDALVGTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKR  2575
             YAP  VIEARIDALVGTNMLSRLLHVRHP+AKQAVITAIDLLG+AV  A+E+G  FPLKR
Sbjct  741   YAPSVVIEARIDALVGTNMLSRLLHVRHPKAKQAVITAIDLLGRAVAKAAETGAPFPLKR  800

Query  2576  RDLLLDYILTLMGRDEEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKAT  2755
             RD+LLDYILTLMGR+E +GF+DS++ELL TQ+LAL+ACTTLVSVEPKLT ETRN +MKAT
Sbjct  801   RDMLLDYILTLMGREETDGFADSSLELLRTQALALNACTTLVSVEPKLTIETRNHVMKAT  860

Query  2756  IGFFGLPNDPSDVINPLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEY  2935
             +GFF LPNDP DV+NPLIDNLITLLC IL+TSGEDGRSRAEQLLHILR ID +VSSS++Y
Sbjct  861   LGFFALPNDPIDVVNPLIDNLITLLCAILLTSGEDGRSRAEQLLHILRKIDQYVSSSVDY  920

Query  2936  QRKRGCLAAHELLIKFRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRD  3115
             QR+RGCLA +E+L KFR +C+ GYC LGC G C+H KQID   + N SNLPSAF LPSR+
Sbjct  921   QRRRGCLAVYEMLDKFRVLCICGYCPLGCHGGCTHGKQIDR-THGNFSNLPSAFVLPSRE  979

Query  3116  ALSLGERIMVYLPRCIDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALS  3295
             ALSLG+R++ YLPRC D + E+RK+S QIL+  FNIS SLPKP+ SS+  DIEL Y+ALS
Sbjct  980   ALSLGDRVITYLPRCADADSEIRKISAQILDQLFNISLSLPKPLGSSVYGDIELCYVALS  1039

Query  3296  SLEDVVAILRSDASIDPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAI  3475
             SLEDV+AILRSDASIDPSEVFNR+V+SVCTL+ K+ELV  LH C  AICD+IKQSAEGAI
Sbjct  1040  SLEDVIAILRSDASIDPSEVFNRIVASVCTLMTKEELVGTLHCCMPAICDRIKQSAEGAI  1099

Query  3476  QAVVEFVTNRGNELNEIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFT  3655
              AV+EFV  RG+EL+E +VSRT+QSLL+A  HVTEK LR E LGAI S++ENT +K+VF 
Sbjct  1100  LAVIEFVAKRGSELSESDVSRTAQSLLSAAGHVTEKQLRLEVLGAISSLSENTNAKIVFN  1159

Query  3656  EVLAAAGRDMVTKDIHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDS  3835
             EVLAAAGRD+VTKDI RL GGWP+QDAFHAFSQH VLS  FLEH+ISV+NQ+   K  D 
Sbjct  1160  EVLAAAGRDIVTKDISRLHGGWPMQDAFHAFSQHTVLSVLFLEHLISVLNQTRVTKSSDP  1219

Query  3836  GKGESSRNSVDGSIEDDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtch  4015
             GKGE+S    +  +ED++ +A++ ALT+FFRGGGK G++ VE SY+SVLA L L LG+CH
Sbjct  1220  GKGENSSLVSETQLEDEILQASIFALTSFFRGGGKVGKRAVEHSYSSVLAALVLQLGSCH  1279

Query  4016  glaSYGDQEPLRALLNAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIK  4195
             GLA+ G  EPLRALL AF+AFCECVGDLEMGKILAR  E   NEKWINLIG+LA  IS+K
Sbjct  1280  GLATSGRHEPLRALLTAFKAFCECVGDLEMGKILARDSEH--NEKWINLIGDLADCISMK  1337

Query  4196  RPKEVPTICLFLSKSLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDS  4375
             RPKEV  IC   SKSL+     QREAAAAA+SEF++Y  GF  LL +MVE LCRHVSD+S
Sbjct  1338  RPKEVQNICKIFSKSLNLQENFQREAAAAAVSEFIQYGSGFSSLLEEMVEVLCRHVSDES  1397

Query  4376  PTVRRLCLRGLVQMPSIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDA  4555
             PTVR LCLRGLV++PS H+ QYTTQ+LGVILALLDD DESVQLTAVSCLL++LESS  DA
Sbjct  1398  PTVRCLCLRGLVKIPSAHIDQYTTQVLGVILALLDDLDESVQLTAVSCLLMILESSPNDA  1457

Query  4556  VEPVLLNLSIRLRNLQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLH  4735
             VEP+LL LS+RLRNLQ+ +N K+RA+AFAAFGALS+YG  +  D+F EQIHA  PR++LH
Sbjct  1458  VEPILLKLSVRLRNLQISMNVKMRADAFAAFGALSNYGIQAHKDAFLEQIHATLPRLILH  1517

Query  4736  LHDDDLGVRQACRNTLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYL  4915
             LHDD+L VR  CRNTLK  APL+EI+ +  L N+H  +S+HRSDYEDF+RD  +Q  Q+L
Sbjct  1518  LHDDELSVRLTCRNTLKRFAPLMEIEGLLVLFNSHIVNSNHRSDYEDFVRDFTKQFLQHL  1577

Query  4916  GPRVDTYLSAIIQAFDAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASN  5095
               RVDTY+ + IQAFDAPWP+IQANA+Y+ SS+LSLSD+++I  LYYSQVFG+LV K S 
Sbjct  1578  PSRVDTYMVSTIQAFDAPWPIIQANAIYVSSSILSLSDDRHILTLYYSQVFGMLVSKMSR  1637

Query  5096  STDAIVRATCSAALGLLLKSPNSSSWRDARLNK  5194
             STDAIVRAT S+A GLLLKS NS  W+ ARL +
Sbjct  1638  STDAIVRATSSSAFGLLLKSTNSVPWKAARLER  1670


 Score =   296 bits (758),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 166/185 (90%), Gaps = 0/185 (0%)
 Frame = +1

Query  94   IPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGNIAG  273
            IPA EAVQV+VSSLAD+SP VREASM++LKDI+ LNPLLVLDCC  +SRGGRRRFGN+AG
Sbjct  11   IPAPEAVQVLVSSLADESPIVREASMASLKDISPLNPLLVLDCCSAISRGGRRRFGNMAG  70

Query  274  LFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLPD  453
            +FQV++  +RALDK D+D +++ KLAKI TAE+IS+KELN+DWQRAAA +LVS+GSHLPD
Sbjct  71   VFQVMAFGVRALDKNDIDASYIAKLAKIVTAEIISSKELNSDWQRAAASLLVSIGSHLPD  130

Query  454  LMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIYRPI  633
            LMMEEIFLH SG +S LPAMVQILAD+AS+DALQFTPRLKGVL+RV+PI+GN R+ +RPI
Sbjct  131  LMMEEIFLHLSGPSSGLPAMVQILADFASADALQFTPRLKGVLSRVLPIIGNGRDAHRPI  190

Query  634  FANGL  648
            FAN  
Sbjct  191  FANAF  195



>ref|XP_008387520.1| PREDICTED: protein SHOOT GRAVITROPISM 6 [Malus domestica]
Length=1553

 Score =  1957 bits (5069),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1014/1360 (75%), Positives = 1168/1360 (86%), Gaps = 8/1360 (1%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             A WQ S+D    + LD D++SFLNS FE LL+VWA SRDLKVR+S+V+ALGQMVGLITR 
Sbjct  200   AVWQXSLDIPSHSPLDXDIMSFLNSVFEXLLKVWAASRDLKVRMSSVDALGQMVGLITRA  259

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstl  1003
             QLKAALPRLVPTILELYKR+QD  F+ATCSLH LLNAS+LS + PPLLDFE+LT++LSTL
Sbjct  260   QLKAALPRLVPTILELYKRDQDITFLATCSLHXLLNASILSESXPPLLDFEELTIILSTL  319

Query  1004  l-lvCSNNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGS  1180
             L +VC NND KEHSDF VGLKTYNEVQ CFLT+G VYPEDLFVFL+NKCRLKEEP TFG+
Sbjct  320   LPVVCINNDNKEHSDFSVGLKTYNEVQRCFLTIGLVYPEDLFVFLINKCRLKEEPLTFGA  379

Query  1181  LCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGE  1360
             LCVLKHLLPRL+E+WH+KRP L+E+V+ LIDE NLGV+KAL+ELIVVMASHCYL+G SGE
Sbjct  380   LCVLKHLLPRLSEAWHSKRPFLVEAVQFLIDEQNLGVQKALSELIVVMASHCYLIGPSGE  439

Query  1361  LFIEYLVRHCAMPDLENVELESSRESSRFTGN-YYPFVYRKLEFKAGAVTTTELRGVCEK  1537
             LF+EYLVRHCA+ D +  + E S+++S   GN Y PF Y++ E K G +  TELR +CEK
Sbjct  440   LFVEYLVRHCALTDKDRSDFERSKDAS---GNPYIPFQYKRSEVKIGTICPTELRAICEK  496

Query  1538  GLLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKA  1717
             GLLL+T+T+PEMEH+LWPFLLKMIIP+ YTGAVA VCRCISELCR R+S S  MLSECKA
Sbjct  497   GLLLLTITIPEMEHILWPFLLKMIIPQAYTGAVAMVCRCISELCRNRASNSXIMLSECKA  556

Query  1718  RTDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMK  1897
             R D+P PEELF RLVVLLH+PLARE   +QIL+VL +LAPLFPKNI  FWQDE  IPK+K
Sbjct  557   RADLPNPEELFVRLVVLLHDPLAREQRASQILTVLCHLAPLFPKNITLFWQDE--IPKLK  614

Query  1898  AYVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEH  2077
             AYVSDTEDLKQDP YQE+WDDMII+F AESLDVIQ+ DW+  LGN   +QYELY SD+EH
Sbjct  615   AYVSDTEDLKQDPSYQETWDDMIINFFAESLDVIQDADWMRSLGNAITQQYELYTSDDEH  674

Query  2078  SALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLD  2257
             SALLHRC G+ LQKV+DRAYVR KID MY+QANI  PTNRLGLAKAMGLVAASHLDTVL+
Sbjct  675   SALLHRCFGVFLQKVNDRAYVRHKIDWMYKQANITNPTNRLGLAKAMGLVAASHLDTVLE  734

Query  2258  KLKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDAL  2437
             KLKGILDNVG+SI +R  SFFSD  K EESDD HAALALMYGYAAKYAP TVIEARIDAL
Sbjct  735   KLKGILDNVGESIFRRFLSFFSDDFKTEESDDVHAALALMYGYAAKYAPSTVIEARIDAL  794

Query  2438  VGTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGR  2617
             VGTNMLSRLLHVRHP AKQAVITAIDLLG+AVI A+E+G SFPLKRRD +LDYILTLMGR
Sbjct  795   VGTNMLSRLLHVRHPTAKQAVITAIDLLGRAVINAAENGSSFPLKRRDQMLDYILTLMGR  854

Query  2618  DEEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVI  2797
             D+ E FSDS +E LHTQ+ ALSACTTLVSVEPKLT ETRN ++KAT+GFF LPNDP DVI
Sbjct  855   DDSESFSDSTLEFLHTQARALSACTTLVSVEPKLTIETRNHVLKATLGFFALPNDPVDVI  914

Query  2798  NPLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLI  2977
             NPLI+NLITLLC IL+TSGEDGRSRAEQL HILR ID +VSS ++ QR+RGCLA HE+L+
Sbjct  915   NPLINNLITLLCAILLTSGEDGRSRAEQLSHILRQIDQYVSSPVDCQRRRGCLAVHEILL  974

Query  2978  KFRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPR  3157
             KFR +C    CALGCQGSC+HSKQID   NRN SNLPSAF LPSR+ALSLG+R+++YLPR
Sbjct  975   KFRTVCTTANCALGCQGSCTHSKQIDRNLNRNFSNLPSAFVLPSREALSLGDRVIMYLPR  1034

Query  3158  CIDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILRSDAS  3337
               DTN E RK S QIL+  F+I+ SLP+P  +S G+DIE+SY ALSSLEDV+AILRSDAS
Sbjct  1035  XADTNSEXRKASAQILDQLFSIALSLPRPSTTSYGMDIEISYRALSSLEDVIAILRSDAS  1094

Query  3338  IDPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNEL  3517
             IDPSEVFNR++SSVC LL K ELVA LHGC+ A+CDKIKQSAEGAIQAV+EFVT RG EL
Sbjct  1095  IDPSEVFNRIISSVCVLLTKSELVATLHGCTAAVCDKIKQSAEGAIQAVIEFVTRRGTEL  1154

Query  3518  NEIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMVTKD  3697
             +E +VSRT+Q+LL A  HVTEK+LRQETL AI S+AE+T+SKVVF EVLA +GRD+VTKD
Sbjct  1155  SETDVSRTTQALLMATAHVTEKHLRQETLAAISSLAESTSSKVVFNEVLATSGRDIVTKD  1214

Query  3698  IHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSVDGSI  3877
             + RLRGGWP+QDAF+AFSQH VLS  FLEHVISV++Q P LK GDS KGE+  + VDG +
Sbjct  1215  VSRLRGGWPMQDAFYAFSQHTVLSSLFLEHVISVLDQFPILK-GDSEKGENPSHLVDGQL  1273

Query  3878  EDDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPLRAL  4057
             EDD+ +AA++A+TAFFRGGGK G+K V+Q+YASVLA LTL LG+CHGLAS G  +PLRAL
Sbjct  1274  EDDILQAAIIAVTAFFRGGGKIGKKAVQQNYASVLAELTLQLGSCHGLASRGQHDPLRAL  1333

Query  4058  LNAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICLFLSK  4237
             L AFQAFCECVGDLEMGKILAR GE NENE+WINLIGE+AG +SIKRPKEV +IC+ LSK
Sbjct  1334  LTAFQAFCECVGDLEMGKILARDGEHNENERWINLIGEIAGCVSIKRPKEVQSICVILSK  1393

Query  4238  SLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQM  4417
             SL+R  R QREAAAAALSEF+RYSDGFG LL Q+VE LCRHVSD+SPTVRRLCLRGLVQ+
Sbjct  1394  SLNRHQRYQREAAAAALSEFVRYSDGFGSLLEQIVEVLCRHVSDESPTVRRLCLRGLVQI  1453

Query  4418  PSIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSIRLRN  4597
             PS+ +LQYT Q+LGVILALLDDSDESVQLTAVSCLL +LESS  DAV+P+LL+LS+RLRN
Sbjct  1454  PSMQMLQYTAQVLGVILALLDDSDESVQLTAVSCLLTMLESSPKDAVDPILLSLSLRLRN  1513

Query  4598  LQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAF  4717
             L +C N K+RANAFAAFGALS+YG G   ++F EQ++  F
Sbjct  1514  LLICTNTKMRANAFAAFGALSNYGIGPQHEAFLEQVYYLF  1553


 Score =   302 bits (773),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 142/185 (77%), Positives = 165/185 (89%), Gaps = 0/185 (0%)
 Frame = +1

Query  94   IPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGNIAG  273
            IPA EAVQV+VS LAD+SP VREAS+++LKD+ +LNPLLVLDCC  +SRGGRRRFGN+AG
Sbjct  10   IPAPEAVQVLVSLLADESPIVREASIASLKDVATLNPLLVLDCCSAISRGGRRRFGNMAG  69

Query  274  LFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLPD  453
            +FQV++  +RALDK DVDP FM KLAKIATAE+IS+KELNADWQRAA+ VLVS+G HLPD
Sbjct  70   VFQVMAYGVRALDKDDVDPPFMAKLAKIATAEIISSKELNADWQRAASAVLVSIGRHLPD  129

Query  454  LMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIYRPI  633
            LMMEEIFLH  G NSALPAMVQILAD+A +DALQFTPRLKGVL+RV PILGNVR+ +RPI
Sbjct  130  LMMEEIFLHLPGPNSALPAMVQILADFAHADALQFTPRLKGVLSRVXPILGNVRDAHRPI  189

Query  634  FANGL  648
            FAN +
Sbjct  190  FANAI  194



>ref|XP_009397255.1| PREDICTED: protein SHOOT GRAVITROPISM 6 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=1726

 Score =  1912 bits (4953),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 995/1512 (66%), Positives = 1221/1512 (81%), Gaps = 10/1512 (1%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             A WQY  DF    +LD+DV+SF+NS FELLLRVWA SRDLKVRLSAV+ALGQMVGLITR+
Sbjct  198   AAWQYIGDFPSDPLLDSDVMSFMNSVFELLLRVWAGSRDLKVRLSAVDALGQMVGLITRS  257

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstl  1003
             QLKA LPRL+PTIL+LYK++Q+ AF+AT SLH+LL A LLS +GPPLLDFE+LTV+L TL
Sbjct  258   QLKAGLPRLIPTILDLYKKDQEIAFLATQSLHNLLTACLLSESGPPLLDFEELTVILCTL  317

Query  1004  llvCSNNDKKEHS-DFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGS  1180
             L V   N + +H  +F +GLKTYNE+QHCFL +GSVYPEDL VFLLNKC+ K+E  T G+
Sbjct  318   LPVACINSQTDHRLNFSMGLKTYNEIQHCFLVIGSVYPEDLCVFLLNKCQSKDELSTIGA  377

Query  1181  LCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGE  1360
             L  +KHLLPRL E+WH KR  L+E VKLL+DE +LGVRKALAELIVVMASHCYL G   E
Sbjct  378   LYAVKHLLPRLLEAWHGKRVSLVEVVKLLVDEQSLGVRKALAELIVVMASHCYLSGPPAE  437

Query  1361  LFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKL-----EFKAGAVTTTELRG  1525
             LF+EYLVRHCA+ D E    +S +E+S     +  F  R L     +   GAV+ +ELR 
Sbjct  438   LFVEYLVRHCAISDQEIKIFKSLKEASSRGSPFQSFQNRNLKASVFQVMVGAVSPSELRV  497

Query  1526  VCEKGLLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLS  1705
             +CEKGLLL+ +T+PEMEH+LWPF+LKM++P+ YTGAVATVC+CI+ELCR RS  ++ +  
Sbjct  498   ICEKGLLLLAITIPEMEHILWPFILKMLLPKEYTGAVATVCKCITELCRHRSFHTSMISC  557

Query  1706  ECKARTDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*I  1885
             E     DIP PE+LFARL+VL+H+P+ARE L TQIL+VL +L PLFPKN++ FWQDE  +
Sbjct  558   EFNNSNDIPSPEDLFARLIVLMHDPVAREQLATQILTVLCFLGPLFPKNLSFFWQDE--V  615

Query  1886  PKMKAYVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKS  2065
             PKMKAY+SD +DL+QD  YQE+WDDMI++FL+ESLDV+Q+ +W+L LGN FARQY LY  
Sbjct  616   PKMKAYISDLDDLRQDSSYQETWDDMIVNFLSESLDVVQDNEWILSLGNAFARQYALYDD  675

Query  2066  DNEHSALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLD  2245
             D+EH ALLHRCLG+LLQKV DR YV  KI+ MY  ANI+VPTNRLGLAK MGL+AASHLD
Sbjct  676   DDEHLALLHRCLGMLLQKVDDRVYVNGKIEWMYAHANISVPTNRLGLAKGMGLIAASHLD  735

Query  2246  TVLDKLKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEAR  2425
             TVL+KLK ILDNVG S  QR FSF S R  +E++DDT+AALALMYGYAA+YAP TVIEAR
Sbjct  736   TVLEKLKCILDNVGYSRFQRFFSFLSGR-VLEDADDTYAALALMYGYAARYAPSTVIEAR  794

Query  2426  IDALVGTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILT  2605
             I+ALVGTNMLSRLLHV+HP AKQA+ITAIDLLG+AVI A+E GISFPLKRRD +LDY+LT
Sbjct  795   INALVGTNMLSRLLHVQHPTAKQAIITAIDLLGRAVINAAEMGISFPLKRRDQMLDYVLT  854

Query  2606  LMGRDEEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDP  2785
             LMGRD+ E   DS+ ELLHTQ+LALSAC TLV VEP+L  E RN +MKAT+GFF LP+DP
Sbjct  855   LMGRDDREELIDSSTELLHTQTLALSACKTLVLVEPRLPVEARNHVMKATLGFFALPSDP  914

Query  2786  SDVINPLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAH  2965
             SD+I+PL+DNLI+LLC IL+TSGEDGRSRAEQLLHILR +D +VSSS+E+QR+RGC+A +
Sbjct  915   SDIIDPLVDNLISLLCAILLTSGEDGRSRAEQLLHILRQVDLYVSSSVEHQRRRGCVAVY  974

Query  2966  ELLIKFRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMV  3145
             ELL+KFRA+   G C LGC  SC HSKQID  A RN SNLPSAF LPSRD+LSLGER++ 
Sbjct  975   ELLLKFRALFSGGVCGLGCHSSCMHSKQIDRVAQRNFSNLPSAFVLPSRDSLSLGERVIA  1034

Query  3146  YLPRCIDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILR  3325
             YLPRC DT+ EVRK++ QI+  FF+++ SLPK   S   IDIE+SY ALSSLEDV++ILR
Sbjct  1035  YLPRCADTSSEVRKLAAQIIGQFFSVALSLPKLAASVSYIDIEVSYSALSSLEDVISILR  1094

Query  3326  SDASIDPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNR  3505
              DASID SE FNRV+SSVC LL +DEL+ +LH C+ AICDKIKQSA+GAIQAV+EF++ R
Sbjct  1095  RDASIDQSETFNRVISSVCVLLTRDELIISLHTCTSAICDKIKQSADGAIQAVIEFISKR  1154

Query  3506  GNELNEIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDM  3685
             GNEL E ++SRT+QSLL+A + +T+K+ RQE L AI  +AENT S +VF E+LAAAGRD+
Sbjct  1155  GNELLEADISRTTQSLLSATIAITDKHTRQEVLNAISCLAENTNSSIVFNEILAAAGRDI  1214

Query  3686  VTKDIHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSV  3865
             VTKD+ R+RGGWP+QDAF AFSQH VLS SFLE+V+SV++++P L   D  KGE   +SV
Sbjct  1215  VTKDVTRIRGGWPMQDAFFAFSQHPVLSFSFLEYVVSVLDRTP-LPKTDVDKGEIVAHSV  1273

Query  3866  DGSIEDDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEP  4045
             +   ++ + +AA+LA+TAFFRGGGK G+K VEQSY++VL+ LTL LG+CHGLAS G  EP
Sbjct  1274  EFQNDNQIQQAAILAITAFFRGGGKIGKKAVEQSYSTVLSALTLQLGSCHGLASLGQLEP  1333

Query  4046  LRALLNAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICL  4225
             LR LL AFQ+FC+CVGD+EMGKILAR GE  + EK I+LI E+A   S+KRPKEV  I +
Sbjct  1334  LRLLLLAFQSFCDCVGDIEMGKILARDGEHKDQEKLIDLIQEIASCTSMKRPKEVSPISM  1393

Query  4226  FLSKSLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRG  4405
              LSK+L+R  R QREAAA+ALSEF+R+SDG   LL  +VEA+C HVSD+SPTVR LCLRG
Sbjct  1394  ILSKALNRHQRFQREAAASALSEFIRHSDGLPSLLEHIVEAMCLHVSDESPTVRSLCLRG  1453

Query  4406  LVQMPSIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSI  4585
             LVQ+P  H+  Y  Q+LGVI+ALL+D DESVQLTAV CLL VL SSS +AV+P+L+NLS+
Sbjct  1454  LVQIPKSHMPNYIAQVLGVIVALLEDPDESVQLTAVQCLLSVLSSSSEEAVDPILINLSV  1513

Query  4586  RLRNLQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQ  4765
             RLRNLQ+ +N K+R+NAFAA+GALS++G GS   +F EQ+HA  PR++LHLHDDDL VRQ
Sbjct  1514  RLRNLQISMNEKMRSNAFAAYGALSNFGMGSQHQAFLEQVHATIPRLILHLHDDDLNVRQ  1573

Query  4766  ACRNTLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSA  4945
             ACRNTL+ +APLIE D   AL N   FSS+ RSDYEDF+RDL+R + Q L  RVD+YL+ 
Sbjct  1574  ACRNTLRQLAPLIEADGFSALFNKQVFSSERRSDYEDFIRDLSRHVYQLLASRVDSYLAP  1633

Query  4946  IIQAFDAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATC  5125
             +IQAFD+PWPVIQANA+Y  S +LSLS+++   A Y  QVF  LV + + S DA+VRA+C
Sbjct  1634  LIQAFDSPWPVIQANAIYFSSCLLSLSEDQRSLAPYCLQVFAALVTRMNRSPDAVVRASC  1693

Query  5126  SAALGLLLKSPN  5161
             S ALGLLLK+ N
Sbjct  1694  SFALGLLLKAFN  1705


 Score =   271 bits (692),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 126/186 (68%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = +1

Query  91   SIPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGNIA  270
            S+PA EAVQV+VSSL D+S  VRE+S++AL++I  LNPLLV+DCC+++S+GGRRRFGN+A
Sbjct  7    SLPALEAVQVLVSSLVDESLVVRESSLAALREIAPLNPLLVIDCCVSISKGGRRRFGNMA  66

Query  271  GLFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLP  450
            G+F V++ A+RA+D  DVD  +M KLAKIAT+E+I++KELNADWQRAAAG+LVS+GSH P
Sbjct  67   GVFLVMAGAVRAMDPKDVDSTYMAKLAKIATSEIITSKELNADWQRAAAGLLVSIGSHAP  126

Query  451  DLMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIYRP  630
            DLMMEE+FLH SG NSAL +MVQILAD+AS++AL+FTP LK VL RV+PILG+VR+  RP
Sbjct  127  DLMMEEVFLHLSGPNSALQSMVQILADFASAEALKFTPHLKDVLLRVLPILGSVRDTQRP  186

Query  631  IFANGL  648
            +FAN  
Sbjct  187  VFANAF  192



>ref|XP_006843104.1| hypothetical protein AMTR_s00140p00065970 [Amborella trichopoda]
 gb|ERN04779.1| hypothetical protein AMTR_s00140p00065970 [Amborella trichopoda]
Length=1691

 Score =  1892 bits (4902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 983/1512 (65%), Positives = 1200/1512 (79%), Gaps = 24/1512 (2%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             A WQ+  DF     LD DV+SFL+S FELLLRVWA SRD+KVRL+ VEALGQMVGL++RT
Sbjct  200   AVWQFCGDFPSDPYLDNDVLSFLHSVFELLLRVWASSRDMKVRLATVEALGQMVGLVSRT  259

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstl  1003
             QLKAALPRL+PTILELY+++  +AF+ATC+L +LL+ASLLS +GPPLL+FE+LT+VLSTL
Sbjct  260   QLKAALPRLIPTILELYRKDHQSAFIATCALDNLLDASLLSESGPPLLEFEELTIVLSTL  319

Query  1004  l-lvCSNNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGS  1180
             L + C  ND+ E S   V  KTYN +QHCFLTVGSVYPE+LF++LLNKC+ +EE  TFG+
Sbjct  320   LPVTCICNDESEKSLVAVKRKTYNAIQHCFLTVGSVYPEELFMYLLNKCKPREESCTFGA  379

Query  1181  LCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGE  1360
             LCVLKHLLPRL+E+WH K   L+E+VK L+++ ++GV+KALAELIVVMASHCYL G  GE
Sbjct  380   LCVLKHLLPRLSETWHGKIESLVETVKSLLEDQSVGVQKALAELIVVMASHCYLGGQYGE  439

Query  1361  LFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKG  1540
             LFIEYLVRHCA+ + +    +  +                   KAG V   ELR +CEKG
Sbjct  440   LFIEYLVRHCAITEADVAGCDPQK------------------VKAGGVCPFELRMICEKG  481

Query  1541  LLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKAR  1720
             LLL+ +T+PEME +LWP LLKMIIPR YTGAVA VCRCISEL R RSS   A L+E  A 
Sbjct  482   LLLLAITIPEMEPILWPCLLKMIIPRKYTGAVAIVCRCISELSRHRSS--YASLTESIAH  539

Query  1721  TDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKA  1900
             TDIP PEELFARLVVLLH+PLAR  L TQIL+VL  LAPLFPKN+N FWQDE  IPKMKA
Sbjct  540   TDIPIPEELFARLVVLLHDPLARGQLSTQILTVLCCLAPLFPKNVNLFWQDE--IPKMKA  597

Query  1901  YVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHS  2080
             Y+SDTEDLKQD  YQE+WDDMII+F AESLDVIQ++DW + LGN F++QY LY  D+EHS
Sbjct  598   YISDTEDLKQDSSYQETWDDMIINFFAESLDVIQDIDWAMSLGNVFSKQYLLYIGDDEHS  657

Query  2081  ALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDK  2260
             ALLHRCLG+LLQKV  R+YVR KIDLMY+ ANIA  TNR+GLAK MGLV+ASHLDTVL+K
Sbjct  658   ALLHRCLGMLLQKVDGRSYVREKIDLMYKHANIANGTNRIGLAKGMGLVSASHLDTVLEK  717

Query  2261  LKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALV  2440
             LK ILD VG +  QR  SFFS+R K +++DD +AALALMYGYAA+YAP T+IEARIDALV
Sbjct  718   LKSILDGVGHNRFQRFLSFFSNRAKTQDADDVYAALALMYGYAARYAPSTIIEARIDALV  777

Query  2441  GTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRD  2620
             GTNMLSRLLHVR P AKQAVITAIDLLG+AVI A+E GISFPLKRRD +LDYILTLMGRD
Sbjct  778   GTNMLSRLLHVRQPAAKQAVITAIDLLGRAVIHAAEGGISFPLKRRDQMLDYILTLMGRD  837

Query  2621  EEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVIN  2800
             E +G  D ++ELLHTQ+LALSACTTLVSVEPKLT ETRNLI+KAT+ FF LPNDP DV++
Sbjct  838   EYDGAVDLSLELLHTQTLALSACTTLVSVEPKLTIETRNLILKATLCFFALPNDPPDVVD  897

Query  2801  PLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIK  2980
             PLI NLITLLC IL+TSG+DGRSR EQLLHI+R++D +VSS++++QR RGCLA +ELL+K
Sbjct  898   PLIKNLITLLCAILLTSGDDGRSRGEQLLHIMRSVDQYVSSAVDHQRARGCLAVYELLVK  957

Query  2981  FRAICVNGYCALGCQGSCSHSKQI-DHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPR  3157
             FR +C +GYC LGC GSC H  QI +  A+RN S+L S F LP+RD+L LGER +VYLPR
Sbjct  958   FRTLCSSGYCVLGCSGSCMHLHQITERIASRNSSSLTSTFLLPTRDSLYLGERTIVYLPR  1017

Query  3158  CIDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILRSDAS  3337
             C DT+ EVRK+S QIL+LFF I+ SLP+P+ S L   IE SY ALS+L DV+AIL+SDAS
Sbjct  1018  CADTSSEVRKISAQILDLFFTIALSLPRPVGSPLSEHIEQSYSALSALGDVIAILKSDAS  1077

Query  3338  IDPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNEL  3517
             IDPSE+FNR+VSSVC LL K+EL   LHGC+ +ICDK+K SAEG++ A++EF+  RGNEL
Sbjct  1078  IDPSEIFNRIVSSVCVLLAKEELAVILHGCTISICDKVKLSAEGSVGAIMEFILKRGNEL  1137

Query  3518  NEIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMVTKD  3697
             NE +VSRT+QSL++A ++VT+K+LRQE L AIC +AE T  KVVF EVL AA RD+VTKD
Sbjct  1138  NENDVSRTTQSLISATIYVTDKHLRQEVLAAICCLAEQTNPKVVFFEVLIAAERDIVTKD  1197

Query  3698  IHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSVDGSI  3877
             I  LRGGWP+QDAF+ FSQH VLS  FLE+++S +N     +GGDS KG+S R+  +   
Sbjct  1198  ISWLRGGWPMQDAFYTFSQHSVLSELFLEYIVSELNNHTPDQGGDSEKGDSVRHLAEVCN  1257

Query  3878  EDDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPLRAL  4057
             +D++ +AA+LALTAFFRGGGK GR+TVEQSYA+VL  L L LG CHG A  G Q  LR L
Sbjct  1258  DDEIPQAAILALTAFFRGGGKTGRRTVEQSYAAVLCALILQLGNCHGWAETGQQHSLRTL  1317

Query  4058  LNAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICLFLSK  4237
             L AF +FCECVGDLEMGKILAR GEQ EN +WINLI +LA  +++KRPKEV  IC  LSK
Sbjct  1318  LPAFYSFCECVGDLEMGKILARDGEQIENGRWINLIEDLASCVAMKRPKEVHPICNILSK  1377

Query  4238  SLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQM  4417
             +L+R  + QREAAAAALS+F+RYSDG G LL  +VE LC HV+D+S T RRLCL GLVQ 
Sbjct  1378  ALNRSQKFQREAAAAALSQFVRYSDGSGSLLEHLVEVLCLHVADESATARRLCLVGLVQA  1437

Query  4418  PSIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSIRLRN  4597
               +HV QY  Q+LGVIL LL+D DE V L+    LL VL++   D V P L+NLSIRLRN
Sbjct  1438  SGLHVDQYAFQVLGVILVLLEDPDEGVALSTSQSLLKVLQTFPRDVVAPSLINLSIRLRN  1497

Query  4598  LQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACRN  4777
             L + +N K+RA++FAAFGALS YG G++ ++F EQ+H+  PRM+LHL DD+  VRQAC++
Sbjct  1498  LIISMNGKVRASSFAAFGALSKYGTGALHEAFLEQVHSTLPRMILHLQDDEASVRQACKS  1557

Query  4778  TLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSAIIQA  4957
              L+ I PL++++ I +L+NT+ F+SDHRSDYE+F+RD+AR + Q L  RVDTY+++ IQA
Sbjct  1558  ALQQILPLLDVEDISSLINTNCFNSDHRSDYENFVRDIARHICQNLAARVDTYMASAIQA  1617

Query  4958  FDAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATCSAAL  5137
             FDAPWPVIQANA+Y   SMLS    +   A Y +QVFG+L+GK S S+DAIVRA CS AL
Sbjct  1618  FDAPWPVIQANALYFVGSMLSHLGEQRSLAPYVTQVFGLLIGKMSRSSDAIVRANCSPAL  1677

Query  5138  GLLLKSPNSSSW  5173
              +LLK+ ++ +W
Sbjct  1678  SMLLKATHALTW  1689


 Score =   254 bits (649),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 154/186 (83%), Gaps = 0/186 (0%)
 Frame = +1

Query  91   SIPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGNIA  270
            S+   EA+QV+V+SL D+SP VREA+M ALK+I  LNPLLVLDCCL  +RGGRRRFGN+A
Sbjct  9    SLHQPEAIQVLVASLGDESPLVREAAMDALKEICPLNPLLVLDCCLGAARGGRRRFGNMA  68

Query  271  GLFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLP  450
            G+F+ ++ A+  +D+ D+D AF+ KLAK+AT E+IS+KE+N DWQ+AA+ +LVS+G+ LP
Sbjct  69   GVFRTMAFAVHVMDERDIDHAFLTKLAKVATTEMISSKEINTDWQKAASSLLVSIGARLP  128

Query  451  DLMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIYRP  630
            DLMM+EIF   SG +SALP MVQ LAD+AS+DA QFTPRLKGVL+RV+PILG+V++  RP
Sbjct  129  DLMMDEIFSSLSGHHSALPTMVQTLADFASADASQFTPRLKGVLSRVLPILGSVKDALRP  188

Query  631  IFANGL  648
            IFA+  
Sbjct  189  IFAHAF  194



>ref|XP_006604595.1| PREDICTED: maestro heat-like repeat-containing protein family 
member 1-like isoform X3 [Glycine max]
Length=1519

 Score =  1870 bits (4843),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 994/1330 (75%), Positives = 1129/1330 (85%), Gaps = 22/1330 (2%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             A WQYS+DF      D DV+SFLNSAFELLLRVWA SRDLKVR+++VEALGQMVGLITRT
Sbjct  197   AAWQYSIDFPSHFPQDGDVMSFLNSAFELLLRVWAASRDLKVRVASVEALGQMVGLITRT  256

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstl  1003
             QLK ALPRL+PTIL+LYK++QD AF+ATCSLH+LLNASLLS +GPP+LDFEDLT+VLSTL
Sbjct  257   QLKTALPRLIPTILDLYKKDQDIAFLATCSLHNLLNASLLSESGPPMLDFEDLTLVLSTL  316

Query  1004  llvCS-NNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGS  1180
             L V S NND K+ SDFPVGLK YNEVQHCFLTVG VYP+DLF+FL+NKCRL+EEP TFGS
Sbjct  317   LPVVSFNNDSKDQSDFPVGLKMYNEVQHCFLTVGLVYPDDLFLFLVNKCRLREEPLTFGS  376

Query  1181  LCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGE  1360
             LC+LKHLLPRL+E+WH+K P+L+E+VK L++E NLGVRKAL+ELIVVMASHCYLVGSSGE
Sbjct  377   LCILKHLLPRLSEAWHSKIPLLVEAVKSLLEEQNLGVRKALSELIVVMASHCYLVGSSGE  436

Query  1361  LFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKG  1540
             LFIEYLVRHCA+ D    +LES+               +++E K GAVT  ELR VCEKG
Sbjct  437   LFIEYLVRHCAITDQNRSDLESTPN-------------KRIEMKIGAVTPGELRAVCEKG  483

Query  1541  LLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKAR  1720
             LLL+T+T+PEMEH+LWPFLL+MIIP  YTGAVATVCRCISEL R RS  SN MLSECK R
Sbjct  484   LLLVTITIPEMEHILWPFLLRMIIPLTYTGAVATVCRCISELWRHRSY-SNDMLSECKTR  542

Query  1721  TDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKA  1900
              DIP  EEL ARL+VLLHNPLARE L TQIL+VL  LAPLFPKNIN FWQDE  IPKMKA
Sbjct  543   PDIPSAEELLARLLVLLHNPLAREQLATQILTVLCLLAPLFPKNINLFWQDE--IPKMKA  600

Query  1901  YVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHS  2080
             YVSDTEDLKQDP YQ++WDDMII+FLAESLDVIQ+ DWV+ LGN FA+ YELY SD++H+
Sbjct  601   YVSDTEDLKQDPSYQDTWDDMIINFLAESLDVIQDADWVMSLGNVFAKHYELYASDDQHT  660

Query  2081  ALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDK  2260
             ALLHRCLGILLQKV+DRAYV  KID MY+QANIA PTNRLGLAKAMGLVAASHLDTVL+K
Sbjct  661   ALLHRCLGILLQKVNDRAYVCDKIDWMYKQANIANPTNRLGLAKAMGLVAASHLDTVLEK  720

Query  2261  LKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALV  2440
             LK ILDNVGQSI QRI S FSD  + EESDD HAALALMYGYAAKYAP TVIEARI+ALV
Sbjct  721   LKDILDNVGQSIFQRILSLFSDSFRTEESDDIHAALALMYGYAAKYAPSTVIEARINALV  780

Query  2441  GTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRD  2620
             GTNMLSRLLHVR P+AKQAVITAIDLLG AVI A+ESG  FPLKRRD LLDYILTLMGRD
Sbjct  781   GTNMLSRLLHVRLPKAKQAVITAIDLLGNAVINAAESGSPFPLKRRDQLLDYILTLMGRD  840

Query  2621  EEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVIN  2800
             +E+GF+D N +LL TQ+LA+SACTTLVSVEPKLT ETR+ +MKAT+GFF +PNDP DV+N
Sbjct  841   DEDGFADYN-DLLRTQALAISACTTLVSVEPKLTVETRSHVMKATLGFFAIPNDPVDVVN  899

Query  2801  PLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIK  2980
             PLIDNLITLLC IL+T GEDGRSRAE L+ ILR ID FV S +EYQRKRGCLA HE+L+K
Sbjct  900   PLIDNLITLLCAILLTGGEDGRSRAELLMLILRQIDQFVCSPVEYQRKRGCLAVHEMLLK  959

Query  2981  FRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPRC  3160
             FR ICV+GYCALGC+GSC+H+KQ+D     N S LPSAF LPSR+AL LG+R+++YLPRC
Sbjct  960   FRMICVSGYCALGCRGSCAHNKQMDRTLYGNFSKLPSAFVLPSREALCLGDRVIMYLPRC  1019

Query  3161  IDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGI-DIELSYIALSSLEDVVAILRSDAS  3337
              DTN EVRK+S QIL+L F+IS SLP+P  SS+   DIELSY ALSSLEDV+AILR+D S
Sbjct  1020  ADTNSEVRKISAQILDLLFSISLSLPRPAGSSISAEDIELSYSALSSLEDVIAILRNDTS  1079

Query  3338  IDPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNEL  3517
             IDPSEVFNR+VSS+C LL K+ELVA LHGCS AICDKIKQSAEGAIQAVVEFVT RG EL
Sbjct  1080  IDPSEVFNRIVSSLCILLTKEELVATLHGCSVAICDKIKQSAEGAIQAVVEFVTKRGREL  1139

Query  3518  NEIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMVTKD  3697
              EI++SRT+QSL++A VH T+K+LR ETLGAI S+AENT+ + VF EVLAAAGRD +TKD
Sbjct  1140  TEIDISRTTQSLISATVHATDKHLRVETLGAISSLAENTSPRTVFDEVLAAAGRDTITKD  1199

Query  3698  IHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSVDGSI  3877
             I RLRGGWP+QDAF+AFSQH+VLS  FLEHVISV++Q P LK GD  + E S+  VD   
Sbjct  1200  ISRLRGGWPMQDAFYAFSQHMVLSVLFLEHVISVLSQIPILK-GDVERLEDSQ--VDSHT  1256

Query  3878  EDDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPLRAL  4057
             ED   +AA+ ALTAFFRGGGK G++ VEQ+YASVL+ LTL LG+CHGL   G  EPLR L
Sbjct  1257  EDGKLQAAIFALTAFFRGGGKVGKRAVEQNYASVLSELTLQLGSCHGLTYSGQHEPLRNL  1316

Query  4058  LNAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICLFLSK  4237
             L AFQAFCECVGDLEMGKILAR GE  ENE+WI+LIG++AG ISIKRPKEV  ICLF   
Sbjct  1317  LTAFQAFCECVGDLEMGKILARDGELLENERWISLIGDIAGCISIKRPKEVQNICLFFQN  1376

Query  4238  SLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQM  4417
             SLDRP + QREAAAAALSEF+RYS G G LL QMVE LCRHVSD+S TVRRLCLRGLVQ+
Sbjct  1377  SLDRPQKYQREAAAAALSEFVRYSGGLGSLLEQMVEVLCRHVSDESSTVRRLCLRGLVQI  1436

Query  4418  PSIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSIRLRN  4597
             P IH+L+YT Q+LGVILALLDD DESVQLTAVSCLL++L SS  DAVEP+LLNLSIRLRN
Sbjct  1437  PLIHILKYTAQVLGVILALLDDLDESVQLTAVSCLLMILNSSPDDAVEPILLNLSIRLRN  1496

Query  4598  LQVCLNAKIR  4627
             LQVC   K++
Sbjct  1497  LQVCNKLKLK  1506


 Score =   294 bits (753),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 138/186 (74%), Positives = 166/186 (89%), Gaps = 0/186 (0%)
 Frame = +1

Query  91   SIPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGNIA  270
            SIPASEAVQV++S LADD+ SVREASMS+LKDI +LNPLLVLDCC  VSRGGRRRFGN+A
Sbjct  6    SIPASEAVQVLLSLLADDTSSVREASMSSLKDIAALNPLLVLDCCAVVSRGGRRRFGNMA  65

Query  271  GLFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLP  450
            G+FQV++  +RALDK DVD AFM KLAKIATAE+IS+KELN+DWQRAA  +LV++GSHLP
Sbjct  66   GVFQVMAFGVRALDKKDVDSAFMAKLAKIATAELISSKELNSDWQRAATSLLVAIGSHLP  125

Query  451  DLMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIYRP  630
            DLMMEEI+LH SG+NSAL +MVQILA++AS+D LQF P  KGVL+R++PILGNVR+++RP
Sbjct  126  DLMMEEIYLHLSGANSALQSMVQILAEFASTDPLQFIPHWKGVLSRILPILGNVRDMHRP  185

Query  631  IFANGL  648
            IFAN  
Sbjct  186  IFANAF  191



>gb|EYU38579.1| hypothetical protein MIMGU_mgv1a000131mg [Erythranthe guttata]
Length=1218

 Score =  1861 bits (4820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 934/1207 (77%), Positives = 1056/1207 (87%), Gaps = 3/1207 (0%)
 Frame = +2

Query  1571  MEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKARTDIPKPEELF  1750
             MEHVLWPFLLKMIIPR+YT AVATVCRCISELCR + ++S+ +LS+CKAR D+P PE+LF
Sbjct  1     MEHVLWPFLLKMIIPRIYTDAVATVCRCISELCRHKHTQSDTILSDCKARFDVPNPEDLF  60

Query  1751  ARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKAYVSDTEDLKQ  1930
             ARLVVLLHNPLARE LV QIL+VL +LA LFPKNI  FWQDE  IPKMKAYVSD EDLKQ
Sbjct  61    ARLVVLLHNPLAREQLVPQILTVLLHLASLFPKNIVVFWQDE--IPKMKAYVSDPEDLKQ  118

Query  1931  DPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHSALLHRCLGIL  2110
             DP YQE+WDDM+I+F+AESLDVIQ+VDWV+ LGN+FA+QYELY S++EHSALLHRCLGIL
Sbjct  119   DPSYQETWDDMVINFVAESLDVIQDVDWVISLGNSFAKQYELYSSEDEHSALLHRCLGIL  178

Query  2111  LQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDKLKGILDNVGQ  2290
             LQKVHDR YV AKIDLMY QANIA+P NRLGLAKAMGLVAASHLDTVLDKLK ILD VG 
Sbjct  179   LQKVHDRTYVHAKIDLMYMQANIALPVNRLGLAKAMGLVAASHLDTVLDKLKDILDTVGD  238

Query  2291  SILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALVGTNMLSRLLH  2470
             SI +RI SFFSD  KMEESDD HAALALMYGYAAKYAP TVIEARIDALVGTNMLSRLL+
Sbjct  239   SIFKRIMSFFSDSAKMEESDDVHAALALMYGYAAKYAPSTVIEARIDALVGTNMLSRLLN  298

Query  2471  VRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRDEEEGFSDSNI  2650
             VRHP AKQAVITAIDLLGQAVIGA+ESGISFPLKRRD+LLDYILTLMGRD+E+G SDSN+
Sbjct  299   VRHPTAKQAVITAIDLLGQAVIGAAESGISFPLKRRDMLLDYILTLMGRDDEDGLSDSNL  358

Query  2651  ELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVINPLIDNLITLL  2830
             ELLHTQSLALSACTTLVSVEPKLTTETRNL++KAT+GFFGLPNDP DV++ LI NLITLL
Sbjct  359   ELLHTQSLALSACTTLVSVEPKLTTETRNLVLKATLGFFGLPNDPPDVMDGLIHNLITLL  418

Query  2831  CTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIKFRAICVNGYC  3010
             C ILVTSGEDGRSR EQLLHILR IDP+VSSS+EYQR+RGCLAA+E+L KFR +CV GYC
Sbjct  419   CAILVTSGEDGRSRTEQLLHILRQIDPYVSSSVEYQRQRGCLAAYEMLHKFRTVCVGGYC  478

Query  3011  ALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPRCIDTNYEVRKV  3190
             +LGCQGSC+HS++ D A+N N SNLPSAF  PSRDAL +GERIMVYLPRC DTN EVRK 
Sbjct  479   SLGCQGSCTHSRRFDRASNYNFSNLPSAFVSPSRDALCIGERIMVYLPRCADTNSEVRKT  538

Query  3191  SVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILRSDASIDPSEVFNRVV  3370
             S QI++LFF++S SLP+  NSS G+DIEL Y ALS+LEDV+AILRSDAS+DPSEVFNRVV
Sbjct  539   SAQIVDLFFSVSLSLPRSSNSSFGLDIELCYTALSALEDVIAILRSDASLDPSEVFNRVV  598

Query  3371  SSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNELNEIEVSRTSQS  3550
             SSVC L  KDELVAALH CS AICDKI+QSAEGAIQ+V+EF+T RG ELNE ++SRT+QS
Sbjct  599   SSVCVLFTKDELVAALHVCSAAICDKIRQSAEGAIQSVIEFITKRGKELNEADISRTTQS  658

Query  3551  LLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMVTKDIHRLRGGWPIQ  3730
             LL+AV+HVTEKYLRQETL AI S+AENT+S++VF EVLAAA RD+ TKD+ RLRGGWPIQ
Sbjct  659   LLSAVIHVTEKYLRQETLHAISSLAENTSSRIVFGEVLAAAERDIATKDVSRLRGGWPIQ  718

Query  3731  DAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSVDGSIEDDVSRAAVLA  3910
             DAFHAFSQH VLS SFL+HV S++NQ+P  +GG  GKGE+     +   ED+V  AA+ A
Sbjct  719   DAFHAFSQHAVLSCSFLDHVTSILNQTPVFQGG-PGKGENPNIFGESLEEDNVLHAAITA  777

Query  3911  LTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPLRALLNAFQAFCECV  4090
             LTAFFRGGGK G++ VEQSY SV ATL LHLGTCH LA+ G  EPLRALL AF AFCECV
Sbjct  778   LTAFFRGGGKIGKRAVEQSYGSVFATLVLHLGTCHCLANSGQHEPLRALLVAFNAFCECV  837

Query  4091  GDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICLFLSKSLDRPLRVQRE  4270
             GDLEMGKI+AR  EQNE + WI LIG+LAG ISIKRPKE+PTIC  L KSLDR  +  RE
Sbjct  838   GDLEMGKIVARDSEQNEEDAWIGLIGDLAGCISIKRPKEIPTICSILCKSLDRSPKYMRE  897

Query  4271  AAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQMPSIHVLQYTTQ  4450
             AAAAALSEF+R+SD  G LL QMVE L RHVSDDSP VRRLCLRGLVQMPS+HV+QYTTQ
Sbjct  898   AAAAALSEFVRFSDSLGSLLEQMVEGLTRHVSDDSPNVRRLCLRGLVQMPSVHVVQYTTQ  957

Query  4451  ILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSIRLRNLQVCLNAKIRA  4630
             IL VI+ALLDD DESVQLTAVSCLL VL +SSTDAVEPVLLNLS+RLRNLQ+C+NAKIRA
Sbjct  958   ILSVIVALLDDPDESVQLTAVSCLLTVLATSSTDAVEPVLLNLSVRLRNLQICMNAKIRA  1017

Query  4631  NAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACRNTLKCIAPLIEI  4810
             NAFAAFGALS YG G   D+F EQ+HAAFPR+VLHLHDDDLGVR+ACRNT K I+PL+E 
Sbjct  1018  NAFAAFGALSKYGFGPQRDTFLEQVHAAFPRLVLHLHDDDLGVRRACRNTFKSISPLMEF  1077

Query  4811  DAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSAIIQAFDAPWPVIQAN  4990
             + I AL NTHR SSDHR+DYEDFLRD+ARQ TQ++  RVDTY+ +IIQAF+APWPVIQAN
Sbjct  1078  NGITALANTHRLSSDHRADYEDFLRDIARQFTQHMSSRVDTYMGSIIQAFEAPWPVIQAN  1137

Query  4991  AVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATCSAALGLLLKSPNSSS  5170
             A+YLCSS+++ S +++ISALY+SQVFG+L+GK S STDAIVRAT S ALGLLLKS NSSS
Sbjct  1138  AIYLCSSVIASSSDQHISALYHSQVFGMLMGKISRSTDAIVRATGSLALGLLLKSANSSS  1197

Query  5171  WRDARLN  5191
             W+ ARL+
Sbjct  1198  WKVARLD  1204



>ref|XP_009768809.1| PREDICTED: protein SHOOT GRAVITROPISM 6 [Nicotiana sylvestris]
Length=1412

 Score =  1856 bits (4807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 960/1190 (81%), Positives = 1062/1190 (89%), Gaps = 4/1190 (0%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             +CWQ SVDF LS++LD D++SFLNSAFELLLRVWA+SRDLKVRLS+VEALGQMVGLITRT
Sbjct  200   SCWQCSVDFPLSSVLDADIMSFLNSAFELLLRVWAISRDLKVRLSSVEALGQMVGLITRT  259

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstl  1003
             QLKAALPRLVPTILELYKR+ D AFVATCSLH++L+ASLLS +GPPLLDFEDLTV+LSTL
Sbjct  260   QLKAALPRLVPTILELYKRDNDVAFVATCSLHNVLSASLLSESGPPLLDFEDLTVILSTL  319

Query  1004  l-lvCSNNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGS  1180
             L +VC +NDKKEHSDF VGLKTYNEVQHCFLT+G VYPEDLFVFLLNKC+LKEEP   G+
Sbjct  320   LPVVCRSNDKKEHSDFSVGLKTYNEVQHCFLTIGLVYPEDLFVFLLNKCKLKEEPQAVGA  379

Query  1181  LCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGE  1360
             LCVLKHLLPRL+E+WHNKRP+LIE VKLL+DE NLGV KALAELIVVMASHCYLVG SGE
Sbjct  380   LCVLKHLLPRLSEAWHNKRPLLIEVVKLLLDELNLGVCKALAELIVVMASHCYLVGPSGE  439

Query  1361  LFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKG  1540
             LFIEYLVRH AM  L   + E SRE +     YYPFVY+K+E K    T +ELR +CE G
Sbjct  440   LFIEYLVRHSAMFGLHRDDTERSRELNSSNDGYYPFVYKKIETKMEVGTLSELRAICETG  499

Query  1541  LLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKAR  1720
             LLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVC+CISELCRRRSS+S A + ECKAR
Sbjct  500   LLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCKCISELCRRRSSQSGAGVLECKAR  559

Query  1721  TDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKA  1900
              DIP PEELFARL+VLLHNPLARE L TQIL+VL YLAPLFPKNIN FWQDE  IPKMKA
Sbjct  560   ADIPHPEELFARLLVLLHNPLAREQLATQILTVLCYLAPLFPKNINLFWQDE--IPKMKA  617

Query  1901  YVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHS  2080
             YVSDTEDLKQDP YQESWDDMII+F+AESLDVIQ+VDWV+ LGN F +QYELY  D+EHS
Sbjct  618   YVSDTEDLKQDPSYQESWDDMIINFIAESLDVIQDVDWVISLGNAFEKQYELYSPDDEHS  677

Query  2081  ALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDK  2260
             ALLHRCLGILLQKVHDRAYVRAKI LMY+QANI +PTNRLGLAKAMGLVAASHLDTVLDK
Sbjct  678   ALLHRCLGILLQKVHDRAYVRAKIYLMYKQANITIPTNRLGLAKAMGLVAASHLDTVLDK  737

Query  2261  LKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALV  2440
             LK ILDNVGQSI QRI SFFSDRGKMEESDD HAALALMYGYAAKYAP TVIEARIDALV
Sbjct  738   LKDILDNVGQSIFQRILSFFSDRGKMEESDDIHAALALMYGYAAKYAPSTVIEARIDALV  797

Query  2441  GTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRD  2620
             GTN+LSRLLHVRHP AKQAVITAIDLLGQAVI A+ESGISFPLKRRD LLDYILTLMG D
Sbjct  798   GTNVLSRLLHVRHPTAKQAVITAIDLLGQAVINAAESGISFPLKRRDQLLDYILTLMGSD  857

Query  2621  EEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVIN  2800
             E +GFS+SN E L TQS ALSACTTLVSVEPKLTTETRNL+MKAT+GFFGLPN+P+DVI+
Sbjct  858   EGDGFSESNTEHLRTQSFALSACTTLVSVEPKLTTETRNLVMKATVGFFGLPNEPADVID  917

Query  2801  PLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIK  2980
             PLI NLITLLCTIL+TSGEDGRSRAEQLLHILR +D +VSSSL+YQRKRGCLAAHELL K
Sbjct  918   PLIGNLITLLCTILITSGEDGRSRAEQLLHILRKVDLYVSSSLDYQRKRGCLAAHELLFK  977

Query  2981  FRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPRC  3160
             FR IC++GYCALGC+G+C+H ++ D A +  LSNLPSAF LPSRDAL LGER M+YLPR 
Sbjct  978   FRMICISGYCALGCRGTCTHREKTDRALHHTLSNLPSAFALPSRDALRLGERTMMYLPRS  1037

Query  3161  IDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILRSDASI  3340
             +DT+ EVRK+SVQIL+L+F+IS SLP+P NS    DIE SY ALSSLEDV+AILRSDASI
Sbjct  1038  VDTSSEVRKLSVQILHLYFSISLSLPRPANSGFSNDIESSYGALSSLEDVIAILRSDASI  1097

Query  3341  DPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNELN  3520
             DPSEVFNRVVSSVC LL KDEL AALHGCSGAICDKIKQSAEGAIQAV EFVT RGN LN
Sbjct  1098  DPSEVFNRVVSSVCILLTKDELAAALHGCSGAICDKIKQSAEGAIQAVNEFVTKRGNALN  1157

Query  3521  EIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMVTKDI  3700
             E +++RT+QSLL+AV+HVTEKYLRQE LGAICS+AENT+S++VF EVLAAA +D+ TKDI
Sbjct  1158  ETDIARTTQSLLSAVIHVTEKYLRQEALGAICSLAENTSSRIVFNEVLAAARKDIATKDI  1217

Query  3701  HRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSVDGSIE  3880
              RLRGGWPIQDAFH FSQH VLS +FL+HV+SVINQ P L+ GD G  ESS ++VD  ++
Sbjct  1218  SRLRGGWPIQDAFHVFSQHSVLSFTFLDHVMSVINQMPPLE-GDLGHDESSGHAVDSIVD  1276

Query  3881  DDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPLRALL  4060
             D+++RAA++ALTAFFRGGGK G+K VEQSYASVLATLTLHLG+CHGLAS G+ EPLRALL
Sbjct  1277  DNIARAAIVALTAFFRGGGKVGKKAVEQSYASVLATLTLHLGSCHGLASTGELEPLRALL  1336

Query  4061  NAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEV  4210
              AFQAFCECVGDLEMGKILAR GEQ+ENEKWINLI +L+G ISIKRPKEV
Sbjct  1337  AAFQAFCECVGDLEMGKILARDGEQSENEKWINLIRDLSGCISIKRPKEV  1386


 Score =   339 bits (870),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 164/188 (87%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = +1

Query  85   GDSIPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGN  264
            G+S+PA+EAVQV+VSSLADDSP VREASM+ LKDITSLNPLLVLDCCLTVSRGGRRRFGN
Sbjct  7    GNSVPAAEAVQVLVSSLADDSPIVREASMATLKDITSLNPLLVLDCCLTVSRGGRRRFGN  66

Query  265  IAGLFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSH  444
            IAGLFQV+SVAI+ALDKGDVDP ++ KLAKIAT+EVISTKELNADWQRAAAGVLVS+GSH
Sbjct  67   IAGLFQVMSVAIQALDKGDVDPNYLAKLAKIATSEVISTKELNADWQRAAAGVLVSIGSH  126

Query  445  LPDLMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIY  624
            +PDLMMEEIFLH SGSNSALPAMVQILA +ASSDALQFTP LKGVLARVVPILGNVR+I+
Sbjct  127  MPDLMMEEIFLHLSGSNSALPAMVQILAVFASSDALQFTPHLKGVLARVVPILGNVRDIH  186

Query  625  RPIFANGL  648
            RPIFAN  
Sbjct  187  RPIFANAF  194



>ref|XP_009397332.1| PREDICTED: protein SHOOT GRAVITROPISM 6 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=1477

 Score =  1837 bits (4757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 957/1460 (66%), Positives = 1178/1460 (81%), Gaps = 10/1460 (1%)
 Frame = +2

Query  800   MVGLITRTQLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFED  979
             MVGLITR+QLKA LPRL+PTIL+LYK++Q+ AF+AT SLH+LL A LLS +GPPLLDFE+
Sbjct  1     MVGLITRSQLKAGLPRLIPTILDLYKKDQEIAFLATQSLHNLLTACLLSESGPPLLDFEE  60

Query  980   ltvvlstlllvCSNNDKKEHS-DFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLK  1156
             LTV+L TLL V   N + +H  +F +GLKTYNE+QHCFL +GSVYPEDL VFLLNKC+ K
Sbjct  61    LTVILCTLLPVACINSQTDHRLNFSMGLKTYNEIQHCFLVIGSVYPEDLCVFLLNKCQSK  120

Query  1157  EEPFTFGSLCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHC  1336
             +E  T G+L  +KHLLPRL E+WH KR  L+E VKLL+DE +LGVRKALAELIVVMASHC
Sbjct  121   DELSTIGALYAVKHLLPRLLEAWHGKRVSLVEVVKLLVDEQSLGVRKALAELIVVMASHC  180

Query  1337  YLVGSSGELFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKL-----EFKAGA  1501
             YL G   ELF+EYLVRHCA+ D E    +S +E+S     +  F  R L     +   GA
Sbjct  181   YLSGPPAELFVEYLVRHCAISDQEIKIFKSLKEASSRGSPFQSFQNRNLKASVFQVMVGA  240

Query  1502  VTTTELRGVCEKGLLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRS  1681
             V+ +ELR +CEKGLLL+ +T+PEMEH+LWPF+LKM++P+ YTGAVATVC+CI+ELCR RS
Sbjct  241   VSPSELRVICEKGLLLLAITIPEMEHILWPFILKMLLPKEYTGAVATVCKCITELCRHRS  300

Query  1682  SESNAMLSECKARTDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINS  1861
               ++ +  E     DIP PE+LFARL+VL+H+P+ARE L TQIL+VL +L PLFPKN++ 
Sbjct  301   FHTSMISCEFNNSNDIPSPEDLFARLIVLMHDPVAREQLATQILTVLCFLGPLFPKNLSF  360

Query  1862  FWQDEL*IPKMKAYVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFA  2041
             FWQDE  +PKMKAY+SD +DL+QD  YQE+WDDMI++FL+ESLDV+Q+ +W+L LGN FA
Sbjct  361   FWQDE--VPKMKAYISDLDDLRQDSSYQETWDDMIVNFLSESLDVVQDNEWILSLGNAFA  418

Query  2042  RQYELYKSDNEHSALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMG  2221
             RQY LY  D+EH ALLHRCLG+LLQKV DR YV  KI+ MY  ANI+VPTNRLGLAK MG
Sbjct  419   RQYALYDDDDEHLALLHRCLGMLLQKVDDRVYVNGKIEWMYAHANISVPTNRLGLAKGMG  478

Query  2222  LVAASHLDTVLDKLKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYA  2401
             L+AASHLDTVL+KLK ILDNVG S  QR FSF S R  +E++DDT+AALALMYGYAA+YA
Sbjct  479   LIAASHLDTVLEKLKCILDNVGYSRFQRFFSFLSGR-VLEDADDTYAALALMYGYAARYA  537

Query  2402  PPTVIEARIDALVGTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRD  2581
             P TVIEARI+ALVGTNMLSRLLHV+HP AKQA+ITAIDLLG+AVI A+E GISFPLKRRD
Sbjct  538   PSTVIEARINALVGTNMLSRLLHVQHPTAKQAIITAIDLLGRAVINAAEMGISFPLKRRD  597

Query  2582  LLLDYILTLMGRDEEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIG  2761
              +LDY+LTLMGRD+ E   DS+ ELLHTQ+LALSAC TLV VEP+L  E RN +MKAT+G
Sbjct  598   QMLDYVLTLMGRDDREELIDSSTELLHTQTLALSACKTLVLVEPRLPVEARNHVMKATLG  657

Query  2762  FFGLPNDPSDVINPLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQR  2941
             FF LP+DPSD+I+PL+DNLI+LLC IL+TSGEDGRSRAEQLLHILR +D +VSSS+E+QR
Sbjct  658   FFALPSDPSDIIDPLVDNLISLLCAILLTSGEDGRSRAEQLLHILRQVDLYVSSSVEHQR  717

Query  2942  KRGCLAAHELLIKFRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDAL  3121
             +RGC+A +ELL+KFRA+   G C LGC  SC HSKQID  A RN SNLPSAF LPSRD+L
Sbjct  718   RRGCVAVYELLLKFRALFSGGVCGLGCHSSCMHSKQIDRVAQRNFSNLPSAFVLPSRDSL  777

Query  3122  SLGERIMVYLPRCIDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSL  3301
             SLGER++ YLPRC DT+ EVRK++ QI+  FF+++ SLPK   S   IDIE+SY ALSSL
Sbjct  778   SLGERVIAYLPRCADTSSEVRKLAAQIIGQFFSVALSLPKLAASVSYIDIEVSYSALSSL  837

Query  3302  EDVVAILRSDASIDPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQA  3481
             EDV++ILR DASID SE FNRV+SSVC LL +DEL+ +LH C+ AICDKIKQSA+GAIQA
Sbjct  838   EDVISILRRDASIDQSETFNRVISSVCVLLTRDELIISLHTCTSAICDKIKQSADGAIQA  897

Query  3482  VVEFVTNRGNELNEIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEV  3661
             V+EF++ RGNEL E ++SRT+QSLL+A + +T+K+ RQE L AI  +AENT S +VF E+
Sbjct  898   VIEFISKRGNELLEADISRTTQSLLSATIAITDKHTRQEVLNAISCLAENTNSSIVFNEI  957

Query  3662  LAAAGRDMVTKDIHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGK  3841
             LAAAGRD+VTKD+ R+RGGWP+QDAF AFSQH VLS SFLE+V+SV++++P L   D  K
Sbjct  958   LAAAGRDIVTKDVTRIRGGWPMQDAFFAFSQHPVLSFSFLEYVVSVLDRTP-LPKTDVDK  1016

Query  3842  GESSRNSVDGSIEDDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchgl  4021
             GE   +SV+   ++ + +AA+LA+TAFFRGGGK G+K VEQSY++VL+ LTL LG+CHGL
Sbjct  1017  GEIVAHSVEFQNDNQIQQAAILAITAFFRGGGKIGKKAVEQSYSTVLSALTLQLGSCHGL  1076

Query  4022  aSYGDQEPLRALLNAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRP  4201
             AS G  EPLR LL AFQ+FC+CVGD+EMGKILAR GE  + EK I+LI E+A   S+KRP
Sbjct  1077  ASLGQLEPLRLLLLAFQSFCDCVGDIEMGKILARDGEHKDQEKLIDLIQEIASCTSMKRP  1136

Query  4202  KEVPTICLFLSKSLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPT  4381
             KEV  I + LSK+L+R  R QREAAA+ALSEF+R+SDG   LL  +VEA+C HVSD+SPT
Sbjct  1137  KEVSPISMILSKALNRHQRFQREAAASALSEFIRHSDGLPSLLEHIVEAMCLHVSDESPT  1196

Query  4382  VRRLCLRGLVQMPSIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVE  4561
             VR LCLRGLVQ+P  H+  Y  Q+LGVI+ALL+D DESVQLTAV CLL VL SSS +AV+
Sbjct  1197  VRSLCLRGLVQIPKSHMPNYIAQVLGVIVALLEDPDESVQLTAVQCLLSVLSSSSEEAVD  1256

Query  4562  PVLLNLSIRLRNLQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLH  4741
             P+L+NLS+RLRNLQ+ +N K+R+NAFAA+GALS++G GS   +F EQ+HA  PR++LHLH
Sbjct  1257  PILINLSVRLRNLQISMNEKMRSNAFAAYGALSNFGMGSQHQAFLEQVHATIPRLILHLH  1316

Query  4742  DDDLGVRQACRNTLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGP  4921
             DDDL VRQACRNTL+ +APLIE D   AL N   FSS+ RSDYEDF+RDL+R + Q L  
Sbjct  1317  DDDLNVRQACRNTLRQLAPLIEADGFSALFNKQVFSSERRSDYEDFIRDLSRHVYQLLAS  1376

Query  4922  RVDTYLSAIIQAFDAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNST  5101
             RVD+YL+ +IQAFD+PWPVIQANA+Y  S +LSLS+++   A Y  QVF  LV + + S 
Sbjct  1377  RVDSYLAPLIQAFDSPWPVIQANAIYFSSCLLSLSEDQRSLAPYCLQVFAALVTRMNRSP  1436

Query  5102  DAIVRATCSAALGLLLKSPN  5161
             DA+VRA+CS ALGLLLK+ N
Sbjct  1437  DAVVRASCSFALGLLLKAFN  1456



>ref|XP_006604597.1| PREDICTED: maestro heat-like repeat-containing protein family 
member 1-like isoform X5 [Glycine max]
Length=1491

 Score =  1834 bits (4750),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 966/1291 (75%), Positives = 1096/1291 (85%), Gaps = 22/1291 (2%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             A WQYS+DF      D DV+SFLNSAFELLLRVWA SRDLKVR+++VEALGQMVGLITRT
Sbjct  197   AAWQYSIDFPSHFPQDGDVMSFLNSAFELLLRVWAASRDLKVRVASVEALGQMVGLITRT  256

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstl  1003
             QLK ALPRL+PTIL+LYK++QD AF+ATCSLH+LLNASLLS +GPP+LDFEDLT+VLSTL
Sbjct  257   QLKTALPRLIPTILDLYKKDQDIAFLATCSLHNLLNASLLSESGPPMLDFEDLTLVLSTL  316

Query  1004  llvCS-NNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGS  1180
             L V S NND K+ SDFPVGLK YNEVQHCFLTVG VYP+DLF+FL+NKCRL+EEP TFGS
Sbjct  317   LPVVSFNNDSKDQSDFPVGLKMYNEVQHCFLTVGLVYPDDLFLFLVNKCRLREEPLTFGS  376

Query  1181  LCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGE  1360
             LC+LKHLLPRL+E+WH+K P+L+E+VK L++E NLGVRKAL+ELIVVMASHCYLVGSSGE
Sbjct  377   LCILKHLLPRLSEAWHSKIPLLVEAVKSLLEEQNLGVRKALSELIVVMASHCYLVGSSGE  436

Query  1361  LFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKG  1540
             LFIEYLVRHCA+ D    +LES+               +++E K GAVT  ELR VCEKG
Sbjct  437   LFIEYLVRHCAITDQNRSDLESTPN-------------KRIEMKIGAVTPGELRAVCEKG  483

Query  1541  LLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKAR  1720
             LLL+T+T+PEMEH+LWPFLL+MIIP  YTGAVATVCRCISEL R RS  SN MLSECK R
Sbjct  484   LLLVTITIPEMEHILWPFLLRMIIPLTYTGAVATVCRCISELWRHRSY-SNDMLSECKTR  542

Query  1721  TDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKA  1900
              DIP  EEL ARL+VLLHNPLARE L TQIL+VL  LAPLFPKNIN FWQDE  IPKMKA
Sbjct  543   PDIPSAEELLARLLVLLHNPLAREQLATQILTVLCLLAPLFPKNINLFWQDE--IPKMKA  600

Query  1901  YVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHS  2080
             YVSDTEDLKQDP YQ++WDDMII+FLAESLDVIQ+ DWV+ LGN FA+ YELY SD++H+
Sbjct  601   YVSDTEDLKQDPSYQDTWDDMIINFLAESLDVIQDADWVMSLGNVFAKHYELYASDDQHT  660

Query  2081  ALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDK  2260
             ALLHRCLGILLQKV+DRAYV  KID MY+QANIA PTNRLGLAKAMGLVAASHLDTVL+K
Sbjct  661   ALLHRCLGILLQKVNDRAYVCDKIDWMYKQANIANPTNRLGLAKAMGLVAASHLDTVLEK  720

Query  2261  LKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALV  2440
             LK ILDNVGQSI QRI S FSD  + EESDD HAALALMYGYAAKYAP TVIEARI+ALV
Sbjct  721   LKDILDNVGQSIFQRILSLFSDSFRTEESDDIHAALALMYGYAAKYAPSTVIEARINALV  780

Query  2441  GTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRD  2620
             GTNMLSRLLHVR P+AKQAVITAIDLLG AVI A+ESG  FPLKRRD LLDYILTLMGRD
Sbjct  781   GTNMLSRLLHVRLPKAKQAVITAIDLLGNAVINAAESGSPFPLKRRDQLLDYILTLMGRD  840

Query  2621  EEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVIN  2800
             +E+GF+D N +LL TQ+LA+SACTTLVSVEPKLT ETR+ +MKAT+GFF +PNDP DV+N
Sbjct  841   DEDGFADYN-DLLRTQALAISACTTLVSVEPKLTVETRSHVMKATLGFFAIPNDPVDVVN  899

Query  2801  PLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIK  2980
             PLIDNLITLLC IL+T GEDGRSRAE L+ ILR ID FV S +EYQRKRGCLA HE+L+K
Sbjct  900   PLIDNLITLLCAILLTGGEDGRSRAELLMLILRQIDQFVCSPVEYQRKRGCLAVHEMLLK  959

Query  2981  FRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPRC  3160
             FR ICV+GYCALGC+GSC+H+KQ+D     N S LPSAF LPSR+AL LG+R+++YLPRC
Sbjct  960   FRMICVSGYCALGCRGSCAHNKQMDRTLYGNFSKLPSAFVLPSREALCLGDRVIMYLPRC  1019

Query  3161  IDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGI-DIELSYIALSSLEDVVAILRSDAS  3337
              DTN EVRK+S QIL+L F+IS SLP+P  SS+   DIELSY ALSSLEDV+AILR+D S
Sbjct  1020  ADTNSEVRKISAQILDLLFSISLSLPRPAGSSISAEDIELSYSALSSLEDVIAILRNDTS  1079

Query  3338  IDPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNEL  3517
             IDPSEVFNR+VSS+C LL K+ELVA LHGCS AICDKIKQSAEGAIQAVVEFVT RG EL
Sbjct  1080  IDPSEVFNRIVSSLCILLTKEELVATLHGCSVAICDKIKQSAEGAIQAVVEFVTKRGREL  1139

Query  3518  NEIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMVTKD  3697
              EI++SRT+QSL++A VH T+K+LR ETLGAI S+AENT+ + VF EVLAAAGRD +TKD
Sbjct  1140  TEIDISRTTQSLISATVHATDKHLRVETLGAISSLAENTSPRTVFDEVLAAAGRDTITKD  1199

Query  3698  IHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSVDGSI  3877
             I RLRGGWP+QDAF+AFSQH+VLS  FLEHVISV++Q P LK GD  + E S+  VD   
Sbjct  1200  ISRLRGGWPMQDAFYAFSQHMVLSVLFLEHVISVLSQIPILK-GDVERLEDSQ--VDSHT  1256

Query  3878  EDDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPLRAL  4057
             ED   +AA+ ALTAFFRGGGK G++ VEQ+YASVL+ LTL LG+CHGL   G  EPLR L
Sbjct  1257  EDGKLQAAIFALTAFFRGGGKVGKRAVEQNYASVLSELTLQLGSCHGLTYSGQHEPLRNL  1316

Query  4058  LNAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICLFLSK  4237
             L AFQAFCECVGDLEMGKILAR GE  ENE+WI+LIG++AG ISIKRPKEV  ICLF   
Sbjct  1317  LTAFQAFCECVGDLEMGKILARDGELLENERWISLIGDIAGCISIKRPKEVQNICLFFQN  1376

Query  4238  SLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQM  4417
             SLDRP + QREAAAAALSEF+RYS G G LL QMVE LCRHVSD+S TVRRLCLRGLVQ+
Sbjct  1377  SLDRPQKYQREAAAAALSEFVRYSGGLGSLLEQMVEVLCRHVSDESSTVRRLCLRGLVQI  1436

Query  4418  PSIHVLQYTTQILGVILALLDDSDESVQLTA  4510
             P IH+L+YT Q+LGVILALLDD DESVQLTA
Sbjct  1437  PLIHILKYTAQVLGVILALLDDLDESVQLTA  1467


 Score =   294 bits (753),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 138/186 (74%), Positives = 166/186 (89%), Gaps = 0/186 (0%)
 Frame = +1

Query  91   SIPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGNIA  270
            SIPASEAVQV++S LADD+ SVREASMS+LKDI +LNPLLVLDCC  VSRGGRRRFGN+A
Sbjct  6    SIPASEAVQVLLSLLADDTSSVREASMSSLKDIAALNPLLVLDCCAVVSRGGRRRFGNMA  65

Query  271  GLFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLP  450
            G+FQV++  +RALDK DVD AFM KLAKIATAE+IS+KELN+DWQRAA  +LV++GSHLP
Sbjct  66   GVFQVMAFGVRALDKKDVDSAFMAKLAKIATAELISSKELNSDWQRAATSLLVAIGSHLP  125

Query  451  DLMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIYRP  630
            DLMMEEI+LH SG+NSAL +MVQILA++AS+D LQF P  KGVL+R++PILGNVR+++RP
Sbjct  126  DLMMEEIYLHLSGANSALQSMVQILAEFASTDPLQFIPHWKGVLSRILPILGNVRDMHRP  185

Query  631  IFANGL  648
            IFAN  
Sbjct  186  IFANAF  191



>ref|XP_006604596.1| PREDICTED: maestro heat-like repeat-containing protein family 
member 1-like isoform X4 [Glycine max]
Length=1493

 Score =  1832 bits (4746),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 966/1291 (75%), Positives = 1096/1291 (85%), Gaps = 22/1291 (2%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             A WQYS+DF      D DV+SFLNSAFELLLRVWA SRDLKVR+++VEALGQMVGLITRT
Sbjct  197   AAWQYSIDFPSHFPQDGDVMSFLNSAFELLLRVWAASRDLKVRVASVEALGQMVGLITRT  256

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstl  1003
             QLK ALPRL+PTIL+LYK++QD AF+ATCSLH+LLNASLLS +GPP+LDFEDLT+VLSTL
Sbjct  257   QLKTALPRLIPTILDLYKKDQDIAFLATCSLHNLLNASLLSESGPPMLDFEDLTLVLSTL  316

Query  1004  llvCS-NNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGS  1180
             L V S NND K+ SDFPVGLK YNEVQHCFLTVG VYP+DLF+FL+NKCRL+EEP TFGS
Sbjct  317   LPVVSFNNDSKDQSDFPVGLKMYNEVQHCFLTVGLVYPDDLFLFLVNKCRLREEPLTFGS  376

Query  1181  LCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGE  1360
             LC+LKHLLPRL+E+WH+K P+L+E+VK L++E NLGVRKAL+ELIVVMASHCYLVGSSGE
Sbjct  377   LCILKHLLPRLSEAWHSKIPLLVEAVKSLLEEQNLGVRKALSELIVVMASHCYLVGSSGE  436

Query  1361  LFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKG  1540
             LFIEYLVRHCA+ D    +LES+               +++E K GAVT  ELR VCEKG
Sbjct  437   LFIEYLVRHCAITDQNRSDLESTPN-------------KRIEMKIGAVTPGELRAVCEKG  483

Query  1541  LLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKAR  1720
             LLL+T+T+PEMEH+LWPFLL+MIIP  YTGAVATVCRCISEL R RS  SN MLSECK R
Sbjct  484   LLLVTITIPEMEHILWPFLLRMIIPLTYTGAVATVCRCISELWRHRSY-SNDMLSECKTR  542

Query  1721  TDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKA  1900
              DIP  EEL ARL+VLLHNPLARE L TQIL+VL  LAPLFPKNIN FWQDE  IPKMKA
Sbjct  543   PDIPSAEELLARLLVLLHNPLAREQLATQILTVLCLLAPLFPKNINLFWQDE--IPKMKA  600

Query  1901  YVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHS  2080
             YVSDTEDLKQDP YQ++WDDMII+FLAESLDVIQ+ DWV+ LGN FA+ YELY SD++H+
Sbjct  601   YVSDTEDLKQDPSYQDTWDDMIINFLAESLDVIQDADWVMSLGNVFAKHYELYASDDQHT  660

Query  2081  ALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDK  2260
             ALLHRCLGILLQKV+DRAYV  KID MY+QANIA PTNRLGLAKAMGLVAASHLDTVL+K
Sbjct  661   ALLHRCLGILLQKVNDRAYVCDKIDWMYKQANIANPTNRLGLAKAMGLVAASHLDTVLEK  720

Query  2261  LKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALV  2440
             LK ILDNVGQSI QRI S FSD  + EESDD HAALALMYGYAAKYAP TVIEARI+ALV
Sbjct  721   LKDILDNVGQSIFQRILSLFSDSFRTEESDDIHAALALMYGYAAKYAPSTVIEARINALV  780

Query  2441  GTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRD  2620
             GTNMLSRLLHVR P+AKQAVITAIDLLG AVI A+ESG  FPLKRRD LLDYILTLMGRD
Sbjct  781   GTNMLSRLLHVRLPKAKQAVITAIDLLGNAVINAAESGSPFPLKRRDQLLDYILTLMGRD  840

Query  2621  EEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVIN  2800
             +E+GF+D N +LL TQ+LA+SACTTLVSVEPKLT ETR+ +MKAT+GFF +PNDP DV+N
Sbjct  841   DEDGFADYN-DLLRTQALAISACTTLVSVEPKLTVETRSHVMKATLGFFAIPNDPVDVVN  899

Query  2801  PLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIK  2980
             PLIDNLITLLC IL+T GEDGRSRAE L+ ILR ID FV S +EYQRKRGCLA HE+L+K
Sbjct  900   PLIDNLITLLCAILLTGGEDGRSRAELLMLILRQIDQFVCSPVEYQRKRGCLAVHEMLLK  959

Query  2981  FRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPRC  3160
             FR ICV+GYCALGC+GSC+H+KQ+D     N S LPSAF LPSR+AL LG+R+++YLPRC
Sbjct  960   FRMICVSGYCALGCRGSCAHNKQMDRTLYGNFSKLPSAFVLPSREALCLGDRVIMYLPRC  1019

Query  3161  IDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGI-DIELSYIALSSLEDVVAILRSDAS  3337
              DTN EVRK+S QIL+L F+IS SLP+P  SS+   DIELSY ALSSLEDV+AILR+D S
Sbjct  1020  ADTNSEVRKISAQILDLLFSISLSLPRPAGSSISAEDIELSYSALSSLEDVIAILRNDTS  1079

Query  3338  IDPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNEL  3517
             IDPSEVFNR+VSS+C LL K+ELVA LHGCS AICDKIKQSAEGAIQAVVEFVT RG EL
Sbjct  1080  IDPSEVFNRIVSSLCILLTKEELVATLHGCSVAICDKIKQSAEGAIQAVVEFVTKRGREL  1139

Query  3518  NEIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMVTKD  3697
              EI++SRT+QSL++A VH T+K+LR ETLGAI S+AENT+ + VF EVLAAAGRD +TKD
Sbjct  1140  TEIDISRTTQSLISATVHATDKHLRVETLGAISSLAENTSPRTVFDEVLAAAGRDTITKD  1199

Query  3698  IHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSVDGSI  3877
             I RLRGGWP+QDAF+AFSQH+VLS  FLEHVISV++Q P LK GD  + E S+  VD   
Sbjct  1200  ISRLRGGWPMQDAFYAFSQHMVLSVLFLEHVISVLSQIPILK-GDVERLEDSQ--VDSHT  1256

Query  3878  EDDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPLRAL  4057
             ED   +AA+ ALTAFFRGGGK G++ VEQ+YASVL+ LTL LG+CHGL   G  EPLR L
Sbjct  1257  EDGKLQAAIFALTAFFRGGGKVGKRAVEQNYASVLSELTLQLGSCHGLTYSGQHEPLRNL  1316

Query  4058  LNAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICLFLSK  4237
             L AFQAFCECVGDLEMGKILAR GE  ENE+WI+LIG++AG ISIKRPKEV  ICLF   
Sbjct  1317  LTAFQAFCECVGDLEMGKILARDGELLENERWISLIGDIAGCISIKRPKEVQNICLFFQN  1376

Query  4238  SLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQM  4417
             SLDRP + QREAAAAALSEF+RYS G G LL QMVE LCRHVSD+S TVRRLCLRGLVQ+
Sbjct  1377  SLDRPQKYQREAAAAALSEFVRYSGGLGSLLEQMVEVLCRHVSDESSTVRRLCLRGLVQI  1436

Query  4418  PSIHVLQYTTQILGVILALLDDSDESVQLTA  4510
             P IH+L+YT Q+LGVILALLDD DESVQLTA
Sbjct  1437  PLIHILKYTAQVLGVILALLDDLDESVQLTA  1467


 Score =   294 bits (753),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 138/186 (74%), Positives = 166/186 (89%), Gaps = 0/186 (0%)
 Frame = +1

Query  91   SIPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGNIA  270
            SIPASEAVQV++S LADD+ SVREASMS+LKDI +LNPLLVLDCC  VSRGGRRRFGN+A
Sbjct  6    SIPASEAVQVLLSLLADDTSSVREASMSSLKDIAALNPLLVLDCCAVVSRGGRRRFGNMA  65

Query  271  GLFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLP  450
            G+FQV++  +RALDK DVD AFM KLAKIATAE+IS+KELN+DWQRAA  +LV++GSHLP
Sbjct  66   GVFQVMAFGVRALDKKDVDSAFMAKLAKIATAELISSKELNSDWQRAATSLLVAIGSHLP  125

Query  451  DLMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIYRP  630
            DLMMEEI+LH SG+NSAL +MVQILA++AS+D LQF P  KGVL+R++PILGNVR+++RP
Sbjct  126  DLMMEEIYLHLSGANSALQSMVQILAEFASTDPLQFIPHWKGVLSRILPILGNVRDMHRP  185

Query  631  IFANGL  648
            IFAN  
Sbjct  186  IFANAF  191



>ref|XP_008813465.1| PREDICTED: protein SHOOT GRAVITROPISM 6, partial [Phoenix dactylifera]
Length=1652

 Score =  1831 bits (4744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 960/1518 (63%), Positives = 1176/1518 (77%), Gaps = 71/1518 (5%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             A WQY  DF    +LD+DV+SF+NS FELLLRVWA SRDLKVRLS+VEALGQMVGL+TR 
Sbjct  196   ATWQYIGDFPSHPLLDSDVMSFMNSVFELLLRVWATSRDLKVRLSSVEALGQMVGLVTRP  255

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvl-st  1000
             QLKAALPRL+PTIL+LYK++ + AF+A+CSLH+LL A LLS +GPPLLDFE+L V+L + 
Sbjct  256   QLKAALPRLIPTILDLYKKDHEIAFLASCSLHNLLAACLLSESGPPLLDFEELKVILCTL  315

Query  1001  lllvCSNNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGS  1180
             L +VC NN   + S+  +GLKTYNE+QHCFL +GSVYP+DL VFLL+ C+ K+EP   G+
Sbjct  316   LPVVCVNNSNDDCSNVSMGLKTYNEIQHCFLVIGSVYPDDLCVFLLDICQSKDEPSMIGA  375

Query  1181  LCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGE  1360
             LC++KHLLPRL E+W++KR +L+E VK L+DE +L VR ALAELIVVMASHCYL G   E
Sbjct  376   LCIIKHLLPRLLETWYSKRTLLVEVVKSLLDEQSLDVRMALAELIVVMASHCYLSGPPAE  435

