BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18095_g2_i1 len=1155 path=[644:0-1154]

Length=1155
                                                                      Score     E

ref|XP_009788435.1|  PREDICTED: MADS-box protein CMB1-like              295   1e-94   
emb|CAC81072.1|  MADS box transcription factor                          289   2e-92   Daucus carota subsp. sativus
ref|NP_001234670.1|  MADS-box transcription factor                      289   2e-92   
ref|XP_006363565.1|  PREDICTED: MADS-box protein CMB1-like              286   2e-91   
ref|XP_002263410.2|  PREDICTED: MADS-box protein CMB1                   286   2e-91   Vitis vinifera
ref|NP_001234837.1|  MADS-box transcription factor                      286   4e-91   
ref|XP_010257958.1|  PREDICTED: developmental protein SEPALLATA 1       285   7e-91   
ref|XP_004237061.1|  PREDICTED: MADS-box protein CMB1 isoform X1        284   2e-90   
ref|XP_010260833.1|  PREDICTED: MADS-box protein CMB1                   284   2e-90   
gb|KHG04329.1|  MADS-box CMB1                                           284   2e-90   
ref|XP_009625300.1|  PREDICTED: MADS-box protein CMB1-like              285   2e-90   
gb|AHW58033.1|  SEP4                                                    281   2e-89   
gb|AFU61112.1|  MADS-box transcription factor MADS-RIN                  281   2e-89   
emb|CAN84110.1|  hypothetical protein VITISV_036170                     281   3e-89   Vitis vinifera
emb|CDP00462.1|  unnamed protein product                                280   5e-89   
gb|ADU56820.1|  MADS-box protein AGL2 subfamily                         278   2e-88   
gb|AEL33632.1|  SEPALLATA2                                              279   3e-88   
gb|ABJ98752.1|  MADS-box transcription factor MADS-RIN                  278   3e-88   Capsicum annuum
gb|AEJ76842.1|  MADS18                                                  278   5e-88   
gb|ADC79693.1|  SEPALLATA1-like protein                                 278   6e-88   Akebia trifoliata
ref|XP_007045799.1|  MADS-box transcription factor                      276   2e-87   
gb|AFO68791.1|  agamous-like protein 234                                275   3e-87   
gb|AGT21645.1|  PFRIN                                                   276   3e-87   
gb|ADD25190.1|  SEP1                                                    273   2e-86   Nelumbo nucifera [Indian lotus]
ref|XP_011102220.1|  PREDICTED: MADS-box protein CMB1-like              274   2e-86   
ref|XP_007032865.1|  K-box region and MADS-box transcription fact...    271   1e-85   
gb|AAK21247.1|AF335234_1  MADS-box transcription factor FBP4            271   2e-85   Petunia x hybrida [garden petunia]
gb|ACD39982.1|  MADS1                                                   271   2e-85   Carica papaya [mamon]
gb|AFO68790.1|  agamous-like protein 234                                271   2e-85   
gb|AGW23594.1|  MADS1                                                   271   2e-85   
gb|ADR83588.1|  Sepallata 1-like protein                                271   3e-85   
ref|XP_006348663.1|  PREDICTED: MADS-box protein CMB1-like              276   5e-85   
gb|AHH28266.1|  MADS-box transcription factor                           270   6e-85   
gb|KDP24297.1|  hypothetical protein JCGZ_25593                         270   7e-85   
gb|AHH28272.1|  MADS-box transcription factor                           269   1e-84   
ref|XP_010320555.1|  PREDICTED: MADS-box transcription factor iso...    266   6e-84   
gb|ACJ26766.1|  MADS-11                                                 266   1e-83   Gossypium hirsutum [American cotton]
ref|XP_002306051.2|  hypothetical protein POPTR_0004s11440g             266   1e-83   Populus trichocarpa [western balsam poplar]
ref|XP_006440806.1|  hypothetical protein CICLE_v10021357mg             268   2e-83   
ref|XP_010660492.1|  PREDICTED: MADS-box protein 2 isoform X1           266   2e-83   
gb|AAQ72498.1|  MADS-box protein 12                                     266   3e-83   Petunia x hybrida [garden petunia]
ref|XP_003518786.1|  PREDICTED: developmental protein SEPALLATA 1...    266   3e-83   
gb|AEJ76844.1|  MADS20                                                  266   3e-83   
ref|XP_010319477.1|  PREDICTED: MADS-box protein CMB1 isoform X2        265   4e-83   
gb|ABG78619.1|  MADS4                                                   265   4e-83   Populus tomentosa [Chinese white poplar]
gb|ADC79694.1|  SEPALLATA1-like protein                                 265   5e-83   Akebia trifoliata
ref|XP_006477714.1|  PREDICTED: developmental protein SEPALLATA 1...    265   5e-83   
gb|AAF12701.2|  Apetala 1 protein                                       265   7e-83   Populus tremuloides
ref|XP_006430949.1|  hypothetical protein CICLE_v10012593mg             265   9e-83   
ref|XP_010681125.1|  PREDICTED: MADS-box protein CMB1-like              265   9e-83   
ref|NP_001268109.1|  MADS-box protein 2                                 264   1e-82   
gb|AAK21249.1|AF335236_1  MADS-box transcription factor FBP9            264   1e-82   Petunia x hybrida [garden petunia]
ref|XP_009773223.1|  PREDICTED: MADS-box protein CMB1-like isofor...    265   1e-82   
gb|AAL08423.2|AF185574_1  transcription factor MAGL4                    264   1e-82   Populus tremuloides
ref|XP_008464576.1|  PREDICTED: developmental protein SEPALLATA 1...    264   1e-82   
gb|AGW23351.1|  MADS box protein MADS49                                 264   2e-82   
ref|XP_010029406.1|  PREDICTED: developmental protein SEPALLATA 1       264   2e-82   
ref|XP_009773224.1|  PREDICTED: MADS-box protein CMB1-like isofor...    264   2e-82   
ref|XP_006482430.1|  PREDICTED: developmental protein SEPALLATA 1...    263   2e-82   
gb|AIU94287.1|  SEPALLATA1-like protein                                 264   2e-82   
ref|XP_007209505.1|  hypothetical protein PRUPE_ppa010391mg             263   3e-82   
ref|XP_004154725.1|  PREDICTED: developmental protein SEPALLATA 2...    263   3e-82   
ref|XP_008240082.1|  PREDICTED: MADS-box protein CMB1-like              263   3e-82   
ref|XP_010694134.1|  PREDICTED: developmental protein SEPALLATA 1...    263   4e-82   
gb|AAK21254.1|AF335241_1  MADS-box transcription factor FBP23           263   5e-82   Petunia x hybrida [garden petunia]
ref|XP_006440804.1|  hypothetical protein CICLE_v10021357mg             264   7e-82   
ref|NP_001233976.1|  MADS-box transcription factor MADS-rin             267   8e-82   
ref|XP_007139420.1|  hypothetical protein PHAVU_008G027900g             262   1e-81   
gb|ADU15479.1|  SEP4                                                    261   1e-81   
ref|NP_001267667.1|  developmental protein SEPALLATA 2-like             261   1e-81   
gb|ACJ64681.1|  MADS-box protein MADS4                                  261   1e-81   Musa acuminata AAA Group [Cavendish banana]
ref|XP_008801852.1|  PREDICTED: agamous-like MADS-box protein AGL...    261   2e-81   
ref|XP_004507288.1|  PREDICTED: developmental protein SEPALLATA 1...    261   2e-81   
gb|AAF77579.1|AF072534_1  pepper MADS-box protein                       258   2e-81   Capsicum annuum
ref|XP_009415892.1|  PREDICTED: agamous-like MADS-box protein AGL...    261   2e-81   
gb|AEW50208.1|  SEP1                                                    261   3e-81   
ref|XP_006477713.1|  PREDICTED: developmental protein SEPALLATA 1...    261   4e-81   
gb|KEH25149.1|  MADS-box transcription factor                           260   4e-81   
gb|AEJ76841.1|  MADS17                                                  260   4e-81   
ref|XP_010694125.1|  PREDICTED: developmental protein SEPALLATA 1...    260   4e-81   
ref|XP_007215876.1|  hypothetical protein PRUPE_ppa010548mg             260   5e-81   
ref|XP_003544012.1|  PREDICTED: developmental protein SEPALLATA 1...    260   6e-81   
ref|NP_001238296.1|  MADS-box protein                                   260   6e-81   
ref|XP_009788128.1|  PREDICTED: MADS-box protein CMB1-like              259   6e-81   
ref|XP_007151389.1|  hypothetical protein PHAVU_004G042300g             260   7e-81   
gb|AIU94433.1|  MADS-box transcription factor 2 isoform 1               259   7e-81   
emb|CAX65570.1|  GRCD4 protein                                          259   9e-81   Gerbera hybrid cultivar
gb|ADJ67241.1|  MADS box transcription factor 11                        259   1e-80   
sp|Q39685.1|CMB1_DIACA  RecName: Full=MADS-box protein CMB1             259   1e-80   Dianthus caryophyllus [carnation]
ref|XP_004507289.1|  PREDICTED: developmental protein SEPALLATA 1...    259   1e-80   
gb|AIE44769.1|  putative MADS-domain transcription factor AGL2          259   1e-80   
gb|KHG17252.1|  Developmental SEPALLATA 2 -like protein                 259   1e-80   
gb|ADC79707.1|  SEPALLATA1-like protein                                 259   2e-80   Euptelea pleiosperma
gb|ACJ64678.1|  MADS-box protein MADS2                                  259   2e-80   Musa acuminata AAA Group [Cavendish banana]
ref|XP_004507287.1|  PREDICTED: developmental protein SEPALLATA 1...    259   2e-80   
gb|AIU94434.1|  MADS-box transcription factor 2 isoform 2               258   2e-80   
ref|XP_003552609.1|  PREDICTED: developmental protein SEPALLATA 1...    259   2e-80   
ref|XP_008230292.1|  PREDICTED: developmental protein SEPALLATA 1...    258   2e-80   
ref|XP_006585806.1|  PREDICTED: developmental protein SEPALLATA 1...    258   3e-80   
ref|XP_011021072.1|  PREDICTED: developmental protein SEPALLATA 2...    258   4e-80   
gb|AFM30904.1|  transcription factor MADS4                              258   4e-80   
gb|ABK41485.1|  putative MADS box protein                               257   5e-80   Elaeis guineensis
ref|XP_010917558.1|  PREDICTED: agamous-like MADS-box protein AGL...    257   5e-80   
ref|XP_006593703.1|  PREDICTED: developmental protein SEPALLATA 1...    258   6e-80   
ref|XP_009608616.1|  PREDICTED: developmental protein SEPALLATA 1...    257   7e-80   
gb|AFO68789.1|  floral-binding protein 9                                256   7e-80   
gb|ABQ85952.1|  MADS-box transcription factor SEP-like 3                256   8e-80   Trochodendron aralioides
ref|XP_009773225.1|  PREDICTED: MADS-box protein CMB1-like isofor...    254   9e-80   
ref|XP_003621519.1|  MADS-box protein                                   256   1e-79   
ref|XP_010913017.1|  PREDICTED: agamous-like MADS-box protein AGL...    256   1e-79   
ref|XP_011014957.1|  PREDICTED: developmental protein SEPALLATA 2...    256   1e-79   
ref|XP_010917559.1|  PREDICTED: agamous-like MADS-box protein AGL...    256   1e-79   
ref|XP_010694117.1|  PREDICTED: developmental protein SEPALLATA 1...    256   1e-79   
gb|AFK42306.1|  unknown                                                 256   2e-79   
gb|AIU94430.1|  MADS-box transcription factor 2 isoform 2               256   2e-79   
ref|XP_006602962.1|  PREDICTED: developmental protein SEPALLATA 1...    256   2e-79   
ref|XP_008230291.1|  PREDICTED: developmental protein SEPALLATA 1...    256   2e-79   
gb|ADD25177.1|  SEP1-1                                                  255   2e-79   Cabomba caroliniana
ref|XP_008360083.1|  PREDICTED: MADS-box protein CMB1-like              255   2e-79   
ref|XP_009356441.1|  PREDICTED: MADS-box protein CMB1-like              255   3e-79   
ref|XP_008801853.1|  PREDICTED: agamous-like MADS-box protein AGL...    255   3e-79   
ref|XP_008350888.1|  PREDICTED: MADS-box protein CMB1-like              255   3e-79   
ref|XP_007215877.1|  hypothetical protein PRUPE_ppa010548mg             255   3e-79   
ref|XP_003531877.1|  PREDICTED: developmental protein SEPALLATA 1...    256   3e-79   
gb|KHN29767.1|  Developmental protein SEPALLATA 2                       255   5e-79   
gb|AGW23364.1|  MADS box protein MADS62                                 255   5e-79   
ref|XP_006477712.1|  PREDICTED: developmental protein SEPALLATA 1...    256   5e-79   
gb|AAF22138.1|AF129875_1  MADS box transcription factor MADS1           254   7e-79   Capsicum annuum
gb|AJC01940.1|  MADS-box protein                                        254   9e-79   
ref|NP_001234201.1|  TAGL2 transcription factor                         254   9e-79   
ref|XP_004304204.1|  PREDICTED: developmental protein SEPALLATA 2...    254   9e-79   
gb|AFX72877.1|  MADS-box protein SEP2A                                  254   1e-78   
gb|AAP83390.1|  SEPALLATA1-like MADS-box                                253   1e-78   Pachysandra terminalis
ref|XP_006603756.1|  PREDICTED: MADS-box protein isoform X1             254   1e-78   
gb|AIU94432.1|  MADS-box transcription factor 2 isoform 3               254   1e-78   
ref|XP_009615088.1|  PREDICTED: MADS-box protein CMB1-like isofor...    253   1e-78   
gb|AEF59025.1|  MADS-1                                                  254   1e-78   
ref|XP_008230290.1|  PREDICTED: developmental protein SEPALLATA 1...    254   2e-78   
dbj|BAM71401.1|  transcription factor                                   253   2e-78   
gb|AAX15924.1|  AGL9.2                                                  253   2e-78   Persea americana
ref|XP_008243812.1|  PREDICTED: MADS-box protein CMB1-like isofor...    253   2e-78   
ref|XP_003516451.1|  PREDICTED: developmental protein SEPALLATA 1...    253   2e-78   
gb|AAY30858.1|  MADS-box transcription factor                           253   3e-78   Prunus dulcis [sweet almond]
gb|AHM92083.1|  MADS-box protein 7                                      253   3e-78   
ref|XP_007221848.1|  hypothetical protein PRUPE_ppa1027139mg            253   3e-78   
ref|XP_011099041.1|  PREDICTED: developmental protein SEPALLATA 1...    253   4e-78   
ref|XP_009608615.1|  PREDICTED: developmental protein SEPALLATA 1...    253   4e-78   
emb|CDP02339.1|  unnamed protein product                                253   4e-78   
ref|NP_001233911.1|  MADS-box protein                                   253   4e-78   
gb|AEJ76843.1|  MADS19                                                  252   4e-78   
ref|XP_011099040.1|  PREDICTED: developmental protein SEPALLATA 1...    253   4e-78   
ref|XP_009419371.1|  PREDICTED: agamous-like MADS-box protein AGL...    252   5e-78   
ref|XP_004491904.1|  PREDICTED: developmental protein SEPALLATA 1...    253   5e-78   
ref|XP_006338336.1|  PREDICTED: developmental protein SEPALLATA 1...    252   5e-78   
gb|AFO68779.1|  agamous-like protein 3                                  251   6e-78   
ref|NP_001234380.1|  MADS-box protein 1                                 252   6e-78   
ref|XP_010913018.1|  PREDICTED: agamous-like MADS-box protein AGL...    251   8e-78   
ref|XP_010558530.1|  PREDICTED: developmental protein SEPALLATA 1       252   8e-78   
gb|AAX69068.1|  MADS box protein M6                                     252   9e-78   Pisum sativum [garden pea]
gb|AFS60086.1|  MADS box transcription factor SEP1                      251   1e-77   
ref|XP_006345102.1|  PREDICTED: MADS-box protein CMB1-like              251   1e-77   
ref|XP_009121545.1|  PREDICTED: developmental protein SEPALLATA 1       251   1e-77   
ref|XP_008230289.1|  PREDICTED: developmental protein SEPALLATA 1...    251   1e-77   
ref|XP_010099309.1|  Developmental protein SEPALLATA 2                  251   2e-77   
gb|AES77737.2|  MADS-box transcription factor                           251   2e-77   
ref|XP_010549963.1|  PREDICTED: developmental protein SEPALLATA 1       251   2e-77   
gb|AHW58036.1|  SEP1/2                                                  251   2e-77   
ref|XP_002263039.1|  PREDICTED: MADS-box protein CMB1 isoform X2        250   3e-77   Vitis vinifera
gb|AFU81295.1|  SEPALLATA1                                              250   3e-77   
ref|XP_004491903.1|  PREDICTED: developmental protein SEPALLATA 1...    250   3e-77   
ref|XP_009757151.1|  PREDICTED: developmental protein SEPALLATA 1...    250   4e-77   
ref|XP_006477711.1|  PREDICTED: developmental protein SEPALLATA 1...    251   4e-77   
ref|XP_009373783.1|  PREDICTED: developmental protein SEPALLATA 1...    250   4e-77   
gb|AET98846.1|  SEPALLATA1                                              249   6e-77   
dbj|BAM34478.1|  MADS-box transcription factor                          249   6e-77   
ref|XP_004299281.1|  PREDICTED: MADS-box protein CMB1-like              250   6e-77   
gb|ABC70706.1|  MADS-box transcription factor                           248   1e-76   Asparagus virgatus
emb|CAA04323.1|  MADS-box protein                                       249   1e-76   Malus domestica [apple tree]
ref|XP_010315869.1|  PREDICTED: MADS-box protein isoform X1             249   1e-76   
gb|KCW48935.1|  hypothetical protein EUGRSUZ_K02546                     249   1e-76   
gb|AHY82573.1|  MADS-box protein 6                                      248   2e-76   
gb|AAQ83834.1|  MADS box protein                                        248   2e-76   Asparagus officinalis
ref|NP_001281016.1|  MADS-box protein CMB1-like                         248   2e-76   
dbj|BAC80255.1|  MADS-box transcription factor                          248   2e-76   Houttuynia cordata [chameleon-plant]
gb|ABD62860.1|  SEP3.2                                                  247   2e-76   Persea borbonia [red bay]
ref|XP_009337956.1|  PREDICTED: MADS-box protein CMB1-like              248   2e-76   
dbj|BAM71399.1|  transcription factor                                   248   3e-76   
gb|AEL33631.1|  SEPALLATA1                                              248   3e-76   
ref|NP_001280893.1|  developmental protein SEPALLATA 1                  248   3e-76   
emb|CDY26462.1|  BnaC09g42060D                                          248   3e-76   
gb|AHH28254.1|  MADS-box transcription factor                           247   3e-76   
gb|AAZ77748.1|  AGL2-like MADS box 3                                    248   3e-76   Castanea mollissima
ref|XP_007037631.1|  K-box region and MADS-box transcription fact...    253   4e-76   
gb|AGV54737.1|  developmental protein SEPALLATA 2-like protein          248   4e-76   
gb|AEX58639.1|  AGL2-1                                                  247   4e-76   
ref|XP_009373782.1|  PREDICTED: developmental protein SEPALLATA 1...    247   4e-76   
gb|AAX15918.1|  AGL9                                                    247   5e-76   Eschscholzia californica
ref|XP_003549578.1|  PREDICTED: MADS-box protein CMB1-like              247   6e-76   
gb|KHN15201.1|  MADS-box protein CMB1                                   247   6e-76   
ref|XP_006856372.1|  hypothetical protein AMTR_s00047p00190220          247   7e-76   
ref|XP_011071269.1|  PREDICTED: floral homeotic protein APETALA 1       254   7e-76   
gb|ABV23569.2|  MADS-box protein                                        246   8e-76   Populus deltoides
gb|AAC25922.1|  MADS-box protein 1                                      246   9e-76   Malus domestica [apple tree]
gb|ACB69509.1|  SEPALLATA3-like MADS-box protein                        246   1e-75   Crocus sativus [saffron crocus]
emb|CDX69499.1|  BnaA10g18480D                                          246   1e-75   
ref|XP_007151388.1|  hypothetical protein PHAVU_004G042300g             245   2e-75   
gb|AAD09206.1|  putative MADS-box family transcription factor           246   2e-75   Pinus radiata
emb|CAE46179.1|  AGL2-like MADS box transcription factor                244   2e-75   Elaeis guineensis
gb|AAZ95252.1|  MADS box protein SEP1                                   246   2e-75   Dendrobium crumenatum
ref|XP_006400104.1|  hypothetical protein EUTSA_v10014493mg             246   2e-75   
gb|AAX15920.1|  AGL9                                                    245   3e-75   Liriodendron tulipifera
ref|XP_007155209.1|  hypothetical protein PHAVU_003G182800g             245   3e-75   
gb|KHN18378.1|  MADS-box protein CMB1                                   245   3e-75   
emb|CAL36576.1|  deficiens H49 homologue                                245   4e-75   Misopates orontium
emb|CAA64741.1|  DEFH49                                                 245   4e-75   Antirrhinum majus [garden snapdragon]
gb|AAX15922.1|  AGL2                                                    244   4e-75   Acorus americanus [sweetflag]
gb|AAY21913.2|  putative MADS box protein                               245   4e-75   Musa acuminata [banana]
gb|AAA32732.1|  transcription factor                                    245   4e-75   Arabidopsis thaliana [mouse-ear cress]
gb|AHW52539.1|  SEPALLATA-like MADS-box protein 4                       245   4e-75   
ref|XP_009761698.1|  PREDICTED: MADS-box protein CMB1-like              244   4e-75   
ref|XP_010250667.1|  PREDICTED: agamous-like MADS-box protein AGL...    244   5e-75   
ref|XP_008243814.1|  PREDICTED: MADS-box protein CMB1-like isofor...    244   5e-75   
emb|CBI27678.3|  unnamed protein product                                244   6e-75   
emb|CAN59955.1|  hypothetical protein VITISV_006723                     244   7e-75   Vitis vinifera
ref|XP_008801850.1|  PREDICTED: agamous-like MADS-box protein AGL...    245   7e-75   
ref|XP_009608617.1|  PREDICTED: developmental protein SEPALLATA 1...    244   8e-75   
gb|AFO68778.1|  agamous-like protein 2                                  243   8e-75   
gb|AFO68784.1|  floral-binding protein 9                                243   9e-75   
dbj|BAC80253.1|  MADS-box transcription factor                          244   1e-74   Houttuynia cordata [chameleon-plant]
ref|XP_002311352.1|  MADS-box protein 4                                 243   1e-74   Populus trichocarpa [western balsam poplar]
ref|NP_001242365.1|  uncharacterized protein LOC100797819               243   1e-74   
dbj|BAO74162.1|  MADS-box transcription factor SEP1.2                   244   1e-74   
gb|AHC54178.1|  sepallata-like MADS box transcription factor 3          241   1e-74   
ref|XP_008341807.1|  PREDICTED: developmental protein SEPALLATA 1...    243   2e-74   
ref|NP_001275579.1|  MADS-box protein CMB1-like                         243   2e-74   
dbj|BAM34481.1|  MADS-box transcription factor                          243   2e-74   
gb|ADD25191.1|  SEP3                                                    242   2e-74   Nelumbo nucifera [Indian lotus]
ref|XP_002873742.1|  hypothetical protein ARALYDRAFT_909555             243   2e-74   
ref|NP_001268114.1|  MADS-box protein 4                                 243   2e-74   
gb|AHM92082.1|  MADS-box protein 6                                      243   3e-74   
gb|AAX53103.1|  AGL2-like protein                                       242   3e-74   Magnolia grandiflora [southern magnolia]
ref|XP_011018962.1|  PREDICTED: MADS-box protein CMB1-like              242   3e-74   
ref|XP_009757152.1|  PREDICTED: developmental protein SEPALLATA 1...    242   3e-74   
gb|AHC54147.1|  sepallata-like MADS box transcription factor 3          239   4e-74   
ref|XP_008811037.1|  PREDICTED: agamous-like MADS-box protein AGL...    242   4e-74   
gb|AFO68783.1|  floral-binding protein 9                                241   5e-74   
gb|AAT46095.1|  SEPALLATA-like protein                                  242   5e-74   Akebia trifoliata
ref|XP_004490238.1|  PREDICTED: MADS-box protein CMB1-like isofor...    242   6e-74   
ref|XP_010678363.1|  PREDICTED: MADS-box protein CMB1-like              242   6e-74   
dbj|BAC80254.1|  MADS-box transcription factor                          241   8e-74   Houttuynia cordata [chameleon-plant]
gb|ABQ85951.1|  MADS-box transcription factor SEP-like 2                241   9e-74   Trochodendron aralioides
ref|XP_006440805.1|  hypothetical protein CICLE_v10021357mg             241   9e-74   
gb|KFK25803.1|  hypothetical protein AALP_AA8G163200                    241   1e-73   
ref|XP_009378252.1|  PREDICTED: developmental protein SEPALLATA 1...    241   1e-73   
ref|XP_009384296.1|  PREDICTED: MADS-box transcription factor 8-like    240   2e-73   
gb|KHG12954.1|  MADS-box CMB1                                           241   2e-73   
gb|AHC54165.1|  sepallata-like MADS box transcription factor 3          238   2e-73   
ref|XP_006354102.1|  PREDICTED: MADS-box protein CMB1-like              240   2e-73   
gb|ADD25197.1|  SEP2                                                    239   2e-73   Nuphar advena
gb|KCW83762.1|  hypothetical protein EUGRSUZ_B00633                     241   2e-73   
emb|CAA04920.1|  MdMADS9                                                240   2e-73   Malus domestica [apple tree]
gb|AGS42240.1|  MADS-box protein                                        240   3e-73   
gb|ADL36751.1|  MADS domain class transcription factor                  240   3e-73   
ref|NP_568322.1|  MADS box transcription factor SEPALLATA 1             240   3e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010453727.1|  PREDICTED: developmental protein SEPALLATA 1       240   3e-73   
gb|AHC54188.1|  sepallata-like MADS box transcription factor 3          237   3e-73   
gb|ADL36747.1|  MADS domain class transcription factor                  239   3e-73   
dbj|BAL05005.1|  putative MADS box protein                              239   4e-73   
ref|XP_004490237.1|  PREDICTED: MADS-box protein CMB1-like isofor...    239   4e-73   
ref|XP_009131500.1|  PREDICTED: developmental protein SEPALLATA 1...    240   4e-73   
ref|NP_001280849.1|  MADS-box protein CMB1-like                         239   4e-73   
emb|CAA04322.1|  MADS-box protein                                       239   5e-73   Malus domestica [apple tree]
ref|XP_010663486.1|  PREDICTED: MADS-box protein CMB1 isoform X1        240   5e-73   
gb|AHC54144.1|  sepallata-like MADS box transcription factor 3          237   5e-73   
gb|AFO68785.1|  floral-binding protein 9                                239   5e-73   
gb|ACB69510.1|  SEPALLATA3-like MADS-box protein                        239   5e-73   Crocus sativus [saffron crocus]
ref|XP_006579436.1|  PREDICTED: uncharacterized protein LOC100805...    239   5e-73   
gb|AAF76381.1|AF068723_1  MADS-box protein MADS4                        239   6e-73   Nicotiana tabacum [American tobacco]
ref|XP_009757345.1|  PREDICTED: developmental protein SEPALLATA 1...    239   6e-73   
gb|ADC79703.1|  SEPALLATA3-like protein                                 239   6e-73   
ref|XP_008811035.1|  PREDICTED: agamous-like MADS-box protein AGL...    239   7e-73   
gb|KDP41334.1|  hypothetical protein JCGZ_15741                         238   7e-73   
gb|AHY82574.1|  MADS-box protein 7                                      239   7e-73   
gb|AFO68782.1|  floral-binding protein 9                                238   7e-73   
ref|XP_009598871.1|  PREDICTED: MADS-box protein CMB1-like              239   7e-73   
ref|XP_008801851.1|  PREDICTED: agamous-like MADS-box protein AGL...    239   8e-73   
gb|ABD60322.1|  SEP2                                                    239   8e-73   
gb|ADD25178.1|  SEP1-2                                                  238   8e-73   
gb|AHW52538.1|  SEPALLATA-like MADS-box protein 3                       239   8e-73   
gb|AHC54154.1|  sepallata-like MADS box transcription factor 3          236   8e-73   
ref|XP_011102259.1|  PREDICTED: developmental protein SEPALLATA 1...    238   9e-73   
gb|ADJ67238.1|  MADS box transcription factor 6                         238   1e-72   
gb|ABC70710.1|  MADS-box transcription factor                           238   1e-72   
gb|AHC54171.1|  sepallata-like MADS box transcription factor 3          236   1e-72   
gb|AFO68772.1|  agamous-like protein 2                                  238   1e-72   
ref|XP_006579434.1|  PREDICTED: uncharacterized protein LOC100805...    238   1e-72   
gb|AHC54189.1|  sepallata-like MADS box transcription factor 3          236   1e-72   
dbj|BAK09619.1|  MADS-box transcription factor                          238   1e-72   
ref|XP_008445436.1|  PREDICTED: truncated transcription factor CA...    238   2e-72   
ref|XP_009589584.1|  PREDICTED: developmental protein SEPALLATA 1...    238   2e-72   
ref|XP_008365428.1|  PREDICTED: developmental protein SEPALLATA 1...    238   2e-72   
gb|ADC79704.1|  SEPALLATA3-like protein                                 238   2e-72   
ref|XP_010420253.1|  PREDICTED: developmental protein SEPALLATA 1...    238   2e-72   
ref|NP_001289642.1|  developmental protein SEPALLATA 1-like             238   2e-72   
gb|AHW52537.1|  SEPALLATA-like MADS-box protein 2                       238   2e-72   
ref|XP_006298399.1|  hypothetical protein CARUB_v10014470mg             238   3e-72   
gb|ADC79706.1|  SEPALLATA3-like protein                                 238   3e-72   
dbj|BAB70747.1|  putative MADS-domain transcription factor MpMADS13     237   3e-72   
ref|XP_008811033.1|  PREDICTED: agamous-like MADS-box protein AGL...    238   3e-72   
gb|AAX15923.1|  AGL9.1                                                  237   3e-72   
gb|ABC70707.1|  MADS-box transcription factor                           237   3e-72   
gb|ADL36750.1|  MADS domain class transcription factor                  237   4e-72   
gb|AHM92084.1|  MADS-box protein 8                                      237   4e-72   
ref|XP_008811034.1|  PREDICTED: agamous-like MADS-box protein AGL...    237   4e-72   
ref|XP_010485469.1|  PREDICTED: developmental protein SEPALLATA 2       237   4e-72   
gb|AHC54161.1|  sepallata-like MADS box transcription factor 3          234   5e-72   
ref|XP_004144258.1|  PREDICTED: MADS-box protein CMB1-like              237   5e-72   
gb|AGW23350.1|  MADS box protein MADS48                                 237   5e-72   
ref|XP_008243815.1|  PREDICTED: MADS-box protein CMB1-like isofor...    236   5e-72   
gb|AHM92085.1|  MADS-box protein 9                                      237   6e-72   
ref|XP_008357795.1|  PREDICTED: LOW QUALITY PROTEIN: developmenta...    236   7e-72   
gb|AHW52536.1|  SEPALLATA-like MADS-box protein 1                       236   7e-72   
gb|AHJ80843.1|  SEPALLATA3                                              236   7e-72   
ref|XP_006579435.1|  PREDICTED: uncharacterized protein LOC100805...    236   7e-72   
gb|KHN34832.1|  MADS-box transcription factor 1                         236   9e-72   
ref|XP_007043947.1|  K-box region and MADS-box transcription fact...    236   9e-72   