Query  1361  LFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKG  1540
             LFIEYLVRHCA+ + +    + S+E +  +G + PF Y+KLE   G V+  +LR +CEKG
Sbjct  436   LFIEYLVRHCAITEDKVRNFKDSKEVTWRSGPFQPFQYKKLEVIMGPVSPVKLRAICEKG  495

Query  1541  LLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKAR  1720
             LLL+ +T+PEME++LWPF+LKMIIP+ YTGAVATVC+CI+ELCR RSS +++  SE    
Sbjct  496   LLLLAITIPEMEYILWPFILKMIIPKKYTGAVATVCKCITELCRHRSSHNSSTFSELNTS  555

Query  1721  TDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKA  1900
             +DIPKPE+LFARLVVLLH+PLAR  L TQIL+VL YL+PLFPKN++ FWQDE  +PKMKA
Sbjct  556   SDIPKPEDLFARLVVLLHDPLARAQLATQILTVLCYLSPLFPKNLSLFWQDE--VPKMKA  613

Query  1901  YVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHS  2080
             Y+SD EDLKQD  YQE+WDDMIISFLAESLDV+++ +WV+ LG  FAR Y LY + +EHS
Sbjct  614   YISDPEDLKQDSSYQETWDDMIISFLAESLDVVRDTEWVISLGEAFARHYALYAAGDEHS  673

Query  2081  ALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDK  2260
             ALLHRCLG+LLQKV DR YVR KI+ MY+ A+I+VPTNRLGLAK MGLVAASHLDTVL+K
Sbjct  674   ALLHRCLGMLLQKVDDRIYVREKIEWMYKHADISVPTNRLGLAKGMGLVAASHLDTVLEK  733

Query  2261  LKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALV  2440
             LK ILDNVG S LQR  SFFS R K+E++D T+AALALMYGYAA+YAP TVIEARIDALV
Sbjct  734   LKNILDNVGHSRLQRFLSFFSSRSKVEDADHTYAALALMYGYAARYAPITVIEARIDALV  793

Query  2441  GTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRD  2620
             GTNMLSRLLHV++  AKQAVITAIDLLG AVI ASE G+SFPLKRRD +LDY+LTLMGRD
Sbjct  794   GTNMLSRLLHVQNATAKQAVITAIDLLGCAVINASEMGVSFPLKRRDQMLDYVLTLMGRD  853

Query  2621  EEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVIN  2800
             E E F DSNIELLHTQSLALS+CTTLVS+EP+L  ETRN ++KAT+ FF LP DPSD+  
Sbjct  854   ESEDFVDSNIELLHTQSLALSSCTTLVSIEPRLPMETRNCVLKATLNFFALPRDPSDI--  911

Query  2801  PLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIK  2980
                                               IDP +S+ +        L    LL  
Sbjct  912   ----------------------------------IDPLISNLIT-------LLCAILLTS  930

Query  2981  FRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPRC  3160
              R +C                             LP+AF LPSRD+L LGERI+ YLPRC
Sbjct  931   MRMLCFTWIL------------------------LPAAFVLPSRDSLCLGERIIAYLPRC  966

Query  3161  IDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILRSDASI  3340
              DT+ EVRKV+VQI+ LFF+IS SLPK + SS  +D+E+SY ALSSLEDV++ILR DASI
Sbjct  967   ADTSSEVRKVAVQIVGLFFSISLSLPKLVVSSSDVDLEVSYSALSSLEDVISILRRDASI  1026

Query  3341  DPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNELN  3520
             D SEVFNRV+SSVC LL KDELV ALH C+ AICDKIKQSA+GAIQAV+EF+T RGNELN
Sbjct  1027  DQSEVFNRVLSSVCVLLTKDELVIALHTCTAAICDKIKQSADGAIQAVIEFITKRGNELN  1086

Query  3521  EIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMVTKDI  3700
             E++V+RT+QSLL A V V +K+ RQE L AI  +AENT S VVF EVLAAAGRD+VTKD+
Sbjct  1087  EVDVARTTQSLLLATVSVIDKHSRQEVLNAISCLAENTNSNVVFNEVLAAAGRDIVTKDV  1146

Query  3701  HRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSVDGSIE  3880
              R+RGGWP+QDAF+AFSQH VLS  FLE+V+SV+N++P  +  D  KG+ + + V+   +
Sbjct  1147  SRIRGGWPMQDAFYAFSQHAVLSVLFLEYVVSVLNRTPVFQS-DIDKGDLTTHPVESPSD  1205

Query  3881  DDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPLRALL  4060
             + + +AA+LALTA FRGGGK G+K VEQSY+SVL+ LTL LG+CHGL+  G QE LRALL
Sbjct  1206  EHILQAAILALTALFRGGGKTGKKAVEQSYSSVLSALTLQLGSCHGLSGLGQQEHLRALL  1265

Query  4061  NAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICLFLSKS  4240
              AFQ+FC+CVGD+EMGKIL RGGE N+ EKW++LI E+A   SIKRPKEV  IC+  SK+
Sbjct  1266  TAFQSFCDCVGDIEMGKILVRGGEHNDKEKWMDLIQEIACCTSIKRPKEVQPICMIFSKA  1325

Query  4241  LDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQMP  4420
             L R  R QREAAAAALSEF+R+SDG   LL  +VEA+C HVSD+SPTVR LCLRGLV +P
Sbjct  1326  LSRHQRFQREAAAAALSEFIRHSDGVPSLLEHIVEAMCLHVSDESPTVRSLCLRGLVLIP  1385

Query  4421  SIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSIRLRNL  4600
               H+ +Y  Q+LGVI+ALL+D+DESVQLTAV CLL VL+SS  DAV+PVL+NLS+RLRNL
Sbjct  1386  DCHMPKYIAQVLGVIVALLEDADESVQLTAVQCLLAVLKSSPKDAVDPVLINLSVRLRNL  1445

Query  4601  QVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACRNT  4780
             Q+ +NAK+R+NAFAA+GALS++G GS   +F EQ+HA  PR++LHLHDDD+ VRQACRNT
Sbjct  1446  QISMNAKMRSNAFAAYGALSNFGVGSQHQAFLEQVHATLPRLILHLHDDDVSVRQACRNT  1505

Query  4781  LKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSAIIQAF  4960
             L+ +APL+E+D   AL +   F+S+HRSDYEDF+RDL RQL Q L   VD YL++ IQAF
Sbjct  1506  LRQLAPLMEVDGFSALFSKQVFNSEHRSDYEDFIRDLTRQLCQVLASSVDKYLASAIQAF  1565

Query  4961  DAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATCSAALG  5140
             DAPWPVIQANA+Y  S MLSLSD++   A Y+SQVF +LV K   S DA+VRAT S ALG
Sbjct  1566  DAPWPVIQANAIYFSSCMLSLSDDQRTLAPYFSQVFALLVSKMCRSPDAVVRATSSFALG  1625

Query  5141  LLLKSPNSSSWRDARLNK  5194
             +LLK+ N  +W  ++L++
Sbjct  1626  MLLKATNPLTWMVSQLDR  1643


 Score =   295 bits (755),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 139/186 (75%), Positives = 167/186 (90%), Gaps = 0/186 (0%)
 Frame = +1

Query  91   SIPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGNIA  270
            S+PA EAVQV+V+SLAD+SP V+EAS++ALK+I  LNPLLVLDCC  VSRGGRRRFGN+A
Sbjct  5    SLPALEAVQVLVASLADESPVVKEASLAALKEIAPLNPLLVLDCCSAVSRGGRRRFGNMA  64

Query  271  GLFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLP  450
            G+F V++ A+RA+D+ DVDP +M KLAKIATAE+I++KELNADWQRAAAG+LVSVGSH+P
Sbjct  65   GVFLVMACAVRAMDRKDVDPTYMAKLAKIATAEMITSKELNADWQRAAAGLLVSVGSHVP  124

Query  451  DLMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIYRP  630
            DLMMEEIFLH SG+NSALPAMVQILAD+AS++ALQF PRLK VL RV+PILGNVR+  RP
Sbjct  125  DLMMEEIFLHLSGTNSALPAMVQILADFASAEALQFAPRLKDVLLRVLPILGNVRDAQRP  184

Query  631  IFANGL  648
            +FAN  
Sbjct  185  VFANAF  190



>gb|EPS71954.1| hypothetical protein M569_02803, partial [Genlisea aurea]
Length=1551

 Score =  1819 bits (4711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 946/1380 (69%), Positives = 1128/1380 (82%), Gaps = 31/1380 (2%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             ACWQY VDF +S ++D DV+SFLNSAFELLLRVWA SRDL+VR S VEALG+MVGL+ R 
Sbjct  199   ACWQYGVDFPISEVIDGDVMSFLNSAFELLLRVWANSRDLEVRASTVEALGEMVGLVNRA  258

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstl  1003
             Q K+A+PRL+P IL L KR QD  ++AT SLH+LLNA+LLS  GPPLLDFEDLT+ LSTL
Sbjct  259   QQKSAIPRLIPIILNLCKRNQDVTYLATSSLHNLLNAALLSETGPPLLDFEDLTITLSTL  318

Query  1004  llvCSNN-DKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGS  1180
             L V + N D KE S+F VGLK YN VQHCFL +G VYPED+F FLL+KCR KEE  TF +
Sbjct  319   LPVVATNYDSKEFSEFSVGLKIYNNVQHCFLIIGEVYPEDMFTFLLHKCRSKEESLTFAA  378

Query  1181  LCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGE  1360
             L VLKHLLPRL+E+WH KRP+L+E++K L+D HNL VRKAL+E+IV+MASHCYLVG   E
Sbjct  379   LSVLKHLLPRLSEAWHAKRPLLVEAMKNLLDVHNLAVRKALSEVIVIMASHCYLVGPPAE  438

Query  1361  LFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKG  1540
             +FIEYL+    M  +E+++        +  G Y                 T+LR VCEKG
Sbjct  439   VFIEYLLCLLTMYVVEHLQ-------EKLMGTY----------------PTDLRDVCEKG  475

Query  1541  LLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKAR  1720
             LLL+TVT+PEMEH+LWPFLLKMIIPR YT +VATVC+CI+ELCR + ++S  +LS+C+AR
Sbjct  476   LLLLTVTIPEMEHILWPFLLKMIIPRNYTASVATVCKCIAELCRHKHTQSGTILSDCRAR  535

Query  1721  TDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKA  1900
              DIP PE+LFARLVVLLHNPLAR+ LVTQIL+VL +LA LFPKNI  FWQ+E  IPKMKA
Sbjct  536   IDIPTPEDLFARLVVLLHNPLARQQLVTQILNVLCHLASLFPKNIILFWQEE--IPKMKA  593

Query  1901  YVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHS  2080
             Y SD EDLKQDP YQE WDDMII+F+AESLDVIQ+ DW + LGN+FA+QYEL+ SD+EHS
Sbjct  594   YASDPEDLKQDPSYQEIWDDMIINFVAESLDVIQDQDWAISLGNSFAKQYELFSSDDEHS  653

Query  2081  ALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDK  2260
             ALLHRCLGILLQK++DR YVR+KI+LMY QANIA P NRLGLAKAMGLVAASHLDTVLDK
Sbjct  654   ALLHRCLGILLQKLNDRTYVRSKINLMYLQANIASPVNRLGLAKAMGLVAASHLDTVLDK  713

Query  2261  LKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALV  2440
             LK I+D+V  S+ +RI SFFSD+ KMEESDD HAALALMYGYAAKYAP TVIEARI+ALV
Sbjct  714   LKSIIDSVDNSLFKRIMSFFSDKAKMEESDDIHAALALMYGYAAKYAPSTVIEARINALV  773

Query  2441  GTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRD  2620
             GTNML RLL+VRHP AKQAVITAIDLLGQAVIGA+++G  FPLKRRD+LLDY LTLMGRD
Sbjct  774   GTNMLVRLLNVRHPIAKQAVITAIDLLGQAVIGAAKTGAPFPLKRRDVLLDYTLTLMGRD  833

Query  2621  EEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVIN  2800
             +EEGFS+S++ELL T+ LALSACTTLVSVEPKLT  TRN I+KAT+GFF LPNDP DV++
Sbjct  834   DEEGFSESSLELLRTRCLALSACTTLVSVEPKLTAGTRNHILKATLGFFSLPNDPPDVVS  893

Query  2801  PLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIK  2980
              L++ LITLLCTIL  SGEDGRSR+EQLLHILR IDPF+SSS+EYQR RGCLA +++L K
Sbjct  894   DLMEKLITLLCTILAMSGEDGRSRSEQLLHILRQIDPFISSSIEYQRIRGCLAVYKMLNK  953

Query  2981  FRAICVNGYCALGCQGSCSHSKQIDHA--ANRNLSNLPSAFFLPSRDALSLGERIMVYLP  3154
             FR IC++GYC+ GCQG C+H+KQID    ++ +++NLP AF  PSRDALSLGERIMVY+P
Sbjct  954   FRMICLSGYCSFGCQGKCNHTKQIDRVSSSSSSITNLPYAFASPSRDALSLGERIMVYIP  1013

Query  3155  RCIDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILRSDA  3334
             RC DTN +V+K S QIL+ FF+IS SLP+P NS    D+E+SY ALS+LEDV+AILRSDA
Sbjct  1014  RCADTNPDVQKTSAQILDQFFSISLSLPRPSNSIPERDVEMSYRALSALEDVIAILRSDA  1073

Query  3335  SIDPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNE  3514
             S+DPSEVFNR+VSSVC L  KDEL+AAL+ CS AICDK++QSAEGAIQAV+EF+T RG E
Sbjct  1074  SLDPSEVFNRIVSSVCILFTKDELIAALYACSTAICDKVRQSAEGAIQAVIEFITERGRE  1133

Query  3515  LNEIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMVTK  3694
             LN+ ++SRT+QSLL+AV  ++EK++ QETLGAICS+AENT+S++VF+EVL+AA +D+ TK
Sbjct  1134  LNDGDISRTAQSLLSAVSRLSEKHILQETLGAICSLAENTSSRIVFSEVLSAARKDISTK  1193

Query  3695  DIHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSVDGS  3874
             D  RLRGGW I   F AFSQH VL  SFLEHV S++NQ+  +  GD  + ES   + +  
Sbjct  1194  DTSRLRGGWQIHQIFQAFSQHTVLCGSFLEHVTSILNQT-LVSQGDYSRRESPSYTGESQ  1252

Query  3875  IEDDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPLRA  4054
               DDVS AAV ALTAFFRGGG+ G++ VEQ+Y+SV+ATL L LGT + LA  G  EPLR 
Sbjct  1253  QVDDVS-AAVTALTAFFRGGGRVGKRAVEQNYSSVVATLVLQLGTSYSLAGKGQLEPLRQ  1311

Query  4055  LLNAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICLFLS  4234
             LL AF +FCEC GDLEMGKILAR   Q E E WI L+GELAG +SIKRPKEVP+ICLFL 
Sbjct  1312  LLVAFNSFCECAGDLEMGKILAR-DRQFEEETWIGLMGELAGCVSIKRPKEVPSICLFLC  1370

Query  4235  KSLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQ  4414
             K+L+RP    RE+AAAALSEF+ +SD F  LL Q+VE +CRHV+DDSPTVRRLCLRGLVQ
Sbjct  1371  KALERPPIYLRESAAAALSEFVPFSDRFDSLLEQLVEGMCRHVTDDSPTVRRLCLRGLVQ  1430

Query  4415  MPSIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSIRLR  4594
             MP  H+ QYTTQIL VI+ALLDD DESVQLTA++CLL VL S+  DAVEP+LLNLS+R+R
Sbjct  1431  MPPTHLFQYTTQILSVIVALLDDLDESVQLTAITCLLKVLGSAPADAVEPILLNLSVRVR  1490

Query  4595  NLQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACR  4774
             NLQVC+N  IR NAF AFGALS YG G   D+F EQ+HA  PR++LH+HDDDLGVR+ACR
Sbjct  1491  NLQVCMNNSIRENAFDAFGALSDYGVGPHRDTFLEQVHATLPRLILHIHDDDLGVRRACR  1550


 Score =   252 bits (644),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 121/188 (64%), Positives = 156/188 (83%), Gaps = 1/188 (1%)
 Frame = +1

Query  85   GDSIPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGN  264
            G SIPA EAVQ++VSSLAD+SP VR+A+ +ALKDI +L+PLLVLDCC   SRG R++FGN
Sbjct  7    GYSIPAPEAVQILVSSLADESPVVRDAAGTALKDIAALSPLLVLDCCSAASRG-RKKFGN  65

Query  265  IAGLFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSH  444
            ++GLFQV++ AI A++K  V   +M KL K+ T E+ISTK+LN DW RAA+GVLVS+G H
Sbjct  66   LSGLFQVMAAAIHAINKDGVGSEYMAKLGKLVTMEIISTKDLNDDWLRAASGVLVSIGLH  125

Query  445  LPDLMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIY  624
             PDLMM+E+FLH SGS SA+P+MVQILA++AS+DA QF PRLKGVL RV+PILG+V++I+
Sbjct  126  NPDLMMDEVFLHLSGSGSAVPSMVQILAEFASADAFQFVPRLKGVLKRVLPILGSVKDIH  185

Query  625  RPIFANGL  648
            R +FAN  
Sbjct  186  RLVFANAF  193



>ref|XP_010267299.1| PREDICTED: protein SHOOT GRAVITROPISM 6 isoform X4 [Nelumbo nucifera]
Length=1442

 Score =  1754 bits (4543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 911/1247 (73%), Positives = 1073/1247 (86%), Gaps = 6/1247 (0%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             A WQYS DF  + +LD+DV+SFLNSAFELLLRVWA SRDLKVR+S+VEALGQMVGLITR 
Sbjct  200   AAWQYSGDFPSNALLDSDVMSFLNSAFELLLRVWANSRDLKVRVSSVEALGQMVGLITRL  259

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstl  1003
             QLKAALPRLV TILELYK++Q+ AF+ATCSLH++LNASLLS +GPPLLDFE+LTV+L+TL
Sbjct  260   QLKAALPRLVQTILELYKKDQEVAFLATCSLHNVLNASLLSEDGPPLLDFEELTVILATL  319

Query  1004  l-lvCSNNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGS  1180
             L +VC N++ KEHSDF VGLKTYNEVQHCFLTVG VY EDLF+FLLNKCRLKEEP+T+G+
Sbjct  320   LPVVCINSENKEHSDFSVGLKTYNEVQHCFLTVGLVYSEDLFMFLLNKCRLKEEPYTYGA  379

Query  1181  LCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGE  1360
             LCVLKHLLPRL+E+WH KRP+L+E+VKLL+DE +LG+RKAL+ELIVVMAS+CY+VG SGE
Sbjct  380   LCVLKHLLPRLSEAWHAKRPLLVEAVKLLLDEQSLGIRKALSELIVVMASNCYVVGPSGE  439

Query  1361  LFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKG  1540
             LF+EYLV HCA+ D E    E+S++  R + +++ F  ++LE K GA    ELR +CEKG
Sbjct  440   LFVEYLVHHCAISDQELNNFENSKDV-RSSISFHAFQQKRLEVKIGAACPAELRSICEKG  498

Query  1541  LLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKAR  1720
             LLL+T+T+PEME+VLWPFLLKMI+PR YTGA ATVCRCISELCR RSS ++++L++CKAR
Sbjct  499   LLLLTITIPEMEYVLWPFLLKMIVPRKYTGAAATVCRCISELCRHRSSYASSVLTDCKAR  558

Query  1721  TDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKA  1900
             TDIP PE+LFARLVVLLH+PLARE L TQIL+VL YL PLFP+N++ FWQDE  IPKMKA
Sbjct  559   TDIPNPEDLFARLVVLLHDPLAREQLATQILTVLCYLGPLFPRNVSLFWQDE--IPKMKA  616

Query  1901  YVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHS  2080
             YVSDTEDLKQDP YQE+WD+MII+FLAESLDVIQ+ +W++ LGN F +QYELY SD+EH+
Sbjct  617   YVSDTEDLKQDPAYQETWDNMIINFLAESLDVIQDPEWLISLGNAFTKQYELYTSDDEHT  676

Query  2081  ALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDK  2260
             ALLHRCLG+LLQK+ DRAYVR KID MYRQANI+VPTNRLGLAK MGLVA+SHLDTVL+K
Sbjct  677   ALLHRCLGMLLQKIDDRAYVREKIDWMYRQANISVPTNRLGLAKGMGLVASSHLDTVLEK  736

Query  2261  LKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALV  2440
             LK ILDNVG +  QR  S FS+R KME++DD HAALALMYGYAA+YAP TVIEARIDALV
Sbjct  737   LKDILDNVGLNFFQRFLSLFSERVKMEDADDIHAALALMYGYAARYAPSTVIEARIDALV  796

Query  2441  GTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRD  2620
             GTNMLSRLLHVR   AKQAVITAIDLLG+AVI A+ESG SFPLKRRD LLDYILTLMGRD
Sbjct  797   GTNMLSRLLHVRCHTAKQAVITAIDLLGRAVINAAESGASFPLKRRDQLLDYILTLMGRD  856

Query  2621  EEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVIN  2800
             + + F+DS++ELL TQSLALSACTTLVSVEPKLT ETRN +MKAT+GFF LP+DPSD+++
Sbjct  857   DTDSFADSSLELLRTQSLALSACTTLVSVEPKLTIETRNHVMKATLGFFALPSDPSDIVD  916

Query  2801  PLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIK  2980
             PLI+NLITLLC IL+TSGEDGRSRAEQLLHILR ID ++SSS+E+QRKRGC+A HE+L+K
Sbjct  917   PLINNLITLLCAILLTSGEDGRSRAEQLLHILRQIDLYISSSMEHQRKRGCIAVHEMLLK  976

Query  2981  FRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPRC  3160
             FRA+C +GYC LGC GSC H+KQID   + N SNLPSAF LPSR +L LGER++VYLPRC
Sbjct  977   FRALCSSGYCTLGCHGSCVHTKQIDRMLHGNFSNLPSAFVLPSRASLCLGERVIVYLPRC  1036

Query  3161  IDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILRSDASI  3340
              DT+ EVRKVS QIL++ F+IS SLP+P  S++  + ELSY ALSSLEDV+AILRSD SI
Sbjct  1037  ADTSAEVRKVSAQILDILFSISLSLPRPAESNISFNAELSYGALSSLEDVIAILRSDTSI  1096

Query  3341  DPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNELN  3520
             D SEVFNRV+SSVC LL KDELV  LHGC+ AICDK++QSAEGAIQAVVEFVT RG ELN
Sbjct  1097  DQSEVFNRVLSSVCNLLTKDELVGTLHGCTAAICDKVRQSAEGAIQAVVEFVTRRGIELN  1156

Query  3521  EIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMVTKDI  3700
             E++VSRT+ +LL+A + V EK+LR E LGAI  +AENT+S+VVF EVLA AGRD++ KDI
Sbjct  1157  EMDVSRTTHALLSATLLVPEKHLRHEILGAISCLAENTSSQVVFNEVLAVAGRDILRKDI  1216

Query  3701  HRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSVDGSIE  3880
              RLRGGWP+QDAF+ FSQH VLS  FLEHV+S++N +P  K  DS KG S  N  D  IE
Sbjct  1217  SRLRGGWPMQDAFYVFSQHTVLSVLFLEHVVSILNHTPIPK-ADSEKGGSC-NLFDTQIE  1274

Query  3881  DDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPLRALL  4060
             D++ +AA+LALTA FRGGGK G+K+VEQSYA+VL+TLTLHLG+CHGLA    QE LR LL
Sbjct  1275  DNILQAALLALTALFRGGGKVGKKSVEQSYAAVLSTLTLHLGSCHGLAGSDQQESLRTLL  1334

Query  4061  NAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICLFLSKS  4240
              AFQAFCECVGDLEMGKILAR GEQNENEKW+ LIG+LAG ISIKRPKEVP IC+ L K+
Sbjct  1335  AAFQAFCECVGDLEMGKILARDGEQNENEKWVTLIGDLAGCISIKRPKEVPAICINLCKA  1394

Query  4241  LDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPT  4381
             L+     QRE+AAAALSEF+RYSD  G LL Q+VEA+CRHVSD+SPT
Sbjct  1395  LNGHQTYQRESAAAALSEFVRYSDRVGSLLEQLVEAMCRHVSDESPT  1441


 Score =   300 bits (769),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 170/188 (90%), Gaps = 0/188 (0%)
 Frame = +1

Query  85   GDSIPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGN  264
            G ++PA EAVQV+VSSLAD++P VREAS +ALKDI +LNPLLVLDCC TVSRGGRRRFGN
Sbjct  7    GSTVPAPEAVQVLVSSLADEAPMVREASTAALKDIAALNPLLVLDCCSTVSRGGRRRFGN  66

Query  265  IAGLFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSH  444
            +AG+FQV++ A+RALDK DVDP F+ KLAKIATAE+IS+KELN+DWQRAA+ +LVS+GSH
Sbjct  67   MAGVFQVMAFAVRALDKKDVDPPFVAKLAKIATAEMISSKELNSDWQRAASSLLVSIGSH  126

Query  445  LPDLMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIY  624
            LPDLMM+EIFLH SG+NS LPAMVQILAD+AS++A QFTP+LKGVL+RV+PILGNVR+  
Sbjct  127  LPDLMMDEIFLHLSGTNSTLPAMVQILADFASAEASQFTPQLKGVLSRVLPILGNVRDAQ  186

Query  625  RPIFANGL  648
            RPIFA+  
Sbjct  187  RPIFAHAF  194



>ref|XP_004985717.1| PREDICTED: LOW QUALITY PROTEIN: maestro heat-like repeat-containing 
protein family member 1-like [Setaria italica]
Length=1734

 Score =  1737 bits (4498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 935/1524 (61%), Positives = 1166/1524 (77%), Gaps = 32/1524 (2%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             A WQY  D       DTDV+SF+NS FELL++VW  SRDLKVR S+VEALG+MVGL+TR+
Sbjct  182   AAWQYLGDAPSERPFDTDVMSFMNSVFELLIKVWMGSRDLKVRSSSVEALGEMVGLVTRS  241

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstl  1003
             QLK+ALPR++PT+L+LY ++ + AFVA+ SLH+LLNASLLS +GPPLLDFE+LTV+L TL
Sbjct  242   QLKSALPRIIPTMLDLYVKDPEVAFVASHSLHNLLNASLLSESGPPLLDFEELTVILVTL  301

Query  1004  llvCSNNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGSL  1183
             L + S N+ K+      GLKTYNE+QHCFL +G  YPEDL +FLLNKC+ K+E    G+L
Sbjct  302   LPLVSVNNSKDEHYVSKGLKTYNELQHCFLVIGLAYPEDLCMFLLNKCKSKDEASIVGAL  361

Query  1184  CVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGEL  1363
               +KHLLPRL ESWH K+  L+E +K L++  +L +R ALAELIVVMASHCYL G   EL
Sbjct  362   STIKHLLPRLLESWHTKQAPLVEIMKSLLEHQSLAIRMALAELIVVMASHCYLSGPPAEL  421

Query  1364  FIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKGL  1543
              +E+LV+H A+ D      E   +      +Y  F  ++ E K      +ELR +CEKGL
Sbjct  422   AVEFLVQHSAITD------EDLNDLGTLKNDY--FQDKRFEMKVSLAGLSELRTICEKGL  473

Query  1544  LLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATV------------------CRCISELC  1669
             LL+ +T+PEME VLWPF+LK+IIP+ YTGAVATV                  C+CI+ELC
Sbjct  474   LLLAITIPEMELVLWPFILKLIIPKKYTGAVATVSIWYTHTKTLQSFIYLQVCKCITELC  533

Query  1670  RRRSSESNAMLSECKARTDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPK  1849
             R + S++N + +E  A  + P PE+LFARLVVLLHNPLAR  L TQIL+VL YL PLFP+
Sbjct  534   RHKLSQTNPLYTEFNALNETPNPEDLFARLVVLLHNPLARGQLATQILTVLCYLGPLFPR  593

Query  1850  NINSFWQDEL*IPKMKAYVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLG  2029
             N++ FWQDE  +PKMKAY+SD EDLKQD  YQE WDDMII+FL+ESLDV+ + +WV+ LG
Sbjct  594   NLSLFWQDE--VPKMKAYISDPEDLKQDSTYQEIWDDMIINFLSESLDVVNDSEWVISLG  651

Query  2030  NTFARQYELYKSDNEHSALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLA  2209
             + FARQY+LY   + H+ALLHRCLG+LLQKV DR YV  KID M R +++++P NRLGLA
Sbjct  652   DAFARQYDLYGISDGHAALLHRCLGMLLQKVDDRIYVSEKIDWMCRHSSMSIPINRLGLA  711

Query  2210  KAMGLVAASHLDTVLDKLKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYA  2389
             + +GLVAASHLDTVL+KLK ILDN GQS LQR  SFFS   K+++ DDT+AALALMYGYA
Sbjct  712   QGIGLVAASHLDTVLEKLKNILDNAGQSALQRFLSFFSFGAKVDDVDDTYAALALMYGYA  771

Query  2390  AKYAPPTVIEARIDALVGTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPL  2569
             A+YAP TVIEARI+ALVGTNML RLLHV+HP AKQAVITAIDLLG+AVI A+E GISFPL
Sbjct  772   ARYAPSTVIEARINALVGTNMLGRLLHVQHPTAKQAVITAIDLLGRAVISAAEMGISFPL  831

Query  2570  KRRDLLLDYILTLMGRDEEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMK  2749
             KRRD LL+Y+LTLMGRD+ +  +D N ELLHTQS+ALSACTTLVS+EP+L  ETRN +MK
Sbjct  832   KRRDQLLEYVLTLMGRDQSDDLTDFNSELLHTQSVALSACTTLVSLEPRLPMETRNRVMK  891

Query  2750  ATIGFFGLPNDPSDVINPLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSL  2929
             AT+GFF LP +PS ++  LI NLI LL  IL+TSGEDGRSRAEQLLHILR +DP+VSSSL
Sbjct  892   ATLGFFALPTEPSSIVESLITNLIILLGAILLTSGEDGRSRAEQLLHILRQLDPYVSSSL  951

Query  2930  EYQRKRGCLAAHELLIKFRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPS  3109
             E+QR+RGC+A  E+LIKFR +C  G+ ALG   + + +KQID    R+LS+LPSAF LPS
Sbjct  952   EHQRRRGCVAVQEVLIKFRNLCSGGFGALGSYPTFTMNKQIDQGGTRSLSSLPSAFVLPS  1011

Query  3110  RDALSLGERIMVYLPRCIDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIA  3289
             RD+LSLGER M YLPRC DT+ EVRK ++QI+ LFFNIS SLPK    +  ID+E SY A
Sbjct  1012  RDSLSLGERTMAYLPRCADTDAEVRKAAIQIIALFFNISLSLPKQKAYANDIDLESSYSA  1071

Query  3290  LSSLEDVVAILRSDASIDPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEG  3469
             LSSLE++V+++R +AS+D +EVF RVVSSVC LL+KDELV  LH C+ A CDK+KQSA+ 
Sbjct  1072  LSSLEELVSVVRREASVDQTEVFQRVVSSVCILLSKDELVILLHSCTLATCDKVKQSADA  1131

Query  3470  AIQAVVEFVTNRGNELNEIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVV  3649
             +IQA++ F+T RG EL E +VSRT+QSLL++ V +T+K+ RQE L AI  +AENT   VV
Sbjct  1132  SIQAIIMFITRRGKELREADVSRTTQSLLSSAVSLTDKHSRQEVLNAISCLAENTNHIVV  1191

Query  3650  FTEVLAAAGRDMVTKDIHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGG  3829
             F EVL+ AGRD+ TKDI R+RGGW IQD F+AFSQH  L+  FLE+ +S++++ P +   
Sbjct  1192  FDEVLSVAGRDICTKDIPRIRGGWAIQDVFYAFSQHKELALLFLEYTLSILHKEP-VTIN  1250

Query  3830  DSGKGESSRNSVDGSIEDDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgt  4009
              S KGE++  S   S +D + +A + A+ AF RGGGK G++ VE+SY SVLA L L LG+
Sbjct  1251  SSEKGETTSES---SADDCILQATMFAVNAFMRGGGKIGKQAVEKSYPSVLAGLILKLGS  1307

Query  4010  chglaSYGDQEPLRALLNAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSIS  4189
              HGLA  G  E LR+LL AFQ+FCECVGD+EMGKI AR GEQ E EKWI+L+ E+A S S
Sbjct  1308  LHGLAELGRNELLRSLLIAFQSFCECVGDVEMGKIFARDGEQTEKEKWIDLVQEVACSSS  1367

Query  4190  IKRPKEVPTICLFLSKSLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSD  4369
             +KRPKEV   C+ LSK+L+R  R +REAAAAALSEF+R+ +    LL Q+VE LC+HVSD
Sbjct  1368  VKRPKEVLPTCVILSKALNRNQRAEREAAAAALSEFIRHIEKEPTLLEQLVEELCQHVSD  1427

Query  4370  DSPTVRRLCLRGLVQMPSIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssT  4549
             DSPTVR LCLRGLVQ+P  H+L+Y  Q+LGVILALL+D +ESVQLTAV CLL VL  S  
Sbjct  1428  DSPTVRSLCLRGLVQIPDSHMLKYIQQVLGVILALLEDPNESVQLTAVQCLLTVLNLSEQ  1487

Query  4550  DAVEPVLLNLSIRLRNLQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMV  4729
             DAV+P+L+NL IRLRNLQV +N K+R+NAFAA+GALS+YG G    +F EQIHA  PR++
Sbjct  1488  DAVDPILINLLIRLRNLQVSMNTKMRSNAFAAYGALSAYGVGLQRTAFIEQIHATLPRLI  1547

Query  4730  LHLHDDDLGVRQACRNTLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQ  4909
             LHLHDDDL VR ACRNT + +APL+E+D +  LL+   F+SD RSDYEDF++DLARQL +
Sbjct  1548  LHLHDDDLSVRLACRNTFQLLAPLMEVDGLSLLLSKQYFTSDRRSDYEDFIKDLARQLCR  1607

Query  4910  YLGPRVDTYLSAIIQAFDAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKA  5089
                 RVD+YL + IQAFDAPWPVI+ANAV L S MLS  D++   A Y+SQVF  LVG+ 
Sbjct  1608  LSPARVDSYLESAIQAFDAPWPVIRANAVCLVSCMLSFLDDQRFIAPYFSQVFATLVGRM  1667

Query  5090  SNSTDAIVRATCSAALGLLLKSPN  5161
             S S DAIVRA  S+ALG+L+K  N
Sbjct  1668  SQSPDAIVRAAASSALGILIKRSN  1691


 Score =   232 bits (592),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 134/160 (84%), Gaps = 0/160 (0%)
 Frame = +1

Query  205  LLVLDCCLTVSRGGRRRFGNIAGLFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTK  384
            +LVLDCC TVSRGGRRRFGN+AG+F V++ A+RALD  D +  F+ K+AKIATAE++S+K
Sbjct  1    MLVLDCCATVSRGGRRRFGNMAGVFLVMASAVRALDNSDAEREFLRKIAKIATAEIVSSK  60

Query  385  ELNADWQRAAAGVLVSVGSHLPDLMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTP  564
            E N DWQRAAA +LV++GSH PDLMMEEIFLHFSG  SALPAM+QILA +AS++ALQFTP
Sbjct  61   EFNVDWQRAAANLLVAIGSHDPDLMMEEIFLHFSGPTSALPAMLQILAHFASAEALQFTP  120

Query  565  RLKGVLARVVPILGNVREIYRPIFANGLLAV*RGFLTVYN  684
            RLK VL RV+PILGNVR+  RP+FANGLL +    + ++N
Sbjct  121  RLKDVLLRVLPILGNVRDGQRPVFANGLLWLLNSSVILFN  160



>ref|XP_006651039.1| PREDICTED: maestro heat-like repeat-containing protein family 
member 1-like [Oryza brachyantha]
Length=1749

 Score =  1729 bits (4477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 934/1507 (62%), Positives = 1169/1507 (78%), Gaps = 17/1507 (1%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             A WQY  D +     DTDV+SF+NS FELLL+VW  SRDLKVRLS+VEALG+MVGL+TR+
Sbjct  213   AAWQYIGDATSELPFDTDVMSFMNSVFELLLKVWTCSRDLKVRLSSVEALGEMVGLVTRS  272

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstl  1003
             QLK+ALPR++PT+L+L +++Q+ AF+A+ SLH+LLNASLLS +GPPLLDFE+L VVL TL
Sbjct  273   QLKSALPRIIPTMLDLCRKDQEVAFIASHSLHNLLNASLLSESGPPLLDFEELNVVLITL  332

Query  1004  llvCS-NNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGS  1180
             L + S N    EHS    GLKTYNE+QHCFL + S YPEDL +FLLNKC+ K+E    G+
Sbjct  333   LPLASANTSNDEHSYLTKGLKTYNEIQHCFLVISSAYPEDLCIFLLNKCKSKDEASIVGA  392

Query  1181  LCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGE  1360
             L  +KHLLPRL ESWH K+ +L+E VK L++E +LG+R ALAELIVVMASHCYL G   E
Sbjct  393   LGTIKHLLPRLLESWHTKQALLVEIVKSLLEEQSLGIRMALAELIVVMASHCYLSGHPAE  452

Query  1361  LFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKG  1540
             L +E+LVRH A+ D      +   +       Y  F  ++ E K      +ELR VCEKG
Sbjct  453   LAVEFLVRHSAITD------DDLNDPDTLKNEY--FQDKRFEMKISLSGLSELRAVCEKG  504

Query  1541  LLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKAR  1720
             LLL+ +T+PEME VLWPF+LK+IIP+ YTGAVATVC+CI+ELCR + S+++ + +E  A 
Sbjct  505   LLLLAITIPEMELVLWPFILKLIIPKKYTGAVATVCKCITELCRHKLSQTSPLYTEFNAS  564

Query  1721  TDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKA  1900
              +IP PE+LFARL+VLLHNPLAR  L T IL V+ YL  LFP+N++ F QDE  +PKMK+
Sbjct  565   NEIPNPEDLFARLLVLLHNPLARGQLATHILMVMCYLGQLFPRNLSLFLQDE--VPKMKS  622

Query  1901  YVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHS  2080
             Y+SD EDLKQD  YQE+WDDMII+FLAESLDV+ + +WV+ LG+ FARQY+LY + + HS
Sbjct  623   YISDPEDLKQDSTYQETWDDMIINFLAESLDVVNDSEWVISLGDAFARQYDLYATSDGHS  682

Query  2081  ALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDK  2260
             ALLHRCLG+LLQKV DR YVR KID M   +++++P NRLGLA+ +GLVAASHLDTVL+K
Sbjct  683   ALLHRCLGMLLQKVDDRIYVREKIDWMCTNSSMSIPINRLGLAQGIGLVAASHLDTVLEK  742

Query  2261  LKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALV  2440
             LK IL++ GQS LQR  S FS   K+EE DDT+AALALMYGYAA+YAP TVIEARI+ALV
Sbjct  743   LKNILNSAGQSALQRFLSIFSFGVKVEEVDDTYAALALMYGYAARYAPSTVIEARINALV  802

Query  2441  GTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRD  2620
             GTNML R LHV+HP AKQAVITAIDLLGQAVI A+E GISFPLKRRD LL+Y+LTLMGRD
Sbjct  803   GTNMLGRFLHVQHPTAKQAVITAIDLLGQAVITAAEMGISFPLKRRDQLLEYVLTLMGRD  862

Query  2621  EEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVIN  2800
             + +   D + ELLHTQSLALSACTTLVS+EP+L  ETRN +MKAT+GFF LP +PS+++ 
Sbjct  863   QNDDLVDFSTELLHTQSLALSACTTLVSIEPRLPMETRNRVMKATLGFFALPTEPSNIVE  922

Query  2801  PLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIK  2980
              LI NLI LL  IL+TSGEDGRSRAEQLLHILR +DP+VSSS E+QR+RGC+A +E+L+K
Sbjct  923   NLITNLIILLGAILLTSGEDGRSRAEQLLHILRQLDPYVSSSAEHQRRRGCVAVNEMLVK  982

Query  2981  FRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPRC  3160
             FR +C  G+  LG   + + +KQID AA R+LS+LPSAF LP+RD+LSLGERIM YLPRC
Sbjct  983   FRNLCSGGFGVLGSYPTFTLNKQIDQAAPRSLSSLPSAFVLPNRDSLSLGERIMAYLPRC  1042

Query  3161  IDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILRSDASI  3340
              DT+ EVRKV++QI+ LFFNI+ SLPK   S+  ID+E SY ALSSLED+V+I+R DASI
Sbjct  1043  FDTDAEVRKVAIQIIALFFNIALSLPKQKASASDIDLESSYSALSSLEDIVSIIRRDASI  1102

Query  3341  DPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNELN  3520
             D +EVF+RVVSSVC LL+KDELV  LH C+ A  DK+KQS++G+IQA++ F+  RG EL 
Sbjct  1103  DQTEVFHRVVSSVCILLSKDELVVLLHSCTLATSDKVKQSSDGSIQAIIMFIIRRGKELR  1162

Query  3521  EIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMVTKDI  3700
             E +V R +Q LL++ V +T+K  R+E L AI  +AENT   VVF EVL  AGRD+ TKDI
Sbjct  1163  EADVLRATQCLLSSAVSLTDKDSRREVLNAISCLAENTNHIVVFNEVLFVAGRDICTKDI  1222

Query  3701  HRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSVDGSIE  3880
              R+RGGW IQD F+AFSQH+VL+  FLE+++S++++ P +   DS KGE++  S   S +
Sbjct  1223  SRIRGGWAIQDVFYAFSQHMVLAILFLEYILSILHKEP-VATNDSEKGETASES---SAD  1278

Query  3881  DDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPLRALL  4060
             D + +A + AL AF RGGGK G++ VEQSY SVL+ L L LG+ HGLA  G  E LR+LL
Sbjct  1279  DCILQATMFALNAFLRGGGKMGKQAVEQSYPSVLSALILKLGSLHGLAELGRNELLRSLL  1338

Query  4061  NAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICLFLSKS  4240
              AFQ+FC+CVGD+EMGKILAR GEQ E EKWI+L+ E+A S S+KRPKEV   C  LSK+
Sbjct  1339  IAFQSFCDCVGDVEMGKILARDGEQTEKEKWIDLVQEVACSSSVKRPKEVLPTCNILSKA  1398

Query  4241  LDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQMP  4420
             L++  R +REAAAAALSE++R+S+    LL QMV  LC+HVSDDSPTVR LCLRGLVQ+P
Sbjct  1399  LNKNQRAEREAAAAALSEYIRHSEKEPILLDQMVLELCQHVSDDSPTVRSLCLRGLVQIP  1458

Query  4421  SIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSIRLRNL  4600
                + +Y  Q+LGV+LALL+D+ ESVQLTAV CLL VL  S  DA++P+L+NL +RLRNL
Sbjct  1459  ESCMPKYIQQVLGVVLALLEDTKESVQLTAVQCLLTVLNVSEQDAIDPILINLLVRLRNL  1518

Query  4601  QVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACRNT  4780
             QV +N K+R++AFAA+GALS+YG GS    F EQIHA  PR++LHLHDDDL VR ACRNT
Sbjct  1519  QVSMNTKMRSSAFAAYGALSAYGVGS--QQFLEQIHATLPRLILHLHDDDLSVRLACRNT  1576

Query  4781  LKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSAIIQAF  4960
              + +APL+E+D + +LLN   FSSD RSDYEDF+RDL RQL +    RVD+YL + IQAF
Sbjct  1577  FQLLAPLMEVDGLSSLLNKKYFSSDRRSDYEDFIRDLTRQLCRLSPARVDSYLESAIQAF  1636

Query  4961  DAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATCSAALG  5140
             DAPWPVI+ANAV L S MLS  D++   A Y+SQVF +LVG+ S S DA+VRA  S+ALG
Sbjct  1637  DAPWPVIKANAVCLVSCMLSFLDDQRFLAPYFSQVFAILVGRLSQSPDAVVRAAASSALG  1696

Query  5141  LLLKSPN  5161
             LL+K  N
Sbjct  1697  LLIKRSN  1703


 Score =   255 bits (651),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = +1

Query  106  EAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGNIAGLFQV  285
            EAVQV+V+SLAD+ P  R+A+++AL++I  +NP+LVLDCC TVSRGGRRRFGNIAG+F V
Sbjct  27   EAVQVLVTSLADECPVARDAALAALREIAPMNPMLVLDCCATVSRGGRRRFGNIAGVFLV  86

Query  286  ISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLPDLMME  465
            ++ A+R LD+ D D  F+ KLAKIATAE++S+KELNADWQRAAA +LV++GSH PDLMME
Sbjct  87   MASAVRTLDRSDADREFLRKLAKIATAEIVSSKELNADWQRAAASLLVAIGSHDPDLMME  146

Query  466  EIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIYRPIFANG  645
            E+FL+F+G  SALPAM+QILAD+AS++ALQFTPRLK VL RV+PILG+VR+  RP+FAN 
Sbjct  147  ELFLYFTGPTSALPAMLQILADFASAEALQFTPRLKDVLLRVLPILGSVRDAQRPVFANA  206

Query  646  L  648
             
Sbjct  207  F  207



>gb|EEE58322.1| hypothetical protein OsJ_09403 [Oryza sativa Japonica Group]
Length=1687

 Score =  1724 bits (4466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 923/1506 (61%), Positives = 1147/1506 (76%), Gaps = 45/1506 (3%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             A WQY  D       DTDV+SF+NS FELLL+VW  SRDLKVRLS+VEALG+MVGL+TR+
Sbjct  181   AAWQYIGDAPSELPFDTDVMSFMNSVFELLLKVWTGSRDLKVRLSSVEALGEMVGLVTRS  240

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstl  1003
             QLK+ALPR++PT+L+L +++Q+ AFVA+ SLH+LLNASLLS +GPPLLDFE         
Sbjct  241   QLKSALPRIIPTMLDLCRKDQEIAFVASHSLHNLLNASLLSESGPPLLDFE---------  291

Query  1004  llvCSNNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGSL  1183
                                 TYNE+QHCFL + S YPEDL +FLLNKC+ K+E    G+L
Sbjct  292   --------------------TYNEIQHCFLVISSAYPEDLCMFLLNKCKSKDEASIVGAL  331

Query  1184  CVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGEL  1363
               +KHLLPRL ESWH K+ +L+E VK L++E +LG+R ALAELIVVMASHCYL G   EL
Sbjct  332   GTIKHLLPRLLESWHTKQALLVEIVKSLLEEQSLGIRMALAELIVVMASHCYLSGHPAEL  391

Query  1364  FIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKGL  1543
              +E+LVRH A+ D      +   + +     Y  F  ++ E K      +ELR VCEKGL
Sbjct  392   AVEFLVRHSAITD------DDLNDPNTLKNEY--FQDKRFEMKISLSGLSELRAVCEKGL  443

Query  1544  LLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKART  1723
             LL+ +T+PEME VLWPF+LK+IIP+ YTGAVAT+C+CI+ELCR + S++N + +E  A  
Sbjct  444   LLLAITIPEMELVLWPFILKLIIPKKYTGAVATICKCITELCRHKLSQTNPLYTEFNASN  503

Query  1724  DIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKAY  1903
             +IP PE+LFARL+VLLHNPLAR  L T IL V+ YL  LFP+N++ F QDE  +PKMKAY
Sbjct  504   EIPNPEDLFARLLVLLHNPLARGQLATHILMVMCYLGQLFPRNLSLFLQDE--VPKMKAY  561

Query  1904  VSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHSA  2083
             + D EDLKQD  YQE+WDDMII+FLAESLDV+ + +WV+ LG+ FARQY+LY + + HSA
Sbjct  562   IGDPEDLKQDSTYQETWDDMIINFLAESLDVVNDSEWVISLGDAFARQYDLYATCDGHSA  621

Query  2084  LLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDKL  2263
             LLHRCLG+LLQKV DR YVR KID M   +++++P NRLGLA+ +GLVAASHLDTVL+KL
Sbjct  622   LLHRCLGMLLQKVDDRIYVREKIDWMCAHSSMSIPINRLGLAQGIGLVAASHLDTVLEKL  681

Query  2264  KGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALVG  2443
             K IL+N GQS LQR  S FS   K+E+ DDT+AALALMYGYAAKYAP TVIEARI+ALVG
Sbjct  682   KNILENAGQSALQRFLSLFSLGAKVEDVDDTYAALALMYGYAAKYAPSTVIEARINALVG  741

Query  2444  TNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRDE  2623
             TNML R LHV+HP AKQAVITAIDLLGQAVI A+E GISFPLKRRD LL+Y+LTLMGRD+
Sbjct  742   TNMLGRFLHVQHPTAKQAVITAIDLLGQAVITAAEMGISFPLKRRDQLLEYVLTLMGRDQ  801

Query  2624  EEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVINP  2803
              +   D + ELLHTQSLALSACTTLVS+EP+L  ETRN +MKAT+GFF LP +PS+++  
Sbjct  802   NDDLVDFSTELLHTQSLALSACTTLVSIEPRLPMETRNRVMKATLGFFALPTEPSNIVES  861

Query  2804  LIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIKF  2983
             LI NLI LL  IL+TSGEDGRSRAEQLLHILR +DP+VSSS E+QR+RGC A +E+L+KF
Sbjct  862   LITNLIILLGAILLTSGEDGRSRAEQLLHILRQLDPYVSSSAEHQRRRGCAAVNEVLVKF  921

Query  2984  RAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPRCI  3163
             R +C  G+  LG   + + +KQID AA R+LS+LPSAF LP+RD+LSLGERIM YLPRC 
Sbjct  922   RNLCSGGFGVLGSYPTFTLNKQIDQAAPRSLSSLPSAFVLPTRDSLSLGERIMAYLPRCA  981

Query  3164  DTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILRSDASID  3343
             DT+ EVRKV++QIL LFFNI+ SLPK   S   ID+E SY ALSSLED+V+I+R +ASID
Sbjct  982   DTDAEVRKVAIQILALFFNIALSLPKKKASVNDIDLESSYSALSSLEDIVSIIRREASID  1041

Query  3344  PSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNELNE  3523
              +EVF+RVVSS+C LL+KDELV  LH C+ A CDK+KQS++G+IQA++ F+  RG EL E
Sbjct  1042  QAEVFHRVVSSLCVLLSKDELVVLLHSCTLAACDKVKQSSDGSIQAIIMFIIRRGKELRE  1101

Query  3524  IEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMVTKDIH  3703
              +V RT+QSLL++ V +T K  R+E L AI  +AENT   VVF EVL  AGRD+ TKDI 
Sbjct  1102  ADVLRTTQSLLSSAVSLTNKESRREVLNAISCLAENTNHTVVFNEVLFVAGRDICTKDIA  1161

Query  3704  RLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSVDGSIED  3883
             R+RGGW IQD FHAFSQH VL+  FLE+++S++++ P +   DS KGE +  S   S +D
Sbjct  1162  RIRGGWAIQDVFHAFSQHKVLAILFLEYILSILHKEP-VATNDSEKGEITSES---SADD  1217

Query  3884  DVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPLRALLN  4063
              + +A + AL AF RGGGK G++ VEQSY SVL+ L L LG+ HGLA  G  E LR+LL 
Sbjct  1218  CILQATMFALNAFLRGGGKIGKQAVEQSYPSVLSALILKLGSLHGLAELGRNELLRSLLI  1277

Query  4064  AFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICLFLSKSL  4243
             AFQ+FC+CVGD+EMGKILAR GEQ E EKWI+L+ E+A S S+KRPKEV   C  LSK+L
Sbjct  1278  AFQSFCDCVGDIEMGKILARDGEQTEKEKWIDLVQEVACSSSVKRPKEVLPTCSILSKAL  1337

Query  4244  DRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQMPS  4423
             ++  R +REAAAAALSE++R+S+    LL QMV  LC+HVSDDSPTVR LCLRGLVQ+P 
Sbjct  1338  NKNQRAEREAAAAALSEYIRHSEKEPILLDQMVLELCQHVSDDSPTVRSLCLRGLVQIPE  1397

Query  4424  IHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSIRLRNLQ  4603
               + +Y  Q+LGVILALL+D+ ESVQLTAV CLL VL  S  DA++PVL+NL +RLRNLQ
Sbjct  1398  SCIPKYIQQVLGVILALLEDTKESVQLTAVQCLLTVLNVSEQDAIDPVLINLLVRLRNLQ  1457

Query  4604  VCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACRNTL  4783
             V +N K+R+NAFA +GALS+YG GS    F EQIHA  PR++LHLHDDDL VR ACRNT 
Sbjct  1458  VSMNTKMRSNAFAVYGALSAYGVGS--QQFLEQIHATLPRLILHLHDDDLSVRLACRNTF  1515

Query  4784  KCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSAIIQAFD  4963
             + +APL+E+D + +LL+   F+SD RSDYEDF+RDL RQL +    RVD+Y  + IQAFD
Sbjct  1516  QLLAPLMEVDGLSSLLSKKYFTSDRRSDYEDFIRDLTRQLCRLSPARVDSYFESAIQAFD  1575

Query  4964  APWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATCSAALGL  5143
             APWPVI+ANAV L S MLS  D++   A Y+SQVF +LVG+ S S DA+VRA  S+ALGL
Sbjct  1576  APWPVIKANAVCLVSCMLSFLDDQRFLAPYFSQVFAILVGRLSQSPDAVVRAASSSALGL  1635

Query  5144  LLKSPN  5161
             L+K  N
Sbjct  1636  LIKRSN  1641


 Score =   206 bits (523),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 100/150 (67%), Positives = 132/150 (88%), Gaps = 0/150 (0%)
 Frame = +1

Query  106  EAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGNIAGLFQV  285
            EAVQV+V+SLAD+SP  R+A+++AL++I  +NPLLVLDCC TVSRGGRRRFGNIAG+F V
Sbjct  27   EAVQVLVTSLADESPVARDAALAALREIAPMNPLLVLDCCATVSRGGRRRFGNIAGVFLV  86

Query  286  ISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLPDLMME  465
            ++ A++ALD+ D +  F+ KLAKIATAE++S+KELN DWQRAAA +LV++GSH PDLMME
Sbjct  87   MASAVKALDRSDAEREFLRKLAKIATAEIVSSKELNVDWQRAAASLLVAIGSHDPDLMME  146

Query  466  EIFLHFSGSNSALPAMVQILADYASSDALQ  555
            E+FL+F+G  SALPAM+QILAD+AS++A +
Sbjct  147  ELFLYFAGPTSALPAMLQILADFASAEAFR  176



>gb|EEC74518.1| hypothetical protein OsI_10014 [Oryza sativa Indica Group]
Length=1650

 Score =  1724 bits (4465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 922/1507 (61%), Positives = 1148/1507 (76%), Gaps = 45/1507 (3%)
 Frame = +2

Query  641   MACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITR  820
             +A WQY  D       DTDV+SF+NS FELLL+VW  SRDLKVRLS+VEALG+MVGL+TR
Sbjct  143   LAAWQYIGDAPSELPFDTDVMSFMNSVFELLLKVWTGSRDLKVRLSSVEALGEMVGLVTR  202

Query  821   TQLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlst  1000
             +QLK+ALPR++PT+L+L +++Q+ AFVA+ SLH+LLNASLLS +GPPLLDFE        
Sbjct  203   SQLKSALPRIIPTMLDLCRKDQEIAFVASHSLHNLLNASLLSESGPPLLDFE--------  254

Query  1001  lllvCSNNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGS  1180
                                  TYNE+QHCFL + S YPEDL +FLLNKC+ K+E    G+
Sbjct  255   ---------------------TYNEIQHCFLVISSAYPEDLCMFLLNKCKSKDEASIVGA  293

Query  1181  LCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGE  1360
             L  +KHLLPRL ESWH K+ +L+E VK L++E +LG+R ALAELIVVMASHCYL G   E
Sbjct  294   LGTIKHLLPRLLESWHTKQALLVEIVKSLLEEQSLGIRMALAELIVVMASHCYLSGHPAE  353

Query  1361  LFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKG  1540
             L +E+LVRH A+ D      +   + +     Y  F  ++ E K      +ELR VCEKG
Sbjct  354   LAVEFLVRHSAITD------DDLNDPNTLKNEY--FQDKRFEMKISLSGLSELRAVCEKG  405

Query  1541  LLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKAR  1720
             LLL+ +T+PEME VLWPF+LK+IIP+ YTGAVAT+C+CI+ELCR + S++N + +E  A 
Sbjct  406   LLLLAITIPEMELVLWPFILKLIIPKKYTGAVATICKCITELCRHKLSQTNPLYTEFNAS  465

Query  1721  TDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKA  1900
              +IP PE+LFARL+VLLHNPLAR  L T IL V+ YL  LFP+N++ F QDE  +PKMKA
Sbjct  466   NEIPNPEDLFARLLVLLHNPLARGQLATHILMVMCYLGQLFPRNLSLFLQDE--VPKMKA  523

Query  1901  YVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHS  2080
             Y+ D EDLKQD  YQE+WDDMII+FLAESLDV+ + +WV+ LG+ FARQY+LY + + HS
Sbjct  524   YIGDPEDLKQDSTYQETWDDMIINFLAESLDVVNDSEWVISLGDAFARQYDLYATCDGHS  583

Query  2081  ALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDK  2260
             ALLHRCLG+LLQKV DR YVR KID M   +++++P NRLGLA+ +GLVAASHLDTVL+K
Sbjct  584   ALLHRCLGMLLQKVDDRIYVREKIDWMCAHSSMSIPINRLGLAQGIGLVAASHLDTVLEK  643

Query  2261  LKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALV  2440
             LK IL+N GQS LQR  S FS   K+E+ DDT+AALALMYGYAA+YAP TVIEARI+ALV
Sbjct  644   LKNILENAGQSALQRFLSLFSLGAKVEDVDDTYAALALMYGYAARYAPSTVIEARINALV  703

Query  2441  GTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRD  2620
             GTNML R LHV+HP AKQAVITAIDLLGQAVI A+E GISFPLKRRD LL+Y+LTLMGRD
Sbjct  704   GTNMLGRFLHVQHPTAKQAVITAIDLLGQAVITAAEMGISFPLKRRDQLLEYVLTLMGRD  763

Query  2621  EEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVIN  2800
             + +   D + ELLHTQSLALSACTTLVS+EP+L  ETRN +MKAT+GFF LP +PS+++ 
Sbjct  764   QNDDLVDFSTELLHTQSLALSACTTLVSIEPRLPMETRNRVMKATLGFFALPTEPSNIVE  823

Query  2801  PLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIK  2980
              LI NLI LL  IL+TSGEDGRSRAEQLLHILR +DP+VSSS E+QR+RGC A +E+L+K
Sbjct  824   SLITNLIILLGAILLTSGEDGRSRAEQLLHILRQLDPYVSSSAEHQRRRGCAAVNEVLVK  883

Query  2981  FRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPRC  3160
             FR +C  G+  LG   + + +KQID AA R+LS+LPSAF LP+RD+LSLGERIM YLPRC
Sbjct  884   FRNLCSGGFGVLGSYTTFTLNKQIDQAAPRSLSSLPSAFVLPTRDSLSLGERIMAYLPRC  943

Query  3161  IDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILRSDASI  3340
              DT+ EVRKV++QIL LFFNI+ SLPK   S   ID+E SY ALSSLED+V+I+R +ASI
Sbjct  944   ADTDAEVRKVAIQILALFFNIALSLPKKKASVNDIDLESSYSALSSLEDIVSIIRREASI  1003

Query  3341  DPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNELN  3520
             D +EVF+RVVSS+C LL+KDELV  L  C+ A CDK+KQS++G+IQA++ F+  RG EL 
Sbjct  1004  DQAEVFHRVVSSLCVLLSKDELVVLLRSCTLAACDKVKQSSDGSIQAIIMFIIRRGKELR  1063

Query  3521  EIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMVTKDI  3700
             E +V RT+QSLL++ V +T K  R+E L AI  +AENT   VVF EVL  AGRD+ TKDI
Sbjct  1064  EADVLRTTQSLLSSAVSLTNKESRREVLNAISCLAENTNHTVVFNEVLFVAGRDICTKDI  1123

Query  3701  HRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSVDGSIE  3880
              R+RGGW IQD FHAFSQH VL+  FLE+++S++++ P +   DS KGE +  S   S +
Sbjct  1124  ARIRGGWAIQDVFHAFSQHKVLAILFLEYILSILHKEP-VATNDSEKGEITSES---SAD  1179

Query  3881  DDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPLRALL  4060
             D + +A + AL AF RGGGK G++ VEQSY SVL+ L L LG+ HGLA  G  E LR+LL
Sbjct  1180  DCILQATMFALNAFLRGGGKIGKQAVEQSYPSVLSALILKLGSLHGLAELGRNELLRSLL  1239

Query  4061  NAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICLFLSKS  4240
              AFQ+FC+CVGD+EMGKILAR GEQ E EKWI+L+ E+A S S+KRPKEV   C  LSK+
Sbjct  1240  IAFQSFCDCVGDIEMGKILARDGEQTEKEKWIDLVQEVACSSSVKRPKEVLPTCSILSKA  1299

Query  4241  LDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQMP  4420
             L++  R +REAAAAALSE++R+S+    LL QMV  LC+HVSDDSPTVR LCLRGLVQ+P
Sbjct  1300  LNKNQRAEREAAAAALSEYIRHSEKEPILLDQMVLELCQHVSDDSPTVRSLCLRGLVQIP  1359

Query  4421  SIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSIRLRNL  4600
                + +Y  Q+LGVILALL+D+ ESVQLTAV CLL VL  S  DA++PVL+NL +RLRNL
Sbjct  1360  ESCIPKYIQQVLGVILALLEDTKESVQLTAVQCLLTVLNVSEQDAIDPVLINLLVRLRNL  1419

Query  4601  QVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACRNT  4780
             QV +N K+R+NAFAA+GALS+YG GS    F EQIHA  PR++LHLHDDDL VR ACRNT
Sbjct  1420  QVSMNTKMRSNAFAAYGALSAYGVGS--QQFLEQIHATLPRLILHLHDDDLSVRLACRNT  1477

Query  4781  LKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSAIIQAF  4960
              + +APL+E+D + +LL+   F+SD RSDYEDF+RDL RQL +    RVD+Y  + IQAF
Sbjct  1478  FQLLAPLMEVDGLSSLLSKKYFTSDRRSDYEDFIRDLTRQLCRLSPARVDSYFESAIQAF  1537

Query  4961  DAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATCSAALG  5140
             DAPWPVI+ANAV L S MLS  D++   A Y+SQVF +LVG+ S S DA+VRA  S+ALG
Sbjct  1538  DAPWPVIKANAVCLVSCMLSFLDDQRFLAPYFSQVFAILVGRLSQSPDAVVRAASSSALG  1597

Query  5141  LLLKSPN  5161
             LL+K  N
Sbjct  1598  LLIKRSN  1604


 Score =   158 bits (400),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = +1

Query  106  EAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGNIAGLFQV  285
            EAVQV+V+SLAD+SP  R+A+++AL++I  +NPLLVLDCC TVSRGGRRRFGNIAG+F V
Sbjct  27   EAVQVLVTSLADESPVARDAALAALREIAPMNPLLVLDCCATVSRGGRRRFGNIAGVFLV  86

Query  286  ISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLPDL  456
            ++ A++ALD+ D +  F+ KLAKIATAE++S+KELN DWQRAAA +LV++GSH PDL
Sbjct  87   MASAVKALDRSDAEREFLRKLAKIATAEIVSSKELNVDWQRAAASLLVAIGSHDPDL  143



>ref|XP_010229217.1| PREDICTED: LOW QUALITY PROTEIN: protein SHOOT GRAVITROPISM 6 
[Brachypodium distachyon]
Length=1740

 Score =  1711 bits (4431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 946/1539 (61%), Positives = 1183/1539 (77%), Gaps = 23/1539 (1%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             A W Y  D S     DTDV+SF+NS FELLL+VW  SRDLKVRLS+VEALG+MVGL+TR+
Sbjct  205   AAWVYIGDAS-GLPFDTDVMSFMNSVFELLLKVWTSSRDLKVRLSSVEALGEMVGLVTRS  263

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstl  1003
             QLK+ALPR++PT+L+L +++Q+ AF+A  SLH+LLNASL+S +GPPLL+FE+LTV L TL
Sbjct  264   QLKSALPRIIPTMLDLCRKDQEIAFIAAHSLHNLLNASLMSESGPPLLEFEELTVTLVTL  323

Query  1004  llvCS-NNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGS  1180
             L + S NN K E S    GLKTYNE+QHCFL +G  YPEDL +FLL+KC+ K+E    G+
Sbjct  324   LPLASVNNSKDERSYVSKGLKTYNELQHCFLVIGLAYPEDLCMFLLSKCKSKDEASIVGA  383

Query  1181  LCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGE  1360
             L  +KHLLPR +ESWH K+ + +E VK  ++E +LG+R ALAELIVV+ASHCYL G   E
Sbjct  384   LGTIKHLLPRFSESWHTKQ-LYVEIVKSXLEEQSLGIRMALAELIVVLASHCYLSGHPAE  442

Query  1361  LFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKG  1540
             L +E+LVRH A+ D +  +L + +       N Y F  ++ E KA     +ELR VCEKG
Sbjct  443   LAVEFLVRHSAITDDDLNDLNTLK-------NEY-FQDKRFEMKASLAGLSELRAVCEKG  494

Query  1541  LLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKAR  1720
             LLL+ +T+PEME VLWPF+LK+IIP+ YTGAV+TVC+CI+ELCR + S++N + +E    
Sbjct  495   LLLLAITIPEMELVLWPFILKLIIPKKYTGAVSTVCKCITELCRHKLSQTNPLYTEFNTS  554

Query  1721  TDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKA  1900
              ++P PE+LFARL+VLLHNPLAR  L TQIL+VL YL PLFPKN++ FWQDE  IPKMKA
Sbjct  555   NEMPSPEDLFARLLVLLHNPLARGQLATQILTVLCYLGPLFPKNLSLFWQDE--IPKMKA  612

Query  1901  YVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHS  2080
             Y+SD EDLKQD  YQE WDDMII+FLAESLDV+ +  W + LG+ FA QY+LY + + HS
Sbjct  613   YISDPEDLKQDSTYQEIWDDMIINFLAESLDVMNDNVWAISLGDAFATQYDLYATSDGHS  672

Query  2081  ALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDK  2260
             ALLHRCLG+LLQKV DR YVR KID M R +++++P NRLGLA+ +GLVAASHLDTVL+K
Sbjct  673   ALLHRCLGMLLQKVDDRIYVREKIDWMCRHSSMSIPVNRLGLAQGIGLVAASHLDTVLEK  732

Query  2261  LKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALV  2440
             LK ILDN GQS LQR  SFFS R K+E+ DDT+AALALMYGYAA+YAP TVIEARI+ALV
Sbjct  733   LKNILDNAGQSALQRFLSFFSFREKVEDVDDTYAALALMYGYAARYAPSTVIEARINALV  792

Query  2441  GTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRD  2620
             GT+ML R L+V+HP AKQAVITAIDLLG+AVI A+E GISFPLKRRD LL+Y+LTLMGRD
Sbjct  793   GTDMLGRFLYVQHPTAKQAVITAIDLLGRAVISAAEMGISFPLKRRDQLLEYVLTLMGRD  852

Query  2621  EEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVIN  2800
             + +   D +IELL TQS+ALSACTTLVS+EP+L  ETRN +MKAT+GFF LP +PS+++ 
Sbjct  853   QSDDLVDFSIELLQTQSVALSACTTLVSIEPRLPMETRNRVMKATLGFFALPTEPSNIVE  912

Query  2801  PLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIK  2980
              LI NLI LL  IL+TSGEDGRSRAEQLLHILR +DP+VSSS E+QR+RGC+A HE+LIK
Sbjct  913   SLITNLIILLGAILLTSGEDGRSRAEQLLHILRQLDPYVSSSSEHQRRRGCVAVHEVLIK  972

Query  2981  FRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPRC  3160
             FR +C  G+ ALG   + +  KQID   +R+LS+LPSAF LP RD+LSLGERIM YLPRC
Sbjct  973   FRNLCSGGFGALGSYPTLTL-KQIDQGGSRSLSSLPSAFVLPHRDSLSLGERIMAYLPRC  1031

Query  3161  IDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILRSDASI  3340
              DT+ EVRKV++QI+ LFFNIS SLPK   S+  ID+E SY ALSSLED+V+I+R  AS+
Sbjct  1032  ADTDDEVRKVAIQIIALFFNISLSLPKQKASANDIDLESSYGALSSLEDIVSIVRRKASV  1091

Query  3341  DPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNELN  3520
             D  E+F+ VVSSVC LL+KDELV  LH C+ A CDK+KQSA+G+IQA++ F+  R  +L 
Sbjct  1092  DQIEIFHTVVSSVCILLSKDELVVLLHSCTLATCDKVKQSADGSIQAIIIFIIRRCKDLR  1151

Query  3521  EIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMVTKDI  3700
             + +V RT+QSLL++ V +T+K+ RQE L AI  +AENT   VVF EVL  AGRD+ TKDI
Sbjct  1152  DADVLRTTQSLLSSAVAITDKHSRQEVLNAISCLAENTNHIVVFDEVLFVAGRDICTKDI  1211

Query  3701  HRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSVDGSIE  3880
              R+RGGW IQD F+AFSQH VL+  FLE+++S++++ P +   DS KGE +  S   S  
Sbjct  1212  TRIRGGWAIQDVFYAFSQHKVLAFLFLEYILSILHKEP-VATNDSEKGEVNSES---SAN  1267

Query  3881  DDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPLRALL  4060
             D + +A + AL AF RGGGK G++ VEQSY SVL+ L L LG  HGLA  G  E LR LL
Sbjct  1268  DCILQATMFALNAFLRGGGKIGKQAVEQSYPSVLSALILKLGGLHGLAELGRNELLRLLL  1327

Query  4061  NAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICLFLSKS  4240
              AF++FC+CVGD+EMGKILAR GEQ E EKWI+L+ E+A S S+KRPKEV   C+ LSKS
Sbjct  1328  IAFRSFCDCVGDVEMGKILARDGEQTEKEKWIDLVQEVACSSSVKRPKEVLPTCVILSKS  1387

Query  4241  LDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQMP  4420
             L+R  R +REAAAAALSEF+R+S+    LL QMVE LC+HVSDDSPTVR LCLRGLVQ+P
Sbjct  1388  LNRNQRAEREAAAAALSEFIRHSEKEPTLLEQMVEELCQHVSDDSPTVRSLCLRGLVQIP  1447

Query  4421  SIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSIRLRNL  4600
               H+L+Y  Q+LGVILALL+D +ESVQLTAV CLL VL  S  DAV+P+L++L +RLRNL
Sbjct  1448  ESHMLKYIQQVLGVILALLEDINESVQLTAVQCLLTVLNVSEQDAVDPILVSLLVRLRNL  1507

Query  4601  QVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACRNT  4780
             Q+ +N K+R+NAFAA+GALS+YG GS   +F EQIHA  PR++LHLHDDDL VR ACRNT
Sbjct  1508  QISMNTKMRSNAFAAYGALSAYGVGSQHHAFLEQIHATLPRLILHLHDDDLSVRLACRNT  1567

Query  4781  LKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSAIIQAF  4960
              + +APL+EID +  LLN   FSSD RSDYEDF+RDL +QL +    RVD+YL + IQAF
Sbjct  1568  FQLLAPLMEIDGLSMLLNKQYFSSDRRSDYEDFIRDLTKQLCRLSPARVDSYLESAIQAF  1627

Query  4961  DAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATCSAALG  5140
             DAPWPVIQANAV L S MLS  D++   A Y+SQVF +LVG+ S S +A+VRA  S+ALG
Sbjct  1628  DAPWPVIQANAVCLVSCMLSFLDDQRFLAPYFSQVFAMLVGRMSQSPEAVVRAAASSALG  1687

Query  5141  LLLKSPN-----SSSWRDARLNK*TPQGSVNYKNQREMN  5242
             LL+K  N     SS +  A  ++ +  G  + K   E++
Sbjct  1688  LLIKRSNMLKSLSSRFDRADSSQSSQHGDPHAKESSELH  1726


 Score =   260 bits (664),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 122/181 (67%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = +1

Query  106  EAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGNIAGLFQV  285
            EAVQV+V+SLADDSP  R+++++AL++I  LNPLLVLDCC TVSRGG RRFGN+AG+F V
Sbjct  19   EAVQVLVASLADDSPRARDSALAALREIAPLNPLLVLDCCATVSRGGHRRFGNMAGVFLV  78

Query  286  ISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLPDLMME  465
            ++ A+RALD+ D +  F+ K+AKIATAE++S+K+ NA WQRAAA +LV++GSH PDLMME
Sbjct  79   MASAVRALDRWDAERGFLRKIAKIATAEIVSSKDFNAIWQRAAATLLVAIGSHDPDLMME  138

Query  466  EIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIYRPIFANG  645
            EIFL+FSG  SALPAM+QILAD+AS++ALQFTPRLK VL RV+PILG+VR+  RP+FAN 
Sbjct  139  EIFLYFSGPTSALPAMLQILADFASAEALQFTPRLKDVLLRVLPILGSVRDGQRPVFANA  198

Query  646  L  648
             
Sbjct  199  F  199



>ref|XP_006381368.1| hypothetical protein POPTR_0006s12240g [Populus trichocarpa]
 gb|ERP59165.1| hypothetical protein POPTR_0006s12240g [Populus trichocarpa]
Length=1163

 Score =  1709 bits (4425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 862/1165 (74%), Positives = 999/1165 (86%), Gaps = 4/1165 (0%)
 Frame = +2

Query  1697  MLSECKARTDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDE  1876
             M+SECKAR D+P PEELFARL+VLLH+PL+ E L TQIL+VL YLAPLFPKNIN FWQDE
Sbjct  1     MVSECKARADVPSPEELFARLLVLLHDPLSMEQLATQILTVLCYLAPLFPKNINLFWQDE  60

Query  1877  L*IPKMKAYVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYEL  2056
               IPKMKAYVSDT+DLK DP YQE+WDDMII+FLAESLDVIQ+ +WV+ LGN F  QYEL
Sbjct  61    --IPKMKAYVSDTDDLKLDPSYQETWDDMIINFLAESLDVIQDTNWVISLGNAFTHQYEL  118

Query  2057  YKSDNEHSALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAAS  2236
             Y SD+EHSALLHRCLG+LLQKV DRAYVR KID MY+QA+IA P NRLGLAKAMGLVAAS
Sbjct  119   YTSDDEHSALLHRCLGMLLQKVDDRAYVRNKIDWMYKQASIANPANRLGLAKAMGLVAAS  178

Query  2237  HLDTVLDKLKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVI  2416
             HLDTVL+KLK ILDNVGQSI QR+ S FSD  + EESDD HAALALMYGYAA+YAP TVI
Sbjct  179   HLDTVLEKLKVILDNVGQSIFQRLLSLFSDSYRTEESDDIHAALALMYGYAARYAPSTVI  238

Query  2417  EARIDALVGTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDY  2596
             EARIDAL+GTNMLSRLLHVRHP AKQAVITAIDLLG+AVI A+ESG SFPLK+RD +LDY
Sbjct  239   EARIDALLGTNMLSRLLHVRHPTAKQAVITAIDLLGRAVINAAESGASFPLKKRDQMLDY  298

Query  2597  ILTLMGRDEEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLP  2776
             ILTLMGRD++ GF DS++ELL TQ+LALSACTTLVSVEPKLT ETRN IMKAT+GFF LP
Sbjct  299   ILTLMGRDDD-GFVDSSLELLRTQALALSACTTLVSVEPKLTIETRNYIMKATLGFFALP  357

Query  2777  NDPSDVINPLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCL  2956
             N+P DV+NPLI+NLITLLC IL+TSGEDGRSRAEQLLHI+R+ D +VSSS E+QRKRGCL
Sbjct  358   NEPVDVVNPLIENLITLLCAILLTSGEDGRSRAEQLLHIMRHTDQYVSSSEEHQRKRGCL  417

Query  2957  AAHELLIKFRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGER  3136
             A +E+L+KFR +C+ G+CALGC GSC+H KQ D   +  +SNLPSAF LPSR+AL LGER
Sbjct  418   AVYEMLLKFRMLCITGHCALGCHGSCTHRKQTDRTLHSTISNLPSAFVLPSREALCLGER  477

Query  3137  IMVYLPRCIDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVA  3316
             ++ YLPRC DTN EVRKVS QIL+  F+++ SLPKP   SL +DIEL Y ALSSLEDV+A
Sbjct  478   VIKYLPRCADTNSEVRKVSAQILDQLFSLALSLPKPSGFSLNVDIELPYSALSSLEDVIA  537

Query  3317  ILRSDASIDPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFV  3496
             ILRSDASIDPSEVFNR+VSS+C LL KDELVA L GCS AICDKIK SAEGAIQA++EFV
Sbjct  538   ILRSDASIDPSEVFNRIVSSICLLLTKDELVATLQGCSAAICDKIKPSAEGAIQAIIEFV  597

Query  3497  TNRGNELNEIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAG  3676
               RG EL+E +VSRT+QSLL+AVVHVTEK+LR ETLGAI S+AE+T+S +VF EVLA AG
Sbjct  598   MKRGKELSETDVSRTTQSLLSAVVHVTEKHLRLETLGAIASLAESTSSNIVFDEVLATAG  657

Query  3677  RDMVTKDIHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSR  3856
             +D+VTKDI RLRGGWP+QDAF+AFSQH VLS  FLEH+IS +NQ+P +K  D  KG++S 
Sbjct  658   KDVVTKDISRLRGGWPMQDAFYAFSQHAVLSFQFLEHLISFLNQTPVVK-SDLEKGDNSS  716

Query  3857  NSVDGSIEDDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGD  4036
             +  DG IEDD+ +AA++ALTAFFRGGGK G+K VEQSYASV+  LTL  G+CHGLAS G 
Sbjct  717   HLADGQIEDDILQAAMIALTAFFRGGGKVGKKAVEQSYASVVVALTLQFGSCHGLASSGQ  776

Query  4037  QEPLRALLNAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPT  4216
              EPLRALL AFQAFCECVGDLEMGKILAR GEQNE E+WINLIGELAGSISIKRPKEV T
Sbjct  777   HEPLRALLTAFQAFCECVGDLEMGKILARDGEQNEKERWINLIGELAGSISIKRPKEVRT  836

Query  4217  ICLFLSKSLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLC  4396
             IC+ L++SL+R  + QREAAAAALS F+ YS GF  LL QMVEALCRHVSD+SPTVRRLC
Sbjct  837   ICVILTESLNRRQKFQREAAAAALSVFVPYSGGFDSLLEQMVEALCRHVSDESPTVRRLC  896

Query  4397  LRGLVQMPSIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLN  4576
             LRGLVQ+PS+H+ Q+T QILG+I+ALLDD DESVQLTAVSCLL++LESS  DAVEP+LLN
Sbjct  897   LRGLVQIPSLHIYQHTIQILGIIVALLDDLDESVQLTAVSCLLMILESSPDDAVEPILLN  956

Query  4577  LSIRLRNLQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLG  4756
             LS+RLRNLQ+ ++ K+RA+AFAAFGALS YG G+  + F EQIHAA PR+VLHLHDDDL 
Sbjct  957   LSVRLRNLQISMDVKMRADAFAAFGALSKYGVGAQREIFLEQIHAAIPRLVLHLHDDDLS  1016

Query  4757  VRQACRNTLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTY  4936
             VRQACRNTLK +APL+E++   AL N+H F+SDHRSDY+DF+RDL +Q  Q+L  RVDTY
Sbjct  1017  VRQACRNTLKRLAPLMEMEESTALFNSHYFTSDHRSDYQDFVRDLTKQFIQHLPSRVDTY  1076

Query  4937  LSAIIQAFDAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVR  5116
             +++ IQAFDAPWP+IQANA+YL S ++SLSD++ I ALY +QVFG L+GK S S DAIVR
Sbjct  1077  MASTIQAFDAPWPIIQANAIYLVSCLVSLSDDQRILALYQTQVFGTLMGKMSRSPDAIVR  1136

Query  5117  ATCSAALGLLLKSPNSSSWRDARLN  5191
             A CS+ALGLLLKS NS  WR ARL+
Sbjct  1137  AACSSALGLLLKSTNSLVWRTARLD  1161



>ref|XP_007027499.1| ARM repeat superfamily protein isoform 3 [Theobroma cacao]
 gb|EOY08001.1| ARM repeat superfamily protein isoform 3 [Theobroma cacao]
Length=1167

 Score =  1706 bits (4418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 866/1214 (71%), Positives = 996/1214 (82%), Gaps = 48/1214 (4%)
 Frame = +2

Query  1322  MASHCYLVGSSGELFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGA  1501
             MASHCYLVG   ELF+EYLV HCA+ + +  +LESS                  + K G+
Sbjct  1     MASHCYLVGPYAELFVEYLVCHCALSEHDRHDLESS------------------QVKIGS  42

Query  1502  VTTTELRGVCEKGLLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRS  1681
             V  TELR +CEKGLLL+T+T+PEMEH+LWPFLLKMIIP+ YTGAVATVCRCI+ELCR RS
Sbjct  43    VCPTELRAICEKGLLLLTITIPEMEHILWPFLLKMIIPQAYTGAVATVCRCIAELCRHRS  102

Query  1682  SESNAMLSECKARTDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINS  1861
             S +N MLS+CKAR+DIP PEELFARLVVLLHNPLARE L TQIL+VL YLAPLFP+NIN 
Sbjct  103   SYNNNMLSDCKARSDIPNPEELFARLVVLLHNPLAREQLATQILTVLCYLAPLFPRNINL  162

Query  1862  FWQDEL*IPKMKAYVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFA  2041
             FWQDE  IPKMKAYVSD EDL+ DP YQE+WDDMII+FLAESLDVIQ+ DWV+ LGN F 
Sbjct  163   FWQDE--IPKMKAYVSDPEDLELDPSYQETWDDMIINFLAESLDVIQDTDWVISLGNAFT  220

Query  2042  RQYELYKSDNEHSALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMG  2221
             +QY LY  D+EHSALLHR LGILLQKV+DR YVR KID MY+QANIA+PTNRLGLAKAMG
Sbjct  221   KQYSLYAPDDEHSALLHRGLGILLQKVNDRGYVRGKIDWMYKQANIAIPTNRLGLAKAMG  280

Query  2222  LVAASHLDTVLDKLKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYA  2401
             LVAASHLD VLDKLK ILDNVGQSI QR  +FFS+  + E+SDD HAALALMYGYAA+YA
Sbjct  281   LVAASHLDAVLDKLKDILDNVGQSIFQRFLAFFSESYRTEDSDDVHAALALMYGYAARYA  340

Query  2402  PPTVIEARIDALVGTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRD  2581
             P  VIEARIDALVGTNMLSRLLHV HP AKQAVITAIDLLG+AVI A+E+G  FPLKRRD
Sbjct  341   PSMVIEARIDALVGTNMLSRLLHVHHPTAKQAVITAIDLLGRAVINAAENGAPFPLKRRD  400

Query  2582  LLLDYILTLMGRDEEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIG  2761
              LLDYILTLMGRDE +GF+DS++ELLHTQ+LAL+ACTTLVSVEPKLT ETRN +MKAT+G
Sbjct  401   QLLDYILTLMGRDETDGFADSSLELLHTQALALNACTTLVSVEPKLTIETRNHVMKATLG  460

Query  2762  FFGLPNDPSDVINPLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQR  2941
             FF LPNDP DVINPLIDNLITLLC IL+TSGEDGRSRAEQLLHILR ID +VSSS+EYQR
Sbjct  461   FFALPNDPIDVINPLIDNLITLLCAILLTSGEDGRSRAEQLLHILRQIDQYVSSSVEYQR  520

Query  2942  KRGCLAAHELLIKFRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDAL  3121
             +RGCLA +E+L+KFR +CV+GYCALGC+GSC+HSKQID   + N SNLPSAF LPSR+AL
Sbjct  521   RRGCLAVYEMLVKFRMLCVSGYCALGCRGSCTHSKQIDRTLHGNFSNLPSAFVLPSREAL  580

Query  3122  SLGERIMVYLPRCIDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSL  3301
             SLG+R+++YLPRC DTN EVRK+S QIL+  F+IS SLP+P+ SS+G DIELSY ALSSL
Sbjct  581   SLGDRVIMYLPRCADTNSEVRKISAQILDQLFSISLSLPRPLGSSVGGDIELSYGALSSL  640

Query  3302  EDVVAILRSDASIDPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQA  3481
             EDV+AILRSDASIDPSEVFNR+V+SVC LL KDELV  LHGC  AICDKIKQSAEGAIQA
Sbjct  641   EDVIAILRSDASIDPSEVFNRIVASVCVLLTKDELVGTLHGCMPAICDKIKQSAEGAIQA  700

Query  3482  VVEFVTNRGNELNEIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEV  3661
             V+EFVT RG EL+E +VSRT+QSLL+AVVHVTEK LR E LGAI S++ENT +K+VF EV
Sbjct  701   VIEFVTKRGIELSETDVSRTTQSLLSAVVHVTEKQLRLEVLGAISSLSENTNAKIVFNEV  760

Query  3662  LAAAGRDMVTKDIHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGK  3841
             LAAAGRD+VTKDI RLRGGWP+QDAFHAFSQH+VLS  FLEH+ISV+NQ+   K  D GK
Sbjct  761   LAAAGRDIVTKDISRLRGGWPMQDAFHAFSQHIVLSVLFLEHLISVLNQTHFTK-SDPGK  819

Query  3842  GESSRNSVDGSIEDDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchgl  4021
             GE+S    +  +ED++ +AA+ ALTAFF+GGGK G++ VEQSY+SVLA L L  G+CHGL
Sbjct  820   GENSSLLSETQLEDEILQAAIFALTAFFKGGGKVGKRAVEQSYSSVLAALILQFGSCHGL  879

Query  4022  aSYGDQEPLRALLNAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRP  4201
             AS G  EPLRALL +FQAFCECVGDLEMGK LAR GEQNE EKWINLIG+LAG ISIKRP
Sbjct  880   ASSGQHEPLRALLTSFQAFCECVGDLEMGKFLARDGEQNEKEKWINLIGDLAGCISIKRP  939

Query  4202  KEVPTICLFLSKSLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPT  4381
             KEV  IC   +KSL+R  + QREAAAAALSEF+ YS GF  LL +MVE LCRHVSD+SP 
Sbjct  940   KEVQNICKIFTKSLNRQEKTQREAAAAALSEFVCYSSGFSSLLEEMVEVLCRHVSDESPA  999

Query  4382  VRRLCLRGLVQMPSIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVE  4561
             VR LCLRGLV++PS+H+ QYT Q+LGVIL+LLDD DESVQLTAVSCL             
Sbjct  1000  VRCLCLRGLVKIPSVHIYQYTNQVLGVILSLLDDLDESVQLTAVSCL-------------  1046

Query  4562  PVLLNLSIRLRNLQVCLNAKIRANAFAAFGALSSYGAGSILDSFRE-QIHAAFPRMVLHL  4738
                         L + +N K+RA+AFAAFGALS+YG G+  D+F E QIHA  PR++LHL
Sbjct  1047  ------------LTISMNVKMRADAFAAFGALSNYGVGAHKDAFIEQQIHATLPRLILHL  1094

Query  4739  HDDDLGVRQACRNTLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLG  4918
             HDDDL VR ACRNTLK  A L+EI+ + AL N+H  +SDHR DYEDF+RD  RQ  Q+L 
Sbjct  1095  HDDDLAVRHACRNTLKRFATLMEIEGLLALFNSHSINSDHR-DYEDFVRDFTRQFVQHLS  1153

Query  4919  PRVDTYLSAIIQAF  4960
              RVDTY+ + IQ F
Sbjct  1154  SRVDTYMVSTIQGF  1167



>ref|XP_009341086.1| PREDICTED: protein SHOOT GRAVITROPISM 6 [Pyrus x bretschneideri]
Length=1677

 Score =  1690 bits (4376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 884/1236 (72%), Positives = 1024/1236 (83%), Gaps = 37/1236 (3%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             A WQYS+D    + LD D++SFLNS FELLL+VWA SRDLKVR+S+V+ALGQMVGLI R 
Sbjct  200   AVWQYSLDIPSHSPLDGDIMSFLNSVFELLLKVWAASRDLKVRMSSVDALGQMVGLINRA  259

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstl  1003
             QLKAALPRLVPTILELYKR+QD  F+ATCSLH+LLNASLLS +GPPLLDFE+LT++LSTL
Sbjct  260   QLKAALPRLVPTILELYKRDQDITFLATCSLHNLLNASLLSESGPPLLDFEELTIILSTL  319

Query  1004  l-lvCSNNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGS  1180
             L +VC NND KEHSDF VGLKTYNEVQ CFLTVG +YPEDLFVFL+NKCRLKEEP TFG+
Sbjct  320   LPVVCINNDNKEHSDFSVGLKTYNEVQRCFLTVGLIYPEDLFVFLINKCRLKEEPLTFGA  379

Query  1181  LCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGE  1360
             LCVLKHLLPRL+E+WH+KRP L+E+V+ LIDE NLGVRKAL+ELIVVMASHCYL+G SGE
Sbjct  380   LCVLKHLLPRLSEAWHSKRPFLVEAVQFLIDEQNLGVRKALSELIVVMASHCYLIGPSGE  439

Query  1361  LFIEYLVRHCAMPDLENVELESSRESSRFTGN-YYPFVYRKLEFKAGAVTTTELRGVCEK  1537
             LF+EYLVRHC++ D +  + E S+++S   GN Y PF Y++ E K G +  TELR +CEK
Sbjct  440   LFVEYLVRHCSLTDKDRSDFERSKDAS---GNPYIPFQYKRSEVKIGPICPTELRAICEK  496

Query  1538  GLLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKA  1717
             GLLL+T T+PEMEH+LWPFLLKMIIP+ YTGAVA VCRCISELCR R+S S+ MLSECKA
Sbjct  497   GLLLLTFTIPEMEHILWPFLLKMIIPQAYTGAVAMVCRCISELCRHRASNSDIMLSECKA  556

Query  1718  RTDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMK  1897
             R D+P PEELF RLVVLLH+PLARE   +QIL+VL +LAPLFPKNI  FWQDE  IPK+K
Sbjct  557   RADLPNPEELFVRLVVLLHDPLAREQRASQILTVLCHLAPLFPKNITLFWQDE--IPKLK  614

Query  1898  AYVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEH  2077
             AYVSDTEDLKQDP YQE+WDDMII+F AESLDVIQ+ DW+  LGN   +QYELY SD+EH
Sbjct  615   AYVSDTEDLKQDPSYQETWDDMIINFFAESLDVIQDADWMRSLGNAITQQYELYTSDDEH  674

Query  2078  SALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLD  2257
             SALLHRC G+ LQKV+DRAYVR KID MY QANI  PTNRLGLAKAMGLVAASHLDTVL+
Sbjct  675   SALLHRCFGVFLQKVNDRAYVRHKIDWMYTQANITNPTNRLGLAKAMGLVAASHLDTVLE  734

Query  2258  KLKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDAL  2437
             KLKGILDNVG SI +R  SFFSD  K EESDD HAALALMYGYAAKYAP TVIEARIDAL
Sbjct  735   KLKGILDNVGDSIFRRFLSFFSDDFKTEESDDIHAALALMYGYAAKYAPSTVIEARIDAL  794

Query  2438  VGTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGR  2617
             VGTNMLSRLLHVRHP AKQAVITAIDLLG+AVI A+E+G SFPLKRRD +LDYILTLMGR
Sbjct  795   VGTNMLSRLLHVRHPTAKQAVITAIDLLGRAVINAAENGSSFPLKRRDQMLDYILTLMGR  854

Query  2618  DEEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVI  2797
             D+ E FSDS +E LHTQ+ ALSACTTLVSVEPKLT ETRN ++KAT+GFF LPNDP DVI
Sbjct  855   DDSESFSDSTLEFLHTQARALSACTTLVSVEPKLTIETRNHVLKATLGFFALPNDPVDVI  914

Query  2798  NPLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLI  2977
             NPLI+NLITLLC IL+TSGEDGRSRAEQL HILR ID +VSS ++ QR+RGCLA HE+L+
Sbjct  915   NPLINNLITLLCAILLTSGEDGRSRAEQLSHILRQIDQYVSSPVDCQRRRGCLAVHEILL  974

Query  2978  KFRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPR  3157
             KFR +C    CALGCQGSC+HSKQID   +RN SNLPSAF LPSRDALSLG+R+++YLPR
Sbjct  975   KFRTVCTTANCALGCQGSCTHSKQIDRNLHRNFSNLPSAFVLPSRDALSLGDRVIMYLPR  1034

Query  3158  CIDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILRSDAS  3337
             C DTN EVRK S QIL+  F+I  SLP+P  +S G+DIE+SY ALSSLEDV+AILRSDAS
Sbjct  1035  CADTNSEVRKTSAQILDQLFSIGLSLPRPSTTSYGVDIEISYRALSSLEDVIAILRSDAS  1094

Query  3338  IDPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNEL  3517
             IDPSEVFNR++SSVC LL K ELVA LHGC+ A+CDKIKQSAEGAIQAV+EFVT RG EL
Sbjct  1095  IDPSEVFNRIISSVCILLTKSELVATLHGCTAAVCDKIKQSAEGAIQAVIEFVTRRGTEL  1154

Query  3518  NEIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMVTKD  3697
             +E +VSRT+Q+LL A  HV EK+LRQETL AI S+AE+T+SKVVF EVLA +GRD+VTKD
Sbjct  1155  SETDVSRTTQALLMATAHVIEKHLRQETLAAISSLAESTSSKVVFNEVLATSGRDIVTKD  1214

Query  3698  IHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSVDGSI  3877
             I RLRGGWP+QDAF+AFSQH VLS  FLEHVISV++Q P LKG      E+  + VDG +
Sbjct  1215  ISRLRGGWPMQDAFYAFSQHTVLSSLFLEHVISVLDQYPILKG-----EENPSHLVDGQM  1269

Query  3878  EDDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPLRAL  4057
             EDD+ +AA++A+TAFFRGGGK G+K V+Q+YASVLA LTL LG+CHGLAS+G  +PLRAL
Sbjct  1270  EDDILQAAIIAVTAFFRGGGKIGKKAVQQNYASVLAELTLQLGSCHGLASHGQHDPLRAL  1329

Query  4058  LNAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPK-----------  4204
             L AFQAFC   G+L +  ++         +  +N+I     S+ IK              
Sbjct  1330  LTAFQAFC---GELYLSLLV---------KCVVNIIICFLWSMEIKACGFIFFFDGYCLF  1377

Query  4205  --EVPTICLFLSKSLDRPLRVQREAAAAALSEFLRY  4306
               +V ++C+ LSKSL+R  R QREAAAAALSEF+RY
Sbjct  1378  YLKVQSVCVILSKSLNRHQRYQREAAAAALSEFVRY  1413


 Score =   303 bits (775),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 142/185 (77%), Positives = 166/185 (90%), Gaps = 0/185 (0%)
 Frame = +1

Query  94   IPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGNIAG  273
            IPA EAVQV+VS LAD+SP VREAS+++LKD+ +LNPLLVLDCC  +SRGGRRRFGN+AG
Sbjct  10   IPAPEAVQVLVSLLADESPIVREASIASLKDVATLNPLLVLDCCSAISRGGRRRFGNMAG  69

Query  274  LFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLPD  453
            +FQV++  +RALDK DVDP FM KLAKIATAE+IS+KELNADWQRAA+ VLVS+G HLPD
Sbjct  70   VFQVMAYGVRALDKDDVDPPFMAKLAKIATAEIISSKELNADWQRAASAVLVSIGRHLPD  129

Query  454  LMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIYRPI  633
            LMMEEIFLH  G NSALPAMVQILAD+A +DALQFTPRLKGVL+RV+PILGNVR+ +RPI
Sbjct  130  LMMEEIFLHLPGPNSALPAMVQILADFAHADALQFTPRLKGVLSRVLPILGNVRDAHRPI  189

Query  634  FANGL  648
            FAN +
Sbjct  190  FANAI  194


 Score =   258 bits (660),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 135/215 (63%), Positives = 172/215 (80%), Gaps = 0/215 (0%)
 Frame = +2

Query  4550  DAVEPVLLNLSIRLRNLQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMV  4729
             DAV+P+LL+LS+RLRNLQ+C N K+RA+AFAAFGALS+YG G   ++F EQ+H   PR+V
Sbjct  1448  DAVDPILLSLSLRLRNLQICTNTKMRADAFAAFGALSNYGIGPQHEAFLEQVHTVIPRLV  1507

Query  4730  LHLHDDDLGVRQACRNTLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQ  4909
             LHLHDDD+ VRQACR TLK IAPL+E+D +  L N H F+ DHR+DYE F+RDL +Q  Q
Sbjct  1508  LHLHDDDVSVRQACRTTLKQIAPLLEMDGLLPLFNMHSFNHDHRTDYEGFVRDLTKQFVQ  1567

Query  4910  YLGPRVDTYLSAIIQAFDAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKA  5089
             +   R+DTY+++ IQAFDAPWP+IQANA+Y  S MLSLSD+++I   YY+QVF  LVGK 
Sbjct  1568  HHPLRLDTYMASTIQAFDAPWPIIQANAIYFSSCMLSLSDDQHILNQYYAQVFETLVGKM  1627

Query  5090  SNSTDAIVRATCSAALGLLLKSPNSSSWRDARLNK  5194
             S S DA+VRATCS+ALGLLLK   SSSW+ AR+++
Sbjct  1628  SKSADAVVRATCSSALGLLLKFSKSSSWKSARVDR  1662



>emb|CDY67451.1| BnaCnng55010D, partial [Brassica napus]
Length=1229

 Score =  1532 bits (3966),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 794/1140 (70%), Positives = 943/1140 (83%), Gaps = 31/1140 (3%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             A W Y  D +  + LD+DV+SFLNS FELLLRVW  SRD KVR+S VEALGQMVGLITRT
Sbjct  117   AVWLYITDLTSDSPLDSDVMSFLNSVFELLLRVWTTSRDHKVRVSTVEALGQMVGLITRT  176

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstl  1003
             QLK+ALPRL+P ILELYK++ + A +AT SL++LLNASLLS +GPPLL+FEDLT+VLSTL
Sbjct  177   QLKSALPRLIPAILELYKKDHEDALLATSSLYNLLNASLLSESGPPLLEFEDLTIVLSTL  236

Query  1004  llvCS-NNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGS  1180
             L V S N++ K H+   +G K YNEVQ CFLTVG VYPEDLF FLLNKC+LKE+  TFG+
Sbjct  237   LPVISMNSENKRHAGSSMGRKAYNEVQRCFLTVGLVYPEDLFTFLLNKCKLKEDHLTFGA  296

Query  1181  LCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGE  1360
             LCVLKHLLPRL E+WH+KRP+LIE+ + L+DE +L VRKAL+ELIVVMASHCYLVG SGE
Sbjct  297   LCVLKHLLPRLLEAWHSKRPLLIEAARSLLDEQSLAVRKALSELIVVMASHCYLVGPSGE  356

Query  1361  LFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKG  1540
             LF+EYLVRH A+ +++N                       L+ K   ++ T+LR VC KG
Sbjct  357   LFVEYLVRHSAIGEIDN-----------------------LKAKGEPISPTQLRAVCGKG  393

Query  1541  LLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKAR  1720
             LLL+TVT+PEME++LWPFLLKMI+P+VYTGAVATVCRCISELCRRRSS +  ML ECKAR
Sbjct  394   LLLLTVTIPEMEYILWPFLLKMIVPKVYTGAVATVCRCISELCRRRSS-TTPMLIECKAR  452

Query  1721  TDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKA  1900
              DIP PEELF RLVVLLHNPLA+E L TQIL+VL YL+PLFPKNI+ FWQDE  IPKMKA
Sbjct  453   ADIPSPEELFTRLVVLLHNPLAKEQLATQILTVLNYLSPLFPKNISMFWQDE--IPKMKA  510

Query  1901  YVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHS  2080
             YV DTEDLK DP YQE+WDDMII+FLAESLDV  + DWV+ LGN FA+QY LY  D++H+
Sbjct  511   YVYDTEDLKLDPSYQENWDDMIINFLAESLDVTHDADWVISLGNAFAKQYNLYTPDDDHA  570

Query  2081  ALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDK  2260
             ALLHRC+GILLQKV+DRAYVR KID MY QA+I++P NRLGLAKAMGLVAASHLDTVL+K
Sbjct  571   ALLHRCMGILLQKVNDRAYVRDKIDWMYEQADISIPANRLGLAKAMGLVAASHLDTVLEK  630

Query  2261  LKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALV  2440
             LK ILDNVGQSI QRI S FS+  K E+SDD HAALALMYGYAAKYAP +VIEARIDALV
Sbjct  631   LKVILDNVGQSIFQRILSLFSESYKTEDSDDIHAALALMYGYAAKYAPSSVIEARIDALV  690

Query  2441  GTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRD  2620
             GTNMLSRLLHVR   AKQAVITAIDLLG+AVI ASESG +FPLKRRD++LDY+LTLMGRD
Sbjct  691   GTNMLSRLLHVRQQTAKQAVITAIDLLGRAVINASESGATFPLKRRDMMLDYVLTLMGRD  750

Query  2621  EEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVIN  2800
             E EGF++S++ELLHTQ+LAL+ACTTLVSVEPKLT ETRN +MKAT+GFF LPNDP DVI 
Sbjct  751   ENEGFAESSLELLHTQALALNACTTLVSVEPKLTVETRNRVMKATLGFFALPNDPPDVIG  810

Query  2801  PLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIK  2980
             PLIDNL++LLC IL+TSGEDGRSRAEQLLH+LR +D +VSS ++YQRKRGC+A HE+L+K
Sbjct  811   PLIDNLVSLLCAILLTSGEDGRSRAEQLLHLLRQLDQYVSSPVDYQRKRGCMAVHEMLLK  870

Query  2981  FRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPRC  3160
             FR +CV GYCALGC G C H K +D +   N SNLPS F  P R+ L LG+R++ YLPRC
Sbjct  871   FRKLCVAGYCALGCSGDCPHRKYVDRSMQGNFSNLPSVFLFPDREVLCLGDRVITYLPRC  930

Query  3161  IDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILRSDASI  3340
              DTN EVRK+S QIL+ FF+IS SLPK   SS G+D E SY ALSSLEDV+AIL+SDASI
Sbjct  931   ADTNSEVRKISAQILDQFFSISLSLPKAALSS-GLDSEESYKALSSLEDVIAILKSDASI  989

Query  3341  DPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNELN  3520
             DPSEVFNR+VSS+C LL  DELVAALH C+ AICDKI+QSAEGAIQAV EFV+ RG++LN
Sbjct  990   DPSEVFNRIVSSICALLTVDELVAALHSCTPAICDKIRQSAEGAIQAVTEFVSRRGSQLN  1049

Query  3521  EIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMVTKDI  3700
             + ++SRT+QSLL+A VH+TEK LR E +GAI ++AENT S +VF+EVLA AG+D+VTKDI
Sbjct  1050  DNDISRTTQSLLSAAVHITEKSLRVEAIGAISALAENTQSSIVFSEVLATAGKDIVTKDI  1109

Query  3701  HRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGG---DSGKGESSRNSVDG  3871
              R+RGGWP+QDAF+AFSQH  LS SF+EH+ISV+N+S  +K     DS KG+++ +S + 
Sbjct  1110  TRMRGGWPMQDAFYAFSQHTELSVSFMEHLISVLNRSSLVKADSHKDSHKGDNTSSSSET  1169

Query  3872  SIEDDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPLR  4051
              +ED++ +AA+ ALTAFFRGGGK G+K VE+SY+SV+  LTL LG+CHGLAS G Q+PLR
Sbjct  1170  HVEDELLQAAIFALTAFFRGGGKTGKKAVEKSYSSVVGALTLQLGSCHGLASTGQQDPLR  1229


 Score =   185 bits (469),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 86/111 (77%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = +1

Query  316  GDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLPDLMMEEIFLHFSGSN  495
            G+ D AFM KLAKIATAE+IS+KELNADWQR A+G+LVS+G+H PDLMMEEIFLH SG  
Sbjct  1    GESDEAFMGKLAKIATAEIISSKELNADWQRQASGLLVSIGTHFPDLMMEEIFLHLSGPA  60

Query  496  SALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIYRPIFANGL  648
            SA PAMVQILAD+ASSDALQFTPRLK VL+RV+PILGNVR+++RPIFAN  
Sbjct  61   SASPAMVQILADFASSDALQFTPRLKDVLSRVLPILGNVRDVHRPIFANAF  111



>ref|XP_007162801.1| hypothetical protein PHAVU_001G1818000g, partial [Phaseolus vulgaris]
 gb|ESW34795.1| hypothetical protein PHAVU_001G1818000g, partial [Phaseolus vulgaris]
Length=1228

 Score =  1518 bits (3931),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 768/1035 (74%), Positives = 880/1035 (85%), Gaps = 19/1035 (2%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             A WQYS+DF      D DV+SFLNSAFELLLRVWA SRDLKVR+++V+ALGQMVGLITR 
Sbjct  138   ASWQYSIDFPSHFPQDGDVMSFLNSAFELLLRVWAASRDLKVRVASVDALGQMVGLITRA  197

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstl  1003
             QLK ALPRL+PTIL+LYK++QD AF+ATCSLH+LLNASLLS +GPP+LDFEDLT+VLSTL
Sbjct  198   QLKTALPRLIPTILDLYKKDQDIAFLATCSLHNLLNASLLSESGPPMLDFEDLTLVLSTL  257

Query  1004  llvCS-NNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGS  1180
             L V S NND K+ SDF +GLK YNEVQHCFLTVG VYP+DLF+FL+NKCRL+EEP TFG+
Sbjct  258   LPVISINNDSKDQSDFSLGLKMYNEVQHCFLTVGLVYPDDLFLFLVNKCRLREEPLTFGA  317

Query  1181  LCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGE  1360
             LC+LKHLLPRL+E+WH+K  +L+E+VK L +E NL VRK L+ELIVVMASHCYLVGSSGE
Sbjct  318   LCILKHLLPRLSEAWHSKISLLVEAVKSLHEEQNLAVRKTLSELIVVMASHCYLVGSSGE  377

Query  1361  LFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKG  1540
             LFIEYLVRHCA+ D    +LE                 ++ E K GAVT +ELR VCEKG
Sbjct  378   LFIEYLVRHCAITDQNRSDLEK-------------IPNKRKEMKIGAVTPSELRAVCEKG  424

Query  1541  LLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKAR  1720
             LLL+T+T+PEMEH+LWPFLL+MIIPR YTGAVATVCRCISEL R RS  SN MLS+CK R
Sbjct  425   LLLVTITIPEMEHILWPFLLRMIIPRTYTGAVATVCRCISELWRHRSF-SNDMLSDCKTR  483

Query  1721  TDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKA  1900
              DIP  EEL ARLVVLLHNPLARE L TQIL+VL  LAPLFPK+IN FWQ+E  IPKMKA
Sbjct  484   PDIPTAEELLARLVVLLHNPLAREQLATQILTVLCLLAPLFPKDINLFWQEE--IPKMKA  541

Query  1901  YVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHS  2080
             YVSDTEDLKQDP YQ++WDDMII+FLAESLDVIQ+ DWV+  GN FAR YELY SD++H+
Sbjct  542   YVSDTEDLKQDPSYQDTWDDMIINFLAESLDVIQDADWVMSFGNVFARHYELYASDDQHT  601

Query  2081  ALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDK  2260
             ALLHRCLGILLQKV++RAYVR KID MY+QANIA PTNRLGLAKAMGLVAASHLDTVLDK
Sbjct  602   ALLHRCLGILLQKVNERAYVRDKIDWMYKQANIANPTNRLGLAKAMGLVAASHLDTVLDK  661

Query  2261  LKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALV  2440
             LK ILDNVGQ + QRI S FSD  + E+SDD HAALALMYGYAAKYAP TVIEARI+ALV
Sbjct  662   LKDILDNVGQGVFQRILSLFSDSFRTEDSDDIHAALALMYGYAAKYAPSTVIEARINALV  721

Query  2441  GTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRD  2620
             GTN+LSRLLHVRHP+AKQAVITAIDLLG AVI A+E+G  FPLKRRD LLDYILTLMGRD
Sbjct  722   GTNVLSRLLHVRHPKAKQAVITAIDLLGNAVINAAENGSPFPLKRRDQLLDYILTLMGRD  781

Query  2621  EEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVIN  2800
             +E+GF+D N +LL TQ+LA+SACTTLVSVEPKLT ETRN +MKAT+GFF +PNDP DV+N
Sbjct  782   DEDGFADYN-DLLRTQALAISACTTLVSVEPKLTFETRNHVMKATLGFFAIPNDPVDVVN  840

Query  2801  PLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIK  2980
             PLIDNLITLLC IL+T GEDGRSRAE L+ ILR ID FV S +EYQRKRGCLA HE+L+K
Sbjct  841   PLIDNLITLLCAILLTGGEDGRSRAELLMLILRQIDQFVCSPIEYQRKRGCLAVHEMLLK  900

Query  2981  FRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPRC  3160
             FR ICV+GYCALGC GSC+H+KQID     N S LPSAF LPSR++L LG+R+++YLPRC
Sbjct  901   FRMICVSGYCALGCHGSCAHNKQIDRTLFGNFSKLPSAFVLPSRESLCLGDRVIMYLPRC  960

Query  3161  IDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGID-IELSYIALSSLEDVVAILRSDAS  3337
              D N EVRK+S QIL+L F+IS SLP+P  SS+  + IELSY ALSSLEDV+AILR+D S
Sbjct  961   ADPNSEVRKISAQILDLLFSISLSLPRPAGSSMSAEVIELSYSALSSLEDVIAILRNDTS  1020

Query  3338  IDPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNEL  3517
             IDPSEVFNR+VSS+C LL K+E+VA LHGCS AICDKIKQSAEGAIQAVVEFVT RG EL
Sbjct  1021  IDPSEVFNRIVSSLCILLTKEEMVATLHGCSVAICDKIKQSAEGAIQAVVEFVTKRGGEL  1080

Query  3518  NEIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMVTKD  3697
              EI++SRT+QSL++AVVH T+K+LR ETLGAI S+AENT+ K VF EVLA AGRD +TKD
Sbjct  1081  TEIDISRTTQSLISAVVHATDKHLRVETLGAISSLAENTSPKTVFDEVLATAGRDTITKD  1140

Query  3698  IHRLRGGWPIQDAFH  3742
             I RLRGGWP+QDAF+
Sbjct  1141  ISRLRGGWPMQDAFY  1155


 Score =   213 bits (542),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = +1

Query  253  RFGNIAGLFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVS  432
            RFGN+AG+FQV++  +RALDK DVD AFM KLAKIATAE+IS+KELN+DWQRAA  +LV+
Sbjct  1    RFGNMAGVFQVMAFGVRALDKRDVDSAFMAKLAKIATAELISSKELNSDWQRAATSLLVA  60

Query  433  VGSHLPDLMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNV  612
            +GSHLPDLMMEEIFLH SG+NSAL AMVQILA++AS+D +QF PR KGVL+R++PILGNV
Sbjct  61   IGSHLPDLMMEEIFLHLSGTNSALQAMVQILAEFASTDPMQFIPRWKGVLSRILPILGNV  120

Query  613  REIYRPIFANGL  648
            RE++RPIFAN  
Sbjct  121  REMHRPIFANAF  132



>ref|XP_009397414.1| PREDICTED: protein SHOOT GRAVITROPISM 6 isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=1119

 Score =  1422 bits (3682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 729/1093 (67%), Positives = 893/1093 (82%), Gaps = 2/1093 (0%)
 Frame = +2

Query  1883  IPKMKAYVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYK  2062
             +PKMKAY+SD +DL+QD  YQE+WDDMI++FL+ESLDV+Q+ +W+L LGN FARQY LY 
Sbjct  8     VPKMKAYISDLDDLRQDSSYQETWDDMIVNFLSESLDVVQDNEWILSLGNAFARQYALYD  67

Query  2063  SDNEHSALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHL  2242
              D+EH ALLHRCLG+LLQKV DR YV  KI+ MY  ANI+VPTNRLGLAK MGL+AASHL
Sbjct  68    DDDEHLALLHRCLGMLLQKVDDRVYVNGKIEWMYAHANISVPTNRLGLAKGMGLIAASHL  127

Query  2243  DTVLDKLKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEA  2422
             DTVL+KLK ILDNVG S  QR FSF S R  +E++DDT+AALALMYGYAA+YAP TVIEA
Sbjct  128   DTVLEKLKCILDNVGYSRFQRFFSFLSGR-VLEDADDTYAALALMYGYAARYAPSTVIEA  186

Query  2423  RIDALVGTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYIL  2602
             RI+ALVGTNMLSRLLHV+HP AKQA+ITAIDLLG+AVI A+E GISFPLKRRD +LDY+L
Sbjct  187   RINALVGTNMLSRLLHVQHPTAKQAIITAIDLLGRAVINAAEMGISFPLKRRDQMLDYVL  246

Query  2603  TLMGRDEEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPND  2782
             TLMGRD+ E   DS+ ELLHTQ+LALSAC TLV VEP+L  E RN +MKAT+GFF LP+D
Sbjct  247   TLMGRDDREELIDSSTELLHTQTLALSACKTLVLVEPRLPVEARNHVMKATLGFFALPSD  306

Query  2783  PSDVINPLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAA  2962
             PSD+I+PL+DNLI+LLC IL+TSGEDGRSRAEQLLHILR +D +VSSS+E+QR+RGC+A 
Sbjct  307   PSDIIDPLVDNLISLLCAILLTSGEDGRSRAEQLLHILRQVDLYVSSSVEHQRRRGCVAV  366

Query  2963  HELLIKFRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIM  3142
             +ELL+KFRA+   G C LGC  SC HSKQID  A RN SNLPSAF LPSRD+LSLGER++
Sbjct  367   YELLLKFRALFSGGVCGLGCHSSCMHSKQIDRVAQRNFSNLPSAFVLPSRDSLSLGERVI  426

Query  3143  VYLPRCIDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAIL  3322
              YLPRC DT+ EVRK++ QI+  FF+++ SLPK   S   IDIE+SY ALSSLEDV++IL
Sbjct  427   AYLPRCADTSSEVRKLAAQIIGQFFSVALSLPKLAASVSYIDIEVSYSALSSLEDVISIL  486

Query  3323  RSDASIDPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTN  3502
             R DASID SE FNRV+SSVC LL +DEL+ +LH C+ AICDKIKQSA+GAIQAV+EF++ 
Sbjct  487   RRDASIDQSETFNRVISSVCVLLTRDELIISLHTCTSAICDKIKQSADGAIQAVIEFISK  546

Query  3503  RGNELNEIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRD  3682
             RGNEL E ++SRT+QSLL+A + +T+K+ RQE L AI  +AENT S +VF E+LAAAGRD
Sbjct  547   RGNELLEADISRTTQSLLSATIAITDKHTRQEVLNAISCLAENTNSSIVFNEILAAAGRD  606

Query  3683  MVTKDIHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNS  3862
             +VTKD+ R+RGGWP+QDAF AFSQH VLS SFLE+V+SV++++P L   D  KGE   +S
Sbjct  607   IVTKDVTRIRGGWPMQDAFFAFSQHPVLSFSFLEYVVSVLDRTP-LPKTDVDKGEIVAHS  665

Query  3863  VDGSIEDDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQE  4042
             V+   ++ + +AA+LA+TAFFRGGGK G+K VEQSY++VL+ LTL LG+CHGLAS G  E
Sbjct  666   VEFQNDNQIQQAAILAITAFFRGGGKIGKKAVEQSYSTVLSALTLQLGSCHGLASLGQLE  725

Query  4043  PLRALLNAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTIC  4222
             PLR LL AFQ+FC+CVGD+EMGKILAR GE  + EK I+LI E+A   S+KRPKEV  I 
Sbjct  726   PLRLLLLAFQSFCDCVGDIEMGKILARDGEHKDQEKLIDLIQEIASCTSMKRPKEVSPIS  785

Query  4223  LFLSKSLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLR  4402
             + LSK+L+R  R QREAAA+ALSEF+R+SDG   LL  +VEA+C HVSD+SPTVR LCLR
Sbjct  786   MILSKALNRHQRFQREAAASALSEFIRHSDGLPSLLEHIVEAMCLHVSDESPTVRSLCLR  845

Query  4403  GLVQMPSIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLS  4582
             GLVQ+P  H+  Y  Q+LGVI+ALL+D DESVQLTAV CLL VL SSS +AV+P+L+NLS
Sbjct  846   GLVQIPKSHMPNYIAQVLGVIVALLEDPDESVQLTAVQCLLSVLSSSSEEAVDPILINLS  905

Query  4583  IRLRNLQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVR  4762
             +RLRNLQ+ +N K+R+NAFAA+GALS++G GS   +F EQ+HA  PR++LHLHDDDL VR
Sbjct  906   VRLRNLQISMNEKMRSNAFAAYGALSNFGMGSQHQAFLEQVHATIPRLILHLHDDDLNVR  965

Query  4763  QACRNTLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLS  4942
             QACRNTL+ +APLIE D   AL N   FSS+ RSDYEDF+RDL+R + Q L  RVD+YL+
Sbjct  966   QACRNTLRQLAPLIEADGFSALFNKQVFSSERRSDYEDFIRDLSRHVYQLLASRVDSYLA  1025

Query  4943  AIIQAFDAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRAT  5122
              +IQAFD+PWPVIQANA+Y  S +LSLS+++   A Y  QVF  LV + + S DA+VRA+
Sbjct  1026  PLIQAFDSPWPVIQANAIYFSSCLLSLSEDQRSLAPYCLQVFAALVTRMNRSPDAVVRAS  1085

Query  5123  CSAALGLLLKSPN  5161
             CS ALGLLLK+ N
Sbjct  1086  CSFALGLLLKAFN  1098



>gb|AAK98733.1|AC090485_12 Hypothetical protein [Oryza sativa Japonica Group]
Length=1549

 Score =  1381 bits (3574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 807/1508 (54%), Positives = 1014/1508 (67%), Gaps = 174/1508 (12%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             A WQY  D       DTDV+SF+NS FELLL+VW  SRDLKVRLS+VEALG+MVGL+TR+
Sbjct  168   AAWQYIGDAPSELPFDTDVMSFMNSVFELLLKVWTGSRDLKVRLSSVEALGEMVGLVTRS  227

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstl  1003
             QLK+ALPR++PT+L+L +++Q+ AFVA+ SLH+LLNASLLS +GPPLLDFE         
Sbjct  228   QLKSALPRIIPTMLDLCRKDQEIAFVASHSLHNLLNASLLSESGPPLLDFE---------  278

Query  1004  llvCSNNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGSL  1183
                                 TYNE+QHCFL + S YPED                    L
Sbjct  279   --------------------TYNEIQHCFLVISSAYPED--------------------L  298

Query  1184  CVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGEL  1363
             C+                                     L  LIVVMASHCYL G   EL
Sbjct  299   CMF------------------------------------LLNLIVVMASHCYLSGHPAEL  322

Query  1364  FIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKGL  1543
              +E+LVRH A+ D      +   + +     Y  F  ++ E K      +ELR VCEKGL
Sbjct  323   AVEFLVRHSAITD------DDLNDPNTLKNEY--FQDKRFEMKISLSGLSELRAVCEKGL  374

Query  1544  LLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKART  1723
             LL+ +T+PEME VLWPF+LK+IIP+ YTGAVAT+C+CI+ELCR + S++N + +E  A  
Sbjct  375   LLLAITIPEMELVLWPFILKLIIPKKYTGAVATICKCITELCRHKLSQTNPLYTEFNASN  434

Query  1724  DIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKAY  1903
             +IP PE+LFARL+VLLHNPLAR  L T IL V+ YL  LFP+N++ F QDE  +PKMKAY
Sbjct  435   EIPNPEDLFARLLVLLHNPLARGQLATHILMVMCYLGQLFPRNLSLFLQDE--VPKMKAY  492

Query  1904  VSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHSA  2083
             + D EDLKQD  YQE+WDDMII+FLAESLDV+ + +WV+ LG+ FARQY+LY + + HSA
Sbjct  493   IGDPEDLKQDSTYQETWDDMIINFLAESLDVVNDSEWVISLGDAFARQYDLYATCDGHSA  552

Query  2084  LLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDKL  2263
             LLHRCLG+LLQKV DR YVR KID M   +++++P NRLGLA+ +GLVAASHLDTVL+KL
Sbjct  553   LLHRCLGMLLQKVDDRIYVREKIDWMCAHSSMSIPINRLGLAQGIGLVAASHLDTVLEKL  612

Query  2264  KGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALVG  2443
             K IL+N GQS LQR  S FS   K+E+ DDT+AALALMYGYAAKYAP TVIEARI+ALVG
Sbjct  613   KNILENAGQSALQRFLSLFSLGAKVEDVDDTYAALALMYGYAAKYAPSTVIEARINALVG  672

Query  2444  TNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRDE  2623
             TNML R LHV+HP AKQAVITAIDLLGQAVI A+E GISFPLKRRD LL+Y+LTLMGRD+
Sbjct  673   TNMLGRFLHVQHPTAKQAVITAIDLLGQAVITAAEMGISFPLKRRDQLLEYVLTLMGRDQ  732

Query  2624  EEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVINP  2803
              +   D + ELLHTQSLALSACTTLVS+EP+L  ETRN +MKAT+GFF LP +PS+++  
Sbjct  733   NDDLVDFSTELLHTQSLALSACTTLVSIEPRLPMETRNRVMKATLGFFALPTEPSNIVES  792

Query  2804  LIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIKF  2983
             LI NLI LL  IL+TSGEDGRSRAEQLLHILR +DP+VSSS E+QR+RGC A +E+L+KF
Sbjct  793   LITNLIILLGAILLTSGEDGRSRAEQLLHILRQLDPYVSSSAEHQRRRGCAAVNEVLVKF  852

Query  2984  RAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPRCI  3163
             R +C  G+  LG   + + +KQID AA R+LS+      LPS                  
Sbjct  853   RNLCSGGFGVLGSYPTFTLNKQIDQAAPRSLSS------LPS------------------  888

Query  3164  DTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILRSDASID  3343
                                 +F LP   + SLG             E ++A L   A  D
Sbjct  889   --------------------AFVLPTRDSLSLG-------------ERIMAYLPRCADTD  915

Query  3344  PSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVT--NRGNEL  3517
              +EV    +  +    N   +  +L     ++ D   +S+  A+ ++ + V+   R   +
Sbjct  916   -AEVRKVAIQILALFFN---IALSLPKKKASVNDIDLESSYSALSSLEDIVSIIRREASI  971

Query  3518  NEIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMVTKD  3697
             ++ EV     S L  ++   E          I  +AENT   VVF EVL  AGRD+ TKD
Sbjct  972   DQAEVFHRVVSSLCVLLSKDE----------ISCLAENTNHTVVFNEVLFVAGRDICTKD  1021

Query  3698  IHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSVDGSI  3877
             I R+RGGW IQD FHAFSQH VL+  FLE+++S++++ P +   DS KGE +  S   S 
Sbjct  1022  IARIRGGWAIQDVFHAFSQHKVLAILFLEYILSILHKEP-VATNDSEKGEITSES---SA  1077

Query  3878  EDDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPLRAL  4057
             +D + +A + AL AF RGGGK G++ VEQSY SVL+ L L LG+ HGLA  G  E LR+L
Sbjct  1078  DDCILQATMFALNAFLRGGGKIGKQAVEQSYPSVLSALILKLGSLHGLAELGRNELLRSL  1137

Query  4058  LNAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICLFLSK  4237
             L AFQ+FC+CVGD+EMGKILAR GEQ E EKWI+L+ E+A S S+KRPKEV   C  LSK
Sbjct  1138  LIAFQSFCDCVGDIEMGKILARDGEQTEKEKWIDLVQEVACSSSVKRPKEVLPTCSILSK  1197

Query  4238  SLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQM  4417
             +L++  R +REAAAAALSE++R+S+    LL QMV  LC+HVSDDSPTVR LCLRGLVQ+
Sbjct  1198  ALNKNQRAEREAAAAALSEYIRHSEKEPILLDQMVLELCQHVSDDSPTVRSLCLRGLVQI  1257

Query  4418  PSIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSIRLRN  4597
             P   + +Y  Q+LGVILALL+D+ ESVQLTAV CLL VL  S  DA++PVL+NL +RLRN
Sbjct  1258  PESCIPKYIQQVLGVILALLEDTKESVQLTAVQCLLTVLNVSEQDAIDPVLINLLVRLRN  1317

Query  4598  LQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACRN  4777
             LQV +N K+R+NAFA +GALS+YG GS    F EQIHA  PR++LHLHDDDL VR ACRN
Sbjct  1318  LQVSMNTKMRSNAFAVYGALSAYGVGS--QQFLEQIHATLPRLILHLHDDDLSVRLACRN  1375

Query  4778  TLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSAIIQA  4957
             T + +APL+E+D + +LL+   F+SD RSDYEDF+RDL RQL +    RVD+Y  + IQA
Sbjct  1376  TFQLLAPLMEVDGLSSLLSKKYFTSDRRSDYEDFIRDLTRQLCRLSPARVDSYFESAIQA  1435

Query  4958  FDAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATCSAAL  5137
             FDAPWPVI+ANAV L S MLS  D++   A Y+SQVF +LVG+ S S DA+VRA  S+AL
Sbjct  1436  FDAPWPVIKANAVCLVSCMLSFLDDQRFLAPYFSQVFAILVGRLSQSPDAVVRAASSSAL  1495

Query  5138  GLLLKSPN  5161
             GLL+K  N
Sbjct  1496  GLLIKRSN  1503


 Score =   205 bits (522),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 100/150 (67%), Positives = 132/150 (88%), Gaps = 0/150 (0%)
 Frame = +1

Query  106  EAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGNIAGLFQV  285
            EAVQV+V+SLAD+SP  R+A+++AL++I  +NPLLVLDCC TVSRGGRRRFGNIAG+F V
Sbjct  14   EAVQVLVTSLADESPVARDAALAALREIAPMNPLLVLDCCATVSRGGRRRFGNIAGVFLV  73

Query  286  ISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLPDLMME  465
            ++ A++ALD+ D +  F+ KLAKIATAE++S+KELN DWQRAAA +LV++GSH PDLMME
Sbjct  74   MASAVKALDRSDAEREFLRKLAKIATAEIVSSKELNVDWQRAAASLLVAIGSHDPDLMME  133

Query  466  EIFLHFSGSNSALPAMVQILADYASSDALQ  555
            E+FL+F+G  SALPAM+QILAD+AS++A +
Sbjct  134  ELFLYFAGPTSALPAMLQILADFASAEAFR  163



>ref|XP_008665853.1| PREDICTED: protein SHOOT GRAVITROPISM 6-like [Zea mays]
Length=2204

 Score =  1379 bits (3569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 729/1173 (62%), Positives = 909/1173 (77%), Gaps = 7/1173 (1%)
 Frame = +2

Query  1643  VCRCISELCRRRSSESNAMLSECKARTDIPKPEELFARLVVLLHNPLAREHLVTQILSVL  1822
             VC+CI+ELCR + S +N + +E  A  + P PE+LFARLVVLLHNPLAR  L TQIL+VL
Sbjct  984   VCKCITELCRHKFSHTNPLYTEFNASNETPNPEDLFARLVVLLHNPLARGQLATQILTVL  1043

Query  1823  WYLAPLFPKNINSFWQDEL*IPKMKAYVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQ  2002
              YL PLFP+N++ FWQDE  +PKMKAY+SD EDLKQD  YQE WDDMII+FLAE LDV+ 
Sbjct  1044  CYLGPLFPRNLSLFWQDE--VPKMKAYISDPEDLKQDSTYQEKWDDMIINFLAECLDVVN  1101

Query  2003  NVDWVLLLGNTFARQYELYKSDNEHSALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIA  2182
             + +WV+ LG+ FARQY+LY   + H+ALLHRCLG+LLQKV DR YV  KID M R ++++
Sbjct  1102  DTEWVISLGDAFARQYDLYSISDGHAALLHRCLGMLLQKVDDRIYVSEKIDWMCRHSSMS  1161

Query  2183  VPTNRLGLAKAMGLVAASHLDTVLDKLKGILDNVGQSILQRIFSFFSDRGKMEESDDTHA  2362
             +P NRLGLA+ +GLVAASHLDTVL+KLK ILD+  QS  QR  SFFS   K+E+ DDT+A
Sbjct  1162  IPINRLGLAQGIGLVAASHLDTVLEKLKNILDSAEQSAFQRFLSFFSFGPKVEDVDDTYA  1221

Query  2363  ALALMYGYAAKYAPPTVIEARIDALVGTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGA  2542
             ALALMYGYAA+YAP TVIEARI+ALVG+NML RLLHV+HP AKQAVITAIDLLG+AVI A
Sbjct  1222  ALALMYGYAARYAPSTVIEARINALVGSNMLGRLLHVQHPTAKQAVITAIDLLGRAVISA  1281

Query  2543  SESGISFPLKRRDLLLDYILTLMGRDEEEGFSDSNIELLHTQSLALSACTTLVSVEPKLT  2722
             +E GISFPLKRRD LL+Y+LTLMGRD+    +D N ELLHTQSLALSACTTLVS+EP+L 
Sbjct  1282  AEMGISFPLKRRDQLLEYVLTLMGRDQSNDLTDFNTELLHTQSLALSACTTLVSLEPRLP  1341

Query  2723  TETRNLIMKATIGFFGLPNDPSDVINPLIDNLITLLCTILVTSGEDGRSRAEQLLHILRN  2902
              ETRN +MKAT+GFF LP +PS ++  L+ NLI LL  IL+TSGEDGRSRAEQLLHILR 
Sbjct  1342  METRNRVMKATLGFFALPTEPSSIVESLVTNLIILLGAILLTSGEDGRSRAEQLLHILRQ  1401

Query  2903  IDPFVSSSLEYQRKRGCLAAHELLIKFRAICVNGYCALGCQGSCSHSKQIDHAANRNLSN  3082
             +DP+VSSSLE+QR+RGC+A  E+LIKFR +C  G+ ALG   + + +KQID    R+LS+
Sbjct  1402  LDPYVSSSLEHQRRRGCVAVQEVLIKFRNLCSGGFGALGSYPTFTMNKQIDR-GTRSLSS  1460

Query  3083  LPSAFFLPSRDALSLGERIMVYLPRCIDTNYEVRKVSVQILNLFFNISFSLPKPINSSLG  3262
             LPSAF LPSRD+LSLGER M YLPRC DT+ EVRKV++QI+ LFF+IS SLPK       
Sbjct  1461  LPSAFVLPSRDSLSLGERTMAYLPRCADTDTEVRKVAIQIIALFFDISLSLPKQKAYPND  1520

Query  3263  IDIELSYIALSSLEDVVAILRSDASIDPSEVFNRVVSSVCTLLNKDELVAALHGCSGAIC  3442
             ID+E SY ALSSLE++V+I+R +AS+D +E+F RVVSSVC LL+KDELV  LH C+ A C
Sbjct  1521  IDLESSYSALSSLEELVSIVRREASVDQTELFQRVVSSVCILLSKDELVVLLHSCTLATC  1580

Query  3443  DKIKQSAEGAIQAVVEFVTNRGNELNEIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSV  3622
             DKIKQSA+ +IQA++ F+  RG EL E +VSRT+QSLL++ + +T+ + RQE L AI  +
Sbjct  1581  DKIKQSADASIQAIIMFIIRRGKELREADVSRTTQSLLSSAISLTDTHSRQEVLNAISCL  1640

Query  3623  AENTTSKVVFTEVLAAAGRDMVTKDIHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVI  3802
             AENT   VVF EVL+ AG+D+ TKDI R+RGGW IQD F+AFSQH  L+  FLE+ +S++
Sbjct  1641  AENTNHVVVFDEVLSVAGKDICTKDIPRIRGGWAIQDVFYAFSQHKELALLFLEYTLSIL  1700

Query  3803  NQSPALKGGDSGKGESSRNSVDGSIEDDVSRAAVLALTAffrgggkfgrkTVEQSYASVl  3982
             ++ P +    S KGES+  S+    +D + +A + AL AF RGGGK G++ VE+SY SVL
Sbjct  1701  HKEPVIINS-SEKGESTSESL---ADDCILQATMFALNAFMRGGGKIGKQAVEKSYPSVL  1756

Query  3983  atltlhlgtchglaSYGDQEPLRALLNAFQAFCECVGDLEMGKILARGGEQNENEKWINL  4162
             + L L LG+ +G+A  G  E LR+LL AFQ+FCECVGD+EMGK+LAR GEQ E +KWI L
Sbjct  1757  SGLILKLGSLNGVAELGRNELLRSLLIAFQSFCECVGDVEMGKLLARDGEQTEKDKWIEL  1816

Query  4163  IGELAGSISIKRPKEVPTICLFLSKSLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMV  4342
             + E+A S S+KRPK+V   C+ L  +L+R  R +REAAAAALSEF+ + +    LL QMV
Sbjct  1817  VQEIACSSSVKRPKDVLPTCVILCNALNRNQRAEREAAAAALSEFIHHIEKEPTLLEQMV  1876

Query  4343  EALCRHVSDDSPTVRRLCLRGLVQMPSIHVLQYTTQILGVILALLDDSDESVQLTAvscl  4522
             E +C+HVSDDSPTVR LCLRGLVQ P  H+L+Y  Q+LGVILALL+D +ESVQLTAV CL
Sbjct  1877  EEMCQHVSDDSPTVRSLCLRGLVQAPESHMLKYIQQVLGVILALLEDPNESVQLTAVQCL  1936

Query  4523  llvlesssTDAVEPVLLNLSIRLRNLQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQ  4702
             L VL  S  DAV P+L+NL +RLRNLQV +N K+R+NAFAA+GALS+YG G    +F EQ
Sbjct  1937  LNVLNLSEQDAVGPILINLLVRLRNLQVSMNTKMRSNAFAAYGALSAYGVGLQRTAFIEQ  1996

Query  4703  IHAAFPRMVLHLHDDDLGVRQACRNTLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFL  4882
             IHA  PR++LHLHDDDL VR ACRNT + +A L+E++ +  LL+   F+SD RSDYEDF+
Sbjct  1997  IHATLPRLILHLHDDDLSVRLACRNTFQLLATLMEVEGLSVLLSKQYFASDRRSDYEDFI  2056

Query  4883  RDLARQLTQYLGPRVDTYLSAIIQAFDAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQ  5062
             RDL RQL +    RVD+YL + IQAFDAPWPVI+ANAV L S MLS  D++   A Y+SQ
Sbjct  2057  RDLTRQLCRLSPARVDSYLESAIQAFDAPWPVIRANAVCLVSCMLSFLDDQRFIAPYFSQ  2116

Query  5063  VFGVLVGKASNSTDAIVRATCSAALGLLLKSPN  5161
             VF  LVG+ S S DAIVRA+ S+ALG+L+K  N
Sbjct  2117  VFATLVGRMSQSPDAIVRASASSALGILIKRSN  2149


 Score =   249 bits (637),  Expect(2) = 6e-73, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = +1

Query  106  EAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGNIAGLFQV  285
            EAVQV+V+SLADDSP  R+A+++AL+DI  LNP+L+LDCC TVSRGGRRRFGN+AG+F V
Sbjct  14   EAVQVLVASLADDSPVARDAALAALRDIAPLNPMLILDCCATVSRGGRRRFGNMAGVFLV  73

Query  286  ISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLPDLMME  465
            ++ A+RALD  D +  F+ K+AKIATAE++++KE N DWQRAAA +LV++GSH PDLMM 
Sbjct  74   MASAVRALDHSDAESEFLRKIAKIATAEIVTSKEFNVDWQRAAACLLVAIGSHDPDLMMG  133

Query  466  EIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIYRPIFANG  645
            EIFLHFSG  SALPAM+QILAD+ASS+ALQFTPRLK VL RV+PILG+VR+  RP+FAN 
Sbjct  134  EIFLHFSGPTSALPAMLQILADFASSEALQFTPRLKDVLLRVLPILGSVRDGQRPVFANA  193

Query  646  L  648
             
Sbjct  194  F  194


 Score = 56.6 bits (135),  Expect(2) = 6e-73, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +2

Query  644  ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVR  772
            A WQY  D      LD DV+SF+NS FELL++VW  SRDLKVR
Sbjct  200  AAWQYLGDAPSELPLDNDVMSFMNSVFELLIKVWTGSRDLKVR  242



>ref|XP_010412903.1| PREDICTED: protein SHOOT GRAVITROPISM 6-like [Camelina sativa]
Length=1670

 Score =  1286 bits (3328),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 687/1126 (61%), Positives = 819/1126 (73%), Gaps = 143/1126 (13%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             A W Y  D +  + LD+DV+SFLNS FELLLRVWA+SRD KVR+S VEALGQMVGLITRT
Sbjct  200   AVWLYITDLTSDSPLDSDVMSFLNSVFELLLRVWAISRDHKVRVSTVEALGQMVGLITRT  259

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstl  1003
             QLK+ALPRL+P ILELYKR+ D A +ATCSLH+LLNASLLS +GPPLL+FEDLT+VLSTL
Sbjct  260   QLKSALPRLIPAILELYKRDHDDALLATCSLHNLLNASLLSESGPPLLEFEDLTIVLSTL  319

Query  1004  llvCS-NNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGS  1180
             L V   N++++  SD  VG KTYNEVQ CFLTVG VYPEDLF FLLNKC+LKE+P TFG+
Sbjct  320   LPVIGVNSERRRCSDISVGRKTYNEVQRCFLTVGLVYPEDLFTFLLNKCKLKEDPLTFGA  379

Query  1181  LCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGE  1360
             LC+LKHLLPRL E+WH+KR +L+++   L+DE +L VRKAL+ELIVVMASHCYL G SGE
Sbjct  380   LCILKHLLPRLFEAWHSKRTLLVDTASSLLDEQSLAVRKALSELIVVMASHCYLAGPSGE  439

Query  1361  LFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKG  1540
             LF+EYLVRH A+ + EN                       L+ K   V+ T+LR VC KG
Sbjct  440   LFVEYLVRHSAIGESEN-----------------------LKAKGEPVSPTQLRAVCGKG  476

Query  1541  LLLITVTVPEME-------------HVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRS  1681
             LLL+TVT+PEME             ++LWPFLLKMIIP+VYTGAVA+VCRCISELCRRRS
Sbjct  477   LLLLTVTIPEMELSDFNAKMYMKLQYILWPFLLKMIIPKVYTGAVASVCRCISELCRRRS  536

Query  1682  SESNAMLSECKARTDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINS  1861
             S +  ML ECKAR DIP PEELF RLVVLLHNPLA++ L +QIL+VL YL+PLFPKNI+ 
Sbjct  537   S-TTPMLIECKARADIPSPEELFTRLVVLLHNPLAKDQLASQILTVLGYLSPLFPKNISM  595

Query  1862  FWQDEL*IPKMKAYVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFA  2041
             FWQDE  IPKMKAYV DTEDL+ DP YQE+WDDMII+FLAESLDV Q+ DWV+ LGN+FA
Sbjct  596   FWQDE--IPKMKAYVFDTEDLQLDPTYQETWDDMIINFLAESLDVTQDADWVISLGNSFA  653

Query  2042  RQYELYKSDNEHSALLHRCLGILLQ-----------------------------------  2116
             +QY LY  D++H+ALLHRC+GILLQ                                   
Sbjct  654   KQYILYTPDDDHAALLHRCIGILLQKVNDRAYVRDKIDWMYEQADISIPANRLGLAKAMG  713

Query  2117  -KVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDKLKGILDNVGQS  2293
              KV+DRAYVR KID MY QA+I++P NRLGLAKAMGLVAASHLDTVL+KLK I+DNVGQS
Sbjct  714   LKVNDRAYVRDKIDWMYEQADISIPANRLGLAKAMGLVAASHLDTVLEKLKIIVDNVGQS  773

Query  2294  ILQRIF----------------SFFSDRGKMEESDDTHAALALMYG--------------  2383
             I QR                     +  G+ E      ++L +++               
Sbjct  774   IFQRFILLDLMKSSPHTXQMLDYILTLMGRDENEGFAESSLEVLHTQALALNACTTLVSV  833

Query  2384  -------------------YAAKYAPPTVIEARIDALV-----------------GTNML  2455
                                +A    P  VI   ID LV                 GTNML
Sbjct  834   EPKLTIETRNRVMKATLGFFALPNDPSDVISPLIDNLVTLLCAILLTRFCLHVPQGTNML  893

Query  2456  SRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRDEEEGF  2635
             SRLLHVR   AKQAVITAIDLLG+AVI A+ESG +FPLKRRD +LDYILTLMGRDE EGF
Sbjct  894   SRLLHVRQQTAKQAVITAIDLLGRAVINAAESGATFPLKRRDQMLDYILTLMGRDENEGF  953

Query  2636  SDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVINPLIDN  2815
             ++S++E+LHTQ+LAL+ACTTLVSVEPKLT ETRN +MKAT+GFF LPNDPSDVI+PLIDN
Sbjct  954   AESSLEVLHTQALALNACTTLVSVEPKLTIETRNRVMKATLGFFALPNDPSDVISPLIDN  1013

Query  2816  LITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIKFRAIC  2995
             L+TLLC IL+TSGEDGRSRAEQLLH+LR +D +VSS ++YQRKRGC+A HE+L+KFR +C
Sbjct  1014  LVTLLCAILLTSGEDGRSRAEQLLHLLRQLDQYVSSPIDYQRKRGCVAVHEMLLKFRKLC  1073

Query  2996  VNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPRCIDTNY  3175
             V GYCALGC G C H K  D +   N SNLPS F  P R+ L LG+R++ YLPRC DTN 
Sbjct  1074  VGGYCALGCSGDCPHRKYADRSMQGNFSNLPSVFLFPDREVLCLGDRVITYLPRCADTNS  1133

Query  3176  EVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILRSDASIDPSEV  3355
             EVRK+S QIL+ FF+IS SLPK   SS G+D E SY ALSSLEDV+AIL+ DASIDPSEV
Sbjct  1134  EVRKISAQILDQFFSISLSLPKAALSS-GLDSEESYKALSSLEDVIAILKRDASIDPSEV  1192

Query  3356  FNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNELNEIEVS  3535
             FNR+VSS+C LL  +ELVAAL+ C+ AICDKI+QSAEGAIQAV EFV+ RG++L++ ++S
Sbjct  1193  FNRIVSSICALLTGNELVAALNSCTAAICDKIRQSAEGAIQAVTEFVSRRGSQLSDNDIS  1252

Query  3536  RTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAA  3673
             RT+QSLL+A VH+T+K LR E +GAI ++AENT   +VF EVL  A
Sbjct  1253  RTTQSLLSAAVHITDKNLRVEAIGAISALAENTQPSIVFNEVLILA  1298


 Score =   461 bits (1187),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 233/361 (65%), Positives = 290/361 (80%), Gaps = 1/361 (0%)
 Frame = +2

Query  4112  ILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICLFLSKSLDRPLRVQREAAAAALS  4291
             ILAR GEQ E EKW++LIG++AG ISIKRPKEV  IC  L+K+L+RP R QREAAAAALS
Sbjct  1296  ILARNGEQREKEKWVDLIGDIAGCISIKRPKEVRHICSILTKALNRPQRFQREAAAAALS  1355

Query  4292  EFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQMPSIHVLQYTTQILGVILA  4471
             EF+RYS  F  ++ +MVEALCRHVSDDSPTVRRLCLRGLVQMPS  +  YTTQ++GVILA
Sbjct  1356  EFIRYSGDFSSVMEEMVEALCRHVSDDSPTVRRLCLRGLVQMPSACMNHYTTQVIGVILA  1415

Query  4472  LLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSIRLRNLQVCLNAKIRANAFAAFG  4651
             LLDD DESVQLTAVSCLL+V ES+S DAVEP+LLNLS+RLRNLQV ++ K+RANAFAA G
Sbjct  1416  LLDDLDESVQLTAVSCLLMVTESASNDAVEPILLNLSVRLRNLQVSMDPKMRANAFAALG  1475

Query  4652  ALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACRNTLKCIAPLIEIDAIPALL  4831
             ALS Y  G   + F EQIH++ PR+V+HLHDDDL +RQACR TLK +A L++I     L 
Sbjct  1476  ALSKYAIGGQREGFVEQIHSSLPRLVVHLHDDDLSIRQACRGTLKRLASLVDIINYSTLY  1535

Query  4832  NTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSAIIQAFDAPWPVIQANAVYLCSS  5011
             ++  F SD R+DYE+F+RDL++ L Q    RVDTY+++ IQAFDAPWPVIQANA++  ++
Sbjct  1536  DSRAFGSDDRTDYENFVRDLSKHLVQE-SERVDTYMASTIQAFDAPWPVIQANAIHFSTT  1594

Query  5012  MLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATCSAALGLLLKSPNSSSWRDARLN  5191
             MLSLS++++I +LYY QVF  LV K + S D++VRA CS+A GLLL+S  S+ WR ARL+
Sbjct  1595  MLSLSEDQHIISLYYPQVFETLVSKMTRSQDSVVRAACSSAFGLLLRSSKSTLWRGARLD  1654

Query  5192  K  5194
             +
Sbjct  1655  R  1655


 Score =   291 bits (746),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 137/188 (73%), Positives = 166/188 (88%), Gaps = 0/188 (0%)
 Frame = +1

Query  85   GDSIPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGN  264
            G SIPA EAVQ++VSSLADDS  VREASM++L+DI+SLNPLLVLDCC  VSRGGRRRFGN
Sbjct  7    GSSIPAPEAVQLLVSSLADDSSVVREASMASLRDISSLNPLLVLDCCYAVSRGGRRRFGN  66

Query  265  IAGLFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSH  444
            +AG+FQV++ ++ +L+KG+ D  FM KLAKIATAE+IS+KELNADWQR A+G+LVS+G+H
Sbjct  67   MAGVFQVMAFSVGSLEKGESDAVFMGKLAKIATAEIISSKELNADWQRQASGLLVSIGTH  126

Query  445  LPDLMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIY  624
             PDLMM+EIFLH SG  +A PAMVQILAD+A+SDALQFTPRLK VL+RV PILGNVR+++
Sbjct  127  FPDLMMDEIFLHLSGPATASPAMVQILADFATSDALQFTPRLKDVLSRVSPILGNVRDLH  186

Query  625  RPIFANGL  648
            RPIFAN  
Sbjct  187  RPIFANAF  194



>gb|KDO46966.1| hypothetical protein CISIN_1g0006553mg, partial [Citrus sinensis]
 gb|KDO46967.1| hypothetical protein CISIN_1g0006553mg, partial [Citrus sinensis]
 gb|KDO46968.1| hypothetical protein CISIN_1g0006553mg, partial [Citrus sinensis]
 gb|KDO46969.1| hypothetical protein CISIN_1g0006553mg, partial [Citrus sinensis]
 gb|KDO46970.1| hypothetical protein CISIN_1g0006553mg, partial [Citrus sinensis]
Length=794

 Score =  1189 bits (3077),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 600/797 (75%), Positives = 688/797 (86%), Gaps = 3/797 (0%)
 Frame = +2

Query  1817  VLWYLAPLFPKNINSFWQDEL*IPKMKAYVSDTEDLKQDPLYQESWDDMIISFLAESLDV  1996
             VL+YL+PLFP NI+ FWQDE  IPKMKAYVSDTEDLK DP YQE+WDDMII+FLAESLDV
Sbjct  1     VLYYLSPLFPTNIDLFWQDE--IPKMKAYVSDTEDLKLDPSYQETWDDMIINFLAESLDV  58

Query  1997  IQNVDWVLLLGNTFARQYELYKSDNEHSALLHRCLGILLQKVHDRAYVRAKIDLMYRQAN  2176
             +Q  DW++ LGN F  QY LY  D++HSALLHRCLGILLQKV DR YV  KID MY+QAN
Sbjct  59    VQETDWLISLGNAFTEQYVLYTPDDDHSALLHRCLGILLQKVADRNYVCDKIDWMYKQAN  118

Query  2177  IAVPTNRLGLAKAMGLVAASHLDTVLDKLKGILDNVGQSILQRIFSFFSDRGKMEESDDT  2356
             IA+PTNRLGLAKAMGLVAASHLD VL+ LKGILDN+GQS+ QR+ SFFS+  +MEESDD 
Sbjct  119   IAIPTNRLGLAKAMGLVAASHLDAVLEMLKGILDNIGQSLFQRLLSFFSNSYRMEESDDI  178

Query  2357  HAALALMYGYAAKYAPPTVIEARIDALVGTNMLSRLLHVRHPRAKQAVITAIDLLGQAVI  2536
             HAALALMYGYAAKYAP TVIEARIDALVGTNMLSRLLHVRH  AKQAVITAIDLLG+AVI
Sbjct  179   HAALALMYGYAAKYAPSTVIEARIDALVGTNMLSRLLHVRHHTAKQAVITAIDLLGRAVI  238

Query  2537  GASESGISFPLKRRDLLLDYILTLMGRDEEEGFSDSNIELLHTQSLALSACTTLVSVEPK  2716
              A+E+G SFPLK+RD LLDYILTLMGR+E + F+DS+IELLHTQ+LALSACTTLV+VEPK
Sbjct  239   NAAENGASFPLKKRDQLLDYILTLMGREENDSFADSSIELLHTQALALSACTTLVTVEPK  298

Query  2717  LTTETRNLIMKATIGFFGLPNDPSDVINPLIDNLITLLCTILVTSGEDGRSRAEQLLHIL  2896
             LT ETRN +MKAT+GFF LPNDP DV+NPLIDNLITLLC IL+TSGEDGRSRA+QLLHIL
Sbjct  299   LTIETRNHVMKATLGFFALPNDPIDVVNPLIDNLITLLCAILLTSGEDGRSRADQLLHIL  358

Query  2897  RNIDPFVSSSLEYQRKRGCLAAHELLIKFRAICVNGYCALGCQGSCSHSKQIDHAANRNL  3076
             R ID +VSS +EYQR+R CLA +E+L+KFR +CV GYCALGC GSC+H KQID A   N 
Sbjct  359   RQIDQYVSSPVEYQRRRSCLAVYEMLLKFRTLCVIGYCALGCHGSCTHIKQIDRAVLGNF  418

Query  3077  SNLPSAFFLPSRDALSLGERIMVYLPRCIDTNYEVRKVSVQILNLFFNISFSLPKPINSS  3256
             SNLPSA+ LPSR+AL LG R+++YLPRC DT+ EVRK+S QIL+  F+IS SLP+P+ SS
Sbjct  419   SNLPSAYVLPSREALCLGNRVIMYLPRCADTDSEVRKISAQILDQLFSISLSLPRPVGSS  478

Query  3257  LGIDIELSYIALSSLEDVVAILRSDASIDPSEVFNRVVSSVCTLLNKDELVAALHGCSGA  3436
              GID+ELSY ALSSLEDV+AILRSDASIDPSEVFNR+VSSVC LL KDELVA LH C+ A
Sbjct  479   SGIDLELSYGALSSLEDVIAILRSDASIDPSEVFNRIVSSVCILLTKDELVATLHSCTTA  538

Query  3437  ICDKIKQSAEGAIQAVVEFVTNRGNELNEIEVSRTSQSLLTAVVHVTEKYLRQETLGAIC  3616
             ICD+ KQSAEGAIQAVVEFVT RGNEL+E +VSRT+QSLL+A VH+T+K+LR ETLGAI 
Sbjct  539   ICDRTKQSAEGAIQAVVEFVTKRGNELSETDVSRTTQSLLSAAVHITDKHLRLETLGAIS  598

Query  3617  SVAENTTSKVVFTEVLAAAGRDMVTKDIHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVIS  3796
              +AENT SK+VF EVLA AG+D+VTKDI RLRGGWP+QDAFHAFSQH VLS  FLEH+IS
Sbjct  599   CLAENTNSKIVFNEVLATAGKDIVTKDISRLRGGWPMQDAFHAFSQHAVLSFLFLEHLIS  658

Query  3797  VINQSPALKGGDSGKGESSRNSVDGSIEDDVSRAAVLALTAffrgggkfgrkTVEQSYAS  3976
              +NQ+P +K GD  KG+ S +S D  I+DD+ +AA+LALTAFFRGGGK G+K VE+SYA 
Sbjct  659   ALNQTPFVK-GDMEKGDYSSHSADTWIDDDILQAAILALTAFFRGGGKVGKKAVEKSYAP  717

Query  3977  VlatltlhlgtchglaSYGDQEPLRALLNAFQAFCECVGDLEMGKILARGGEQNENEKWI  4156
             VLA LTL LG+CHGLAS G  EPLRA+L +FQAFCECVGDLEM KILAR GEQN+ EKWI
Sbjct  718   VLAALTLQLGSCHGLASSGQHEPLRAILTSFQAFCECVGDLEMRKILARDGEQNDKEKWI  777

Query  4157  NLIGELAGSISIKRPKE  4207
             NLIG++AG +SIKRPKE
Sbjct  778   NLIGDVAGCVSIKRPKE  794



>ref|XP_003625712.1| HEAT repeat-containing protein 7A [Medicago truncatula]
Length=1835

 Score =  1150 bits (2975),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 627/944 (66%), Positives = 738/944 (78%), Gaps = 62/944 (7%)
 Frame = +2

Query  2303  RIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALV--------------  2440
             RI S FSD  +  ESDD HAALALMYGYAAKYAP +VIEARI+ALV              
Sbjct  875   RILSLFSDSYRTVESDDIHAALALMYGYAAKYAPSSVIEARINALVVGYLFSILLMMEEA  934

Query  2441  --------------------GTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGIS  2560
                                 GTNMLSRLLHVRHP AKQAVITAIDLLG AVI A+ESG  
Sbjct  935   VAMSRVVKDSLEGSMMVVEQGTNMLSRLLHVRHPIAKQAVITAIDLLGNAVINAAESGAP  994

Query  2561  FPLKRRDLLLDYILTLMGRDEEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNL  2740
             FPLKRRD LLDYILTLMGRD+ +GF D N ELL TQ+LA+SACTTLV+VEPKLT ETRN 
Sbjct  995   FPLKRRDQLLDYILTLMGRDDNDGFVDYN-ELLRTQALAISACTTLVTVEPKLTVETRNY  1053

Query  2741  IMKATIGFFGLPNDPSDVINPLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVS  2920
             +MKAT+GFF + NDP +V+ PLIDNLI+LLC IL+T GEDGRSRAE L+ ILR ID FVS
Sbjct  1054  VMKATLGFFAIQNDPVEVVTPLIDNLISLLCAILLTGGEDGRSRAELLMLILRQIDQFVS  1113

Query  2921  SSLEYQRKRGCLAAHELLIKFRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFF  3100
             S +EYQRKRGCLA HE+L+KFR +CV+GYCALG  G+ +H+KQID     N S LPSAF 
Sbjct  1114  SPVEYQRKRGCLAVHEMLLKFRMVCVSGYCALGSHGNSAHTKQIDRTLYGNFSKLPSAFV  1173

Query  3101  LPSRDALSLGERIMVYLPRCIDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGI-DIEL  3277
             LP+R+AL LG+R+++YLPRC DTN EVRK+S QIL+  F+IS SLPKP   S+   DIEL
Sbjct  1174  LPNREALCLGDRVIMYLPRCADTNSEVRKISAQILDQLFSISLSLPKPPGLSISAEDIEL  1233

Query  3278  SYIALSSLEDVVAILRSDASIDPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQ  3457
             SY ALSSLEDV+A+LR+D SIDPSEVFNR++SS+C LL +DELVA LHGCS AICDKIKQ
Sbjct  1234  SYRALSSLEDVIAMLRNDTSIDPSEVFNRIISSLCILLTRDELVAMLHGCSVAICDKIKQ  1293

Query  3458  SAEGAIQAVVEFVTNRGNELNEIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTT  3637
             SAEGAIQAVVEFVT RG+EL EI++SRT+QSL++A VH T+K+LR ETLGAI  +AE+T+
Sbjct  1294  SAEGAIQAVVEFVTRRGSELTEIDISRTTQSLISATVHATDKHLRVETLGAIACLAESTS  1353

Query  3638  SKVVFTEVLAAAGRDMVTKDIHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPA  3817
             +K VF EVLA AG+D+VTKDI RLRGGWP+QDAF+AFSQH+VLS  FLEHVISVI+Q P 
Sbjct  1354  AKTVFDEVLATAGKDIVTKDISRLRGGWPMQDAFYAFSQHMVLSVLFLEHVISVISQIPI  1413

Query  3818  LKGGDSGKGESSRNSVDGSIEDDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltl  3997
             LK  D  + E S+  V    ED    AA+ ALTAFFRGGGK G++ VEQ+YASVL+ L L
Sbjct  1414  LKC-DVDRVEDSQ--VHNHTEDGKLEAAIFALTAFFRGGGKVGKRAVEQNYASVLSELML  1470

Query  3998  hlgtchglaSYGDQEPLRALLNAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELA  4177
              LG+CHGLAS G  EPLR LL AFQAFCECVGDLEMGKILAR GE +ENE+WINLIG++A
Sbjct  1471  QLGSCHGLASSGHLEPLRNLLTAFQAFCECVGDLEMGKILARDGELSENERWINLIGDIA  1530

Query  4178  GSISIKRPKEVPTICLFLSKSLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCR  4357
             G ISIKRPKE+  IC FL +SLDRP + QREAAAAALSEF+RYS G G LL QMV+ +CR
Sbjct  1531  GCISIKRPKEIQNICQFLKRSLDRPQKYQREAAAAALSEFVRYSGGLGSLLEQMVDVVCR  1590

Query  4358  HVSDDSPTVRRLCLRGLVQMPSIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvle  4537
              VSD+S TVRR CLRGLVQ+PSIH+L+YT Q+LGVILALLDDSDESVQLTAVSCLL++LE
Sbjct  1591  RVSDESSTVRRFCLRGLVQIPSIHILKYTAQVLGVILALLDDSDESVQLTAVSCLLMILE  1650

Query  4538  sssTDAVEPVLLNLSIRLRNLQV-----------------------CLNAKIRANAFAAF  4648
             SS  DAVEP+LLNL +RLRNLQV                        +NAK+RA++FA F
Sbjct  1651  SSPDDAVEPILLNLLLRLRNLQVRQFTFNVSSFEFYSVHVSLHPHTSMNAKMRASSFAVF  1710

Query  4649  GALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACRNTLKCIAPLIEIDAIPAL  4828
             GALS+YG G + ++F EQ+HAA PR+VLHLHD+D+ VR ACRNTL+ + PL+EI+ + AL
Sbjct  1711  GALSNYGIGELKEAFVEQVHAAIPRLVLHLHDEDVSVRLACRNTLRRVFPLMEIEGLLAL  1770

Query  4829  LNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSAIIQAF  4960
             LNT  F SDHRSDYEDFLRD+A+Q TQ+L  RVDTY+++ +Q  
Sbjct  1771  LNTPSFLSDHRSDYEDFLRDIAKQFTQHLLSRVDTYMASTVQVL  1814


 Score =   533 bits (1372),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 291/462 (63%), Positives = 340/462 (74%), Gaps = 59/462 (13%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             A WQYS DF  +   D DV+SFLNSAFELLLRVWA SRDLKVR+++VEALGQMVGLITRT
Sbjct  166   AAWQYSTDFPSNLPQDGDVMSFLNSAFELLLRVWAASRDLKVRVASVEALGQMVGLITRT  225

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFE---------  976
             QLKAALPRLVPTILELYK++ D AF+ATCSLH+LLNASLLS +GPP+LDFE         
Sbjct  226   QLKAALPRLVPTILELYKKDLDVAFLATCSLHNLLNASLLSESGPPMLDFEVMYGVKLFL  285

Query  977   ---------------DltvvlstlllvCSNNDKKEHSDFPVGLKTYNEVQHCFLTVGSVY  1111
                                + + L ++  N++ K+ +DF VGLK YNEVQHCFLTVG VY
Sbjct  286   KVIGMLNFFILQLGDLTLTLGTLLPVISMNSESKDQTDFSVGLKMYNEVQHCFLTVGLVY  345

Query  1112  PEDLFVFLLNKCRLKEEPFTFGSLCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGV  1291
             P+DLF+FL+NKCRLKEE  TFG+LCVLKHLLPRL+E+WH K P+L+E+VK L++EHNLGV
Sbjct  346   PDDLFLFLVNKCRLKEEASTFGALCVLKHLLPRLSEAWHGKIPLLVEAVKSLLEEHNLGV  405

Query  1292  RKALAELIVVMASHCYLVGSSGELFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFV  1471
             RKAL+ELIVVMASHCYLVGSSGELFIEYL+RHCA+ D    +L+S               
Sbjct  406   RKALSELIVVMASHCYLVGSSGELFIEYLIRHCALTDKNQSDLDSIPN------------  453

Query  1472  YRKLEFKAGAVTTTELRGVCEKGLLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVAT---  1642
              +++E K GAVT  ELR VCEKGLLL+T+T+PEMEH+LWPFLLKMIIP+ YTGAVA    
Sbjct  454   -KRIEMKIGAVTPGELRTVCEKGLLLVTITIPEMEHILWPFLLKMIIPQTYTGAVAMVKV  512

Query  1643  ------------------VCRCISELCRRRSSESNAMLSECKARTDIPKPEELFARLVVL  1768
                               VCRCISEL R RS  S+ MLSECK R DIP  EEL AR VVL
Sbjct  513   LYLRFDLANLKTSFLPLQVCRCISELWRHRSYGSD-MLSECKTRPDIPTAEELLARFVVL  571

Query  1769  LHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKM  1894
             LH+PLARE L TQIL+VL  LAPLFPKNIN FWQDE+ + +M
Sbjct  572   LHDPLAREQLATQILTVLCLLAPLFPKNINLFWQDEVTVVEM  613


 Score =   242 bits (618),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 132/150 (88%), Gaps = 3/150 (2%)
 Frame = +2

Query  1883  IPKMKAYVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYK  2062
             IPKMKAYVSDT+DLKQDP YQ++WDDMII+FLAESLDVIQ+ DW++ LGN FA+ YELY 
Sbjct  671   IPKMKAYVSDTDDLKQDPSYQDTWDDMIINFLAESLDVIQDADWIMSLGNVFAKHYELYT  730

Query  2063  SDNEHSALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHL  2242
             SD+EH+ALLHRCLGILLQKV+DRAYV  K++ MY+ +NIA+P NRLGLAKAMGLVAASHL
Sbjct  731   SDDEHAALLHRCLGILLQKVNDRAYVHDKMNWMYKHSNIAIPINRLGLAKAMGLVAASHL  790

Query  2243  DTVLDKLKGILDNVGQSILQRIFSFFSDRG  2332
             DTVL+KLK I+DNVGQ+I+QR   F  D G
Sbjct  791   DTVLEKLKDIIDNVGQTIIQR---FMPDLG  817


 Score =   143 bits (361),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 87/106 (82%), Gaps = 2/106 (2%)
 Frame = +1

Query  382  KELNADWQRAAAGVLVSVGSHLPDLMMEEIFLHFSGSNSALPAMVQILADYASSDALQFT  561
            KELN+DWQRAA  +LV++GSHLPDL+MEEIFLH +G++SAL AMVQILA++ASS  L F 
Sbjct  44   KELNSDWQRAATSLLVAIGSHLPDLVMEEIFLHLTGTSSALQAMVQILAEFASSSPLLFI  103

Query  562  PRLKGVLARVVPILGNVREIYRPIFANGL--LAV*RGFLTVYNPRY  693
            PR KGVL+R++PILGNVR+++RP FANG+  L    G +++ +P Y
Sbjct  104  PRWKGVLSRILPILGNVRDMHRPTFANGVLWLTFLNGVISINSPMY  149



>gb|KDO46965.1| hypothetical protein CISIN_1g0006553mg, partial [Citrus sinensis]
Length=767

 Score =  1143 bits (2957),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 582/797 (73%), Positives = 666/797 (84%), Gaps = 30/797 (4%)
 Frame = +2

Query  1817  VLWYLAPLFPKNINSFWQDEL*IPKMKAYVSDTEDLKQDPLYQESWDDMIISFLAESLDV  1996
             VL+YL+PLFP NI+ FWQDE  IPKMKAYVSDTEDLK DP YQE+WDDMII+FLAESLDV
Sbjct  1     VLYYLSPLFPTNIDLFWQDE--IPKMKAYVSDTEDLKLDPSYQETWDDMIINFLAESLDV  58

Query  1997  IQNVDWVLLLGNTFARQYELYKSDNEHSALLHRCLGILLQKVHDRAYVRAKIDLMYRQAN  2176
             +Q  DW++ LGN F  QY LY  D++HSALLHRCLGILLQKV DR YV  KID MY+QAN
Sbjct  59    VQETDWLISLGNAFTEQYVLYTPDDDHSALLHRCLGILLQKVADRNYVCDKIDWMYKQAN  118

Query  2177  IAVPTNRLGLAKAMGLVAASHLDTVLDKLKGILDNVGQSILQRIFSFFSDRGKMEESDDT  2356
             IA+PTNRLGLAKAMGLVAASHLD VL+ LKGILDN+GQS+ QR+ SFFS+  +MEESDD 
Sbjct  119   IAIPTNRLGLAKAMGLVAASHLDAVLEMLKGILDNIGQSLFQRLLSFFSNSYRMEESDDI  178

Query  2357  HAALALMYGYAAKYAPPTVIEARIDALVGTNMLSRLLHVRHPRAKQAVITAIDLLGQAVI  2536
             HAALALMYGYAAKYAP TVIEARIDALVGTNMLSRLLHVRH  AKQAVITAIDLLG+AVI
Sbjct  179   HAALALMYGYAAKYAPSTVIEARIDALVGTNMLSRLLHVRHHTAKQAVITAIDLLGRAVI  238

Query  2537  GASESGISFPLKRRDLLLDYILTLMGRDEEEGFSDSNIELLHTQSLALSACTTLVSVEPK  2716
              A+E+G SFPLK+RD LLDYILTLMGR+E + F+DS+IELLHTQ+LALSACTTLV+VEPK
Sbjct  239   NAAENGASFPLKKRDQLLDYILTLMGREENDSFADSSIELLHTQALALSACTTLVTVEPK  298

Query  2717  LTTETRNLIMKATIGFFGLPNDPSDVINPLIDNLITLLCTILVTSGEDGRSRAEQLLHIL  2896
             LT ETRN +MKAT+GFF LPNDP DV+NPLIDNLITLLC IL+TSGEDGRSRA+QLLHIL
Sbjct  299   LTIETRNHVMKATLGFFALPNDPIDVVNPLIDNLITLLCAILLTSGEDGRSRADQLLHIL  358

Query  2897  RNIDPFVSSSLEYQRKRGCLAAHELLIKFRAICVNGYCALGCQGSCSHSKQIDHAANRNL  3076
             R ID +VSS +EYQR+R CLA +E+L+KFR +CV GYCALGC GSC+H KQID A   N 
Sbjct  359   RQIDQYVSSPVEYQRRRSCLAVYEMLLKFRTLCVIGYCALGCHGSCTHIKQIDRAVLGNF  418

Query  3077  SNLPSAFFLPSRDALSLGERIMVYLPRCIDTNYEVRKVSVQILNLFFNISFSLPKPINSS  3256
             SNLPSA+ LPSR+AL LG R+++YLPRC DT+ EVRK+S QIL+  F+IS SLP+P+ SS
Sbjct  419   SNLPSAYVLPSREALCLGNRVIMYLPRCADTDSEVRKISAQILDQLFSISLSLPRPVGSS  478

Query  3257  LGIDIELSYIALSSLEDVVAILRSDASIDPSEVFNRVVSSVCTLLNKDELVAALHGCSGA  3436
              GID+ELSY ALSSLEDV+AILRSDASIDPSEVFNR+VSSVC LL KDELVA LH C+ A
Sbjct  479   SGIDLELSYGALSSLEDVIAILRSDASIDPSEVFNRIVSSVCILLTKDELVATLHSCTTA  538

Query  3437  ICDKIKQSAEGAIQAVVEFVTNRGNELNEIEVSRTSQSLLTAVVHVTEKYLRQETLGAIC  3616
             ICD+ KQSAEGAIQAVVEFVT RGNEL+E +VSRT+QSLL+A VH+T+K+LR ETLGAI 
Sbjct  539   ICDRTKQSAEGAIQAVVEFVTKRGNELSETDVSRTTQSLLSAAVHITDKHLRLETLGAIS  598

Query  3617  SVAENTTSKVVFTEVLAAAGRDMVTKDIHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVIS  3796
              +AENT SK+VF EVLA AG+D+VTKDI RLRGGWP+QDAFH                  
Sbjct  599   CLAENTNSKIVFNEVLATAGKDIVTKDISRLRGGWPMQDAFH------------------  640

Query  3797  VINQSPALKGGDSGKGESSRNSVDGSIEDDVSRAAVLALTAffrgggkfgrkTVEQSYAS  3976
                       GD  KG+ S +S D  I+DD+ +AA+LALTAFFRGGGK G+K VE+SYA 
Sbjct  641   ----------GDMEKGDYSSHSADTWIDDDILQAAILALTAFFRGGGKVGKKAVEKSYAP  690

Query  3977  VlatltlhlgtchglaSYGDQEPLRALLNAFQAFCECVGDLEMGKILARGGEQNENEKWI  4156
             VLA LTL LG+CHGLAS G  EPLRA+L +FQAFCECVGDLEM KILAR GEQN+ EKWI
Sbjct  691   VLAALTLQLGSCHGLASSGQHEPLRAILTSFQAFCECVGDLEMRKILARDGEQNDKEKWI  750

Query  4157  NLIGELAGSISIKRPKE  4207
             NLIG++AG +SIKRPKE
Sbjct  751   NLIGDVAGCVSIKRPKE  767



>ref|XP_001770412.1| predicted protein [Physcomitrella patens]
 gb|EDQ64749.1| predicted protein [Physcomitrella patens]
Length=1855

 Score =  1136 bits (2938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 685/1606 (43%), Positives = 976/1606 (61%), Gaps = 149/1606 (9%)
 Frame = +2

Query  680   TILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRTQLKAALPRLVPT  859
             T L +D+ + L+SAFEL L  W +SRD KVR +  EALG++VGL+++ QL  ALPRL+P 
Sbjct  258   TPLGSDLQALLHSAFELFLNSWVLSRDRKVRSATAEALGELVGLMSKPQLTLALPRLLPA  317

Query  860   ILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstlllvCSNNDKKEH  1039
             IL +YK+E++    A      ++  ++L N G PL+DF+ L   L+ LL V   +  K  
Sbjct  318   ILAVYKKEKEDPLPAA-HSLHMVLNAVLLNYGSPLVDFQALLATLNVLLPVAYFSTSKGS  376

Query  1040  SD-FPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGSLCVLKHLLPRLA  1216
              D     LK++NEV HCF+ +G+VYPE+++ FLL++ + +E+P   GS  V+KHLL RL+
Sbjct  377   GDELSSYLKSFNEVLHCFVIIGAVYPEEMYTFLLHRLKAREDPIRLGSCSVIKHLLTRLS  436

Query  1217  ESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGELFIEYLVRHCAM  1396
             E W +++  L+E V  L+ E +L  +KA+AELIV MASH      +GE ++E+LV+ CA+
Sbjct  437   EPWASRKVELVEVVGDLLQEKDLNTKKAVAELIVSMASHGVFTKDTGEPYVEFLVQQCAI  496

Query  1397  PDLE-----------------------NVELESSRESSRFTGNYYP-FVYRKLEFKAGAV  1504
              D E                         E+E+ + S ++   Y         +   GAV
Sbjct  497   SDAEVERVQAEHAAIEKAMGMLLASPNKTEMETQQRSIKYLSMYIQDLSISDAQINVGAV  556

Query  1505  TTTELRGVCEKGLLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSS  1684
             + +ELR V EK LLL+   V  +E VLWP LLKM++          V +CISEL RR+ +
Sbjct  557   SPSELRAVSEKSLLLLAGIVANVEVVLWPLLLKMLV----------VEKCISELSRRKLA  606

Query  1685  ESNAMLSECKARTDIPKPEEL---------FARLVVLLHNP----------------LAR  1789
              + ++  +     DIP+PE L         F  +V                      L +
Sbjct  607   RAESIYVDYTLHADIPRPEVLSVHQFVTRSFGSIVGASSRSYGKGSAGVPHFDSGSWLCQ  666

Query  1790  EHLVTQIL-SVLWYLAPLFPKNINSFWQDEL*IPKMKAYVSDTEDLKQDPLYQESWDDMI  1966
              +L   +L  VL+++ PLFP  +   W+DE  IPK++ Y++D +D++ D L Q  W+DMI
Sbjct  667   MYLTFMVLLQVLYHIGPLFPPAVVLLWEDE--IPKLRTYITDADDMRGDALQQTIWEDMI  724

Query  1967  ISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHSALLHRCLGILLQKVHDRAYVRA  2146
             I  L+ESLDVI++ +W + +GN F + Y+LY  DN+HSALLHRC+G+LLQKV++R+YV+ 
Sbjct  725   IHLLSESLDVIRDQEWTISMGNAFTKHYDLYVGDNQHSALLHRCMGMLLQKVNNRSYVQQ  784

Query  2147  KIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDKLKGILDNVGQSILQRIFSFFSD  2326
             KI  MY+ A++A   NRLGLAK MGLVAASHLDTVL+KL+ +L++  Q+ ++R+ ++   
Sbjct  785   KITAMYKHADLADEVNRLGLAKGMGLVAASHLDTVLEKLRRVLESQNQTGIRRVIAYLFS  844