ref|XP_010045613.1|  PREDICTED: MADS-box protein CMB1-like              236   9e-72   
ref|XP_006408426.1|  hypothetical protein EUTSA_v10021390mg             236   1e-71   
gb|AHH28301.1|  MADS-box transcription factor                           235   1e-71   
ref|XP_006848294.1|  hypothetical protein AMTR_s00013p00103080          236   1e-71   
dbj|BAM34480.1|  MADS-box transcription factor                          235   1e-71   
ref|NP_001284431.1|  agamous-like MADS-box protein AGL9 homolog         236   1e-71   
ref|XP_004140534.1|  PREDICTED: agamous-like MADS-box protein AGL...    236   1e-71   
gb|AAX13298.1|  MADS box protein SEP3                                   236   1e-71   
ref|XP_006579433.1|  PREDICTED: uncharacterized protein LOC100805...    236   1e-71   
ref|XP_010463632.1|  PREDICTED: developmental protein SEPALLATA 2...    236   1e-71   
gb|ACB69511.1|  SEPALLATA3-like MADS-box protein                        235   1e-71   
gb|AEX92976.1|  MADS box protein 1                                      235   2e-71   
sp|Q38694.1|AGL9_ARADE  RecName: Full=Agamous-like MADS-box prote...    236   2e-71   
ref|XP_009147359.1|  PREDICTED: developmental protein SEPALLATA 2...    236   2e-71   
dbj|BAD38890.1|  MADS box transcription factor                          235   2e-71   
gb|ADU56817.1|  MADS-box protein AGL2 subfamily                         235   2e-71   
ref|XP_006585132.1|  PREDICTED: MADS-box transcription factor 1-l...    235   2e-71   
ref|XP_010653929.1|  PREDICTED: MADS-box protein 4 isoform X1           236   2e-71   
ref|XP_008243816.1|  PREDICTED: MADS-box protein CMB1-like isofor...    234   2e-71   
gb|AHC54190.1|  sepallata-like MADS box transcription factor 3          232   3e-71   
ref|XP_006585130.1|  PREDICTED: MADS-box transcription factor 1-l...    234   3e-71   
ref|XP_006660815.1|  PREDICTED: MADS-box transcription factor 8-like    234   4e-71   
gb|AHC54191.1|  sepallata-like MADS box transcription factor 3          232   4e-71   
ref|XP_009152152.1|  PREDICTED: agamous-like MADS-box protein AGL3      235   4e-71   
ref|XP_010470619.1|  PREDICTED: developmental protein SEPALLATA 2...    234   5e-71   
emb|CDY57524.1|  BnaA05g33600D                                          234   5e-71   
gb|AHC54175.1|  sepallata-like MADS box transcription factor 3          231   6e-71   
gb|AHC54174.1|  sepallata-like MADS box transcription factor 3          231   7e-71   
gb|KFK33520.1|  hypothetical protein AALP_AA5G023700                    234   7e-71   
gb|AHC54157.1|  sepallata-like MADS box transcription factor 3          231   7e-71   
dbj|BAK09620.1|  MADS-box transcription factor                          234   8e-71   
ref|XP_010318407.1|  PREDICTED: MADS-box protein 1 isoform X1           233   1e-70   
ref|XP_002460491.1|  hypothetical protein SORBIDRAFT_02g029310          233   1e-70   
gb|ADP09004.1|  SEP3-like protein                                       233   1e-70   
gb|ABF67487.1|  MADS-domain transcription factor                        233   1e-70   
ref|NP_001289529.1|  agamous-like MADS-box protein AGL9 homolog         233   1e-70   
ref|NP_001105525.1|  MADS27                                             233   1e-70   
gb|ACO72983.1|  SEP3-like MADS-box protein                              233   1e-70   
gb|AEJ76840.1|  MADS16                                                  233   1e-70   
gb|AAQ11687.1|  MADS box protein                                        233   1e-70   
gb|ACF78403.1|  unknown                                                 233   1e-70   
gb|ABD62861.1|  SEP3.1                                                  232   2e-70   
ref|XP_011036099.1|  PREDICTED: agamous-like MADS-box protein AGL...    233   2e-70   
ref|XP_009600809.1|  PREDICTED: agamous-like MADS-box protein AGL...    233   2e-70   
gb|AAT37486.1|  MADS7 protein                                           233   2e-70   
gb|AAT37484.1|  MADS5 protein                                           233   2e-70   
ref|XP_006585131.1|  PREDICTED: MADS-box transcription factor 1-l...    233   2e-70   
gb|AEX58640.1|  AGL2-2                                                  233   2e-70   
ref|XP_007043949.1|  K-box region and MADS-box transcription fact...    233   2e-70   
gb|AGT20512.1|  SEP2.b                                                  233   2e-70   
dbj|BAF34912.1|  MADS-box protein                                       233   2e-70   
ref|XP_006437995.1|  hypothetical protein CICLE_v10032507mg             233   2e-70   
gb|ACB45304.1|  MIKC-type MADS-box transcription factor WM10A           233   2e-70   
ref|NP_001289804.1|  MADS-box transcription factor 8                    233   2e-70   
gb|AFO68788.1|  floral-binding protein 9                                231   2e-70   
gb|AFX72879.1|  MADS-box protein SEP3                                   233   2e-70   
gb|AAK21248.1|AF335235_1  MADS-box transcription factor FBP5            233   2e-70   
gb|AHC54160.1|  sepallata-like MADS box transcription factor 3          229   3e-70   
dbj|BAN89460.1|  sepallata 3                                            232   3e-70   
gb|AAB53193.1|  MADS box protein                                        232   3e-70   
gb|AFH66785.1|  SEP-like MADS-box protein                               232   3e-70   
ref|XP_003601749.1|  MADS-box transcription factor                      232   3e-70   
gb|EEC84853.1|  hypothetical protein OsI_31966                          232   3e-70   
gb|KHN24051.1|  MADS-box transcription factor 1                         232   3e-70   
ref|NP_001063613.1|  Os09g0507200                                       232   3e-70   
dbj|BAD10944.1|  SEPALLATA1 homologous protein                          232   4e-70   
gb|AEL33633.1|  SEPALLATA3                                              232   4e-70   
gb|KCW83763.1|  hypothetical protein EUGRSUZ_B00633                     232   4e-70   
gb|AAU82009.1|  SEPALLATA2                                              232   4e-70   
gb|KEH32046.1|  MADS-box transcription factor                           232   4e-70   
ref|XP_006585129.1|  PREDICTED: MADS-box transcription factor 1-l...    232   4e-70   
gb|AHH28302.1|  MADS-box transcription factor                           231   4e-70   
emb|CDX78653.1|  BnaA03g05650D                                          232   5e-70   
gb|ADX97328.1|  SEPALLATA1-like protein                                 231   5e-70   
ref|NP_001119230.1|  MADS box transcription factor SEPALLATA 1          232   5e-70   
emb|CDY51202.1|  BnaA06g39810D                                          232   6e-70   
dbj|BAF75018.1|  MADS-box protein                                       231   6e-70   
emb|CAH04878.1|  MADS domain protein                                    231   7e-70   
ref|NP_001234384.1|  agamous-like MADS-box protein AGL9 homolog         231   7e-70   
gb|AHC54155.1|  sepallata-like MADS box transcription factor 3          229   7e-70   
ref|XP_002884314.1|  SEPALLATA2                                         231   7e-70   
gb|AGH61294.1|  sepallata 3                                             231   7e-70   
ref|NP_186880.1|  developmental protein SEPALLATA 2                     231   7e-70   
ref|NP_001236390.1|  MADS transcription factor                          231   8e-70   
gb|AAO42085.1|  putative floral homeotic protein AGL4                   231   8e-70   
gb|AAT37483.1|  MADS4 protein                                           231   8e-70   
emb|CAM59053.1|  MIKC-type MADS-box transcription factor WM10A          231   8e-70   
gb|AAL14197.1|  SEPELLATA3-like MADS-box protein                        228   9e-70   
emb|CAD48302.1|  MADS-box protein AGL3-a                                231   1e-69   
ref|XP_002875226.1|  predicted protein                                  231   1e-69   
gb|ACA24481.1|  agamous-like 9 protein 1                                230   1e-69   
dbj|BAG55316.1|  transcription factor                                   231   1e-69   
gb|AAT37485.1|  MADS6 protein                                           231   1e-69   
ref|XP_004504398.1|  PREDICTED: agamous-like MADS-box protein AGL...    231   1e-69   
emb|CDY04164.1|  BnaA09g19420D                                          231   1e-69   
sp|Q03489.2|AGL9_PETHY  RecName: Full=Agamous-like MADS-box prote...    230   1e-69   
dbj|BAF75016.1|  MADS-box protein                                       230   2e-69   
gb|AET04966.2|  MADS-box transcription factor                           230   2e-69   
gb|AAT37482.1|  MADS3 protein                                           230   2e-69   
ref|XP_011086825.1|  PREDICTED: agamous-like MADS-box protein AGL...    230   2e-69   
ref|XP_006352168.1|  PREDICTED: agamous-like MADS-box protein AGL...    230   2e-69   
ref|XP_004957289.1|  PREDICTED: MADS-box transcription factor 8-l...    230   2e-69   
ref|XP_011020782.1|  PREDICTED: agamous-like MADS-box protein AGL...    230   2e-69   
dbj|BAF75017.1|  MADS-box protein                                       230   2e-69   
tpg|DAA40489.1|  TPA: zea mays MADS7                                    233   2e-69   
ref|XP_009117898.1|  PREDICTED: developmental protein SEPALLATA 2       230   2e-69   
gb|AAO22982.1|  MADS-box transcription factor CDM44                     230   2e-69   
ref|NP_001288311.1|  MADS-box transcription factor 7-like               230   2e-69   
gb|EPS70807.1|  hypothetical protein M569_03954                         230   2e-69   
emb|CDY34718.1|  BnaA01g33070D                                          230   2e-69   
gb|ABF57932.1|  MADS-box transcription factor TaAGL30                   230   2e-69   
emb|CAA70485.1|  putative MADS-domain transcription factor              229   3e-69   
gb|AAF13262.1|AF198176_1  MADS box protein DOMADS3                      229   3e-69   
gb|AHM92068.1|  MADS-box protein 8                                      230   3e-69   
sp|O65874.1|MTF1_PEA  RecName: Full=MADS-box transcription factor 1     230   3e-69   
ref|XP_006288512.1|  hypothetical protein CARUB_v10001783mg             230   3e-69   
gb|ACB69512.1|  SEPALLATA3-like MADS-box protein                        229   3e-69   
dbj|BAM34479.1|  MADS-box transcription factor                          229   3e-69   
gb|AGV31155.1|  E-class MADS-box protein                                229   3e-69   
emb|CDX70651.1|  BnaC03g07350D                                          230   4e-69   
gb|AGT20511.1|  SEP2.a                                                  229   4e-69   
gb|AHH28303.1|  MADS-box transcription factor                           228   4e-69   
gb|ABS17562.1|  SEPALLATA 3-like protein                                229   4e-69   
gb|AAO49811.1|  SEP3-related MADS-box protein                           229   5e-69   
ref|XP_007163780.1|  hypothetical protein PHAVU_001G263400g             229   5e-69   
gb|ABE02212.1|  SEP-like                                                229   5e-69   
gb|ABF57918.1|  MADS-box transcription factor TaAGL16                   229   5e-69   
ref|XP_010936438.1|  PREDICTED: agamous-like MADS-box protein AGL...    229   6e-69   
gb|AFO68775.1|  agamous-like protein 2                                  228   6e-69   
ref|XP_010531079.1|  PREDICTED: developmental protein SEPALLATA 3...    229   7e-69   
emb|CAB97355.1|  MADS-box protein 9                                     229   7e-69   
sp|Q0J466.2|MADS7_ORYSJ  RecName: Full=MADS-box transcription fac...    229   8e-69   
gb|AEO45959.1|  SEPALLATA3-like protein                                 228   1e-68   
gb|ABF57929.1|  MADS-box transcription factor TaAGL28                   228   1e-68   
ref|XP_006395681.1|  hypothetical protein EUTSA_v10004767mg             229   1e-68   
ref|XP_010527982.1|  PREDICTED: agamous-like MADS-box protein AGL3      228   1e-68   
ref|XP_010531071.1|  PREDICTED: developmental protein SEPALLATA 3...    228   1e-68   
gb|ABD65406.1|  MADS-box protein                                        228   1e-68   
gb|ADU15477.1|  SEP3                                                    228   1e-68   
ref|XP_007163779.1|  hypothetical protein PHAVU_001G263400g             228   1e-68   
gb|AEE60891.1|  MADS-box protein 5                                      228   1e-68   
ref|XP_004974003.1|  PREDICTED: MADS-box transcription factor 7-like    228   2e-68   
gb|AAC49816.2|  MADS box protein                                        228   2e-68   
gb|AFU81296.1|  SEPALLATA3                                              228   2e-68   
ref|XP_006437996.1|  hypothetical protein CICLE_v10032507mg             228   2e-68   
gb|AIU94765.1|  class E MADS-domain transcription factor                227   2e-68   
ref|XP_004957288.1|  PREDICTED: MADS-box transcription factor 8-l...    228   2e-68   
ref|XP_010514140.1|  PREDICTED: agamous-like MADS-box protein AGL...    229   2e-68   
gb|ABI60898.1|  MADS-box transcription factor                           228   2e-68   
ref|XP_004504397.1|  PREDICTED: agamous-like MADS-box protein AGL...    227   2e-68   
gb|AHW58034.1|  SEP3                                                    227   2e-68   
ref|XP_006437997.1|  hypothetical protein CICLE_v10032507mg             228   3e-68   
emb|CAA64742.1|  DEFH72                                                 227   3e-68   
ref|NP_001171777.1|  MADS-domain transcription factor 4                 227   3e-68   
ref|XP_008786031.1|  PREDICTED: truncated transcription factor CA...    227   4e-68   
ref|XP_004502275.1|  PREDICTED: MADS-box transcription factor 1-l...    227   4e-68   
gb|ACF83306.1|  unknown                                                 227   4e-68   
ref|XP_008811809.1|  PREDICTED: MADS-box protein CMB1-like isofor...    227   4e-68   
ref|XP_010066815.1|  PREDICTED: MADS-box protein CMB1                   227   4e-68   
gb|AIU94763.1|  class E MADS-domain transcription factor                226   5e-68   
ref|XP_009129078.1|  PREDICTED: agamous-like MADS-box protein AGL3      227   5e-68   
ref|XP_006291635.1|  hypothetical protein CARUB_v10017787mg             228   5e-68   
gb|ACG32919.1|  MADS-box transcription factor 8                         226   5e-68   
ref|NP_849930.1|  protein SEPALLATA 4                                   227   5e-68   
dbj|BAJ11578.1|  transcription factor                                   226   6e-68   
emb|CAA75241.1|  M79 protein                                            226   6e-68   
ref|XP_004502274.1|  PREDICTED: MADS-box transcription factor 1-l...    226   7e-68   
ref|NP_001289232.1|  agamous-like MADS-box protein AGL9 homolog         226   7e-68   
ref|XP_010425168.1|  PREDICTED: agamous-like MADS-box protein AGL...    228   7e-68   
ref|NP_178466.1|  protein SEPALLATA 4                                   226   7e-68   
ref|XP_010530562.1|  PREDICTED: developmental protein SEPALLATA 3...    226   7e-68   
ref|XP_008459849.1|  PREDICTED: agamous-like MADS-box protein AGL...    225   8e-68   
gb|AAV84087.1|  MADS box transcription factor                           224   8e-68   
ref|XP_010425169.1|  PREDICTED: agamous-like MADS-box protein AGL...    228   8e-68   



>ref|XP_009788435.1| PREDICTED: MADS-box protein CMB1-like [Nicotiana sylvestris]
Length=239

 Score =   295 bits (755),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 154/233 (66%), Positives = 184/233 (79%), Gaps = 14/233 (6%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSSSISKTLERYH+
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHR  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSY  LEA Q+S DSQ++YQEY KLKA VEVLQQSQRH+LGEDL QL IK+LEQLE Q+D
Sbjct  73   CSYSNLEAGQSSTDSQNSYQEYTKLKARVEVLQQSQRHILGEDLGQLNIKELEQLERQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
            +SL+ IRS RT++++DQLS+L QKEQ+LLE+N++L+IKL E  N  A+ T W+   QN+Q
Sbjct  133  SSLRQIRSRRTQNILDQLSDLQQKEQSLLEINRSLKIKLDE--NYVAYQTHWDTGEQNIQ  190

Query  542  YGQHSSSQ--------QCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
            + +H  +Q        QC +T    YN       +N+ +ST N  GVLPGWML
Sbjct  191  F-RHRPAQPQEFFQPLQCNSTMPNRYNQAPW---DNIESSTQNATGVLPGWML  239



>emb|CAC81072.1| MADS box transcription factor [Daucus carota subsp. sativus]
Length=246

 Score =   289 bits (740),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 146/236 (62%), Positives = 179/236 (76%), Gaps = 13/236 (6%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCS+SS++KTL RYH+
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSTSSMNKTLGRYHR  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYGALE  QT +D+QS+YQEY+KLKA VE LQQSQRHLLGE+L QLG K+LE+LE Q+D
Sbjct  73   CSYGALETGQTDRDTQSSYQEYIKLKAKVEALQQSQRHLLGEELGQLGTKELEELERQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWE-PQGQNM  538
            ++L+ +RST+T++M+DQLS+L QKEQ L+E+NKALR KL E  N+    + WE  +  N+
Sbjct  133  STLRQVRSTKTQYMLDQLSDLQQKEQELVEINKALRNKLEE--NDVRIQSQWEAAERNNV  190

Query  539  QYGQHSS----------SQQCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
             Y  H +          S +C NT  +GYN           T T N +GV+PGWML
Sbjct  191  AYRSHPAEHPPDHGVFESLECNNTMHMGYNSAMNDHQMASATPTQNASGVIPGWML  246



>ref|NP_001234670.1| MADS-box transcription factor [Solanum lycopersicum]
 gb|AAM15775.1|AF448522_1 MADS-box transcription factor MADS-RIN [Solanum lycopersicum]
 gb|AAZ83587.1| MADS-box transcription factor MADS-RIN [Solanum lycopersicum]
 gb|AAZ83588.1| MADS-box transcription factor [Solanum lycopersicum]
Length=242

 Score =   289 bits (740),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 151/233 (65%), Positives = 176/233 (76%), Gaps = 11/233 (5%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELSILCDAE+ALIIFS+RGKLYEFCS+SS+SKTLERYH+
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSILCDAEIALIIFSSRGKLYEFCSNSSMSKTLERYHR  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
             +YG LE  QTS DSQ+NYQEYLKLK  VE+LQQSQRHLLGEDL QLG KDLEQLE Q+D
Sbjct  73   YNYGTLEGTQTSSDSQNNYQEYLKLKTRVEMLQQSQRHLLGEDLGQLGTKDLEQLERQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
            +SL+ IRST+T+H++DQL+EL QKEQ+L E+NK+LRIKL E      F T W    Q++Q
Sbjct  133  SSLRQIRSTKTQHILDQLAELQQKEQSLTEMNKSLRIKLEELG--VTFQTSWHCGEQSVQ  190

Query  542  YGQHSSSQQ--------CQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
            Y     S          C NT  I Y   ++Q   N   ST +  GV+PGWML
Sbjct  191  YRHEQPSHHEGFFQHVNCNNTLPISYGYDNVQP-ENAAPSTHDATGVVPGWML  242



>ref|XP_006363565.1| PREDICTED: MADS-box protein CMB1-like [Solanum tuberosum]
Length=241

 Score =   286 bits (733),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 149/231 (65%), Positives = 178/231 (77%), Gaps = 8/231 (3%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELSILC+AEVALIIFSNRGKLYEFCS+SS+S TLERYH+
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSILCEAEVALIIFSNRGKLYEFCSTSSMSDTLERYHR  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYG LE  Q+S DSQ+NYQEY+KLKA VEVLQQSQRH+LGEDL QL  KDLEQLE Q+D
Sbjct  73   CSYGDLETGQSSMDSQNNYQEYMKLKARVEVLQQSQRHILGEDLSQLNTKDLEQLERQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQG-QNM  538
            +SL+ IRS RT++M+DQLS+L QKEQ+LLE+N++L+ KL E  N+ A    W   G QN+
Sbjct  133  SSLRQIRSRRTQNMLDQLSDLQQKEQSLLEINRSLKTKLEE--NSVAHQAHWHTTGEQNI  190

Query  539  QYGQHSSS-----QQCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
            Q+ Q  +      Q  Q    I  N  ++   +N+  ST N  G+LPGWML
Sbjct  191  QFRQQPAQSEGFFQPLQCNTNIVPNRYNLAPLDNIEPSTHNATGILPGWML  241



>ref|XP_002263410.2| PREDICTED: MADS-box protein CMB1 [Vitis vinifera]
 emb|CBI27319.3| unnamed protein product [Vitis vinifera]
Length=243

 Score =   286 bits (733),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 143/232 (62%), Positives = 176/232 (76%), Gaps = 8/232 (3%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCS SS+ +TLERY +
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSGSSMPETLERYQR  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSY ALEA+Q +K++Q++YQEYLKLK+ VEVLQ++QR+ LGEDL  LG K+LEQLE+Q+D
Sbjct  73   CSYSALEASQPAKETQNSYQEYLKLKSKVEVLQRTQRNFLGEDLGHLGTKELEQLEHQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
             SLK IRST+T+ M+DQLS+L +KEQ L+E N ALR KLGESS      + WE    N+ 
Sbjct  133  KSLKQIRSTKTQFMLDQLSDLQRKEQILMEANNALRRKLGESSAESGLGSTWEAAAHNLP  192

Query  542  YGQHS-------SSQQCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
            Y +            QC +T QIGYNP  ++   N  ++T N  G +PGWM+
Sbjct  193  YNREPVQSEDFFEPLQCDSTLQIGYNPV-LRVEMNGASTTQNVNGFIPGWMV  243



>ref|NP_001234837.1| MADS-box transcription factor [Solanum lycopersicum]
 gb|ABB70186.1| MADS-box transcription factor [Solanum lycopersicum]
Length=242

 Score =   286 bits (732),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 150/233 (64%), Positives = 175/233 (75%), Gaps = 11/233 (5%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELSILCDAE+ALIIFS+RGKLYEFCS+SS+SKTLERYH+
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSILCDAEIALIIFSSRGKLYEFCSNSSMSKTLERYHR  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
             +YG LE  QTS DSQ+NYQEYLKLK  VE+LQQSQRHLLGEDL QLG KDLEQLE Q+ 
Sbjct  73   YNYGTLEGTQTSSDSQNNYQEYLKLKTRVEMLQQSQRHLLGEDLGQLGTKDLEQLERQLA  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
            +SL+ IRST+T+H++DQL+EL QKEQ+L E+NK+LRIKL E      F T W    Q++Q
Sbjct  133  SSLRQIRSTKTQHILDQLAELQQKEQSLTEMNKSLRIKLEELG--VTFQTSWHCGEQSVQ  190

Query  542  YGQHSSSQQ--------CQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
            Y     S          C NT  I Y   ++Q   N   ST +  GV+PGWML
Sbjct  191  YRHEQPSHHEGFFQHVNCNNTLPISYGYDNVQP-ENAAPSTHDATGVVPGWML  242



>ref|XP_010257958.1| PREDICTED: developmental protein SEPALLATA 1 [Nelumbo nucifera]
Length=243

 Score =   285 bits (730),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 149/232 (64%), Positives = 176/232 (76%), Gaps = 8/232 (3%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSSS+ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYGALEA+Q +K++QS+YQEYLKLKA VEVLQ+SQR+LLGEDL  L  K+LEQLE+Q++
Sbjct  73   CSYGALEASQPAKETQSSYQEYLKLKARVEVLQRSQRNLLGEDLGPLSTKELEQLEHQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
             SLK IRST+T+ M+DQLS+L +KEQ L E N+AL+ KL ESS+ +     WE  GQN+ 
Sbjct  133  MSLKQIRSTKTQLMLDQLSDLQRKEQMLQEANRALKRKLDESSSENPLRLTWEAGGQNIS  192

Query  542  YGQHSSSQ-------QCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
            Y +  S         +  +T QIGYNP        V  S  N  G +PGWML
Sbjct  193  YSRQPSQSEGFFQPLEGNSTLQIGYNPVGPD-QITVAASAQNVNGYIPGWML  243



>ref|XP_004237061.1| PREDICTED: MADS-box protein CMB1 isoform X1 [Solanum lycopersicum]
Length=238

 Score =   284 bits (727),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 148/231 (64%), Positives = 179/231 (77%), Gaps = 11/231 (5%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELSILC+AEVALIIFSNRGKLYEFCS+SS+S TLERYH+
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSILCEAEVALIIFSNRGKLYEFCSTSSMSDTLERYHR  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYG LE  Q+SKDSQ+NYQEY+KLKA VEVLQQSQRH+LGEDL QL  KDLEQLE Q+D
Sbjct  73   CSYGDLETGQSSKDSQNNYQEYMKLKARVEVLQQSQRHILGEDLGQLNTKDLEQLERQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQG-QNM  538
            +SL+ IRS RT++M+DQLS+L QKEQ+LLE+N++L+ KL E+S     +  W   G QN+
Sbjct  133  SSLRLIRSRRTQNMLDQLSDLQQKEQSLLEINRSLKTKLEENS-----VAHWHITGEQNV  187

Query  539  QYGQHSSS-----QQCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
            Q+ Q  +      Q  Q    I  N  ++   +++  ST N  G+LPGWML
Sbjct  188  QFRQQPAQSEGFFQPLQCNTNIVPNRYNVAPLDSIEPSTQNATGILPGWML  238



>ref|XP_010260833.1| PREDICTED: MADS-box protein CMB1 [Nelumbo nucifera]
Length=243

 Score =   284 bits (727),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 147/232 (63%), Positives = 176/232 (76%), Gaps = 8/232 (3%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSSS+ KTL+RY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLDRYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYGALE +Q +K++QS+YQEYLKLKA VEVLQ+SQR+LLGEDL  L  K+LEQLE+Q++
Sbjct  73   CSYGALETSQPAKETQSSYQEYLKLKARVEVLQRSQRNLLGEDLGPLTTKELEQLEHQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
             SLK IRST+T+ M+DQLS+L +KEQ L E N+ L+ KL ESS  +     WE  GQN+ 
Sbjct  133  MSLKQIRSTKTQLMLDQLSDLQRKEQMLQEANRTLKRKLEESSCENPLRLTWEAGGQNIS  192

Query  542  YGQHSSSQ-------QCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
            Y + ++         +C +T QIGYNP        V T T N  G +PGWML
Sbjct  193  YSRQAAQSEGFFQPLECNSTLQIGYNPVG-PDQITVTTPTQNVNGFIPGWML  243