Query  2327  RGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALVGTNMLSRLLHVRHPRAKQAVIT  2506
             +G   E DD  AALALMYGYAA YAP   IEARI+ LVGTNMLS  L+VR P AKQAVIT
Sbjct  845   QGNTTEVDDVCAALALMYGYAASYAPSAAIEARIETLVGTNMLSGFLNVRSPAAKQAVIT  904

Query  2507  AIDLLG----------------------------QAVIGASESGISFPLKRRDLLLDYIL  2602
             AI LLG                            QAV+ A+ +G  FPLK+RD +LDY +
Sbjct  905   AISLLGLLAPTYSSLSSEVYFKNVSSQFDDQIAGQAVLKAAANGAFFPLKKRDTMLDYTM  964

Query  2603  TLMGRDEEEGFSDSNIE-----LLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFF  2767
              LM  D+  G+  S  +     LL TQ LAL+ACTTLVSVEPKLT  TR+ I++AT+GFF
Sbjct  965   ALMA-DQGAGYVLSTSKSLDAGLLRTQELALNACTTLVSVEPKLTMTTRDRILQATLGFF  1023

Query  2768  GLPNDPSDVINPLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKR  2947
              LP +  DV + L+ +L TLLC IL+TSG+DG+SRA+QL H+L+N+D +V+S ++YQR+R
Sbjct  1024  TLPPETVDVTSSLLSSLTTLLCAILLTSGDDGKSRADQLQHLLKNLDQYVASPIDYQRQR  1083

Query  2948  GCLAAHELLIKFRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSL  3127
                    LL +FRA+C  G C   C G+C H   +   A R  S+  +A  LP R+ L L
Sbjct  1084  ASYTVLALLKQFRALCTTGSCPFNCAGNCMH---LRSTAERIQSSSAAAPLLPPREGLKL  1140

Query  3128  GERIMVYLPRCIDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLED  3307
             GERI+ YLPRC D + EVRK + +IL+L F+ S  LP+P+ +    D + SY A+S+LED
Sbjct  1141  GERIIAYLPRCSDVSSEVRKTATEILDLLFSTSLLLPRPVGAEGSEDRQASYAAVSALED  1200

Query  3308  VVAILRSDASIDPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVV  3487
             ++A+   + S + + V   ++SSV  LL   E+VA L GC  AICDK+ QSA+G+I AV 
Sbjct  1201  LIALTNWETSTEDTSVLKGILSSVGVLLTTQEVVAGLKGCVPAICDKVPQSAKGSIIAVT  1260

Query  3488  EFVTNRGNELNEIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLA  3667
             + +  RG E+ E +VSR  Q+L TA  ++ EK  RQ+ L A+C +AE+  ++VVF EVL 
Sbjct  1261  DLIVRRGAEIGEADVSRIIQALFTAASYLHEKINRQKVLAAMCCLAEHPQARVVFNEVLG  1320

Query  3668  AAGRDMVTKDIHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALK--GGDSGK  3841
             AA +D       + +G WP+Q+A+ A + H  LS  FL +V+S+IN  P  +    D   
Sbjct  1321  AADKDASRT---KQKGAWPVQEAYLALANHCNLSLPFLNYVVSIINDVPVFREDEADKAD  1377

Query  3842  GESSRNSVDGSIEDDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchgl  4021
              ESS+N +  ++ + +  AA LAL   FR G +   K VEQ Y++VL  L L +G+CHG 
Sbjct  1378  SESSQNLLPHTL-NKLPAAATLALGCIFRSGNEVATKAVEQQYSAVLCALILRIGSCHGT  1436

Query  4022  aSYGDQEPLRALLNAFQAFCECVGDLEMGKILARGGEQN-ENEKWINLIGELAGSISIKR  4198
             AS  D +PLR ++  FQ+FCECVGD EM ++L R GE     ++W   I E+A   +  R
Sbjct  1437  ASL-DSQPLRDVIPTFQSFCECVGDEEMSQVLMRDGEHRLSGDRWTEAIEEIAACSAKSR  1495

Query  4199  PKEVPTICLFLSKSLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSP  4378
             P++V  IC  +  +L R    QR AAAAALS+++++S+    LLGQ+V  LC H+ DDSP
Sbjct  1496  PQQVSNICTIIWPALKRTRDFQRAAAAAALSDYIKHSEEDEVLLGQLVGVLCAHIGDDSP  1555

Query  4379  TVRRLCLRGLVQMPSIHVLQYTTQILGVILALLDDSDESVQLTAvsclll----vlesss  4546
             +VRRLC++GLVQ+P + V +Y +QIL VI+AL++D++E V L AV  L        E   
Sbjct  1556  SVRRLCVKGLVQIPELGVAKYASQILSVIVALIEDAEEEVALEAVQGLGKILDFEAEVVP  1615

Query  4547  TDAVEPVLLNLSIRLRNLQV----------CLNA------------------------KI  4624
                V P+LLNL +RLR+LQ            LNA                          
Sbjct  1616  EAIVAPMLLNLCVRLRSLQASDSIYAEGTFTLNASGLSWSMYSRNYRTLLSLHGRQKENT  1675

Query  4625  RANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACRNTLKCIAPLI  4804
             RA AFAA G+L+ Y  G  L++F EQ+HA  PR+VLH++D+   V QAC++TLK +APL+
Sbjct  1676  RAAAFAALGSLTRYAVGVQLEAFMEQVHATLPRLVLHINDEAPSVCQACKDTLKRLAPLL  1735

Query  4805  EIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSAIIQAFDAPWPVIQ  4984
                 I AL+N   +      +Y++F+R+ A+ L    G RVDTY++A +QAF++PWP+IQ
Sbjct  1736  HAQDIRALVNLQTYIQSEELEYDEFVREFAKHLVLQFGDRVDTYVTAAMQAFESPWPLIQ  1795

Query  4985  ANAVYLCSSMLS-LSDNKNISALYYSQVFGVLVGKASNSTDAIVRA  5119
             ANAVY    MLS +SD++ + A+Y  QV G LV   +++  A+VRA
Sbjct  1796  ANAVYFAGCMLSEISDSRPL-AIYLPQVTGALVRMTASAPSAVVRA  1840


 Score = 80.9 bits (198),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 68/108 (63%), Gaps = 1/108 (1%)
 Frame = +1

Query  253  RFGNI-AGLFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLV  429
            + GN  AGL  +++  +R +   +VD AFM K+ K+A A++   KE+N DW  +A+ +LV
Sbjct  126  QLGNYRAGLLLIMAHTVREMRDEEVDAAFMRKVTKLAMADLSMNKEMNPDWLHSASSLLV  185

Query  430  SVGSHLPDLMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLK  573
            ++GS  PD+MM+EIF    G +  + A+VQ L+++A      F+ +++
Sbjct  186  ALGSRFPDMMMDEIFNQLGGPSVPVVALVQTLSEFAKLHGWLFSIKMQ  233



>gb|KCW48789.1| hypothetical protein EUGRSUZ_K024311, partial [Eucalyptus grandis]
Length=794

 Score =  1063 bits (2750),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 544/741 (73%), Positives = 631/741 (85%), Gaps = 19/741 (3%)
 Frame = +2

Query  647   CW-----QYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGL  811
             CW      Y ++F   +IL+ DV+SFLNSAFELLLRVWA SRDLKVR ++VEALGQMVGL
Sbjct  66    CWCQATRLYVMEFPSHSILEADVMSFLNSAFELLLRVWAASRDLKVRTTSVEALGQMVGL  125

Query  812   ITRTQLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvv  991
             I RTQLK ALP+LVPT+L+LYKR+Q+ A++ATCSL+++L +SL+S +GPPLLDFEDLTV+
Sbjct  126   INRTQLKGALPKLVPTVLDLYKRDQETAYLATCSLYNVLYSSLMSESGPPLLDFEDLTVI  185

Query  992   lstll-lvCSNNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPF  1168
             LSTLL +VC NN+ KE +DF VGLKTYNEVQ CFLTVGSVYPEDLF FL++KCRLKEE  
Sbjct  186   LSTLLPVVCVNNEGKERADFSVGLKTYNEVQRCFLTVGSVYPEDLFGFLMSKCRLKEESL  245

Query  1169  TFGSLCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVG  1348
             TFG++CVLKHL+PRL+E WH+KR  L+E+VK L+DE +L VRKAL+ELIVVMASHCYLVG
Sbjct  246   TFGAICVLKHLVPRLSEVWHSKRLSLVEAVKSLLDEQSLSVRKALSELIVVMASHCYLVG  305

Query  1349  SSGELFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGV  1528
              SGELF+EYLVRHCA+ D E    ESS+E             R+LE K G V   ELR +
Sbjct  306   PSGELFVEYLVRHCALSDYERTAHESSKEIQN----------RRLEVKIGVVNPAELRAI  355

Query  1529  CEKGLLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRS-SESNAMLS  1705
             CEKGLLL+T+T+PEMEH+LWPFLLKMIIPR+YT AVATVCRCISELCR ++ + +  +LS
Sbjct  356   CEKGLLLLTITIPEMEHILWPFLLKMIIPRMYTSAVATVCRCISELCRHQTYNNTETVLS  415

Query  1706  ECKARTDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*I  1885
             +CKAR DIP PEELFARLVVLLH+PL R+ L T IL+VL+YLAPLFP+N+N FWQDE  I
Sbjct  416   DCKARPDIPSPEELFARLVVLLHDPLERKQLATHILAVLYYLAPLFPRNVNLFWQDE--I  473

Query  1886  PKMKAYVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKS  2065
             PKMKAYVSDTEDLK DP YQE+WDDMII+FLAESLDVIQ++DWV+ LGN+F RQYELY S
Sbjct  474   PKMKAYVSDTEDLKLDPSYQETWDDMIINFLAESLDVIQDIDWVISLGNSFTRQYELYTS  533

Query  2066  DNEHSALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLD  2245
             D+EHSALLHRCLG+LLQKV DRAYV  KI  MY+QANI+ PTNRLGLAKAMGLVAASHLD
Sbjct  534   DDEHSALLHRCLGVLLQKVDDRAYVHDKIAWMYKQANISNPTNRLGLAKAMGLVAASHLD  593

Query  2246  TVLDKLKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEAR  2425
             TVL+KLK ILDNV QS +QR  SFFSD  K  ESDD HAALALMYGYAA+YAP TVI+AR
Sbjct  594   TVLEKLKDILDNVCQSFVQRFLSFFSDSFKGMESDDIHAALALMYGYAARYAPSTVIQAR  653

Query  2426  IDALVGTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILT  2605
             IDALVGTNMLSRLLHV+HP AKQAVITAIDLLG+AVI A+ESG  FPLKRRD LLDYILT
Sbjct  654   IDALVGTNMLSRLLHVQHPTAKQAVITAIDLLGRAVINAAESGAPFPLKRRDQLLDYILT  713

Query  2606  LMGRDEEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDP  2785
             LMGRD+ +G++DSN+ELL TQ+LALSACTTLVSVEPKLT ETRN ++KAT+GFF LPNDP
Sbjct  714   LMGRDDNDGWTDSNLELLRTQALALSACTTLVSVEPKLTIETRNYVLKATLGFFALPNDP  773

Query  2786  SDVINPLIDNLITLLCTILVT  2848
              DV+NPLI+NLI LLC IL+T
Sbjct  774   IDVVNPLINNLIDLLCAILLT  794


 Score =   115 bits (288),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +1

Query  457  MMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIYRPIF  636
            MMEE+FLH SG +SALPAM+QILADYAS+DALQFTPRLKGVL+RV+PILGNVR+ YRPIF
Sbjct  1    MMEEVFLHLSGPSSALPAMIQILADYASADALQFTPRLKGVLSRVLPILGNVRDPYRPIF  60

Query  637  ANGL  648
            AN  
Sbjct  61   ANAF  64



>ref|XP_010507584.1| PREDICTED: protein SHOOT GRAVITROPISM 6-like [Camelina sativa]
Length=1628

 Score =  1047 bits (2708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 537/741 (72%), Positives = 622/741 (84%), Gaps = 27/741 (4%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             A W Y  D +  + LD+DV+SFLNS FELLLRVWA+SRD KVR+S VEALGQMVGLITRT
Sbjct  200   AVWLYITDLTSDSPLDSDVMSFLNSVFELLLRVWAISRDHKVRVSTVEALGQMVGLITRT  259

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstl  1003
             QLK+ALPRL+P ILELYKR+ D A +AT SLH+LLNASLLS +GPPLL+FEDLTVVLSTL
Sbjct  260   QLKSALPRLIPAILELYKRDHDDALLATSSLHNLLNASLLSESGPPLLEFEDLTVVLSTL  319

Query  1004  llvCS-NNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGS  1180
             L V   N++++  SD  VG KTYNEVQ CFLTVG VYPEDLF FLLNKC+LKE+P TFG+
Sbjct  320   LPVIGVNSERRRCSDISVGRKTYNEVQRCFLTVGLVYPEDLFTFLLNKCKLKEDPLTFGA  379

Query  1181  LCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGE  1360
             LC+LKHLLPRL E+WH+KR +L+++   L+DE +L VRKAL+ELIVVMASHCYL G SGE
Sbjct  380   LCILKHLLPRLFEAWHSKRTLLVDTASSLLDEQSLAVRKALSELIVVMASHCYLAGPSGE  439

Query  1361  LFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKG  1540
             LF+EYLVRH A+ + EN                       L+ K   V+ T+LR VC KG
Sbjct  440   LFVEYLVRHSAIGESEN-----------------------LKAKGEPVSPTQLRAVCGKG  476

Query  1541  LLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKAR  1720
             LLL+TVT+PEME++LWPFLLKMIIP+VYTGAVA++CRCISELCRRRSS +  ML ECKAR
Sbjct  477   LLLLTVTIPEMEYILWPFLLKMIIPKVYTGAVASICRCISELCRRRSS-TTPMLIECKAR  535

Query  1721  TDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKA  1900
              DIP PEELF RLVVLLHNPLA++ L +QIL+VL YL+PLFPKNI+ FWQDE  IPKMKA
Sbjct  536   ADIPSPEELFTRLVVLLHNPLAKDQLASQILTVLGYLSPLFPKNISMFWQDE--IPKMKA  593

Query  1901  YVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHS  2080
             YV DTEDL+ DP YQE+WDDMII+FLAESLDV Q+ DWV+ LGN+FA+QY LY  D++H+
Sbjct  594   YVFDTEDLQLDPTYQETWDDMIINFLAESLDVTQDADWVISLGNSFAKQYILYTPDDDHA  653

Query  2081  ALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDK  2260
             ALLHRC+GILLQKV+DRAYVR KID MY QA+I++P NRLGLAKAMGLVAASHLDTVL+K
Sbjct  654   ALLHRCIGILLQKVNDRAYVRDKIDWMYEQADISIPANRLGLAKAMGLVAASHLDTVLEK  713

Query  2261  LKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALV  2440
             LK I+DNVGQSI QRI S FS+  K E SDD HAALALMYGYAAKYAP +VIEARIDALV
Sbjct  714   LKIIVDNVGQSIFQRILSLFSESYKTENSDDIHAALALMYGYAAKYAPSSVIEARIDALV  773

Query  2441  GTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRD  2620
             GTNMLSRLLHVR   AKQAVITAIDLLG+AVI A+ESG +FPLKRRD +LDYILTLMGRD
Sbjct  774   GTNMLSRLLHVRQQTAKQAVITAIDLLGRAVINAAESGATFPLKRRDQMLDYILTLMGRD  833

Query  2621  EEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVIN  2800
             E EGF++S++E+LHTQ+LAL+ACTTLVSVEPKLT ETRN +MKAT+GFF LPNDPSDVI+
Sbjct  834   ENEGFAESSLEVLHTQALALNACTTLVSVEPKLTIETRNRVMKATLGFFALPNDPSDVIS  893

Query  2801  PLIDNLITLLCTILVTSGEDG  2863
             PLIDNL+TLLC IL+TSGEDG
Sbjct  894   PLIDNLVTLLCAILLTSGEDG  914


 Score =   861 bits (2225),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/702 (65%), Positives = 564/702 (80%), Gaps = 3/702 (0%)
 Frame = +2

Query  3089  SAFFLPSRDALSLGERIMVYLPRCIDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGID  3268
             + F  P R+ L LG+R++ YLPRC DTN EVRK+S QIL+ FF+IS SLPK   SS G+D
Sbjct  915   TVFLFPDREVLCLGDRVITYLPRCADTNSEVRKISAQILDQFFSISLSLPKAALSS-GLD  973

Query  3269  IELSYIALSSLEDVVAILRSDASIDPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDK  3448
              E SY ALSSLEDV+AIL+ DASIDPSEVFNR+VSS+C LL  +ELVAAL+ C+ AICDK
Sbjct  974   SEESYKALSSLEDVIAILKRDASIDPSEVFNRIVSSICALLTGNELVAALNSCTAAICDK  1033

Query  3449  IKQSAEGAIQAVVEFVTNRGNELNEIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAE  3628
             I+QSAEGAIQAV EFV+ RG++L++ ++SRT+QSLL+A VH+T+K LR E +GAI  +AE
Sbjct  1034  IRQSAEGAIQAVTEFVSRRGSQLSDNDISRTTQSLLSAAVHITDKNLRVEAVGAISVLAE  1093

Query  3629  NTTSKVVFTEVLAAAGRDMVTKDIHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQ  3808
             NT   +VF EVLA AGRD+VTKDI R+RGGWP+QD F+AFSQH  LS  F+EH+IS++N+
Sbjct  1094  NTQPSIVFNEVLATAGRDIVTKDITRMRGGWPMQDVFYAFSQHTELSVPFMEHLISILNR  1153

Query  3809  SPALKGGDSGKGESSRNSVDGSIEDDVSRAAVLALTAffrgggkfgrkTVEQSYASVlat  3988
             S  +KG DS KGE++ +S +  +EDD+ +AA+ ALTAFFRGGGK G+K VE+SY+SV+  
Sbjct  1154  SSLVKG-DSHKGENTSSSTETHVEDDILQAAIFALTAFFRGGGKIGKKAVEKSYSSVVGA  1212

Query  3989  ltlhlgtchglaSYGDQEPLRALLNAFQAFCECVGDLEMGKILARGGEQNENEKWINLIG  4168
             LTL LG+CHGLAS G Q+PLR LL +FQAFCECVGDLEMGKILAR GEQ E EKW++LIG
Sbjct  1213  LTLQLGSCHGLASSGQQDPLRVLLTSFQAFCECVGDLEMGKILARNGEQREKEKWVDLIG  1272

Query  4169  ELAGSISIKRPKEVPTICLFLSKSLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEA  4348
             ++AG ISIKRPKEV  IC  L+K+L+RP R QREAAAAALSEF+RYS  F  ++ +MVEA
Sbjct  1273  DIAGCISIKRPKEVRHICSILTKALNRPQRFQREAAAAALSEFIRYSGDFSSVMEEMVEA  1332

Query  4349  LCRHVSDDSPTVRRLCLRGLVQMPSIHVLQYTTQILGVILALLDDSDESVQLTAvsclll  4528
             LCRHVSDDSPTVRRLCLRGLVQMPS  +  YTTQ++GVILALLDD DESVQLTAVSCLL+
Sbjct  1333  LCRHVSDDSPTVRRLCLRGLVQMPSACMNHYTTQVIGVILALLDDLDESVQLTAVSCLLM  1392

Query  4529  vlesssTDAVEPVLLNLSIRLRNLQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIH  4708
             V ES+S DAVEP+LLNLS+RLRNLQV ++ K+RANAFAA GALS Y  G   + F EQIH
Sbjct  1393  VTESASNDAVEPILLNLSVRLRNLQVSMDPKMRANAFAALGALSKYAIGGQREGFVEQIH  1452

Query  4709  AAFPRMVLHLHDDDLGVRQACRNTLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRD  4888
             ++ PR+V+H HDDDL +RQACR TLK +A L+ I     L ++  F SD R+DYE+F+RD
Sbjct  1453  SSLPRLVVHFHDDDLSIRQACRATLKRLASLVNIINYSTLYDSRAFGSDDRTDYENFVRD  1512

Query  4889  LARQLTQYLGPRVDTYLSAIIQAFDAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVF  5068
             L++ L Q    RVDTY+++ IQAFDAPWPVIQANA++  ++MLSLS++++I +LYY QVF
Sbjct  1513  LSKHLVQE-SERVDTYMASTIQAFDAPWPVIQANAIHFSTTMLSLSEDQHIISLYYPQVF  1571

Query  5069  GVLVGKASNSTDAIVRATCSAALGLLLKSPNSSSWRDARLNK  5194
               LV K + S D++VRA CS+A GLLL+S  S  WR ARL++
Sbjct  1572  ETLVSKMTRSQDSVVRAACSSAFGLLLRSSKSQLWRGARLDR  1613


 Score =   293 bits (749),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 138/188 (73%), Positives = 165/188 (88%), Gaps = 0/188 (0%)
 Frame = +1

Query  85   GDSIPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGN  264
            G SIPA EAVQ++VSSLADDS  VREASM++L+DI SLNPLLVLDCC  VSRGGRRRFGN
Sbjct  7    GSSIPAPEAVQLLVSSLADDSSVVREASMASLRDIASLNPLLVLDCCYAVSRGGRRRFGN  66

Query  265  IAGLFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSH  444
            +AG+FQV++ ++ AL+KG+ D  FM KLAKIATAE+IS+KELNADWQR A+G+LVS+G+H
Sbjct  67   MAGVFQVMAFSVGALEKGESDAVFMGKLAKIATAEIISSKELNADWQRQASGLLVSIGTH  126

Query  445  LPDLMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIY  624
             PDLMM+EIFLH SG  +A PAMVQILAD+A+SDALQFTPRLK VL+RV PILGNVR+++
Sbjct  127  FPDLMMDEIFLHLSGPATASPAMVQILADFATSDALQFTPRLKDVLSRVSPILGNVRDLH  186

Query  625  RPIFANGL  648
            RPIFAN  
Sbjct  187  RPIFANAF  194



>gb|KCW48788.1| hypothetical protein EUGRSUZ_K024312, partial [Eucalyptus grandis]
Length=794

 Score =  1039 bits (2686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 523/781 (67%), Positives = 647/781 (83%), Gaps = 2/781 (0%)
 Frame = +2

Query  2852  GEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIKFRAICVNGYCALGCQGS  3031
             GEDGRSRAEQLLHILR ID +V+S ++YQRKRGCLAA+++L KFR +C  GYC+LGC G+
Sbjct  1     GEDGRSRAEQLLHILRQIDKYVASPVDYQRKRGCLAAYKMLTKFRMLCATGYCSLGCHGT  60

Query  3032  CSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPRCIDTNYEVRKVSVQILNL  3211
             C+HSKQID     N S+LP+A+ LPSR+ LSLG+R++ YLPRC DT  EVRK+S +IL+ 
Sbjct  61    CTHSKQIDRGLLGNFSSLPTAYVLPSREGLSLGDRVIAYLPRCADTESEVRKISAEILDQ  120

Query  3212  FFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILRSDASIDPSEVFNRVVSSVCTLL  3391
              F+IS SLP+P+ +S+ +D+E SY ALSSLEDV+AILRSDASIDPSEVFNR+VSSVC LL
Sbjct  121   LFSISLSLPRPVTASV-VDVESSYSALSSLEDVIAILRSDASIDPSEVFNRIVSSVCGLL  179

Query  3392  NKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNELNEIEVSRTSQSLLTAVVH  3571
              KDEL++ L GC+ AICDKIKQSAEGAIQAV EFV+ RG ELNE +VSRT+QSLL+A  H
Sbjct  180   TKDELLSTLFGCTTAICDKIKQSAEGAIQAVTEFVSKRGAELNENDVSRTTQSLLSAANH  239

Query  3572  VTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMVTKDIHRLRGGWPIQDAFHAFS  3751
             V EK LR ETL AICS+AENT+SK VF EV+AAAGRD+VTKDI RLRGGWP+QDAF+AFS
Sbjct  240   VAEKQLRLETLSAICSLAENTSSKAVFNEVVAAAGRDIVTKDISRLRGGWPMQDAFYAFS  299

Query  3752  QHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSVDGSIEDDVSRAAVLALTAffrg  3931
             QH +L++SFLEH+IS+INQSP  K  D  K E S   ++G ++++  +AA++ALT+FFRG
Sbjct  300   QHTMLAYSFLEHIISIINQSPGSKD-DLFKVEVSSCGLEGHLDNEFLQAAIVALTSFFRG  358

Query  3932  ggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPLRALLNAFQAFCECVGDLEMGK  4111
             GGK GRK VEQSY+ VL  L + LG+ H LA  G  EPL+ALL AF+AFCECVGDLEMGK
Sbjct  359   GGKVGRKAVEQSYSHVLTELIIQLGSSHVLAGAGQHEPLQALLAAFRAFCECVGDLEMGK  418

Query  4112  ILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICLFLSKSLDRPLRVQREAAAAALS  4291
             ILAR GEQNE+EKW+ LIG+LAGSISIKRPKEV +IC+ LS SL+R  + QREAAAAALS
Sbjct  419   ILARDGEQNEDEKWVTLIGDLAGSISIKRPKEVQSICIILSSSLNRNHKYQREAAAAALS  478

Query  4292  EFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQMPSIHVLQYTTQILGVILA  4471
             EF+RYS GF  +L QMVEA+CRHVSD+SPTVRRLCLRGLVQ+PS+H++QYT Q+LGVILA
Sbjct  479   EFIRYSGGFDSVLEQMVEAMCRHVSDESPTVRRLCLRGLVQIPSVHIVQYTAQVLGVILA  538

Query  4472  LLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSIRLRNLQVCLNAKIRANAFAAFG  4651
             LLDD+DESVQLTAVSCLL +L+S+  +AVEP+LLNLS RLRNLQ+ ++ K+RA+A AAFG
Sbjct  539   LLDDTDESVQLTAVSCLLTILDSAQIEAVEPILLNLSKRLRNLQISMDVKMRADAIAAFG  598

Query  4652  ALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACRNTLKCIAPLIEIDAIPALL  4831
             ALS+Y  G   ++F EQ+HA  PR+V HL+DD+ G+RQACR+TLK +APL E +      
Sbjct  599   ALSNYAIGPQREAFVEQVHAVLPRLVFHLYDDNHGIRQACRSTLKQVAPLFETEGFSMPF  658

Query  4832  NTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSAIIQAFDAPWPVIQANAVYLCSS  5011
             N   F+SDHRSDYEDF+R+LA+Q TQ+L  RVDTY+++ IQAFDAPWP+IQANA+Y   S
Sbjct  659   NVQNFNSDHRSDYEDFVRNLAKQFTQHLSSRVDTYMASTIQAFDAPWPLIQANAIYFACS  718

Query  5012  MLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATCSAALGLLLKSPNSSSWRDARLN  5191
             +LSLSD+++I  +YY+QVF +LVGK S S+ A+VRATC +ALGLLLKS NS SWR+ RL+
Sbjct  719   LLSLSDDQHILTVYYTQVFSLLVGKMSRSSHAVVRATCFSALGLLLKSTNSRSWREVRLD  778

Query  5192  K  5194
             +
Sbjct  779   R  779



>tpg|DAA43367.1| TPA: hypothetical protein ZEAMMB73_966343 [Zea mays]
Length=921

 Score =   969 bits (2506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 525/870 (60%), Positives = 663/870 (76%), Gaps = 5/870 (1%)
 Frame = +2

Query  2552  GISFPLKRRDLLLDYILTLMGRDEEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTET  2731
             GISFPLKRRD LL+Y+LTLMGRD+    +D N ELLHTQSLALSACTTLVS+EP+L  ET
Sbjct  2     GISFPLKRRDQLLEYVLTLMGRDQSNDLTDFNTELLHTQSLALSACTTLVSLEPRLPMET  61

Query  2732  RNLIMKATIGFFGLPNDPSDVINPLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDP  2911
             RN +MKAT+GFF LP +PS ++  L+ NLI LL  IL+TSGEDGRSRAEQLLHILR +DP
Sbjct  62    RNRVMKATLGFFALPTEPSSIVESLVTNLIILLGAILLTSGEDGRSRAEQLLHILRQLDP  121

Query  2912  FVSSSLEYQRKRGCLAAHELLIKFRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPS  3091
             +VSSSLE+QR+RGC+A  E+LIKFR +C  G+ ALG   + + +KQID    R+LS+LPS
Sbjct  122   YVSSSLEHQRRRGCVAVQEVLIKFRNLCSGGFGALGSYPTFTMNKQIDRG-TRSLSSLPS  180

Query  3092  AFFLPSRDALSLGERIMVYLPRCIDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDI  3271
             AF LPSRD+LSLGER M YLPRC DT+ EVRKV++QI+ LFF+IS SLPK       ID+
Sbjct  181   AFVLPSRDSLSLGERTMAYLPRCADTDTEVRKVAIQIIALFFDISLSLPKQKAYPNDIDL  240

Query  3272  ELSYIALSSLEDVVAILRSDASIDPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKI  3451
             E SY ALSSLE++V+I+R +AS+D +E+F RVVSSVC LL+KDELV  LH C+ A CDKI
Sbjct  241   ESSYSALSSLEELVSIVRREASVDQTELFQRVVSSVCILLSKDELVVLLHSCTLATCDKI  300

Query  3452  KQSAEGAIQAVVEFVTNRGNELNEIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAEN  3631
             KQSA+ +IQA++ F+  RG EL E +VSRT+QSLL++ + +T+ + RQE L AI  +AEN
Sbjct  301   KQSADASIQAIIMFIIRRGKELREADVSRTTQSLLSSAISLTDTHSRQEVLNAISCLAEN  360

Query  3632  TTSKVVFTEVLAAAGRDMVTKDIHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQS  3811
             T   VVF EVL+ AG+D+ TKDI R+RGGW IQD F+AFSQH  L+  FLE+ +S++++ 
Sbjct  361   TNHVVVFDEVLSVAGKDICTKDIPRIRGGWAIQDVFYAFSQHKELALLFLEYTLSILHKE  420

Query  3812  PALKGGDSGKGESSRNSVDGSIEDDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatl  3991
             P +    S KGES+  S+    +D + +A + AL AF RGGGK G++ VE+SY SVL+ L
Sbjct  421   PVIINS-SEKGESTSESL---ADDCILQATMFALNAFMRGGGKIGKQAVEKSYPSVLSGL  476

Query  3992  tlhlgtchglaSYGDQEPLRALLNAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGE  4171
              L LG+ +G+A  G  E LR+LL AFQ+FCECVGD+EMGK+LAR GEQ E +KWI L+ E
Sbjct  477   ILKLGSLNGVAELGRNELLRSLLIAFQSFCECVGDVEMGKLLARDGEQTEKDKWIELVQE  536

Query  4172  LAGSISIKRPKEVPTICLFLSKSLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEAL  4351
             +A S S+KRPK+V   C+ L  +L+R  R +REAAAAALSEF+ + +    LL QMVE +
Sbjct  537   IACSSSVKRPKDVLPTCVILCNALNRNQRAEREAAAAALSEFIHHIEKEPTLLEQMVEEM  596

Query  4352  CRHVSDDSPTVRRLCLRGLVQMPSIHVLQYTTQILGVILALLDDSDESVQLTAvsclllv  4531
             C+HVSDDSPTVR LCLRGLVQ P  H+L+Y  Q+LGVILALL+D +ESVQLTAV CLL V
Sbjct  597   CQHVSDDSPTVRSLCLRGLVQAPESHMLKYIQQVLGVILALLEDPNESVQLTAVQCLLNV  656

Query  4532  lesssTDAVEPVLLNLSIRLRNLQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHA  4711
             L  S  DAV P+L+NL +RLRNLQV +N K+R+NAFAA+GALS+YG G    +F EQIHA
Sbjct  657   LNLSEQDAVGPILINLLVRLRNLQVSMNTKMRSNAFAAYGALSAYGVGLQRTAFIEQIHA  716

Query  4712  AFPRMVLHLHDDDLGVRQACRNTLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDL  4891
               PR++LHLHDDDL VR ACRNT + +A L+E++ +  LL+   F+SD RSDYEDF+RDL
Sbjct  717   TLPRLILHLHDDDLSVRLACRNTFQLLATLMEVEGLSVLLSKQYFASDRRSDYEDFIRDL  776

Query  4892  ARQLTQYLGPRVDTYLSAIIQAFDAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFG  5071
              RQL +    RVD+YL + IQAFDAPWPVI+ANAV L S MLS  D++   A Y+SQVF 
Sbjct  777   TRQLCRLSPARVDSYLESAIQAFDAPWPVIRANAVCLVSCMLSFLDDQRFIAPYFSQVFA  836

Query  5072  VLVGKASNSTDAIVRATCSAALGLLLKSPN  5161
              LVG+ S S DAIVRA+ S+ALG+L+K  N
Sbjct  837   TLVGRMSQSPDAIVRASASSALGILIKRSN  866



>ref|XP_002972118.1| hypothetical protein SELMODRAFT_412624 [Selaginella moellendorffii]
 gb|EFJ27035.1| hypothetical protein SELMODRAFT_412624 [Selaginella moellendorffii]
Length=1556

 Score =   927 bits (2397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 571/1394 (41%), Positives = 835/1394 (60%), Gaps = 145/1394 (10%)
 Frame = +2

Query  641   MACWQ-----YSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMV  805
              ACW      Y   +  +  L  D+ + L+SAF+L L  W ++RD KV L+ VEAL QM 
Sbjct  197   FACWSAGMIVYVEKYPSAPYLGPDMQALLHSAFDLFLGRWLLARDAKVSLATVEALAQMF  256

Query  806   GLITRTQLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDlt  985
              LI + QLK+ALP+LVP+IL +YK++    F  T      +   ++  +G P+L+F+ + 
Sbjct  257   PLINKIQLKSALPKLVPSILSVYKKDSSNCFPVT--HALHMLLEVVLPSGQPMLEFQAVV  314

Query  986   vvlstlllvCSNNDKKE-HSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEE  1162
              +L+T+L + S   +KE + +    LK +NEV  CF+ +G+ +PEDLF +LL++   KE 
Sbjct  315   SILNTILPMASIYSRKERNGEASAILKNFNEVATCFVIIGTAFPEDLFNYLLSRLNAKEM  374

Query  1163  PFTFGSLCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAE---------LI  1315
               + G   +LKHLLPRLA SW+ KR  L+E+VK+ + E NL +RKALAE         L+
Sbjct  375   EASLGVFLILKHLLPRLATSWNGKRSTLLEAVKVSLQEPNLNLRKALAEVVFTSIIIQLV  434

Query  1316  VVMASHCYLVGSSGELFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKA  1495
              +M++  +L   +  +F+E+LV+  A+ D E                        L  K 
Sbjct  435   AIMSAVGFLQQDNDRIFLEFLVKQSAITDSE------------------------LRLKV  470

Query  1496  GAVTTTELRGVCEKGLLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRR  1675
             G V+ +ELR V +K L L+  T P ME ++WPFLLK++IP  +TGA+AT+C+CI E+ +R
Sbjct  471   GFVSPSELRVVSDKILYLLASTTPHMEELMWPFLLKVLIPPCFTGAIATLCKCICEIIKR  530

Query  1676  RSSESNAMLSECKARTDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNI  1855
             ++ +   +  + + + D+P+PE L                           ++ LFP  +
Sbjct  531   KNGKGEPVSVDYRLQPDVPRPEALL-------------------------NMSSLFPTAV  565

Query  1856  NSFWQDEL*IPKMKAYVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNT  2035
                W+DE  IPK+KAY+SD+ED   D   QE+W++MI+  L+ES+DVI + +W + + N 
Sbjct  566   QLLWEDE--IPKLKAYISDSED---DSWQQETWEEMILHLLSESVDVISSSEWTMSMANA  620

Query  2036  FARQYELYKSDNEHSALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKA  2215
              +  Y LY+ DN+H A LHRCLG++L KV +R++VR KI  MYRQ+N+A   NRLGLA  
Sbjct  621   LSGHYCLYEGDNQHCAFLHRCLGVVLSKVDNRSFVREKIATMYRQSNVADTANRLGLAMG  680

Query  2216  MGLVAASHLDTVLDKLKGILDNVGQSILQRIF-SFFSDRGKMEESDDTHAALALMYGYAA  2392
             MGLVAASHLDTVL+KLK +L+   +  + R   SFF+ R    + D+ +AALALMYGYAA
Sbjct  681   MGLVAASHLDTVLEKLKDVLEKESRRTITRFLASFFAQREN--DVDNIYAALALMYGYAA  738

Query  2393  KYAPPTVIEARIDALVGTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLK  2572
              YAP TVIEARID LVGTN+LSRLL V+   AKQAVITAI+LLGQAVI A   G+ FPLK
Sbjct  739   SYAPSTVIEARIDKLVGTNVLSRLLDVKSAAAKQAVITAINLLGQAVIKAGAHGVPFPLK  798

Query  2573  RRDLLLDYILTLMGRDEEEGF--SDSNIEL--LHTQSLALSACTTLVSVEPKLTTETRNL  2740
             RRD +LDY++TLM          + S +E   L TQ+LA++ACTTLVSVEPKLT+ +R+ 
Sbjct  799   RRDTMLDYVMTLMVSQTSSYVLATQSLLEADSLRTQNLAINACTTLVSVEPKLTSASRDR  858

Query  2741  IMKATIGFFGLPNDPSDVINPLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVS  2920
             I++AT+ F+ LP +P+ V++ ++ +L  LLC IL TSGEDG+SRA+Q+ H+L ++D ++S
Sbjct  859   ILEATLRFYTLPAEPAPVVDSVLSDLTNLLCVILRTSGEDGKSRADQVHHLLNSLDQYIS  918

Query  2921  SSLEYQRKRGCLAAHELLIKFRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFF  3100
             S +++ R+R C                          CSH                   F
Sbjct  919   SQVDHHRERAC--------------------------CSH------------------LF  934

Query  3101  LPSRDALSLGERIMVYLPRCIDTNYEVRKVS--VQILNLFFNISFSLPKPINSSLGIDIE  3274
             L    +L L  +++      ++T   + K++  +QI++L F+I+ +LPK   SS     +
Sbjct  935   L----SLCLLYKVV----SGMETRQALGKLTFRLQIIDLLFSIALTLPKLGGSSSMESRQ  986

Query  3275  LSYIALSSLEDVVAILRSDASIDPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIK  3454
             +S+ ALSSLE+++A+ + D++ + +    ++V +V  LL  DE       C+ AICD I 
Sbjct  987   VSFGALSSLEELIAVSKWDSTAELAGTLQQIVGAVSILLTNDEY------CNTAICDIIP  1040

Query  3455  QSAEGAIQAVVEFVTNRGNELNEIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENT  3634
             Q  EGA  AV + +  RGN+L E ++   +QSL  A   V E   RQ+ L  +CS+A+ T
Sbjct  1041  QCGEGATFAVKQLILERGNQLGERDIPTITQSLFKAATSVAEVGRRQKVLETVCSLAQET  1100

Query  3635  TSKVVFTEVLAAAGRDMVTKDIHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSP  3814
              S++V +E+LAAA R+   KD  + +G WPI +AF AF+ H+ L+  FL++++SV++Q+P
Sbjct  1101  QSRIVMSELLAAAVREAQVKDSLKQKGSWPIDEAFKAFANHVDLALPFLDYLVSVLDQTP  1160

Query  3815  ALKGGDSGKGESSRNSVDGSIEDDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatlt  3994
              LK  D+ K E S ++    I D    AAV ALT  FR GG   RK +EQ YA+V   L 
Sbjct  1161  VLK-DDTDKNEQSSHA--PHIIDYFPIAAVRALTTAFRVGGDPIRKALEQRYATVFCALL  1217

Query  3995  lhlgtchglaSYGDQEPLRALLNAFQAFCECVGDLEMGKILARGGEQNENEK-WINLIGE  4171
             L +G  HG     D++  R ++ AF+ FC  VGDL+M  ++    ++   E  WI  +G+
Sbjct  1218  LQIGGSHGTTGL-DKQASRDIILAFKTFCRFVGDLDMENVVDSSIDELLTEGYWIKAVGK  1276

Query  4172  LAGSISIKRPKEVPTICLFLSKSLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEAL  4351
             +A  +++  PK+V  IC  L   L R    QR AAAAALSE+++ S G   +L Q+V  L
Sbjct  1277  IAHCVALTHPKKVGAICNLLWPVLKRDYVFQRIAAAAALSEYVKTSRGTADVLEQLVGVL  1336

Query  4352  CRHVSDDSPTVRRLCLRGLVQMPSIHVLQYTTQILGVILALLDDSDESVQLTAvsclllv  4531
              RH+ D+SP VRRLC+ GLVQ+P   + QY  Q+LGVI+ L+DD  ESV   AV  L LV
Sbjct  1337  SRHIGDESPVVRRLCVEGLVQVPHDDMAQYAPQVLGVIVTLIDDDVESVSYAAVQGLPLV  1396

Query  4532  lesssTDAVEPVLLNLSIRLRNLQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHA  4711
             LE ++ + V PVLLNL +RLR+LQ   +  +RA +F A G LS++  GS LD+F EQ   
Sbjct  1397  LEITTEETVVPVLLNLCVRLRSLQTRESVHMRAASFGALGTLSAFATGSQLDAFLEQ--T  1454

Query  4712  AFPRMVLHLHDDDL  4753
              F R+   L  ++L
Sbjct  1455  TFKRIAPLLQAEEL  1468


 Score =   133 bits (334),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 73/210 (35%), Positives = 125/210 (60%), Gaps = 8/210 (4%)
 Frame = +1

Query  85   GDSIPASE---AVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRR  255
             D  PAS     ++ +V +L+D S +VREA+  +L      +  ++LDCCLT  R  +RR
Sbjct  3    SDEEPASHQSVVIRALVGALSDSSDAVREAATISLCKDARGSAHVILDCCLTSLRTVKRR  62

Query  256  FGNIA----GLFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGV  423
             G +A     +  V++  IR +++  +    +  + KI+  E+ S K+L++ W+ AA+ +
Sbjct  63   GGQVAVHRSSVLNVMARTIRDMERMQLSEDKIKSMVKISFTEMTSCKDLDSSWEHAASSL  122

Query  424  LVSVGSHLPDLMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPIL  603
            LV+V   +P L+MEEIFL   G +  + A+VQ LA++++ DA+QF P +KGVL+RV+P+L
Sbjct  123  LVAVCCQMPSLVMEEIFLQLVGGSVPVLALVQALAEFSTIDAVQFVPHMKGVLSRVLPLL  182

Query  604  GNVREIYRPIFANGLLAV*RGFLTVYNPRY  693
            G +++  +  FA+       G + VY  +Y
Sbjct  183  GGIKDAQKKTFADAFACWSAGMI-VYVEKY  211



>ref|XP_002881470.1| binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57729.1| binding protein [Arabidopsis lyrata subsp. lyrata]
Length=1057

 Score =   915 bits (2365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 473/659 (72%), Positives = 552/659 (84%), Gaps = 27/659 (4%)
 Frame = +2

Query  800   MVGLITRTQLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFED  979
             MVGLITRT+LK+ALPRL+P ILELYK++ D A +ATCSLH+LLNASLLS +GPPLLDFED
Sbjct  1     MVGLITRTKLKSALPRLIPAILELYKKDHDDALLATCSLHNLLNASLLSESGPPLLDFED  60

Query  980   ltvvlstlllvCS-NNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLK  1156
             LT+VLSTLL V   N+++K  SD  VG KTYNEVQ CFLTVG VYPEDLF FLLNKC+LK
Sbjct  61    LTIVLSTLLPVIGINSERKRCSDISVGRKTYNEVQRCFLTVGLVYPEDLFTFLLNKCKLK  120

Query  1157  EEPFTFGSLCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHC  1336
             E+P TFG+LC+LKHLLPRL E+WH+K+P+L+++ + L+DE +L VRKAL+ELIVVMASHC
Sbjct  121   EDPLTFGALCILKHLLPRLFEAWHSKQPLLVDTARSLLDEQSLAVRKALSELIVVMASHC  180

Query  1337  YLVGSSGELFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTE  1516
             YL G SGELF+EYLVRH A+ + ++                       L+ KA  V+ T+
Sbjct  181   YLAGPSGELFVEYLVRHSAIGESDD-----------------------LKAKAEPVSPTQ  217

Query  1517  LRGVCEKGLLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNA  1696
             LR VC KGLLL+TVT+PEME++LWPFLLK+IIP+VYTGAVA+VCRCISELCRRRSS +  
Sbjct  218   LRAVCGKGLLLLTVTIPEMEYILWPFLLKVIIPKVYTGAVASVCRCISELCRRRSS-TTP  276

Query  1697  MLSECKARTDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDE  1876
             ML ECKAR DIP PEELF RLVVLLHNPLA+E L +QIL+VL YL+PLFPKNI+ FWQDE
Sbjct  277   MLIECKARADIPSPEELFTRLVVLLHNPLAKEQLASQILTVLGYLSPLFPKNISMFWQDE  336

Query  1877  L*IPKMKAYVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYEL  2056
               IPKMKAYV DTEDLK DP YQE+WDDMII+FLAESLDV Q+ DWV+ LGN FA+QY L
Sbjct  337   --IPKMKAYVFDTEDLKLDPTYQETWDDMIINFLAESLDVTQDADWVISLGNAFAKQYIL  394

Query  2057  YKSDNEHSALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAAS  2236
             Y  D++H+ALLHRC+GILLQKV+DRAYVR KID MY QA+I++P NRLGLAKAMGLVAAS
Sbjct  395   YSPDDDHAALLHRCIGILLQKVNDRAYVRDKIDWMYEQADISIPANRLGLAKAMGLVAAS  454

Query  2237  HLDTVLDKLKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVI  2416
             HLDTVL+KLK I+DNVGQSI QRI S FS+  K E+SDD HAALALMYGYAAKYAP +VI
Sbjct  455   HLDTVLEKLKIIVDNVGQSIFQRILSLFSESYKTEDSDDIHAALALMYGYAAKYAPSSVI  514

Query  2417  EARIDALVGTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDY  2596
             EARIDALVGTNMLSRLLHVR   AKQAVITAIDLLG+AVI A+ESG +FPLKRRD +LDY
Sbjct  515   EARIDALVGTNMLSRLLHVRQQTAKQAVITAIDLLGRAVINAAESGATFPLKRRDQMLDY  574

Query  2597  ILTLMGRDEEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGL  2773
             ILTLMGRDE EGF++S++E+LHTQ+LAL+ACTTLVSVEPKLT ETRN +MK    FF +
Sbjct  575   ILTLMGRDENEGFAESSLEVLHTQALALNACTTLVSVEPKLTVETRNRVMKILDQFFSI  633


 Score =   323 bits (828),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 189/388 (49%), Positives = 244/388 (63%), Gaps = 51/388 (13%)
 Frame = +2

Query  4031  GDQEPLRALLNAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEV  4210
              D +  R LL +FQAFCECVGDLEMGKILAR GEQ E EKW++LIG +AG ISIKRPKE 
Sbjct  706   SDNDISRVLLTSFQAFCECVGDLEMGKILARNGEQREKEKWVDLIGHIAGCISIKRPKE-  764

Query  4211  PTICLFLSKSLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRR  4390
                             +         +     ++   P       + CR +      VR 
Sbjct  765   ---------------NLSFNTGVTGSTYLHDSNESTKPSTKISAGSCCRCI------VRV  803

Query  4391  LCLRGLVQMPSIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVL  4570
               L    QMPS  +  YTTQ++GVIL LLDD +ESVQLTAV+CLL+V ES+S DAVEP+L
Sbjct  804   YTL----QMPSDCMNHYTTQVIGVILVLLDDLEESVQLTAVACLLMVTESASNDAVEPIL  859

Query  4571  LNLSIRLRNLQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDD  4750
             LNLSIRLRNLQV ++ K+RANAFAA GALS Y  G   + F EQ                
Sbjct  860   LNLSIRLRNLQVSMDPKMRANAFAALGALSKYAIGGQREGFVEQ----------------  903

Query  4751  LGVRQACRNTLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVD  4930
                      TLK  APL++I    +L ++  F+S+ R+DYE+F+RDL++ L Q    RVD
Sbjct  904   --------GTLKRFAPLVDIINHSSLYDSRAFASEDRTDYENFVRDLSKHLVQE-SERVD  954

Query  4931  TYLSAIIQAFDAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAI  5110
             TY+++ IQAFDAPWPVIQANA++  ++MLSLS++++I +LYY QVF  LV K + S D++
Sbjct  955   TYMASTIQAFDAPWPVIQANAIHFSTTMLSLSEDQHIISLYYPQVFETLVSKMTRSQDSV  1014

Query  5111  VRATCSAALGLLLKSPNSSSWRDARLNK  5194
             VRA CS+A GLLL+S  S+ WR ARL++
Sbjct  1015  VRAACSSAFGLLLRSSKSTLWRGARLDR  1042


 Score =   106 bits (264),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 79/121 (65%), Gaps = 26/121 (21%)
 Frame = +2

Query  3176  EVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILRSDASIDPSEV  3355
             E R   ++IL+ FF+IS SLPK + +S G+D E SY ALSSLEDV+AIL+S         
Sbjct  618   ETRNRVMKILDQFFSISLSLPKAVLTS-GLDSEDSYKALSSLEDVIAILKS---------  667

Query  3356  FNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNELNEIEVS  3535
                             LVAALH C+ AICDKI+QSAEGAIQAV EFV+ RG++L++ ++S
Sbjct  668   ----------------LVAALHSCTAAICDKIRQSAEGAIQAVTEFVSRRGSQLSDNDIS  711

Query  3536  R  3538
             R
Sbjct  712   R  712



>gb|AAD20157.1| unknown protein [Arabidopsis thaliana]
Length=1071

 Score =   911 bits (2355),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 475/672 (71%), Positives = 552/672 (82%), Gaps = 40/672 (6%)
 Frame = +2

Query  800   MVGLITRTQLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFED  979
             MVGLITRTQLK+ALPRL+P ILELYK++ D A +ATCSLH+LLNASLLS +GPPLLDFED
Sbjct  1     MVGLITRTQLKSALPRLIPAILELYKKDHDDALLATCSLHNLLNASLLSESGPPLLDFED  60

Query  980   ltvvlstlllvCS-NNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLK  1156
             LT+VLSTLL V   NN++K  SD  VG KTYNEVQ CFLTVG VYPEDLF FLLNKC+LK
Sbjct  61    LTIVLSTLLPVIGINNERKRFSDISVGRKTYNEVQRCFLTVGLVYPEDLFTFLLNKCKLK  120

Query  1157  EEPFTFGSLCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHC  1336
             E+P TFG+LC+LKHLLPRL E+WH+KRP+L+++   L+DE +L VRKAL+ELIVVMASHC
Sbjct  121   EDPLTFGALCILKHLLPRLFEAWHSKRPLLVDTASSLLDEQSLAVRKALSELIVVMASHC  180

Query  1337  YLVGSSGELFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTE  1516
             YLVG SGELF+EYLVRH A+ + ++                       L+ K   V+ T+
Sbjct  181   YLVGPSGELFVEYLVRHSAIGESDH-----------------------LKAKGELVSPTQ  217

Query  1517  LRGVCEKGLLLITVTVPEME-------------HVLWPFLLKMIIPRVYTGAVATVCRCI  1657
             LR VC KGLLL+TVT+PEME             ++LWPFLLKMIIP+VYTGAVA+VCRCI
Sbjct  218   LRAVCGKGLLLLTVTIPEMELSDFNAKEYMKLQYILWPFLLKMIIPKVYTGAVASVCRCI  277

Query  1658  SELCRRRSSESNAMLSECKARTDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAP  1837
             +ELCRRRSS +  ML ECKAR DIP PEELF RLVVLLHNPLA+E L +QIL+VL YL+P
Sbjct  278   TELCRRRSS-TTPMLIECKARADIPNPEELFTRLVVLLHNPLAKEQLASQILTVLGYLSP  336

Query  1838  LFPKNINSFWQDEL*IPKMKAYVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWV  2017
             LFPKNI+ FWQDE  IPKMKAYV DTEDLK DP YQE+WDDMII+FLAESLDV Q+ DWV
Sbjct  337   LFPKNISMFWQDE--IPKMKAYVYDTEDLKLDPTYQETWDDMIINFLAESLDVTQDADWV  394

Query  2018  LLLGNTFARQYELYKSDNEHSALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNR  2197
             + LGN+FA+QY LY  D++H+ALLHRC+GILLQKV+DRAYVR KID MY QA+I++P NR
Sbjct  395   ISLGNSFAKQYILYAPDDDHAALLHRCIGILLQKVNDRAYVRDKIDWMYEQADISIPANR  454

Query  2198  LGLAKAMGLVAASHLDTVLDKLKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALM  2377
             LGLAKAMGLVAASHLDTVL+KLK I+DNVGQSI QRI S FS+  K E+SDD HAALALM
Sbjct  455   LGLAKAMGLVAASHLDTVLEKLKIIVDNVGQSIFQRILSLFSESYKTEDSDDIHAALALM  514

Query  2378  YGYAAKYAPPTVIEARIDALVGTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGI  2557
             YGYAAKYAP +VIEARIDALVGTNMLSRLLHVR   AKQAVITAIDLLG+AVI A+E+G 
Sbjct  515   YGYAAKYAPSSVIEARIDALVGTNMLSRLLHVRQQTAKQAVITAIDLLGRAVINAAETGA  574

Query  2558  SFPLKRRDLLLDYILTLMGRDEEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRN  2737
             +FPLKRRD +LDYILTLMGRDE EGF++S++E+LHTQ+LAL+ACTTLVSVEPKLT ETRN
Sbjct  575   TFPLKRRDQMLDYILTLMGRDENEGFAESSLEVLHTQALALNACTTLVSVEPKLTIETRN  634

Query  2738  LIMKATIGFFGL  2773
              +MK    FF +
Sbjct  635   RVMKILDQFFSI  646


 Score =   326 bits (835),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 195/387 (50%), Positives = 247/387 (64%), Gaps = 50/387 (13%)
 Frame = +2

Query  4031  GDQEPLRALLNAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEV  4210
              D +  R LL +FQAFCECVGDLEMGKILAR GEQ E EKW+ LIG++AG ISIKRPKEV
Sbjct  719   SDNDISRVLLTSFQAFCECVGDLEMGKILARNGEQIEKEKWVGLIGDIAGCISIKRPKEV  778

Query  4211  PTICLFLSKSLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRR  4390
                   LS S                S +L  S+       ++ +  C         VR 
Sbjct  779   D-----LSFS-----------TGVTGSTYLHDSNKSTKPSTKISKGSCCCC-----IVRV  817

Query  4391  LCLRGLVQMPSIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVL  4570
               L    QMPS  +  YTTQ++GVILALLDD DESVQLTAVSCLL+V ES+S DAVEP+L
Sbjct  818   YTL----QMPSACMSHYTTQVIGVILALLDDLDESVQLTAVSCLLMVTESASNDAVEPIL  873

Query  4571  LNLSIRLRNLQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDD  4750
             LNLS+RLRNLQV ++ K+RANAF+A GALS Y  G   + F EQ+               
Sbjct  874   LNLSVRLRNLQVSMDPKMRANAFSALGALSKYATGGQREGFVEQV---------------  918

Query  4751  LGVRQACRNTLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVD  4930
                      TLK  APL++I     L ++  F S+ R+DYE+F+RDL++ L Q    RVD
Sbjct  919   ---------TLKRFAPLVDIINYSTLYDSRAFGSEDRTDYENFVRDLSKHLVQE-SERVD  968

Query  4931  TYLSAIIQAFDAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAI  5110
             TY+++ IQAFDAPWPVIQANA++  ++MLSLS++++I +LYY QVF  LV K + S D++
Sbjct  969   TYMASTIQAFDAPWPVIQANAIHFSTTMLSLSEDQHIISLYYPQVFETLVSKMTRSQDSV  1028

Query  5111  VRATCSAALGLLLKSPNSSSWRDARLN  5191
             VRA CS+A GLLL+S  S+ WR ARL+
Sbjct  1029  VRAACSSAFGLLLRSSKSTLWRGARLD  1055


 Score =   106 bits (265),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 79/121 (65%), Gaps = 26/121 (21%)
 Frame = +2

Query  3176  EVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILRSDASIDPSEV  3355
             E R   ++IL+ FF+IS SLPK + +S G+D E SY ALSSLEDV+AIL+S         
Sbjct  631   ETRNRVMKILDQFFSISLSLPKAVLTS-GLDSEDSYKALSSLEDVIAILKS---------  680

Query  3356  FNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNELNEIEVS  3535
                             LVAALH C+ AICDKI+QSAEGAIQAV EFV+ RG++L++ ++S
Sbjct  681   ----------------LVAALHSCTAAICDKIRQSAEGAIQAVTEFVSRRGSQLSDNDIS  724

Query  3536  R  3538
             R
Sbjct  725   R  725



>gb|ABF93965.1| HEAT repeat family protein, expressed [Oryza sativa Japonica 
Group]
Length=853

 Score =   903 bits (2334),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 495/812 (61%), Positives = 621/812 (76%), Gaps = 6/812 (1%)
 Frame = +2

Query  2726  ETRNLIMKATIGFFGLPNDPSDVINPLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNI  2905
             ETRN +MKAT+GFF LP +PS+++  LI NLI LL  IL+TSGEDGRSRAEQLLHILR +
Sbjct  2     ETRNRVMKATLGFFALPTEPSNIVESLITNLIILLGAILLTSGEDGRSRAEQLLHILRQL  61

Query  2906  DPFVSSSLEYQRKRGCLAAHELLIKFRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNL  3085
             DP+VSSS E+QR+RGC A +E+L+KFR +C  G+  LG   + + +KQID AA R+LS+L
Sbjct  62    DPYVSSSAEHQRRRGCAAVNEVLVKFRNLCSGGFGVLGSYPTFTLNKQIDQAAPRSLSSL  121

Query  3086  PSAFFLPSRDALSLGERIMVYLPRCIDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGI  3265
             PSAF LP+RD+LSLGERIM YLPRC DT+ EVRKV++QIL LFFNI+ SLPK   S   I
Sbjct  122   PSAFVLPTRDSLSLGERIMAYLPRCADTDAEVRKVAIQILALFFNIALSLPKKKASVNDI  181

Query  3266  DIELSYIALSSLEDVVAILRSDASIDPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICD  3445
             D+E SY ALSSLED+V+I+R +ASID +EVF+RVVSS+C LL+KDELV  LH C+ A CD
Sbjct  182   DLESSYSALSSLEDIVSIIRREASIDQAEVFHRVVSSLCVLLSKDELVVLLHSCTLAACD  241

Query  3446  KIKQSAEGAIQAVVEFVTNRGNELNEIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVA  3625
             K+KQS++G+IQA++ F+  RG EL E +V RT+QSLL++ V +T K  R+E L AI  +A
Sbjct  242   KVKQSSDGSIQAIIMFIIRRGKELREADVLRTTQSLLSSAVSLTNKESRREVLNAISCLA  301

Query  3626  ENTTSKVVFTEVLAAAGRDMVTKDIHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVIN  3805
             ENT   VVF EVL  AGRD+ TKDI R+RGGW IQD FHAFSQH VL+  FLE+++S+++
Sbjct  302   ENTNHTVVFNEVLFVAGRDICTKDIARIRGGWAIQDVFHAFSQHKVLAILFLEYILSILH  361

Query  3806  QSPALKGGDSGKGESSRNSVDGSIEDDVSRAAVLALTAffrgggkfgrkTVEQSYASVla  3985
             + P +   DS KGE +  S   S +D + +A + AL AF RGGGK G++ VEQSY SVL+
Sbjct  362   KEP-VATNDSEKGEITSES---SADDCILQATMFALNAFLRGGGKIGKQAVEQSYPSVLS  417

Query  3986  tltlhlgtchglaSYGDQEPLRALLNAFQAFCECVGDLEMGKILARGGEQNENEKWINLI  4165
              L L LG+ HGLA  G  E LR+LL AFQ+FC+CVGD+EMGKILAR GEQ E EKWI+L+
Sbjct  418   ALILKLGSLHGLAELGRNELLRSLLIAFQSFCDCVGDIEMGKILARDGEQTEKEKWIDLV  477

Query  4166  GELAGSISIKRPKEVPTICLFLSKSLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVE  4345
              E+A S S+KRPKEV   C  LSK+L++  R +REAAAAALSE++R+S+    LL QMV 
Sbjct  478   QEVACSSSVKRPKEVLPTCSILSKALNKNQRAEREAAAAALSEYIRHSEKEPILLDQMVL  537

Query  4346  ALCRHVSDDSPTVRRLCLRGLVQMPSIHVLQYTTQILGVILALLDDSDESVQLTAvscll  4525
              LC+HVSDDSPTVR LCLRGLVQ+P   + +Y  Q+LGVILALL+D+ ESVQLTAV CLL
Sbjct  538   ELCQHVSDDSPTVRSLCLRGLVQIPESCIPKYIQQVLGVILALLEDTKESVQLTAVQCLL  597

Query  4526  lvlesssTDAVEPVLLNLSIRLRNLQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQI  4705
              VL  S  DA++PVL+NL +RLRNLQV +N K+R+NAFA +GALS+YG GS    F EQI
Sbjct  598   TVLNVSEQDAIDPVLINLLVRLRNLQVSMNTKMRSNAFAVYGALSAYGVGS--QQFLEQI  655

Query  4706  HAAFPRMVLHLHDDDLGVRQACRNTLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLR  4885
             HA  PR++LHLHDDDL VR ACRNT + +APL+E+D + +LL+   F+SD RSDYEDF+R
Sbjct  656   HATLPRLILHLHDDDLSVRLACRNTFQLLAPLMEVDGLSSLLSKKYFTSDRRSDYEDFIR  715

Query  4886  DLARQLTQYLGPRVDTYLSAIIQAFDAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQV  5065
             DL RQL +    RVD+Y  + IQAFDAPWPVI+ANAV L S MLS  D++   A Y+SQV
Sbjct  716   DLTRQLCRLSPARVDSYFESAIQAFDAPWPVIKANAVCLVSCMLSFLDDQRFLAPYFSQV  775

Query  5066  FGVLVGKASNSTDAIVRATCSAALGLLLKSPN  5161
             F +LVG+ S S DA+VRA  S+ALGLL+K  N
Sbjct  776   FAILVGRLSQSPDAVVRAASSSALGLLIKRSN  807



>gb|EMT01688.1| HEAT repeat-containing 7A-like protein [Aegilops tauschii]
Length=1258

 Score =   876 bits (2263),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 460/734 (63%), Positives = 572/734 (78%), Gaps = 20/734 (3%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             A W Y  D S     D DV+SF+NS FELLL+VW  SRDLKVRLS+VEALG+MVGL+TR+
Sbjct  169   AAWVYIGDASSGLPFDDDVMSFMNSVFELLLKVWTGSRDLKVRLSSVEALGEMVGLVTRS  228

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstl  1003
             QLK+ALPR++PT+L+L K++Q+ AF A  SLH+LLNASLLS +GPPLL+FE+L VVL TL
Sbjct  229   QLKSALPRIIPTMLDLCKKDQEVAFTAAHSLHNLLNASLLSESGPPLLEFEELAVVLITL  288

Query  1004  llvCSNN-DKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGS  1180
             L + S N  K E S    GLKTYNE+QHCFL  G  YPEDL +FLL+KCR K+E    G+
Sbjct  289   LPLVSVNISKDERSYISKGLKTYNELQHCFLVTGLAYPEDLCMFLLSKCRSKDEASIVGA  348

Query  1181  LCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGE  1360
             L  +KHLLPRL ESWH K+ +L+E VK L++E +LG+R ALAELIVVMASHCYL G S E
Sbjct  349   LGTIKHLLPRLLESWHTKQTLLVEIVKSLLEEQSLGIRMALAELIVVMASHCYLSGHSAE  408

Query  1361  LFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKG  1540
             L +E+LV H A+ D +  ++ + +       N Y F  ++ E K      +ELR VCEKG
Sbjct  409   LAVEFLVGHSAITDDDLNDINTLK-------NEY-FQDKRFEMKISLAGLSELRAVCEKG  460

Query  1541  LLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKAR  1720
             LLL+ +T+PEME VLWPFLL++IIP+ YTGAVATVC+CI+ELCR + S++N + +E  A 
Sbjct  461   LLLLAITIPEMELVLWPFLLQLIIPKKYTGAVATVCKCITELCRHKLSQTNPLYTEFNAS  520

Query  1721  TDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKA  1900
              ++P PE+LFARL+VLLHNPLAR  L TQIL+VL YL  LFP+N++ FW+DE  +PKMKA
Sbjct  521   NEMPSPEDLFARLLVLLHNPLARGQLATQILTVLCYLGQLFPRNLSLFWEDE--VPKMKA  578

Query  1901  YVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHS  2080
             Y+SD EDLKQD  YQE WD+MII+FLAESLDV+ +  WV+ LG+ FARQY+LY + + HS
Sbjct  579   YISDPEDLKQDSTYQEIWDNMIINFLAESLDVVNDNVWVISLGDAFARQYDLYATSDGHS  638

Query  2081  ALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDK  2260
             ALLHRCLG+LLQKV DR YVR KIDLM R +++++P NRLGLA+ +GLVAASHLDTVL+K
Sbjct  639   ALLHRCLGMLLQKVDDRIYVREKIDLMCRHSSMSIPVNRLGLAQGIGLVAASHLDTVLEK  698

Query  2261  LKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALV  2440
             LK IL+N GQS LQR  SFFS R K+E+ DDT+AALALMYGYAA+YAP TVIEARI+ALV
Sbjct  699   LKNILENAGQSALQRFLSFFSFREKVEDVDDTYAALALMYGYAARYAPSTVIEARINALV  758

Query  2441  GTNMLSRLLHVRHPRAKQAVITAIDLL---------GQAVIGASESGISFPLKRRDLLLD  2593
             GT+ML R LHV+HP AKQAVITAIDLL         G+AVI A+E GISFPL+RRD LL+
Sbjct  759   GTDMLGRFLHVQHPTAKQAVITAIDLLVHIYFRKTCGRAVISAAEIGISFPLQRRDQLLE  818

Query  2594  YILTLMGRDEEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGL  2773
             Y+LTLMGRD+ +   D +IELL TQ++ALSACTTLVS+EP+L  ETRN +MKAT+GFF L
Sbjct  819   YVLTLMGRDQSDDLVDFSIELLQTQTVALSACTTLVSIEPRLPMETRNRVMKATLGFFAL  878

Query  2774  PNDPSDVINPLIDN  2815
             P +PS+++  LI N
Sbjct  879   PTEPSNIVESLITN  892


 Score =   216 bits (549),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 100/150 (67%), Positives = 131/150 (87%), Gaps = 0/150 (0%)
 Frame = +1

Query  106  EAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGNIAGLFQV  285
            EAVQV+V+SLADDSP  R+++++AL++I  LNPLLVLDCC TVSRGG RRFGN+AG+F V
Sbjct  15   EAVQVLVASLADDSPRARDSALAALREIAPLNPLLVLDCCATVSRGGHRRFGNMAGVFLV  74

Query  286  ISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLPDLMME  465
            ++ A+RALD+ D +  F+ K+AKIATAE++S+K+ N DWQRAAA +LV++GSH PDLMME
Sbjct  75   MASAVRALDRLDAEREFLRKIAKIATAEIVSSKDFNVDWQRAAATLLVAIGSHDPDLMME  134

Query  466  EIFLHFSGSNSALPAMVQILADYASSDALQ  555
            EIFL+FSG  SALPAM+QILAD+AS++AL+
Sbjct  135  EIFLYFSGPTSALPAMLQILADFASAEALK  164


 Score =   291 bits (745),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 189/375 (50%), Positives = 242/375 (65%), Gaps = 43/375 (11%)
 Frame = +2

Query  3083  LPSAFFLPSRDALSLGERIMVYLPRCIDTNYEVRKVSVQILNLFFNISFSLPKPINSSLG  3262
             +P+AF LP+RD+LSLGERIM YLPRC DT+ EVRKV++QI+ LFFNIS SLPK   S+  
Sbjct  912   VPAAFVLPNRDSLSLGERIMAYLPRCADTDDEVRKVAIQIIALFFNISLSLPKQKTSAND  971

Query  3263  IDIELSYIALSSLEDVVAILRSDASIDPSEVFNRVVSSVCTLLNKDELVAALHGCSGAIC  3442
             ID+E SY ALSSLED+V+I+R  AS+D  EVF+RVVSSVC LL+KDELV  LH C+ A C
Sbjct  972   IDLESSYGALSSLEDIVSIIRR-ASVDQIEVFHRVVSSVCILLSKDELVVLLHSCTLAAC  1030

Query  3443  DKIKQSAEGAIQAVVEFVTNRGNELNEIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSV  3622
             DK+KQSA+G+IQA++ F+  RG +L E +V                       L     V
Sbjct  1031  DKVKQSADGSIQAIIVFIIRRGKDLREADV-----------------------LSGAVDV  1067

Query  3623  AENTTSKVVFTEVLAAAGRDMVTKDIHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVI  3802
                  S V   E   +  +    KDI               FSQH VL+  FLE+++S++
Sbjct  1068  VSGDASLVTILE--KSQLKRTSRKDI-------------LVFSQHKVLATLFLEYILSIL  1112

Query  3803  NQSPALKGGDSGKGESSRNSVDGSIEDDVSRAAVLALTAffrgggkfgrkTVEQSYASVl  3982
             ++ P +   DS KGE +  S   S +D + +A + AL AF RGGGK G++ VEQSY SVL
Sbjct  1113  HKEP-VATNDSEKGEINSES---SADDCILQATMFALNAFLRGGGKVGKQAVEQSYPSVL  1168

Query  3983  atltlhlgtchglaSYGDQEPLRALLNAFQAFCECVGDLEMGKILARGGEQNENEKWINL  4162
             + L L LG  HGLA  G  E LR+LL AFQ+FC+CVGD+EMGKILAR GE+ E EKWI+L
Sbjct  1169  SALILKLGGLHGLAELGRNELLRSLLIAFQSFCDCVGDVEMGKILARDGERTEKEKWIDL  1228

Query  4163  IGELAGSISIKRPKE  4207
             + E+A S S+KRP E
Sbjct  1229  VQEVACSSSVKRPNE  1243



>gb|AAO00894.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP68235.1| At2g36810 [Arabidopsis thaliana]
 dbj|BAE99257.1| hypothetical protein [Arabidopsis thaliana]
Length=723

 Score =   879 bits (2271),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/707 (65%), Positives = 573/707 (81%), Gaps = 3/707 (0%)
 Frame = +2

Query  3071  NLSNLPSAFFLPSRDALSLGERIMVYLPRCIDTNYEVRKVSVQILNLFFNISFSLPKPIN  3250
             N SNLPS F  P R+ L LG+R++ YLPRC DTN EVRK+S QIL+ FF+IS SLPK + 
Sbjct  4     NFSNLPSVFLFPDREVLCLGDRVITYLPRCADTNSEVRKISAQILDQFFSISLSLPKAVL  63

Query  3251  SSLGIDIELSYIALSSLEDVVAILRSDASIDPSEVFNRVVSSVCTLLNKDELVAALHGCS  3430
             +S G+D E SY ALSSLEDV+AIL+SDASIDPSEVFNR+VSS+C+LL + ELVAALH C+
Sbjct  64    TS-GLDSEDSYKALSSLEDVIAILKSDASIDPSEVFNRIVSSICSLLTEHELVAALHSCT  122

Query  3431  GAICDKIKQSAEGAIQAVVEFVTNRGNELNEIEVSRTSQSLLTAVVHVTEKYLRQETLGA  3610
              AICDKI+QSAEGAIQAV EFV+ RG++L++ ++SRT+ SLL+A VH+T+K LR E +GA
Sbjct  123   AAICDKIRQSAEGAIQAVTEFVSRRGSQLSDNDISRTTHSLLSAAVHITDKNLRVEAIGA  182

Query  3611  ICSVAENTTSKVVFTEVLAAAGRDMVTKDIHRLRGGWPIQDAFHAFSQHLVLSHSFLEHV  3790
             I ++AENT S +VF EVLA AG+D+VTKDI R+RGGWP+QDAF+AFSQH  LS  F+EH+
Sbjct  183   ISALAENTQSSIVFNEVLATAGKDIVTKDITRMRGGWPMQDAFYAFSQHTELSVLFMEHL  242

Query  3791  ISVINQSPALKGGDSGKGESSRNSVDGSIEDDVSRAAVLALTAffrgggkfgrkTVEQSY  3970
             IS++N+S  +K  DS KGE++ +S +  +EDD+ +AA+ ALTAFFRGGGK G+K VE+SY
Sbjct  243   ISILNRSSLVKS-DSHKGENTSSSSETHVEDDILQAAIFALTAFFRGGGKIGKKAVEKSY  301

Query  3971  ASVlatltlhlgtchglaSYGDQEPLRALLNAFQAFCECVGDLEMGKILARGGEQNENEK  4150
             +SV+  LTL LG+CHGLAS G Q+PLR LL +FQAFCECVGDLEMGKILAR GEQ E EK
Sbjct  302   SSVVGALTLQLGSCHGLASSGQQDPLRVLLTSFQAFCECVGDLEMGKILARNGEQIEKEK  361

Query  4151  WINLIGELAGSISIKRPKEVPTICLFLSKSLDRPLRVQREAAAAALSEFLRYSDGFGPLL  4330
             W+ LIG++AG ISIKRPKEV  IC+ L+K+L+RP R QREAAAAALSEF+RYS  F  ++
Sbjct  362   WVGLIGDIAGCISIKRPKEVRHICMILTKALNRPQRFQREAAAAALSEFIRYSGDFSSVM  421

Query  4331  GQMVEALCRHVSDDSPTVRRLCLRGLVQMPSIHVLQYTTQILGVILALLDDSDESVQLTA  4510
              +MVEALCRHVSDDSPTVRRLCLRGLVQMPS  +  YTTQ++GVILALLDD DESVQLTA
Sbjct  422   EEMVEALCRHVSDDSPTVRRLCLRGLVQMPSACMSHYTTQVIGVILALLDDLDESVQLTA  481

Query  4511  vsclllvlesssTDAVEPVLLNLSIRLRNLQVCLNAKIRANAFAAFGALSSYGAGSILDS  4690
             VSCLL+V ES+S DAVEP+LLNLS+RLRNLQV ++ K+RANAF+A GALS Y  G   + 
Sbjct  482   VSCLLMVTESASNDAVEPILLNLSVRLRNLQVSMDPKMRANAFSALGALSKYATGGQREG  541

Query  4691  FREQIHAAFPRMVLHLHDDDLGVRQACRNTLKCIAPLIEIDAIPALLNTHRFSSDHRSDY  4870
             F EQIH+  PR+V+HLHDDD  +RQACR TLK  APL++I     L ++  F S+ R+DY
Sbjct  542   FVEQIHSTLPRLVVHLHDDDPSIRQACRVTLKRFAPLVDIINYSTLYDSRAFGSEDRTDY  601

Query  4871  EDFLRDLARQLTQYLGPRVDTYLSAIIQAFDAPWPVIQANAVYLCSSMLSLSDNKNISAL  5050
             E+F+RDL++ L Q    RVDTY+++ IQAFDAPWPVIQANA++  ++MLSLS++++I +L
Sbjct  602   ENFVRDLSKHLVQE-SERVDTYMASTIQAFDAPWPVIQANAIHFSTTMLSLSEDQHIISL  660

Query  5051  YYSQVFGVLVGKASNSTDAIVRATCSAALGLLLKSPNSSSWRDARLN  5191
             YY QVF  LV K + S D++VRA CS+A GLLL+S  S+ WR ARL+
Sbjct  661   YYPQVFETLVSKMTRSQDSVVRAACSSAFGLLLRSSKSTLWRGARLD  707



>tpg|DAA43368.1| TPA: hypothetical protein ZEAMMB73_966343 [Zea mays]
Length=859

 Score =   870 bits (2247),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 476/806 (59%), Positives = 608/806 (75%), Gaps = 5/806 (1%)
 Frame = +2

Query  2744  MKATIGFFGLPNDPSDVINPLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSS  2923
              +AT+GFF LP +PS ++  L+ NLI LL  IL+TSGEDGRSRAEQLLHILR +DP+VSS
Sbjct  4     FQATLGFFALPTEPSSIVESLVTNLIILLGAILLTSGEDGRSRAEQLLHILRQLDPYVSS  63

Query  2924  SLEYQRKRGCLAAHELLIKFRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFL  3103
             SLE+QR+RGC+A  E+LIKFR +C  G+ ALG   + + +KQID    R+LS+LPSAF L
Sbjct  64    SLEHQRRRGCVAVQEVLIKFRNLCSGGFGALGSYPTFTMNKQIDRG-TRSLSSLPSAFVL  122

Query  3104  PSRDALSLGERIMVYLPRCIDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSY  3283
             PSRD+LSLGER M YLPRC DT+ EVRKV++QI+ LFF+IS SLPK       ID+E SY
Sbjct  123   PSRDSLSLGERTMAYLPRCADTDTEVRKVAIQIIALFFDISLSLPKQKAYPNDIDLESSY  182

Query  3284  IALSSLEDVVAILRSDASIDPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSA  3463
              ALSSLE++V+I+R +AS+D +E+F RVVSSVC LL+KDELV  LH C+ A CDKIKQSA
Sbjct  183   SALSSLEELVSIVRREASVDQTELFQRVVSSVCILLSKDELVVLLHSCTLATCDKIKQSA  242

Query  3464  EGAIQAVVEFVTNRGNELNEIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSK  3643
             + +IQA++ F+  RG EL E +VSRT+QSLL++ + +T+ + RQE L AI  +AENT   
Sbjct  243   DASIQAIIMFIIRRGKELREADVSRTTQSLLSSAISLTDTHSRQEVLNAISCLAENTNHV  302

Query  3644  VVFTEVLAAAGRDMVTKDIHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALK  3823
             VVF EVL+ AG+D+ TKDI R+RGGW IQD F+AFSQH  L+  FLE+ +S++++ P + 
Sbjct  303   VVFDEVLSVAGKDICTKDIPRIRGGWAIQDVFYAFSQHKELALLFLEYTLSILHKEPVII  362

Query  3824  GGDSGKGESSRNSVDGSIEDDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhl  4003
                S KGES+  S+    +D + +A + AL AF RGGGK G++ VE+SY SVL+ L L L
Sbjct  363   NS-SEKGESTSESL---ADDCILQATMFALNAFMRGGGKIGKQAVEKSYPSVLSGLILKL  418

Query  4004  gtchglaSYGDQEPLRALLNAFQAFCECVGDLEMGKILARGGEQNENEKWINLIGELAGS  4183
             G+ +G+A  G  E LR+LL AFQ+FCECVGD+EMGK+LAR GEQ E +KWI L+ E+A S
Sbjct  419   GSLNGVAELGRNELLRSLLIAFQSFCECVGDVEMGKLLARDGEQTEKDKWIELVQEIACS  478

Query  4184  ISIKRPKEVPTICLFLSKSLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHV  4363
              S+KRPK+V   C+ L  +L+R  R +REAAAAALSEF+ + +    LL QMVE +C+HV
Sbjct  479   SSVKRPKDVLPTCVILCNALNRNQRAEREAAAAALSEFIHHIEKEPTLLEQMVEEMCQHV  538

Query  4364  SDDSPTVRRLCLRGLVQMPSIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvless  4543
             SDDSPTVR LCLRGLVQ P  H+L+Y  Q+LGVILALL+D +ESVQLTAV CLL VL  S
Sbjct  539   SDDSPTVRSLCLRGLVQAPESHMLKYIQQVLGVILALLEDPNESVQLTAVQCLLNVLNLS  598

Query  4544  sTDAVEPVLLNLSIRLRNLQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPR  4723
               DAV P+L+NL +RLRNLQV +N K+R+NAFAA+GALS+YG G    +F EQIHA  PR
Sbjct  599   EQDAVGPILINLLVRLRNLQVSMNTKMRSNAFAAYGALSAYGVGLQRTAFIEQIHATLPR  658

Query  4724  MVLHLHDDDLGVRQACRNTLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQL  4903
             ++LHLHDDDL VR ACRNT + +A L+E++ +  LL+   F+SD RSDYEDF+RDL RQL
Sbjct  659   LILHLHDDDLSVRLACRNTFQLLATLMEVEGLSVLLSKQYFASDRRSDYEDFIRDLTRQL  718

Query  4904  TQYLGPRVDTYLSAIIQAFDAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVG  5083
              +    RVD+YL + IQAFDAPWPVI+ANAV L S MLS  D++   A Y+SQVF  LVG
Sbjct  719   CRLSPARVDSYLESAIQAFDAPWPVIRANAVCLVSCMLSFLDDQRFIAPYFSQVFATLVG  778

Query  5084  KASNSTDAIVRATCSAALGLLLKSPN  5161
             + S S DAIVRA+ S+ALG+L+K  N
Sbjct  779   RMSQSPDAIVRASASSALGILIKRSN  804



>gb|KDO46964.1| hypothetical protein CISIN_1g0006553mg, partial [Citrus sinensis]
Length=725

 Score =   845 bits (2182),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/530 (77%), Positives = 462/530 (87%), Gaps = 2/530 (0%)
 Frame = +2

Query  1817  VLWYLAPLFPKNINSFWQDEL*IPKMKAYVSDTEDLKQDPLYQESWDDMIISFLAESLDV  1996
             VL+YL+PLFP NI+ FWQDE  IPKMKAYVSDTEDLK DP YQE+WDDMII+FLAESLDV
Sbjct  1     VLYYLSPLFPTNIDLFWQDE--IPKMKAYVSDTEDLKLDPSYQETWDDMIINFLAESLDV  58

Query  1997  IQNVDWVLLLGNTFARQYELYKSDNEHSALLHRCLGILLQKVHDRAYVRAKIDLMYRQAN  2176
             +Q  DW++ LGN F  QY LY  D++HSALLHRCLGILLQKV DR YV  KID MY+QAN
Sbjct  59    VQETDWLISLGNAFTEQYVLYTPDDDHSALLHRCLGILLQKVADRNYVCDKIDWMYKQAN  118

Query  2177  IAVPTNRLGLAKAMGLVAASHLDTVLDKLKGILDNVGQSILQRIFSFFSDRGKMEESDDT  2356
             IA+PTNRLGLAKAMGLVAASHLD VL+ LKGILDN+GQS+ QR+ SFFS+  +MEESDD 
Sbjct  119   IAIPTNRLGLAKAMGLVAASHLDAVLEMLKGILDNIGQSLFQRLLSFFSNSYRMEESDDI  178

Query  2357  HAALALMYGYAAKYAPPTVIEARIDALVGTNMLSRLLHVRHPRAKQAVITAIDLLGQAVI  2536
             HAALALMYGYAAKYAP TVIEARIDALVGTNMLSRLLHVRH  AKQAVITAIDLLG+AVI
Sbjct  179   HAALALMYGYAAKYAPSTVIEARIDALVGTNMLSRLLHVRHHTAKQAVITAIDLLGRAVI  238

Query  2537  GASESGISFPLKRRDLLLDYILTLMGRDEEEGFSDSNIELLHTQSLALSACTTLVSVEPK  2716
              A+E+G SFPLK+RD LLDYILTLMGR+E + F+DS+IELLHTQ+LALSACTTLV+VEPK
Sbjct  239   NAAENGASFPLKKRDQLLDYILTLMGREENDSFADSSIELLHTQALALSACTTLVTVEPK  298

Query  2717  LTTETRNLIMKATIGFFGLPNDPSDVINPLIDNLITLLCTILVTSGEDGRSRAEQLLHIL  2896
             LT ETRN +MKAT+GFF LPNDP DV+NPLIDNLITLLC IL+TSGEDGRSRA+QLLHIL
Sbjct  299   LTIETRNHVMKATLGFFALPNDPIDVVNPLIDNLITLLCAILLTSGEDGRSRADQLLHIL  358

Query  2897  RNIDPFVSSSLEYQRKRGCLAAHELLIKFRAICVNGYCALGCQGSCSHSKQIDHAANRNL  3076
             R ID +VSS +EYQR+R CLA +E+L+KFR +CV GYCALGC GSC+H KQID A   N 
Sbjct  359   RQIDQYVSSPVEYQRRRSCLAVYEMLLKFRTLCVIGYCALGCHGSCTHIKQIDRAVLGNF  418

Query  3077  SNLPSAFFLPSRDALSLGERIMVYLPRCIDTNYEVRKVSVQILNLFFNISFSLPKPINSS  3256
             SNLPSA+ LPSR+AL LG R+++YLPRC DT+ EVRK+S QIL+  F+IS SLP+P+ SS
Sbjct  419   SNLPSAYVLPSREALCLGNRVIMYLPRCADTDSEVRKISAQILDQLFSISLSLPRPVGSS  478

Query  3257  LGIDIELSYIALSSLEDVVAILRSDASIDPSEVFNRVVSSVCTLLNKDEL  3406
              GID+ELSY ALSSLEDV+AILRSDASIDPSEVFNR+VSSVC LL KDE+
Sbjct  479   SGIDLELSYGALSSLEDVIAILRSDASIDPSEVFNRIVSSVCILLTKDEI  528


 Score =   242 bits (618),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 143/203 (70%), Positives = 167/203 (82%), Gaps = 1/203 (0%)
 Frame = +2

Query  3599  TLGAICSVAENTTSKVVFTEVLAAAGRDMVTKDIHRLRGGWPIQDAFHAFSQHLVLSHSF  3778
             T   I  +AENT SK+VF EVLA AG+D+VTKDI RLRGGWP+QDAFHAFSQH VLS  F
Sbjct  524   TKDEISCLAENTNSKIVFNEVLATAGKDIVTKDISRLRGGWPMQDAFHAFSQHAVLSFLF  583

Query  3779  LEHVISVINQSPALKGGDSGKGESSRNSVDGSIEDDVSRAAVLALTAffrgggkfgrkTV  3958
             LEH+IS +NQ+P +KG D  KG+ S +S D  I+DD+ +AA+LALTAFFRGGGK G+K V
Sbjct  584   LEHLISALNQTPFVKG-DMEKGDYSSHSADTWIDDDILQAAILALTAFFRGGGKVGKKAV  642

Query  3959  EQSYASVlatltlhlgtchglaSYGDQEPLRALLNAFQAFCECVGDLEMGKILARGGEQN  4138
             E+SYA VLA LTL LG+CHGLAS G  EPLRA+L +FQAFCECVGDLEM KILAR GEQN
Sbjct  643   EKSYAPVLAALTLQLGSCHGLASSGQHEPLRAILTSFQAFCECVGDLEMRKILARDGEQN  702

Query  4139  ENEKWINLIGELAGSISIKRPKE  4207
             + EKWINLIG++AG +SIKRPKE
Sbjct  703   DKEKWINLIGDVAGCVSIKRPKE  725



>ref|XP_001780240.1| predicted protein [Physcomitrella patens]
 gb|EDQ54904.1| predicted protein [Physcomitrella patens]
Length=1666

 Score =   860 bits (2222),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 563/1511 (37%), Positives = 845/1511 (56%), Gaps = 120/1511 (8%)
 Frame = +2

Query  689   DTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRTQLKAALPRLVPTILE  868
             + D+ + L  AFELLL  W  S D  VRL+  EALG+MV LI+R  L +ALPRL+P+IL 
Sbjct  193   EGDLQALLQQAFELLLNSWIKSPDSGVRLATAEALGKMVDLISRKHLISALPRLLPSILA  252

Query  869   LYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstlllvCSNNDKK-EHSD  1045
             + ++E++    AT SLH++L+  L+++   P++DF  L+ VL+ LLL      KK  +S 
Sbjct  253   VCRKEKENPLPATTSLHTVLSLILVNDARSPMIDFLALSPVLNMLLLKAYLTVKKGSNSA  312

Query  1046  FPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGSLCVLKHLLPRLAESW  1225
             +   +K +NEV  CF+T+   YP ++F FLL++ R +EE    G L V KHL+ R +E W
Sbjct  313   YSAQMKNHNEVLRCFVTIREAYPSEIFDFLLHQLRTREEYVQLGVLSVWKHLIFRQSEPW  372

Query  1226  HNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGELFIEYLVRHCAMPDL  1405
              N+R  + E+V  L+ + +L ++K++AELIV MAS  YL  ++ E  IE+LV+ CA+   
Sbjct  373   LNRRGEIAEAVNYLLRKQDLKLKKSIAELIVCMASSGYLNKTTSEACIEFLVKQCALAST  432

Query  1406  -ENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKGLLLITVTVPEMEH-  1579
              + +   SS    +      P      +   G + + ELR VCE GLLL+  TVP  E  
Sbjct  433   RKRLSEASSAVPEKPKATEMPVSIPAKKELGGQLRSLELRRVCETGLLLLAGTVPAAERR  492

Query  1580  -----VLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKARTDIPKPEE  1744
                  +LWPFLLKM++P  YT A+ TVC+CI+E+ + + S    +  +    ++IP+PE 
Sbjct  493   VIFQVILWPFLLKMLMPVEYTAALDTVCKCITEVLKHKRSRGEKVSIDYSMTSNIPEPE-  551

Query  1745  LFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKAYVSDTEDL  1924
                                     +L  L P+FP  I   W++E  IPK+KAY+S+ +  
Sbjct  552   ------------------------ILDDLGPIFPTAIVLLWEEE--IPKLKAYISNIDVA  585

Query  1925  KQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHSALLHRCLG  2104
                   Q  W+DMII  L+++L V+ + +W++  GN  A  Y LY  DN+  +LLHRC+G
Sbjct  586   SWQ---QIVWEDMIIHLLSDALGVVHDPEWIMSFGNALATHYNLY-DDNQQISLLHRCMG  641

Query  2105  ILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDKLKGILDNV  2284
              +LQK  +  YV+  I LMY++++++   NR GLA AMGLV  + L  +++     + NV
Sbjct  642   TVLQKTDNEVYVQRMITLMYQRSDVSNKINRGGLATAMGLVTRA-LKRLINGFSAPIFNV  700

Query  2285  ---------------GQSILQRIFS-------------------------FFSDRGKMEE  2344
                              S +QRI S                          F    K+  
Sbjct  701   ILMVFILFFPSSRIRKPSQVQRIVSGRFCTSGYCVGKAAKNPRQSQTFVLHFVKPQKIRA  760

Query  2345  SDDTHAALALMYGYAAKYAPPTVIEARIDALVGTNMLSRLLHVRHPRAKQAVITAIDLLG  2524
              D+  A LALMYGY A YAP + IEARI+ LVG++ML   L V+   +KQAV++AI+LLG
Sbjct  761   VDNVFATLALMYGYTASYAPSSGIEARIEILVGSDMLKGFLKVKAQASKQAVLSAINLLG  820

Query  2525  QAVIGASESGISFPLKRRDLLLDYILTLMGRDEEEGFSDSNIELLHTQSLALSACTTLVS  2704
             QAVI A+++G  FPLK+RD++L+YI++LM +DE+      +IEL HTQ +AL AC TLVS
Sbjct  821   QAVIKAAKNGTVFPLKKRDIMLNYIISLMEKDEKNSL---DIELQHTQEMALDACATLVS  877

Query  2705  VEPKLTTETRNLIMKATIGFFGLPNDPSDVINPLIDNLITLLCTILVTSGEDGRSRAEQL  2884
             V PKLT++ R+ +++A  GFF LP   + V + L  NL   LCTIL+TSG+DG+SRA QL
Sbjct  878   VNPKLTSKMRDSVLQAAFGFFTLPMSLA-VSDTLFTNLTRFLCTILLTSGDDGKSRAMQL  936

Query  2885  LHILRNIDPFVSSSLEYQRKRGCLAAHELLIKFRAICVNGYCALGCQGSCSHSKQIDHAA  3064
               +L+ +D F SSS+EY+R+R       LL  +RA+C  G C +GC GS  H +      
Sbjct  937   QFLLKRLDEFASSSMEYERERAVRTVLALLQYYRALCFPGSCYVGCTGSYMHLRSSSDTD  996

Query  3065  NRNLSNLPSAFFLPSRDALSLGERIMVYLPRCIDTNYEVRKVSVQILNLFFNISFSLPKP  3244
                 +  P+   LP R+AL LGERI+ +LPRC D +  +R ++ QI+ +  N+   +P P
Sbjct  997   QSGGAAGPA--LLPPREALRLGERIVAFLPRCTDVSPVIRILAGQIITILCNMVMLIPDP  1054

Query  3245  INSSLGID-IELSYIALSSLEDVVAILRSDASIDPSEVFNRVVSSVCTLLNKDE------  3403
               +    D IELS +A+++L+D+    +         V  RVV +V  LLN  E      
Sbjct  1055  AGAKSTDDSIELS-LAITALQDLTDSTKGKTDGSEVNVLQRVVDAVLNLLNYTEEAQIYA  1113

Query  3404  -----------------LVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNELNEIEV  3532
                              +VAAL GC  A+CDK+ QSA+GA+ A+ + + +RG++L E ++
Sbjct  1114  HGYININLNGNSWVEGQVVAALKGCKIAVCDKVLQSAQGAMSALTQIIYSRGSQLREGDI  1173

Query  3533  SRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMVTKDIHRLR  3712
              + +++L  A     +++  Q  L  +CS+AE++ +KVVF+E++ A   ++V  D+ + R
Sbjct  1174  CKIARNLFEAAAIDCDRH--QGILAVVCSLAEHSVAKVVFSEIITAGEIELV-DDLDK-R  1229

Query  3713  GGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSVDGSIEDDVS  3892
                  +    A S H  LS  FLE+V+ +++ +P  K  D+ KG  S +          S
Sbjct  1230  KLCRFEKIILAISHHEKLSLIFLEYVVDILDHAPVFKEDDAEKGNISDHLTFPMSLCQRS  1289

Query  3893  RAAVLALTAffrgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPLRALLNAFQ  4072
             +AA LAL    RG     ++ V Q Y  VL  L L +G+     S  D +PLR ++    
Sbjct  1290  QAATLALQEILRGANDTVKQAVNQCYPRVLCCLLLRIGSIQESISI-DMQPLRDMITTIH  1348

Query  4073  AFCECVGDLEMGKILARGGEQN-ENEKWINLIGELAGSISIKRPKEVPTICLFLSKSLDR  4249
              F E V + +MGK+L   GEQ    E+W   + E+A + + ++P+EV  +C  L  +L+R
Sbjct  1349  VFSETVENDDMGKVLFTDGEQRLSGERWTEAVEEVASNSAREKPEEVTNMCTLLWPALER  1408

Query  4250  PLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQMPSIH  4429
                 QR AAAAALS  +++ +    LLG +VEAL  H SD+S TVR LC+R LVQM    
Sbjct  1409  QHDCQRAAAAAALSGLVQHCENTSILLGSLVEALTAHTSDESSTVRLLCVRSLVQMIKRG  1468

Query  4430  VLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSIRLRNLQVC  4609
             V  +  + L VI+ALL+D ++ V   AV  L  V++ +S + V P+LLNL +RL  LQ  
Sbjct  1469  VTAFVPEALNVIVALLEDKEDEVANAAVCGLSPVIQVASAEVVYPMLLNLCLRLSILQTR  1528

Query  4610  LNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACRNTLKC  4789
                  RA AF A G++S +  G  L +F EQIH   PR+V H++D+   V  AC+N L+ 
Sbjct  1529  HLESTRAAAFEALGSVSKFATGVQLGTFMEQIHKILPRLVFHVNDEAPSVSLACKNALRS  1588

Query  4790  IAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSAIIQAFDAP  4969
             I+PL+    I AL+N   F      +Y+DF+++  + L      +VD Y+S  IQ   A 
Sbjct  1589  ISPLLHAQDIRALVNLRTFEFGRSMEYDDFVKEFVKHLVLQFRDKVDIYVSCAIQ---AS  1645

Query  4970  WPVIQANAVYL  5002
             W   Q++ ++L
Sbjct  1646  WQYYQSSKIFL  1656


 Score =   139 bits (349),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 105/172 (61%), Gaps = 0/172 (0%)
 Frame = +1

Query  133  LADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGNIAGLFQVISVAIRALD  312
            + D + SV+EA+ SAL  I   N   VLDCC T  R G+R     AGL  +++  +R + 
Sbjct  1    MGDSARSVQEAAASALCQIAQQNAEAVLDCCATSLRAGKRVVSYRAGLLLILAYTVREMR  60

Query  313  KGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLPDLMMEEIFLHFSGS  492
            +  ++ + M   AK+A  E+ + KE  +DW  AA+ +LV+VGS  PDL+M+E F   +G 
Sbjct  61   EEQINISLMRSTAKLAMTELAANKEDVSDWNSAASNLLVAVGSRSPDLLMDETFNQLAGG  120

Query  493  NSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIYRPIFANGL  648
               +  +VQ LA++ASS  LQF PRLK VL+RV+PIL NV + +R  FAN  
Sbjct  121  MVPVVHLVQTLAEFASSCGLQFAPRLKNVLSRVLPILSNVTDNHRQAFANAF  172



>ref|XP_002993045.1| hypothetical protein SELMODRAFT_162778 [Selaginella moellendorffii]
 gb|EFJ05884.1| hypothetical protein SELMODRAFT_162778 [Selaginella moellendorffii]
Length=1469

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/717 (45%), Positives = 474/717 (66%), Gaps = 34/717 (5%)
 Frame = +2

Query  1301  LAELIVVMASHCYLVGSSGELFIEYLVRHCAMPDLENVELESSRESSRFT-GNYYPFVYR  1477
             L  L+ +M++  +L   +  +F+E+LV+  A+ D E   L S +E+     G     +++
Sbjct  227   LLSLVAIMSAVGFLQQDNDRIFLEFLVKQSAITDSEVKILHSQQEALEIALGTRNAEIHQ  286

Query  1478  K-LEFKAGAVTTTELRGVCEKGLLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRC  1654
               L  K G V+ +ELR V +K L L+  T P ME ++WPFLLK++IP  +TGA+AT+C+C
Sbjct  287   NHLRLKVGFVSPSELRVVSDKILYLLASTTPHMEELMWPFLLKVLIPPCFTGAIATLCKC  346

Query  1655  ISELCRRRSSESNAMLSECKARTDIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLA  1834
             I E+ +R++ +   +  + + + D+P+PEE+  RL+VLL NP AR HL   IL+ L  ++
Sbjct  347   ICEIIKRKNGKGEPVYVDYRLQPDVPRPEEVLGRLIVLLQNPHARNHLAASILTALLNMS  406

Query  1835  PLFPKNINSFWQDEL*IPKMKAYVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDW  2014
              LFP  +   W+DE  IPK+KAY+SD+ED   D   QE+W++MI+  L+ES+DVI + +W
Sbjct  407   SLFPTAVQLLWEDE--IPKLKAYISDSED---DSWQQETWEEMILHLLSESVDVISSSEW  461

Query  2015  VLLLGNTFARQYELYKSDNEHSALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTN  2194
              + + N  +  Y LY+ DN+H A LHRCLG++L KV +R++VR KI  MYRQ+N+A   N
Sbjct  462   TMSMANALSGHYCLYEGDNQHCAFLHRCLGVVLSKVDNRSFVREKIATMYRQSNVADTAN  521

Query  2195  RLGLAKAMGLVAASHLDTVLDKLKGILDNVGQSILQRIF-SFFSDRGKMEESDDTHAALA  2371
             RLGLA  MGLVAASHLDTVL+KLK +L+   +  + R   SFF+ R K  + D+ +AALA
Sbjct  522   RLGLAMGMGLVAASHLDTVLEKLKDVLEKESRRTITRFLASFFAQREK--DVDNIYAALA  579

Query  2372  LMYGYAAKYAPPTVIEARIDALVGTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASES  2551
             LMYGYAA YAP TVIEARID LVGTN+LSRLL V+   AKQAVITAI+LLGQAVI A   
Sbjct  580   LMYGYAASYAPSTVIEARIDKLVGTNVLSRLLDVKSAAAKQAVITAINLLGQAVIKAGAH  639

Query  2552  GISFPLKRRDLLLDYILTLMGRDEEEGF--SDSNIEL--LHTQSLALSACTTLVSVEPKL  2719
             G+ FPLKRRD +LDY++TLM          + S +E   L TQ+LA++ACTTLVSVEPKL
Sbjct  640   GVPFPLKRRDTMLDYVMTLMVSQTSSYVLATQSLLEADSLRTQNLAINACTTLVSVEPKL  699

Query  2720  TTETRNLIMKATIGFFGLPNDPSDVINPLIDNLITLLCTILVTSGEDGRSRAEQLLHILR  2899
             T+ +R+ I++AT+ F+ LP +P+ V++ ++ +L  LLC IL TSGEDG+SRA+Q+ H+L 
Sbjct  700   TSASRDRILEATLRFYTLPAEPAPVVDSVLSDLTNLLCVILRTSGEDGKSRADQVHHLLN  759

Query  2900  NIDPFVSSSLEYQRKRGCLAAHELLIKFRAICVNGYCALGCQGSCSHSKQIDHAANRNLS  3079
             ++D ++SS +++ R+R C++   LL +FR  C  G         CSH         + +S
Sbjct  760   SLDQYISSQVDHHRERACMSVLALLREFRTFCTAG---------CSHLFLSLCLLYKVVS  810

Query  3080  NLPSAFFLPSRDALSLGERIMVYLPRCIDTNYEVRK--------VSVQILNLFFNISFSL  3235
               P    LPSRDAL LG+R+M+YLPRC D +  +RK          +QI++L F+I+ +L
Sbjct  811   GTP---LLPSRDALILGKRVMMYLPRCADVSSLIRKSKALGKLTFRLQIIDLLFSIALTL  867

Query  3236  PKPINSSLGIDIELSYIALSSLEDVVAILRSDASIDPSEVFNRVVSSVCTLLNKDEL  3406
             PK   SS     ++S+ ALSSLE+++A+ + D++ + +    ++V +V  LL  DE+
Sbjct  868   PKLGGSSSMESRQVSFGALSSLEELIAVSKWDSTAELAGTLQQIVGAVSILLTNDEV  924


 Score =   356 bits (914),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 227/539 (42%), Positives = 328/539 (61%), Gaps = 23/539 (4%)
 Frame = +2

Query  3611  ICSVAENTTSKVVFTEVLAAAGRDMVTKDIHRLRGGWPIQDAFHAFSQHLVLSHSFLEHV  3790
             +CS+A+ T S++V +E+LAAA R+   KD  + +G WPI +AF AF+ H+ L+  FL+++
Sbjct  924   VCSLAQETQSRIVMSELLAAAVREAQVKDSLKHKGSWPIDEAFKAFANHVDLALPFLDYL  983

Query  3791  ISVINQSPALKGGDSGKGESSRNSVDGSIEDDVSRAAVLALTAffrgggkfgrkTVEQSY  3970
             +SV++Q+P LK  D+ K E S ++      D    AAV ALT  FR GG   RK +EQ Y
Sbjct  984   VSVLDQTPVLKD-DTDKNEQSSHA--PHTIDYFPIAAVRALTTAFRVGGDPIRKALEQRY  1040

Query  3971  ASVlatltlhlgtchglaSYGDQEPLRALLNAFQAFCECVGDLEMGKILARGGEQNENEK  4150
             A+V   L L +G  HG     D++  R ++ AF+ FC  VGDL+M  ++    ++   E 
Sbjct  1041  ATVFCALLLQIGGSHGTTGL-DKQASRDIILAFKTFCRFVGDLDMENVVDSSIDELLTEG  1099

Query  4151  -WINLIGELAGSISIKRPKEVPTICLFLSKSLDRPLRVQREAAAAALSEFLRYSDGFGPL  4327
              WI  +G++A  +++  PK+V  IC  L   L R    QR AAAAALSE+++ S G   +
Sbjct  1100  YWIKAVGKIAHCVALTHPKKVGAICNLLWPVLKRDYVFQRIAAAAALSEYVKTSRGTADV  1159

Query  4328  LGQMVEALCRHVSDDSPTVRRLCLRGLVQMPSIHVLQYTTQILGVILALLDDSDESVQLT  4507
             L Q+V  L RH+ D+SP VRRLC+ GLVQ+P   + QY  Q+LGVI+ L+DD  ESV   
Sbjct  1160  LEQLVGVLSRHIGDESPVVRRLCVEGLVQVPHDDMAQYAPQVLGVIVTLIDDDVESVSYA  1219

Query  4508  AvsclllvlesssTDAVEPVLLNLSIRLRNLQVCLNAKIRANAFAAFGALSSYGAGSILD  4687
             AV  L LVLE ++ + V PVLLNL +RLR+LQ   +  +RA +F A G LS++  GS LD
Sbjct  1220  AVQGLPLVLEITTEETVVPVLLNLCVRLRSLQTRESVHMRAASFGALGTLSAFATGSQLD  1279

Query  4688  SFREQIHAAFPRMVLHLHDDDLGVRQACRNTLKCIAPLIEIDAIPALLNTHRFSSDHR--  4861
             +F EQ+H+  PR++LH++D+D  VRQAC+ T K IAPL++ + +  +       SD+R  
Sbjct  1280  AFLEQMHSILPRVLLHINDEDSSVRQACKTTFKRIAPLLQAEELKHVARLDCKESDNRLV  1339

Query  4862  ------SD----------YEDFLRDLARQLTQYLGPRVDTYLSAIIQAFDAPWPVIQANA  4993
                   S+          Y+ FL+++ R L      R+DTYLS  IQAFD+PWP +QANA
Sbjct  1340  ESRSPQSETNLFSFRRLYYDAFLKEITRHLITRFSDRLDTYLSCAIQAFDSPWPRVQANA  1399

Query  4994  VYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATCSAALGLLLKSPNSSS  5170
             V   + MLS  +++  S++Y  QV  +L+    NS   IVRA  + ALG+LL+    SS
Sbjct  1400  VSFVAFMLSQLEDQRSSSIYVPQVVTLLMRAVENSPSQIVRARSAWALGVLLEQLKLSS  1458


 Score = 89.7 bits (221),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 85/172 (49%), Gaps = 36/172 (21%)
 Frame = +2

Query  641   MACWQ-----YSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMV  805
              ACW      Y   +  +  L  D+ + L+SAF+L L  W ++RD KV L+ VEAL QM 
Sbjct  89    FACWSAGMIVYVEKYPSAPYLGPDMQALLHSAFDLFLGRWLLARDAKVSLATVEALAQMF  148

Query  806   GLITRTQLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDlt  985
              LI + QLK+ALP+LVP+IL +YK++    F  T                          
Sbjct  149   PLINKIQLKSALPKLVPSILSVYKKDSSNCFPVT------------------------HA  184

Query  986   vvlstlllvCSNNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLN  1141
             + +   +++ S     E  +F       NEV  CF+ +G+ +PEDLF +LL+
Sbjct  185   LHMLLEVVLPSGQPMLEFQNF-------NEVATCFVIIGTAFPEDLFNYLLS  229


 Score = 64.3 bits (155),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 55/85 (65%), Gaps = 0/85 (0%)
 Frame = +1

Query  298  IRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLPDLMMEEIFL  477
            IR +++  +    +  + KI+ AE+ S K+L++ W+ AA+ +LV+V   +P L+MEEIFL
Sbjct  5    IRDMERMQLSEDKIKSMVKISFAEMTSCKDLDSSWEHAASSLLVAVCCQMPSLVMEEIFL  64

Query  478  HFSGSNSALPAMVQILADYASSDAL  552
               G +  + A+VQ LA++++ DA 
Sbjct  65   QLVGGSVPVLALVQALAEFSTIDAF  89



>ref|XP_002468504.1| hypothetical protein SORBIDRAFT_01g047100 [Sorghum bicolor]
 gb|EER95502.1| hypothetical protein SORBIDRAFT_01g047100 [Sorghum bicolor]
Length=514

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/514 (61%), Positives = 395/514 (77%), Gaps = 4/514 (1%)
 Frame = +2

Query  2666  QSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVINPLIDNLITLLCTILV  2845
             QSLALSACTTLVS+EP+L  ETRN +MKAT+GFF LP +PS ++  LI NLI LL  IL+
Sbjct  2     QSLALSACTTLVSLEPRLPMETRNRVMKATLGFFALPTEPSSIVESLITNLIILLGAILL  61

Query  2846  TSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIKFRAICVNGYCALGCQ  3025
             TSGEDGRSRAEQLLHILR +DP+VSSSLE+QR+RGC+A  E+LIKFR +C  G+ ALG  
Sbjct  62    TSGEDGRSRAEQLLHILRQLDPYVSSSLEHQRRRGCVAVQEVLIKFRNLCSGGFGALGSY  121

Query  3026  GSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPRCIDTNYEVRKVSVQIL  3205
              +   +KQID    R+LS+LPSAF LPSRD+LSLGER M YLPRC DT+ EV KV++QI+
Sbjct  122   PAFIMNKQIDQGGTRSLSSLPSAFVLPSRDSLSLGERTMAYLPRCADTDTEVMKVAIQII  181

Query  3206  NLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILRSDASIDPSEVFNRVVSSVCT  3385
              LFFNIS SLPK    S  ID+E SY ALSSLE++V+I+R +AS+D +E+F RVVSS+C 
Sbjct  182   ALFFNISLSLPKQKAYSNDIDLESSYSALSSLEELVSIVRREASVDQTELFQRVVSSLCI  241

Query  3386  LLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNELNEIEVSRTSQSLLTAV  3565
             LL+KDELV  LH C+ A CDK+KQSA+ +IQA++ F+  RG EL E +VSRT+QSLL++ 
Sbjct  242   LLSKDELVILLHSCTLATCDKVKQSADASIQAIIMFIIRRGKELREADVSRTTQSLLSSA  301

Query  3566  VHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMVTKDIHRLRGGWPIQDAFHA  3745
             V +T+K+ RQE L AI S+AENT   VVF EVL+ AGRD+ TKDI R+RGGW IQD F++
Sbjct  302   VSLTDKHSRQEVLNAISSLAENTNHIVVFDEVLSVAGRDICTKDIPRIRGGWAIQDVFYS  361

Query  3746  FSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSVDGSIEDDVSRAAVLALTAff  3925
             FSQH  L+  FLE+ +S++++ P +    S KGES+  S   S +D + +A + AL AF 
Sbjct  362   FSQHKELALLFLEYTLSILHKEPVIINS-SEKGESTSES---SADDCILQATMFALNAFM  417

Query  3926  rgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPLRALLNAFQAFCECVGDLEM  4105
             RGGGK G++ VEQSY SVL+ L L LG+ HGLA  G  E LR+LL AFQ+FCECVGD+EM
Sbjct  418   RGGGKIGKQAVEQSYPSVLSGLILKLGSLHGLAELGRNELLRSLLIAFQSFCECVGDVEM  477

Query  4106  GKILARGGEQNENEKWINLIGELAGSISIKRPKE  4207
             GKILAR GEQ E EKWI+++ E+A S S+KRPK+
Sbjct  478   GKILARDGEQTEKEKWIDVVQEIACSSSVKRPKD  511



>tpg|DAA43366.1| TPA: hypothetical protein ZEAMMB73_966343 [Zea mays]
Length=451

 Score =   533 bits (1374),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 272/454 (60%), Positives = 348/454 (77%), Gaps = 5/454 (1%)
 Frame = +2

Query  2552  GISFPLKRRDLLLDYILTLMGRDEEEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTET  2731
             GISFPLKRRD LL+Y+LTLMGRD+    +D N ELLHTQSLALSACTTLVS+EP+L  ET
Sbjct  2     GISFPLKRRDQLLEYVLTLMGRDQSNDLTDFNTELLHTQSLALSACTTLVSLEPRLPMET  61

Query  2732  RNLIMKATIGFFGLPNDPSDVINPLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDP  2911
             RN +MKAT+GFF LP +PS ++  L+ NLI LL  IL+TSGEDGRSRAEQLLHILR +DP
Sbjct  62    RNRVMKATLGFFALPTEPSSIVESLVTNLIILLGAILLTSGEDGRSRAEQLLHILRQLDP  121

Query  2912  FVSSSLEYQRKRGCLAAHELLIKFRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPS  3091
             +VSSSLE+QR+RGC+A  E+LIKFR +C  G+ ALG   + + +KQID    R+LS+LPS
Sbjct  122   YVSSSLEHQRRRGCVAVQEVLIKFRNLCSGGFGALGSYPTFTMNKQIDRG-TRSLSSLPS  180

Query  3092  AFFLPSRDALSLGERIMVYLPRCIDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDI  3271
             AF LPSRD+LSLGER M YLPRC DT+ EVRKV++QI+ LFF+IS SLPK       ID+
Sbjct  181   AFVLPSRDSLSLGERTMAYLPRCADTDTEVRKVAIQIIALFFDISLSLPKQKAYPNDIDL  240

Query  3272  ELSYIALSSLEDVVAILRSDASIDPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKI  3451
             E SY ALSSLE++V+I+R +AS+D +E+F RVVSSVC LL+KDELV  LH C+ A CDKI
Sbjct  241   ESSYSALSSLEELVSIVRREASVDQTELFQRVVSSVCILLSKDELVVLLHSCTLATCDKI  300

Query  3452  KQSAEGAIQAVVEFVTNRGNELNEIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAEN  3631
             KQSA+ +IQA++ F+  RG EL E +VSRT+QSLL++ + +T+ + RQE L AI  +AEN
Sbjct  301   KQSADASIQAIIMFIIRRGKELREADVSRTTQSLLSSAISLTDTHSRQEVLNAISCLAEN  360

Query  3632  TTSKVVFTEVLAAAGRDMVTKDIHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQS  3811
             T   VVF EVL+ AG+D+ TKDI R+RGGW IQD F+AFSQH  L+  FLE+ +S++++ 
Sbjct  361   TNHVVVFDEVLSVAGKDICTKDIPRIRGGWAIQDVFYAFSQHKELALLFLEYTLSILHKE  420

Query  3812  PALKGGDSGKGESSRNSVDGSIEDDVSRAAVLAL  3913
             P +    S KGES+  S+    +D + +A + AL
Sbjct  421   PVIINS-SEKGESTSESL---ADDCILQATMFAL  450



>ref|XP_009771492.1| PREDICTED: protein SHOOT GRAVITROPISM 6-like [Nicotiana sylvestris]
Length=302

 Score =   472 bits (1215),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 239/286 (84%), Positives = 266/286 (93%), Gaps = 0/286 (0%)
 Frame = +2

Query  4337  MVEALCRHVSDDSPTVRRLCLRGLVQMPSIHVLQYTTQILGVILALLDDSDESVQLTAvs  4516
             MV+ALCRHVSDDSPTVRRLCLRGLVQMPSIHVLQYTTQILGVILALLDDSDESVQLTAVS
Sbjct  1     MVQALCRHVSDDSPTVRRLCLRGLVQMPSIHVLQYTTQILGVILALLDDSDESVQLTAVS  60

Query  4517  clllvlesssTDAVEPVLLNLSIRLRNLQVCLNAKIRANAFAAFGALSSYGAGSILDSFR  4696
             CLL+VLESSS DAVEPVLLNLSIRLRNLQ C+N KIRANA+AAFGALS+YG G   DSF 
Sbjct  61    CLLMVLESSSRDAVEPVLLNLSIRLRNLQACMNEKIRANAYAAFGALSTYGTGPQRDSFL  120

Query  4697  EQIHAAFPRMVLHLHDDDLGVRQACRNTLKCIAPLIEIDAIPALLNTHRFSSDHRSDYED  4876
             EQ HAAFPRMVLHLH+DDL VRQACR+TLKC+APL+EID I ALLNTH FSSDHRSDYED
Sbjct  121   EQFHAAFPRMVLHLHEDDLSVRQACRSTLKCVAPLMEIDGINALLNTHWFSSDHRSDYED  180

Query  4877  FLRDLARQLTQYLGPRVDTYLSAIIQAFDAPWPVIQANAVYLCSSMLSLSDNKNISALYY  5056
             FLR+LARQLTQ+L  RVDTY+++IIQAFDAPWPV+QANAVYLCSS+LSLSD+K+ISAL+Y
Sbjct  181   FLRELARQLTQHLASRVDTYMASIIQAFDAPWPVVQANAVYLCSSVLSLSDDKHISALFY  240

Query  5057  SQVFGVLVGKASNSTDAIVRATCSAALGLLLKSPNSSSWRDARLNK  5194
             +QVF +LVGK S STDAIVRATCS+ALGLLLKS N++SW+D RL++
Sbjct  241   NQVFDMLVGKMSRSTDAIVRATCSSALGLLLKSSNANSWKDVRLDR  286



>gb|KDO46957.1| hypothetical protein CISIN_1g0006552mg, partial [Citrus sinensis]
 gb|KDO46958.1| hypothetical protein CISIN_1g0006552mg, partial [Citrus sinensis]
 gb|KDO46959.1| hypothetical protein CISIN_1g0006552mg, partial [Citrus sinensis]
 gb|KDO46960.1| hypothetical protein CISIN_1g0006552mg, partial [Citrus sinensis]
 gb|KDO46961.1| hypothetical protein CISIN_1g0006552mg, partial [Citrus sinensis]
Length=343

 Score =   445 bits (1145),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 223/329 (68%), Positives = 271/329 (82%), Gaps = 1/329 (0%)
 Frame = +2

Query  4208  VPTICLFLSKSLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVR  4387
             V TICL L+KS++R  R QREAAAAALSEF+RYS GF  LL QMVEALCRHVSD+SPTVR
Sbjct  1     VQTICLILTKSINRQQRFQREAAAAALSEFVRYSGGFDSLLEQMVEALCRHVSDESPTVR  60

Query  4388  RLCLRGLVQMPSIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPV  4567
              LCLRGLVQ+PSIH+ QY TQ+L VILALLDD DESVQLTAVSCLL +L+SSS DAVEP+
Sbjct  61    GLCLRGLVQIPSIHIHQYATQVLSVILALLDDLDESVQLTAVSCLLTILKSSSKDAVEPI  120

Query  4568  LLNLSIRLRNLQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDD  4747
             LLNLS+RLRNLQV +N K+R NAFAAFGALS++G GS  ++F EQIHA  PR++LH++DD
Sbjct  121   LLNLSVRLRNLQVSMNVKMRRNAFAAFGALSNFGVGSQREAFLEQIHAMLPRLILHIYDD  180

Query  4748  DLGVRQACRNTLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRV  4927
             DL VRQACRNTLK +AP +EI  +  + N+H F+SDHRSDYE F+RDL RQ  Q+   R+
Sbjct  181   DLSVRQACRNTLKQVAPFMEI-GVYGIFNSHCFNSDHRSDYETFVRDLTRQFVQHFPSRI  239

Query  4928  DTYLSAIIQAFDAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDA  5107
             D+Y+ + IQAF+APWP+IQANA+Y  SS+L L D+++I +L+Y+QVFG+LV K S S DA
Sbjct  240   DSYMGSTIQAFEAPWPIIQANAIYFSSSILCLCDDQHILSLFYTQVFGLLVVKLSQSADA  299

Query  5108  IVRATCSAALGLLLKSPNSSSWRDARLNK  5194
             IVRATCS++LG LLKS NS SWR  RL +
Sbjct  300   IVRATCSSSLGWLLKSINSHSWRSTRLER  328



>gb|KDO46984.1| hypothetical protein CISIN_1g018728mg [Citrus sinensis]
Length=351

 Score =   311 bits (798),  Expect(2) = 4e-118, Method: Compositional matrix adjust.
 Identities = 145/188 (77%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = +1

Query  85   GDSIPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGN  264
            G SIPA EAVQ +VSSLAD+SP VREASM++LKDI +LNPLLVLDCCL VSRGGRRRFGN
Sbjct  9    GISIPAPEAVQFLVSSLADESPIVREASMASLKDIAALNPLLVLDCCLAVSRGGRRRFGN  68

Query  265  IAGLFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSH  444
            +AG+FQV++ A+RALD+ D+DPAFM KL++IATAE+IS+KELN DWQRAA+ +LVS+GSH
Sbjct  69   MAGIFQVMAFAVRALDENDIDPAFMSKLSRIATAEMISSKELNTDWQRAASALLVSIGSH  128

Query  445  LPDLMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIY  624
            LPDLMMEEIFL+ SG+NSALPAMVQILAD+AS+DALQFTPRLKGVL RV+PILGN+R+++
Sbjct  129  LPDLMMEEIFLYLSGTNSALPAMVQILADFASADALQFTPRLKGVLVRVLPILGNIRDVH  188

Query  625  RPIFANGL  648
            RPIFAN  
Sbjct  189  RPIFANAF  196


 Score =   145 bits (365),  Expect(2) = 4e-118, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = +2

Query  644  ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
            A WQYSVDF   + LD D++SFLNSAFELLLRVWA SRDLKVR+S V+ALGQMVGLITR+
Sbjct  202  AAWQYSVDFPSHSFLDGDIMSFLNSAFELLLRVWATSRDLKVRVSTVDALGQMVGLITRS  261

Query  824  QLKAALPRLVPTILELYKREQDAAFVATC  910
            QLK ALP+LVP+ILELYK++QD A VATC
Sbjct  262  QLKGALPKLVPSILELYKKDQDTALVATC  290



>ref|XP_004344439.1| conserved hypothetical protein [Capsaspora owczarzaki ATCC 30864]
 gb|EFW41686.1| hypothetical protein CAOG_06818 [Capsaspora owczarzaki ATCC 30864]
Length=1654

 Score =   415 bits (1066),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 389/1524 (26%), Positives = 677/1524 (44%), Gaps = 156/1524 (10%)
 Frame = +2

Query  716   SAFELLLRVW-AMSRDLKVRLSAVEALGQMVGLITRTQLKAALPRLVPTILELYKREQDA  892
             +AFE++  VW     D K+R++ VEALG M   ++R Q    LP+LVP +L LY ++ + 
Sbjct  239   TAFEVMFNVWLPNGNDPKLRMAIVEALGFMAQCLSREQFDIQLPKLVPGVLALY-KKHNE  297

Query  893   AFVATCslhsllnasllsnngppllDFEDltvvlstlllvCSNNDKKEHSDFPVGLKTYN  1072
                 T  +  +L  ++  +        E     L  ++ +  +            LK +N
Sbjct  298   HLPITAGMCMILETAVKEDTRALDPLLEQTLQTLQPMVAIPIDYGSS------TSLKNHN  351

Query  1073  EVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGSLCVLKHLLPRLAESWHNKRPILIE  1252
             E+  CF  +   Y + +  FL+ K           +L VLKH++        +K+ +++ 
Sbjct  352   ELLRCFEILARSYSDRVVAFLIQKLENSNPANRIATLDVLKHIINSRDAELKDKKELILS  411

Query  1253  SVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGELFIEYLVRHCAMPD----------  1402
              +K ++ E NL VRK    +++ MAS  YL    G   IE++VR CA+ +          
Sbjct  412   GLKQVLQEPNLSVRKTFGTVVIAMASKKYLGLEGGNAMIEFVVRQCALVEDAADRKKREE  471

Query  1403  -LENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTE-LRGVCEKGLLLITVTVPEME  1576
                      S++S            R+  F    VT+ + LR +CE  L LIT T+P ME
Sbjct  472   EERKRRAAQSKDSDE---------SRQRAFSELEVTSPQGLRSMCENVLHLITTTIPHME  522

Query  1577  HVLWPFLLKMIIPRVYTGAVATVCRCISELC-RRRSSESNAMLSECKARTDIPKPEELFA  1753
              VLWPFL + ++P  YT A A VC+C++ L  ++R+  +   +     + ++P+P  L  
Sbjct  523   EVLWPFLTEFLVPVQYTDAFAIVCKCLTYLASKKRAENAEDYMINFDRKVNVPRPFALIG  582

Query  1754  RLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKAYVSDTEDLKQD  1933
             RL+V+  +P  R+  +   L +L   +P     +   W D   IPK+ AY+    D + D
Sbjct  583   RLLVMASHPQERQRGM-HALQLLQSFSPNLRATLPDMWDDV--IPKLLAYLEANADGEFD  639

Query  1934  PLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHSALLHRCLGILL  2113
                Q++W+++++ FLA ++D + N DW + LG   A+Q  LY     H   L RC+G+ +
Sbjct  640   ---QKAWEELLLKFLARTIDKVGNEDWTVSLGEDMAKQLPLYDKLVTHKNFLLRCIGVCM  696

Query  2114  QKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDKLKGI--LDNVG  2287
             +K  ++ +++  +D+M+   +      R G+A+  G  A+SHLDTV++KL+ +   D V 
Sbjct  697   KKSTNKNFIKTHLDIMFNSIDHKDQVEREGVAQGFGFAASSHLDTVIEKLQTVTKTDMVR  756

Query  2288  QSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALVGTNMLSRLL  2467
             +S     F    D+ ++ + +   A + L +GY A YAP  +I +RID  +   ++ +  
Sbjct  757   KS--SGFFGMVKDKSEI-DVERLRATVMLGFGYTALYAPSNLITSRIDVSIFNIIIPQFA  813

Query  2468  HVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRDEEEGFSDSN  2647
              +R    ++ V  A+ L+  A++        F   RR  LL+ +LT +        ++ N
Sbjct  814   TIRETFVRENVTRAVALICTALLPDRIDDPKFVCTRRTELLNNMLTYIT-------AEKN  866

Query  2648  IELLHTQSLALSACTTLVSVEPKLTTETR-NLIMKATIGFFGLPNDPSDVINPLIDNLIT  2824
                   Q+LA+ A TT+V + P L+   R + +   T   + L   P +V   L+   +T
Sbjct  867   TLKNQVQALAMDALTTMVHMAPVLSDADRLDAVRTCTTAIYEL---PENVDAELMTQTLT  923

Query  2825  LLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIKFRAICVNG  3004
              L  +L    E+  S    L  +L ++ P + S   ++R+R   AA  +           
Sbjct  924   SLNKMLAAIIEENAS-ISSLTSMLESLAPTIRSDQAHRRQRAVEAALYV-----------  971

Query  3005  YCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPRCIDTNYEVR  3184
                         S+Q     +  L   P        D L  G+ I    PRC D   ++R
Sbjct  972   ------------SQQYFKFKSERLKENPEV----PEDFLGFGKLIAFLAPRCTDPVVKIR  1015

Query  3185  KVSVQILNLFFNIS----FSLPKPINSSLGIDIELSYIALSSLEDVVAILRSDASIDPSE  3352
             + ++  + +   +S       P  + S+  I+      A++ L++     R++ S +P+ 
Sbjct  1016  QTALDAIQVLLRVSELTRAGSPDKLTSNPAIE------AVTVLKE-----RAEKS-EPNA  1063

Query  3353  VF---NRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNELNE  3523
              F   N +   +   L+  EL+  +      + DK   +A GA   +      RG EL  
Sbjct  1064  QFAVVNDLSKVLAKTLDPIELLPFVVELLEGLTDKEDAAASGACVVLNGLFRQRGAELG-  1122

Query  3524  IEVSRTSQSLLTAVVHVTEKYLRQET--LGAICSVAENTTS--KVVFTEVLAAAGRDMVT  3691
                  T   LL   +H   K ++ E   +G + S+    T   K V T++LA    D+  
Sbjct  1123  -----TDVQLLLGEIHKRLKLIKHEQTEIGTLRSLRTLATHHLKTVVTDLLAF---DLPY  1174

Query  3692  KDIHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVI--NQSPALKGGDSGKGESSRNSV  3865
              ++        +   +   +   V +   LEH+++VI  NQ    K   + K E +R + 
Sbjct  1175  DEV--------VVKIWKTLAGEEVTALPMLEHLLTVITKNQPYEEKPSKNNKKEYTREAT  1226

Query  3866  DGSIEDDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhl--gtchglaSYGDQ  4039
                ++   + A V                  E S A V   L   +         S G  
Sbjct  1227  RPPMQATSALAEVF---------------RAEDSEALVGKLLPRIMCSLLIRIGTSNGMD  1271

Query  4040  EPLRALLNAFQAFCECVGDLEMGKILARGGEQN------ENEKWINLIGELAGSISIKRP  4201
              P   + +   AF E +   +   +     EQ+      + +++ N +  +A SI +   
Sbjct  1272  GPKLPIGDTISAFKEFLIRSKADYVTKDLDEQDHWDLLSDEDEFFNGLTTVARSICVHGG  1331

Query  4202  KEVPTICLFLSKSLDRPLRVQREAAAAALSEFL--RYSDGFGPLLGQMVEALCRHVSDDS  4375
             + VP +  FL   L  P   QR   AA  +EF+  R ++    L+ Q++ A    + DDS
Sbjct  1332  EHVPAMIEFLMPFLSSPYDTQRVVTAALFAEFIYNRCAENVN-LIEQLMNACLGRLIDDS  1390

Query  4376  PTVRRLCLRGL---VQMPSIHVLQYTTQILGVILALLDDS---DESVQLTAvsclllvle  4537
               VR+LC+RGL      P   + +Y+T IL  ++A +DD    DE + + A++ L  +L 
Sbjct  1391  HVVRKLCIRGLGNVANAPEAQIQRYSTTILSAMMAGMDDKNDIDEEITMEAMNGLSKILA  1450

Query  4538  sssTDAVEPVLLNLSIRLRNLQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAF  4717
                 + + P+L+N+ +R+R         +RA A   FG LS +G G     F EQI A F
Sbjct  1451  KLDENHIRPILINICLRIRPCFEKQQDGVRAAAITLFGKLSRFGDGPSKAPFFEQILANF  1510

Query  4718  PRMVLHLHDDDLGVRQACRNTLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLAR  4897
               M+LHL+DD + VR AC++ LK + PL+  D + A+   +         Y DF+ DL++
Sbjct  1511  VSMLLHLNDDSVLVRTACKSALKDVGPLLGADDVNAMFQKYLLEKGSLL-YPDFMSDLSK  1569

Query  4898  QLTQYLGPRVDTYLSAIIQAFDAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVL  5077
              +      +++ ++   +  F + W  I+ANA      +L   +     ++    V   L
Sbjct  1570  LVIDAFPEKMNFFVMGNVNFFKSDWDTIKANAALFAGFLLCQINKTARGSVTVEHVCSSL  1629

Query  5078  VGKASNSTDAIVRATCSAALGLLL  5149
                   S+  +VR   + A+GLL 
Sbjct  1630  TNLLQESS-PLVREKAAEAIGLLF  1652


 Score = 55.8 bits (133),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 85/172 (49%), Gaps = 5/172 (3%)
 Frame = +1

Query  112  VQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRR--FGNIAGLFQV  285
            V  ++ + AD   +V +    +L D+    P LVL   L      ++     +   L +V
Sbjct  26   VMALIETAADKEETVHDRVRQSLVDLGLQQPNLVLSSILVFFHKNKKNIPLPHRTLLLRV  85

Query  286  I-SVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLPDLMM  462
            +  +    L+K   D   M  L ++A++E+ +TK+L  DWQ  ++ ++VS+G      ++
Sbjct  86   LRDIVNERLEKLPHDLCAM--LIRLASSELTATKDLVPDWQSTSSELIVSLGGRFGKEVV  143

Query  463  EEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVRE  618
            +E+      +      +V+ L ++ASS A    P L  V +R++P+LG +++
Sbjct  144  DELLSKCEPATIPHFYIVKTLGNFASSHAALMVPCLNDVFSRLLPVLGMIKQ  195



>tpg|DAA43365.1| TPA: hypothetical protein ZEAMMB73_728051 [Zea mays]
Length=296

 Score =   366 bits (940),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 184/282 (65%), Positives = 217/282 (77%), Gaps = 23/282 (8%)
 Frame = +2

Query  1742  ELFARLVVLLHNPLAREHLVTQILS---------------------VLWYLAPLFPKNIN  1858
             +LFARLVVLLHNPLAR  L TQIL+                     VL YL PLFP+N++
Sbjct  6     DLFARLVVLLHNPLARGQLATQILTRELPRALEISCSTSRRMLRCGVLCYLGPLFPRNLS  65

Query  1859  SFWQDEL*IPKMKAYVSDTEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTF  2038
              FWQDE  +PKMKAY+SD EDLKQD  YQE WDDMII+FLAE LDV+ + +WV+ LG+ F
Sbjct  66    LFWQDE--VPKMKAYISDPEDLKQDSTYQEKWDDMIINFLAECLDVVNDTEWVISLGDAF  123

Query  2039  ARQYELYKSDNEHSALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAM  2218
             ARQY+LY   + H+ALLHRCLG+LLQKV DR YV  KID M R +++++P NRLGLA+ +
Sbjct  124   ARQYDLYSISDGHAALLHRCLGMLLQKVDDRIYVSEKIDWMCRHSSMSIPINRLGLAQGI  183

Query  2219  GLVAASHLDTVLDKLKGILDNVGQSILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKY  2398
             GLVAASHLDTVL+KLK ILD+  QS  QR  SFFS   K+E+ DDT+AALALMYGYAA+Y
Sbjct  184   GLVAASHLDTVLEKLKNILDSAEQSAFQRFLSFFSFGPKVEDVDDTYAALALMYGYAARY  243

Query  2399  APPTVIEARIDALVGTNMLSRLLHVRHPRAKQAVITAIDLLG  2524
             AP TVIEARI+ALVG+NML RLLHV+HP AKQAVITAIDLLG
Sbjct  244   APSTVIEARINALVGSNMLGRLLHVQHPTAKQAVITAIDLLG  285



>ref|XP_007162803.1| hypothetical protein PHAVU_001G182000g, partial [Phaseolus vulgaris]
 gb|ESW34797.1| hypothetical protein PHAVU_001G182000g, partial [Phaseolus vulgaris]
Length=270

 Score =   360 bits (925),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 179/258 (69%), Positives = 222/258 (86%), Gaps = 0/258 (0%)
 Frame = +2

Query  4409  VQMPSIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSIR  4588
             +Q+P IH+L+YTTQ+LGVILALLDDSDESVQLT VSCLL++L+SS  DAVEP+LLNLS R
Sbjct  1     LQIPLIHILKYTTQVLGVILALLDDSDESVQLTGVSCLLMILDSSPDDAVEPILLNLSKR  60

Query  4589  LRNLQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQA  4768
             LRNLQ  +NAK+RA +FA FGALS YG G++ ++F EQ+HAA PR+VLHLHD+D+ VR A
Sbjct  61    LRNLQSSMNAKMRATSFAVFGALSKYGIGALSEAFVEQVHAAVPRLVLHLHDEDVSVRSA  120

Query  4769  CRNTLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSAI  4948
             CRNTLK + PL+EI+ + A+LNT  F SDHRSDYEDFLRD+A+Q TQ+L  RVD+Y+++ 
Sbjct  121   CRNTLKQVFPLMEIERLLAVLNTQSFLSDHRSDYEDFLRDIAKQFTQHLPSRVDSYMASS  180

Query  4949  IQAFDAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATCS  5128
             +QAFDAPWP+IQANA+Y CSS+LSLSDN++I A+Y+SQVFG+LVGK S S DA+VRATCS
Sbjct  181   VQAFDAPWPIIQANAIYFCSSILSLSDNQHILAVYHSQVFGMLVGKMSRSPDAVVRATCS  240

Query  5129  AALGLLLKSPNSSSWRDA  5182
             AALGLLLKS N  SW D+
Sbjct  241   AALGLLLKSSNLCSWVDS  258



>ref|XP_006442483.1| hypothetical protein CICLE_v10024523mg [Citrus clementina]
 gb|ESR55723.1| hypothetical protein CICLE_v10024523mg [Citrus clementina]
Length=358

 Score =   311 bits (798),  Expect(2) = 1e-98, Method: Compositional matrix adjust.
 Identities = 144/188 (77%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = +1

Query  85   GDSIPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGN  264
            G SIPA EAVQ +VSSLAD+SP VREASM++LKDI +LNPLLVLDCCL +SRGGRRRFGN
Sbjct  7    GISIPAPEAVQFLVSSLADESPIVREASMASLKDIAALNPLLVLDCCLAISRGGRRRFGN  66

Query  265  IAGLFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSH  444
            +AG+FQV++ A+RALD+ D+DPAFM KL++IATAE+IS+KELN DWQRAA+ +LVS+GSH
Sbjct  67   MAGIFQVMAFAVRALDEKDIDPAFMSKLSRIATAEMISSKELNTDWQRAASALLVSIGSH  126

Query  445  LPDLMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIY  624
            LPDLMMEEIFL+ SG+NSALPAMVQILAD+AS+DALQFTPRLKGVL RV+PILGN+R+++
Sbjct  127  LPDLMMEEIFLYLSGTNSALPAMVQILADFASADALQFTPRLKGVLVRVLPILGNIRDVH  186

Query  625  RPIFANGL  648
            RPIFAN  
Sbjct  187  RPIFANAF  194


 Score = 80.5 bits (197),  Expect(2) = 1e-98, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 58/95 (61%), Gaps = 6/95 (6%)
 Frame = +2

Query  644  ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRL------SAVEALGQMV  805
            A WQYSVDF   ++LD D++SFLNSAFELLLRVWA SRDLKV L      S       + 
Sbjct  200  AAWQYSVDFPSHSVLDGDIMSFLNSAFELLLRVWATSRDLKVYLLLHHIFSTTTCTRHIF  259

Query  806  GLITRTQLKAALPRLVPTILELYKREQDAAFVATC  910
              I R QL+  L  L   +L  Y ++QD A VATC
Sbjct  260  CYIFRHQLEITLLFLFSFLLIRYTKDQDTALVATC  294



>ref|XP_002468505.1| hypothetical protein SORBIDRAFT_01g047105 [Sorghum bicolor]
 gb|EER95503.1| hypothetical protein SORBIDRAFT_01g047105 [Sorghum bicolor]
Length=369

 Score =   266 bits (679),  Expect(2) = 7e-97, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 154/181 (85%), Gaps = 0/181 (0%)
 Frame = +1

Query  106  EAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGNIAGLFQV  285
            EAVQV+V+SLADDSP  R+A++ AL DI  LNP+LVLDCC TVSRGGRRRFGN+AG+F V
Sbjct  14   EAVQVLVASLADDSPVARDAALDALCDIAPLNPMLVLDCCATVSRGGRRRFGNMAGVFLV  73

Query  286  ISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLPDLMME  465
            ++ A+RALD  D D  F+ K+AKIATAE++++KE N DWQRAAA +LV++GSH PDLMME
Sbjct  74   MASAVRALDHSDADREFLGKIAKIATAEIVTSKEFNVDWQRAAACLLVAIGSHDPDLMME  133

Query  466  EIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIYRPIFANG  645
            EIFLHFSG  SALPAM+QILAD+AS++ALQFTPRLK VL RV+PILG+VR+  RP+FAN 
Sbjct  134  EIFLHFSGPTSALPAMLQILADFASAEALQFTPRLKDVLLRVLPILGSVRDGQRPVFANA  193

Query  646  L  648
             
Sbjct  194  F  194


 Score =   120 bits (300),  Expect(2) = 7e-97, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 108/133 (81%), Gaps = 1/133 (1%)
 Frame = +2

Query  644   ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
             A WQY  D       D DV+SF+NS FELL++VW  SRDLKVR S+VEALG+MVGL+TR+
Sbjct  200   AAWQYLGDAPSELPFDNDVMSFMNSVFELLIKVWTGSRDLKVRSSSVEALGEMVGLVTRS  259

Query  824   QLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstl  1003
             QLK+ALPR++PT+L+L K++Q+ AFVA+ SLH+LLNASLLS +GPPLLDFE+LTV L TL
Sbjct  260   QLKSALPRIIPTMLDLCKKDQEVAFVASHSLHNLLNASLLSQSGPPLLDFEELTVTLVTL  319

Query  1004  llvCS-NNDKKEH  1039
             L + S NN+K EH
Sbjct  320   LPLVSANNNKDEH  332



>gb|KDO46985.1| hypothetical protein CISIN_1g018728mg [Citrus sinensis]
Length=335

 Score =   237 bits (604),  Expect(2) = 1e-95, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 148/188 (79%), Gaps = 16/188 (9%)
 Frame = +1

Query  85   GDSIPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGN  264
            G SIPA EAVQ +VSSLAD+SP VREASM++LKDI +LNPLLVLDCCL VSRGGRRRFGN
Sbjct  9    GISIPAPEAVQFLVSSLADESPIVREASMASLKDIAALNPLLVLDCCLAVSRGGRRRFGN  68

Query  265  IAGLFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSH  444
            +AG+FQV++ A+RALD+ D+DPAFM KL++IATAE+IS+KELN DWQRAA+ +LVS+GSH
Sbjct  69   MAGIFQVMAFAVRALDENDIDPAFMSKLSRIATAEMISSKELNTDWQRAASALLVSIGSH  128

Query  445  LPDLMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIY  624
            LPDL+                 +  +L+    S  L FTPRLKGVL RV+PILGN+R+++
Sbjct  129  LPDLV----------------LLGFLLSLSPLSLLLMFTPRLKGVLVRVLPILGNIRDVH  172

Query  625  RPIFANGL  648
            RPIFAN  
Sbjct  173  RPIFANAF  180


 Score =   144 bits (364),  Expect(2) = 1e-95, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = +2

Query  644  ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRT  823
            A WQYSVDF   + LD D++SFLNSAFELLLRVWA SRDLKVR+S V+ALGQMVGLITR+
Sbjct  186  AAWQYSVDFPSHSFLDGDIMSFLNSAFELLLRVWATSRDLKVRVSTVDALGQMVGLITRS  245

Query  824  QLKAALPRLVPTILELYKREQDAAFVATC  910
            QLK ALP+LVP+ILELYK++QD A VATC
Sbjct  246  QLKGALPKLVPSILELYKKDQDTALVATC  274



>ref|XP_798384.3| PREDICTED: HEAT repeat-containing protein 7A [Strongylocentrotus 
purpuratus]
Length=938

 Score =   300 bits (767),  Expect(2) = 1e-94, Method: Compositional matrix adjust.
 Identities = 201/698 (29%), Positives = 346/698 (50%), Gaps = 52/698 (7%)
 Frame = +2

Query  716   SAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRTQLKAALPRLVPTILELYKREQDAA  895
             S F++L  +W  S++ K+RL  VEALG M  ++T+ +L+  LP+LVP IL LYK+ Q+A 
Sbjct  233   SGFDVLFSLWLPSKEAKLRLIVVEALGPMTHIMTKEKLEEQLPKLVPGILALYKKHQEAF  292

Query  896   FVAT--CslhsllnasllsnngppllDFEDltvvlstlllvCSNNDKKEHSDFPVGLKTY  1069
             ++    C +     A       P L    +       +    +N         P  LK +
Sbjct  293   YITQGLCMILEAAAAEGSIILEPQLDTILNTMHAQVCVPADYTN---------PTALKNH  343

Query  1070  NEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGSLCVLKHLLPRLAESWHNKRPILI  1249
             NEV+ CF  + + +P+ +  FLL K     E    G+L V K L+        +K+P+++
Sbjct  344   NEVRRCFSVLATSFPDRVVTFLLLKLDSSNERIRIGTLAVFKQLINSSGPHMEDKKPLIL  403

Query  1250  ESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGELFIEYLVRHCAM-PDLENVELES  1426
               +K ++ E+N  V+K  A++++ MA H YL+   G   +E+++R C + PD++      
Sbjct  404   SGLKPVLQENNNKVKKMFAQVVIAMADHEYLLLEGGHQMVEFIIRQCTLTPDVQ------  457

Query  1427  SRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKGLLLITVTVPEMEHVLWPFLLKM  1606
                    TG   P            V+   LR + E  L LIT T+  ME VLWPFLL+ 
Sbjct  458   -------TGRRNP--------DPEYVSNEALRSMSENVLHLITTTIGSMEEVLWPFLLEF  502

Query  1607  IIPRVYTGAVATVCRCISELC-RRRSSESNAMLSECKARTDIPKPEELFARLVVLLHNPL  1783
             +    YT A+ ++CR ++ +  ++R ++    + + +   ++P+P  + ARL+V+   P 
Sbjct  503   LALPQYTDAMMSLCRNLAYIAAKKREAQDEDYMIDYETLANVPRPCSIIARLMVMAGRPD  562

Query  1784  AREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKAYVSDTEDLKQDPLYQESWDDM  1963
                     +L ++  L+P   ++I   W  +  +PK+  Y+ D  D   D   Q+SW+D+
Sbjct  563   NGRQRGVHVLKLMLGLSPNLNESIADMW--DAVVPKLIQYIEDNLD-DPDKWSQKSWEDL  619

Query  1964  IISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHSALLHRCLGILLQKVHDRAYVR  2143
             ++  L+++LD  QN DWV  LG  F     LY++  E    L++CLG++++KV ++ +++
Sbjct  620   LLKLLSKTLDDAQNEDWVAELGTYFGEHTALYQNMPEEKNFLYKCLGVVMRKVTNKQFIQ  679

Query  2144  AKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDKLKGILDNVGQSILQRIFSFFS  2323
               +D+M+        T R G A  +G  A+SHLD  L KL+ +            F+F  
Sbjct  680   KHLDIMFATIRHNDQTEREGCAIGVGFCASSHLDLALTKLETVTKGEMSRKSSGFFNFVK  739

Query  2324  DRGKMEESDDT---HAALALMYGYAAKYAPPTVIEARIDALVGTNMLSRLLHVRHPRAKQ  2494
             D+G     DDT    + + L YGY   YAP  +I +R++  +  N+     +V+    KQ
Sbjct  740   DKG----GDDTGKIKSTVMLCYGYLTLYAPTDIIASRVETNILKNINPHFKNVKDTTVKQ  795

Query  2495  AVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRDEEEGFSDSNIELLHTQSL  2674
              +I A+DL+G+A +            ++  LL ++++ M  +  +  +        T+SL
Sbjct  796   NLIRAVDLIGKA-LHPDHLKTRHSFAKKTDLLGHMMSYMQAESTKEIT------TETRSL  848

Query  2675  ALSACTTLVSVEPKLT-TETRNLIMKATIGFFGLPNDP  2785
             AL AC  LV ++P L+  +   LI       F LP+ P
Sbjct  849   ALQACAALVKLDPLLSEADAFTLITTGVNCLFKLPDCP  886


 Score = 78.6 bits (192),  Expect(2) = 1e-94, Method: Compositional matrix adjust.
 Identities = 54/184 (29%), Positives = 99/184 (54%), Gaps = 12/184 (7%)
 Frame = +1

Query  112  VQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGNIAGLFQVIS  291
            V  ++ +  D   +VR   +S+L D+    P LVL  C +  R   +   +   +  ++ 
Sbjct  22   VMSLIDAAYDKKANVRSIIISSLVDVGKKKPKLVLSSCHSYLRKHNKLSKDHRTV--ILR  79

Query  292  VAIRALDKGDVDP-AFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLPDLMMEE  468
               + L +GD  P A  M L K+A+ E+ ++KE+  +WQ AA+ VLV++G+ L + +ME+
Sbjct  80   TMEQVLKEGDDVPGALSMDLIKLASDEMTASKEVEPEWQTAASNVLVALGNKLCNDVMED  139

Query  469  IFLHFSGSNSALPA--MVQILADYASSDALQFTPRLKGVLARVVPILG-----NVREIYR  627
            ++  F      LP   +VQ +A+ A+ ++  F P L  VL+ ++P+LG     N++ ++ 
Sbjct  140  LYKKFQP--GCLPHFFVVQTMANLANVNSFGFVPHLSAVLSTMIPMLGMAKHDNMKWVFS  197

Query  628  PIFA  639
              FA
Sbjct  198  AAFA  201



>ref|XP_006381369.1| hypothetical protein POPTR_0006s12250g [Populus trichocarpa]
 gb|ERP59166.1| hypothetical protein POPTR_0006s12250g [Populus trichocarpa]
Length=278

 Score =   319 bits (817),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 189/284 (67%), Positives = 220/284 (77%), Gaps = 23/284 (8%)
 Frame = +2

Query  800   MVGLITRTQLKAALPRLVPTILELYKREQDAAFVATCslhsllnasllsnngppllDFED  979
             M GL+TRTQLK ALPRLVPTILELYK++QD A +ATCSL++LLNASLLS  GPPLLDFED
Sbjct  1     MFGLVTRTQLKTALPRLVPTILELYKKDQDIALLATCSLYNLLNASLLSETGPPLLDFED  60

Query  980   ltvvlstll-lvCSNNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLK  1156
             LTV+LSTLL +VC NND KE+SDF VGLKTYNEVQ CFLTVG VYP+DLF FLLNKCRLK
Sbjct  61    LTVILSTLLPVVCFNNDIKENSDFSVGLKTYNEVQRCFLTVGLVYPDDLFTFLLNKCRLK  120

Query  1157  EEPFTFGSLCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHC  1336
             EE  TF     +   + R +E+WH+KRP+L+E+VK L+DE N GVRKAL+ELIVVMASHC
Sbjct  121   EESLTFA----VYVFIWRSSEAWHSKRPLLVEAVKSLLDEQNFGVRKALSELIVVMASHC  176

Query  1337  YLVGSSGELFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTE  1516
             YLVG S ELFIEYLV HCA+ D    + E+S+                   + GA   T+
Sbjct  177   YLVGPSAELFIEYLVCHCALSDHNRNDPENSK------------------VRIGAFCPTK  218

Query  1517  LRGVCEKGLLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVC  1648
             LR VCEKGLLL+T+T+PEMEH+LWPFLLKMIIP+ YT A ATVC
Sbjct  219   LRAVCEKGLLLLTITIPEMEHILWPFLLKMIIPQSYTAATATVC  262



>ref|XP_006381371.1| hypothetical protein POPTR_0006s12270g [Populus trichocarpa]
 gb|ERP59168.1| hypothetical protein POPTR_0006s12270g [Populus trichocarpa]
Length=279

 Score =   313 bits (802),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 148/204 (73%), Positives = 185/204 (91%), Gaps = 1/204 (0%)
 Frame = +1

Query  85   GDSIPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGN  264
            G+SI ASEAVQV+VSSLAD+SP+VR++SM++LKDI SLNPLLVLDCC TVSRGGRRRFGN
Sbjct  7    GNSIAASEAVQVLVSSLADESPTVRQSSMASLKDIASLNPLLVLDCCYTVSRGGRRRFGN  66

Query  265  IAGLFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSH  444
            +AG+FQV+++ + AL++GDVDP+FM KLAKIAT E+IS+KELNADWQRAAAG+LVS+GSH
Sbjct  67   MAGVFQVMALGVSALNEGDVDPSFMAKLAKIATTEMISSKELNADWQRAAAGLLVSIGSH  126

Query  445  LPDLMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIY  624
            LPDLM+EEIFLH SG +SALPAMVQILAD+AS++A+QF PRLKGVL+RV+PILGNVR+++
Sbjct  127  LPDLMIEEIFLHLSGPSSALPAMVQILADFASANAIQFIPRLKGVLSRVLPILGNVRDVH  186

Query  625  RPIFANGLLAV*RGFLTVYNPRYR  696
            RPIFANG +A+   FL  +  + +
Sbjct  187  RPIFANG-MAILSDFLGSFRSKLK  209


 Score = 63.9 bits (154),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +2

Query  644  ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVRL  775
            A WQY++DF   + LD DV+SFLNSAFELLLRVWA S+DLK  L
Sbjct  233  AAWQYNMDFPSLSPLDADVMSFLNSAFELLLRVWATSKDLKGHL  276



>gb|KDO46971.1| hypothetical protein CISIN_1g0006554mg, partial [Citrus sinensis]
 gb|KDO46972.1| hypothetical protein CISIN_1g0006554mg, partial [Citrus sinensis]
 gb|KDO46973.1| hypothetical protein CISIN_1g0006554mg, partial [Citrus sinensis]
 gb|KDO46974.1| hypothetical protein CISIN_1g0006554mg, partial [Citrus sinensis]
 gb|KDO46975.1| hypothetical protein CISIN_1g0006554mg, partial [Citrus sinensis]
Length=207

 Score =   305 bits (780),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 149/224 (67%), Positives = 173/224 (77%), Gaps = 18/224 (8%)
 Frame = +2

Query  1142  KCRLKEEPFTFGSLCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVV  1321
             KCRLKEE  + G+L VLKHLLPR +E+WH+KRP+L+E+VK L+DE NL V+KA++ELIVV
Sbjct  1     KCRLKEEHLSVGALYVLKHLLPRSSEAWHSKRPLLLEAVKSLLDEQNLAVQKAISELIVV  60

Query  1322  MASHCYLVGSSGELFIEYLVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGA  1501
             MASHCYL+G SGELF+EYLVRHCA+ D +    ESS+                   K GA
Sbjct  61    MASHCYLIGPSGELFVEYLVRHCALSDQKKYVNESSK------------------VKIGA  102

Query  1502  VTTTELRGVCEKGLLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRS  1681
                TELR +CEKGLLL+T+T+PEM+H+LWP LLKMIIPR YT A ATVCRCISELCR RS
Sbjct  103   FCPTELRAICEKGLLLLTITIPEMQHILWPLLLKMIIPRAYTSAAATVCRCISELCRHRS  162

Query  1682  SESNAMLSECKARTDIPKPEELFARLVVLLHNPLAREHLVTQIL  1813
             S SN MLSECKAR DIP PEELFARLVVLLH+PLARE   TQIL
Sbjct  163   SSSNVMLSECKARDDIPNPEELFARLVVLLHDPLAREQQATQIL  206



>ref|XP_635367.1| hypothetical protein DDB_G0291161 [Dictyostelium discoideum AX4]
 sp|Q54F23.1|MROH1_DICDI RecName: Full=Maestro heat-like repeat-containing protein family 
member 1; AltName: Full=HEAT repeat-containing protein 7A 
homolog [Dictyostelium discoideum]
 gb|EAL61864.1| hypothetical protein DDB_G0291161 [Dictyostelium discoideum AX4]
Length=1647

 Score =   287 bits (734),  Expect(2) = 7e-89, Method: Compositional matrix adjust.
 Identities = 248/988 (25%), Positives = 466/988 (47%), Gaps = 98/988 (10%)
 Frame = +2

Query  719   AFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRTQLKAALPRLVPTILELYKREQDAAF  898
             A EL+   W  +   KVRL  +EA+G +  +++  QL++ + +LV  +L + K+E+D   
Sbjct  229   ALELMFSKWLGTNHEKVRLVTIEAVGSICSILSVEQLESQIQKLVVGVLSMLKKEKDLLP  288

Query  899   VA---TCslhsllnasllsnngppllDFEDltvvlstlllvCSNNDKKEHSDFPVGLKTY  1069
             V     C L   +   L       L+        L  ++   SN         P   KTY
Sbjct  289   VTHSLCCILEVCVKNDLKLQVNELLIPIMTTLHPLVCIVPDYSN---------PASTKTY  339

Query  1070  NEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGSLCVLKHLLPRLAESWHNKRPILI  1249
             NEV  CF  +G  Y + L  FL  +   ++     GSL +++H++ RL     +K+P+++
Sbjct  340   NEVLRCFEVIGRGYSDVLISFLNQRLENRDLRSRAGSLSIIRHIVTRLDVELADKKPLIL  399

Query  1250  ESVKLLID-EHNLGVRKALAELIVVMASHCYLVGSSGELFIEYLVRHCAMPDLENVELES  1426
              ++K LI  E +L ++K LA++I+ MA + YL    G   +E++V+  +    ++ E+  
Sbjct  400   SAIKPLIQTEPSLFIKKYLAQIIIAMAPYGYLEMEGGLTLLEFIVKGSSW--YQDSEIGK  457

Query  1427  SRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKGLLLITVTVPEMEHVLWPFLLKM  1606
             ++ +            +K+E     VT +ELR +C+  L LIT T+P++E +LWP+L + 
Sbjct  458   AQPTQP---------PKKIENPDLHVTDSELRLICDNILNLITTTMPQLESILWPYLFEF  508

Query  1607  IIPRVYTGAVATVCRCISELC-RRRSSESNAMLSECKARTDIPKPEELFARLVVLLHNPL  1783
             I+P  YT A+  V + ++ +   ++S +S+    +     ++PKP ++ AR  VLL  PL
Sbjct  509   ILPEQYTAAIPVVTKSLTYIALSKKSVDSDDYYIDFDKEINLPKPTQIIARYFVLLTAPL  568

Query  1784  AREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKAYVSDTEDLKQDPLYQESWDDM  1963
              R  L  +IL  +  + P+   +I   W  ++ +PK+ +Y+ D  D+  +   +  W+++
Sbjct  569   RRNQLGIRILENMKAIGPILHPSICDMW--DVTLPKLISYLEDHTDI--ETWNKNQWEEL  624

Query  1964  IISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHSALLHRCLGILLQKVHDRAYVR  2143
             ++  L+E++    + +W + LGN+ + Q + YK D      L++ +G+++QK   + +V+
Sbjct  625   VLRLLSETIKNAADDEWTVALGNSMSEQIDHYKKDPILKRSLYKQMGLIMQKCSHKEFVK  684

Query  2144  AKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDKLKGILDNVGQSILQRIFSFFS  2323
             +KI++M+   +        G A  +G   ASH D VL+K+   + N   S++++   FF 
Sbjct  685   SKIEVMFTSVDYTNSLENEGCAIGLGYCGASHFDIVLEKINFYIKN---SMVKK-SGFFG  740

Query  2324  DRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALVGTNMLSRLLHVRHPRAKQAVI  2503
              +G           + L  GY+A YA   +  +R++  V   +   +L ++    K + I
Sbjct  741   KKG----PKGIKNCILLSLGYSATYAQSALFSSRVEVHVIQPIKPSILQLKKVPKKLSSI  796

Query  2504  TAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRDEEEGFSDSNIELLHTQSLALS  2683
               IDL+G+A+     S  +F  K+RD L+  +++ M        +   I+         +
Sbjct  797   KMIDLIGKALHPNKAS--TFIFKQRDELMKLLISYMSTPPPSTNNQVKID-------GTN  847

Query  2684  ACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDV----------INPLIDNLITLLC  2833
             AC+TLV++EP ++ E    I+  ++ FF     P++           +N LI ++  LL 
Sbjct  848   ACSTLVNLEPMISLELEVQIINLSLSFFNQQVSPANATNTDSDEYKEVNSLITSVNNLLS  907

Query  2834  TILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIKFRAICVNGYCA  3013
             TIL       ++    L  ++  +DP   S   + R+R       L+ KF          
Sbjct  908   TILY-----NQTTIACLNRLIGYLDPLSRSKDAHIRERSLFCILYLVKKF----------  952

Query  3014  LGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDAL--SLGERIMVYLPRCIDTNYEVRK  3187
                         I+++ + +  ++P+       D L  S+G  + V +PRC D    VR+
Sbjct  953   ------------IEYSTDSD--SMPT-------DKLFDSIGTTLSVLIPRCTDPEINVRR  991

Query  3188  VSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILRSDASIDPSEVFNRV  3367
              +V+ + L   I F L      +  +        L+S+ D  +I  ++ +   S VF  +
Sbjct  992   YAVESIQLILYIGFMLKNATPDNRRVKPSEVLHPLTSIRD--SITTTEVNEQFSLVF-EI  1048

Query  3368  VSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNELNEIEVSRTSQ  3547
                +  +++ +E+   L G    + D    S  G+   +   +  RG EL E  V    +
Sbjct  1049  SVIISKMISLEEIPKFLEGSIKGLQDLQAFSTNGSCIIINGLIKTRGEELIEY-VPILVK  1107

Query  3548  SLLTAVVHVTEKYLRQETLGAICSVAEN  3631
              LLTA+  +T +     TL ++ S+A +
Sbjct  1108  GLLTAMEGITSETTMNGTLVSLRSLANH  1135


 Score = 72.4 bits (176),  Expect(2) = 7e-89, Method: Composition-based stats.
 Identities = 45/185 (24%), Positives = 95/185 (51%), Gaps = 11/185 (6%)
 Frame = +1

Query  112  VQVMVSSLADDSPSVREASMSALKDITSLNPLLVLD-CCLTVSRGGR----RRFGNIAGL  276
            V  ++ SL+D   SVR   +++L +I    P  VL   C  +++  +     R   +  +
Sbjct  16   VTSLLQSLSDSDESVRSTVVNSLYEIGFRQPNFVLQVACDYINKNQKIDQTHRVKILNSI  75

Query  277  FQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLPDL  456
             Q++        +  +  A  + L  ++ +E+   KE+  DWQ+ A+ +LVS+G   P  
Sbjct  76   LQILEQT-----RNQLTDALSLNLIAMSISEMTRDKEVVPDWQQVASSLLVSLGLRYPSQ  130

Query  457  MMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVR-EIYRPI  633
            +M+E+   F         +++ L D+ SS+ +   P+++ +L+R++P+LG ++ + ++ +
Sbjct  131  IMDELLKRFEPGTLPHYFVMKTLGDFISSNPIPTVPKIREILSRILPVLGTIKHDNFKWV  190

Query  634  FANGL  648
            FA  L
Sbjct  191  FAAAL  195


 Score =   115 bits (288),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 101/379 (27%), Positives = 184/379 (49%), Gaps = 15/379 (4%)
 Frame = +2

Query  4043  PLRALLNAFQAFCECVGDLE--MGKILARGG-EQNENEKWINLIGELAGSISIKRPKEVP  4213
             P + +L  F+ F +C  + E  + +I ++G   Q E   +   I E+   +S   P  + 
Sbjct  1270  PSQQMLVTFRQFFKCTKEEETLLAEIESKGSFSQLETPFYHQGIIEILSVVSSHHPDLIQ  1329

Query  4214  TICLFLSKSLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRL  4393
              I  +L           R    +  +E + +      L+ +++  L   + D  P V+ +
Sbjct  1330  GIFQYLLPYQRSNHLEHRIVTISVTTELINHCKD-KELIQRLINTLLNSLVD--PLVKLI  1386

Query  4394  CLRGLVQMPSIHVLQ---YTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEP  4564
              L+GL  + S  V Q   Y   ++  +   +DD DE++ +  +  L  + E +    V P
Sbjct  1387  SLKGLSNIVSAGVEQTNRYAPTVIDALSTSIDDQDETMAMECMLGLSKIFEVADEGRVAP  1446

Query  4565  VLLNLSIRLRNLQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHD  4744
             +L+N+  R+R      N  IRA +F  FG+L  +G+GS  D F EQIH++ P +++HL+D
Sbjct  1447  ILVNICNRIRPAFEKPNDSIRAASFQLFGSLWRFGSGSACDPFYEQIHSSLPSLIMHLND  1506

Query  4745  DDLGVRQACRNTLKCIAPLIEI-DAIPALLNTHR-FSSDH-RSDYEDFLRDLARQLTQYL  4915
             D   V+ +C+ TL  ++ L+   DA+    N  + F  D+ + +YE+FL D ++ L    
Sbjct  1507  DVQSVKNSCKKTLFQLSTLMRSQDAMDYFNNKSKGFVGDNDQPNYEEFLLDFSKLLIINY  1566

Query  4916  GPRVDTYLSAIIQAFDAPWPVIQANAVYLCSSML-SLSDNKNISALYYSQVF-GVLVGKA  5089
               RV+ ++  +I+ F + W  ++ NA      +L +L+++K       S +    LVG  
Sbjct  1567  PERVNYFVMTVIEFFKSTWVNLRGNAATFIGFILGNLTEDKRTQTNINSTILTKSLVGLL  1626

Query  5090  SNSTDAIVRATCSAALGLL  5146
             +  + A VR   + +LGLL
Sbjct  1627  AEKSPA-VRKKAAESLGLL  1644



>ref|XP_003622230.1| HEAT repeat-containing protein 7A, partial [Medicago truncatula]
Length=216

 Score =   295 bits (754),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 166/213 (78%), Positives = 194/213 (91%), Gaps = 1/213 (0%)
 Frame = +2

Query  767   VRLSAVEALGQMVGLITRTQLKAALPRLVPTILELYKREQDAAFVATCslhsllnaslls  946
             VR+++VEALGQMVGLITRTQLKAALPRLVPTILELYK++ D AF+ATCSLH+LLNASLLS
Sbjct  2     VRVASVEALGQMVGLITRTQLKAALPRLVPTILELYKKDLDVAFLATCSLHNLLNASLLS  61

Query  947   nngppllDFEDltvvlstlllvCS-NNDKKEHSDFPVGLKTYNEVQHCFLTVGSVYPEDL  1123
              +GPP+LDFEDLT+ L TLL V S N++ K+ +DF VGLK YNEVQHCFLTVG VYP+DL
Sbjct  62    ESGPPMLDFEDLTLTLGTLLPVISMNSESKDQTDFSVGLKMYNEVQHCFLTVGLVYPDDL  121

Query  1124  FVFLLNKCRLKEEPFTFGSLCVLKHLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKAL  1303
             F+FL+NKCRLKEE  TFG+LCVLKHLLPRL+E+WH K P+L+E+VK L++EHNLGVRKAL
Sbjct  122   FLFLVNKCRLKEEASTFGALCVLKHLLPRLSEAWHGKIPLLVEAVKSLLEEHNLGVRKAL  181

Query  1304  AELIVVMASHCYLVGSSGELFIEYLVRHCAMPD  1402
             +ELIVVMASHCYLVGSSGELFIEYL+RHCA+ D
Sbjct  182   SELIVVMASHCYLVGSSGELFIEYLIRHCALTD  214



>ref|XP_003291776.1| hypothetical protein DICPUDRAFT_50034 [Dictyostelium purpureum]
 gb|EGC31710.1| hypothetical protein DICPUDRAFT_50034 [Dictyostelium purpureum]
Length=1662

 Score =   287 bits (735),  Expect(2) = 9e-85, Method: Compositional matrix adjust.
 Identities = 245/986 (25%), Positives = 459/986 (47%), Gaps = 96/986 (10%)
 Frame = +2

Query  719   AFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRTQLKAALPRLVPTILELYKREQDAAF  898
             A EL+   W  +   KVRL  +EA+G +  +++  QL++ + +LV  +L + K+E+D   
Sbjct  229   ALELMFSKWLGTNHEKVRLVTIEAVGSICSILSIEQLESQIQKLVSGVLAMLKKEKDLLP  288

Query  899   VA---TCslhsllnasllsnngppllDFEDltvvlstlllvCSNNDKKEHSDFPVGLKTY  1069
             V     C L   +   +       L+        L  ++   SN         P   KTY
Sbjct  289   VTHSLCCILEVCVKNDIKLQVNELLIPMMQTLHPLVCVVPDYSN---------PASTKTY  339

Query  1070  NEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGSLCVLKHLLPRLAESWHNKRPILI  1249
             NEV  CF  +G  Y + L  FL NK   ++     GSL +++H++ RL     +K+P++I
Sbjct  340   NEVLRCFEVIGRGYVDSLISFLNNKLENRDLKSRAGSLSIIRHMVTRLDVELTDKKPLII  399

Query  1250  ESVKLLID-EHNLGVRKALAELIVVMASHCYLVGSSGELFIEYLVRHCAMPDLENVELES  1426
              ++K L+  E ++ ++K L+++IV MA + YL    G   IE++++  +           
Sbjct  400   SAIKPLVQSEPSIFIKKYLSQIIVAMAPYGYLHMEGGLQLIEFIIKGSSF----------  449

Query  1427  SRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKGLLLITVTVPEMEHVLWPFLLKM  1606
               + S       P   +K+E     VT  ELR + +  L L+T T+P+ME VLWP+L + 
Sbjct  450   -VQDSELGKTVAPQPQKKIENPELHVTEQELRSISDNILNLMTTTMPDMESVLWPYLFEF  508

Query  1607  IIPRVYTGAVATVCRCISELCR-RRSSESNAMLSECKARTDIPKPEELFARLVVLLHNPL  1783
             ++P  YTG++  V +C++   + +++++S+    +     ++PKP ++ +R  VLL  PL
Sbjct  509   LLPDQYTGSIPIVAKCLTYYAQQKKAADSDDYYIDFDKEINLPKPTQIISRYFVLLTAPL  568

Query  1784  AREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKAYVSDTEDLKQDPLYQESWDDM  1963
              R  L  +IL  +  + P+   +I   W  ++ +PK+ +Y+ D  D   D   +  W+++
Sbjct  569   RRSQLGIRILENMKAIGPILHPSICDMW--DVTLPKLISYLEDHTD--PDTWNKNQWEEL  624

Query  1964  IISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHSALLHRCLGILLQKVHDRAYVR  2143
              +  LAE++    + +W + LGN+ + Q + YK D+     L++ +G+++QK   + +V+
Sbjct  625   TLRLLAETIKNAADDEWTVTLGNSMSEQIDHYKKDSSLKRSLYKQMGLIMQKCAHKEFVK  684

Query  2144  AKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDKLKGILDNVGQSILQRIFSFFS  2323
             +KI++M+   +        G A  +G  A+SH D VL+K+   + N     + +   FF 
Sbjct  685   SKIEVMFTSVDYTNGLENEGCAIGLGYCASSHPDIVLEKINYHIKNT----MVKKSGFFG  740

Query  2324  DRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALVGTNMLSRLLHVRHPRAKQAVI  2503
              +G           + L  GY A++    +  +R++  V   +   +  ++    K + I
Sbjct  741   KKG----PKGVKNCILLSLGYMAQHMASNIFSSRVEVHVFQPIKPAISILKKVPKKLSAI  796

Query  2504  TAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRDEEEGFSDSNIELLHTQSLALS  2683
               IDL+G+A+      G +F  K+RD L+  +++ M         ++ +++       ++
Sbjct  797   KMIDLIGKALHPNKVPGYTF--KQRDELVKLLISYMNPATPPIGMNNQVKV-----DGVN  849

Query  2684  ACTTLVSVEPKLTTETRNLIMKATIGFFGL-------PNDPSD---VINPLIDNLITLLC  2833
             AC+TL+ +EP +T E  N I++  + F+ L        N  SD    IN L+  +  L  
Sbjct  850   ACSTLIHLEPMITLELENQIVQLVLTFYNLQVSAANASNTESDEYKEINSLVTAVNNLFS  909

Query  2834  TILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIKFRAICVNGYCA  3013
             TIL       ++  E    +L  +DP   S   + R+R       L+ KF          
Sbjct  910   TILY-----NQTSIECFNRLLGYLDPLSRSKDAHVRERSMFCILYLVKKF----------  954

Query  3014  LGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDAL--SLGERIMVYLPRCIDTNYEVRK  3187
                         I+++       LP       +D +  ++G  + + +PRC D    VRK
Sbjct  955   ------------IEYSTES--QELP-------KDKVFDNIGSTLSILIPRCTDPEINVRK  993

Query  3188  VSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILRSDASIDPSEVFNRV  3367
              +V+ + L   +SF L      +  +        L+S+ +   I  ++ +   S VF  +
Sbjct  994   YAVEGIQLMLYVSFMLKNTTLENRRVKPSEVLHPLTSIRE--GITTTEVNEQFSLVF-EI  1050

Query  3368  VSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNELNEIEVSRTSQ  3547
              S +  +++ +E+   L G    + D    S  G+   +   + +RG EL +  V    +
Sbjct  1051  SSVISKMVSLEEIPKFLEGSIKGLQDLQTFSTNGSCIMINGIIKSRGEELIDY-VPVLVR  1109

Query  3548  SLLTAVVHVTEKYLRQETLGAICSVA  3625
              LLTA+  +T +     TL ++ S+A
Sbjct  1110  GLLTAMEGITSETTMNGTLVSLRSLA  1135


 Score = 58.2 bits (139),  Expect(2) = 9e-85, Method: Composition-based stats.
 Identities = 41/181 (23%), Positives = 94/181 (52%), Gaps = 3/181 (2%)
 Frame = +1

Query  112  VQVMVSSLADDSPSVREASMSALKDITSLNPLLVLD-CCLTVSRGGRRRFGNIAGLFQVI  288
            V  ++ SL+D   +V+   +++L +I    P  VL   C  +++  +    +   +   I
Sbjct  16   VNSLLQSLSDSDENVKSTVVNSLYEIGFRQPNFVLHVACEFINKNQKIDLSHRVKILTSI  75

Query  289  SVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLPDLMMEE  468
               I    + D+     M L +++ +E+   KE+  +WQ+ ++ +LVS+G   P L+M+E
Sbjct  76   H-QILEQTRNDITDQLSMNLIQMSISEMTKDKEVVPEWQQISSSLLVSLGLRYPQLIMDE  134

Query  469  IFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVR-EIYRPIFANG  645
            +   F         +++ L D+  S+ +   P+++ +L+R++P+L +++ + ++ +FA  
Sbjct  135  LLKRFEPGTIPHYFVMKTLGDFIGSNPIPTVPKVREILSRILPVLASIKHDNFKWVFAAA  194

Query  646  L  648
            L
Sbjct  195  L  195


 Score =   106 bits (264),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 102/397 (26%), Positives = 181/397 (46%), Gaps = 36/397 (9%)
 Frame = +2

Query  4043  PLRALLNAFQAFCECVGDLE--MGKILARGG-EQNENEKWINLIGELAGSISIKRPKEVP  4213
             P + +L  F+ F  C  + E  +  I  +G   + E   +   I E+ G ++   P+ + 
Sbjct  1270  PSQQMLATFRQFFTCTKEEETCLNPIEGKGSFNRLEAYDYHEGIIEITGVVAAAHPEHIK  1329

Query  4214  TICLFLSKSLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRL  4393
              I  FL           R    A  +E + +      +L +++  L   + D  P V+ +
Sbjct  1330  GIFEFLLPYQRSNHLQHRIVVIAVTTELINHCKD-KEILQRLINTLLNSLVD--PLVKLI  1386

Query  4394  CLRGLVQMPSIHVLQ---YTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEP  4564
              L+GL  + S  + Q   Y   ++  +   +DD DE + +  +  L  + E +    V P
Sbjct  1387  SLKGLSNIVSAGIEQTNRYAPTVIDALSTSIDDQDEGMAMECMLGLSKIFEVADEGRVAP  1446

Query  4565  VLLNLSIRLRNLQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHD  4744
             +L+N+  R+R      N  IR  +F  FG+L  +G+GS  D F EQIH + P +++HL+D
Sbjct  1447  ILVNICNRIRPAFEKPNDFIRGASFKLFGSLWRFGSGSACDPFYEQIHNSLPALIMHLND  1506

Query  4745  DDLGVRQACRNTL--KCIAPLIEIDAIPALL---------------NTHRFSSDHRS-DY  4870
             D+  V+ AC+ TL   C   + E  + P  L                 H   SD  S +Y
Sbjct  1507  DNPMVKDACKKTLFELCGQNISEDRSRPYNLMRSLEIMEYFNNKSKGFHPSVSDSSSINY  1566

Query  4871  EDFLRDLARQLTQYLGPRVDTYLSAIIQAFDAPWPVIQAN-AVYLCSSMLSLSDNK----  5035
             ++FL D ++ L  +   RV+ ++  +I+ F + W  ++ N A      + +L+D K    
Sbjct  1567  DEFLLDFSKLLIVHYPERVNYFIMTVIEFFKSGWVTLKGNSATLTGLLLGNLTDEKRIQT  1626

Query  5036  NISALYYSQVFGVLVGKASNSTDAIVRATCSAALGLL  5146
             NI++   ++    L+G  S    ++VR   + +LGLL
Sbjct  1627  NINSTIITKTLINLLGDRS----SMVRKKAAESLGLL  1659



>gb|ELT91566.1| hypothetical protein CAPTEDRAFT_173785 [Capitella teleta]
Length=1648

 Score =   293 bits (751),  Expect(2) = 1e-83, Method: Compositional matrix adjust.
 Identities = 279/1080 (26%), Positives = 458/1080 (42%), Gaps = 172/1080 (16%)
 Frame = +2

Query  725   ELLLRVWAMSRDLKVRLSAVEALGQMVGLITRTQLKAALPRLVPTILELYKREQDAAFVA  904
             E+LL  W  +RD K+R   +EA+GQM  ++++ +L+  LP+L+ T   LYK+  +   V+
Sbjct  216   EVLLNNWIGTRDAKIREQVIEAVGQMSYVVSKPKLQERLPKLLQTFSNLYKKHPEPFHVS  275

Query  905   TCslhsllnasllsnngppllDFEDltvvlstlllvCSNNDKKEHSDFPVGLKTYNEVQH  1084
                 + L   S    +       +      +    VC   D       P+ +K +NE+  
Sbjct  276   KGLYNILDANSSDILHPHVESILQ------AIFPQVCHAVDYS----VPMTIKNHNELLR  325

Query  1085  CFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGSLCVLKHLLPRLAESWHNKRPILIESVKL  1264
             C   +  V    + +FL+ K     E    G L +++HL+    E   +K+ I I  +K 
Sbjct  326   CLSVLVRVDSMLVVMFLMEKLENSNERVRIGVLSIMRHLINSAGEEMADKKDIFISGLKK  385

Query  1265  LIDEHNLGVRKALAELIVVMASHCYLVGSSGELFIEYLVRHCAMPDLENVELESSRESSR  1444
             +  + N  V+K LA+ I+ MA H YL    G+  IE++V  CA+P        +     R
Sbjct  386   VTGDPNNKVKKILAQTIIAMAHHGYLQLVGGQEMIEFIVNQCALP--------TETPGRR  437

Query  1445  FTGNYYPFVYRKLEFKAGAVTTTELRGVCEKGLLLITVTVPEMEHVLWPFLLKMIIPRVY  1624
              T   Y             V+   LR +C+  L L+T TV  M  VLWPFLL+ +IP  Y
Sbjct  438   PTDPEY-------------VSNDALRSMCDNVLQLLTTTVDNMGKVLWPFLLECVIPEKY  484

Query  1625  TGAVATVCRCISELCRRRSSESN-AMLSECKARTDIPKPEELFARLVVLLHNPLAREHLV  1801
             T A +T+CRCI+    ++  E++ +   +  A  ++PKP+ L AR  VL   P+  +H  
Sbjct  485   TMAQSTICRCIAHTAAKKKEENDDSFYVDFDASANVPKPQALLARFFVLCGLPVQSKHRG  544

Query  1802  TQILSVLWYLAPLFPKNINSFWQDEL*IPKMKAYVSDTEDLKQDPLYQESWDDMIISFLA  1981
                L+ L +LAPL  +N+   W  ++ IPK+  ++ D +DL  D   Q +W+D+++ F++
Sbjct  545   LHALTALRWLAPLIHENLIEMW--DIVIPKLIKHLEDHQDL--DDWSQNNWEDLMLKFVS  600

Query  1982  ESLDVIQNVDWVLLLGNTFARQYELYKSDNEHSALLHRCLGILLQKVHDRAYVRAKIDLM  2161
             +SL+ + + +W+  +G+  A Q  LY + ++    L++CLGI+++    + +V   +D +
Sbjct  601   KSLEQVGDEEWICSMGDAMAEQISLYDNLHDEKNFLYKCLGIIMRISSKKDFVSHHLDTL  660

Query  2162  YRQANIAVPTNRLGLAKAMGLVAASHLDTVLDKLKGILDNVGQSILQR-IFSFFSDRGKM  2338
             +     A    R G A  +G  AASHLD V  KL  I      S  +  I SF  D G  
Sbjct  661   FSTVKHANQVEREGCAVGLGYAAASHLDIVTTKLDLIAKRKSDSTRKSGILSFIKDFGSG  720

Query  2339  EESDD-THAALALMYGYAAKYAPPTVIEARIDALVGTNMLSRLLHVR-----------HP  2482
              E DD T A + L YGY A YAPP +I +R+   +   +   L + +            P
Sbjct  721   SELDDQTKATILLCYGYVALYAPPHLIISRLQTQILVAINPHLTNAKLLLLSPPLPSQDP  780

Query  2483  RAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRDEEEGFSDSNIELLH  2662
               KQ +I  I+L+G++ +             ++ LL ++   +  +     +        
Sbjct  781   DVKQNLIRTIELIGRS-MHPEHLNARHDFSHKNKLLQHLQDYIKAESPTQVTGE------  833

Query  2663  TQSLALSACTTLVSVEPKL-TTETRNLIMKATIGFFGLPNDP------------SDVINP  2803
             T+ LA  A   LV + P+L ++E   L+         LP  P            S+ +  
Sbjct  834   TRYLAFKAMCVLVQLTPRLMSSELAALLQNVLDASMQLPPLPPNADAKDSELLLSNTLKS  893

Query  2804  LIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAA----HEL  2971
             L   L+ +L T + T G D          I   + P+  SS  ++R+R    +    H  
Sbjct  894   LQQLLLDILSTEMTTKGLDI---------ICTALQPWRVSSHSHERERAMELSLKIYHHF  944

Query  2972  LIKFRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYL  3151
             L     + V+   A   QGSC                              LG RI   +
Sbjct  945   LQGVDVVSVSSLLAFCSQGSC------------------------------LG-RI---V  970

Query  3152  PRCIDTNYEVRKVSVQILNLFFNIS----FSLPK-------PINSSLG-----IDIELSY  3283
             PRC D   +VR+ +   +     I     FS P+       P   S+      ID+E S 
Sbjct  971   PRCSDPQDDVRESAFNCIYTLLKIKKHAYFSFPRKRPDYSDPFVESVNELKHKIDVEDSA  1030

Query  3284  IALSSLEDVVAILRSDASIDPSEVFNRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSA  3463
                  +  +  +LR   S D    F +V+         + LV A   CS   C  +K   
Sbjct  1031  GLFEVISQLAEVLRQKLSSDQLMPFLQVL--------MEGLVDAEPFCSSGACVVMK---  1079

Query  3464  EGAIQAVVEFVTNRGNELNEIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSK  3643
                      F+ +RG EL+  +V+     L   +  +T    R  TL A           
Sbjct  1080  --------SFMESRGAELHS-QVATLQTGLHAKLSVITHPQTRTGTLRA-----------  1119

Query  3644  VVFTEVLAAAGRDMVTKDIHRLRGGWPIQ----DAFHAFSQHLVLSHSFLEHVISVINQS  3811
                  V A     M+T   H ++   P+     D +    Q   L+ +F+E  + ++ Q+
Sbjct  1120  -----VRALGKHHMLTMLEHLMQRTLPLDAATLDTWKVIGQKASLTAAFMETALEMLRQA  1174


 Score = 48.1 bits (113),  Expect(2) = 1e-83, Method: Compositional matrix adjust.
 Identities = 42/175 (24%), Positives = 83/175 (47%), Gaps = 9/175 (5%)
 Frame = +1

Query  121  MVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLT-VSRGGRRRFGNIAGLFQVISVA  297
            ++ +  D   +VR+   ++L+D+ S    LVL  CL  +S+  +    +   +   ++  
Sbjct  3    LIDAQLDKDSNVRDVVGASLRDLGSKQTSLVLTSCLNYLSKHVKLPVAHKIAILNCMADV  62

Query  298  IRA-LDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLPDLMMEEIF  474
            +RA L+K  VD    + + K A  ++  TK+   +WQ AA+ VLV+VG         E+ 
Sbjct  63   VRANLEK--VDKELAIAIVKEAATQMTQTKDAVPEWQAAASHVLVAVGCQWILESNTELI  120

Query  475  LHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILG-----NVREIY  624
              F+        +V+ + + A  +     P +K  L+ ++ ++G     N+R I+
Sbjct  121  KRFNPGQLPDFFIVETMGNLAKENVYGMVPYIKAGLSTMLSVIGIAKQDNIRWIF  175


 Score =   111 bits (277),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 80/286 (28%), Positives = 138/286 (48%), Gaps = 14/286 (5%)
 Frame = +2

Query  4262  QREAAAAALSEFLRYSD-------GFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQMP  4420
             QR  AAA  ++ +           G   L+  +V  L   + D +  VR LC+RGL  + 
Sbjct  1340  QRMMAAAVYAQVISERSLIEEGCAGDSNLVDLLVNGLLARLVDSNHRVRMLCIRGLGNVA  1399

Query  4421  SI---HVLQYTTQILGVILALLDDS---DESVQLTAvsclllvlesssTDAVEPVLLNLS  4582
             S     + +Y+  ++  ++A +DD    D+ + L A+  L  +L     + +  VL+N+S
Sbjct  1400  SAGSEQLRKYSMSVVSAMIAGMDDKEDVDDYITLEAMEGLSRILAEIDEEQIRGVLINVS  1459

Query  4583  IRLRNLQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVR  4762
             +R+R      N ++RA A   FG L+ +G G   D F EQIH+    ++LHL+D    VR
Sbjct  1460  LRIRPCFEKNNDRVRAVAIGLFGDLARFGDGPSKDPFVEQIHSNLVTLLLHLNDPSPQVR  1519

Query  4763  QACRNTLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLS  4942
              AC+ TL+ I P +  +AI  +   H   S     Y +F+ DL++ + +    +++ Y  
Sbjct  1520  LACKKTLRSIGPFVGSEAINEMFQKHLLESASLI-YGEFMNDLSKAINKDFVDKLNFYTM  1578

Query  4943  AIIQAFDAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLV  5080
               +  F + W  I++NA      +L   D+ + S L    + G L+
Sbjct  1579  GNVSFFRSSWSEIRSNAAMFVGFLLGNMDSSSASNLSKEHICGALI  1624



>ref|XP_003384630.1| PREDICTED: HEAT repeat-containing protein 7A homolog [Amphimedon 
queenslandica]
Length=1634

 Score =   287 bits (734),  Expect(2) = 3e-83, Method: Compositional matrix adjust.
 Identities = 241/964 (25%), Positives = 440/964 (46%), Gaps = 117/964 (12%)
 Frame = +2

Query  716   SAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRTQLKAALPRLVPTILELYKREQDAA  895
             SA++    VW +S+D ++RL+ VEALG  V +I+   L   LP+LVP +++LYK++ +  
Sbjct  222   SAYDTFFNVWLLSKDARLRLAVVEALGYAVHIISAEALNDQLPKLVPGVVQLYKKQSEHY  281

Query  896   FVATCslhsllnasllsnngppllDFEDltvvlstlllvCSNNDKKEHSDFPVGLKTYNE  1075
             ++  C    +  +                 ++       C+  D        + +K +NE
Sbjct  282   YITQCLCMIMEASCKKECANFT---VLLDNLLNLLHQQACAPVDFSSS----MAVKNHNE  334

Query  1076  VQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGSLCVLKHLLPRLAESWHNKRPILIES  1255
             V  CF      +P+ +  +LL K    ++    G+  V KHL+    +   +K+P+++  
Sbjct  335   VLRCFTVACKFHPQRVVSYLLTKLETNQDKIKGGTQEVFKHLMNSCDKELDDKKPLIVSG  394

Query  1256  VKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGELFIEYLVRHCAM-PDLENVELESSR  1432
             +K+L++E +L +R    ++I+ MA H YL    G   IE++V+ CA+ PD +        
Sbjct  395   MKILLNEQSLKIRSTFGQVIITMALHHYLELEGGFSMIEFIVKQCAINPDDK--------  446

Query  1433  ESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKGLLLITVTVPEMEHVLWPFLLKMII  1612
                         +Y K +     V+   L+ +    L +IT T+P M  VLWP LL+ I 
Sbjct  447   ------------LYAK-QPPGDNVSPKTLKSMSANVLQIITTTMPHMHPVLWPNLLEFIG  493

Query  1613  PRVYTGAVATVCRCISELC-RRRSSESNAMLSECKARTDIPKPEELFARLVVLLHNPLAR  1789
             P  Y  A   +CRC++ +  ++R ++ +    + +   ++PKP  + + L+VLL  P   
Sbjct  494   PVQYIEATPILCRCLAAIASKKRENQDDDYDIDFEDLVNLPKPARIVSSLIVLLGKPSVA  553

Query  1790  EHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKAYVSDTEDLKQDPLYQESWDDMII  1969
             +     IL+ L  + P+  + +   W  ++ IPK+  Y++  E+   D   Q+ W+D+I+
Sbjct  554   DR-GEHILNCLQSMGPILQEELVDLW--DVVIPKLLNYLN--ENAGCDTWDQKHWEDLIL  608

Query  1970  SFLAESLDVIQNVDWVLLLGNTFA-RQYEL--YKSDNEHSALLHRCLGILLQKVHDRAYV  2140
              FL++SLD + N DW+L  GN    ++Y L  Y+   E    L++CLG++++K   + +V
Sbjct  609   KFLSKSLDELSNEDWLLEFGNALGDKEYILRTYEQFPEEKGFLYKCLGVVMRKTTHKQFV  668

Query  2141  RAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDKLKGILDNVGQSILQRIFSFF  2320
                +++M+     +  + R G A + G  A+SHLD V +KL+ +     Q ++++   FF
Sbjct  669   HTNLEMMFATIRHSNQSEREGCAISSGFAASSHLDIVAEKLENV---TKQDMVKKSKGFF  725

Query  2321  SDRGKMEESD--DTHAALALMYGYAAKYAPPTVIEARIDALVGTNMLSRLLHVRHPRAKQ  2494
                    ++D     A + L YGY   ++PP +I +R++  +   +      V+    KQ
Sbjct  726   GFGKDKTDADIERIKATVLLCYGYVCFHSPPNLITSRVEVSILRVINPHFSKVKDTIVKQ  785

Query  2495  AVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRDEEEGFSDSNIELLHTQSL  2674
              +I  IDL+G++V         F    R  L++++L+ +    E G   +   L  T+SL
Sbjct  786   NLIRTIDLIGRSVHPDHLKIPDFIFNGRSDLINHLLSYIS--AEPG---TMPVLTETKSL  840

Query  2675  ALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDP-----------------SDVINP  2803
             A+ A TTLV +EP LT   +  I+  +     LP+ P                 +++ N 
Sbjct  841   AIRALTTLVKLEPYLTDADQYDILNVSTDAI-LPSPPLSPNTKRKDITITPEESNELTNK  899

Query  2804  LIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIKF  2983
              I++L  LL  I        R  ++ L  I +++DP+  SS   +R R            
Sbjct  900   AIEDLTKLLIQI-----SSRRYGSDNLESIFKHLDPWSRSSDSTERLR------------  942

Query  2984  RAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPRCI  3163
                      A+ C        + +        +LP    +  R            +PRC+
Sbjct  943   ---------AMNCIVRLLEDYETNTREKEEARSLPLQVHIIGR-----------LVPRCL  982

Query  3164  DTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILRSDASID  3343
             D    +R++++  +     IS  +P    +S+ IDI+        L + +++L+  A  D
Sbjct  983   DPELAIRQLAITAIQTTLKISSCIP---GTSI-IDIK------DQLVNALSLLKERAEND  1032

Query  3344  -PSEVFN---RVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGN  3511
               S +F+    +   +C  L+ + L   +      + D    S+ GA   +  FV  RG+
Sbjct  1033  EASSLFSLCTDLSKVLCKKLHTEFLWPTMQVLLEGLVDYQGHSSSGACVVLNNFVKQRGS  1092

Query  3512  ELNE  3523
              L E
Sbjct  1093  SLAE  1096


 Score = 53.5 bits (127),  Expect(2) = 3e-83, Method: Compositional matrix adjust.
 Identities = 44/166 (27%), Positives = 77/166 (46%), Gaps = 9/166 (5%)
 Frame = +1

Query  163  ASMSALKDITSLNPLLVLDCC--LTVSRGGRRRFGNIAGLFQVISVAIRALDKGDVDPAF  336
            A   +L DI      LVLD C    V      R   +  L  + ++    ++  DV    
Sbjct  27   AIFKSLLDIGRKKHTLVLDTCHLYLVKHSKLSRNHRVILLKLMENICKNHIE--DVSNET  84

Query  337  MMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLPDLMMEEIFLHFSGSNSALPAMV  516
             MKL  + +AE+  + ++  +WQ AA+ +L ++G      +M+E+   F         +V
Sbjct  85   AMKLISLGSAEMTQSSDVVPEWQTAASNLLSTLGLKYAKEVMQELLTKFQTGQLPHFFIV  144

Query  517  QILADYASSDALQFTPRLKGVLARVVPILG-----NVREIYRPIFA  639
              L   A+S+  +  P LK V+AR++P+LG     N++ ++   FA
Sbjct  145  STLGQLATSNVGEVVPLLKVVMARMLPMLGLAKLDNMQWVFSNAFA  190


 Score =   118 bits (295),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 97/333 (29%), Positives = 161/333 (48%), Gaps = 11/333 (3%)
 Frame = +2

Query  4172  LAGSISIKRPKEVPTICLFLSKSLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQ--MVE  4345
             LA ++S + P+ +  I   LS SL      QR    A  SE +   +     L +  M  
Sbjct  1302  LARALSSQYPELILPIVEDLSSSLSSIYDPQRITVVAFYSELISTLNAETMSLAETIMNN  1361

Query  4346  ALCRHVSDDSPTVRRLCLRGLVQMPSI---HVLQYTTQILGVILALLDDSD---ESVQLT  4507
              L R V D +  VR  C+RGL  M  I    V +++T +L  +LA +DD +   E + + 
Sbjct  1362  LLGRQV-DANYNVRMYCIRGLGNMADIKGTEVSKFSTTVLSAMLAGMDDREDPSELITME  1420

Query  4508  AvsclllvlesssTDAVEPVLLNLSIRLRNLQVCLNAKIRANAFAAFGALSSYGAGSILD  4687
             A++ L  + +      V P+L+N+++R+R       A +RA A   FG LS +G G    
Sbjct  1421  AMNGLSRIFDRIDEGHVRPILINIALRIRPCFEKPTASVRAAAINLFGTLSRFGNGPSEG  1480

Query  4688  SFREQIHAAFPRMVLHLHDDDLGVRQACRNTLKCIAPLIEIDAIPALLNTHRFSSDHRSD  4867
              F EQI   F  ++LHL++ D  V  A +++L+ + PLI+ + I  +   H  + +    
Sbjct  1481  PFHEQIQTNFVSLLLHLNEGDPTVVMATKSSLQKLGPLIKSEKINNMFQKH-LNPEDSIL  1539

Query  4868  YEDFLRDLARQLTQYLGPRVDTYLSAIIQAFDAPWPVIQANAVYLCSSMLSLSDNKNISA  5047
             Y DFL DL + +      +V+ Y+ A +Q F + WP ++ NA      M+     + I  
Sbjct  1540  YADFLNDLCKLIVVDFTEKVNFYIMASVQFFKSMWPEVRGNAALFVGYMMGNLPKEKIGI  1599

Query  5048  LYYSQVFGVLVGKASNSTDAIVRATCSAALGLL  5146
             +    V   L+    +++  +VRA+ + AL LL
Sbjct  1600  VSKEHVCEALIHMLKDNS-PLVRASTAEALSLL  1631



>dbj|GAM28545.1| hypothetical protein SAMD00019534_117210, partial [Acytostelium 
subglobosum LB1]
Length=1644

 Score =   267 bits (682),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 232/975 (24%), Positives = 433/975 (44%), Gaps = 84/975 (9%)
 Frame = +2

Query  719   AFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRTQLKAALPRLVPTILELYKREQDAAF  898
             A EL+   W  +   KVRL  ++A+G +  +++  QL A   RL+  ++ ++K+E+D   
Sbjct  244   ALELMYGKWLSNNQDKVRLVTIQAIGSICAILSVEQLDAQANRLISGLMPMFKKEKD--L  301

Query  899   VATCslhsllnasllsnngppllDFEDltvvlstlllvCSNNDKKEHSDFPVGLKTYNEV  1078
             +  C   + +    + +     ++     + L+   LVC+  D    S F    K +NEV
Sbjct  302   LPVCQALTNILDVCVKHELKTQVEPTLPLITLTLHPLVCTTPDYNNPSSF----KIFNEV  357

Query  1079  QHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGSLCVLKHLLPRL-AESWHNKRPILIES  1255
                F  +G  +P+ L  FL  +  +K+     G L + KH++ RL AE    K+ +++ +
Sbjct  358   LRAFEIIGRGFPDQLVHFLSQRLEIKDPRSRAGCLSITKHVVTRLDAELGEEKKMMILSA  417

Query  1256  VK-LLIDEHNLGVRKALAELIVVMASHCYLVGSSGELFIEYLVRHCAMPDLENVELESSR  1432
             +K L++ E ++ V+K LA++++ MASH YL    G+  IE++V+             S  
Sbjct  418   IKPLILTETSMFVKKYLAQVVIAMASHGYLHLEGGQSMIEFIVKGA-----------SYF  466

Query  1433  ESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKGLLLITVTVPEMEHVLWPFLLKMII  1612
               S       P   +K       VT  E R +C+  L LIT T+P+M+ VLWP+L + I 
Sbjct  467   VDSDIGKPMPPAEKKKEPVNEMTVTDLEFRKICDDVLNLITTTIPDMDAVLWPYLFESIT  526

Query  1613  PRVYTGAVATVCRCISELC-RRRSSESNAMLSECKARTDIPKPEELFARLVVLLHNPLAR  1789
             P  YTGA A V +CI  +   +R  E+     +     ++PKP ++ AR  VLL  P  R
Sbjct  527   PIEYTGAAAIVAKCIGHIASNKREQEAEDYYIDFDKEVNLPKPTQIIARYFVLLTAPHRR  586

Query  1790  EHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKAYVSDTEDLKQDPLYQESWDDMII  1969
               L T++L  +  + P+   +I   W  ++ +PK+  Y++D  D   D   +  W+++++
Sbjct  587   NELGTRVLEAMRSIGPILHPSICDMW--DITLPKLGQYLADHPD--GDQFNKNQWEELVL  642

Query  1970  SFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHSALLHRCLGILLQKVHDRAYVRAK  2149
               L+E++    + +W + LG+  A Q + YK D      L + LG+++QK   + +V+ K
Sbjct  643   RLLSETIKNAADDEWTVSLGSALADQTDHYKRDPILKRSLFKQLGLIMQKCSHKEFVKTK  702

Query  2150  IDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDKLKGILDNVGQSILQRIFSFFSDR  2329
             I+ M+   +        G A  +G  +ASH D VL+K+   + N     + +   FF   
Sbjct  703   IEYMFNSVDYTNHLENEGCAIGLGYCSASHFDIVLEKIGSFIKNN----MAKKSGFFKKT  758

Query  2330  GKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALVGTNMLSRLLHVRHPRAKQAVITA  2509
             G           + L   Y A Y+  T++  R++  + + +   +  ++ P  K + I  
Sbjct  759   G----IKGIKNCILLSLAYCATYSQATLLSTRVEVHILSPIRPCINTLKKPPKKLSAIKM  814

Query  2510  IDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRDEEEGFSDSNIELLHTQSLALSAC  2689
             ID LG+A+    +   +F  K+RD L   I+         G+          +   ++AC
Sbjct  815   IDHLGKAL--HEDKVPNFVFKQRDELFKIII---------GYMSVGAVTPQVKIDGINAC  863

Query  2690  TTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVINPLIDNLITLLCTILVTSGEDGRS  2869
              TL+++ P L  E    I+   + F+  P D S+    L++ + +L  T+L       ++
Sbjct  864   ATLINLSPALPLELETQIVTLLLQFYNTPED-SEQSAQLVETINSLFSTLLF-----NQT  917

Query  2870  RAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIKFRAICVNGYCALGCQGSCSHSKQ  3049
                 L  ++  +DP   S   + R+R                     +L C         
Sbjct  918   SIVCLNRLIAYLDPLTRSKETHLRER---------------------SLNC---------  947

Query  3050  IDHAANRNLSNLPSAFFLPSRDALS-LGERIMVYLPRCIDTNYEVRKVSVQILNLFFNIS  3226
             + H   + +     A  LP+      +G  + + +PR  D    +RK +V+ + L   I 
Sbjct  948   MLHIVKKFIEYTTDAEQLPTEKKFERVGHAVSIIVPRICDPESSIRKNAVESMQLVLYID  1007

Query  3227  FSLPKPINSSLGIDIELSYIALSSLEDVVAILRSDASIDPSEVFNRVVSSVCTLLNKDEL  3406
               L    + +  +    +    + +++ +     +     +   + +++ + TL   DE+
Sbjct  1008  HMLKNVSHENRRVKPVDTIQPFTQMKETIMTEEVNEQFTLALEISNIIAKMLTL---DEI  1064

Query  3407  VAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNELNEIEVSRTSQSLLTAVVHVTEKY  3586
                L G    + D    S  G    +   +  RG EL +  V+   + L++A+  +T   
Sbjct  1065  PVFLEGTLKGLQDHQTLSTNGTCIILNGVIKARGGELGDY-VTPLVKGLVSAMETITSDT  1123

Query  3587  LRQETLGAICSVAEN  3631
                 TL +I S++ +
Sbjct  1124  TMNGTLASIRSLSNH  1138


 Score = 70.9 bits (172),  Expect(2) = 2e-82, Method: Composition-based stats.
 Identities = 48/184 (26%), Positives = 96/184 (52%), Gaps = 9/184 (5%)
 Frame = +1

Query  112  VQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGNIAGLFQVIS  291
            V  ++ S  D   SVR + +++  +I    P    +  L+++     +F  I    +V  
Sbjct  31   VNALLYSANDSDESVRNSVIASTYEIGFRQP----NTVLSLASEYLTKFPKIDQTHRVTI  86

Query  292  VA----IRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLPDLM  459
            +     I    + ++  +  ++L K+  +E+   KE+N DWQ+AA+ +LVS+    P L+
Sbjct  87   LKSIHQIIGEKRDEIVDSLALELVKLGISEMTRDKEVNPDWQQAASSILVSLCLRYPGLI  146

Query  460  MEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVR-EIYRPIF  636
            M+E+   F   +     +++ L D   S+ +   PR++ VL+RV+PILG+++ +  + +F
Sbjct  147  MDELIKRFETGSIPHFFIMKTLGDVIGSNPIPTVPRIREVLSRVLPILGSIKHDNIKWVF  206

Query  637  ANGL  648
            A+ L
Sbjct  207  ASAL  210


 Score =   118 bits (296),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 81/330 (25%), Positives = 157/330 (48%), Gaps = 8/330 (2%)
 Frame = +2

Query  4043  PLRALLNAFQAFCECVGDLEMGKILARGGEQN--ENEKWINLIGELAGSISIKRPKEVPT  4216
             P + L+ +F+ F +C  + ++ +++   G     E   +   I E+    +   P+ +  
Sbjct  1270  PSQQLVTSFRQFFKCTKEDDVLELIENKGSMAGLEGPTYHIAIQEITAQFAHSHPELIKG  1329

Query  4217  ICLFLSKSLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLC  4396
             +  FL          QR    +  SE + +      LL +++  L   + +  P ++ + 
Sbjct  1330  VFEFLLPYQRANYVPQRVITLSIYSELINHCKD-KDLLQKLINTLLNSLVE--PALKLIS  1386

Query  4397  LRGLVQMPSI---HVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPV  4567
             L+GL  + S       +Y   ++  I + +DDSDE + + ++  L  +        V P+
Sbjct  1387  LKGLSNIVSAGEESTNRYAPTVIDAISSSIDDSDEVMAMESMLGLSKIFTIVDEARVAPI  1446

Query  4568  LLNLSIRLRNLQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDD  4747
             L+N+  R++      N +IRA +F  FG+L  +G+G   D F EQIH   P +++HL+D+
Sbjct  1447  LVNICNRIKPAFEKPNNEIRAASFTLFGSLWRFGSGMACDPFYEQIHYNLPSIIMHLNDE  1506

Query  4748  DLGVRQACRNTLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRV  4927
                VR AC+ TL+ ++ L+  +   AL +   F  D   DY+ FL D ++ +      R+
Sbjct  1507  SPLVRTACKTTLRQLSKLLRTEEAKALFHRKNFDVDATLDYDAFLEDFSKVMITLYTDRI  1566

Query  4928  DTYLSAIIQAFDAPWPVIQANAVYLCSSML  5017
             + ++   I+ + +PW  ++ NA  L   +L
Sbjct  1567  NYFIMTSIEYYKSPWVQLRGNAATLTGFIL  1596



>ref|XP_009885148.1| PREDICTED: maestro heat-like repeat-containing protein family 
member 1 [Charadrius vociferus]
Length=1620

 Score =   273 bits (698),  Expect(2) = 8e-81, Method: Compositional matrix adjust.
 Identities = 348/1506 (23%), Positives = 611/1506 (41%), Gaps = 245/1506 (16%)
 Frame = +2

Query  716   SAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRTQLKAALPRLVPTILELYKREQDAA  895
             SA+E+L   W   R+ K+RL+ VEA+G M  L+   +L+  LP+L+P IL LYK+  +A 
Sbjct  222   SAYEVLFNSWLQHREAKLRLAVVEAMGPMSYLMPSEKLEEQLPKLIPGILALYKKHTEAF  281

Query  896   FVATCslhsllnasllsnngppllDFEDltvvlstlllvCSNNDKKEHSDFPVGLKTYNE  1075
             +++                                   +C+  D       P+ +K + E
Sbjct  282   YISK----------------------------------ICAPAD----PSVPLTVKNHTE  303

Query  1076  VQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGSLCVLKHLLPRLAESWHNKRPILIES  1255
             V  CF  +   +P+ +  FLL K     E    G+L +++ ++         K+P ++ S
Sbjct  304   VLRCFTVLACSFPDRVLAFLLPKLESSNERTRVGTLLIMRQIINSAPSQMEIKKPFILSS  363

Query  1256  VKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGELFIEYLVRHCAMPDLENVELESSRE  1435
             +KL + + N  V++AL ++I  MA H YL    GE  +E+LVR CA+P            
Sbjct  364   MKLPLQDSNNKVKRALVQVISAMAHHGYLEQPGGEAMMEFLVRQCALPS-----------  412

Query  1436  SSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKGLLLITVTVPEMEHVLWPFLLKMIIP  1615
                          +K    A  +T+  ++ +    L L++ TV  M +VLWP+LL+ + P
Sbjct  413   ----------DAPKKQPPDADDLTSDSVQSISVNTLFLLSTTVDRMNNVLWPYLLEFVTP  462

Query  1616  RVYTGAVATVCRCISELCRRRSSES-NAMLSECKARTDIPKPEELFARLVVLLHNPLA--  1786
               +T A+  +C+ +  L  ++  E  NA L       ++P P  L  RL+V+   P A  
Sbjct  463   IQFTNALTPLCKSLMYLAVKKQEEGENASLIRYDLNANLPSPYALTTRLLVVSSQPYAGD  522

Query  1787  -REHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKAYVSDTEDLKQDPLYQESWDDM  1963
              R     ++L+VL Y   + P  ++  W  +  +P +   V   E+  +  L Q+ W++ 
Sbjct  523   CRGMAALRLLNVLHY--SVHPA-LDQLWSKQ--VPLL---VEHIEENTEKSLSQKEWEEK  574

Query  1964  IISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHSALLHRCLGILLQKVHDRAYVR  2143
             ++ FL E+L  + +  W+        RQ   Y         L++C+G  L     +  V+
Sbjct  575   LLLFLQETLAAVSDSAWICHFVTEMCRQLNNYNGFPPEKNFLYKCIGTTLGACASKDLVQ  634

Query  2144  AKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDKLKGILDNVGQSILQR---IFS  2314
              ++  +   A       R GLA   G+ A +HL+  L KL+   D V   + ++   +FS
Sbjct  635   KQLQELLETARYHEEAEREGLASCFGICAINHLEETLAKLE---DFVRSDVFKKSVGLFS  691

Query  2315  FFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALV--------GTNMLSRLLH  2470
              F DR    E +   + L L YGY A YAP  ++ +RI+A +         T +L   + 
Sbjct  692   IFKDRSD-NEVEKIKSTLILCYGYVAVYAPKELVLSRIEADILKNIFQYFNTKVLGIKVE  750

Query  2471  VRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRDEEEGFSDSNI  2650
              +    K  +I  I ++ QA+    + G  F   R+  L+  ++  +  +  E       
Sbjct  751   TKDLTLKLCLIRTICMISQAICNGVKCG-DFIFSRKAELVAQMVEFIKAEPLEAMRTP--  807

Query  2651  ELLHTQSLALSACTTLVSVEPKLTTETRN-LIMKATIGFFGLPN-DP-------------  2785
                  +  A+  CT LV +EP L+   R  LI         LP  DP             
Sbjct  808   ----VRQRAMITCTYLVVLEPHLSDPDRTELIDTCLASVLALPPLDPGRERDENGGNVLH  863

Query  2786  -----SDVINPLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRG  2950
                   D I+ L D L +LL   L   G         L  +  ++ P++ S+ E++R+R 
Sbjct  864   KEVLYGDTISALKDLLKSLLQRNLTPHG---------LQDMFAHLGPWIKSNKEHERQRA  914

Query  2951  CLAAHELLIKFRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLG  3130
                     ++  A  ++ Y                      LS L  +  +P  +   LG
Sbjct  915   --------VEVSAALLDFY----------------------LSKLNVSTVIPFYN---LG  941

Query  3131  ERIMVYLPRCIDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSS----  3298
               I ++ PRC D+   VR+ +V  +                   + I+L Y   +     
Sbjct  942   VLIALFSPRCSDSLASVRQHAVDCVYCL----------------LYIQLCYEGFARDHRD  985

Query  3299  --LEDVVAILRSDASIDPSEVF---NRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSA  3463
               +E + A+ +     + + +F   N +   +   +  D+L++ L      + D  K  +
Sbjct  986   EMVEGLKALKKGLEEPNFTILFHTCNNIAMVIGKRVPPDQLMSLLLAMFEGLADPDKNCS  1045

Query  3464  EGAIQAVVEFVTNRGNELNEIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSK  3643
               A   +   +  RG  L E +V      + + +  V E+++R+     +  +A    S 
Sbjct  1046  RAATVMINSLLKERGGVLQE-KVPDIMSIIHSKLEEVDEEHIRKAAQQTVYILASQHKSM  1104

Query  3644  VVFTEVLAAAGRDMVTKDIHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVINQSPALK  3823
             VV + + +A   D  T  + R            A +    L+   LE ++  +N+     
Sbjct  1105  VVSSLLGSALPFDSHTCAMWR------------ALATEPTLTSQILEQLLEKVNR-----  1147

Query  3824  GGDSGKGESSRNSVDGSIEDDVSRAAVLALTAffrgggkfgrkTVEQSYASVlatltlhl  4003
               D    ES    + GS  + V+    LA T        +   +  +S A+VL       
Sbjct  1148  --DVPYKESKGFPLLGSGSERVATPLPLAATC-----ALYEIMSAPESGAAVLGLYPPLF  1200

Query  4004  gtchglaS--YGDQEP-------LRALLNAFQA--FCECVGDLEMGKI-LARGGEQN---  4138
              T     S   G Q P        R+  +   A     CV  +E  K+ LARGG +    
Sbjct  1201  VTLLLRLSCTVGVQLPKNLQSRERRSSSHGLLARGLTPCVCAVETLKVMLARGGSEEVAR  1260

Query  4139  ------------ENEKWINLIGELAGSISIKRPKEVPTICLFLSKSLDRPLRVQREAAAA  4282
                           E+  + I  LAG+++      +P I   L  +L+     QR    A
Sbjct  1261  AVGSAGGWELMASPERHHDGIAVLAGAMARHAGPRLPLIVKNLIPTLNSVFDSQRITTTA  1320

Query  4283  ALSEFLR---YSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQMPS---IHVLQYT  4444
               +E L     +D    LL  M++ +     D    VR L LRGL  + S     V ++ 
Sbjct  1321  FFAELLNSNVVNDLI--LLETMMDNMMGRQKDTCTLVRMLALRGLGNIASGSPEKVRKHG  1378

Query  4445  TQILGVILALLDDSDES---VQLTAvsclllvlesssTDAVEPVLLNLSIRLRNLQVCLN  4615
              ++L  ++  +DD D+    V L A+S L  +L+      ++ +LL+++IR+R       
Sbjct  1379  AKLLASMVNGMDDKDDPHNLVALEAMSSLSKLLDHVEERDIQSMLLHIAIRIRPFFDSEQ  1438

Query  4616  AKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACRNTLKCIA  4795
               +R ++   FG L+ +   +  + F EQI      ++LHL D    V +AC+  L+   
Sbjct  1439  PDLRQSSIVLFGNLTKFSEDNC-EVFFEQILNGLVTLLLHLQDPKPEVVKACKFALRMCG  1497

Query  4796  PLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSAIIQAFDAPWP  4975
             P +  + +  +   H    D    Y +F+ ++ + L Q     ++  +S  +  F + W 
Sbjct  1498  PSMGCEGLCDMFLNH-LREDRSLHYGEFMNNVCKHLMQSYPEMLNRLISTNLFYFKSNWV  1556

Query  4976  VIQANA  4993
              I+A A
Sbjct  1557  DIRAAA  1562


 Score = 59.3 bits (142),  Expect(2) = 8e-81, Method: Compositional matrix adjust.
 Identities = 46/183 (25%), Positives = 82/183 (45%), Gaps = 11/183 (6%)
 Frame = +1

Query  118  VMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSR-----GGRRRFGNIAGLFQ  282
             ++ +  D  P V+E   +AL  +    P  +L+ C    R     G   R   +  +  
Sbjct  12   TLMDATTDKDPLVQEQIYNALCYLGESEPEEILNSCDEYLRQHDKLGYPHRVIILKAMET  71

Query  283  VISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLPDLMM  462
            V+   I  LDK        +     A+ E+  +KE+  DWQ+AA+ VLV+VG    + +M
Sbjct  72   VVKNNIALLDKSTAKVVIFL-----ASNEMTKSKEVIRDWQQAASNVLVAVGQRFINKVM  126

Query  463  EEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIY-RPIFA  639
            EE+   F         ++Q  A+ + S+     P L  +L  ++P+LG  ++ + + +F 
Sbjct  127  EEVLTKFQPGILPHYFVMQTFANLSVSNVFGMVPFLNSILGTMLPMLGMAKQDHMKSVFC  186

Query  640  NGL  648
              L
Sbjct  187  YAL  189



>gb|KDO46976.1| hypothetical protein CISIN_1g0006554mg, partial [Citrus sinensis]
Length=233

 Score =   273 bits (699),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 134/206 (65%), Positives = 156/206 (76%), Gaps = 18/206 (9%)
 Frame = +2

Query  1196  HLLPRLAESWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGELFIEY  1375
             H   R +E+WH+KRP+L+E+VK L+DE NL V+KA++ELIVVMASHCYL+G SGELF+EY
Sbjct  45    HFHWRSSEAWHSKRPLLLEAVKSLLDEQNLAVQKAISELIVVMASHCYLIGPSGELFVEY  104

Query  1376  LVRHCAMPDLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKGLLLIT  1555
             LVRHCA+ D +    ESS+                   K GA   TELR +CEKGLLL+T
Sbjct  105   LVRHCALSDQKKYVNESSK------------------VKIGAFCPTELRAICEKGLLLLT  146

Query  1556  VTVPEMEHVLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKARTDIPK  1735
             +T+PEM+H+LWP LLKMIIPR YT A ATVCRCISELCR RSS SN MLSECKAR DIP 
Sbjct  147   ITIPEMQHILWPLLLKMIIPRAYTSAAATVCRCISELCRHRSSSSNVMLSECKARDDIPN  206

Query  1736  PEELFARLVVLLHNPLAREHLVTQIL  1813
             PEELFARLVVLLH+PLARE   TQIL
Sbjct  207   PEELFARLVVLLHDPLAREQQATQIL  232



>gb|KDO46977.1| hypothetical protein CISIN_1g0006554mg, partial [Citrus sinensis]
Length=189

 Score =   270 bits (691),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 131/198 (66%), Positives = 152/198 (77%), Gaps = 18/198 (9%)
 Frame = +2

Query  1220  SWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGELFIEYLVRHCAMP  1399
             +WH+KRP+L+E+VK L+DE NL V+KA++ELIVVMASHCYL+G SGELF+EYLVRHCA+ 
Sbjct  9     AWHSKRPLLLEAVKSLLDEQNLAVQKAISELIVVMASHCYLIGPSGELFVEYLVRHCALS  68

Query  1400  DLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKGLLLITVTVPEMEH  1579
             D +    ESS+                   K GA   TELR +CEKGLLL+T+T+PEM+H
Sbjct  69    DQKKYVNESSK------------------VKIGAFCPTELRAICEKGLLLLTITIPEMQH  110

Query  1580  VLWPFLLKMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKARTDIPKPEELFARL  1759
             +LWP LLKMIIPR YT A ATVCRCISELCR RSS SN MLSECKAR DIP PEELFARL
Sbjct  111   ILWPLLLKMIIPRAYTSAAATVCRCISELCRHRSSSSNVMLSECKARDDIPNPEELFARL  170

Query  1760  VVLLHNPLAREHLVTQIL  1813
             VVLLH+PLARE   TQIL
Sbjct  171   VVLLHDPLAREQQATQIL  188



>ref|XP_008489507.1| PREDICTED: maestro heat-like repeat-containing protein family 
member 1 [Calypte anna]
Length=1648

 Score =   266 bits (679),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 350/1544 (23%), Positives = 623/1544 (40%), Gaps = 184/1544 (12%)
 Frame = +2

Query  716   SAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRTQLKAALPRLVPTILELYKREQDAA  895
             SA+E+L   W   R+ K+RL+ VEALG M  L+   +L+  LPRL+P IL LYK+  +A 
Sbjct  222   SAYEVLFNSWLQHREAKLRLAVVEALGPMSYLLPAEKLEEQLPRLIPGILSLYKKHTEA-  280

Query  896   FVATCslhsllnasllsnngppllDFEDltvvlstlllvCSNNDKKEHSDFPVGLKTYNE  1075
             F  + SL  +L AS+   +    +  E L   L   +   S+         P+ +K + E
Sbjct  281   FCISKSLCQILEASVNIGSRSLDVQLEPLLSTLHPQISAPSD------PSLPLTVKNHTE  334

Query  1076  VQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGSLCVLKHLLPRLAESWHNKRPILIES  1255
             V  CF  +   +P+ +  FLL K     E    G+L +++ ++         K+P ++ S
Sbjct  335   VLRCFTVLACSFPDRVLAFLLPKLESSNERTRVGTLLIIRQIINSAPSQMEMKKPFILSS  394

Query  1256  VKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGELFIEYLVRHCAMPDLENVELESSRE  1435
             ++  + + N  V++ L ++I  MA H YL    GE  +E+LVR CA+P     EL   ++
Sbjct  395   MRPPLQDSNNKVKRTLVQVISAMAHHGYLEQPGGEAMVEFLVRQCALPS----ELHPKKQ  450

Query  1436  SSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKGLLLITVTVPEMEHVLWPFLLKMIIP  1615
             S                     +T+  +R +    L L++ TV  M +VLWP+LL+ + P
Sbjct  451   SP----------------DGDDLTSDSVRSISVNTLFLLSTTVHRMTNVLWPYLLEFVTP  494

Query  1616  RVYTGAVATVCRCISELCRRRSSESNA-MLSECKARTDIPKPEELFARLVVLLHNPLARE  1792
               +T A+  +C+ +  L  ++  E  A  L        +P P  L +RL+V+   P   E
Sbjct  495   MHFTNALTPLCKSLMYLAMKKQEEGEASSLLRYDLNATLPSPYALTSRLLVVSSQPYLGE  554

Query  1793  HLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKAYVSDTEDLKQDPLYQESWDDMIIS  1972
                   L +L  L       +   W       K+   V   E+  +  L Q+ W++ ++ 
Sbjct  555   GRGAAALRLLHVLRGSIHPALQHLWSK-----KVPLLVEHLEENTEKSLIQKEWEEKLLL  609

Query  1973  FLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHSALLHRCLGILLQKVHDRAYVRAKI  2152
             FL E+L  + +  W+             Y         L++C+G  L     +  V+ ++
Sbjct  610   FLQETLVAVADNTWICQFIPEMCGHLNSYNGIPLEKNFLYKCIGTTLGACTSKDLVQKQL  669

Query  2153  DLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDKLKGILDNVGQSILQR---IFSFFS  2323
               +   A       R GLA   G+ A  HL+  L KL+   + V   + +R   +FS F 
Sbjct  670   QELLETARYHEEAEREGLASCFGICAIHHLEETLAKLE---EFVKSDVFKRSMGLFSIFK  726

Query  2324  DRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALV--------GTNMLSRLLHVRH  2479
             DR    E +   ++L L YGY A YAP  ++ +RI+A +         T +L   +  + 
Sbjct  727   DRSD-NEVEKIKSSLILCYGYVAAYAPKELVLSRIEADILKNIFQYFNTKVLGIKVETKD  785

Query  2480  PRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRDEEEGFSDSNIELL  2659
                K  +I +I ++ QA+     +G  F   R+  L+  ++  +  +  E          
Sbjct  786   LTLKLCLIRSICMISQAIHSGDRAG-DFTFSRKAELVAQMVEFIKAEPLEAMRTP-----  839

Query  2660  HTQSLALSACTTLVSVEPKLTTETRN-LIMKATIGFFGLPNDP-----------------  2785
               +  A+  CT LV +EP+L+   R  LI     G   LP                    
Sbjct  840   -VRQRAMVTCTYLVVLEPQLSDPDRTELIDTCLAGVLSLPPPDQGKEKDENGGDVLHREM  898

Query  2786  --SDVINPLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLA  2959
                D ++ L D L +LL   L   G         L  +  ++ P++ S  E +R+R    
Sbjct  899   LYGDTLSALKDLLKSLLQRSLTPHG---------LQDMFAHLGPWIKSQKEQERQRA---  946

Query  2960  AHELLIKFRAICVNGYCALGCQGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERI  3139
                  ++  A  +  Y                      L+ L  +  +P  +   LG  +
Sbjct  947   -----VEVSAALLEFY----------------------LTKLNVSTLIPFYN---LGVLV  976

Query  3140  MVYLPRCIDTNYEVRKVSVQILNLFFNISFSLPKPINSSLGIDIELSYIALSS------L  3301
              ++ PRC D+   VR+ +V  +       +SL         + I+L Y   +       +
Sbjct  977   ALFSPRCSDSLAAVRRDAVDCV-------YSL---------LYIQLCYEGFARDHRDEMV  1020

Query  3302  EDVVAILRSDASIDPSEVF---NRVVSSVCTLLNKDELVAALHGCSGAICDKIKQSAEGA  3472
             E + A+ +     D + +F   N + + +   +  D+L++ L     A+ D  K  +  A
Sbjct  1021  EGLKALKKGLEDPDFTVLFHTCNNIATVIGKRVPPDQLMSLLLAMFEALADPDKNCSRAA  1080

Query  3473  IQAVVEFVTNRGNELNEIEVSRTSQSLLTAVVHVTEKYLRQETLGAICSVAENTTSKVVF  3652
                +   +  RG  L E +V      + + +  V E+++R+     +  +A    S VV 
Sbjct  1081  TVIINSLLKERGGVLQE-KVPDILSIIHSKLEEVDEEHVRKAAQQTVYILASQHKSVVVS  1139

Query  3653  TEVLAAAGRDMVTKDIHRLRGGWPIQDAFHAFSQHLVLSHSFLEHVISVIN------QSP  3814
             + + +    D  T  + R   G P             L+   LE ++  +N      +S 
Sbjct  1140  SLLGSTLPFDSHTCTMWRSLAGEP------------TLTSQILEQLLEKVNRDVPYKESK  1187

Query  3815  ALKGGDSGKGESSRNSVDGS------IEDDVSRAAVLALTAffrgggkfgrkTVEQSYAS  3976
              L  G   +  ++  S+  +      +    + AAVL L +                   
Sbjct  1188  GLLLGSGSERVATLLSLQATCALYEIMSAPEAGAAVLGLYSPLFVTLLLRLSCTVGVQLP  1247

Query  3977  VlatltlhlgtchglaSYGDQEPLRALLNAFQAFCECVGDLEMGKIL--ARGGEQNEN-E  4147
                            A+    +P  + ++  +      G  E+ + +  A G E   N E
Sbjct  1248  KSLQSKEKRSQSQSSAAPRSLQPCSSAVDTLKVMLTRGGSEEVTRAVGSAGGWEMMVNPE  1307

Query  4148  KWINLIGELAGSISIKRPKEVPTICLFLSKSLDRPLRVQREAAAAALSEFLR---YSDGF  4318
             +    I  LAG+++      +P +   L  +L+     QR    A  SE L     +D  
Sbjct  1308  RHHEGIAVLAGAMARHAGPRLPLVVKNLIPTLNSVFDSQRVTTTAFFSELLSSNVVNDLI  1367

Query  4319  GPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQMPS---IHVLQYTTQILGVILALLDDSD  4489
               LL  M++ L     D S  VR L LRGL  + +     V ++  Q+L  ++  +DD D
Sbjct  1368  --LLETMLDNLTGRQKDSSMLVRMLALRGLGNIATGSPEKVRKHGAQLLASMVNGMDDKD  1425

Query  4490  ES---VQLTAvsclllvlesssTDAVEPVLLNLSIRLRNLQVCLNAKIRANAFAAFGALS  4660
             +    V L A+S L  +L+      ++ +LL+++IR+R        ++R  +   FG L+
Sbjct  1426  DPNNLVALEAMSSLSKLLDHVEERDIQAMLLHIAIRIRPFFDSEQPQLRQASIVLFGNLT  1485

Query  4661  SYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACRNTLKCIAPLIEIDAIPALLNTH  4840
              +   +  + F EQI      ++LHL D    V +AC+  L+   P +  + +  +   H
Sbjct  1486  RFSEANC-EVFFEQILNGLVTLLLHLQDPKPEVVKACKFALRMCGPSMGCEGLCEMFLNH  1544

Query  4841  RFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSAIIQAFDAPWPVIQANAVYLCSSMLS  5020
                 D    Y +F+ ++ + L Q     ++  +S  +  F + W  I+A A      ++ 
Sbjct  1545  -LREDRSLHYGEFMNNVCKHLMQSYPEMLNRLISTNLFYFKSSWVDIRAAAPMFIGFLVL  1603

Query  5021  LSDNKNISALYYSQVFGVLVGKASNSTDAIVRATCSAALGLLLK  5152
               D ++   +   Q+   L     +   A VR   +  LG L++
Sbjct  1604  HVDEEHCPQVDLDQLISALNLLLKDPVPA-VRVKVAETLGRLVR  1646


 Score = 58.9 bits (141),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 45/183 (25%), Positives = 83/183 (45%), Gaps = 11/183 (6%)
 Frame = +1

Query  118  VMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRR-----RFGNIAGLFQ  282
             ++ +  D  P V+E   +AL  +    P  +L+ C    R   +     R   +  +  
Sbjct  12   TLMDATTDKDPLVQEQIYNALCYLGESEPEEILNSCDEYLRQHEKLAYPHRVIILNAMET  71

Query  283  VISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLPDLMM  462
            V+   I  L+K        +     A++E+  +KEL  DWQ+AA+ VLV+VG    + +M
Sbjct  72   VVKNNIALLEKSTAKVVIFL-----ASSEMTKSKELVRDWQQAASNVLVAVGQRFINKVM  126

Query  463  EEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIY-RPIFA  639
            EE+   F         ++Q  A+ + S+     P L  +L  ++P+LG  ++ + + +F 
Sbjct  127  EEVLTKFQPGILPHYFVLQTFANLSVSNVFGMVPFLNSILGTMLPMLGMAKQDHMKSVFC  186

Query  640  NGL  648
              L
Sbjct  187  YAL  189



>ref|XP_001743639.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ91217.1| predicted protein [Monosiga brevicollis MX1]
Length=1658

 Score =   293 bits (751),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 218/765 (28%), Positives = 385/765 (50%), Gaps = 51/765 (7%)
 Frame = +2

Query  716   SAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRTQLKAALPRLVPTILELYKREQDAA  895
             SAFE+  +VW  SR+ K+RL  VEALG M  +++R +L++  PRL+P ++ LYK+     
Sbjct  236   SAFEVFFKVWLNSREAKLRLQVVEALGVMSHVLSRDKLESLTPRLIPGMINLYKKFTSDM  295

Query  896   FVATCslhsllnasllsnngppllDFEDltvvls-tlllvCSNNDKKEHSDFPVGLKTYN  1072
                T  L ++L+A     +       E +   L   L    S  D+    ++   L+ + 
Sbjct  296   LPLTKGLCTVLDACTRGGDTMLEPQLEFMLNSLYPLLQYPPSFQDQAGMRNYNELLRCFE  355

Query  1073  EVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGSLCVLKHLLPRLAESWHNKRPILIE  1252
             ++ + F        + L  F+  K    EE    G+L V KHL+    E+  +KR +++ 
Sbjct  356   KLCNAF-------SDRLLAFMFIKLEQPEERSRVGALLVFKHLINACDENLRDKRELIVT  408

Query  1253  SVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGELFIEYLVRHCAMPDLENVELESSR  1432
              +K L+++ +L VR+ LA++I+ M  H YL    G+  ++++VR CA+ +   + + S  
Sbjct  409   GLKPLLEDQSLKVRQTLAQVIIAMGHHDYLHLEGGQTLLKFIVRQCALVE-PCITIASKF  467

Query  1433  ESSRFTGNYYPFVYRKLEF-----KAGA--VTTTELRGVCEKGLLLITVTVPEMEHVLWP  1591
             ++   + N  P      +      +AG   VT  +LR +C+  L + T T+  ME VLWP
Sbjct  468   DAGTLSTNALPVEQEVDDINSPKKRAGPEDVTVPQLRAMCDSILFMATKTISCMELVLWP  527

Query  1592  FLLKMIIPRVYTGAVATVCRCISELCRRRS-SESNAMLSECKARTDIPKPEELFARLVVL  1768
             FL + ++P  YT AV T+C+C++ L  + S +ES+    + +A  ++P+P+E+ AR VVL
Sbjct  528   FLFEFLVPFEYTEAVPTLCKCLTHLADKFSEAESDNYDIDFEANVNLPRPQEILARCVVL  587

Query  1769  LHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKAYVSDTEDLKQDPLYQE  1948
             LH+   R     ++L +L  ++    + +   W DE+ IPKM AY+ D     ++    +
Sbjct  588   LHDAKYRRR-GWELLRLLQAISVNLHEEVEELW-DEV-IPKMIAYL-DLHLEGEEEWKPD  643

Query  1949  SWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHSALLHRCLGILLQKVHD  2128
             +W+D+++ FL+ SLD I   +W+L +G    R Y LY  D    ++L +CLG++L+K   
Sbjct  644   AWEDLLLKFLSRSLDAINEEEWILEVGRALGRHYVLYPGDANARSMLSKCLGVVLRKSAK  703

Query  2129  RAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDKLKGILDNVGQSILQRI  2308
             + ++   +D ++   +      R G AK +G  A+SHLD V+++L+ +     Q ++++ 
Sbjct  704   KDFIETHLDKVFLSVDHNSQVEREGCAKGIGFAASSHLDIVIERLQALQK---QEMVRKS  760

Query  2309  FSFFSDRGKMEESD--DTHAALALMYGYAAKYAPPTVIEARIDALVGTNMLSRLLHVRHP  2482
               F        ESD     A L L YGY   YAPP +I +RI+  +   ++    + R  
Sbjct  761   TGFLGMMKDKSESDVNRIKATLMLTYGYVTFYAPPQLITSRIEVNILATIMPHFANPRER  820

Query  2483  RAKQAVITAIDLLGQAVIGAS-ESGISFPLKRRDLLLDYILTLMGRDEEEGFSDSNIELL  2659
               K+ +I  ++L+G+++          F + RR  +LD++   M  +   G +       
Sbjct  821   LVKENLIRCVELIGKSLHDDHLNKEQKFVMHRRQEVLDHMEKYMQAEPLSGVTT------  874

Query  2660  HTQSLALSACTTLVSVEPKLTTET-RNLIMKATIGFFGLPNDPSDVINPL---------I  2809
              T+ L + AC+TLV +EPKL+ E    L+  A    F     P D    +         I
Sbjct  875   RTRQLCIEACSTLVQLEPKLSDEQLHQLLQIAMSCVFDAALAPEDNKEQMELHRDARRSI  934

Query  2810  DNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRK  2944
             D L++++     T        A  L +    I P+++S+ ++QR+
Sbjct  935   DELLSIVVAKDCT--------AISLQNRFNQIQPWLTSATDHQRE  971


 Score =   105 bits (263),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 74/281 (26%), Positives = 132/281 (47%), Gaps = 9/281 (3%)
 Frame = +2

Query  4199  PKEVPTICLFLSKSLDRPLRVQREAAAAALSEFL-RYSDGFGPLLGQMVEALCRHVSDDS  4375
             P+ VP +       L +   +QR A AA  +E + +   G   L+ ++   L   + D +
Sbjct  1334  PEAVPLLVASFDPVLKKVYDMQRIAGAAVYAEIINQQCAGHTNLINKLKNGLLSKLVDTN  1393

Query  4376  PTVRRLCLRGL---VQMPSIHVLQYTTQILGVILALLDD---SDESVQLTAvsclllvle  4537
               VR LC+RGL     +P  H+ +++T +L  ++  +DD    ++ + L A+  L  +  
Sbjct  1394  HVVRMLCIRGLGNVSSLPENHLRKHSTTVLSAMMNGMDDRNDPNDDITLEAMRGLSKIFA  1453

Query  4538  sssTDAVEPVLLNLSIRLRNLQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAF  4717
                 DA+  +L+N+S+R+R         +R  A   FG L+ +G G     F EQIH+  
Sbjct  1454  KVEEDAIRAILINISLRIRPCFDNPKPNVRGAAMELFGNLARFGDGPSKVPFLEQIHSNI  1513

Query  4718  PRMVLHLHDDDLGVRQACRNTLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLAR  4897
                ++H+ DD + ++   R  LK +APL++   +    + H F       Y + L DL++
Sbjct  1514  ITFLMHVEDDSVEIQVVVRAALKKLAPLLDSPELVECFDDH-FKEGRTFHYGELLNDLSK  1572

Query  4898  QLTQYLGPRVDTYLSAIIQAFDAPW-PVIQANAVYLCSSML  5017
                +    ++  Y    +  F   W P ++ANAV L   +L
Sbjct  1573  LFIKLFPDKIGFYTMTAVNFFRCDWQPKLRANAVMLIGFLL  1613


 Score = 67.4 bits (163),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 88/171 (51%), Gaps = 4/171 (2%)
 Frame = +1

Query  112  VQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLT-VSRGGRRRFGNIAGLFQVI  288
            V  ++    D   SVR+   S+LKDI    PLL+L  C T + +  +   G+   L Q++
Sbjct  24   VMALIEHANDAVVSVRQTFQSSLKDIGRQQPLLLLSSCETYLHKHQKLEMGHRIFLIQLM  83

Query  289  SVAIRALDKGD-VDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLPDLMME  465
               +  +  GD + P    +L ++A  E+   +E+  +WQ AA+G+LV+ G+   D++++
Sbjct  84   QAIVGEM--GDRMPPLLAQRLVRLAAHEMTVKQEIIPEWQSAASGLLVACGNVYGDIVLQ  141

Query  466  EIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVRE  618
             +   +         +++ L D+A S+ +   P L  ++ R +P+LG ++ 
Sbjct  142  TLKDMYQPGVVPHYFVLKTLGDFAVSNYVAVVPSLSELIGRSLPMLGMIKH  192



>ref|XP_006276285.1| PREDICTED: maestro heat-like repeat-containing protein family 
member 1-like, partial [Alligator mississippiensis]
Length=1669

 Score =   246 bits (627),  Expect(2) = 2e-74, Method: Compositional matrix adjust.
 Identities = 193/707 (27%), Positives = 323/707 (46%), Gaps = 58/707 (8%)
 Frame = +2

Query  716   SAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRTQLKAALPRLVPTILELYKREQDAA  895
             SA+++L   W  SR+ K+RL+ VEALG M  L+   +L+  LPRL+P IL LYK+  +  
Sbjct  244   SAYDVLFNSWLQSREAKLRLAVVEALGPMSYLMPGDKLEEQLPRLIPGILALYKKHGETF  303

Query  896   FVATCslhsllnasllsnngppllDFEDltvvlstlllvCSNNDKKEHSDFPVGLKTYNE  1075
             +V+              N G   LD +   ++ +    +C+  D       P+ +K + E
Sbjct  304   YVSK---SLCQILEASVNIGSRTLDTQLDALLSALHPQICAPAD----PSVPLMVKNHTE  356

Query  1076  VQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGSLCVLKHLLPRLAESWHNKRPILIES  1255
             V  CF  +   +P+ + VFLL K     E    G+L +++ ++   A     K+P ++ S
Sbjct  357   VLRCFTVLACSFPDRVLVFLLPKLENSNERVRVGTLLIMRQIINCAASQMEIKKPFILSS  416

Query  1256  VKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGELFIEYLVRHCAMPDLENVELESSRE  1435
             +KL + + +  V++A+ ++I  MA H YL  + GE  +EY++R CA+P L+    + + E
Sbjct  417   MKLPLQDSSDKVKRAVVQVISAMAHHGYLEQAGGEAMMEYILRQCALP-LDTGPKKQTPE  475

Query  1436  SSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKGLLLITVTVPEMEHVLWPFLLKMIIP  1615
                FT +                    +R +    L LI+ TV  M  VLWP+LL+ + P
Sbjct  476   GDDFTSD-------------------SVRSISINTLFLISTTVDGMSEVLWPYLLEFVTP  516

Query  1616  RVYTGAVATVCRCISELCRRRSSESN-AMLSECKARTDIPKPEELFARLVVLLHNPLARE  1792
               +T A+  +C+ +  L  ++  E   A+L    A  ++P P  L  RL+V+   P   +
Sbjct  517   VQFTSALTPLCKSLMHLAMKKQEEGEAAVLIHYDANPNLPSPSALTTRLLVVSSQPYLGD  576

Query  1793  HLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKAYVSDTEDLKQDPLYQESWDDMIIS  1972
                   L +L  L       +   W     IP +   V   E+  +  L Q+ W+D ++ 
Sbjct  577   GRGAAALRLLNVLHSSIHPTLGPLWNAA--IPPL---VEHLEEHTEKSLSQKEWEDKLLL  631

Query  1973  FLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHSALLHRCLGILLQKVHDRAYVRAKI  2152
             FL E+L VI +  W+        +Q   Y         L++C+G  L+    +  V+ ++
Sbjct  632   FLKETLTVISDKSWICQFSTEMCKQLNSYNGFPLEKTFLYKCIGTTLRVCPSKDMVQKQL  691

Query  2153  DLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDKLKGILDNVGQSILQR---IFSFFS  2323
               +   A       R GLA   G+ A SHLD  L KL+   D V   I ++   +FS F 
Sbjct  692   QELLETARYHEEAEREGLASCFGICAISHLDEALAKLE---DFVRSDIFKKSVGLFSIFK  748

Query  2324  DRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALV--------GTNMLSRLLHVRH  2479
             DR    E +   + L L YGY A YAP  ++ +RI+A +         T +L   +  + 
Sbjct  749   DRSD-NEVEKIKSTLILCYGYVAMYAPKELVLSRIEADILKNVFQYFNTKVLGIKVETKD  807

Query  2480  PRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRDEEEGFSDSNIELL  2659
                K  +I +I ++ QAV  +  SG +F   R+  L+  ++  +  +  +          
Sbjct  808   LTLKLCLIRSICMISQAVYHSVHSG-AFVFSRKAELISQMMEFIKAEPADAMRSP-----  861

Query  2660  HTQSLALSACTTLVSVEPKLT-TETRNLIMKATIGFFGLPNDPSDVI  2797
               +  A+ +CT L ++EP L  TE   LI         LP  P +V+
Sbjct  862   -IRQRAMISCTYLATLEPPLGHTERAELIDCCLNSVLALP--PPEVM  905


 Score = 65.5 bits (158),  Expect(2) = 2e-74, Method: Compositional matrix adjust.
 Identities = 45/183 (25%), Positives = 84/183 (46%), Gaps = 11/183 (6%)
 Frame = +1

Query  118  VMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRR-----RFGNIAGLFQ  282
             ++ +  D  PSV+E   +AL  +    P  +L+CC    R   +     R   +  +  
Sbjct  34   TLMDATTDKDPSVQEQIYNALCYLGEAEPEEILNCCDEYLRQHEKLAYPHRVTILKAMET  93

Query  283  VISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLPDLMM  462
            V+   +  LDK        +     A+ E+  +KE+  +WQ+AA+ VLV+VG    + +M
Sbjct  94   VVKNNMSHLDKSTAKVVIFL-----ASNEMTKSKEIIHEWQQAASNVLVAVGQRFINKVM  148

Query  463  EEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIY-RPIFA  639
            EE+   F         ++Q  A+ + S+     P L  +L  ++P+LG  ++ + + +F 
Sbjct  149  EEVLTKFQPGILPHYFIMQTFANLSVSNVFGMVPFLNSILGTMLPMLGMAKQDHMKSVFC  208

Query  640  NGL  648
              L
Sbjct  209  YAL  211


 Score = 77.4 bits (189),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 75/286 (26%), Positives = 131/286 (46%), Gaps = 12/286 (4%)
 Frame = +2

Query  4163  IGELAGSISIKRPKEVPTICLFLSKSLDRPLRVQREAAAAALSEFLR---YSDGFGPLLG  4333
             +  LAG+++      +P I   L   L+    +QR    A  +E L     +D    LL 
Sbjct  1333  VALLAGAMAKHAGPRLPLIVKNLLPVLNSVYDIQRITTTAFFAELLSSXVVNDLV--LLE  1390

Query  4334  QMVEALCRHVSDDSPTVRRLCLRGLVQMPS---IHVLQYTTQILGVILALLDDSDES---  4495
              M++ +     D   TVR L LRGL  + S     V ++  Q+L  ++  +DD D+    
Sbjct  1391  SMMDNMTGRQKDPCTTVRMLALRGLGNIASGSPEKVRKHGAQLLASMINGMDDKDDPHNL  1450

Query  4496  VQLTAvsclllvlesssTDAVEPVLLNLSIRLRNLQVCLNAKIRANAFAAFGALSSYGAG  4675
             V L A+S L  +L+      +  +LL+++IR+R      + ++R ++   FG+L+ +  G
Sbjct  1451  VALEAMSSLSKLLDHVEERDIRSMLLHIAIRIRPFFDNESHELRQSSILLFGSLTKFSEG  1510

Query  4676  SILDSFREQIHAAFPRMVLHLHDDDLGVRQACRNTLKCIAPLIEIDAIPALLNTHRFSSD  4855
             S  D F EQI      ++LHL D    V +AC+  L+   P +  + +  +   H    +
Sbjct  1511  SCEDVFFEQILNGLVTLLLHLQDPQPEVVKACKFALRMCGPSMGCEGLRDMFRNH-LREE  1569

Query  4856  HRSDYEDFLRDLARQLTQYLGPRVDTYLSAIIQAFDAPWPVIQANA  4993
                 Y +FL  + + L Q     +   +S  +  F + WP ++A A
Sbjct  1570  RGLHYGEFLNHVCKHLMQTYPEMLPRLISTNLFYFKSIWPDLRAAA  1615



>gb|EFA77696.1| hypothetical protein PPL_12305 [Polysphondylium pallidum PN500]
Length=1641

 Score =   283 bits (724),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 245/982 (25%), Positives = 454/982 (46%), Gaps = 90/982 (9%)
 Frame = +2

Query  719   AFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRTQLKAALPRLVPTILELYKREQDAAF  898
             A EL+   W  S   KVRL  ++A+G + G++   QL A + RL+  IL ++K+E+D   
Sbjct  233   AMELIFSKWLSSNHEKVRLVTIQAVGSICGILAVEQLDAQVTRLIGGILPMFKKEKD--L  290

Query  899   VATCslhsllnasllsnngppllDFEDltvvlstlllvCSNNDKKEHSDFPVGLKTYNEV  1078
             +  CS  S +    + +N    L+ +   +  +   LVC   D    S F    KT+NEV
Sbjct  291   LPVCSALSNILEQCIKHNLRLQLEPQLPAIFQTLHPLVCVTPDFNNPSSF----KTFNEV  346

Query  1079  QHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGSLCVLKHLLPRL-AESWHNKRPILIES  1255
               CF  +G  + + L  FL  +  +K+     GSL +L+H++ RL  E    K+ +++ +
Sbjct  347   LRCFEIIGRGFSDPLVHFLSQRLEIKDSRSRGGSLSILRHIITRLDNELGEEKKCLILSA  406

Query  1256  VKLLID-EHNLGVRKALAELIVVMASHCYLVGSSGELFIEYLVRHCAMPDLENVELESSR  1432
             VK L+  E +L V+K LA+ ++ MASH Y+    GE  IE+++R  +     +VE+    
Sbjct  407   VKPLVQTETSLFVKKHLAQAVIAMASHRYIHLQGGECLIEFIIRGSSYS--TDVEIGKPA  464

Query  1433  ESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKGLLLITVTVPEMEHVLWPFLLKMII  1612
              +++      P            VT  E R +C+  L LIT T+P+M+ VLWP+L + + 
Sbjct  465   PATQEKKKVDPL---------ETVTEVEFRKICDDILHLITTTIPDMDLVLWPYLFESVT  515

Query  1613  PRVYTGAVATVCRCISELC-RRRSSESNAMLSECKARTDIPKPEELFARLVVLLHNPLAR  1789
             P   TGA A V RC+  +   +R +E+     +     ++PKP ++ AR  VLL  P  R
Sbjct  516   PVDLTGAAAVVARCLGHIAWNKRETEAEDYYIDFDKEVNLPKPTQIIARYFVLLTTPHRR  575

Query  1790  EHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKAYVSDTEDLKQDPLYQESWDDMII  1969
               L ++IL  +  + P+   +I   W  ++ +PK+  +++D  DL+Q    +  W+++++
Sbjct  576   GELGSRILEAMRAIGPILHPSICDMW--DVTLPKLANFLTDQPDLEQ--FNRNQWEELVL  631

Query  1970  SFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHSALLHRCLGILLQKVHDRAYVRAK  2149
               L+E++    + +W + LG+  A Q + YK D      L++ LG+++QK   + +V++K
Sbjct  632   RLLSETIKNAADDEWTVALGSALADQIDHYKRDPILKRSLYKQLGLIMQKCSHKEFVKSK  691

Query  2150  IDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDKLKGILDNVGQSILQRIFSFFSDR  2329
             I++M+   +   P    G A  +G  AASH D +L+K+   + N     + +   FF   
Sbjct  692   IEVMFNSVDYTNPLENEGCAIGLGYCAASHFDILLEKIGFFIKNS----MAKKGGFFKKS  747

Query  2330  GKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALVGTNMLSRLLHVRHPRAKQAVITA  2509
             G           + L   YAA YA P+++ +R++  +   +   +  ++ P  K + I  
Sbjct  748   G----PKGIKNCVLLSLAYAATYAQPSLLSSRVEVHMLNPIKPSITLLKKPPKKISAIKM  803

Query  2510  IDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRDEEEGFSDSNIELLHTQSLALSAC  2689
             ID +G+A+   ++   ++  K+RD +   +L+ M            I+        ++AC
Sbjct  804   IDFIGKAL--HADKIPNYIFKQRDEMFKLLLSYMSTPPPSVNLQVKID-------GVNAC  854

Query  2690  TTLVSVEPKLTTETRNLIMKATIGFFGL-PN--DPSD--VINPLIDNLITLLCTILVTSG  2854
             +TL++++P +  E    ++   + F+   PN   PSD   +N +I  +  L  TIL    
Sbjct  855   STLINLQPMVPLELETQVINLLLQFYATQPNGQTPSDETEVNQMITAINNLFSTILF---  911

Query  2855  EDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIKFRAICVNGYCALGCQGSC  3034
                +     L  +++ +DP   S   + R++       L+ K+                 
Sbjct  912   --NQPTIACLNRLIQYLDPLSRSKESHLREKAMFCILYLVKKY-----------------  952

Query  3035  SHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPRCIDTNYEVRKVSVQILNLF  3214
                  I+++       LP+      +   ++G  + +  PRC D    +RK +V+ + L 
Sbjct  953   -----IEYSTES--EELPT-----DKKFENIGASMAIITPRCTDPESIIRKYAVESIQLM  1000

Query  3215  FNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILRSDASIDPSEVFNRV--VSSVCTL  3388
               I + L    +    +        +  +  +  I  S  + D +E F  V  +S + + 
Sbjct  1001  LYIDYMLKNATHEVRRVK------PIDIIHPLTQIKESITTTDVNEQFTLVFEISGIISK  1054

Query  3389  LNKDELVAALHGCS-GAICDKIKQSAEGAIQAVVEFVTNRGNELNEIEVSRTSQSLLTAV  3565
             +   E +     CS   + D    S  G+   +   + +RG EL +  V    + LL ++
Sbjct  1055  MIVLEEIPKFLECSLKGLQDLQTFSTNGSCIMINGLIKSRGGELIDY-VPTLVKGLLGSM  1113

Query  3566  VHVTEKYLRQETLGAICSVAEN  3631
               +T       TL ++ S+A +
Sbjct  1114  EGITSDTTMNGTLVSLRSLANH  1135


 Score =   117 bits (294),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 85/337 (25%), Positives = 163/337 (48%), Gaps = 9/337 (3%)
 Frame = +2

Query  4043  PLRALLNAFQAFCECVGDLEMGKILARGGEQN--ENEKWINLIGELAGSISIKRPKEVPT  4216
             P + L+ +F+ F +C  + E+ + +   G     E   +   I E+    +I  P  +  
Sbjct  1268  PSQQLVASFRQFFKCTKEDEILEAIEAKGSMTGLETPTYHVAIQEITAQFAIAHPDLIKG  1327

Query  4217  ICLFLSKSLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLC  4396
             +  +L          QR    A  SE + ++     LL +++  L   + +  P V+ + 
Sbjct  1328  VFEYLIPYQRANHIPQRIITIAVFSELINHTKD-KELLQRLINTLLNALVE--PAVKLIS  1384

Query  4397  LRGLVQMPSIHVLQ---YTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPV  4567
             L+GL  + S    Q   Y   ++  I + +DD+DE + + ++  L  +    +   V P+
Sbjct  1385  LKGLSNIVSAGEEQTNRYAPTVIDAISSSIDDADEVMAMESMLGLSKIFTLVNESRVAPI  1444

Query  4568  LLNLSIRLRNLQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDD  4747
             L+N+  R++      N +IRA +F  FG+L  +G+G   D F EQIH   P +V+HL+D+
Sbjct  1445  LVNICNRIKPAFEKPNNEIRAASFTLFGSLWRFGSGMAADPFYEQIHYNLPAIVMHLNDE  1504

Query  4748  DLGVRQACRNTLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRV  4927
                VR AC+ TL+ ++ L+  +      +   F  D   DY++FL + ++ L      R+
Sbjct  1505  SPLVRDACKVTLRHLSKLLRTEEAKIFFHRRNFDVDGSLDYDEFLDEFSKLLIALYIDRI  1564

Query  4928  DTYLSAIIQAFDAPWPVIQANAVYLCSSML-SLSDNK  5035
             + ++   ++ + + W V++ NA  L   +L +LS++K
Sbjct  1565  NYFIMTTLEYYKSNWTVLRGNAATLTGFILGNLSEDK  1601


 Score = 69.3 bits (168),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 40/160 (25%), Positives = 86/160 (54%), Gaps = 2/160 (1%)
 Frame = +1

Query  139  DDSPSVREASMSALKDITSLNPLLVLD-CCLTVSRGGRRRFGNIAGLFQVISVAIRALDK  315
            D   SVR + ++++ +I    P  VL   C  +++  +   G+   + + +   I    +
Sbjct  32   DSDESVRNSVIASIYEIGFRQPNTVLALACEYLNKNQKIDLGHRVTILKSVH-QILGERR  90

Query  316  GDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLPDLMMEEIFLHFSGSN  495
             D+  A  ++L  ++ +E+   K++  DWQ+AA+ ++VS+G   P  +M+E+   F    
Sbjct  91   DDITEALSLQLIAMSISEMTRDKDVVPDWQQAASSLMVSLGLRFPTQIMDELVKRFETGM  150

Query  496  SALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVR  615
                 +++ L D+ +S+ L   PR++ VL+RV+P+L +++
Sbjct  151  IPHYFIMKTLGDFIASNPLPTVPRIRDVLSRVLPVLASIK  190



>ref|XP_004997194.1| hypothetical protein PTSG_01221 [Salpingoeca rosetta]
 gb|EGD80633.1| hypothetical protein PTSG_01221 [Salpingoeca rosetta]
Length=1533

 Score =   282 bits (721),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 326/1383 (24%), Positives = 579/1383 (42%), Gaps = 168/1383 (12%)
 Frame = +2

Query  1061  KTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGSLCVLKHLLPRLAESWHNKRP  1240
             + +NE+  CF  +   + E L  FL  K  ++EE    G+L  L+HL+    E   NK+ 
Sbjct  295   RNFNELLRCFEKLCIPFSERLMAFLFLKLEVREERPRIGTLLCLRHLINSSGEHLQNKKE  354

Query  1241  ILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGELFIEYLVRHCAMPDLENVEL  1420
             +++  +K L++E NL V+  LA LIV MA H YL    GE  + ++V   A+P  E+V  
Sbjct  355   LIVTGLKPLLEETNLKVKSTLATLIVAMAHHDYLHLEGGEALLRFIVDQSAIP--EHVVQ  412

Query  1421  ESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKGLLLITVTVPEMEHVLWPFLL  1600
              ++                        VT  +LR +C+  +L+ + T+P ME        
Sbjct  413   AAAAAPKDKRKKPP---------PEDEVTPLQLRTMCDNIILMSSRTIPCME--------  455

Query  1601  KMIIPRVYTGAVATVCRCISELCRRRSSESNAMLSECKARTDIPKPEELFARLVVLLHNP  1780
               ++P +              L RRR  E+  ML                          
Sbjct  456   --LVPVIG-----------QPLHRRRGIEALKML--------------------------  476

Query  1781  LAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKAYVSDT--EDLKQDPLYQESW  1954
                     Q LS+ ++      +NI   W  +  IPK+  Y+ +   +       +Q SW
Sbjct  477   --------QSLSINFH------ENIEELW--DAIIPKLVQYLEENSCDAHVWAEKHQSSW  520

Query  1955  DDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHSALLHRCLGILLQKVHDRA  2134
             +D+++ FL+ +LD I    W + LG     QY    S+    +L+ R +G++L+K     
Sbjct  521   EDLLLKFLSRTLDTIATEAWTIKLGEALHEQYTCCPSEPAVKSLISRYIGVVLRKSTKHD  580

Query  2135  YVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDKLKGILDNVGQSILQRIFS  2314
             ++   +  M+   +      R G AK  G  A+SHLDTV+++LK I              
Sbjct  581   FLEKMLVAMFESVDHESQDEREGCAKGFGFCASSHLDTVIEQLKRITKRDMVRKPTGFLG  640

Query  2315  FFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALVGTNMLSRLLHVRHPRAKQ  2494
                D+ + E +    A + L +GY   +APP++I +RI+  V +N+L     VR    K+
Sbjct  641   MLKDKSEAEVA-RIKATIMLTWGYVTLFAPPSLINSRIEVHVMSNILPHFERVRETLVKE  699

Query  2495  AVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRDEEEGFSDSNIELLHTQSL  2674
              +I  ++L+G+A+  +   G    L RR  L+ ++      +E             T++L
Sbjct  700   NLIRCVELIGKALHPSHLKGEKVSLHRRSELIAFM------EEYMKMEPPTTITTETRAL  753

Query  2675  ALSACTTLVSVEPKLTTETRNLIMKATIGF---FGLPNDPSDVINPLIDNLITLLCTIL-  2842
              + AC TL+ +EP L+    + +++ ++      GLP +       LID     L  +  
Sbjct  754   CMDACATLIELEPTLSESDLHQLLEVSVACVFDIGLPAEGDTTTQALIDKARKSLGGLFA  813

Query  2843  VTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIKFRAICVNGYCALGC  3022
             V   +D  +   Q   + +++ P++ S  ++QR+    A H++L     I          
Sbjct  814   VVIRKDPTTTCLQ--SVYKHLSPYIVSLKDHQREHMMAAIHDVLDVMFQI----------  861

Query  3023  QGSCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPRCIDTNYEVRKVSVQI  3202
                      +D  A+   S  P+     +      G+ +  ++PRC D    VR+ ++  
Sbjct  862   ---------LDERADAQSSTDPNT----NTAMAGFGKLLADFIPRCADPMLPVRQHALGS  908

Query  3203  LNLFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILRSDASIDPSEVFNRVVSSVC  3382
             +    +I   +   +N +  I        +++++ ++    +  S     V N +   + 
Sbjct  909   IKTLLHIRRVMAGDMNETDPI--------INAIDKLIQRAENGDSNPLFSVVNDLSKVLA  960

Query  3383  TLLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNELNEIEVSRTSQSLLTA  3562
               ++K+EL+  ++     + D      +GA   +      RG +L E EV     +L   
Sbjct  961   KKISKEELLDLIYPLFEGLLDVFTDGGDGACVVINGLFKLRGGDL-ENEVDAIIDALYEK  1019

Query  3563  VVHVTEKYLRQETLGAICSVAENTTSKVVFTEVLAAAGRDMVTKDIHRLRGGWPIQDAFH  3742
             +  +T++  +   L AI ++A +    V+         + +++ D   L     + D +H
Sbjct  1020  LEAITQERTKTGVLRAIRTLAVHHLDAVI---------KKLLSFD---LPFAELVVDMWH  1067

Query  3743  AFSQHLVLSHSFLEHVISVINQSPALKGGDSGKGESSRNSVDGSIEDDVSRAAVLALTAf  3922
               S    L+   L  ++S+++ S  L   D G G+ +           +     +  TA 
Sbjct  1068  TLSADQNLAPRILTELLSILDNS--LPYHDQG-GKFTHTLPPMKATRALKELFFVEETAQ  1124

Query  3923  frgggkfgrkTVEQSYASVlatltlhlgtchglaSYGDQEPLRALLNAFQAFCECVGDLE  4102
                         E +Y+ VLA L L L +C  L   GD  P++  ++AF+ F E      
Sbjct  1125  L----------AEDNYSDVLAQLLLRLASCVRLQPEGDVNPMQDAVDAFKQFLERSESGF  1174

Query  4103  MGKIL-ARGG------EQNENEKWINLIGELAGSISIKRPKEVPTICLFLSKSLDRPLRV  4261
             +   L A GG      E + N  +  ++ +L       +P  VP +  F    + R    
Sbjct  1175  VADALDATGGWDQFFSEMDNNLAFTTVVAQLCQ----HKPDMVPFLVEFFHGVMKRKFDT  1230

Query  4262  QREAAAAALSEFL-RYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGL---VQMPSIH  4429
             QR  A A  +E + +   G   L+ ++   L   + D+S  VR LC+RGL     +P  H
Sbjct  1231  QRVLAVALYAEVINQQCAGDLSLMVRLRNGLLAQIMDESHIVRMLCMRGLGNVASLPDEH  1290

Query  4430  VLQYTTQILGVILALLD---DSDESVQLTAvsclllvlesssTDAVEPVLLNLSIRLRNL  4600
             + +++T +L  ++  +D   D ++ + L A+  L  + E    D +  +L+N+S+R+R  
Sbjct  1291  IRKHSTAVLSAVMTGMDDRNDPNDDITLEAMRTLNKIFEKVEEDTIRNILINISLRIRPC  1350

Query  4601  QVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACRNT  4780
                    +RA A   FG LS +G G     F EQIH+     +LHL +DD  V  A    
Sbjct  1351  FEKDKPAVRAAAIELFGNLSQFGDGPSKVPFLEQIHSNLVSFILHLAEDDPDVCAAVARA  1410

Query  4781  LKCIAPLIEIDAIPALLNTHRFSSDHRS-DYEDFLRDLARQLTQYLGPRVDTYLSAIIQA  4957
             L  + PL+E D + +L    +   D +S  Y +FL +L+R L +    +V  Y  +    
Sbjct  1411  LLKLGPLLESDELTSLFE--KCLGDGKSLHYAEFLAELSRVLIKDFRDKVSFYTMSTADF  1468

Query  4958  FDAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATCSAAL  5137
             F A    I+ NA      +L      +   +    V G LV +     D  VR   + ++
Sbjct  1469  FKAYRQDIRCNAALFMGELLHSIPADDRRDITKEHVCGELV-RLLKDPDTKVRQQAAESI  1527

Query  5138  GLL  5146
              LL
Sbjct  1528  SLL  1530



>ref|XP_002881471.1| hypothetical protein ARALYDRAFT_321384 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57730.1| hypothetical protein ARALYDRAFT_321384 [Arabidopsis lyrata subsp. 
lyrata]
Length=209

 Score =   252 bits (644),  Expect(2) = 5e-73, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 140/160 (88%), Gaps = 0/160 (0%)
 Frame = +1