>gb|KHG04329.1| MADS-box CMB1 [Gossypium arboreum]
Length=244

 Score =   284 bits (727),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 144/234 (62%), Positives = 173/234 (74%), Gaps = 11/234 (5%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCS+SS++KTLE+Y+ 
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSTSSMAKTLEKYNS  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
             +YGALE  QT  D+QSNYQEYLKLK+ VEVLQQSQRH LGE++  LG K+LEQLE+Q+D
Sbjct  73   YTYGALEPAQTEIDAQSNYQEYLKLKSKVEVLQQSQRHFLGEEIADLGTKELEQLEHQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
             SLK IRST+ + MIDQLSEL  KE+ LLE N+ LR+KL ES    +  + WE   Q++ 
Sbjct  133  FSLKKIRSTKMQLMIDQLSELQTKEEVLLETNRNLRMKLDES--GPSMRSSWETGEQSIP  190

Query  542  YGQHSSSQQ---------CQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
            Y       Q         C N+ QIGYNP+S+   +    S +  +G +PGWML
Sbjct  191  YNHPPPPPQSEGFFEPLHCNNSLQIGYNPSSVTVEDTATASALAPSGFIPGWML  244



>ref|XP_009625300.1| PREDICTED: MADS-box protein CMB1-like [Nicotiana tomentosiformis]
Length=256

 Score =   285 bits (728),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 146/225 (65%), Positives = 173/225 (77%), Gaps = 9/225 (4%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTF+KRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSSSISKTLERYH 
Sbjct  41   NKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHI  100

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSY  LEA Q+S DSQ++YQEY KLKA VEVLQQSQRH+LGEDL QL IK+LEQ+E Q+D
Sbjct  101  CSYSNLEAGQSSIDSQNSYQEYTKLKARVEVLQQSQRHILGEDLGQLNIKELEQIERQLD  160

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
            +SL+ IRS RT++M+DQLS+L QKEQ+LLE+N++L+IKL E+         ++P     Q
Sbjct  161  SSLRQIRSRRTQNMLDQLSDLQQKEQSLLEINRSLKIKLDEN------YVAYQPHWDTAQ  214

Query  542  YGQHSSSQQCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
              +     QC NT    YN       +N+  ST N  GVLPGWM+
Sbjct  215  PQEFFQPLQCNNTMPNRYNQA---PGDNIEPSTQNATGVLPGWMI  256



>gb|AHW58033.1| SEP4 [Coffea arabica]
Length=239

 Score =   281 bits (720),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 146/232 (63%), Positives = 176/232 (76%), Gaps = 12/232 (5%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELSILCDAEVALI+FSNRGKLYEFCSSSS+SKTLERYH+
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIVFSNRGKLYEFCSSSSMSKTLERYHR  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSY     NQ+SKD QS+YQEYLKLKA VEVLQQSQRHLLGEDL QLG K L+QLE Q+D
Sbjct  73   CSYADAGMNQSSKDPQSDYQEYLKLKARVEVLQQSQRHLLGEDLAQLGAKQLDQLERQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
             SL+ IRST+T+HM+DQLS+L QKE++L+EVNKALR K  E +   A+   W+ +  N++
Sbjct  133  ASLRQIRSTKTQHMLDQLSDLQQKERSLMEVNKALRNKQLEETTA-AYQLSWDSEEHNLR  191

Query  542  YGQHS-------SSQQCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
            +   +          +C N++ + YN   M   +     T N +G+LPGWML
Sbjct  192  HRSQTIHPEGFFQPLEC-NSSIMNYN---MVVADAEAEPTQNPSGILPGWML  239



>gb|AFU61112.1| MADS-box transcription factor MADS-RIN [Capsicum annuum]
Length=241

 Score =   281 bits (719),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 147/235 (63%), Positives = 180/235 (77%), Gaps = 16/235 (7%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAE+ALIIFS+RGKLYEFCSSSS+SKTLERYH+
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEIALIIFSSRGKLYEFCSSSSMSKTLERYHR  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
             +YGALE  Q S DSQ+NYQEYLKLK  VE+LQQSQRH+LGEDL +L IKDLEQLE+Q+D
Sbjct  73   YNYGALEGTQPSADSQNNYQEYLKLKTRVELLQQSQRHMLGEDLGELNIKDLEQLEHQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
            +SL+ IRST+T+HM+DQL+ELHQKEQ+L E+N++L+ KL E     AF T W    Q++Q
Sbjct  133  SSLRQIRSTKTQHMLDQLAELHQKEQSLTEMNESLKTKLEELGV--AFQTSWHSGEQSVQ  190

Query  542  YGQHSSSQQCQNTAQ-IGYNPTSMQ---------ANNNVGTSTMNGAGVLPGWML  676
            Y Q    QQ +   Q + YN  ++             +   ST + +GV+PGWML
Sbjct  191  YRQ----QQPEGFFQHVDYNNNTVSDIRYGYDAVLPKHAAPSTQDASGVVPGWML  241



>emb|CAN84110.1| hypothetical protein VITISV_036170 [Vitis vinifera]
Length=243

 Score =   281 bits (719),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 141/232 (61%), Positives = 175/232 (75%), Gaps = 8/232 (3%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCS SS+ +TLER+ +
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSGSSMPETLERHQR  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSY ALEA+Q +K++Q++YQEYLKLK+ VEVLQ++QR+ LGEDL  LG K+LEQLE+Q+D
Sbjct  73   CSYSALEASQPAKETQNSYQEYLKLKSKVEVLQRTQRNFLGEDLGHLGTKELEQLEHQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
             SLK IRST+T+ M+DQLS+L +K Q L+E N ALR KLGESS      + WE    N+ 
Sbjct  133  KSLKQIRSTKTQFMLDQLSDLQRKVQILMEANNALRRKLGESSAESGLGSTWEAAAHNLP  192

Query  542  YGQHS-------SSQQCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
            Y +            QC +T QIGYNP  ++   N  ++T N  G +PGWM+
Sbjct  193  YNREPVQSEDFFEPLQCDSTLQIGYNPV-LRVEMNGASTTQNVNGFIPGWMV  243



>emb|CDP00462.1| unnamed protein product [Coffea canephora]
Length=239

 Score =   280 bits (717),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 147/233 (63%), Positives = 177/233 (76%), Gaps = 14/233 (6%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELSILCDAEVALI+FSNRGKLYEFCSSSS+SKTLERYH+
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIVFSNRGKLYEFCSSSSMSKTLERYHR  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSY     NQ+SKD Q +YQEYLKLKA VEVLQQSQRHLLGEDL QLG K L+QLE Q+D
Sbjct  73   CSYADAGMNQSSKDPQGDYQEYLKLKAKVEVLQQSQRHLLGEDLAQLGAKQLDQLERQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWE-PQGQNM  538
             SL+ IRST+T+HM+DQLS+L QKE++L+EVNKALR KL E++   AF   W+  +  N+
Sbjct  133  ASLRQIRSTKTQHMLDQLSDLQQKEKSLMEVNKALRNKLEETTA--AFQLSWDVSEEHNL  190

Query  539  QYGQHS-------SSQQCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
            ++   +          +C N++ + YN   M   +     T N +G+LPGWML
Sbjct  191  RHRSQTIHPEGFFQPLEC-NSSIMNYN---MVVADAEAEPTQNPSGILPGWML  239



>gb|ADU56820.1| MADS-box protein AGL2 subfamily [Coffea arabica]
Length=240

 Score =   278 bits (712),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 147/233 (63%), Positives = 176/233 (76%), Gaps = 13/233 (6%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELSILCDAEVALI+FSNRGKLYEFCSSSS+SKTLERYH+
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIVFSNRGKLYEFCSSSSMSKTLERYHR  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSY     NQ+SKD QS+YQEYLKLKA VEVLQQSQRHLLGEDL QLG K L+QLE Q+D
Sbjct  73   CSYADAGMNQSSKDPQSDYQEYLKLKAKVEVLQQSQRHLLGEDLAQLGAKQLDQLERQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWE-PQGQNM  538
             SL+ IRST+T+HM+DQLS+L QKE++L+EVNKALR K  E +   AF   W+  +  N+
Sbjct  133  ASLRQIRSTKTQHMLDQLSDLQQKERSLMEVNKALRNKQLEETTA-AFQLSWDVSEEHNL  191

Query  539  QYGQHS-------SSQQCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
            ++   +          +C N++ + YN   M   +     T N +G+LPGWML
Sbjct  192  RHRSQTIHPEGFFQPLEC-NSSIMNYN---MVVADAEAEPTQNPSGILPGWML  240



>gb|AEL33632.1| SEPALLATA2 [Gossypium hirsutum]
Length=244

 Score =   279 bits (713),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 142/234 (61%), Positives = 170/234 (73%), Gaps = 11/234 (5%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCS+SS++KTLE+Y+ 
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSTSSMAKTLEKYNS  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
             +YGALE  QT  D+QSNYQEYLKLK+ VEVLQQSQRH LGE++  LG K+LEQLE+Q+D
Sbjct  73   YTYGALEPGQTEIDAQSNYQEYLKLKSKVEVLQQSQRHFLGEEIADLGTKELEQLEHQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
             SLK IRST+ + MIDQLSEL  KE+ LLE N+ LR+KL  S    +  + WE    ++ 
Sbjct  133  FSLKKIRSTKMQLMIDQLSELQTKEEVLLETNRNLRMKLDGS--GPSMRSSWETGEHSIP  190

Query  542  YGQHSSSQQ---------CQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
            Y       Q         C N+ QIGYNP S+   +    S +  +G +PGWML
Sbjct  191  YNHPPPPPQSEGFFEPLHCNNSLQIGYNPISVTVEDTATASALAPSGFIPGWML  244



>gb|ABJ98752.1| MADS-box transcription factor MADS-RIN [Capsicum annuum]
Length=243

 Score =   278 bits (712),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 149/233 (64%), Positives = 176/233 (76%), Gaps = 10/233 (4%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAE+ALIIFS+RGKLYEFCSSSS+SKTLERYHK
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEIALIIFSSRGKLYEFCSSSSMSKTLERYHK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
             +YGALE  Q S DSQ+NYQEYLKLK  VEVLQQSQRH+LGEDL +L  KDLEQLE Q+D
Sbjct  73   HNYGALEGTQPSADSQNNYQEYLKLKTRVEVLQQSQRHMLGEDLGELNTKDLEQLERQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWE--PQGQN  535
            +SL+ IRST+T+HM DQL+ELHQKEQ+L E+NK+L+ KL E     AF T W   P  Q+
Sbjct  133  SSLRQIRSTKTQHMFDQLAELHQKEQSLTEMNKSLKTKLEELGV--AFQTSWHSGPGEQS  190

Query  536  MQYGQHSSSQQCQNTAQIGYNPTSMQ-ANNNV-----GTSTMNGAGVLPGWML  676
            +QY Q       Q+     +   +M+   +NV       ST +  GV+PGWML
Sbjct  191  VQYRQQQPEGFFQHVDCNNHTVPNMRYGYDNVPPEYAAPSTQDALGVVPGWML  243



>gb|AEJ76842.1| MADS18 [Gossypium hirsutum]
Length=249

 Score =   278 bits (711),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 142/234 (61%), Positives = 170/234 (73%), Gaps = 11/234 (5%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCS+SS++KTLE+Y+ 
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSTSSMAKTLEKYNS  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
             +YGALE  QT  D+QSNYQEYLKLK+ VEVLQQSQRH LGE++  LG K+LEQLE+Q+D
Sbjct  73   YTYGALEPGQTEIDAQSNYQEYLKLKSKVEVLQQSQRHFLGEEIADLGTKELEQLEHQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
             SLK IRST+ + MIDQLSEL  KE+ LLE N+ LR+KL  S    +  + WE    ++ 
Sbjct  133  FSLKKIRSTKMQLMIDQLSELQTKEEVLLETNRNLRMKLDGS--GPSMRSSWETGEHSIP  190

Query  542  YGQHSSSQQ---------CQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
            Y       Q         C N+ QIGYNP S+   +    S +  +G +PGWML
Sbjct  191  YNHPPPPPQSEGFFEPLHCNNSLQIGYNPISVTVEDTATASALAPSGFIPGWML  244



>gb|ADC79693.1| SEPALLATA1-like protein [Akebia trifoliata]
Length=246

 Score =   278 bits (711),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 146/234 (62%), Positives = 175/234 (75%), Gaps = 9/234 (4%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS+RGKLYEFCSSSS+ KTL+RY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFCSSSSMLKTLDRYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYG LEA+   KD+Q+NYQEYL+LKA VEVLQQ+QR+LLGEDL  L  K+L+QLENQ++
Sbjct  73   CSYGTLEASMPPKDTQNNYQEYLRLKARVEVLQQTQRNLLGEDLGPLNTKELDQLENQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFL-TPWEPQ-GQN  535
            TSL++IRST+T+ + DQLS+L +KEQ L E N+ LR KL E+S     L   W+   GQN
Sbjct  133  TSLRTIRSTKTQFLFDQLSDLQRKEQMLHEANRTLRRKLDENSTEIPNLQLSWDASGGQN  192

Query  536  MQYGQHS-------SSQQCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
            M YG+ +          +C +T QIGYNP      NN  TS  N    +PGWML
Sbjct  193  MAYGRQNLPSDGFFQPLECNSTLQIGYNPVDQDQINNGQTSAQNVNCFIPGWML  246



>ref|XP_007045799.1| MADS-box transcription factor [Theobroma cacao]
 gb|EOY01631.1| MADS-box transcription factor [Theobroma cacao]
Length=240

 Score =   276 bits (706),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 143/233 (61%), Positives = 171/233 (73%), Gaps = 13/233 (6%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCS+SS++KTLERYH+
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSTSSMAKTLERYHR  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            C+YG LE  QT  D+QS+YQEYLKLKA VEVLQ+SQRH LGEDL  LG  +LEQLE+Q+D
Sbjct  73   CTYGTLEPGQTESDTQSSYQEYLKLKAKVEVLQRSQRHFLGEDLGDLGSTELEQLEHQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
             SLK +RST+   M+DQL+EL +KE+ LLE N+ LR KL ES++     + WE   Q+  
Sbjct  133  FSLKQLRSTKMHSMLDQLAELQRKEEILLETNRNLRRKLEESTS--TLRSSWETGEQSNP  190

Query  542  YGQHSSSQ--------QCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
            Y  H   Q        QC ++ QIGYNPT+   +     +     G +PGWML
Sbjct  191  YNHHPPPQPEGFFEPLQCSSSMQIGYNPTAADQDA---AAASAPNGFIPGWML  240



>gb|AFO68791.1| agamous-like protein 234, partial [Pachysandra terminalis]
Length=228

 Score =   275 bits (704),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 149/228 (65%), Positives = 174/228 (76%), Gaps = 7/228 (3%)
 Frame = +2

Query  14   RQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHKCSYG  193
            RQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSI KTLERY KCSYG
Sbjct  1    RQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSILKTLERYQKCSYG  60

Query  194  ALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVDTSLK  373
            ALE +Q +K++QS+YQEYLKLKA VEVLQQSQR+LLGEDL  LG K+LE+LE+Q++ SLK
Sbjct  61   ALEPSQPAKETQSSYQEYLKLKANVEVLQQSQRNLLGEDLGPLGTKELEELEHQLEMSLK  120

Query  374  SIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQYG-Q  550
             IRST+T+ M+DQL +L +KEQ L E N+ALR KL ESS  +     WE  G NMQY  Q
Sbjct  121  QIRSTKTQFMLDQLYDLQRKEQMLQEANRALRRKLDESSAENHLRQSWEAAGHNMQYSQQ  180

Query  551  HSSSQ------QCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
            H+ S+      +C +T QIGYNP     +  +     N  G +PGWML
Sbjct  181  HAQSEDFFQPLECNSTLQIGYNPVGPDDHMTIAAPAQNVNGFVPGWML  228



>gb|AGT21645.1| PFRIN [Physalis pubescens]
Length=240

 Score =   276 bits (705),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 144/233 (62%), Positives = 173/233 (74%), Gaps = 13/233 (6%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAE+ALIIFS RGKLYEFCSSSS+SKTLERYH+
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEIALIIFSTRGKLYEFCSSSSMSKTLERYHR  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
             SYG LE  Q+  DSQ+NYQEYLKLK  V+VLQ+SQRH+LGEDL +L  KDLEQLE Q+D
Sbjct  73   YSYGGLEGTQSLVDSQNNYQEYLKLKTRVQVLQESQRHMLGEDLGELSTKDLEQLERQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
            +SL+ IRST+TK M+DQL+EL QKEQ+L E+NK+LR+K+ E     AF T W    Q++Q
Sbjct  133  SSLRQIRSTKTKQMLDQLAELQQKEQSLTEMNKSLRMKMEELGV--AFQTSWHGGEQSVQ  190

Query  542  YGQHSSS-----QQCQNTAQI---GYNPTSMQANNNVGTSTMNGAGVLPGWML  676
            Y +  +        C NT  I   GY     +   +   ST +  GV+PGWML
Sbjct  191  YREQPAEGFFQHADCNNTLPIISYGYGTVPPE---HAAPSTHDATGVVPGWML  240



>gb|ADD25190.1| SEP1, partial [Nelumbo nucifera]
Length=230

 Score =   273 bits (699),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 145/231 (63%), Positives = 171/231 (74%), Gaps = 8/231 (3%)
 Frame = +2

Query  5    KINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHKC  184
            KINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSSS+ KTLERY KC
Sbjct  1    KINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKC  60

Query  185  SYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVDT  364
            SYGALEA+Q +K++QS+YQEYLKLKA VEVLQ+SQR+LLGEDL  L  K+LEQLE+Q++ 
Sbjct  61   SYGALEASQPAKETQSSYQEYLKLKARVEVLQRSQRNLLGEDLGPLSTKELEQLEHQLEM  120

Query  365  SLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQY  544
            SLK IRST+T+ M+DQLS+L +KEQ L E N+ L+ KL ESS+ +     WE  G    Y
Sbjct  121  SLKQIRSTKTQLMLDQLSDLQRKEQMLQEANRDLKRKLDESSSENPLRLTWEAGGAKHLY  180

Query  545  GQHSSSQ-------QCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
             +  S         +  +T QIGYNP        V  S  N  G +PGWML
Sbjct  181  SRQPSQSEGVFPPLEGNSTWQIGYNPVGPD-QITVAASAQNVNGYIPGWML  230



>ref|XP_011102220.1| PREDICTED: MADS-box protein CMB1-like [Sesamum indicum]
Length=237

 Score =   274 bits (700),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 147/232 (63%), Positives = 173/232 (75%), Gaps = 16/232 (7%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKA ELS+LCDAEVALIIFSN+GKLYEFCS+SS+SKTLERYHK
Sbjct  13   NKINRQVTFAKRRNGLLKKACELSVLCDAEVALIIFSNKGKLYEFCSTSSMSKTLERYHK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
             SYG +EA+Q+  ++Q+NYQEYLKLKA VEVLQQSQRHLLGEDL +LG K+L+QLE  +D
Sbjct  73   SSYGPIEAHQSPNNAQNNYQEYLKLKARVEVLQQSQRHLLGEDLGKLGPKELDQLETMLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
            TSLK IR  +T+HM +QLS L QKE+NL+EVN+ALR KL E+  N A    W+   +NM 
Sbjct  133  TSLKQIRLKQTQHMFEQLSGLQQKEKNLMEVNRALRSKLEET--NAAIRETWQQGERNMP  190

Query  542  YGQHSSSQQ--------CQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWM  673
            Y     +Q         C NTAQI Y    + A NN      N  G+LPGWM
Sbjct  191  YRPLQLAQPEAFLEPLGCNNTAQIQYR---LSAPNNAAE---NAKGMLPGWM  236



>ref|XP_007032865.1| K-box region and MADS-box transcription factor family protein 
[Theobroma cacao]
 gb|EOY03791.1| K-box region and MADS-box transcription factor family protein 
[Theobroma cacao]
Length=243

 Score =   271 bits (694),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 141/234 (60%), Positives = 177/234 (76%), Gaps = 12/234 (5%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS+S+ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSASMLKTLERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYGA+E ++ +K+ +S+Y+EYLKLKA  E LQ++QR+LLGEDL  L  K+LEQLE Q++
Sbjct  73   CSYGAVEVSKPAKELESSYREYLKLKARYEALQRTQRNLLGEDLGPLNSKELEQLERQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
            TSLK +RST+T++++DQLS+L  KEQ L+E N+AL IKL E S  + F   WE   Q++ 
Sbjct  133  TSLKHVRSTKTQYLLDQLSDLQNKEQMLMEANRALSIKLDEISARNQFRASWEGGEQSVP  192

Query  542  YG-QHSSSQ------QCQNTAQIGYNPTSMQANNNVGTST--MNGAGVLPGWML  676
            YG Q + SQ      +C  T QIGYNP    A++ +  +T      G +PGWML
Sbjct  193  YGNQQAQSQGLFQPLECNPTLQIGYNPV---ASDQIAATTHAQQVNGFIPGWML  243



>gb|AAK21247.1|AF335234_1 MADS-box transcription factor FBP4 [Petunia x hybrida]
Length=240

 Score =   271 bits (694),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 146/233 (63%), Positives = 173/233 (74%), Gaps = 13/233 (6%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSSS+S TLE+YH+
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMSTTLEKYHR  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
              YGALE +Q S DSQ+ YQEYLKLK  VE LQQSQRH+LG DL QLG KDLEQLE Q+D
Sbjct  73   YCYGALEGSQPSTDSQNIYQEYLKLKTRVEALQQSQRHMLGADLGQLGTKDLEQLERQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQK-EQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNM  538
            +SL+ IRSTRT++M+DQLSEL +K EQ+L+E+NK+LR+KL E     AF T      +++
Sbjct  133  SSLRQIRSTRTQNMLDQLSELQEKQEQSLIEMNKSLRMKLEEL--GVAFQTSMHSGEESV  190

Query  539  QYGQHSSSQ-------QCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
            QY Q  +         +C N+  I YN        +V  S  +  GVLPGWML
Sbjct  191  QYRQQPAEPEGLFHPVECNNSLPIRYNTL---PREHVVPSAQDSTGVLPGWML  240



>gb|ACD39982.1| MADS1 [Carica papaya]
Length=245

 Score =   271 bits (694),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 142/241 (59%), Positives = 174/241 (72%), Gaps = 24/241 (10%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSSS+ KTL+RY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLDRYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYGA+E ++ +K+ +S+Y+EYLKLK   E LQ++QR+LLGEDL  L  K+LEQLE Q++
Sbjct  73   CSYGAVEVSKPAKELESSYREYLKLKTRFEALQRTQRNLLGEDLGPLNTKELEQLERQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
            +SLK +RST+T++M+DQL++L  KE  LLE N+AL IKL E S  +     WE   QN+ 
Sbjct  133  SSLKHVRSTKTQYMLDQLTDLQNKEHMLLEANRALTIKLDEISARNHLRVAWEGSEQNVS  192

Query  542  YG-QHSSSQ------QCQNTAQIGYNPTSMQANNNVGTSTMNGA---------GVLPGWM  673
            YG QH+ SQ      +C  T QIGYNP        VG+  M  A         G +PGWM
Sbjct  193  YGHQHAQSQGLFQPLECNPTLQIGYNP--------VGSDQMTAAATSQGQQVNGFIPGWM  244

Query  674  L  676
            L
Sbjct  245  L  245



>gb|AFO68790.1| agamous-like protein 234, partial [Pachysandra terminalis]
Length=228

 Score =   271 bits (692),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 138/228 (61%), Positives = 167/228 (73%), Gaps = 7/228 (3%)
 Frame = +2

Query  14   RQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHKCSYG  193
            RQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS RGKLYEFCSSSS+  TLERY KCSYG
Sbjct  1    RQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSARGKLYEFCSSSSMQNTLERYQKCSYG  60

Query  194  ALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVDTSLK  373
             LE +Q +K++QS+Y EY++LKA VE LQ+SQR+L GEDL  L  K+LEQLE+Q++ SL 
Sbjct  61   PLEPSQPAKETQSSYLEYMRLKARVEGLQRSQRNLFGEDLGPLSTKELEQLEHQLEMSLN  120

Query  374  SIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQYG-Q  550
             IRST+T+ M+DQLS+L +KEQ L E N+ALR KL ESS  +     WE  G NMQY  Q
Sbjct  121  QIRSTKTQFMLDQLSDLQRKEQMLQEANRALRRKLDESSAENHLRQSWEAAGHNMQYSQQ  180

Query  551  HSSSQ------QCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
            H+ S+      +C +T QIGYNP     +  +     N  G +PGWML
Sbjct  181  HAQSEDFFQPLECNSTLQIGYNPVGPDDHMTIAAPAQNVNGFVPGWML  228



>gb|AGW23594.1| MADS1 [Mangifera indica]
Length=254

 Score =   271 bits (694),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 142/242 (59%), Positives = 171/242 (71%), Gaps = 17/242 (7%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSSS+ KTLERY +
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMMKTLERYQR  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYGAL+ N+T  +SQ  YQEYLKLK  VEVLQ+SQR+LLGEDL  L  K+L+QLENQ++
Sbjct  73   CSYGALDTNRTGNESQGTYQEYLKLKTTVEVLQRSQRNLLGEDLGPLSTKELDQLENQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQG-QNM  538
            TSLK IR+T+T+ M+DQLSEL ++EQ L+E NKALR K  E+     F   W+  G QNM
Sbjct  133  TSLKHIRTTKTQFMVDQLSELQKREQMLVETNKALRKKFEETGAQVPFRLAWDQAGVQNM  192

Query  539  QYGQHSSSQQ--------CQNTAQIGYNPTSMQANN--------NVGTSTMNGAGVLPGW  670
             Y                  +T  +GYNP ++ A++        +V   T    G +PGW
Sbjct  193  AYNTRLPGHSEGFFQPLGANSTINMGYNPMAVVASSGAEEVVSFSVAGQTQTVNGYIPGW  252

Query  671  ML  676
            ML
Sbjct  253  ML  254



>gb|ADR83588.1| Sepallata 1-like protein [Platanus x acerifolia]
Length=244

 Score =   271 bits (692),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 142/233 (61%), Positives = 171/233 (73%), Gaps = 9/233 (4%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSS-ISKTLERYH  178
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSSS + KTL RY 
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSSMLKTLGRYQ  72

Query  179  KCSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQV  358
            +CSYG LEA+Q  K++QS+YQEYLKLKA VE+LQ+SQR+LLGEDL  L  K+LEQLE+Q+
Sbjct  73   RCSYGTLEASQPPKETQSSYQEYLKLKARVELLQRSQRNLLGEDLGSLNTKELEQLEHQL  132

Query  359  DTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNM  538
            + SLK +RST+T+ M+DQLS+L +KE    E N+ALR KL ESS  +     WE  GQN+
Sbjct  133  EMSLKQVRSTKTQLMLDQLSDLQEKEHMPQEANRALRRKLDESSTENPLRLSWEAGGQNI  192

Query  539  QYGQHSS-------SQQCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
             Y +  +       + +C +T QIGYNP        V     N  G +PGWML
Sbjct  193  PYNRQPAQSEGFFQALECNSTLQIGYNPVGPD-QITVTAPAQNVNGFIPGWML  244



>ref|XP_006348663.1| PREDICTED: MADS-box protein CMB1-like [Solanum tuberosum]
Length=397

 Score =   276 bits (705),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 145/212 (68%), Positives = 166/212 (78%), Gaps = 15/212 (7%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAE+ALIIFS+RGKLYEFCS+SSISKTLERYH+
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEIALIIFSSRGKLYEFCSNSSISKTLERYHR  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
             +YG LE  QTS DSQ+NYQEYLKLKA VEVLQQSQRHLLGEDL QLG KDLEQLE Q+D
Sbjct  73   YNYGTLEGTQTSPDSQNNYQEYLKLKARVEVLQQSQRHLLGEDLGQLGTKDLEQLERQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
            +SL+ IRST+T+H++DQL+EL QKEQ+L E+NK+LRIKL E     AF T W    Q++Q
Sbjct  133  SSLRQIRSTKTQHILDQLAELQQKEQSLTEMNKSLRIKLEELG--VAFQTSWHSGEQSVQ  190

Query  542  YGQHSSSQQ--------CQNTAQIGYNPTSMQ  613
            Y     SQ         C NT      P SM+
Sbjct  191  YRHEQPSQHEGFFQHVNCNNTM-----PISME  217


 Score = 83.6 bits (205),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 75/115 (65%), Gaps = 3/115 (3%)
 Frame = +2

Query  149  SISKTLERYHKCSYGA--LEANQTSKDSQSNYQ-EYLKLKAGVEVLQQSQRHLLGEDLVQ  319
            S+ + LERY + SY    L AN +    Q N+  EY KLKA +++LQ++ +H +GEDL  
Sbjct  215  SMEQILERYERYSYAERRLLANNSESPVQENWSLEYTKLKARIDLLQRNHKHYMGEDLDS  274

Query  320  LGIKDLEQLENQVDTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGE  484
            + +KDL+ LE Q+D++LK IRS + + M + +SEL +KE+ +LE N  L  K+ E
Sbjct  275  MSLKDLQNLEQQLDSALKLIRSRKNQLMHESISELQKKERAILEENNMLTKKIKE  329



>gb|AHH28266.1| MADS-box transcription factor, partial [Rhizanthes lowii]
Length=244