Query  169  MSALKDITSLNPLLVLDCCLTVSRGGRRRFGNIAGLFQVISVAIRALDKGDVDPAFMMKL  348
            M++L+DI SLNPLLVLDCC  VSRGGRRRFGN+AG+FQV++ ++  L+KG+ D  FM KL
Sbjct  1    MASLRDIASLNPLLVLDCCYAVSRGGRRRFGNMAGVFQVMAFSVGVLEKGESDAVFMGKL  60

Query  349  AKIATAEVISTKELNADWQRAAAGVLVSVGSHLPDLMMEEIFLHFSGSNSALPAMVQILA  528
            AKIATAE+IS+KELNADWQR A+ +LVS+G+H PDLMMEEIFLH SG  +A PAMVQILA
Sbjct  61   AKIATAEIISSKELNADWQRQASMLLVSIGTHFPDLMMEEIFLHLSGPATAAPAMVQILA  120

Query  529  DYASSDALQFTPRLKGVLARVVPILGNVREIYRPIFANGL  648
            D+ASSDALQFTPRLKGVL+RV PILGNVR+++RPIFAN  
Sbjct  121  DFASSDALQFTPRLKGVLSRVSPILGNVRDLHRPIFANAF  160


 Score = 53.9 bits (128),  Expect(2) = 5e-73, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +2

Query  644  ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKV  769
            A W Y  D +  + LD+DV+S LNS FELLLRVWA+SRD KV
Sbjct  166  AAWLYITDLTSDSPLDSDVMSNLNSVFELLLRVWAISRDHKV  207



>tpg|DAA43364.1| TPA: hypothetical protein ZEAMMB73_478475, partial [Zea mays]
Length=248

 Score =   248 bits (634),  Expect(2) = 3e-72, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = +1

Query  106  EAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGNIAGLFQV  285
            EAVQV+V+SLADDSP  R+A+++AL+DI  LNP+L+LDCC TVSRGGRRRFGN+AG+F V
Sbjct  14   EAVQVLVASLADDSPVARDAALAALRDIAPLNPMLILDCCATVSRGGRRRFGNMAGVFLV  73

Query  286  ISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLPDLMME  465
            ++ A+RALD  D +  F+ K+AKIATAE++++KE N DWQRAAA +LV++GSH PDLMM 
Sbjct  74   MASAVRALDHSDAESEFLRKIAKIATAEIVTSKEFNVDWQRAAACLLVAIGSHDPDLMMG  133

Query  466  EIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIYRPIFANG  645
            EIFLHFSG  SALPAM+QILAD+ASS+ALQFTPRLK VL RV+PILG+VR+  RP+FAN 
Sbjct  134  EIFLHFSGPTSALPAMLQILADFASSEALQFTPRLKDVLLRVLPILGSVRDGQRPVFANA  193

Query  646  L  648
             
Sbjct  194  F  194


 Score = 55.1 bits (131),  Expect(2) = 3e-72, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +2

Query  644  ACWQYSVDFSLSTILDTDVVSFLNSAFELLLRVWAMSRDLKVR  772
            A WQY  D      LD DV+SF+NS FELL++VW  SRDLKVR
Sbjct  200  AAWQYLGDAPSELPLDNDVMSFMNSVFELLIKVWTGSRDLKVR  242



>ref|XP_006032526.1| PREDICTED: maestro heat-like repeat-containing protein family 
member 1-like [Alligator sinensis]
Length=1661

 Score =   236 bits (603),  Expect(2) = 4e-72, Method: Compositional matrix adjust.
 Identities = 205/797 (26%), Positives = 353/797 (44%), Gaps = 92/797 (12%)
 Frame = +2

Query  716   SAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRTQLKAALPRLVPTILELYKREQDAA  895
             SA+++L   W  SR+ K+RL+ VEALG M  L+   +L+  LP+L+P IL LYK+  +  
Sbjct  227   SAYDVLFNSWLQSREAKLRLAVVEALGPMSYLMPGDKLEEQLPKLIPGILALYKKHVETF  286

Query  896   FVATCslhsllnasllsnngppllDFEDltvvlstlllvCSNNDKKEHSDFPVGLKTYNE  1075
             +V+              N G   LD +   ++ +    +C+  D       P+ +K + E
Sbjct  287   YVSK---SLCQILEASVNIGSRTLDTQLDALLSALHPQICAPAD----PSVPLMVKNHTE  339

Query  1076  VQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGSLCVLKHLLPRLAESWHNKRPILIES  1255
             V  CF  +   +P+ +  FLL K     E    G+L +++ ++   A     K+P ++ S
Sbjct  340   VLRCFTVLACSFPDRVLAFLLPKLENSNERVRVGTLLIMRQIINCAASQMEIKKPFILSS  399

Query  1256  VKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGELFIEYLVRHCAMPDLENVELESSRE  1435
             +KL + + +  V++A+ ++I  MA H YL  + GE  +EY++R CA+P      L++  +
Sbjct  400   MKLPLQDSSDKVKRAVVQVISAMAHHGYLEQAGGEAMMEYILRQCALP------LDTGPK  453

Query  1436  SSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKGLLLITVTVPEMEHVLWPFLLKMIIP  1615
                  G+ +              T+  +R +      LI+ TV  M  VLWP+LL+ + P
Sbjct  454   KQMPEGDDF--------------TSDSVRSISINTRFLISTTVDGMSEVLWPYLLEFVTP  499

Query  1616  RVYTGAVATVCRCISELCRRRSSESN-AMLSECKARTDIPKPEELFARLVVLLHNPLARE  1792
               +T A+  +C+ +  L  ++  E   A+L    A  ++P P  L  RL+V+   P   +
Sbjct  500   VQFTSALTPLCKSLMHLAMKKQEEGEAAVLIHYDANPNLPSPSALTTRLLVVSSQPYLGD  559

Query  1793  HLVTQILSVLWYLAPLFPKN---------INSFWQDEL*IPKMKAYVSDTEDLKQDPLYQ  1945
                   L +L   A L   N         +   W     IP +   V   E+  +  L Q
Sbjct  560   GQGAAALRLLMGAAALRLLNGLHSSIHPTLGPLWNAA--IPPL---VEHLEEHTEKSLSQ  614

Query  1946  ESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHSALLHRCLGILLQKVH  2125
             + W+D ++ FL E+L VI +  W+        +Q   Y         L++C+G  L+   
Sbjct  615   KEWEDKLLLFLKETLTVISDKSWICQFSTEMCKQLNSYNGFPLEKTFLYKCMGTPLRVCP  674

Query  2126  DRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDKLKGILDNVGQSILQR  2305
              +  V  ++  +   A       R GLA   G+ A  HLD  L KL+   D V   I ++
Sbjct  675   SKDMVHKQLQELLETARYHEEAEREGLASCFGICAIGHLDEALAKLE---DFVRSDIFKK  731

Query  2306  ---IFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALV--------GTNM  2452
                +FS F DR    E +   + L L YGY A YAP  ++ +RI+A +         T +
Sbjct  732   SVGLFSIFKDRSD-NEVEKIKSTLILCYGYVAMYAPKELVLSRIEADILKNVFQYFNTKV  790

Query  2453  LSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRDEEEG  2632
             L   +  +    K ++I +I ++ QA+  +  SG +F   R+  L+  ++  +  +  + 
Sbjct  791   LGIKVETKDLTLKLSLIRSICMISQAIYHSVHSG-AFVFSRKAELISQMMEFIKAEPVDA  849

Query  2633  FSDSNIELLHTQSLALSACTTLVSVEPKLT-TETRNLIMKATIGFFGLP-------NDPS  2788
                        +  A+ +CT L ++EP L  TE   LI         LP        D +
Sbjct  850   MRSP------IRQRAMISCTYLATLEPPLGHTERAELIDCCLNSVLALPPPEVMRERDST  903

Query  2789  -----------DVINPLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEY  2935
                        D IN L D + +LL   L   G         L  +  +++ ++ S+ E+
Sbjct  904   VTDTCLKDLYRDTINALKDLMKSLLQKDLTPQG---------LHDMFEHLNRWIKSAREH  954

Query  2936  QRKRGCLAAHELLIKFR  2986
             +R+R    +  LL ++R
Sbjct  955   ERERAMEVSVALLERYR  971


 Score = 67.0 bits (162),  Expect(2) = 4e-72, Method: Compositional matrix adjust.
 Identities = 46/183 (25%), Positives = 84/183 (46%), Gaps = 11/183 (6%)
 Frame = +1

Query  118  VMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRR-----RFGNIAGLFQ  282
             ++ +  D  PSV+E   SAL  +    P  +L+CC    R   +     R   +  +  
Sbjct  17   TLMDATTDKDPSVQEQIYSALCYLGEAEPEEILNCCDEYLRQHEKLAYPHRVTILKAMET  76

Query  283  VISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLPDLMM  462
            V+   +  LDK        +     A+ E+  +KE+  +WQ+AA+ VLV+VG    + +M
Sbjct  77   VVKNNMSHLDKSTAKVVIFL-----ASNEMTKSKEIVHEWQQAASNVLVAVGQRFINKVM  131

Query  463  EEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIY-RPIFA  639
            EE+   F         ++Q  A+ + S+     P L  +L  ++P+LG  ++ + + +F 
Sbjct  132  EEVLTKFQPGILPHYFIMQTFANLSVSNVFGMVPFLNSILGTMLPMLGMAKQDHMKSVFC  191

Query  640  NGL  648
              L
Sbjct  192  YAL  194


 Score = 75.1 bits (183),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 75/291 (26%), Positives = 133/291 (46%), Gaps = 10/291 (3%)
 Frame = +2

Query  4145  EKWINLIGELAGSISIKRPKEVPTICLFLSKSLDRPLRVQREAAAAALSEFLRYSDGFGP  4324
             E+  + +  LA +++      +P I   L   L+    +QR    A  +E L  S+    
Sbjct  1319  ERHHDGVALLASAMAKHAGPRLPLIVKNLLPVLNSVYDIQRITTTAFFAELLS-SNVVND  1377

Query  4325  L--LGQMVEALCRHVSDDSPTVRRLCLRGLVQMPS---IHVLQYTTQILGVILALLDDSD  4489
             L  L  M++ +     D   TVR L LRGL  + S     V ++  Q+L  ++  +DD D
Sbjct  1378  LVLLESMMDNMTGRQKDPCTTVRMLALRGLGNIASGSPEKVRKHGAQLLASMINGMDDKD  1437

Query  4490  ES---VQLTAvsclllvlesssTDAVEPVLLNLSIRLRNLQVCLNAKIRANAFAAFGALS  4660
             +    V L A+S L  +L+      +  +LL+++IR+R      + ++R ++   FG+L+
Sbjct  1438  DPHNLVALEAMSSLSKLLDHVEERDIHSMLLHIAIRIRPFFDNESHELRQSSILLFGSLT  1497

Query  4661  SYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACRNTLKCIAPLIEIDAIPALLNTH  4840
              +  GS  D F EQI      ++LHL D    V +AC+  L+   P +  + +  +   H
Sbjct  1498  KFSEGSCEDVFFEQILNGLVTLLLHLQDPQPEVVKACKFALRMCGPSMGCEGLRDMFRNH  1557

Query  4841  RFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSAIIQAFDAPWPVIQANA  4993
                 +    Y +FL  + + L Q     +   +S  +  F + WP ++A A
Sbjct  1558  -LREERGLHYGEFLNHVCKHLMQTYPEMLPRLISTNLFYFKSIWPDLRAAA  1607



>ref|XP_004656475.1| PREDICTED: maestro heat-like repeat-containing protein family 
member 1-like [Jaculus jaculus]
Length=1641

 Score =   230 bits (586),  Expect(2) = 6e-72, Method: Compositional matrix adjust.
 Identities = 186/753 (25%), Positives = 350/753 (46%), Gaps = 81/753 (11%)
 Frame = +2

Query  719   AFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRTQLKAALPRLVPTILELYKREQDAAF  898
             A+++L   W  SRD K+RL+ V ALG M  L+   +L+  LP+L+P +L LYK+  +   
Sbjct  223   AYDILFHHWLQSRDAKLRLAVVSALGPMSHLLPSEKLEEQLPKLLPGVLGLYKKHAETFQ  282

Query  899   VATCslhsllnasllsnngppllDFEDltvvlstlllvCSNNDKKEHSDFPVGLKTYNEV  1078
             ++              +     LD +   ++++    +C   +    S  P+ + +  EV
Sbjct  283   ISK---SLGQILEAAVSVSSRTLDVQLDVLLVALHSQICVPVE----SSSPLVMSSQKEV  335

Query  1079  QHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGSLCVLKHLLPRLAESWHNKRPILIESV  1258
               CF  +    P+ L  FLL K     E    G+L +L+H++   A     K+P ++ S+
Sbjct  336   LRCFTVLACCSPDRLLAFLLPKLDTSNERLRVGTLQILRHIINSAAAHMEAKKPFILSSM  395

Query  1259  KLLIDEHNLGVRKALAELIVVMASHCYLVGSSGELFIEYLVRHCAMPDLENVELESSRES  1438
             +L + + N  V++A+ ++I  MA H YL    GE+ +EY+V+ CA+P     E E  +  
Sbjct  396   RLPLLDTNTKVKRAVVQVISAMAHHGYLEQPGGEVMVEYIVQQCALPP----EQEPEQSG  451

Query  1439  SRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKGLLLITVTVPEMEHVLWPFLLKMIIPR  1618
             +   G                + T  +R V  + L L++ TV  M  VLWP+LL+ + P 
Sbjct  452   ADCEG----------------LVTDSVRAVSVRTLYLVSTTVDRMSDVLWPYLLEFLTPA  495

Query  1619  VYTGAVATVCRCISELC-RRRSSESNAMLSECKARTDIPKPEELFARLVVLLHNPL---A  1786
              +T A+  +CR +  L  +R+ + ++A L       ++P P  +  RL+V+  +P     
Sbjct  496   RFTTALTPLCRSLVHLALKRQETGADAFLVHYDKHANLPSPYAVTTRLLVVSSSPYLGDG  555

Query  1787  REHLVTQILSVLWY-LAPLFPKNINSFWQDEL*IPKMKAYVSDTEDLKQDPLYQESWDDM  1963
             R     ++L V+   + PL  +     W+    +P +  Y+   ++  ++ L  + W++ 
Sbjct  556   RGAAALRLLKVMHRDIHPLLGQR----WEKT--VPLLLEYL---DEHTEESLSLKEWEEK  606

Query  1964  IISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHSALLHRCLGILLQKVHDRAYVR  2143
             ++ FL ++L V+ +  W+  L     +Q   Y    +    L++C+G  L     +  VR
Sbjct  607   LLVFLRDTLTVVSDNTWICQLSLEMCKQLPCYNGTPQEKNFLYKCIGTTLGAASSKEVVR  666

Query  2144  AKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDKLKGIL--DNVGQSILQRIFSF  2317
               +  +   A     T R GLA  +G+ A +HL+  L +L+  +  D   +SI   IFS 
Sbjct  667   KHLQELLETARYQEDTEREGLACCLGICAITHLEDTLAQLQDFVKSDMFRKSI--GIFSI  724

Query  2318  FSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALVGTNM--------LSRLLHV  2473
             F DR +  E++   +AL L YG+ A  AP  ++ AR+++ +  NM        L   +  
Sbjct  725   FKDRSE-HEAERVKSALILCYGHVAAQAPRELVLARVESDILRNMYQCFSTKVLGIKVET  783

Query  2474  RHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRDEEEGFSDSNIE  2653
             + P  K  +I ++ ++ QA+  ++++  SF   R+  L+  ++  +  +  +        
Sbjct  784   KDPALKLCLIQSLCMVSQAICSSTQAS-SFHFSRKAELVAQMMEFIRMEPPDCLRTP---  839

Query  2654  LLHTQSLALSACTTLVSVEPKLTTETRNLIMKATIGFFGLPNDPSDVINPLIDNLITLLC  2833
                 +  A+ AC  LV++EP L  + +                 +DVI+  + +++ L  
Sbjct  840   ---IRKKAMLACMYLVNLEPALEEQAQ-----------------ADVIHGCLHSVMALPA  879

Query  2834  TILVTSGEDGRSRAEQLLHILRNIDPFVSSSLE  2932
                 + GEDG  +    L  +R ++  ++S L+
Sbjct  880   E---SEGEDGACQKTLYLDTVRALEDLLTSLLQ  909


 Score = 72.8 bits (177),  Expect(2) = 6e-72, Method: Compositional matrix adjust.
 Identities = 52/183 (28%), Positives = 91/183 (50%), Gaps = 11/183 (6%)
 Frame = +1

Query  118  VMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRR-----RFGNIAGLFQ  282
             ++ ++ D  P V+E   S+L  +    P   L  C    R   +     R   +  +  
Sbjct  12   TLLDAITDKDPMVQEQVCSSLCSLGEAQPQETLHACEEYLRHHDKLAHPYRTMILRAMEM  71

Query  283  VISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLPDLMM  462
            ++S  I  LDK   D A ++ L  +A +E+  TKEL+ +WQ+AA+ VLV+VG H  + +M
Sbjct  72   ILSSHIHELDK---DTASIVIL--LACSEMTRTKELSCEWQQAASSVLVAVGKHFVNQVM  126

Query  463  EEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVRE-IYRPIFA  639
            EE+ + F        +++Q LA  + S+A    P L  +L+ ++P+L   ++   R +F 
Sbjct  127  EEVLIRFQPGILPHCSVLQTLASLSVSNAFGMVPFLPSILSTMIPMLSMAKQDTLRVVFC  186

Query  640  NGL  648
              L
Sbjct  187  CAL  189


 Score = 71.6 bits (174),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 71/256 (28%), Positives = 111/256 (43%), Gaps = 16/256 (6%)
 Frame = +2

Query  4259  VQREAAAAALSEFLR---YSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQMPS--  4423
             +QR  + A L+E L     +D    LL  ++E+L     D S +VRRL LRGL  + S  
Sbjct  1337  IQRVTSTAFLAELLSSNVVNDLM--LLEPLLESLAARQKDSSASVRRLVLRGLANIASGS  1394

Query  4424  -IHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEP-----VLLNLSI  4585
                V  +  Q+L  +++ LDD D+   L A+  ++ +      D VEP     VLL+ +I
Sbjct  1395  PDKVRAHGPQLLTAMISGLDDGDDPHSLVALEAMVGLARLL--DLVEPWDLRLVLLHTAI  1452

Query  4586  RLRNLQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQ  4765
             R+R        + R  +   FG L+        D F EQ+      ++LHL D    V  
Sbjct  1453  RIRPFFDSERVEFRTASIRLFGHLNKVCHKDCEDVFLEQVVGGLVPLLLHLQDPQSPVAM  1512

Query  4766  ACRNTLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSA  4945
             ACR  L    P +E   + A    H    D    + +FL    + L  +    +   +S 
Sbjct  1513  ACRFALCMCVPHLECVELAAAFQKH-LQEDRSMHFGEFLNSTCKHLMHHFPDLLGRLVST  1571

Query  4946  IIQAFDAPWPVIQANA  4993
              +  F + W  ++A A
Sbjct  1572  NLFYFKSSWDDVRAAA  1587



>ref|XP_008832666.1| PREDICTED: maestro heat-like repeat-containing protein family 
member 1 isoform X2 [Nannospalax galili]
 ref|XP_008832673.1| PREDICTED: maestro heat-like repeat-containing protein family 
member 1 isoform X2 [Nannospalax galili]
Length=1630

 Score =   236 bits (601),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 197/776 (25%), Positives = 358/776 (46%), Gaps = 80/776 (10%)
 Frame = +2

Query  719   AFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRTQLKAALPRLVPTILELYKREQDAAF  898
             A+++LL  W  SRD K+RL+ V ALG M  L+   +L+  LPRL+P +L LYK+  +   
Sbjct  223   AYDILLHHWLQSRDAKLRLAVVAALGPMSHLLPNEKLEEQLPRLLPGVLVLYKKHVETFQ  282

Query  899   VATCslhsllnasllsnngppllDFEDltvvlstlllvCSNNDKKEHSDFPVGLKTYNEV  1078
             ++              +     L+ +   ++++    +C   +    S  P+ + +  EV
Sbjct  283   ISK---SLGQILEAAVSVSSRTLEVQLDALLVALHTQICVPVE----SSSPLVMSSQKEV  335

Query  1079  QHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGSLCVLKHLLPRLAESWHNKRPILIESV  1258
               CF  +    P+ L  FLL K     E    G+L +L+H++   A     K+P ++ S+
Sbjct  336   LRCFTVLACCSPDRLLAFLLPKLDTNNERLRVGTLQILRHIINSAASQMEVKQPFILSSM  395

Query  1259  KLLIDEHNLGVRKALAELIVVMASHCYLVGSSGELFIEYLVRHCAMPDLENVELESSRES  1438
             +L + + N  V++A+ ++I  MA H YL    GE+ I+Y+V+ CA+P  E  +     E 
Sbjct  396   RLPLLDTNSKVKRAVVQVISAMAHHGYLEQPGGEVMIDYIVQQCALPPEEPEKPGPDGED  455

Query  1439  SRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKGLLLITVTVPEMEHVLWPFLLKMIIPR  1618
                                  +    +R V  + L L++ TV  M +VLWP+LL+ + P 
Sbjct  456   ---------------------LAADSVRAVSIRTLYLVSTTVDRMSNVLWPYLLEFLTPV  494

Query  1619  VYTGAVATVCRCISELC-RRRSSESNAMLSECKARTDIPKPEELFARLVVLLHNPL---A  1786
              +T A+  +CR +  L  +R+ + ++A L +  +  ++P P  +  RL+V+  NP     
Sbjct  495   RFTAALTPLCRSLVHLALKRQEAGADAFLVQFNSHANLPSPYAVTTRLLVVSSNPYLGDG  554

Query  1787  REHLVTQILSVL-WYLAPLFPKNINSFWQDEL*IPKMKAYVSDTEDLKQDPLYQESWDDM  1963
             R     ++L VL W + PL    +   W+    +P +  Y+   ++  ++ L ++ W + 
Sbjct  555   RGAASLRLLKVLHWNIHPL----LGQHWETT--VPVLLQYL---DEHTEETLSRKEWQEK  605

Query  1964  IISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHSALLHRCLGILLQKVHDRAYVR  2143
             ++ FL ++L VI +  W+  L     +Q   Y    +    L++C+G  L     +  VR
Sbjct  606   LLVFLRDTLAVISDDTWICQLSLEMCKQLSSYNGTPQEKNFLYKCIGTTLGTASSKEVVR  665

Query  2144  AKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDKLKGILDNVGQSILQR---IFS  2314
               +  +   A       R GLA   G+ A +HL+  L +L+   D V   + ++   IFS
Sbjct  666   KHLRELLETARYQEEAEREGLACCFGICAIAHLEDTLAQLE---DFVKSDVFRKSIGIFS  722

Query  2315  FFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALVGTNMLSRLLHVRHPRAKQ  2494
              F DR +  E +   +AL L YG+ A  AP  ++ A++++ V  NM  +    + P  K 
Sbjct  723   IFKDRSE-HEVERMKSALILCYGHVAAQAPHELLLAKVESDVLRNMF-QCFSTKDPALKL  780

Query  2495  AVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRDEEEGFSDSNIELLHTQSL  2674
              ++ ++ ++ QAV  + ++  SF   R+  L+  ++  +  +  +            +  
Sbjct  781   CLVQSLCMVSQAVCSSIQAS-SFHFSRKAELVAQMVEFINAEPPDCLKTP------IRKK  833

Query  2675  ALSACTTLVSVEPKLTTETR-NLIMKATIGFFGLPNDPS------------DVINPLIDN  2815
             A+ ACT L+++EP L  +T+ ++I         LP +P             D    L D 
Sbjct  834   AMLACTYLINLEPALEEQTQADVIHSCLHSVMALPPEPEGEDGACQEPLYLDTARALEDL  893

Query  2816  LITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIKF  2983
             L +LL   +   G         L  I+ ++ P++ SS  ++R R  L     L+KF
Sbjct  894   LTSLLRRNMTPQG---------LQVIVEHLSPWIKSSRGHERARA-LGLGACLLKF  939


 Score = 65.5 bits (158),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 54/178 (30%), Positives = 86/178 (48%), Gaps = 11/178 (6%)
 Frame = +1

Query  133  LADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRR-----RFGNIAGLFQVISVA  297
            + D   +V+E   SAL  +    P   L  C    R   +     R   +  +  V+S  
Sbjct  17   ITDKDSAVQEQVCSALCSLGEAQPGETLRACEEYLRQHDKLAHPYRVKVLRAMETVLSSH  76

Query  298  IRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLPDLMMEEIFL  477
            I  LDK   D A ++ L  +A++E+  TKEL+ DWQRAA+ VLV+VG    + +ME +  
Sbjct  77   IHELDK---DTASIVIL--LASSEMTRTKELDCDWQRAASSVLVAVGKRFINQVMEVVLS  131

Query  478  HFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVRE-IYRPIFANGL  648
             F        +++  LA  + S+A    P L  VL+ ++P+LG  ++   R +F   L
Sbjct  132  KFQPGVLPHSSVLHTLASLSLSNAFGMVPFLPSVLSTMLPMLGMAKQDALRVVFCCAL  189


 Score = 73.2 bits (178),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 91/356 (26%), Positives = 153/356 (43%), Gaps = 38/356 (11%)
 Frame = +2

Query  4040  EPLRALLNAFQAF---------CECVGDLEMGKILARGGEQNENEKWINLIGELAGSISI  4192
             EP  + ++A QA            CV +LE G  L R    +E+      + +LA +++ 
Sbjct  1251  EPCSSAVDALQALLLRGGTQDVVRCV-ELEGGWELLRTSAGHEDG-----VAQLASAMAK  1304

Query  4193  KRPKEVPTI--CLFLSKSLDRPLRVQREAAAAALSEFLR---YSDGFGPLLGQMVEALCR  4357
                  +P +   L  + S+      QR  + A L+E L     +D    LL  ++++L  
Sbjct  1305  CAGPRLPLVMKALVCTHSV---YETQRVTSTAFLAELLSNNVVNDLM--LLEPLLDSLAA  1359

Query  4358  HVSDDSPTVRRLCLRGLVQMPS---IHVLQYTTQILGVILALLDDSDESVQLTAvsclll  4528
                D S +VRRL LRGL  + S     V  +  Q+L  ++  LDD D+   L A+  ++ 
Sbjct  1360  RQKDSSASVRRLVLRGLANIASGSPDKVRAHGPQLLTAMIGGLDDGDDPHGLVALEAMVG  1419

Query  4529  vlesssTDAVEP-----VLLNLSIRLRNLQVCLNAKIRANAFAAFGALSSYGAGSILDSF  4693
             +      D VEP     VLL+ +IR+R        + R  +   FG L+    G+  D F
Sbjct  1420  LARL--QDLVEPWDLRLVLLHTTIRIRPFFDSEKVEFRTASIRLFGHLNKTCHGNCEDVF  1477

Query  4694  REQIHAAFPRMVLHLHDDDLGVRQACRNTLKCIAPLIEIDAIPALLNTHRFSSDHRS-DY  4870
              EQ+      ++LHL D    V  ACR  L    P +E   + A    +++  + RS  +
Sbjct  1478  LEQVVGGLVPLLLHLQDPQASVASACRFALCMCVPHLECAELAAAF--YKYLQEGRSVHF  1535

Query  4871  EDFLRDLARQLTQYLGPRVDTYLSAIIQAFDAPWPVIQANAVYLCSSMLSLSDNKN  5038
              +FL    + L  +    +   +S  +  F + W  ++A A      +L  ++ K 
Sbjct  1536  GEFLNSTCKHLMHHFPDLLGRLVSTTLFYFKSSWDDVRAAAPMFTGFLLLHAETKQ  1591



>ref|XP_005316100.1| PREDICTED: maestro heat-like repeat-containing protein family 
member 1-like [Ictidomys tridecemlineatus]
Length=1641

 Score =   229 bits (585),  Expect(2) = 4e-71, Method: Compositional matrix adjust.
 Identities = 198/789 (25%), Positives = 364/789 (46%), Gaps = 90/789 (11%)
 Frame = +2

Query  716   SAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRTQLKAALPRLVPTILELYKREQDAA  895
             SA+++L   W  SRD K+RL+ V ALG M  L+   +L+  LPRL+P +L LYK+  +  
Sbjct  222   SAYDILFHHWLQSRDAKLRLAVVAALGPMSHLLPSEKLEEQLPRLLPGVLSLYKKHAETF  281

Query  896   FVATCslhsllnasllsnngppllDFEDltvvlstlllvCSNNDKKEHSDFPVGLKTYNE  1075
              V+              + G   L+ +   ++ +    +C   +    S  P+ + +  E
Sbjct  282   HVSK---SLGQILEAAVSVGSRTLEAQLDALLATLHTQICVPVE----SSSPLVMSSQKE  334

Query  1076  VQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGSLCVLKHLLPRLAESWHNKRPILIES  1255
             V  CF  +    P+ L  FLL +     E    G+L +L+HL+   A     K+P ++ +
Sbjct  335   VLRCFTVLACCLPDRLLAFLLPRLDTSSERLRVGTLQILRHLINSAAAQMEVKKPFILSA  394

Query  1256  VKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGELFIEYLVRHCAMPDLENVELESSRE  1435
             ++L + + N  V++A+ ++I  MA H YL    GE+ IEY+V+ CA+P       E   E
Sbjct  395   MRLPLLDTNNKVKRAVVQVISAMAHHGYLEQPGGEVMIEYIVQQCALPP------EQEPE  448

Query  1436  SSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKGLLLITVTVPEMEHVLWPFLLKMIIP  1615
                  G                     +R V  + L L++ TV  M  VLWP+L++ ++P
Sbjct  449   KPGPDGE-------------DLAAADSVRAVSVRTLYLVSTTVDRMSDVLWPYLMEFLVP  495

Query  1616  RVYTGAVATVCRCISELC-RRRSSESNAMLSECKARTDIPKPEELFARLVVLLHNPL---  1783
               +T A+  +CR +  L  +R+ + ++A L   +A  ++P P  +  RL+V+  +P    
Sbjct  496   AHFTEALTPLCRSLVHLALKRQEAGADAFLVPFEAHANLPSPYAVTTRLLVVSSHPYLGD  555

Query  1784  AREHLVTQILSVLWY-LAPLFPKNINSFWQD--EL*IPKMKAYVSDTEDLKQDPLYQESW  1954
              R     ++L V+ + + PL  +     W+    L +  ++A+  +T  L++       W
Sbjct  556   GRGAASLRLLRVMRHSIHPLLAQP----WETAVPLLLEHLEAHTEETLSLQE-------W  604

Query  1955  DDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHSALLHRCLGILLQKVHDRA  2134
             ++ +++FL ++L V+ +  W   L     ++   Y    +    L++CLG  L     R 
Sbjct  605   EEKLLAFLRDTLAVVSDDTWTCQLSLEMRKRLPSYNRVPQEKNFLYKCLGTALAAAASRE  664

Query  2135  YVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDKLKGILDNVGQSILQR---  2305
              VR  +  +   A+        GLA   G+ A +HL+  L +L+   D +   +L++   
Sbjct  665   VVRKSLQELLGAASYQQQAEHEGLACCFGICATAHLEDTLTQLE---DFIRSDVLRKSSG  721

Query  2306  IFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALVGTNML----SRLLHV  2473
             IFS F DRG+ +E +   +AL L YG+ A  AP  ++ A++++ V  NM     +++L +
Sbjct  722   IFSIFKDRGE-QELEKVKSALILCYGHVAARAPHELVLAKVESEVLRNMFQCFSTKVLGI  780

Query  2474  ----RHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRDEEEGFSD  2641
                 + P  K  ++ ++ ++ QA+  ++++  SF   R+  L+  ++  +  +  +    
Sbjct  781   KVETKDPALKLCLVQSLCMVSQAICSSAQAS-SFYFSRKAELVAQMMEFIRAEPLDSLKT  839

Query  2642  SNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATI-GFFGLPNDP-----------  2785
                     +  A+ ACT LVS+EP L  + R  +++  +     L  +P           
Sbjct  840   P------LRKKAMLACTHLVSLEPALEEQARADVIRGCLYSVLALVPEPDREDGGSQESL  893

Query  2786  -SDVINPLIDNLITLLCTILVTSGEDGRSRAEQLLHIL-RNIDPFVSSSLEYQRKRGCLA  2959
               D +  L D L  LL           R+   Q L I+  ++ P++ S   ++R R    
Sbjct  894   YQDTVRALEDLLAGLL----------QRNMTPQGLQIMVEHLSPWIKSPKGHERARALGL  943

Query  2960  AHELLIKFR  2986
             +  LL  FR
Sbjct  944   STRLLRHFR  952


 Score = 70.5 bits (171),  Expect(2) = 4e-71, Method: Compositional matrix adjust.
 Identities = 55/183 (30%), Positives = 91/183 (50%), Gaps = 11/183 (6%)
 Frame = +1

Query  118  VMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRR-----RFGNIAGLFQ  282
             ++ ++ D  P V+E   SAL+ +    P   L  C    R   +     R   +  +  
Sbjct  12   TLLDAITDKEPVVQEQVCSALRFLGEARPRETLRACDAYLRQHDKLAQPYRALILRAMEM  71

Query  283  VISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLPDLMM  462
            V+S  I  LDK   D A ++ L  +A++E+  TK L+ DWQRAA+ VLV+VG    + +M
Sbjct  72   VLSSHIHQLDK---DTASILIL--LASSEMTRTKGLDCDWQRAASSVLVAVGKRFINQVM  126

Query  463  EEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVRE-IYRPIFA  639
            EE+   F        +++Q LA  + S+A    P L  +L+ ++P+LG  ++   R +F 
Sbjct  127  EEVLSRFQPGVLPHCSVLQTLASLSVSNAFGMVPFLPSILSTMLPMLGMAKQDALRVVFC  186

Query  640  NGL  648
              L
Sbjct  187  CAL  189


 Score = 64.7 bits (156),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 87/341 (26%), Positives = 141/341 (41%), Gaps = 38/341 (11%)
 Frame = +2

Query  4040  EPLRALLNAFQAF---------CECVGDLEMGKILARGGEQNENEKWINLIGELAGSISI  4192
             EP  + ++A QA           +C+  LE G  L R    +E       +  LA +++ 
Sbjct  1261  EPCSSAVDALQALLLRGGSQDVAQCM-QLEGGWELLRTSAGHEEG-----VTRLASAMAR  1314

Query  4193  KRPKEVPTICLFLSKSLDRPLRVQREAAAAALSEFLR---YSDGFGPLLGQMVEALCRHV  4363
                  +P +   L  + + P  +QR  + A L+E L     +D    LL  +++ L    
Sbjct  1315  CAGPRLPLVVKALVCTQNSPYEMQRVTSTAFLAELLSSNVVNDLM--LLESLLDNLAARQ  1372

Query  4364  SDDSPTVRRLCLRGLVQMPS---IHVLQYTTQILGVILALLDDSDESVQLTAvsclllvl  4534
              D S +VRRL LRGL  + S     V  +  Q+L  +++ LDD D+   L A+  ++ + 
Sbjct  1373  KDSSTSVRRLVLRGLANVASGSPDKVRAHGPQLLTAMISGLDDRDDPHGLVALEAMVGLA  1432

Query  4535  esssTDAVEP-----VLLNLSIRLRNLQVCLNAKIRANAFAAFGALSSYGAGSILDSFRE  4699
                  D V P     VLL+  IR+R        + R  +   FG L+    G   + F E
Sbjct  1433  RLL--DLVAPWDLRLVLLHTVIRIRPFFDSEKVEFREASIRLFGHLNKACHGDCEEVFLE  1490

Query  4700  QIHAAFPRMVLHLHDDDLGVRQACRNTLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDF  4879
             Q+      ++LHL D    V  ACR  L    P +E + + A  + H         + +F
Sbjct  1491  QVVGGLVPLLLHLQDPQAPVASACRFALCMCVPNLECEELAATFHKH-LQEGRSLHFGEF  1549

Query  4880  LRDLARQLTQY----LGPRVDT---YLSAIIQAFDAPWPVI  4981
             L    + L  +    LG  V T   Y  + ++   A  P+ 
Sbjct  1550  LNSTCKHLMHHFPDLLGRLVSTNLFYFKSTLEEVRAAAPMF  1590



>gb|KDO46983.1| hypothetical protein CISIN_1g018728mg [Citrus sinensis]
Length=322

 Score =   254 bits (648),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = +1

Query  85   GDSIPASEAVQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGN  264
            G SIPA EAVQ +VSSLAD+SP VREASM++LKDI +LNPLLVLDCCL VSRGGRRRFGN
Sbjct  9    GISIPAPEAVQFLVSSLADESPIVREASMASLKDIAALNPLLVLDCCLAVSRGGRRRFGN  68

Query  265  IAGLFQVISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSH  444
            +AG+FQV++ A+RALD+ D+DPAFM KL++IATAE+IS+KELN DWQRAA+ +LVS+GSH
Sbjct  69   MAGIFQVMAFAVRALDENDIDPAFMSKLSRIATAEMISSKELNTDWQRAASALLVSIGSH  128

Query  445  LPDLMMEEIFLHFSGSNSALPAMVQILADYASSD  546
            LPDLMMEEIFL+ SG+NSALPAMVQILAD+AS+D
Sbjct  129  LPDLMMEEIFLYLSGTNSALPAMVQILADFASAD  162


 Score =   120 bits (302),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +2

Query  704  SFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRTQLKAALPRLVPTILELYKRE  883
            SFLNSAFELLLRVWA SRDLKVR+S V+ALGQMVGLITR+QLK ALP+LVP+ILELYK++
Sbjct  193  SFLNSAFELLLRVWATSRDLKVRVSTVDALGQMVGLITRSQLKGALPKLVPSILELYKKD  252

Query  884  QDAAFVATC  910
            QD A VATC
Sbjct  253  QDTALVATC  261


 Score = 29.3 bits (64),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 30/55 (55%), Gaps = 3/55 (5%)
 Frame = +3

Query  489  FKFSSTCNGSNTCRLCII*CFA---VYSTIKRCSCTSRTHSWECERNIQANLCKW  644
            F + S  N +    + I+  FA   V+ST K C+CT  T++ +  R   AN+CKW
Sbjct  138  FLYLSGTNSALPAMVQILADFASADVHSTTKGCTCTCSTYTRKHTRCPPANICKW  192



>ref|XP_004387453.1| PREDICTED: HEAT repeat-containing protein 7A-like [Trichechus 
manatus latirostris]
Length=1641

 Score =   236 bits (601),  Expect(2) = 6e-71, Method: Compositional matrix adjust.
 Identities = 199/770 (26%), Positives = 362/770 (47%), Gaps = 69/770 (9%)
 Frame = +2

Query  704   SFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRTQLKAALPRLVPTILELYKRE  883
             S + SA ++L   W  SR+ K+RL+ VEALG M  L+   +L+  LPRL+P +L LYK+ 
Sbjct  218   SHIFSAHDVLFNHWLQSREAKLRLAVVEALGPMSHLLPNERLEEQLPRLIPGVLALYKKH  277

Query  884   QDAAFVATCslhsllnasllsnngppllDFEDltvvlstlllvCSNNDKKEHSDFPVGLK  1063
              +   V+              + G   L+ +   ++ +    +C   +    S  P+ ++
Sbjct  278   AETFHVSK---SLGQILEAAVSVGSRTLEVQLDALLAALHAQICVPVE----SSSPLVVR  330

Query  1064  TYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGSLCVLKHLLPRLAESWHNKRPI  1243
                EV  C+  +    P+ L  FLL K     E    GSL VL+H++   A     ++  
Sbjct  331   NQKEVLRCYTVLACFAPDRLLAFLLPKLDTSNERIRVGSLQVLRHVINSAAAQMEIRKLF  390

Query  1244  LIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGELFIEYLVRHCAMPDLENVELE  1423
             ++ S++L + + N  V++A+ ++I  MA H YL    G+  +EY+V+ CA+P     EL+
Sbjct  391   ILSSMRLPLLDTNNKVKRAVVQVISAMAHHGYLEQPGGQAMMEYIVQQCALPP----ELQ  446

Query  1424  SSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKGLLLITVTVPEMEHVLWPFLLK  1603
               R+     G   P                 +R +    L LI+ TV  M  VLWP+LL+
Sbjct  447   PERQGP--GGEDLP--------------ADSVRAISISTLYLISTTVDRMSDVLWPYLLE  490

Query  1604  MIIPRVYTGAVATVCRCISELC-RRRSSESNAMLSECKARTDIPKPEELFARLVVLLHNP  1780
              + P  +TGA+  +CR ++ L  +R+ + ++A L + +A   +P P  + +RL+V+  +P
Sbjct  491   FLTPVRFTGALTPLCRSLAHLALKRQEAGADAFLIQYEASVKLPSPYAITSRLLVVSSDP  550

Query  1781  LAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKAYVSDTEDLKQDPLYQESWDD  1960
                +      L +L  L       +   W+    +P++   V   ++  ++ L ++ W++
Sbjct  551   YVGDCRGVASLRLLHVLHHHIHPLLGPRWETT--VPQL---VQHLDEHTEETLSRKEWEE  605

Query  1961  MIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHSALLHRCLGILLQKVHDRAYV  2140
              ++ FL ++L V+ +  WV  L     +Q   Y    +    L++C+G  L     +  V
Sbjct  606   KLLMFLRDTLAVVSDNTWVCQLSLEMCKQLPCYNGAPQEKNFLYKCIGTALGAASSKEVV  665

Query  2141  RAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDKLKGILDNVGQSILQR---IF  2311
             R ++  +   A       R GLA   G+ A SHLD VL +L+   D V   + ++   I 
Sbjct  666   RKQLQGLLETARYQEEAEREGLACCFGICAVSHLDNVLAQLE---DFVRSDVFRKSVGIL  722

Query  2312  SFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALVGTNMLSRL--------L  2467
             S F DR +  E +   +AL L YG+ A  AP  ++ AR++A +  NM            +
Sbjct  723   SIFKDRSE-NEVEKVKSALILCYGHVAVQAPRELVLARVEADILRNMFQYFNTKVLGIKV  781

Query  2468  HVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRDEEEGFSDSN  2647
               + P  K  ++ +I ++ QA+ G++++G +F   R+  L+ ++   +  +  +      
Sbjct  782   ETKDPALKLCLVQSICMVCQAICGSTQAG-AFHFARKAELVAHMTEFIRAEPPDSLRTP-  839

Query  2648  IELLHTQSLALSACTTLVSVEPKLTTETR----NLIMKATIGFFGLPN--DPSDVINPLI  2809
                   +  A++ACT LVS+EP L  + +    +  +++ +     P+  D SD     +
Sbjct  840   -----LRKKAMTACTLLVSLEPPLEEQMQADMTHCCLQSVMALLPEPDREDASDREALYL  894

Query  2810  DNLITL--LCTILVTSGEDGRSRAEQLLHIL-RNIDPFVSSSLEYQRKRG  2950
             D L  L  L T L+      R+   Q L I+  ++ P++ S   ++R+R 
Sbjct  895   DTLHALEDLLTSLL-----HRNMTPQGLQIMVEHLSPWIKSPRGHERERA  939


 Score = 63.5 bits (153),  Expect(2) = 6e-71, Method: Compositional matrix adjust.
 Identities = 51/183 (28%), Positives = 88/183 (48%), Gaps = 11/183 (6%)
 Frame = +1

Query  118  VMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRR-----RFGNIAGLFQ  282
             ++ ++ D  P V+E   SAL  +    P   L  C    R   +     R   +  +  
Sbjct  12   TLMDAVTDKDPQVQEQICSALCALGEAQPEETLRACEEYLRQHEKLAHPYRAMILKAMEA  71

Query  283  VISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLPDLMM  462
            V+   I  LDK D+  A ++    +A++E+   K+L  DWQ+AA+ VLV+VG+   + +M
Sbjct  72   VVRSHISKLDK-DMARAIIL----LASSEMTKAKDLVPDWQQAASSVLVAVGTRFINAVM  126

Query  463  EEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVRE-IYRPIFA  639
            EE+   F         +VQ LA  A+S+     P L  +L+ ++P+L   ++   R +F 
Sbjct  127  EELLSRFQPGLLPHHFIVQTLASLAASNVFGMVPFLTSILSTMLPMLPMAKQDAMRVVFC  186

Query  640  NGL  648
            + L
Sbjct  187  SAL  189


 Score = 70.5 bits (171),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 83/312 (27%), Positives = 133/312 (43%), Gaps = 23/312 (7%)
 Frame = +2

Query  4094  DLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICLFLSKSLDRPLRVQREA  4273
             +LE G  L R  E +E       +  LA +++      +P +   L  +      +QR  
Sbjct  1287  ELEGGWELLRTSEGHEEG-----VTRLARAMAKHAGPRLPLVMKALISTQSSAYEIQRVT  1341

Query  4274  AAAALSEFLR---YSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQMPS---IHVL  4435
             + A L+E L     +D    LL  +++ L     D   +VRRL LRGL  + S     V 
Sbjct  1342  STAFLAELLSSNVVNDLM--LLETLLDNLAVRQKDMCASVRRLVLRGLANLASGSPDKVR  1399

Query  4436  QYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEP-----VLLNLSIRLRNL  4600
              +  Q+L  ++  LDD D+   L A+  ++ +      D VEP     VLL+ +IR+R  
Sbjct  1400  THGPQLLTTLIGGLDDVDDLHSLVALEAMVGLARLL--DLVEPWDLRSVLLHTAIRIRPF  1457

Query  4601  QVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACRNT  4780
                   + R  +   FG L+    G   D F EQ  +A   ++LHL D    V  ACR  
Sbjct  1458  FDSEKVEFRRASICLFGHLNKACHGDCEDVFLEQTVSALGPLLLHLRDPQATVVGACRFA  1517

Query  4781  LKCIAPLIEIDAIPALLNTHRFSSDHRS-DYEDFLRDLARQLTQYLGPRVDTYLSAIIQA  4957
             L+   P +  + + A    H    D RS  + +FL    + L  +    +   +S  +  
Sbjct  1518  LRMCGPNLACEELTAAFEKHL--QDGRSLHFGEFLNTTCKHLMHHFPDLLGRLVSTNLFY  1575

Query  4958  FDAPWPVIQANA  4993
             F + W  ++A A
Sbjct  1576  FKSSWENVRATA  1587



>gb|ELV13596.1| HEAT repeat-containing protein 7A, partial [Tupaia chinensis]
Length=1662

 Score =   233 bits (594),  Expect(2) = 9e-71, Method: Compositional matrix adjust.
 Identities = 197/783 (25%), Positives = 352/783 (45%), Gaps = 81/783 (10%)
 Frame = +2

Query  680   TILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRTQLKAALPRLVPT  859
             T+      S +  A++LL   W  SR+ K+RL+ VEALG M  L+   +L+  LPRL+P 
Sbjct  198   TVRKDTFASDIFCAYDLLFPSWLQSREAKLRLAVVEALGPMSHLLPSERLEEQLPRLLPG  257

Query  860   ILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstlllvCSNNDKKEH  1039
             +L LY++  +A+ V+              + G   L+ +  T++ +    +C   +    
Sbjct  258   VLALYRKHAEASHVSK---SLGQILEAAVSVGSRTLEVQLDTLLAALHAQMCMPVE----  310

Query  1040  SDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGSLCVLKHLLPRLAE  1219
             S  P+ L    EV  CF  +    P+ L  FLL K  +  E    G+L  L+H++   A 
Sbjct  311   SSSPLVLSNQKEVLRCFTVLAGCSPDRLLAFLLPKLDIGSERLRVGTLLTLRHIINSAAP  370

Query  1220  SWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGELFIEYLVRHCAMP  1399
                 K+P ++ +++L + + +  V++A+ ++I  MA H YL    GE+ +EY+V+ CA+P
Sbjct  371   QMEVKKPFILSAMRLPLLDSSSQVKRAVVQVISAMAHHGYLEQPGGEVMVEYIVQQCALP  430

Query  1400  DLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKGLLLITVTVPEMEH  1579
               +  E                    K            +R +  + L L++ TV  M  
Sbjct  431   PAQEPE--------------------KPGLDGDDPAADSVRAISVRTLYLVSTTVDRMGD  470

Query  1580  VLWPFLLKMIIPRVYTGAVATVCRCISELC-RRRSSESNAMLSECKARTDIPKPEELFAR  1756
             VLWP+LL ++IP  +TGA+  +CR +  L  +R+ + ++A L +  A+ ++P P  +  R
Sbjct  471   VLWPYLLTLLIPVRFTGALTPLCRSLLHLALKRQEAGADASLIQQDAKVNLPSPYAVTTR  530

Query  1757  LVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKAYVSDTEDLKQDP  1936
             L+V+  +P   +      L +L  L       +   W     IP +  Y+   ++  +D 
Sbjct  531   LLVVSSSPCLADGRAAAALRLLNVLHRDIHPLLGPRWGRT--IPLLLEYL---DEHTEDS  585

Query  1937  LYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHSALLHRCLGILLQ  2116
             L Q+ W++ +++FL ++L  + +  W+  L     +Q   Y    +    L++C+G  L 
Sbjct  586   LSQKDWEERLLTFLRDTLATVSDNTWIRQLSLEMCKQLPCYNGMPQEKNFLYQCIGTALG  645

Query  2117  KVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDKLKGILDNVGQSI  2296
                 R  VR  +  +   A         GLA   G+ A SHL+  L +L+   D V   +
Sbjct  646   A--SREGVREHLRELLATARYQEEAEHEGLACCFGICAVSHLEDTLAQLE---DFVRSDV  700

Query  2297  LQR---IFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALVGTNM-----  2452
              ++   I S F DRG+  E+    + L L YG+ A  AP  ++ A++++ +  NM     
Sbjct  701   FRKSVGILSIFKDRGE-HEAAKVKSTLLLCYGHVAARAPRELLLAKVESDILRNMSQHYS  759

Query  2453  ---LSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRDE  2623
                L   +  + P  K  ++ ++ ++ QAV  AS    SFPL  +  L+  ++  +  + 
Sbjct  760   TKVLGVKVETKDPALKLCLVQSLCMVCQAVC-ASTQPRSFPLPSKAELVAQMMEFIRSEP  818

Query  2624  EEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETR-NLIMKATIGFFGLPNDPS----  2788
              +            +  A+  CT LV +EP L  + R +++         LP +P     
Sbjct  819   PDALQTP------IRKKAMLTCTYLVPLEPALGEQARADMVQTCLHSVLALPPEPEGEGC  872

Query  2789  --------DVINPLIDNLITLLCTILVTSGEDGRSRAEQLLHIL-RNIDPFVSSSLEYQR  2941
                     D +  L D L +LL           RS   Q L ++  ++ P++ S   ++R
Sbjct  873   SCQESLYLDTVRALEDLLTSLL----------QRSMTPQGLQVMVEHLSPWIKSPRGHER  922

Query  2942  KRG  2950
              R 
Sbjct  923   ARA  925


 Score = 65.9 bits (159),  Expect(2) = 9e-71, Method: Compositional matrix adjust.
 Identities = 46/172 (27%), Positives = 88/172 (51%), Gaps = 12/172 (7%)
 Frame = +1

Query  121  MVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGNIAGLFQVISVAI  300
            ++ ++ D  P+V+E   SAL  +    P  +L  C        RR   +A  ++  ++ +
Sbjct  1    LLDAITDKDPAVQEQVCSALCALGEARPGQLLRAC----EEHLRRHDKLAPPYR--AMVL  54

Query  301  RALDK------GDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLPDLMM  462
            RA++K       ++D      +  +A++E+  TK+L  DWQ+AA+GVLV+VG+   + +M
Sbjct  55   RAMEKVLSNHASELDKDTASSVILLASSEMTRTKDLACDWQQAASGVLVAVGTRFINRVM  114

Query  463  EEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVRE  618
            EE+            ++V+  A  A+ +A    P L  +L+ ++P+L  V+ 
Sbjct  115  EELLGKLQPGVLPHCSVVRTFASLAADNAFGMVPFLPSILSTLLPVLPQVKH  166


 Score = 62.8 bits (151),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 64/237 (27%), Positives = 104/237 (44%), Gaps = 15/237 (6%)
 Frame = +2

Query  4163  IGELAGSISIKRPKEVPTICLFLSKSLDRPLRVQREAAAAALSEFLR---YSDGFGPLLG  4333
             +  LA +++      +P +   L  +       QR  A A L E +R    +D    LL 
Sbjct  1291  VARLASAMAKHAGPRLPLVVKALVSTQSSVYEAQRVTATAFLGELVRSNVVNDLM--LLE  1348

Query  4334  QMVEALCRHVSDDSPTVRRLCLRGLVQMP---SIHVLQYTTQILGVILALLDDSDESVQL  4504
              ++++L     D   +VRRL LRGL  +       V  + TQ+L  +++ LDD D+   L
Sbjct  1349  PLLDSLAARQKDSCSSVRRLALRGLANLAFGSPDKVRAHGTQLLSAMISGLDDGDDPHSL  1408

Query  4505  TAvsclllvlesssTDAVEP-----VLLNLSIRLRNLQVCLNAKIRANAFAAFGALSSYG  4669
              A+  ++ +      D V P     V+L+++IR R       A+ R  +   FG L+   
Sbjct  1409  VALEAMVGLAGLL--DLVAPCDLRLVVLHVAIRTRPFFDSEKAEFRTASIRLFGHLNQAC  1466

Query  4670  AGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACRNTLKCIAPLIEIDAIPALLNTH  4840
              G   + F EQ+      ++LHL D    V  ACR  L+  A  +E + + A    H
Sbjct  1467  LGDCEEVFLEQVAGGLVPLLLHLQDPQAPVASACRFALRMCAHNLECEELEAAFEKH  1523



>ref|XP_006162530.1| PREDICTED: maestro heat-like repeat-containing protein family 
member 1-like [Tupaia chinensis]
Length=1636

 Score =   232 bits (591),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 197/783 (25%), Positives = 352/783 (45%), Gaps = 81/783 (10%)
 Frame = +2

Query  680   TILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRTQLKAALPRLVPT  859
             T+      S +  A++LL   W  SR+ K+RL+ VEALG M  L+   +L+  LPRL+P 
Sbjct  210   TVRKDTFASDIFCAYDLLFPSWLQSREAKLRLAVVEALGPMSHLLPSERLEEQLPRLLPG  269

Query  860   ILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstlllvCSNNDKKEH  1039
             +L LY++  +A+ V+              + G   L+ +  T++ +    +C   +    
Sbjct  270   VLALYRKHAEASHVSK---SLGQILEAAVSVGSRTLEVQLDTLLAALHAQMCMPVE----  322

Query  1040  SDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGSLCVLKHLLPRLAE  1219
             S  P+ L    EV  CF  +    P+ L  FLL K  +  E    G+L  L+H++   A 
Sbjct  323   SSSPLVLSNQKEVLRCFTVLAGCSPDRLLAFLLPKLDIGSERLRVGTLLTLRHIINSAAP  382

Query  1220  SWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGELFIEYLVRHCAMP  1399
                 K+P ++ +++L + + +  V++A+ ++I  MA H YL    GE+ +EY+V+ CA+P
Sbjct  383   QMEVKKPFILSAMRLPLLDSSSQVKRAVVQVISAMAHHGYLEQPGGEVMVEYIVQQCALP  442

Query  1400  DLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKGLLLITVTVPEMEH  1579
               +  E                    K            +R +  + L L++ TV  M  
Sbjct  443   PAQEPE--------------------KPGLDGDDPAADSVRAISVRTLYLVSTTVDRMGD  482

Query  1580  VLWPFLLKMIIPRVYTGAVATVCRCISELC-RRRSSESNAMLSECKARTDIPKPEELFAR  1756
             VLWP+LL ++IP  +TGA+  +CR +  L  +R+ + ++A L +  A+ ++P P  +  R
Sbjct  483   VLWPYLLTLLIPVRFTGALTPLCRSLLHLALKRQEAGADASLIQQDAKVNLPSPYAVTTR  542

Query  1757  LVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKAYVSDTEDLKQDP  1936
             L+V+  +P   +      L +L  L       +   W     IP +  Y+   ++  +D 
Sbjct  543   LLVVSSSPCLADGRAAAALRLLNVLHRDIHPLLGPRWGRT--IPLLLEYL---DEHTEDS  597

Query  1937  LYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHSALLHRCLGILLQ  2116
             L Q+ W++ +++FL ++L  + +  W+  L     +Q   Y    +    L++C+G  L 
Sbjct  598   LSQKDWEERLLTFLRDTLATVSDNTWIRQLSLEMCKQLPCYNGMPQEKNFLYQCIGTALG  657

Query  2117  KVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDKLKGILDNVGQSI  2296
                 R  VR  +  +   A         GLA   G+ A SHL+  L +L+   D V   +
Sbjct  658   A--SREGVREHLRELLATARYQEEAEHEGLACCFGICAVSHLEDTLAQLE---DFVRSDV  712

Query  2297  LQR---IFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALVGTNM-----  2452
              ++   I S F DRG+  E+    + L L YG+ A  AP  ++ A++++ +  NM     
Sbjct  713   FRKSVGILSIFKDRGE-HEAAKVKSTLLLCYGHVAARAPRELLLAKVESDILRNMSQHYS  771

Query  2453  ---LSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRDE  2623
                L   +  + P  K  ++ ++ ++ QAV  AS    SFPL  +  L+  ++  +  + 
Sbjct  772   TKVLGVKVETKDPALKLCLVQSLCMVCQAVC-ASTQPRSFPLPSKAELVAQMMEFIRSEP  830

Query  2624  EEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETR-NLIMKATIGFFGLPNDPS----  2788
              +            +  A+  CT LV +EP L  + R +++         LP +P     
Sbjct  831   PDALQTP------IRKKAMLTCTYLVPLEPALGEQARADMVQTCLHSVLALPPEPEGEGC  884

Query  2789  --------DVINPLIDNLITLLCTILVTSGEDGRSRAEQLLHIL-RNIDPFVSSSLEYQR  2941
                     D +  L D L +LL           RS   Q L ++  ++ P++ S   ++R
Sbjct  885   SCQESLYLDTVRALEDLLTSLL----------QRSMTPQGLQVMVEHLSPWIKSPRGHER  934

Query  2942  KRG  2950
              R 
Sbjct  935   ARA  937


 Score = 65.9 bits (159),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 46/175 (26%), Positives = 89/175 (51%), Gaps = 12/175 (7%)
 Frame = +1

Query  112  VQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGNIAGLFQVIS  291
             + ++ ++ D  P+V+E   SAL  +    P  +L  C        RR   +A  ++  +
Sbjct  10   CRALLDAITDKDPAVQEQVCSALCALGEARPGQLLRAC----EEHLRRHDKLAPPYR--A  63

Query  292  VAIRALDK------GDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLPD  453
            + +RA++K       ++D      +  +A++E+  TK+L  DWQ+AA+GVLV+VG+   +
Sbjct  64   MVLRAMEKVLSNHASELDKDTASSVILLASSEMTRTKDLACDWQQAASGVLVAVGTRFIN  123

Query  454  LMMEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVRE  618
             +MEE+            ++V+  A  A+ +A    P L  +L+ ++P+L  V+ 
Sbjct  124  RVMEELLGKLQPGVLPHCSVVRTFASLAADNAFGMVPFLPSILSTLLPVLPQVKH  178


 Score = 62.4 bits (150),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 64/237 (27%), Positives = 104/237 (44%), Gaps = 15/237 (6%)
 Frame = +2

Query  4163  IGELAGSISIKRPKEVPTICLFLSKSLDRPLRVQREAAAAALSEFLR---YSDGFGPLLG  4333
             +  LA +++      +P +   L  +       QR  A A L E +R    +D    LL 
Sbjct  1303  VARLASAMAKHAGPRLPLVVKALVSTQSSVYEAQRVTATAFLGELVRSNVVNDLM--LLE  1360

Query  4334  QMVEALCRHVSDDSPTVRRLCLRGLVQMP---SIHVLQYTTQILGVILALLDDSDESVQL  4504
              ++++L     D   +VRRL LRGL  +       V  + TQ+L  +++ LDD D+   L
Sbjct  1361  PLLDSLAARQKDSCSSVRRLALRGLANLAFGSPDKVRAHGTQLLSAMISGLDDGDDPHSL  1420

Query  4505  TAvsclllvlesssTDAVEP-----VLLNLSIRLRNLQVCLNAKIRANAFAAFGALSSYG  4669
              A+  ++ +      D V P     V+L+++IR R       A+ R  +   FG L+   
Sbjct  1421  VALEAMVGLAGLL--DLVAPCDLRLVVLHVAIRTRPFFDSEKAEFRTASIRLFGHLNQAC  1478

Query  4670  AGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACRNTLKCIAPLIEIDAIPALLNTH  4840
              G   + F EQ+      ++LHL D    V  ACR  L+  A  +E + + A    H
Sbjct  1479  LGDCEEVFLEQVAGGLVPLLLHLQDPQAPVASACRFALRMCAHNLECEELEAAFEKH  1535



>ref|XP_008832661.1| PREDICTED: maestro heat-like repeat-containing protein family 
member 1 isoform X1 [Nannospalax galili]
 ref|XP_008832662.1| PREDICTED: maestro heat-like repeat-containing protein family 
member 1 isoform X1 [Nannospalax galili]
 ref|XP_008832663.1| PREDICTED: maestro heat-like repeat-containing protein family 
member 1 isoform X1 [Nannospalax galili]
 ref|XP_008832664.1| PREDICTED: maestro heat-like repeat-containing protein family 
member 1 isoform X1 [Nannospalax galili]
 ref|XP_008832665.1| PREDICTED: maestro heat-like repeat-containing protein family 
member 1 isoform X1 [Nannospalax galili]
 ref|XP_008832672.1| PREDICTED: maestro heat-like repeat-containing protein family 
member 1 isoform X1 [Nannospalax galili]
 ref|XP_008832674.1| PREDICTED: maestro heat-like repeat-containing protein family 
member 1 isoform X7 [Nannospalax galili]
Length=1639

 Score =   232 bits (592),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 198/784 (25%), Positives = 362/784 (46%), Gaps = 87/784 (11%)
 Frame = +2

Query  719   AFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRTQLKAALPRLVPTILELYKREQDAAF  898
             A+++LL  W  SRD K+RL+ V ALG M  L+   +L+  LPRL+P +L LYK+  +   
Sbjct  223   AYDILLHHWLQSRDAKLRLAVVAALGPMSHLLPNEKLEEQLPRLLPGVLVLYKKHVETFQ  282

Query  899   VATCslhsllnasllsnngppllDFEDltvvlstlllvCSNNDKKEHSDFPVGLKTYNEV  1078
             ++              +     L+ +   ++++    +C   +    S  P+ + +  EV
Sbjct  283   ISK---SLGQILEAAVSVSSRTLEVQLDALLVALHTQICVPVE----SSSPLVMSSQKEV  335

Query  1079  QHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGSLCVLKHLLPRLAESWHNKRPILIESV  1258
               CF  +    P+ L  FLL K     E    G+L +L+H++   A     K+P ++ S+
Sbjct  336   LRCFTVLACCSPDRLLAFLLPKLDTNNERLRVGTLQILRHIINSAASQMEVKQPFILSSM  395

Query  1259  KLLIDEHNLGVRKALAELIVVMASHCYLVGSSGELFIEYLVRHCAMPDLENVELESSRES  1438
             +L + + N  V++A+ ++I  MA H YL    GE+ I+Y+V+ CA+P  E  +     E 
Sbjct  396   RLPLLDTNSKVKRAVVQVISAMAHHGYLEQPGGEVMIDYIVQQCALPPEEPEKPGPDGED  455

Query  1439  SRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKGLLLITVTVPEMEHVLWPFLLKMIIPR  1618
                                  +    +R V  + L L++ TV  M +VLWP+LL+ + P 
Sbjct  456   ---------------------LAADSVRAVSIRTLYLVSTTVDRMSNVLWPYLLEFLTPV  494

Query  1619  VYTGAVATVCRCISELC-RRRSSESNAMLSECKARTDIPKPEELFARLVVLLHNPL---A  1786
              +T A+  +CR +  L  +R+ + ++A L +  +  ++P P  +  RL+V+  NP     
Sbjct  495   RFTAALTPLCRSLVHLALKRQEAGADAFLVQFNSHANLPSPYAVTTRLLVVSSNPYLGDG  554

Query  1787  REHLVTQILSVL-WYLAPLFPKNINSFWQDEL*IPKMKAYVSDTEDLKQDPLYQESWDDM  1963
             R     ++L VL W + PL    +   W+    +P +  Y+   ++  ++ L ++ W + 
Sbjct  555   RGAASLRLLKVLHWNIHPL----LGQHWETT--VPVLLQYL---DEHTEETLSRKEWQEK  605

Query  1964  IISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHSALLHRCLGILLQKVHDRAYVR  2143
             ++ FL ++L VI +  W+  L     +Q   Y    +    L++C+G  L     +  VR
Sbjct  606   LLVFLRDTLAVISDDTWICQLSLEMCKQLSSYNGTPQEKNFLYKCIGTTLGTASSKEVVR  665

Query  2144  AKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDKLKGILDNVGQSILQR---IFS  2314
               +  +   A       R GLA   G+ A +HL+  L +L+   D V   + ++   IFS
Sbjct  666   KHLRELLETARYQEEAEREGLACCFGICAIAHLEDTLAQLE---DFVKSDVFRKSIGIFS  722

Query  2315  FFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALVGTNML----SRLLHV---  2473
              F DR +  E +   +AL L YG+ A  AP  ++ A++++ V  NM     +++L +   
Sbjct  723   IFKDRSE-HEVERMKSALILCYGHVAAQAPHELLLAKVESDVLRNMFQCFSTKVLGIKVE  781

Query  2474  -RHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRDEEEGFSDSNI  2650
              + P  K  ++ ++ ++ QAV  + ++  SF   R+  L+  ++  +  +  +       
Sbjct  782   TKDPALKLCLVQSLCMVSQAVCSSIQAS-SFHFSRKAELVAQMVEFINAEPPDCLKTP--  838

Query  2651  ELLHTQSLALSACTTLVSVEPKLTTETR-NLIMKATIGFFGLPNDPS------------D  2791
                  +  A+ ACT L+++EP L  +T+ ++I         LP +P             D
Sbjct  839   ----IRKKAMLACTYLINLEPALEEQTQADVIHSCLHSVMALPPEPEGEDGACQEPLYLD  894

Query  2792  VINPLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHEL  2971
                 L D L +LL   +   G         L  I+ ++ P++ SS  ++R R  L     
Sbjct  895   TARALEDLLTSLLRRNMTPQG---------LQVIVEHLSPWIKSSRGHERARA-LGLGAC  944

Query  2972  LIKF  2983
             L+KF
Sbjct  945   LLKF  948


 Score = 65.5 bits (158),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 54/178 (30%), Positives = 86/178 (48%), Gaps = 11/178 (6%)
 Frame = +1

Query  133  LADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRR-----RFGNIAGLFQVISVA  297
            + D   +V+E   SAL  +    P   L  C    R   +     R   +  +  V+S  
Sbjct  17   ITDKDSAVQEQVCSALCSLGEAQPGETLRACEEYLRQHDKLAHPYRVKVLRAMETVLSSH  76

Query  298  IRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLPDLMMEEIFL  477
            I  LDK   D A ++ L  +A++E+  TKEL+ DWQRAA+ VLV+VG    + +ME +  
Sbjct  77   IHELDK---DTASIVIL--LASSEMTRTKELDCDWQRAASSVLVAVGKRFINQVMEVVLS  131

Query  478  HFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVRE-IYRPIFANGL  648
             F        +++  LA  + S+A    P L  VL+ ++P+LG  ++   R +F   L
Sbjct  132  KFQPGVLPHSSVLHTLASLSLSNAFGMVPFLPSVLSTMLPMLGMAKQDALRVVFCCAL  189


 Score = 73.2 bits (178),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 91/356 (26%), Positives = 153/356 (43%), Gaps = 38/356 (11%)
 Frame = +2

Query  4040  EPLRALLNAFQAF---------CECVGDLEMGKILARGGEQNENEKWINLIGELAGSISI  4192
             EP  + ++A QA            CV +LE G  L R    +E+      + +LA +++ 
Sbjct  1260  EPCSSAVDALQALLLRGGTQDVVRCV-ELEGGWELLRTSAGHEDG-----VAQLASAMAK  1313

Query  4193  KRPKEVPTI--CLFLSKSLDRPLRVQREAAAAALSEFLR---YSDGFGPLLGQMVEALCR  4357
                  +P +   L  + S+      QR  + A L+E L     +D    LL  ++++L  
Sbjct  1314  CAGPRLPLVMKALVCTHSV---YETQRVTSTAFLAELLSNNVVNDLM--LLEPLLDSLAA  1368

Query  4358  HVSDDSPTVRRLCLRGLVQMPS---IHVLQYTTQILGVILALLDDSDESVQLTAvsclll  4528
                D S +VRRL LRGL  + S     V  +  Q+L  ++  LDD D+   L A+  ++ 
Sbjct  1369  RQKDSSASVRRLVLRGLANIASGSPDKVRAHGPQLLTAMIGGLDDGDDPHGLVALEAMVG  1428

Query  4529  vlesssTDAVEP-----VLLNLSIRLRNLQVCLNAKIRANAFAAFGALSSYGAGSILDSF  4693
             +      D VEP     VLL+ +IR+R        + R  +   FG L+    G+  D F
Sbjct  1429  LARL--QDLVEPWDLRLVLLHTTIRIRPFFDSEKVEFRTASIRLFGHLNKTCHGNCEDVF  1486

Query  4694  REQIHAAFPRMVLHLHDDDLGVRQACRNTLKCIAPLIEIDAIPALLNTHRFSSDHRS-DY  4870
              EQ+      ++LHL D    V  ACR  L    P +E   + A    +++  + RS  +
Sbjct  1487  LEQVVGGLVPLLLHLQDPQASVASACRFALCMCVPHLECAELAAAF--YKYLQEGRSVHF  1544

Query  4871  EDFLRDLARQLTQYLGPRVDTYLSAIIQAFDAPWPVIQANAVYLCSSMLSLSDNKN  5038
              +FL    + L  +    +   +S  +  F + W  ++A A      +L  ++ K 
Sbjct  1545  GEFLNSTCKHLMHHFPDLLGRLVSTTLFYFKSSWDDVRAAAPMFTGFLLLHAETKQ  1600



>ref|XP_008163307.1| PREDICTED: maestro heat-like repeat-containing protein family 
member 1 isoform X2 [Chrysemys picta bellii]
Length=1639

 Score =   239 bits (611),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 208/778 (27%), Positives = 355/778 (46%), Gaps = 71/778 (9%)
 Frame = +2

Query  716   SAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRTQLKAALPRLVPTILELYKREQDAA  895
             +A+++L  +W  SR+ K+RL+ V+ALG M  L+   +L+  LPRLVP IL LYK+  +A 
Sbjct  222   NAYDVLFNIWLQSREAKLRLAVVKALGPMSHLMPSEKLEEQLPRLVPGILALYKKHVEAF  281

Query  896   FVATCslhsllnasllsnngppllDFEDltvvlstlllvCSNNDKKEHSDFPVGLKTYNE  1075
             +V               N G   LD +   ++ +    +C+  +    S  P+ LK +NE
Sbjct  282   YVTK---SLCQILEASVNVGSRTLDTQLDALLSTLHPQICAPVE----SSVPLSLKNHNE  334

Query  1076  VQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGSLCVLKHLLPRLAESWHNKRPILIES  1255
             V  CF  +   +P+ L  FLL K     E    G+L +++ ++         K+P ++ S
Sbjct  335   VLRCFTVLACTFPDRLLGFLLPKLENHHERIRVGTLIIMRQIINCAPSQMEIKKPFILSS  394

Query  1256  VKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGELFIEYLVRHCAMPDLENVELESSRE  1435
             +KL + + +  V++A+ ++I  MA H YL  + GE+ IEY+V  CA+P            
Sbjct  395   MKLPLQDSSNKVKRAVVQVISAMAHHGYLEQAGGEVMIEYIVHQCALPP-----------  443

Query  1436  SSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKGLLLITVTVPEMEHVLWPFLLKMIIP  1615
                   + +P   RK   +A  +T+  ++ +    L LI+ TV  M+ VLWP+LL+ + P
Sbjct  444   ------DTHP---RKQTPEADDLTSDSVQNISISTLFLISTTVDRMDEVLWPYLLEFVTP  494

Query  1616  RVYTGAVATVCRCISELCRRRSSES-NAMLSECKARTDIPKPEELFARLVVLLHNPLARE  1792
               +TGA+  +CR +  L  +R  E     L       ++P P  L ARL+ +   P   +
Sbjct  495   VEFTGALTPLCRSLMHLATKRQEEGETTFLIHYDTHANLPSPCALMARLLTVSSQPYLGD  554

Query  1793  HLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKAYVSDTEDLKQDPLYQESWDDMIIS  1972
                   L +L  L       +   W       K+   V   E   +  L  + W+D ++ 
Sbjct  555   GRGAAALRLLNVLHLNIHPTLGKLWNK-----KIPPLVEHLEANTEKSLSSKEWEDKLLL  609

Query  1973  FLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHSALLHRCLGILLQKVHDRAYVRAKI  2152
              L E+L  I +  W+        +    Y         L++C+G  L    ++  V+ ++
Sbjct  610   LLRETLTAISDNAWICQFSTEMCKHLNSYNGFPSEKNFLYKCIGTALGVCSNKEVVQKQL  669

Query  2153  DLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDKLKGILDNVGQSILQR---IFSFFS  2323
               +   A       R GLA   G+ A +HLD  L KL+   D V   + ++   +FS F 
Sbjct  670   QELLETARYQEEAEREGLASCFGICAINHLDETLAKLE---DFVKSDVFKKSVGLFSIFK  726

Query  2324  DRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALVGTNMLSRLLHVRHPRAKQAVI  2503
             DR    E++   + L L YGY A+YAP  ++ +RI+A +  N+     + R    K  +I
Sbjct  727   DRSD-NEAEKIKSTLILCYGYVARYAPKELVLSRIEADILRNVF-HYFNTRDLTLKLCLI  784

Query  2504  TAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRDEEEGFSDSNIELLHT--QSLA  2677
              +I ++ QA+  +++SG +F   R+  LL  ++        E      ++LL T  +  A
Sbjct  785   RSICMISQAISSSAQSG-AFVFSRKAELLAQMM--------EFIKTEPLDLLRTPIRQRA  835

Query  2678  LSACTTLVSVEPKLTTETR-NLIMKATIGFFGLPNDPSDVIN-------------PLIDN  2815
             + +CT LV +EP L+      LI         LP  P DV+               L  +
Sbjct  836   MISCTYLVVLEPPLSEPDHVELIDTCLSSVLALP--PLDVLKERDGHVPDALHKETLYHD  893

Query  2816  LITLLCTILVTS-GEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELLIKFR  2986
              ++ L  +L +   +D   R  Q   +  ++ P++ SS E++R+R    +  LL  +R
Sbjct  894   TVSALKDLLKSVLQKDLTPRGLQ--SMFEHLGPWIRSSKEHERERAVEVSATLLEFYR  949


 Score = 57.8 bits (138),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 91/184 (49%), Gaps = 13/184 (7%)
 Frame = +1

Query  118  VMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGNIAGLFQVISV-  294
             ++ +  D  P V+E   +AL  +    P  +L+ C        R+   +A   ++I + 
Sbjct  12   TLMDATTDKDPLVQEQIYNALCYLGESEPEEILNSC----DEYLRQHDKLAYPHRIIILK  67

Query  295  AIRALDKGDVDPAFMMK-LAKI----ATAEVISTKELNADWQRAAAGVLVSVGSHLPDLM  459
            A+ A+ K ++D  ++ K  AKI    A+ E+  +KE+  DWQ+AA+ VLV+ G    + +
Sbjct  68   AMEAVLKNNID--YLDKSTAKIVIFLASNEMTKSKEIIYDWQQAASNVLVAAGGRFINKV  125

Query  460  MEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIY-RPIF  636
            MEE+   F         ++Q  A+ + S+     P L  +L  ++P+LG  ++ + + +F
Sbjct  126  MEEVLTKFQPGILPHYFIMQTFANLSVSNVFGMVPFLNSILGTMLPMLGMAKQDHMKSVF  185

Query  637  ANGL  648
               L
Sbjct  186  CYAL  189


 Score = 76.6 bits (187),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 85/330 (26%), Positives = 146/330 (44%), Gaps = 15/330 (5%)
 Frame = +2

Query  4040  EPLRALLNAFQAFCECVGDLEMGKILARGGE---QNENEKWINLIGELAGSISIKRPKEV  4210
             +P    + A  A     G  E+ K +   G        E+  + I  LA +++     ++
Sbjct  1259  DPCSCAVEALSAMLTQGGSDEVVKSVGSAGGWELMKSPERHHDGIALLARAMAKHAGPKL  1318

Query  4211  PTICLFLSKSLDRPLRVQREAAAAALSEFLR---YSDGFGPLLGQMVEALCRHVSDDSPT  4381
             P I   L   L+     QR    A ++E L     SD    LL  M++ +     D    
Sbjct  1319  PLIAKNLFPMLNSVYDSQRITTTAFVAELLNSSVVSDLI--LLESMMDNMTGRQKDPCTL  1376

Query  4382  VRRLCLRGLVQMPS---IHVLQYTTQILGVILALLDDSDES---VQLTAvsclllvless  4543
             VR L LRGL  + +     V ++  Q+L  ++  +DD D+    V L A+S L  +L+  
Sbjct  1377  VRMLALRGLGNISAGSPDKVRKHGAQLLASMVNGMDDKDDPDNLVALEAMSSLSKLLDHV  1436

Query  4544  sTDAVEPVLLNLSIRLRNLQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPR  4723
                 +  +LL+++IR+R      N ++RA++   FG L+ + AG+  D F EQI      
Sbjct  1437  EERDIRSMLLHIAIRIRPFFDNENHELRASSIVLFGNLTKFSAGNCEDVFFEQILNGLVT  1496

Query  4724  MVLHLHDDDLGVRQACRNTLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQL  4903
             ++LHL D    V +AC+  L+   P +  + +  +   H    D    Y +F+ D+ + L
Sbjct  1497  LLLHLQDPRPEVIKACKFALRMCGPNMGCEGLCDMFLNH-LHEDRSLHYGEFMNDVCKHL  1555

Query  4904  TQYLGPRVDTYLSAIIQAFDAPWPVIQANA  4993
              Q     ++  +S  +  F + W  I+A A
Sbjct  1556  MQNYPEMLNRLISTNLFYFKSNWVDIRAAA  1585



>ref|XP_009495134.1| hypothetical protein H696_02975 [Fonticula alba]
 gb|KCV70618.1| hypothetical protein H696_02975 [Fonticula alba]
Length=1850

 Score =   243 bits (621),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 179/673 (27%), Positives = 327/673 (49%), Gaps = 68/673 (10%)
 Frame = +2

Query  716   SAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRTQLKAALPRLVPTILELYKREQDAA  895
             ++F++    W    +  +RL+ +EA+G +   + R Q +A LPR+V  IL+LY++E+   
Sbjct  244   TSFDMFFGQWLGRSEPSLRLAVIEAVGHLSQSMDREQFEANLPRIVSGILQLYRKEK---  300

Query  896   FVATCslhsllnasllsnngppllDFEDltvvlstlllvCSNNDKKEHSDFPVGLKTYNE  1075
             F+   +   +    + +  G   LD +   ++ +   L+C+   + + S  P  ++ ++E
Sbjct  301   FLLPITHGLVQVLEVATAGGSRSLDQQIPQLMQTMHGLICA--PELQPSVNPALMRNFSE  358

Query  1076  VQHCFLTVGSVYPEDLFVFLLNK-CRLKEEPFTFGSLCVLKHLLPRLAESWHNKRPILIE  1252
             +  C+  + + + +++  FLL +    ++E    G+L +LKHL+         +R +++ 
Sbjct  359   MLRCWEIMANTFTDEVLFFLLQRFVDSRDERIRVGTLLILKHLVNACDGVMQARRAVVVS  418

Query  1253  SVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGELFIEYLVRHCAMPDLENVELESSR  1432
              ++ L+ E +  VR+A A++IV MASH YL    G+L +E++VR C++ + +      + 
Sbjct  419   GLRPLLPETSYKVRRAFAQVIVTMASHNYLSLEGGQLLVEFIVRQCSISEADEQAYTKAL  478

Query  1433  ESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKGLLLITVTVPEMEHVLWPFLLKMII  1612
              S++            ++     VT   LR +CE  L L+T T+  ME VLWP+L +M+ 
Sbjct  479   ASNK-----------AMQADPDPVTPAMLRSMCENILSLLTTTISNMEGVLWPYLFEMLT  527

Query  1613  PRVYTGAVATVCRCISELCRRR----------------------SSESNAMLSECKART-  1723
             P  Y  A + V R +S +  R+                        E +A    C     
Sbjct  528   PVGYYPAASVVARSLSLIAERKRGAGDSDDVDADDDQANDAADGEEEKDAARGPCPEYMI  587

Query  1724  ------DIPKPEELFARLVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*I  1885
                   ++P+P  + ARL+VL   P A+  L   IL+ L    P+F  ++   W DE+ I
Sbjct  588   DFDELLNLPRPHAIIARLLVLASQPHAQRQLGDNILAFLRAAGPIFHPSLAYLW-DEV-I  645

Query  1886  PKMKAYVSD-TEDLKQDPLYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYK  2062
             P+++  + + +E++ Q       W+DMI+  L  +L V+ + +W++ LG  F  Q  LY 
Sbjct  646   PRLRVRLQERSENMAQ--WSASRWEDMILRLLTRTLGVVDDDEWLVELGEAFCSQVTLYS  703

Query  2063  SDN----EHSALLHRCLGILLQKVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVA  2230
              D+    ++ A+L + +G L +K   +AYVR ++D++   A  +V  +R GLA   G  A
Sbjct  704   GDSAIMRQYRAMLFKLVGALTEKSTKKAYVRERLDVLLDMAQHSVEEDREGLAAGFGHCA  763

Query  2231  ASHLDTVLDKLKGILDNVGQSILQRIFSFFSDRGKMEESDDTHA-------------ALA  2371
             A+HLD VLDKL+  L N+                    +DD  A              +A
Sbjct  764   AAHLDLVLDKLQDTLQNMILDKKGGSGGGGFFSFFGGSNDDDKATGARAADPELLKCTVA  823

Query  2372  LMYGYAAKYAPPTVIEARIDALVGTNMLSRLLHVRHPRAKQAVITAIDLLGQAVIGASES  2551
             L +G AA +A   +I++R+D  +  ++L      +    K++++ A+DLL +A+      
Sbjct  824   LCFGKAALHADRVLIKSRLDVAIIGHLLPLFPTAKRAVVKESLVQAVDLLARAMHVDHIG  883

Query  2552  GISFPLKRRDLLL  2590
                   KRRDL++
Sbjct  884   PGYLCSKRRDLVV  896


 Score = 53.9 bits (128),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 46/178 (26%), Positives = 82/178 (46%), Gaps = 9/178 (5%)
 Frame = +1

Query  112  VQVMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLT--VSRGGRRRFGNIAGLFQV  285
            V  +V+ L D   + R++   +L DI   +P LVL    +   +  G      IA L  +
Sbjct  30   VSTLVAKLNDRDNAARDSIKRSLMDIGQRHPDLVLSVSASYLTNNSGASTSHRIALLTIM  89

Query  286  ISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLPDLMME  465
             S+     D+  V  +    LA +A +E+ +T E+ ADWQ  A G+LVS+G      +++
Sbjct  90   QSLIESHHDR--VTNSLTHDLASLAFSEMTATDEIKADWQNTACGLLVSLGIFQAPFVLQ  147

Query  466  EIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILG-----NVREIY  624
             +             +++ L D A ++ L   P LK +  ++V +L      N+R ++
Sbjct  148  SLLDRMPHGQLPHYFVIKALGDLAVANPLFMVPHLKEIFGKLVALLNLIKHDNIRWVF  205


 Score = 68.9 bits (167),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 86/308 (28%), Positives = 127/308 (41%), Gaps = 43/308 (14%)
 Frame = +2

Query  4325  LLGQMVEALCRHVSDDSPTVRRLCLRGL---VQMPSIHVLQYTTQILGVILALLDD----  4483
             LLG ++ AL    +D  P+VR L LRGL    +  +  V  Y T +L  +LA LDD    
Sbjct  1549  LLGVLINALLARQADHHPSVRVLVLRGLGNVAECGARSVNTYATTLLSALLAGLDDPVKQ  1608

Query  4484  -------------SDESVQLTAvsclllvlesssTDAVE--PVLLNLSIRLRNLQVCLNA  4618
                           +  + +T  +   L    S  D+    P+L+N+  RLR        
Sbjct  1609  TTSSMSSSEKKEAEEAGLLMTMSAMEGLRQVLSVVDSTYFIPMLVNVCNRLRPFFENPTD  1668

Query  4619  KIRANAFAAFGALSSYGAGSIL--DSFREQIHAAFPRMVLHLHDDDLGVRQACRNTLKCI  4792
              +RA +   FG L  +GA   L    F  QIH     M LHL D+   V  A + TL   
Sbjct  1669  HVRAASIELFGVLGRFGAEDSLCCSIFLAQIHMNMMAMYLHLSDESPEVVAATKRTLVKF  1728

Query  4793  APLIEIDAIPALLNTHRFSS--DHRSDYE--DFLRDLARQLTQYLGPRVDTYLSAIIQAF  4960
             APL     +PA   T  F +  D     +  +F       L ++    +++YL+ I  A 
Sbjct  1729  APL-----LPAAPVTEFFEAALDESKPLQVGEFTHKFTSLLIKHFPTHINSYLNDITNAM  1783

Query  4961  DAPWPVIQANAV----YLCSSMLSLSDN--KNISALYYSQVFGVLVGKASNSTDAIVRAT  5122
              + W   +A+A     YL   + + S +    IS  +       L+   S    A VRA 
Sbjct  1784  RSKWAWQRAHAALFAGYLLGQLATFSADLRAGISVDHVCTALDHLMKDDS----APVRAK  1839

Query  5123  CSAALGLL  5146
             C+ A+ LL
Sbjct  1840  CAEAISLL  1847



>ref|XP_006879292.1| PREDICTED: maestro heat-like repeat-containing protein family 
member 1 [Elephantulus edwardii]
Length=1626

 Score =   230 bits (587),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 199/771 (26%), Positives = 359/771 (47%), Gaps = 83/771 (11%)
 Frame = +2

Query  719   AFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRTQLKAALPRLVPTILELYKREQDAAF  898
             A+++    W  SR+ K+RL+ VEALG M  L+   +L+  LP+LVP +L LYK+  +   
Sbjct  210   AYDVFFNHWLQSREAKLRLAVVEALGPMSHLLPNERLEEQLPKLVPGVLSLYKKHAETLP  269

Query  899   VATCslhsllnasllsnngppllDFEDltvvlstlllvCSNNDKKEHSDFPVGLKTYNEV  1078
             V+              N G  +L+ +   ++ +    +C   +    S  P+ +    EV
Sbjct  270   VSK---SLGQILEAAVNVGSRILEGQLDMLLGALHAQICVPVE----SSSPLVVSNQKEV  322

Query  1079  QHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGSLCVLKHLLPRLAESWHNKRPILIESV  1258
               CF  +    P+ L  FLL K     E    GSL VL+H++   A     ++  ++ S+
Sbjct  323   LRCFTVLACFAPDRLLAFLLPKLDTSNERIRVGSLQVLRHVINSAATQMEVRKLFILSSM  382

Query  1259  KLLIDEHNLGVRKALAELIVVMASHCYLVGSSGELFIEYLVRHCAMPDLENVELESSRES  1438
             +L + + N  V++A+ ++I  MA H YL    G+  +EY+V+ CA+P       E  R  
Sbjct  383   RLPLQDTNNKVKRAMVQVISAMAHHGYLEQPGGQAMVEYIVQQCALPP------EPQRAG  436

Query  1439  SRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKGLLLITVTVPEMEHVLWPFLLKMIIPR  1618
                TG+         +  A +V     R +    L LI+ TV  M  VLWP+LL+ + P 
Sbjct  437   ---TGSE--------DLPADSV-----RAISISTLYLISTTVDRMSDVLWPYLLEFLTPV  480

Query  1619  VYTGAVATVCRCISELC-RRRSSESNAMLSECKARTDIPKPEELFARLVVLLHNPLAREH  1795
              +TGA+  +CR ++ L  +R+ + + A L   +A   +P P  +  R++V+  +P   + 
Sbjct  481   RFTGALGPLCRSLAHLTLKRQEAGAEAFLIPFEASGSLPSPYAITTRILVVSSDPYVGDG  540

Query  1796  LVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKAYVSDTEDLKQDPLYQESWDDMIISF  1975
                  L +L  L       +   W+    +P++  ++   ++  ++ L ++ W++ ++ F
Sbjct  541   RGAASLRLLQVLHHHIHPLLGLRWEKL--VPQLLQHL---DEHSEETLPRKEWEEKLLMF  595

Query  1976  LAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHSALLHRCLGILLQKVHDRAYVRAKID  2155
             L E+L V+ +  W+  LG    RQ   Y   ++    L++C+G  L  +  +  VR  + 
Sbjct  596   LRETLAVVSDNTWICQLGLEMCRQLPSYNGVSQEKNFLYKCIGTTLGAISSKEVVRKHLQ  655

Query  2156  LMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDKLKGILDNVGQSILQR---IFSFFSD  2326
              +   A   V     GLA   G+ A SHLD VL +L+   D V   + ++   I S F D
Sbjct  656   ELLEMARYQVEAEHEGLACCFGICAISHLDDVLAQLE---DFVRSEVFRKSIGILSIFKD  712

Query  2327  RGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALVGTNMLSRL--------LHVRHP  2482
             R +  E +   +AL L YG+ A  AP  ++ AR +A +  NM            +  + P
Sbjct  713   RSE-NEVEKVRSALILCYGHVAAQAPRELVLARAEADILRNMFQYFSTKVLGIKVETKDP  771

Query  2483  RAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRDEEEGFSDSNIELLH  2662
               K  ++ ++ ++ QA+ G++++  +F   R+  L+ +++  + R E         +LL 
Sbjct  772   ALKLCLVQSVCMVSQAICGSAQAS-TFHFSRKAELVAHMMDFI-RAEPP-------DLLR  822

Query  2663  T--QSLALSACTTLVSVEP----KLTTETRNLIMKATIGFFGLPN--DPS-------DVI  2797
             T  +  A+ AC  LVS+EP    K+  +  +  + + +     P+  D S       D I
Sbjct  823   TPLRKKAMMACALLVSLEPPLDEKMQADVAHGCLHSVMALLPEPDREDASDYEVLYLDTI  882

Query  2798  NPLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRG  2950
             + L + L  LLC  +   G         L  ++ ++ P++ S   ++R+R 
Sbjct  883   HALENLLTKLLCRNMTPQG---------LQVMVEHLSPWIKSPRGHERERA  924


 Score = 66.2 bits (160),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 86/182 (47%), Gaps = 13/182 (7%)
 Frame = +1

Query  124  VSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGN------IAGLFQV  285
            + ++ D  P V+E   SAL  +    P ++L  C     G   +  +      +  +  V
Sbjct  1    MDAVTDKDPQVQEQVCSALCTLGEAQPEVMLGTCAEY-LGQHEKLAHPYRALILKAMEAV  59

Query  286  ISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLPDLMME  465
            +S  I +LDK       +M     AT E+   K+L  DWQ+A++ VLV+VG+   + +ME
Sbjct  60   VSTHISSLDKDTARALILM-----ATREMTKAKDLVPDWQQASSSVLVAVGTRFINAVME  114

Query  466  EIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVRE-IYRPIFAN  642
            E+   F         +VQ LA+ A+S+     P L  +L  ++P+L   ++   R +F +
Sbjct  115  ELLNQFQPGLLPHHFVVQTLANLATSNVFGMVPFLPSILGTMLPMLPMAKQDALRVVFCS  174

Query  643  GL  648
             L
Sbjct  175  AL  176


 Score = 71.6 bits (174),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 81/310 (26%), Positives = 133/310 (43%), Gaps = 19/310 (6%)
 Frame = +2

Query  4094  DLEMGKILARGGEQNENEKWINLIGELAGSISIKRPKEVPTICLFLSKSLDRPLRVQREA  4273
             +L+ G  L R  E +E       +  LA +++      +P +   L  +     + Q+  
Sbjct  1272  ELQGGWELLRTSEGHEEG-----VTHLARAMAKHAGPRLPLVMKALLSTQSSVYKTQKVT  1326

Query  4274  AAAALSEFLRYSDGFGPL--LGQMVEALCRHVSDDSPTVRRLCLRGLVQMPS---IHVLQ  4438
             + A L+E L  S+    L  L  +++ L     D  P+VRRL LRGL  + S     V  
Sbjct  1327  STAFLAELLS-SNAVNDLMLLESLLDNLAARQKDTCPSVRRLVLRGLANLASGSPDKVPA  1385

Query  4439  YTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEP-----VLLNLSIRLRNLQ  4603
             +  Q+L V++  LDD+D+   L A+  ++ +      D VEP     VLL+++IR R   
Sbjct  1386  HGPQLLAVLIGGLDDTDDPHSLVALEAMVGLARI--VDLVEPWDLRTVLLHVAIRSRPFF  1443

Query  4604  VCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACRNTL  4783
                  + R  +   FG L+    G   D F EQ  +A   ++LHL D    V +ACR  L
Sbjct  1444  DSEKMEFRQASIHLFGHLNKVCQGDCEDVFLEQTVSALVPLLLHLRDPQPTVVEACRFAL  1503

Query  4784  KCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSAIIQAFD  4963
                 P +  + +   +  H         + +FL    + L  +    +   LS  +  F 
Sbjct  1504  CMCGPNLGCEELTITVQKH-LQEGRGLHFGEFLNITCKHLMHHFPDLLGRLLSTNLFYFK  1562

Query  4964  APWPVIQANA  4993
             + W  I+A A
Sbjct  1563  SGWEDIRAAA  1572



>ref|XP_008251762.1| PREDICTED: maestro heat-like repeat-containing protein family 
member 1 [Oryctolagus cuniculus]
Length=1695

 Score =   226 bits (577),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 196/792 (25%), Positives = 353/792 (45%), Gaps = 90/792 (11%)
 Frame = +2

Query  680   TILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRTQLKAALPRLVPT  859
             T+      + L+SA+++L   W  SR+ K+RL+ VEALG M  L+   +L+  LP+L+P 
Sbjct  210   TVRKDTFAADLSSAYDILFHHWLQSREAKLRLAVVEALGPMSHLLPGDKLEEQLPKLLPG  269

Query  860   ILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstlllvCSNNDKKEH  1039
             +L LYK+  +A  V+              + G   L+ +  T++ +    +C   +    
Sbjct  270   VLALYKKHAEAFHVSK---SLGQILEAAVSVGSRTLEVQLDTLLATLHAQICVPVE----  322

Query  1040  SDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGSLCVLKHLLPRLAE  1219
             S  P+      EV  CF  +    P+ L  FLL K     E    GSL +L+H++   A 
Sbjct  323   SSSPLVQSNQKEVLRCFTVLACCSPDRLLAFLLPKLDTNNERLRVGSLQILRHVINSAAA  382

Query  1220  SWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGELFIEYLVRHCAMP  1399
                  +P ++ S++L + + N  V++A+ ++I  MA H YL    GE  IEY+V+ CA+P
Sbjct  383   QMEANKPFILSSMRLPLLDTNNKVKRAVVQVISAMAHHGYLEQPGGEAMIEYIVQQCALP  442

Query  1400  DLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKGLLLITVTVPEMEH  1579
                                      ++L+  +       +R V  + L L++ TV  M  
Sbjct  443   P-----------------------EQELDPGSADAPADSVRAVSVRTLYLVSTTVDRMSD  479

Query  1580  VLWPFLLKMIIPRVYTGAVATVCRCISELC-RRRSSESNAMLSECKARTDIPKPEELFAR  1756
             VLWP LL+ + P  +TGA+  +CR +  L  +R+ + ++A L +  A  ++P P  +  R
Sbjct  480   VLWPHLLQFLTPVRFTGALTPLCRSLVHLALKRQEAGADAFLIQFDAHVNLPSPYAITTR  539

Query  1757  LVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKAYVSDTEDLKQDP  1936
             L+ +  NP   +      L +L  L P     +  +W+    +P +  ++   ++  ++ 
Sbjct  540   LLAVSCNPYLGDGRGVASLRLLHVLHPNIHPLLGQYWESA--VPLLLKHL---DEHTEET  594

Query  1937  LYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHSALLHRCLGILLQ  2116
             L  + W+  ++ FL ++L V+ +  W+  L     +Q   Y         L++C+G  L+
Sbjct  595   LSPKEWEARLLMFLQDTLAVVSDNTWICQLSLEMCKQLPCYNGAPREKNFLYKCIGATLR  654

Query  2117  KVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDKLKGIL--DNVGQ  2290
                 R  VR  +  +   A         GLA   G+ A SHL+  L +L+  +  D   +
Sbjct  655   AASSREVVRKHLRELLETARYQEEAEHEGLACCFGICADSHLEDTLAQLEDFVRSDMSRK  714

Query  2291  SILQRIFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALVGTNML----S  2458
             SI   IF+ F DR +  E+D   +AL L YG+ A  AP  ++ A++++ +  NM     +
Sbjct  715   SI--GIFNIFKDRSE-SEADRVRSALVLCYGHVASQAPRELLLAKVESDILRNMFQVFST  771

Query  2459  RLLHV----RHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRDEE  2626
             ++L +    + P  KQ ++  + ++ QA I  + +G   P   R    D + T +     
Sbjct  772   KVLGIKIESKDPTLKQCLVQGLCMVSQA-IHTTRAGRQLPEFIRAEPPDSLRTPI-----  825

Query  2627  EGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETRNLIMKATI-GFFGLPNDPS-----  2788
                          ++ A+  C  LVS+EP L  + +  ++   +     LP +P      
Sbjct  826   -------------RNTAMLTCACLVSLEPALEEQAQADVVHGCLHSVMALPPEPQEEGAD  872

Query  2789  -------DVINPLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKR  2947
                    D +  L + L +LL   +   G         L  ++ ++ P++ S   ++R R
Sbjct  873   CQELLYLDTMRALENLLTSLLRRNMTPQG---------LQVMVEHLSPWIKSPRAHERAR  923

Query  2948  GCLAAHELLIKF  2983
                 +  LL  F
Sbjct  924   ALTLSASLLRYF  935


 Score = 70.1 bits (170),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 88/172 (51%), Gaps = 12/172 (7%)
 Frame = +1

Query  121  MVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGN------IAGLFQ  282
            ++ ++ D  P+V+E    AL  +  + P  +L  C    R  R +  +      +  +  
Sbjct  13   LLEAVTDKDPAVQEQVCRALCSLGEVRPGEMLRACEEFLRH-RDKLAHPYRAMVLRAMET  71

Query  283  VISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLPDLMM  462
            V+S     LDK D   A ++    +A++E+  TKEL ++WQ+AA+ VLV+VG H  + +M
Sbjct  72   VLSSHTCRLDK-DTASAVLL----LASSEMTKTKELFSEWQQAASSVLVAVGKHCINPVM  126

Query  463  EEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVRE  618
            EE+   F       P ++Q LA  A S+     P L  VL+ ++P+LG  R+
Sbjct  127  EELLSQFQPGVLPHPLVLQTLAGLAVSNVFGTVPFLPSVLSTMLPMLGMARQ  178


 Score = 58.2 bits (139),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 64/233 (27%), Positives = 101/233 (43%), Gaps = 15/233 (6%)
 Frame = +2

Query  4325  LLGQMVEALCRHVSDDSPTVRRLCLRGLVQMPS---IHVLQYTTQILGVILALLDDSDES  4495
             LL  ++++L     D    VRRL LRG+  + S     V  +  Q+L  ++  LDD D +
Sbjct  1414  LLESLLDSLAARQQDPCAGVRRLVLRGMSNVASGSPDKVRAHGPQLLTAMVGGLDDGDHA  1473

Query  4496  ---VQLTAvsclllvlesssTDAVEPVLLNLSIRLRNLQVCLNAKIRANAFAAFGALSSY  4666
                V L A++ L  ++E      +  VLL+++IR R        + R  +   FG L+  
Sbjct  1474  HSPVALEAMAGLARLVELVEARELRAVLLHVAIRTRPFFDSDKTEFRTASIRLFGHLNKA  1533

Query  4667  GAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACRNTLKCIAPLIEIDAIPALLNTHRF  4846
               G+  D F +Q+      ++LHL D    V  ACR  L+  A  +E + +  +   H  
Sbjct  1534  CHGACEDVFLDQVVGGLAPLLLHLQDPQAPVAGACRFALRMCARNLECEELENVFRQH-L  1592

Query  4847  SSDHRSDYEDFL----RDLARQLTQYLGPRVDTYLSAIIQAFDAPWPVIQANA  4993
                    + +FL    R L R     LG  V T L      F + W  ++A A
Sbjct  1593  QEGRGLHFGEFLNAACRPLMRGFPDLLGRLVSTSLF----YFKSSWEGVRAAA  1641



>ref|XP_008359624.1| PREDICTED: protein SHOOT GRAVITROPISM 6-like [Malus domestica]
Length=206

 Score =   246 bits (627),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 119/191 (62%), Positives = 150/191 (79%), Gaps = 0/191 (0%)
 Frame = +2

Query  4622  IRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACRNTLKCIAPL  4801
             +RANAFAAFGALS+YG G   ++F EQ+H   PR+VLHLHDDD+ VRQACR TLK IAPL
Sbjct  1     MRANAFAAFGALSNYGIGPQHEAFLEQVHTVIPRLVLHLHDDDVSVRQACRTTLKQIAPL  60

Query  4802  IEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSAIIQAFDAPWPVI  4981
             +E+D +  L N H F+ DHR+DYE F+RDL +Q  Q+   R+DTY+++ IQAFDAPWP+I
Sbjct  61    LEMDGLLPLFNMHSFNHDHRTDYEGFVRDLTKQFVQHHPSRLDTYMASTIQAFDAPWPII  120

Query  4982  QANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATCSAALGLLLKSPN  5161
             QANA+Y  S MLSLSD+++I   YY+QVFG LVGK S S DA+VRATCS+ALG LLK   
Sbjct  121   QANAIYFSSCMLSLSDDQHILNQYYAQVFGTLVGKMSKSADAVVRATCSSALGXLLKFSK  180

Query  5162  SSSWRDARLNK  5194
             SSSW+ AR+++
Sbjct  181   SSSWKSARVDR  191



>ref|XP_005959762.1| PREDICTED: maestro heat-like repeat-containing protein family 
member 1-like isoform X2 [Pantholops hodgsonii]
Length=1642

 Score =   234 bits (596),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 197/783 (25%), Positives = 356/783 (45%), Gaps = 78/783 (10%)
 Frame = +2

Query  680   TILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRTQLKAALPRLVPT  859
             T+      S ++ A+++L   W  SR+ K+RL+ VEALG M  L+   +L+  LP+L+P 
Sbjct  210   TVRKDAFASDISGAYDILFHQWLQSREAKLRLAVVEALGPMSHLLPSEKLEEQLPKLLPG  269

Query  860   ILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstlllvCSNNDKKEH  1039
             +L LYK+  +   V+              + G   LD +  +++ +    +C   +    
Sbjct  270   VLALYKKHAETVHVSK---SLGQILEAAVSVGSRTLDVQLDSLLAALHTQICVPVE----  322

Query  1040  SDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGSLCVLKHLLPRLAE  1219
             S  P+ +    EV  CF  +    P+ L  FLL K     E    G+L VL+H++   A 
Sbjct  323   SSSPLVMSNQKEVLRCFTVLACYSPDRLLAFLLPKLDTSNERTRVGTLQVLRHVINAAAA  382

Query  1220  SWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGELFIEYLVRHCAMP  1399
                 K+P ++ S+KL + + N  V++A+ +++  MA H YL    G+  +EY+V+ CA+P
Sbjct  383   QMEVKKPFILSSMKLPLLDTNNKVKRAVVQVVSAMAHHGYLEQPGGKAMVEYIVQQCALP  442

Query  1400  DLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKGLLLITVTVPEMEH  1579
                  E E+ + ++                 + A+    ++ +    L L++ TV  M  
Sbjct  443   P----EAETQKPAA----------------DSEALAADSVQAISVSTLYLVSTTVDRMGE  482

Query  1580  VLWPFLLKMIIPRVYTGAVATVCRCISELCRRRS-SESNAMLSECKARTDIPKPEELFAR  1756
             VLWP+LL+ ++P  +TGA++ +CR +  L ++R  + ++A L +      +P P  +  R
Sbjct  483   VLWPYLLEFLVPIRFTGALSPLCRSLVHLAQKRQEAGAHAPLIQYSGNVHLPSPYAITTR  542

Query  1757  LVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKAYVSDTEDLKQDP  1936
             L+V+  NP   +      L +L  L       +   W     IP +  ++   ++  ++ 
Sbjct  543   LLVVSSNPYVGDGRGAASLRLLSVLHQDIHPALGQRWATA--IPLLLEHL---DEYSEET  597

Query  1937  LYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHSALLHRCLGILLQ  2116
             L Q+ W++ ++ FL +SL V+ +  WV  L     +Q   Y         L++C+G  L 
Sbjct  598   LPQKEWEEKLLMFLRDSLAVVSDNTWVCQLTLEMCKQLPNYNGMPLEKNFLYKCVGTTLG  657

Query  2117  KVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDKLKGILDNVGQSI  2296
                 +  VR  +  +   A       R GLA   GL A SHLD  L +L+   D V   +
Sbjct  658   SASSKEVVRKHLQELLETARYQEEREREGLACCFGLCAISHLDDTLAQLE---DFVKSDV  714

Query  2297  LQR---IFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALVGTNM-----  2452
             L++   IF+ F DR +  E+D   +AL L YG+ A  AP  ++ AR++A V  NM     
Sbjct  715   LRKSAGIFNIFKDRSE-SEADKVRSALILCYGHVAARAPRELLLARVEADVFRNMSQCFS  773

Query  2453  ---LSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRDE  2623
                L   +  + P  + +++ ++ +  QA+  ++  G SF L R+  L+  ++  +  + 
Sbjct  774   TKVLGIKVETKDPALRLSLVQSVCMATQAICSSAHGG-SFHLSRKAELVVQMVEFIKAEP  832

Query  2624  EEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETR-NLIMKATIGFFGLPNDPS----  2788
              +            +  A+ AC  LV++EP L  + + +LI         +  +P     
Sbjct  833   PDSLRTP------IRKKAMLACMYLVTLEPALEEQVQADLIHSCLHSVMAVLPEPEEGDS  886

Query  2789  ---------DVINPLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQR  2941
                      D +  L D L +LL   +   G         L  ++ ++ P++ S   ++R
Sbjct  887   LQELSSLYLDTMQALKDLLTSLLQQNMTPQG---------LQVMVEHLSPWIKSPKGHER  937

Query  2942  KRG  2950
              R 
Sbjct  938   VRA  940


 Score = 61.6 bits (148),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 48/172 (28%), Positives = 82/172 (48%), Gaps = 10/172 (6%)
 Frame = +1

Query  118  VMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRR-----RFGNIAGLFQ  282
            +++ ++ D  P V+E    AL  +    P+ VL  C    R   +     R   +  +  
Sbjct  12   ILLDAITDKDPRVQEQVCGALCALGESQPVEVLSACEEHLRLREKLAHPYRTMILRAIEI  71

Query  283  VISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLPDLMM  462
            V+S  I  LDK D+  A ++    +A+ E+   KEL +DWQ+AA+ VLV+VG      +M
Sbjct  72   VVSNHIGELDK-DMARAIIL----LASNEMTKVKELVSDWQQAASSVLVAVGRRFISSVM  126

Query  463  EEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVRE  618
            EE+   F       P  +  LA  + ++     P L  +L+ ++P+LG  + 
Sbjct  127  EELLSKFQPGLLPHPCTMHTLASLSVANVFGMVPFLTSILSTMLPMLGAAKH  178


 Score = 63.5 bits (153),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 73/259 (28%), Positives = 112/259 (43%), Gaps = 19/259 (7%)
 Frame = +2

Query  4259  VQREAAAAALSEFLR---YSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQMP---  4420
             VQR  + A L+E L     +D    LL  +++ L     D S  VRRL LRGL  +    
Sbjct  1341  VQRITSTAFLAELLSSNVVNDLM--LLESLLDNLMARQKDTSARVRRLVLRGLANVALGS  1398

Query  4421  SIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvless-sTDA--VEPVLLNLSIRL  4591
                V  +  Q+L  ++  LDD D+   L A+  ++ +       DA  +  VLL++++R+
Sbjct  1399  PDKVRTHGPQLLTAMIGGLDDGDDPHSLVALEAMVGLARLMDLVDAWDLRAVLLHIAVRI  1458

Query  4592  RNLQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQAC  4771
             R        + R+ +   FG L+    G   D F EQ+      ++LHL D    V  AC
Sbjct  1459  RPFFDSERMEFRSASIRLFGHLNKACRGDCEDVFLEQVVGGLAPLLLHLRDPQAPVVAAC  1518

Query  4772  RNTLKCIAPLIEIDAIPALLNTH--RFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSA  4945
             R  L+   P +E + + A+   H     S H  D    L+   R     LG      LS 
Sbjct  1519  RFALRMCGPNLECEELAAVFQKHLQEGRSLHFGDLTASLQ--MRHFPDLLG----RLLST  1572

Query  4946  IIQAFDAPWPVIQANAVYL  5002
              +  F + W  ++A A  L
Sbjct  1573  SLFYFKSSWEDVRAAAPML  1591



>ref|XP_004580940.1| PREDICTED: uncharacterized protein LOC101525017 [Ochotona princeps]
Length=3408

 Score =   233 bits (595),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 195/757 (26%), Positives = 350/757 (46%), Gaps = 72/757 (10%)
 Frame = +2

Query  596   PFLGM*EKYTGQSLQMACWQYSVDFSLSTILDTD-----------VVSFLNSAFELLLRV  742
             P LGM +  T +++     Q+  + +L  + + D             + L SA+++L   
Sbjct  1946  PMLGMAKHDTMRAVLCCALQHFSESALEYLANLDQAPDPTVRKDTFAADLASAYDVLFHH  2005

Query  743   WAMSRDLKVRLSAVEALGQMVGLITRTQLKAALPRLVPTILELYKREQDAAFVATCslhs  922
             W  SR+ K+RL+ VEALG M  L+   +L+  LP+L+P +L LYK+  +A  V+      
Sbjct  2006  WLQSREAKLRLAVVEALGPMSHLLPGEKLEEQLPKLLPAVLGLYKKHAEAFHVSK---SL  2062

Query  923   llnasllsnngppllDFEDltvvlstlllvCSNNDKKEHSDFPVGLKTYNEVQHCFLTVG  1102
                     + G   L+ +  T++ +  + +C   +    S  P+      EV  CF  + 
Sbjct  2063  GQILQAAVSVGSRTLEAQLDTLLAALHMQICVPVE----SSSPMVQSNQKEVLRCFTVLA  2118

Query  1103  SVYPEDLFVFLLNKCRLKEEPFTFGSLCVLKHLLPRLAESWHNKRPILIESVKLLIDEHN  1282
                P+ L  FLL K     E    GSL +L+H++   A     K+P ++ S++L + + N
Sbjct  2119  CCLPDRLLAFLLPKLDSSNERLRVGSLQILRHVINTAAAQMEVKKPFILSSMRLPLLDTN  2178

Query  1283  LGVRKALAELIVVMASHCYLVGSSGELFIEYLVRHCAMPDLENVELESSRESSRFTGNYY  1462
               V++A+ ++I  MA H YL    GE  +EYLV+ CA+P  +  EL+   E         
Sbjct  2179  SKVKRAVVQVISAMAHHGYLEQPGGEAMVEYLVQQCALPPEQ--ELDPDPED--------  2228

Query  1463  PFVYRKLEFKAGAVTTTELRGVCEKGLLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVAT  1642
                          V    +R V  + L L++ TV  M  VLWP LL+ + P  +TGA+  
Sbjct  2229  -------------VPADSVRAVSVRTLYLVSTTVDRMSDVLWPHLLEFLTPVRFTGALTP  2275

Query  1643  VCRCISELC-RRRSSESNAMLSECKARTDIPKPEELFARLVVLLHNPLAREHLVTQILSV  1819
             +CR +  L  +R+ + ++A L +  A  ++P P  +  RL+V+  NP   +   T  L +
Sbjct  2276  LCRSLLHLALKRQEAGADAFLIQFDAHGNLPSPYAVTTRLLVVSANPYLGDGRGTASLRL  2335

Query  1820  LWYLAPLFPKNINSFWQDEL*IPKMKAYVSDTEDLKQDPLYQESWDDMIISFLAESLDVI  1999
             L  L P     +  +W     +P +  ++   ++  ++ L Q+ W+  ++ FL ++L  +
Sbjct  2336  LHVLHPNIHPLLGQYWDSA--VPLLLKHL---DEHTEETLSQKEWEARLLLFLQDTLAAV  2390

Query  2000  QNVDWVLLLGNTFARQYELYKSDNEHSALLHRCLGILLQKVHDRAYVRAKIDLMYRQANI  2179
              +  WV  L     +Q   Y         L++C+G  L+    +  VR  +  +   A  
Sbjct  2391  SDNTWVCQLSLEMCKQLAYYDGAPREKNFLYKCVGATLRAASSKEVVRKHLRELLENARY  2450

Query  2180  AVPTNRLGLAKAMGLVAASHLDTVLDKLKGILDNVGQSILQR----IFSFFSDRGKMEES  2347
                  R GLA   GL A SHL+  L +    L++  +S + R    I + F DR +  E+
Sbjct  2451  QEEAEREGLACCFGLCAVSHLEDTLAQ----LEDFSRSDVSRRSIGILNMFKDRSE-NEA  2505

Query  2348  DDTHAALALMYGYAAKYAPPTVIEARIDALVGTNML----SRLLHV----RHPRAKQAVI  2503
             D    AL L YG+ A  AP  ++ A++++ +  NM     +++L +    + P  KQ ++
Sbjct  2506  DRVRCALVLCYGHVASQAPRELLLAKVESDILRNMFQAFSTKVLGIKVDSKDPALKQCLV  2565

Query  2504  TAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRDEEEGFSDSNIELLHTQSLALS  2683
              ++ ++ QAV   +++G SF   R+  L+  ++  +  +  +            +  A+ 
Sbjct  2566  QSLYMVCQAVHSGAQAG-SFQFCRKAELVAQLMEFVRAEPPDSLRTP------IRKTAML  2618

Query  2684  ACTTLVSVEPKLTTETRNLIMKATI-GFFGLPNDPSD  2791
              C  LVS+EP L  + +  + +  +     LP +P +
Sbjct  2619  TCACLVSLEPALEEQAQADMARGCLHSIMALPPEPQE  2655


 Score = 61.6 bits (148),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 81/171 (47%), Gaps = 10/171 (6%)
 Frame = +1

Query  121   MVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRR-----RFGNIAGLFQV  285
             ++ +++D  P V+E    AL  +    P+ +L  C    R   +     R   +  +  V
Sbjct  1788  LLEAISDKDPVVQEQVCGALCSLGQERPVEMLQACEEFLRQQDKLAPPYRAMVLRAMGTV  1847

Query  286   ISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLPDLMME  465
             ++     LD+       ++     A++E+  TKEL  DWQ AA+ VLV+VG H+ + +ME
Sbjct  1848  LNSHTCKLDEATASTVLLL-----ASSEMTRTKELVGDWQPAASSVLVAVGKHVINPVME  1902

Query  466   EIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVRE  618
             E+           P ++Q LA  + S+     P L  +L+ ++P+LG  + 
Sbjct  1903  EVLSKLQPGLLPHPLVLQTLAGLSVSNVFGTVPFLPSILSTMLPMLGMAKH  1953


 Score = 65.1 bits (157),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 77/305 (25%), Positives = 125/305 (41%), Gaps = 8/305 (3%)
 Frame = +2

Query  4253  LRVQREAAAAALSEFL--RYSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQMPS-  4423
             L VQR    A L+E L    +D    LL  ++++L     D    VRRL LRGL  + S 
Sbjct  3105  LEVQRVTCTAFLAELLSSNVADDLT-LLESLLDSLVAWQQDPCVGVRRLVLRGLSNVASG  3163

Query  4424  --IHVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPVLLNLSIRLRN  4597
                 V  +   +L  +++ LDD D      A+  +  +        +  VLL+++IR+R 
Sbjct  3164  CPAKVQAHGPLLLTAMVSGLDDGDHPHSPVALEAMAGLARLVDLVELRSVLLHVAIRIRP  3223

Query  4598  LQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQACRN  4777
                    + R  +   FG LS    G+  D F EQ+      ++LHL D    V  ACR 
Sbjct  3224  FFDSEQVEFRTASIRLFGHLSKACHGACKDVFLEQVVGGLAPLLLHLQDPQPPVVGACRF  3283

Query  4778  TLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLSAIIQA  4957
              L+   P ++ + + A+   H         + +FL    R L +     +   +S  +  
Sbjct  3284  ALRMCVPNLDCEQLEAVFLQH-LQEGRSLHFGEFLNATCRLLMRGFPDLLGRLVSTSLFY  3342

Query  4958  FDAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTDAIVRATCSAAL  5137
             F + W  ++A A  L +  L L  ++        +     +          VRAT +  L
Sbjct  3343  FKSSWEGVRA-AAPLFTGFLVLHADREFLPQVDLEQLLAGLQLLLADPAPCVRATAAETL  3401

Query  5138  GLLLK  5152
             G L+K
Sbjct  3402  GRLVK  3406



>dbj|GAM26848.1| hypothetical protein SAMD00019534_100230 [Acytostelium subglobosum 
LB1]
Length=1587

 Score =   264 bits (675),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 245/982 (25%), Positives = 441/982 (45%), Gaps = 94/982 (10%)
 Frame = +2

Query  719   AFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRTQLKAALPRLVPTILELYKREQDAAF  898
             A EL+   W  S   KVRL  ++++G +  ++   QL A   R++  +L ++K+E+D   
Sbjct  180   ALELMFSKWLSSSQDKVRLVTIQSIGSICSILAVEQLDAQANRIITGLLPMFKKEKDV--  237

Query  899   VATCslhsllnasllsnngppllDFEDltvvlstlllvCSNNDKKEHSDFPVGLKTYNEV  1078
             +  C   + +    + N+    ++    +++++   LVC   D       P   K +NEV
Sbjct  238   LPVCQALAHILEVCVKNDLKVQIELLLPSIMMTLHPLVCIIPDFNN----PASSKLFNEV  293

Query  1079  QHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGSLCVLKHLLPRL-AESWHNKRPILIES  1255
              HCF  +G  +P+ L  FL  +  +K+     GSL ++KH + RL AE    ++ +++ +
Sbjct  294   LHCFEIIGRGFPDQLVSFLSQRLEIKDPRSRAGSLSIIKHAISRLDAELGEERKMMILSA  353

Query  1256  VKLLI-DEHNLGVRKALAELIVVMASHCYLVGSSGELFIEYLVRHCAMPDLENVELESSR  1432
             +K LI  E +L V+K LA+++V MAS+ Y+    G   +E++++  +      V+ E  +
Sbjct  354   IKPLIGTETSLFVKKYLAQVVVSMASNGYIHLEGGLCLVEFVIKGSSY----FVDTEIGK  409

Query  1433  ESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKGLLLITVTVPEMEHVLWPFLLKMII  1612
              +        P   +K       VT  E R +C+  L LIT TVP ME VLWP+L + I 
Sbjct  410   PAP-------PQDKKKEPVNEMTVTEYEFRKICDDILNLITTTVPNMETVLWPYLFEFIT  462

Query  1613  PRVYTGAVATVCRCISELC-RRRSSESNAMLSECKARTDIPKPEELFARLVVLLHNPLAR  1789
             P  Y+GA A + +C+  L   RR  E++    +     ++PKP ++ AR  VLL  P  R
Sbjct  463   PIEYSGACAILAKCVGFLAWNRREQEADDYYIDFDKEVNLPKPTQIIARYFVLLTAPHRR  522

Query  1790  EHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKAYVSDTEDLKQDPLYQESWDDMII  1969
                 T+IL  +  + P+   +I   W   L  PK+  ++ D  D +Q    +  W+++++
Sbjct  523   NEQGTRILEAMRAIGPILHPSICDMWDVTL--PKLAQFLVDHPDNEQ--FNKNQWEELVL  578

Query  1970  SFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHSALLHRCLGILLQKVHDRAYVRAK  2149
               L+E++    + +W + LG   + Q + YK D      L++ LG+++QK   + +V+ K
Sbjct  579   RLLSETIKNAADDEWTVALGTCTSDQIDHYKRDPILKRSLYKQLGLVMQKCSHKEFVKTK  638

Query  2150  IDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDKLKGILDNVGQSILQRIFSFFSDR  2329
             I+ M+   +        G A  +G  AASH D +L+K+   + N     + +   FF   
Sbjct  639   IEAMFNSVDYTSALENEGCAVGLGYCAASHFDILLEKIGLFIKNN----MAKKTGFFKKS  694

Query  2330  GKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALVGTNMLSRLLHVRHPRAKQAVITA  2509
             G           + L   YAA Y+ P ++  R++  + T +   +  ++ P  K + I  
Sbjct  695   G----PKGIKNCVLLSLAYAATYSQPVLLSTRVEVHMLTPIRPSISILKKPLKKLSAIKM  750

Query  2510  IDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRDEEEGFSDSNIELLHTQSLALSAC  2689
             ID +G+A+    +   +F  K+RD L   ++  M            IE        +SAC
Sbjct  751   IDCIGRAL--HHDKVPNFVFKQRDELFKLLVQYMATPPPSVNYQVKIE-------GISAC  801

Query  2690  TTLVSVEPKLTTETRNLIMKATIGFFG-----LPNDPSDVINPLIDNLITLLCTILVTSG  2854
             +TL  ++P L  +    I+   + F+G      P D S  +N ++  + T   TIL T  
Sbjct  802   STLAKLQPTLPLDLEGQIVTLLLQFYGAQAASAPADDSADVNNMVSQINTFFSTILYT--  859

Query  2855  EDGRSRAEQLLHILRNIDPFVSSSLEYQRKR--GCLAAHELLIKFRAICVNGYCALGCQG  3028
                ++    L  +++ +DP   +   + R+R  GC+    L+ KF     +         
Sbjct  860   ---QTSIVCLNRLVQYLDPLTRAKEAHLRERSIGCILY--LVKKFIEYSTDA-------E  907

Query  3029  SCSHSKQIDHAANRNLSNLPSAFFLPSRDALSLGERIMVYLPRCIDTNYEVRKVSVQILN  3208
                  K+ +H                      +G  + V +PRC D    VRK +V+ + 
Sbjct  908   QIPAEKKFEH----------------------IGTSLSVIIPRCADPEPTVRKNAVETIQ  945

Query  3209  LFFNISFSLPKPINSSLGIDIELSYIALSSLEDVVAILRSDASIDPSEVFNRV--VSSVC  3382
             L   I + L      +  +        + ++  +  I  S  + D +E F  V  +S + 
Sbjct  946   LMLYIDYMLKNVSYENRRVK------PVDTIHPLTQIKESITTTDVNEQFTLVFEISGII  999

Query  3383  T-LLNKDELVAALHGCSGAICDKIKQSAEGAIQAVVEFVTNRGNELNEIEVSRTSQSLLT  3559
             + +L  +E+   L      + D    S  G    +   + NRG EL +  V    + LL+
Sbjct  1000  SKMLVIEEIPTFLESSLKGLQDVHTFSTNGTCIMINGLIKNRGGELLDY-VPMLVKGLLS  1058

Query  3560  AVVHVTEKYLRQETLGAICSVA  3625
             ++  +T       TL ++ S+A
Sbjct  1059  SMEGITSDTTMNGTLVSLRSLA  1080


 Score = 30.4 bits (67),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 13/43 (30%), Positives = 29/43 (67%), Gaps = 1/43 (2%)
 Frame = +1

Query  523  LADYASSDALQFTPRLKGVLARVVPILGNVR-EIYRPIFANGL  648
            + D+  S+ +   PR++ VL+RV+P+L +++ +  + +FA+ L
Sbjct  104  IGDFIGSNPVPTVPRIRDVLSRVLPVLASIKHDNIKWVFASAL  146


 Score =   120 bits (302),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 98/374 (26%), Positives = 177/374 (47%), Gaps = 10/374 (3%)
 Frame = +2

Query  4043  PLRALLNAFQAFCECVGDLEMGKILARGGEQN--ENEKWINLIGELAGSISIKRPKEVPT  4216
             P + ++ +F+ F +C  DLE+ + L   G     E   +   I E+    +   P  +  
Sbjct  1215  PSQQMVTSFKQFFKCTKDLEILEALETKGSMTSLEGPTYHIAIQEITAQFAQAHPDLLRG  1274

Query  4217  ICLFLSKSLDRPLRVQREAAAAALSEFLRYSDGFGPLLGQMVEALCRHVSDDSPTVRRLC  4396
             +  +L          QR  A +  SE + +      LL +++  L   + +  P ++ + 
Sbjct  1275  VFDYLIPYQRANYVPQRIIALSVFSEMINHCKD-KELLQRLINTLLNSLVE--PALKLIS  1331

Query  4397  LRGLVQMPSI---HVLQYTTQILGVILALLDDSDESVQLTAvsclllvlesssTDAVEPV  4567
             L+GL  + S       +Y   ++  I + +DD+DE + + A+  L  +        V P+
Sbjct  1332  LKGLSNVVSAGEEATNRYAPTVIDAISSAIDDADEVMAMEAMLGLSRIFALVDEARVAPI  1391

Query  4568  LLNLSIRLRNLQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDD  4747
             L+N+  R++      N +IRA AF  FG+L  +G+G   DSF EQIH   P +V+HL+D+
Sbjct  1392  LVNICNRIKPAFEKPNNEIRAAAFTLFGSLWRFGSGMASDSFYEQIHYNLPSIVMHLNDE  1451

Query  4748  DLGVRQACRNTLKCIAPLIEIDAIPALLNTHRF-SSDHRSDYEDFLRDLARQLTQYLGPR  4924
                VR AC+ TL+ ++ L+  +    L N   F ++D   DY+ FL DL++        R
Sbjct  1452  APVVRAACKTTLRQLSQLLRTEDAVLLFNRKCFDANDATLDYDVFLDDLSKLFIAMYMDR  1511

Query  4925  VDTYLSAIIQAFDAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGKASNSTD  5104
             ++ ++  +I+ F + W  +++NA  L   +L     +  +A+  S +   +V    N   
Sbjct  1512  INFFVMTVIEYFKSNWTQLRSNAATLTGFILGNMPEEKKTAVNPSIITKAVVS-LLNEKS  1570

Query  5105  AIVRATCSAALGLL  5146
              +VR   + AL LL
Sbjct  1571  PLVRKRAADALSLL  1584



>ref|XP_009270559.1| PREDICTED: maestro heat-like repeat-containing protein family 
member 1 isoform X2 [Aptenodytes forsteri]
Length=1638

 Score =   236 bits (603),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 198/777 (25%), Positives = 344/777 (44%), Gaps = 77/777 (10%)
 Frame = +2

Query  716   SAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRTQLKAALPRLVPTILELYKREQDAA  895
             SA+E+L   W   R+ K+RL+ VEA+G M  L+   +L+  LP+L+P IL LYK+  +A 
Sbjct  222   SAYEVLFNSWLQHREAKLRLAVVEAMGPMSYLMPSEKLEEQLPKLIPGILALYKKHTEAF  281

Query  896   FVATCslhsllnasllsnngppllDFEDltvvlstlllvCSNNDKKEHSDFPVGLKTYNE  1075
             +++              N G   LD +  +++ +    +C+  D       P+ +K + E
Sbjct  282   YISK---SLCQILEASVNIGSRSLDVQLDSLLGTLHPQICAPAD----PSVPLTVKNHTE  334

Query  1076  VQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGSLCVLKHLLPRLAESWHNKRPILIES  1255
             V  CF  +   +P+ +  FLL K     E    G+L +++ ++         K+P ++ S
Sbjct  335   VLRCFTVLACSFPDRVLAFLLPKLESSNERTRVGTLLIMRQIINSAPSQMEIKKPFILSS  394

Query  1256  VKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGELFIEYLVRHCAMPDLENVELESSRE  1435
             +KL + + N  V++A+ ++I  MA H YL    GE  +E+LVR CA+P            
Sbjct  395   MKLPLQDSNNKVKRAVVQVISAMAHHGYLEQPGGEAMMEFLVRQCALP------------  442

Query  1436  SSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKGLLLITVTVPEMEHVLWPFLLKMIIP  1615
                   +  P   +K    A  +T+  ++ +    L L++ TV  M +VLWP+LL+ + P
Sbjct  443   -----SDAQP---KKQPPDADDLTSDSVQSISVNTLFLLSTTVDRMNNVLWPYLLEFVTP  494

Query  1616  RVYTGAVATVCRCISELCRRRSSES-NAMLSECKARTDIPKPEELFARLVVLLHNPLARE  1792
               +T A+  +C+ +  L  ++  E  NA L       ++P P  L  RL+V+   P   +
Sbjct  495   IQFTNALTPLCKSLMYLAMKKQEEGENASLIRYDLNANLPSPYALTTRLLVVSSQPYVGD  554

Query  1793  HLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKAYVSDTEDLKQDPLYQESWDDMIIS  1972
                T  L +L  L       ++  W       K+   V   E+  +  L Q+ W++ ++ 
Sbjct  555   CRGTAALRLLNVLHYSVHPTLDQLWSK-----KVPLLVEHIEENTEKSLSQKEWEEKLLL  609

Query  1973  FLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHSALLHRCLGILLQKVHDRAYVRAKI  2152
             FL E+L  + +  W+        RQ   Y         L++C+G  L     +  V+ ++
Sbjct  610   FLQETLAAVSDNTWICHFVTEMCRQLNSYNGFLLEKNFLYKCIGTTLGACTSKDLVQKQL  669

Query  2153  DLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDKLKGILDNVGQSILQR---IFSFFS  2323
               +   A       R GLA   G+ A +HL+  L KL+   D V   + ++   +FS F 
Sbjct  670   QELLETARYHEEAEREGLASCFGICAINHLEETLAKLE---DFVRSDVFKKSAGLFSIFK  726

Query  2324  DRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALVGTNMLSRLLHVRHPRAKQAVI  2503
             DR    E +   + L L YGY A YAP  ++ +RI+A +  N+  +  + +    K  +I
Sbjct  727   DRSD-NEVEKIKSTLILCYGYVAVYAPKELVLSRIEADILKNIF-QYFNTKDLTLKLCLI  784

Query  2504  TAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRDEEEGFSDSNIELLHTQSLALS  2683
              +I ++ QA+    + G  F   R+  L+  ++  +  +  E            +  A+ 
Sbjct  785   RSICMISQAIYNGVKCG-DFIFSRKAELVAQMVEFIKAEPLEAMRTP------VRQRAMI  837

Query  2684  ACTTLVSVEPKLTTETRN-LIMKATIGFFGLP-------NDPS------------DVINP  2803
              CT LV +EP L+   R  LI         LP        D +            D I+ 
Sbjct  838   TCTYLVILEPHLSDPDRTELIDTCLASVLALPPLELVKERDENGGDALHKEMLYGDTISA  897

Query  2804  LIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHELL  2974
             L D L +LL   L   G         L  +  ++ P++ S+ E++R+R    +  LL
Sbjct  898   LKDLLKSLLQRNLTPHG---------LQDMFAHLGPWIKSNKEHERQRAVEVSAALL  945


 Score = 57.8 bits (138),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 45/183 (25%), Positives = 82/183 (45%), Gaps = 11/183 (6%)
 Frame = +1

Query  118  VMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRR-----RFGNIAGLFQ  282
             ++ +  D  P V+E   +AL  +    P  +L+ C    R   +     R   +  +  
Sbjct  12   TLMDATTDKDPLVQEQIYNALCYLGESEPEEILNSCDEYLRQHDKLAYPHRVIILKAMET  71

Query  283  VISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLPDLMM  462
            V+   I  LDK        +     A+ E+  +KE+  DWQ+AA+ VLV+VG    + +M
Sbjct  72   VVKSNIALLDKSTAKVVIFL-----ASNEMTKSKEVIRDWQQAASNVLVAVGQRFINKVM  126

Query  463  EEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIY-RPIFA  639
            EE+   F         ++Q  A+ + S+     P L  +L  ++P+LG  ++ + + +F 
Sbjct  127  EEVLTKFQPGILPHYFVMQTFANLSVSNVFGMVPFLNSILGTMLPMLGMAKQDHMKSVFC  186

Query  640  NGL  648
              L
Sbjct  187  YAL  189


 Score = 66.2 bits (160),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 88/382 (23%), Positives = 160/382 (42%), Gaps = 30/382 (8%)
 Frame = +2

Query  4079  CECVGDLEMGKILARGGEQN---------------ENEKWINLIGELAGSISIKRPKEVP  4213
             C C  +  +  +LARGG +                  E+  + I  LAG+++      +P
Sbjct  1261  CSCAVE-TLKVMLARGGSEEVARAVGSASGWELMVSPERHHDGIAVLAGAMARHAGPRLP  1319

Query  4214  TICLFLSKSLDRPLRVQREAAAAALSEFLR---YSDGFGPLLGQMVEALCRHVSDDSPTV  4384
              I   L  +L      QR    A  +E L     +D    LL  M++ +     D    V
Sbjct  1320  LIVKNLIPTLSSVFDSQRITTTAFFAELLNNNVVNDLI--LLETMMDNMTGRQKDTCMLV  1377

Query  4385  RRLCLRGLVQMPS---IHVLQYTTQILGVILALLDDSDES---VQLTAvsclllvlesss  4546
             R L LRGL  + S     V ++  ++L  ++  +DD D+    V L A+S L  +L+   
Sbjct  1378  RMLALRGLGNIASGSPEKVRKHGAKLLASMVNGMDDKDDPHNLVALEAMSSLSKLLDHVE  1437

Query  4547  TDAVEPVLLNLSIRLRNLQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRM  4726
                ++ +LL+++IR+R         +R ++   FG L+ +  G+  + F EQI      +
Sbjct  1438  ERDIQSMLLHIAIRIRPFFDSEQPDLRQSSIVLFGNLTKFSEGNC-EVFFEQILNGLVTL  1496

Query  4727  VLHLHDDDLGVRQACRNTLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLT  4906
             +LHL D    V +AC+  L+   P +  + +  +   H    D    Y +F+ ++ + L 
Sbjct  1497  LLHLQDPKPEVVKACKFALRMCGPNMGCEGLCDMFLNH-LREDRSLHYGEFMNNVCKHLM  1555

Query  4907  QYLGPRVDTYLSAIIQAFDAPWPVIQANAVYLCSSMLSLSDNKNISALYYSQVFGVLVGK  5086
             Q     ++  +   +  F + W  I+A A      ++   D ++   +   Q+   L   
Sbjct  1556  QSYPEMLNRLILTNLFYFKSNWVDIRAAAPMFIGFLVLHVDEEHCQQVDLDQLISALNLL  1615

Query  5087  ASNSTDAIVRATCSAALGLLLK  5152
               +   A VR   +  LG L++
Sbjct  1616  LKDPVPA-VRVKVAETLGRLIR  1636



>ref|XP_005022597.1| PREDICTED: maestro heat-like repeat-containing protein family 
member 1-like [Anas platyrhynchos]
Length=1551

 Score =   239 bits (609),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 198/774 (26%), Positives = 343/774 (44%), Gaps = 84/774 (11%)
 Frame = +2

Query  716   SAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRTQLKAALPRLVPTILELYKREQDAA  895
             SA+E+L   W   R+ K+RL+ VEA+G M  L+   +L+  LP+L+P IL LYK+  +A 
Sbjct  144   SAYEVLFNSWLQHREAKLRLAVVEAMGPMSHLMPSEKLEEQLPKLIPGILALYKKHAEAF  203

Query  896   FVATCslhsllnasllsnngppllDFEDltvvlstlllvCSNNDKKEHSDFPVGLKTYNE  1075
             +++              N G   LD +   ++ +    +C+  D       P+ +K + E
Sbjct  204   YISK---SLCQILEASVNIGSRSLDVQLDALLGTLHPQICAPADPF----VPLTVKNHTE  256

Query  1076  VQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGSLCVLKHLLPRLAESWHNKRPILIES  1255
             V  CF  +   +P+ +  FLL K     E    G+L +++ ++         K+P ++ S
Sbjct  257   VLRCFTVLACSFPDRVLAFLLPKLESSNERTRVGTLLIMRQIINSAPSQMEIKKPFILSS  316

Query  1256  VKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGELFIEYLVRHCAMPDLENVELESSRE  1435
             +KL + + N  V++A+ ++I  MA H YL    GE  +EYLVR CA+P            
Sbjct  317   MKLPLQDSNDKVKRAVVQVISAMAHHGYLEQPGGEAMMEYLVRQCALP------------  364

Query  1436  SSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKGLLLITVTVPEMEHVLWPFLLKMIIP  1615
                      P   +K    A  +T+  ++ +    L L++ TV  M +VLWP+LL+ + P
Sbjct  365   -----SEAQP---KKQPLDADDLTSDSVQSISVNTLFLLSTTVDRMNNVLWPYLLEFVTP  416

Query  1616  RVYTGAVATVCRCISELCRRRSSES-NAMLSECKARTDIPKPEELFARLVVLLHNPLA--  1786
               +T A+  +C+ +  L  ++  E  NA L       ++P P  L  RL+V+   P A  
Sbjct  417   IQFTNALTPLCKSLMYLAMKKQEEGENANLIRYDLNGNLPSPYALTTRLLVVSSQPYAGD  476

Query  1787  -REHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKAYVSDTEDLKQDPLYQESWDDM  1963
              R     ++L VL Y   + P  +   W       ++ A V   E+  +  L Q+ W++ 
Sbjct  477   CRGAAALRLLHVLQY--SVHPA-LEQLWSK-----RVPALVEHIEENTEKCLCQKEWEEK  528

Query  1964  IISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHSALLHRCLGILLQKVHDRAYVR  2143
             ++ FL E+L  + +  W+        RQ   Y         L++C+G  L     +  V+
Sbjct  529   LLLFLQETLAAVSDNTWICHFVTEMCRQLNCYNGFPLEKNFLYKCIGTTLGACVSKDLVQ  588

Query  2144  AKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDKLKGILDNVGQSILQR---IFS  2314
              ++  +   A       R GLA   G+ A +HL+  L KL+   D V   + ++   +FS
Sbjct  589   KQLQELLETARYHEEAEREGLASCFGICAINHLEETLAKLE---DFVRSDVFKKSVGLFS  645

Query  2315  FFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALV--------GTNMLSRLLH  2470
              F DR    E +   + L L YG+ A +AP  ++ +RI+A +         T +L   + 
Sbjct  646   IFKDRSD-NEVEKIKSTLILCYGFVAVHAPKELVLSRIEADILKNIFQYFNTKVLGIKVE  704

Query  2471  VRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRDEEEGFSDSNI  2650
              +    K  +I +I ++ QA+    + G  F   R+  L+  ++  +  +  +       
Sbjct  705   TKDLTLKLCLIRSICMISQAIHNGGKCG-DFVFSRKAELVAQMVEFIKAEPLDAMRTP--  761

Query  2651  ELLHTQSLALSACTTLVSVEPKLTTETRN-LIMKATIGFFGLPNDP-------------S  2788
                  +  A+  CT LV++EP L+   R  LI         LP DP              
Sbjct  762   ----VRQRAMVTCTYLVALEPHLSDPDRTELIDTCLASVLALPPDPGPERDGISSDILYG  817

Query  2789  DVINPLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRG  2950
             D ++ L D L +LL   L   G         L  +  ++ P++ S+ E +R+R 
Sbjct  818   DTLSALKDLLKSLLQRNLTPHG---------LQDMFAHLGPWIKSNKEQERQRA  862


 Score = 55.5 bits (132),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 54/99 (55%), Gaps = 1/99 (1%)
 Frame = +1

Query  355  IATAEVISTKELNADWQRAAAGVLVSVGSHLPDLMMEEIFLHFSGSNSALPAMVQILADY  534
            +A+ E+  +KE+  DWQ+AA+ VLV+VG    + +MEE+   F         +VQ  A+ 
Sbjct  13   LASNEMTKSKEVIRDWQQAASSVLVAVGQRFINKVMEEVLTKFQPGILPHYFIVQTFANL  72

Query  535  ASSDALQFTPRLKGVLARVVPILGNVREIY-RPIFANGL  648
            + S+     P L  +L  ++P+LG  ++ + + +F   L
Sbjct  73   SVSNVFGMVPFLNSILGTMLPMLGMAKQDHMKSVFCYAL  111


 Score = 59.3 bits (142),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 76/324 (23%), Positives = 143/324 (44%), Gaps = 24/324 (7%)
 Frame = +2

Query  4079  CECVGDLEMGKILARGGEQNENEKWINL------IGELAGS----ISIKRPKEVPTICLF  4228
             C C  +  +  +LARGG +   ++ +        +G++A S    ++      +P I   
Sbjct  1186  CSCAVE-TLKVMLARGGSEAVTKELLAEAHAHPGVGDVAPSARSAMARHAGPRLPLIVKN  1244

Query  4229  LSKSLDRPLRVQREAAAAALSEFLR---YSDGFGPLLGQMVEALCRHVSDDSPTVRRLCL  4399
             L  +L      QR    A  +E L     +D    LL  +++ +     D    VR L L
Sbjct  1245  LVPTLSSVFDSQRITTTAFFAELLNSNVVNDLM--LLETVMDNMTGRQKDPCLLVRMLAL  1302

Query  4400  RGLVQMPS---IHVLQYTTQILGVILALLDDSDES---VQLTAvsclllvlesssTDAVE  4561
             RGL  + S     V ++  ++L  ++  +DD D+    V L A+S L  +L+      ++
Sbjct  1303  RGLGNISSGSPEKVRKHGAKLLASMVNGMDDKDDPHNLVALEAMSSLSKLLDHLEERDIQ  1362

Query  4562  PVLLNLSIRLRNLQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLH  4741
              +LL+++IR+R        ++R ++   FG L+ +      ++F EQI      ++LHL 
Sbjct  1363  SMLLHIAIRIRPFFDSEQPELRQSSIVLFGNLTKFSEEDC-EAFFEQILNGLVTLLLHLQ  1421

Query  4742  DDDLGVRQACRNTLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQLTQYLGP  4921
             D    V +AC+  L+   P +  + +  +   H    D    Y +F+ ++ + L Q    
Sbjct  1422  DPKPEVVKACKFALRMCGPNMGCEGLCDMFLNH-LREDRSLHYGEFMNNVCKHLMQSYPE  1480

Query  4922  RVDTYLSAIIQAFDAPWPVIQANA  4993
              ++  +S  +  F + W  I+A A
Sbjct  1481  MLNRLISTNLFYFKSNWVDIRAAA  1504



>ref|XP_005959761.1| PREDICTED: maestro heat-like repeat-containing protein family 
member 1-like isoform X1 [Pantholops hodgsonii]
Length=1665

 Score =   233 bits (593),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 182/697 (26%), Positives = 327/697 (47%), Gaps = 55/697 (8%)
 Frame = +2

Query  680   TILDTDVVSFLNSAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRTQLKAALPRLVPT  859
             T+      S ++ A+++L   W  SR+ K+RL+ VEALG M  L+   +L+  LP+L+P 
Sbjct  210   TVRKDAFASDISGAYDILFHQWLQSREAKLRLAVVEALGPMSHLLPSEKLEEQLPKLLPG  269

Query  860   ILELYKREQDAAFVATCslhsllnasllsnngppllDFEDltvvlstlllvCSNNDKKEH  1039
             +L LYK+  +   V+              + G   LD +  +++ +    +C   +    
Sbjct  270   VLALYKKHAETVHVSK---SLGQILEAAVSVGSRTLDVQLDSLLAALHTQICVPVE----  322

Query  1040  SDFPVGLKTYNEVQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGSLCVLKHLLPRLAE  1219
             S  P+ +    EV  CF  +    P+ L  FLL K     E    G+L VL+H++   A 
Sbjct  323   SSSPLVMSNQKEVLRCFTVLACYSPDRLLAFLLPKLDTSNERTRVGTLQVLRHVINAAAA  382

Query  1220  SWHNKRPILIESVKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGELFIEYLVRHCAMP  1399
                 K+P ++ S+KL + + N  V++A+ +++  MA H YL    G+  +EY+V+ CA+P
Sbjct  383   QMEVKKPFILSSMKLPLLDTNNKVKRAVVQVVSAMAHHGYLEQPGGKAMVEYIVQQCALP  442

Query  1400  DLENVELESSRESSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKGLLLITVTVPEMEH  1579
                  E E+ + ++                 + A+    ++ +    L L++ TV  M  
Sbjct  443   P----EAETQKPAA----------------DSEALAADSVQAISVSTLYLVSTTVDRMGE  482

Query  1580  VLWPFLLKMIIPRVYTGAVATVCRCISELCRRRS-SESNAMLSECKARTDIPKPEELFAR  1756
             VLWP+LL+ ++P  +TGA++ +CR +  L ++R  + ++A L +      +P P  +  R
Sbjct  483   VLWPYLLEFLVPIRFTGALSPLCRSLVHLAQKRQEAGAHAPLIQYSGNVHLPSPYAITTR  542

Query  1757  LVVLLHNPLAREHLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKAYVSDTEDLKQDP  1936
             L+V+  NP   +      L +L  L       +   W     IP +  ++   ++  ++ 
Sbjct  543   LLVVSSNPYVGDGRGAASLRLLSVLHQDIHPALGQRWATA--IPLLLEHL---DEYSEET  597

Query  1937  LYQESWDDMIISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHSALLHRCLGILLQ  2116
             L Q+ W++ ++ FL +SL V+ +  WV  L     +Q   Y         L++C+G  L 
Sbjct  598   LPQKEWEEKLLMFLRDSLAVVSDNTWVCQLTLEMCKQLPNYNGMPLEKNFLYKCVGTTLG  657

Query  2117  KVHDRAYVRAKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDKLKGILDNVGQSI  2296
                 +  VR  +  +   A       R GLA   GL A SHLD  L +L+   D V   +
Sbjct  658   SASSKEVVRKHLQELLETARYQEEREREGLACCFGLCAISHLDDTLAQLE---DFVKSDV  714

Query  2297  LQR---IFSFFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALVGTNM-----  2452
             L++   IF+ F DR +  E+D   +AL L YG+ A  AP  ++ AR++A V  NM     
Sbjct  715   LRKSAGIFNIFKDRSE-SEADKVRSALILCYGHVAARAPRELLLARVEADVFRNMSQCFS  773

Query  2453  ---LSRLLHVRHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRDE  2623
                L   +  + P  + +++ ++ +  QA+  ++  G SF L R+  L+  ++  +  + 
Sbjct  774   TKVLGIKVETKDPALRLSLVQSVCMATQAICSSAHGG-SFHLSRKAELVVQMVEFIKAEP  832

Query  2624  EEGFSDSNIELLHTQSLALSACTTLVSVEPKLTTETR  2734
              +            +  A+ AC  LV++EP L  + +
Sbjct  833   PDSLRTP------IRKKAMLACMYLVTLEPALEEQVQ  863


 Score = 61.6 bits (148),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 48/172 (28%), Positives = 82/172 (48%), Gaps = 10/172 (6%)
 Frame = +1

Query  118  VMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRR-----RFGNIAGLFQ  282
            +++ ++ D  P V+E    AL  +    P+ VL  C    R   +     R   +  +  
Sbjct  12   ILLDAITDKDPRVQEQVCGALCALGESQPVEVLSACEEHLRLREKLAHPYRTMILRAIEI  71

Query  283  VISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLPDLMM  462
            V+S  I  LDK D+  A ++    +A+ E+   KEL +DWQ+AA+ VLV+VG      +M
Sbjct  72   VVSNHIGELDK-DMARAIIL----LASNEMTKVKELVSDWQQAASSVLVAVGRRFISSVM  126

Query  463  EEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVRE  618
            EE+   F       P  +  LA  + ++     P L  +L+ ++P+LG  + 
Sbjct  127  EELLSKFQPGLLPHPCTMHTLASLSVANVFGMVPFLTSILSTMLPMLGAAKH  178


 Score = 62.8 bits (151),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 74/260 (28%), Positives = 113/260 (43%), Gaps = 21/260 (8%)
 Frame = +2

Query  4259  VQREAAAAALSEFLR---YSDGFGPLLGQMVEALCRHVSDDSPTVRRLCLRGLVQM----  4417
             VQR  + A L+E L     +D    LL  +++ L     D S  VRRL LRGL  +    
Sbjct  1364  VQRITSTAFLAELLSSNVVNDLM--LLESLLDNLMARQKDTSARVRRLVLRGLANVALGS  1421

Query  4418  PSIHVLQYTTQILGVILALLDDSDESVQLTAvsclllvless-sTDA--VEPVLLNLSIR  4588
             P   V  +  Q+L  ++  LDD D+   L A+  ++ +       DA  +  VLL++++R
Sbjct  1422  PD-KVRTHGPQLLTAMIGGLDDGDDPHSLVALEAMVGLARLMDLVDAWDLRAVLLHIAVR  1480

Query  4589  LRNLQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPRMVLHLHDDDLGVRQA  4768
             +R        + R+ +   FG L+    G   D F EQ+      ++LHL D    V  A
Sbjct  1481  IRPFFDSERMEFRSASIRLFGHLNKACRGDCEDVFLEQVVGGLAPLLLHLRDPQAPVVAA  1540

Query  4769  CRNTLKCIAPLIEIDAIPALLNTH--RFSSDHRSDYEDFLRDLARQLTQYLGPRVDTYLS  4942
             CR  L+   P +E + + A+   H     S H  D    L+   R     LG      LS
Sbjct  1541  CRFALRMCGPNLECEELAAVFQKHLQEGRSLHFGDLTASLQ--MRHFPDLLG----RLLS  1594

Query  4943  AIIQAFDAPWPVIQANAVYL  5002
               +  F + W  ++A A  L
Sbjct  1595  TSLFYFKSSWEDVRAAAPML  1614



>ref|XP_005291199.1| PREDICTED: maestro heat-like repeat-containing protein family 
member 1 isoform X1 [Chrysemys picta bellii]
Length=1648

 Score =   236 bits (603),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 210/789 (27%), Positives = 359/789 (46%), Gaps = 84/789 (11%)
 Frame = +2

Query  716   SAFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRTQLKAALPRLVPTILELYKREQDAA  895
             +A+++L  +W  SR+ K+RL+ V+ALG M  L+   +L+  LPRLVP IL LYK+  +A 
Sbjct  222   NAYDVLFNIWLQSREAKLRLAVVKALGPMSHLMPSEKLEEQLPRLVPGILALYKKHVEAF  281

Query  896   FVATCslhsllnasllsnngppllDFEDltvvlstlllvCSNNDKKEHSDFPVGLKTYNE  1075
             +V               N G   LD +   ++ +    +C+  +    S  P+ LK +NE
Sbjct  282   YVTK---SLCQILEASVNVGSRTLDTQLDALLSTLHPQICAPVE----SSVPLSLKNHNE  334

Query  1076  VQHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGSLCVLKHLLPRLAESWHNKRPILIES  1255
             V  CF  +   +P+ L  FLL K     E    G+L +++ ++         K+P ++ S
Sbjct  335   VLRCFTVLACTFPDRLLGFLLPKLENHHERIRVGTLIIMRQIINCAPSQMEIKKPFILSS  394

Query  1256  VKLLIDEHNLGVRKALAELIVVMASHCYLVGSSGELFIEYLVRHCAMPDLENVELESSRE  1435
             +KL + + +  V++A+ ++I  MA H YL  + GE+ IEY+V  CA+P            
Sbjct  395   MKLPLQDSSNKVKRAVVQVISAMAHHGYLEQAGGEVMIEYIVHQCALPP-----------  443

Query  1436  SSRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKGLLLITVTVPEMEHVLWPFLLKMIIP  1615
                   + +P   RK   +A  +T+  ++ +    L LI+ TV  M+ VLWP+LL+ + P
Sbjct  444   ------DTHP---RKQTPEADDLTSDSVQNISISTLFLISTTVDRMDEVLWPYLLEFVTP  494

Query  1616  RVYTGAVATVCRCISELCRRRSSES-NAMLSECKARTDIPKPEELFARLVVLLHNPLARE  1792
               +TGA+  +CR +  L  +R  E     L       ++P P  L ARL+ +   P   +
Sbjct  495   VEFTGALTPLCRSLMHLATKRQEEGETTFLIHYDTHANLPSPCALMARLLTVSSQPYLGD  554

Query  1793  HLVTQILSVLWYLAPLFPKNINSFWQDEL*IPKMKAYVSDTEDLKQDPLYQESWDDMIIS  1972
                   L +L  L       +   W       K+   V   E   +  L  + W+D ++ 
Sbjct  555   GRGAAALRLLNVLHLNIHPTLGKLWNK-----KIPPLVEHLEANTEKSLSSKEWEDKLLL  609

Query  1973  FLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHSALLHRCLGILLQKVHDRAYVRAKI  2152
              L E+L  I +  W+        +    Y         L++C+G  L    ++  V+ ++
Sbjct  610   LLRETLTAISDNAWICQFSTEMCKHLNSYNGFPSEKNFLYKCIGTALGVCSNKEVVQKQL  669

Query  2153  DLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDKLKGILDNVGQSILQR---IFSFFS  2323
               +   A       R GLA   G+ A +HLD  L KL+   D V   + ++   +FS F 
Sbjct  670   QELLETARYQEEAEREGLASCFGICAINHLDETLAKLE---DFVKSDVFKKSVGLFSIFK  726

Query  2324  DRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALVGTNML----SRLLHVRHPRA-  2488
             DR    E++   + L L YGY A+YAP  ++ +RI+A +  N+     +R+L ++     
Sbjct  727   DRSD-NEAEKIKSTLILCYGYVARYAPKELVLSRIEADILRNVFHYFNTRVLGIKVETKD  785

Query  2489  ---KQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRDEEEGFSDSNIELL  2659
                K  +I +I ++ QA+  +++SG +F   R+  LL  ++        E      ++LL
Sbjct  786   LTLKLCLIRSICMISQAISSSAQSG-AFVFSRKAELLAQMM--------EFIKTEPLDLL  836

Query  2660  HT--QSLALSACTTLVSVEPKLTTETR-NLIMKATIGFFGLPNDPSDVI-----------  2797
              T  +  A+ +CT LV +EP L+      LI         LP  P DV+           
Sbjct  837   RTPIRQRAMISCTYLVVLEPPLSEPDHVELIDTCLSSVLALP--PLDVLKERDGHVPDAL  894

Query  2798  ------NPLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLA  2959
                   +  +  L  LL ++L    +D   R  Q   +  ++ P++ SS E++R+R    
Sbjct  895   HKETLYHDTVSALKDLLKSVL---QKDLTPRGLQ--SMFEHLGPWIRSSKEHERERAVEV  949

Query  2960  AHELLIKFR  2986
             +  LL  +R
Sbjct  950   SATLLEFYR  958


 Score = 57.8 bits (138),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 91/184 (49%), Gaps = 13/184 (7%)
 Frame = +1

Query  118  VMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRRRFGNIAGLFQVISV-  294
             ++ +  D  P V+E   +AL  +    P  +L+ C        R+   +A   ++I + 
Sbjct  12   TLMDATTDKDPLVQEQIYNALCYLGESEPEEILNSC----DEYLRQHDKLAYPHRIIILK  67

Query  295  AIRALDKGDVDPAFMMK-LAKI----ATAEVISTKELNADWQRAAAGVLVSVGSHLPDLM  459
            A+ A+ K ++D  ++ K  AKI    A+ E+  +KE+  DWQ+AA+ VLV+ G    + +
Sbjct  68   AMEAVLKNNID--YLDKSTAKIVIFLASNEMTKSKEIIYDWQQAASNVLVAAGGRFINKV  125

Query  460  MEEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVREIY-RPIF  636
            MEE+   F         ++Q  A+ + S+     P L  +L  ++P+LG  ++ + + +F
Sbjct  126  MEEVLTKFQPGILPHYFIMQTFANLSVSNVFGMVPFLNSILGTMLPMLGMAKQDHMKSVF  185

Query  637  ANGL  648
               L
Sbjct  186  CYAL  189


 Score = 76.6 bits (187),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 85/330 (26%), Positives = 146/330 (44%), Gaps = 15/330 (5%)
 Frame = +2

Query  4040  EPLRALLNAFQAFCECVGDLEMGKILARGGE---QNENEKWINLIGELAGSISIKRPKEV  4210
             +P    + A  A     G  E+ K +   G        E+  + I  LA +++     ++
Sbjct  1268  DPCSCAVEALSAMLTQGGSDEVVKSVGSAGGWELMKSPERHHDGIALLARAMAKHAGPKL  1327

Query  4211  PTICLFLSKSLDRPLRVQREAAAAALSEFLR---YSDGFGPLLGQMVEALCRHVSDDSPT  4381
             P I   L   L+     QR    A ++E L     SD    LL  M++ +     D    
Sbjct  1328  PLIAKNLFPMLNSVYDSQRITTTAFVAELLNSSVVSDLI--LLESMMDNMTGRQKDPCTL  1385

Query  4382  VRRLCLRGLVQMPS---IHVLQYTTQILGVILALLDDSDES---VQLTAvsclllvless  4543
             VR L LRGL  + +     V ++  Q+L  ++  +DD D+    V L A+S L  +L+  
Sbjct  1386  VRMLALRGLGNISAGSPDKVRKHGAQLLASMVNGMDDKDDPDNLVALEAMSSLSKLLDHV  1445

Query  4544  sTDAVEPVLLNLSIRLRNLQVCLNAKIRANAFAAFGALSSYGAGSILDSFREQIHAAFPR  4723
                 +  +LL+++IR+R      N ++RA++   FG L+ + AG+  D F EQI      
Sbjct  1446  EERDIRSMLLHIAIRIRPFFDNENHELRASSIVLFGNLTKFSAGNCEDVFFEQILNGLVT  1505

Query  4724  MVLHLHDDDLGVRQACRNTLKCIAPLIEIDAIPALLNTHRFSSDHRSDYEDFLRDLARQL  4903
             ++LHL D    V +AC+  L+   P +  + +  +   H    D    Y +F+ D+ + L
Sbjct  1506  LLLHLQDPRPEVIKACKFALRMCGPNMGCEGLCDMFLNH-LHEDRSLHYGEFMNDVCKHL  1564

Query  4904  TQYLGPRVDTYLSAIIQAFDAPWPVIQANA  4993
              Q     ++  +S  +  F + W  I+A A
Sbjct  1565  MQNYPEMLNRLISTNLFYFKSNWVDIRAAA  1594



>ref|XP_008832670.1| PREDICTED: maestro heat-like repeat-containing protein family 
member 1 isoform X5 [Nannospalax galili]
Length=1595

 Score =   232 bits (591),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 198/784 (25%), Positives = 362/784 (46%), Gaps = 87/784 (11%)
 Frame = +2

Query  719   AFELLLRVWAMSRDLKVRLSAVEALGQMVGLITRTQLKAALPRLVPTILELYKREQDAAF  898
             A+++LL  W  SRD K+RL+ V ALG M  L+   +L+  LPRL+P +L LYK+  +   
Sbjct  179   AYDILLHHWLQSRDAKLRLAVVAALGPMSHLLPNEKLEEQLPRLLPGVLVLYKKHVETFQ  238

Query  899   VATCslhsllnasllsnngppllDFEDltvvlstlllvCSNNDKKEHSDFPVGLKTYNEV  1078
             ++              +     L+ +   ++++    +C   +    S  P+ + +  EV
Sbjct  239   ISK---SLGQILEAAVSVSSRTLEVQLDALLVALHTQICVPVE----SSSPLVMSSQKEV  291

Query  1079  QHCFLTVGSVYPEDLFVFLLNKCRLKEEPFTFGSLCVLKHLLPRLAESWHNKRPILIESV  1258
               CF  +    P+ L  FLL K     E    G+L +L+H++   A     K+P ++ S+
Sbjct  292   LRCFTVLACCSPDRLLAFLLPKLDTNNERLRVGTLQILRHIINSAASQMEVKQPFILSSM  351

Query  1259  KLLIDEHNLGVRKALAELIVVMASHCYLVGSSGELFIEYLVRHCAMPDLENVELESSRES  1438
             +L + + N  V++A+ ++I  MA H YL    GE+ I+Y+V+ CA+P  E  +     E 
Sbjct  352   RLPLLDTNSKVKRAVVQVISAMAHHGYLEQPGGEVMIDYIVQQCALPPEEPEKPGPDGED  411

Query  1439  SRFTGNYYPFVYRKLEFKAGAVTTTELRGVCEKGLLLITVTVPEMEHVLWPFLLKMIIPR  1618
                                  +    +R V  + L L++ TV  M +VLWP+LL+ + P 
Sbjct  412   ---------------------LAADSVRAVSIRTLYLVSTTVDRMSNVLWPYLLEFLTPV  450

Query  1619  VYTGAVATVCRCISELC-RRRSSESNAMLSECKARTDIPKPEELFARLVVLLHNPL---A  1786
              +T A+  +CR +  L  +R+ + ++A L +  +  ++P P  +  RL+V+  NP     
Sbjct  451   RFTAALTPLCRSLVHLALKRQEAGADAFLVQFNSHANLPSPYAVTTRLLVVSSNPYLGDG  510

Query  1787  REHLVTQILSVL-WYLAPLFPKNINSFWQDEL*IPKMKAYVSDTEDLKQDPLYQESWDDM  1963
             R     ++L VL W + PL    +   W+    +P +  Y+   ++  ++ L ++ W + 
Sbjct  511   RGAASLRLLKVLHWNIHPL----LGQHWETT--VPVLLQYL---DEHTEETLSRKEWQEK  561

Query  1964  IISFLAESLDVIQNVDWVLLLGNTFARQYELYKSDNEHSALLHRCLGILLQKVHDRAYVR  2143
             ++ FL ++L VI +  W+  L     +Q   Y    +    L++C+G  L     +  VR
Sbjct  562   LLVFLRDTLAVISDDTWICQLSLEMCKQLSSYNGTPQEKNFLYKCIGTTLGTASSKEVVR  621

Query  2144  AKIDLMYRQANIAVPTNRLGLAKAMGLVAASHLDTVLDKLKGILDNVGQSILQR---IFS  2314
               +  +   A       R GLA   G+ A +HL+  L +L+   D V   + ++   IFS
Sbjct  622   KHLRELLETARYQEEAEREGLACCFGICAIAHLEDTLAQLE---DFVKSDVFRKSIGIFS  678

Query  2315  FFSDRGKMEESDDTHAALALMYGYAAKYAPPTVIEARIDALVGTNML----SRLLHV---  2473
              F DR +  E +   +AL L YG+ A  AP  ++ A++++ V  NM     +++L +   
Sbjct  679   IFKDRSE-HEVERMKSALILCYGHVAAQAPHELLLAKVESDVLRNMFQCFSTKVLGIKVE  737

Query  2474  -RHPRAKQAVITAIDLLGQAVIGASESGISFPLKRRDLLLDYILTLMGRDEEEGFSDSNI  2650
              + P  K  ++ ++ ++ QAV  + ++  SF   R+  L+  ++  +  +  +       
Sbjct  738   TKDPALKLCLVQSLCMVSQAVCSSIQAS-SFHFSRKAELVAQMVEFINAEPPDCLKTP--  794

Query  2651  ELLHTQSLALSACTTLVSVEPKLTTETR-NLIMKATIGFFGLPNDPS------------D  2791
                  +  A+ ACT L+++EP L  +T+ ++I         LP +P             D
Sbjct  795   ----IRKKAMLACTYLINLEPALEEQTQADVIHSCLHSVMALPPEPEGEDGACQEPLYLD  850

Query  2792  VINPLIDNLITLLCTILVTSGEDGRSRAEQLLHILRNIDPFVSSSLEYQRKRGCLAAHEL  2971
                 L D L +LL   +   G         L  I+ ++ P++ SS  ++R R  L     
Sbjct  851   TARALEDLLTSLLRRNMTPQG---------LQVIVEHLSPWIKSSRGHERARA-LGLGAC  900

Query  2972  LIKF  2983
             L+KF
Sbjct  901   LLKF  904


 Score = 62.0 bits (149),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 68/123 (55%), Gaps = 6/123 (5%)
 Frame = +1

Query  283  VISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQRAAAGVLVSVGSHLPDLMM  462
            V+S  I  LDK   D A ++ L  +A++E+  TKEL+ DWQRAA+ VLV+VG    + +M
Sbjct  28   VLSSHIHELDK---DTASIVIL--LASSEMTRTKELDCDWQRAASSVLVAVGKRFINQVM  82

Query  463  EEIFLHFSGSNSALPAMVQILADYASSDALQFTPRLKGVLARVVPILGNVRE-IYRPIFA  639
            E +   F        +++  LA  + S+A    P L  VL+ ++P+LG  ++   R +F 
Sbjct  83   EVVLSKFQPGVLPHSSVLHTLASLSLSNAFGMVPFLPSVLSTMLPMLGMAKQDALRVVFC  142

Query  640  NGL  648
              L
Sbjct  143  CAL  145


 Score = 73.2 bits (178),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 91/356 (26%), Positives = 153/356 (43%), Gaps = 38/356 (11%)
 Frame = +2

Query  4040  EPLRALLNAFQAF---------CECVGDLEMGKILARGGEQNENEKWINLIGELAGSISI  4192
             EP  + ++A QA            CV +LE G  L R    +E+      + +LA +++ 
Sbjct  1216  EPCSSAVDALQALLLRGGTQDVVRCV-ELEGGWELLRTSAGHEDG-----VAQLASAMAK  1269

Query  4193  KRPKEVPTI--CLFLSKSLDRPLRVQREAAAAALSEFLR---YSDGFGPLLGQMVEALCR  4357
                  +P +   L  + S+      QR  + A L+E L     +D    LL  ++++L  
Sbjct  1270  CAGPRLPLVMKALVCTHSV---YETQRVTSTAFLAELLSNNVVNDLM--LLEPLLDSLAA  1324

Query  4358  HVSDDSPTVRRLCLRGLVQMPS---IHVLQYTTQILGVILALLDDSDESVQLTAvsclll  4528
                D S +VRRL LRGL  + S     V  +  Q+L  ++  LDD D+   L A+  ++ 
Sbjct  1325  RQKDSSASVRRLVLRGLANIASGSPDKVRAHGPQLLTAMIGGLDDGDDPHGLVALEAMVG  1384

Query  4529  vlesssTDAVEP-----VLLNLSIRLRNLQVCLNAKIRANAFAAFGALSSYGAGSILDSF  4693
             +      D VEP     VLL+ +IR+R        + R  +   FG L+    G+  D F
Sbjct  1385  LARL--QDLVEPWDLRLVLLHTTIRIRPFFDSEKVEFRTASIRLFGHLNKTCHGNCEDVF  1442

Query  4694  REQIHAAFPRMVLHLHDDDLGVRQACRNTLKCIAPLIEIDAIPALLNTHRFSSDHRS-DY  4870
              EQ+      ++LHL D    V  ACR  L    P +E   + A    +++  + RS  +
Sbjct  1443  LEQVVGGLVPLLLHLQDPQASVASACRFALCMCVPHLECAELAAAF--YKYLQEGRSVHF  1500

Query  4871  EDFLRDLARQLTQYLGPRVDTYLSAIIQAFDAPWPVIQANAVYLCSSMLSLSDNKN  5038
              +FL    + L  +    +   +S  +  F + W  ++A A      +L  ++ K 
Sbjct  1501  GEFLNSTCKHLMHHFPDLLGRLVSTTLFYFKSSWDDVRAAAPMFTGFLLLHAETKQ  1556



>ref|XP_008682341.1| PREDICTED: maestro heat-like repeat-containing protein family 
member 1 [Ursus maritimus]
Length=1400

 Score =   224 bits (571),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 180/733 (25%), Positives = 334/733 (46%), Gaps = 60/733 (8%)
 Frame = +2

Query  596   PFLGM*EKYTGQSLQMACWQYSVDFSLSTILDTD-----------VVSFLNSAFELLLRV  742
             P LGM +  T ++      QY  + +L  + + D             + + SA++LL   
Sbjct  171   PMLGMAKHDTMRAAFCCALQYFSESTLEYLANLDQAPDPTVRKDTFATDIFSAYDLLFNH  230

Query  743   WAMSRDLKVRLSAVEALGQMVGLITRTQLKAALPRLVPTILELYKREQDAAFVATCslhs  922
             W  SR+ K+RL+ VEALG M  L+   +L+  LP+L+P +L LYK+  +   V+      
Sbjct  231   WLQSREAKLRLAVVEALGPMSHLLPSEKLEEQLPKLLPGVLALYKKHAETFHVSK---SL  287

Query  923   llnasllsnngppllDFEDltvvlstlllvCSNNDKKEHSDFPVGLKTYNEVQHCFLTVG  1102
                     + G   L+ +  +++ +    +C   +    S  P+ +    EV  CF  + 
Sbjct  288   GQILEAAVSVGSRTLEPQLDSLLAALHAQICVPVE----SSSPLVVSNQKEVLRCFTVLA  343

Query  1103  SVYPEDLFVFLLNKCRLKEEPFTFGSLCVLKHLLPRLAESWHNKRPILIESVKLLIDEHN  1282
                P+ L  FLL K     E    G+L V++H++   A     K+P ++ S++L + + N
Sbjct  344   CCAPDRLLAFLLPKLDASNERTRVGTLQVVRHVINSAASQMEVKKPFILSSMRLPLLDTN  403

Query  1283  LGVRKALAELIVVMASHCYLVGSSGELFIEYLVRHCAMPDLENVELESSRESSRFTGNYY  1462
               V++A+ ++I  MA H YL    GE  +EY+V+ CA+P     E E             
Sbjct  404   TKVKRAVVQVISAMAHHGYLEQPGGEAMVEYIVQQCALPP----ETEP------------  447

Query  1463  PFVYRKLEFKAGAVTTTELRGVCEKGLLLITVTVPEMEHVLWPFLLKMIIPRVYTGAVAT  1642
                 +KL   +  +    +R +    L L++ TV  M  VLWP+LL+ + P  +TGA+  
Sbjct  448   ----QKLGPDSEDLPADSVRAISISTLYLVSTTVDRMSDVLWPYLLEFLTPVRFTGALTP  503

Query  1643  VCRCISELCRRRSS-ESNAMLSECKARTDIPKPEELFARLVVLLHNPLAREHLVTQILSV  1819
             +C+ +  L ++R    ++A L +      +P P  +  RL+ +  NP   +      L +
Sbjct  504   LCKSLVHLVQKRQEVGADAFLIQYDGNVTLPSPYAITTRLLTVSSNPYLGDGRGAASLRL  563

Query  1820  LWYLAPLFPKNINSFWQDEL*IPKMKAYVSDTEDLKQDPLYQESWDDMIISFLAESLDVI  1999
             L  L       +   W     +P +  ++   ++  ++ L Q+ W++ +++FL ++L V+
Sbjct  564   LNVLHRSIHPALGPRWATT--VPLLLEHL---DERTEESLSQKEWEEKLLAFLRDTLAVV  618

Query  2000  QNVDWVLLLGNTFARQYELYKSDNEHSALLHRCLGILLQKVHDRAYVRAKIDLMYRQANI  2179
              +  W+  L     +Q   Y    +    L++C+G  L     +  VR ++  +   A  
Sbjct  619   SDNTWICQLSLEMCKQLPCYNGMPQEKNFLYKCIGTALGAASSKEVVRKQLQELLETARH  678

Query  2180  AVPTNRLGLAKAMGLVAASHLDTVLDKLKGILDNVGQSILQRIFSFFSDRGKMEESDDTH  2359
                  R GLA   G+ A SHLD VL +L+  + +        IF+ F DR +  E +   
Sbjct  679   QEEAEREGLACCFGICAISHLDDVLAQLEDFMRSDVFRKSTGIFNIFKDRSE-NEVEKLK  737

Query  2360  AALALMYGYAAKYAPPTVIEARIDALV--------GTNMLSRLLHVRHPRAKQAVITAID  2515
               L L YG+ A  AP  ++ A++++ +         T +L   +  + P  K  ++ ++ 
Sbjct  738   CTLILCYGHVAAQAPRELVLAKVESDILRNIFQYFSTKVLGIKVETKDPALKLCLVQSVC  797

Query  2516  LLGQAVIGASESGISFPLKRRDLLLDYILTLMGRDEEEGFSDSNIELLHTQSLALSACTT  2695
             +  QA+  ++++G SF   R+  L+  ++  +  + ++            +  A+ ACT 
Sbjct  798   MASQAICSSAQAG-SFHFSRKAELVAQMMEFIKAEPQDSLRTP------IRKKAMLACTY  850

Query  2696  LVSVEPKLTTETR  2734
             LVS+EP L  + +
Sbjct  851   LVSLEPALDKQVQ  863


 Score = 69.7 bits (169),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 87/174 (50%), Gaps = 14/174 (8%)
 Frame = +1

Query  118  VMVSSLADDSPSVREASMSALKDITSLNPLLVLDCCLTVSRGGRR-----RFGNIAGLFQ  282
            +++ ++ D  P VRE   SAL  +    P   L  C    R   +     R   +  +  
Sbjct  12   ILLDAVTDKDPVVREQVCSALCALGEAQPEEALGACEEYLRQHEKLAHPYRTMILRAMET  71

Query  283  VISVAIRALDKGDVDPAFMMKLAKIATAEVISTKELNADWQR