 Score =   270 bits (690),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 138/233 (59%), Positives = 168/233 (72%), Gaps = 9/233 (4%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSS++ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSNMLKTLERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYGA+E N+ +K+ +S+Y+EY+KLK+  E LQ++QR+LLGEDL  L  K+LEQLE Q++
Sbjct  73   CSYGAIEVNKPAKELESSYREYMKLKSRFESLQRTQRNLLGEDLGPLNTKELEQLERQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
            +SLK +RST+T++M+DQLS+L  KEQ LLE N+AL IKL E    +     WE   QNM 
Sbjct  133  SSLKQVRSTKTQYMLDQLSDLQNKEQLLLEANRALTIKLDEMGARNNLRPSWEGPEQNMA  192

Query  542  YGQHSSSQ--------QCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
            Y  H   Q        +C  T QIGYNP     +    T      G +PGWML
Sbjct  193  YAHHHHPQNQELFQPLECNPTLQIGYNPVC-SDHMTATTHAQQVNGFIPGWML  244



>gb|KDP24297.1| hypothetical protein JCGZ_25593 [Jatropha curcas]
Length=243

 Score =   270 bits (690),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 143/239 (60%), Positives = 174/239 (73%), Gaps = 22/239 (9%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEF S S++ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFSSISNMLKTLERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYGA+E N+ +K+ +S+Y+EYLKLK   E LQ++QR+LLGEDL  L  K+LEQLE Q++
Sbjct  73   CSYGAVEVNKPAKELESSYREYLKLKGRFESLQRTQRNLLGEDLGPLNTKELEQLERQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
            +SLK +RSTRT++M+DQLS+L  KEQ LLE N+AL IKL E S  ++  + WE   Q+M 
Sbjct  133  SSLKQVRSTRTQYMLDQLSDLQNKEQLLLEANRALTIKLDEISARNSLRSSWEGGEQSMS  192

Query  542  YG-QHSSSQ------QCQNTAQIGYNPTSMQANNNVGTSTMNG-------AGVLPGWML  676
            YG QH  SQ      +C  T QIGYNP        VG+  M         +G +PGWML
Sbjct  193  YGQQHPQSQELFQPLECNPTLQIGYNP--------VGSDQMTATTHAQQVSGFIPGWML  243



>gb|AHH28272.1| MADS-box transcription factor, partial [Rafflesia tuan-mudae]
Length=242

 Score =   269 bits (688),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 138/232 (59%), Positives = 167/232 (72%), Gaps = 8/232 (3%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSS++ KTLERY K
Sbjct  12   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSNMLKTLERYQK  71

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYGA+E N+ +K+ +S+Y+EY+KLK+  E LQ++QR+LLGEDL  L  K+LEQLE Q++
Sbjct  72   CSYGAIEVNKPAKELESSYREYMKLKSRFESLQRTQRNLLGEDLGPLNTKELEQLERQLE  131

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
            +SLK +RST+T++M+DQLS+L  KEQ LLE N+AL IKL E    +     WE   QNM 
Sbjct  132  SSLKQVRSTKTQYMLDQLSDLQNKEQLLLEANRALTIKLDEMGARNNLRPSWEGPEQNMP  191

Query  542  YGQHSSSQQ-------CQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
            Y  H    Q       C  T QIGYNP     +    T      G +PGWML
Sbjct  192  YAHHHPQNQELFQPLECNPTLQIGYNPVC-SDHITATTHAQQVNGFIPGWML  242



>ref|XP_010320555.1| PREDICTED: MADS-box transcription factor isoform X1 [Solanum 
lycopersicum]
Length=219

 Score =   266 bits (681),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 139/204 (68%), Positives = 160/204 (78%), Gaps = 10/204 (5%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELSILCDAE+ALIIFS+RGKLYEFCS+SS+SKTLERYH+
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSILCDAEIALIIFSSRGKLYEFCSNSSMSKTLERYHR  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
             +YG LE  QTS DSQ+NYQEYLKLK  VE+LQQSQRHLLGEDL QLG KDLEQLE Q+D
Sbjct  73   YNYGTLEGTQTSSDSQNNYQEYLKLKTRVEMLQQSQRHLLGEDLGQLGTKDLEQLERQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
            +SL+ IRST+T+H++DQL+EL QKEQ+L E+NK+LRIKL E      F T W    Q++Q
Sbjct  133  SSLRQIRSTKTQHILDQLAELQQKEQSLTEMNKSLRIKLEELG--VTFQTSWHCGEQSVQ  190

Query  542  YGQHSSSQQ--------CQNTAQI  589
            Y     S          C NT  I
Sbjct  191  YRHEQPSHHEGFFQHVNCNNTLPI  214



>gb|ACJ26766.1| MADS-11 [Gossypium hirsutum]
Length=239

 Score =   266 bits (681),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 137/229 (60%), Positives = 167/229 (73%), Gaps = 6/229 (3%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEF SS+SI+  LERY++
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFSSSNSIADILERYNR  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            C+YGALE  QT  ++Q NYQEYLKLKA VEVLQ SQRH LGEDL  LG ++LEQLE Q+D
Sbjct  73   CTYGALEPGQTEIETQRNYQEYLKLKAKVEVLQHSQRHFLGEDLGDLGSEELEQLERQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQ---  532
             SLK IRS + +HM++QLS+L +KE+ LLE N+ LR +L E  N     + WE   Q   
Sbjct  133  LSLKKIRSLKMEHMVEQLSKLERKEEMLLETNRNLRRRLDE--NASTLRSTWETGEQSVP  190

Query  533  -NMQYGQHSSSQQCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
             N+Q+ +     QC  + QI YN  +   + N+ T+T   +G +P WML
Sbjct  191  CNLQHPRFLEPLQCTTSMQISYNFPADLTHENIATTTSAPSGFIPDWML  239



>ref|XP_002306051.2| hypothetical protein POPTR_0004s11440g [Populus trichocarpa]
 ref|XP_006384290.1| hypothetical protein POPTR_0004s11440g [Populus trichocarpa]
 ref|XP_011008140.1| PREDICTED: developmental protein SEPALLATA 2-like [Populus euphratica]
 ref|XP_011008141.1| PREDICTED: developmental protein SEPALLATA 2-like [Populus euphratica]
 gb|EEE86562.2| hypothetical protein POPTR_0004s11440g [Populus trichocarpa]
 gb|ERP62087.1| hypothetical protein POPTR_0004s11440g [Populus trichocarpa]
Length=245

 Score =   266 bits (681),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 138/233 (59%), Positives = 170/233 (73%), Gaps = 8/233 (3%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCS+S++ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSTSNMLKTLERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYGA E N+ +K+ +S+Y+EYLK+KA  E LQ++QR+LLGEDL  L  K+LEQLE Q++
Sbjct  73   CSYGAEEVNKPAKELESSYREYLKVKARFEALQRTQRNLLGEDLGPLNTKELEQLERQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQG-QNM  538
            +SL  +RST+T++M+DQL++L  KE  LLE N+ L IKL E S  ++    WE    QNM
Sbjct  133  SSLNQVRSTKTQYMLDQLADLQNKEHLLLEANRGLTIKLDEISARNSLRPSWEGDDQQNM  192

Query  539  QYG-QHSSSQ------QCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
             YG QH+ SQ      +C  T QIGYNP           +T    G +PGWML
Sbjct  193  SYGHQHAQSQGLFQALECNPTLQIGYNPVGSDQMTATTHATQQVHGFIPGWML  245



>ref|XP_006440806.1| hypothetical protein CICLE_v10021357mg [Citrus clementina]
 gb|ESR54046.1| hypothetical protein CICLE_v10021357mg [Citrus clementina]
Length=300

 Score =   268 bits (686),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 143/240 (60%), Positives = 173/240 (72%), Gaps = 18/240 (8%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS SI KTLERYH+
Sbjct  64   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSPSIMKTLERYHR  123

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CS+GALEAN+   ++QS YQEYL+LK  VE+LQ+SQR+LLGEDL  L  K+LEQLE+Q++
Sbjct  124  CSFGALEANRPPIETQSTYQEYLRLKTAVELLQRSQRNLLGEDLEPLSTKELEQLEHQLE  183

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTP-----WEP-  523
            TSLK +RST+T+ M+DQLS+L ++EQ LLE+NK LR KL ES  N A   P     WE  
Sbjct  184  TSLKHVRSTKTQCMVDQLSDLQKREQVLLELNKGLRKKLDES--NIAHQVPPHRLAWEAA  241

Query  524  -QGQNMQYGQHSSSQQ--------CQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
              GQN+ Y ++    +             QIGYNP   +   ++     N  G +PGWML
Sbjct  242  SAGQNITYNRYPVQSEGFFQPLSGGTPILQIGYNPMGSE-EAHIPVHAQNVTGFIPGWML  300



>ref|XP_010660492.1| PREDICTED: MADS-box protein 2 isoform X1 [Vitis vinifera]
 emb|CBI16936.3| unnamed protein product [Vitis vinifera]
Length=243

 Score =   266 bits (680),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 141/232 (61%), Positives = 172/232 (74%), Gaps = 8/232 (3%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS RGKLYEFCSSSS+ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCSSSSMLKTLERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYGA+E ++ SK+ +S+Y+EYLKLK+  E LQ++QR+LLGEDL  L  K+LEQLE Q++
Sbjct  73   CSYGAVEVSRPSKELESSYREYLKLKSKFESLQRTQRNLLGEDLGPLNTKELEQLERQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
            TSLK +RST+T+ M+DQLS+L  KEQ L+E NKAL  KL E S  +     WE   Q+M 
Sbjct  133  TSLKQVRSTKTQFMLDQLSDLQNKEQVLVESNKALTRKLDEISVKNHLQLSWESGEQSMP  192

Query  542  YG-QHSSSQ------QCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
            YG Q + SQ      +C  T QIGYNP    +  +  ++  N  G +PGWML
Sbjct  193  YGHQQAQSQGFFQPLECNPTLQIGYNPAG-SSQLSAPSNAQNVNGFIPGWML  243



>gb|AAQ72498.1| MADS-box protein 12 [Petunia x hybrida]
Length=246

 Score =   266 bits (679),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 141/234 (60%), Positives = 169/234 (72%), Gaps = 9/234 (4%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS+++ K+LERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSNNMFKSLERYQK  72

Query  182  CSYGALEANQTSKDS-QSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQV  358
            CSYG LE NQ+SKD+ Q+NY+EYLKLKA  E LQ+ QRHLLGEDL  L I DLE LE Q+
Sbjct  73   CSYGTLEVNQSSKDNEQNNYREYLKLKAKYESLQRYQRHLLGEDLGPLNIDDLENLEVQL  132

Query  359  DTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNM  538
            DTSLK IRSTRT+ M+DQLS+L  KE+  +E NK L  KL E    ++    W    Q++
Sbjct  133  DTSLKHIRSTRTQLMLDQLSDLQTKEKLWVEANKVLERKLEEIYAENSLQQSWGGGEQSV  192

Query  539  QYGQHSSSQ--------QCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
             YG   ++Q        +C +T QIGYNP +        T+  N  G++PGWML
Sbjct  193  TYGHQHNAQSQGFFQPLECNSTLQIGYNPITTSRQITAVTNAQNVNGMVPGWML  246



>ref|XP_003518786.1| PREDICTED: developmental protein SEPALLATA 1-like [Glycine max]
 gb|KHN29958.1| MADS-box protein CMB1 [Glycine soja]
Length=244

 Score =   266 bits (679),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 139/233 (60%), Positives = 170/233 (73%), Gaps = 11/233 (5%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCS  S++KTLERYH+
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSGHSMAKTLERYHR  72

Query  182  CSYGALEA-NQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQV  358
            CSYGALE  +Q   ++Q  YQEYLKLK+ VE LQQ+QR+LLGE+L  L +KDLEQLE Q+
Sbjct  73   CSYGALEVQHQPEIETQRRYQEYLKLKSRVEALQQTQRNLLGEELEHLDVKDLEQLERQL  132

Query  359  DTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNM  538
            D+SLK IRS +T+ M+DQL++LH+KE+ LLE N  LR KL E   N A    WE + QN 
Sbjct  133  DSSLKQIRSNKTQQMLDQLADLHRKEEMLLETNNILRNKLEEI--NVALQPTWETREQNA  190

Query  539  QYGQHSS-------SQQCQNTAQIGYNPTSM-QANNNVGTSTMNGAGVLPGWM  673
             Y  H S       +  C +T +IGY+ + + +A    GTS  N +  + GWM
Sbjct  191  PYNYHPSQSEGYYETAHCNSTLRIGYDSSGLNEAGGAAGTSAQNASEFMNGWM  243



>gb|AEJ76844.1| MADS20 [Gossypium hirsutum]
Length=244

 Score =   266 bits (679),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 139/235 (59%), Positives = 169/235 (72%), Gaps = 13/235 (6%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEF SS+SI+ TLERY++
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFSSSNSIADTLERYNR  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            C+YGALE  QT  ++Q NYQ+YLKLKA VEVLQ SQRH LGE+L  LG K+LEQLE+Q+D
Sbjct  73   CTYGALEPGQTEIETQRNYQDYLKLKAKVEVLQHSQRHFLGEELGDLGSKELEQLEHQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGES--------SNNDA--FLT  511
             SLK IRS + +HM++QLSEL  KE+ LLE N+ LR+++G           N  A   + 
Sbjct  133  FSLKKIRSLKMEHMVEQLSELQTKEEVLLETNRNLRMEVGWKWSITEIIMGNGGAKHSIQ  192

Query  512  PWEPQGQNMQYGQHSSSQQCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
            P  P  Q+  + +      C N+ QIGYNP S+    N   S +  +G +PGWML
Sbjct  193  PSTPPPQSEGFFE---PFHCNNSMQIGYNPISVTVYYNATASALAPSGFIPGWML  244



>ref|XP_010319477.1| PREDICTED: MADS-box protein CMB1 isoform X2 [Solanum lycopersicum]
Length=218

 Score =   265 bits (676),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 159/187 (85%), Gaps = 6/187 (3%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELSILC+AEVALIIFSNRGKLYEFCS+SS+S TLERYH+
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSILCEAEVALIIFSNRGKLYEFCSTSSMSDTLERYHR  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYG LE  Q+SKDSQ+NYQEY+KLKA VEVLQQSQRH+LGEDL QL  KDLEQLE Q+D
Sbjct  73   CSYGDLETGQSSKDSQNNYQEYMKLKARVEVLQQSQRHILGEDLGQLNTKDLEQLERQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQG-QNM  538
            +SL+ IRS RT++M+DQLS+L QKEQ+LLE+N++L+ KL E+S     +  W   G QN+
Sbjct  133  SSLRLIRSRRTQNMLDQLSDLQQKEQSLLEINRSLKTKLEENS-----VAHWHITGEQNV  187

Query  539  QYGQHSS  559
            Q+ Q  +
Sbjct  188  QFRQQPA  194



>gb|ABG78619.1| MADS4 [Populus tomentosa]
Length=245

 Score =   265 bits (678),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 137/233 (59%), Positives = 171/233 (73%), Gaps = 8/233 (3%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCS+S++ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSTSNMLKTLERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYGA E N+ +K+ +++Y+EYLK+KA  E LQ++QR+LLGEDL  L  KDLEQLE Q++
Sbjct  73   CSYGAEEVNKPAKELENSYREYLKVKARFEALQRTQRNLLGEDLGPLNTKDLEQLERQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQG-QNM  538
            +SL  +RST+T++M+DQL++L  KE  LLE N+ L +KL E S  ++    WE    QNM
Sbjct  133  SSLNQVRSTKTQYMLDQLADLQNKEHLLLEANRGLTMKLDEISARNSLRPSWEGDDQQNM  192

Query  539  QYG-QHSSSQ------QCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
             YG QH+ SQ      +C  T QIGYNP      +    +T    G +PGWML
Sbjct  193  SYGHQHAQSQGLFQALECNPTLQIGYNPVGSDQMSCTTHATQQVHGFIPGWML  245



>gb|ADC79694.1| SEPALLATA1-like protein [Akebia trifoliata]
Length=243

 Score =   265 bits (678),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 137/233 (59%), Positives = 173/233 (74%), Gaps = 10/233 (4%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELSILCDAEVA+IIFS+RGKL+EFCSSSS+SKTLERY +
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSILCDAEVAVIIFSSRGKLFEFCSSSSMSKTLERYQQ  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            C+Y A+EA+ ++ +++S+YQ+YL+LKA VEVLQQSQR+LLGE+L  LG  +LEQLE+Q++
Sbjct  73   CNYRAVEASTSANETESSYQDYLRLKARVEVLQQSQRNLLGEELGSLGTGELEQLEHQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
             SL  +RST+T+ M+DQL++L +KEQ L E N+ LR KL E S  + +   WE  GQN+ 
Sbjct  133  MSLNQVRSTKTQFMLDQLTDLQRKEQMLQEANRTLRRKLDERSTENPYTLSWEAGGQNIP  192

Query  542  YGQHSSSQ--------QCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
            Y  H  +Q        QC +  QIGYN T       V   T N  G +PGWML
Sbjct  193  YS-HQPAQSEGFFQPLQCNSMLQIGYN-TGSPDQLTVAAPTQNINGFIPGWML  243



>ref|XP_006477714.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X4 
[Citrus sinensis]
Length=249

 Score =   265 bits (678),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 142/240 (59%), Positives = 172/240 (72%), Gaps = 18/240 (8%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS SI KTLERYH+
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSPSIMKTLERYHR  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CS+GA EAN+   ++QS YQEYL+LK  VE+LQ+SQR+LLGEDL  L  K+LEQLE+Q++
Sbjct  73   CSFGAHEANRPPIETQSTYQEYLRLKTAVELLQRSQRNLLGEDLDPLSTKELEQLEHQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTP-----WEP-  523
            TSLK +RST+T+ M+DQLS+L ++EQ LLE+NK LR KL ES  N A   P     WE  
Sbjct  133  TSLKHVRSTKTQCMVDQLSDLQKREQVLLELNKGLRKKLDES--NIAHQVPPHRLAWEAA  190

Query  524  -QGQNMQYGQHSSSQQ--------CQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
              GQN+ Y ++    +             QIGYNP   +   ++     N  G +PGWML
Sbjct  191  SAGQNITYNRYPVQSEGFFQPLSGGNPILQIGYNPMGSE-EAHIPVHAQNVTGFIPGWML  249



>gb|AAF12701.2| Apetala 1 protein [Populus tremuloides]
Length=237

 Score =   265 bits (676),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 137/233 (59%), Positives = 171/233 (73%), Gaps = 8/233 (3%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCS+S++ KTLERY K
Sbjct  5    NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSTSNMLKTLERYQK  64

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYGA E N+ +K+ +++Y+EYLK+KA  E LQ++QR+LLGEDL  L  KDLEQLE Q++
Sbjct  65   CSYGAEEVNKPAKELENSYREYLKVKARFEALQRTQRNLLGEDLGPLNTKDLEQLERQLE  124

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQG-QNM  538
            +SL  +RST+T++M+DQL++L  KE  LLE N+ L IKL E S  ++    WE    QNM
Sbjct  125  SSLNQVRSTKTQYMLDQLADLQNKEHLLLEANRGLTIKLDEISARNSLRPSWEGDDQQNM  184

Query  539  QYG-QHSSSQ------QCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
             YG QH+ SQ      +C  T QIGYN       + +  +T    G +PGWML
Sbjct  185  SYGHQHAQSQGLFQALECNPTLQIGYNAVGSDQVSAITHATQQVHGFIPGWML  237



>ref|XP_006430949.1| hypothetical protein CICLE_v10012593mg [Citrus clementina]
 gb|ESR44189.1| hypothetical protein CICLE_v10012593mg [Citrus clementina]
Length=243

 Score =   265 bits (676),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 139/233 (60%), Positives = 173/233 (74%), Gaps = 10/233 (4%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSSS+ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYGA+E N+ +K+ +S+Y+EYLKLK   E LQ++QR+LLGEDL  L  K+LEQLE Q++
Sbjct  73   CSYGAVEVNKPAKELESSYREYLKLKTRFESLQRTQRNLLGEDLGPLNSKELEQLERQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
            +SLK +RST+T++M+DQLS+L  KEQ LL+ N+AL IKL E +        WE   Q + 
Sbjct  133  SSLKHVRSTKTQYMLDQLSDLQNKEQLLLDTNRALTIKLDEINAKTQLRPSWEGSEQQLG  192

Query  542  YG-QHSSSQ------QCQNTAQIGYNPTSMQANNNVGTS-TMNGAGVLPGWML  676
            Y  QH+ +Q      +C  T QIGYNP+   ++    TS     +G +PGWML
Sbjct  193  YNPQHTQTQGLFQPIECNPTLQIGYNPSC--SDQMTATSHAQQVSGFIPGWML  243



>ref|XP_010681125.1| PREDICTED: MADS-box protein CMB1-like [Beta vulgaris subsp. vulgaris]
Length=243

 Score =   265 bits (676),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 139/233 (60%), Positives = 175/233 (75%), Gaps = 10/233 (4%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSSS++KTLERY +
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMAKTLERYQR  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYGALEA+Q SK+++++YQEYLKLKA V+VLQ++QR+LLGEDL +L  K+LEQLE+Q+D
Sbjct  73   CSYGALEASQPSKETENSYQEYLKLKAKVDVLQRNQRNLLGEDLSELSTKELEQLEHQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
             SL+ IRS +T++M+DQL++L +KE+ LLE N+AL+ KL E+    +    WE + QN  
Sbjct  133  KSLRQIRSIKTQYMLDQLADLQRKEEMLLESNRALKSKLEETC--ASLRQNWEAEPQNAP  190

Query  542  --YGQHSS-----SQQCQNTA-QIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
              Y +  +        C N +  IGYN  +    NN  TST N     P WML
Sbjct  191  PTYVRQPAEGFFEPLPCNNNSLHIGYNAVTQDHLNNATTSTHNENSFTPTWML  243



>ref|NP_001268109.1| MADS-box protein 2 [Vitis vinifera]
 gb|AAM21342.1|AF373601_1 MADS-box protein 2 [Vitis vinifera]
Length=244

 Score =   264 bits (675),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 142/233 (61%), Positives = 172/233 (74%), Gaps = 9/233 (4%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS RGKLYEFCSSSS+ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCSSSSMLKTLERYQK  72

Query  182  CSYGALEANQTSKD-SQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQV  358
            CSYGA+E ++ SK+  QS+Y+EYLKLK+  E LQ++QR+LLGEDL  L  K+LEQLE Q+
Sbjct  73   CSYGAVEVSRPSKELEQSSYREYLKLKSKFEALQRTQRNLLGEDLGPLNTKELEQLERQL  132

Query  359  DTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNM  538
            +TSLK +RST+T+ M+DQLS+L  KEQ L+E NKAL  KL E S  +     WE   Q+M
Sbjct  133  ETSLKQVRSTKTQFMLDQLSDLQNKEQVLVESNKALTRKLDEISVKNHLQLSWESGEQSM  192

Query  539  QYG-QHSSSQ------QCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
             YG Q + SQ      +C  T QIGYNP    +  +  ++  N  G +PGWML
Sbjct  193  PYGHQQAQSQGFFQPLECNPTLQIGYNPAG-SSQLSAPSNAQNVNGFIPGWML  244



>gb|AAK21249.1|AF335236_1 MADS-box transcription factor FBP9 [Petunia x hybrida]
Length=245

 Score =   264 bits (675),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 134/233 (58%), Positives = 170/233 (73%), Gaps = 8/233 (3%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS+RGKLYEFCS+SS+ KTLE+Y +
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFCSTSSMMKTLEKYQQ  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSY +L+  Q++ D+Q+NY EYL+LKA VE+LQ+SQR+LLGEDL  L  K+LEQLE+Q+D
Sbjct  73   CSYASLDPMQSANDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGSLNSKELEQLEHQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
            +SLK IRS +T+HM+DQL++L QKEQ L E NK LR KL ES+        W+  GQ MQ
Sbjct  133  SSLKQIRSKKTQHMLDQLADLQQKEQMLAEANKQLRRKLEESAARIPLRLSWDNGGQPMQ  192

Query  542  YGQHSSSQQC--------QNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
            + +     +          ++ Q GY+P      NN  ++  N  G +PGWML
Sbjct  193  HNRLPPQTEGFFQPLGLNSSSPQFGYSPMGANEVNNAVSTAQNMNGFIPGWML  245



>ref|XP_009773223.1| PREDICTED: MADS-box protein CMB1-like isoform X1 [Nicotiana sylvestris]
Length=264

 Score =   265 bits (676),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 137/213 (64%), Positives = 164/213 (77%), Gaps = 7/213 (3%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS RGKLYEFCSSSS+SKT+E+YHK
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCSSSSMSKTVEKYHK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
             +Y A+E +Q S DSQ+ YQEYLKLK  VEVLQQSQRH+LGEDL QL  KDLEQLE QVD
Sbjct  73   YNYAAVEGSQPSTDSQNTYQEYLKLKTRVEVLQQSQRHILGEDLGQLNTKDLEQLERQVD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
            +SL+ IRSTRT+HMID+L+EL QKE++L E+NK+LR+KL E     A  T W+   Q++Q
Sbjct  133  SSLRQIRSTRTQHMIDELTELQQKEESLTEMNKSLRMKLEELGV--ALQTSWQYGEQSLQ  190

Query  542  YGQHSS-----SQQCQNTAQIGYNPTSMQANNN  625
            Y +           C NT  + YN  + +  N+
Sbjct  191  YREQQPDGFFHPVDCNNTMPLRYNTVNQKMQNH  223



>gb|AAL08423.2|AF185574_1 transcription factor MAGL4 [Populus tremuloides]
Length=245

 Score =   264 bits (675),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 137/233 (59%), Positives = 171/233 (73%), Gaps = 8/233 (3%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCS+S++ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSTSNMLKTLERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYGA E N+ +K+ +++Y+EYLK+KA  E LQ++QR+LLGEDL  L  KDLEQLE Q++
Sbjct  73   CSYGAEEVNKPAKELENSYREYLKVKARFEGLQRTQRNLLGEDLGPLNTKDLEQLERQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQG-QNM  538
            +SL  +RST+T++M+DQL++L  KE  L E N+ L IKL E S  ++    WE    QNM
Sbjct  133  SSLNQVRSTKTQYMLDQLADLQNKEHLLQEANRGLTIKLDEISARNSLRPSWEGDDQQNM  192

Query  539  QYG-QHSSSQ------QCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
             YG QH+ SQ      +C  T QIGYNP      + +  +T    G +PGWML
Sbjct  193  SYGHQHAQSQGLFQALECNPTLQIGYNPVGSDQVSAITHATQQVHGFIPGWML  245



>ref|XP_008464576.1| PREDICTED: developmental protein SEPALLATA 1-like [Cucumis melo]
Length=246

 Score =   264 bits (675),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 137/236 (58%), Positives = 176/236 (75%), Gaps = 13/236 (6%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCS+S++ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSTSNMLKTLERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYGA+E  + +K+ +S+Y+EY+KLK+  E LQ++QR+LLGEDL  L  K+LEQLE Q++
Sbjct  73   CSYGAVEVTKPAKELESSYREYVKLKSRFESLQRTQRNLLGEDLGPLNSKELEQLERQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
            +SLK +RST+T++M+DQLS+L  KEQ L+E N+AL++KL E S+ +    PW+   Q+M 
Sbjct  133  SSLKQVRSTKTQYMLDQLSDLQNKEQMLIETNRALQMKLEEISSRNNIRHPWDGGDQSMS  192

Query  542  YGQHSSSQQ-------CQNTAQIGYNPTSMQANNNVGTSTMNGA----GVLPGWML  676
            YG  ++  Q       C  T QIGY  TS  ++    T+T   A    G LPGWML
Sbjct  193  YGTQNAQTQGFFQPLDCNPTLQIGY--TSAVSDQITSTTTPTHAQQVNGFLPGWML  246



>gb|AGW23351.1| MADS box protein MADS49 [Gossypium hirsutum]
Length=239

 Score =   264 bits (674),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 137/229 (60%), Positives = 165/229 (72%), Gaps = 6/229 (3%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEF SS+SI+ TLERY++
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFSSSNSIADTLERYNR  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            C+YGALE  QT  ++Q NYQ+YLKLKA VEVLQ SQRH  GE+L  LG K+LEQLE+Q+D
Sbjct  73   CTYGALEPGQTEIETQRNYQDYLKLKAKVEVLQHSQRHFRGEELGDLGSKELEQLEHQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQ---  532
             SLK IRS + +HM++QLS+L +KE+ LLE N+ LR KL E  N     + WE   Q   
Sbjct  133  FSLKKIRSLKMEHMVEQLSKLERKEEMLLETNRNLRRKLDE--NASTLRSTWETGEQSVP  190

Query  533  -NMQYGQHSSSQQCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
             N+Q        QC  + QI YN  +   + N+ T+T    G +P WML
Sbjct  191  CNLQRPPFFEPLQCTTSMQISYNVPADLTHENIATTTSAPGGFIPDWML  239



>ref|XP_010029406.1| PREDICTED: developmental protein SEPALLATA 1 [Eucalyptus grandis]
 gb|KCW56317.1| hypothetical protein EUGRSUZ_I02058 [Eucalyptus grandis]
Length=247

 Score =   264 bits (674),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 138/235 (59%), Positives = 170/235 (72%), Gaps = 10/235 (4%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS RGKLYEFCSS S+ KTL+RY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCSSPSMLKTLDRYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYG++E N+ SK+ ++ Y+EYLKLK   E LQ++QR+L+GEDL  L  K+LEQLE Q++
Sbjct  73   CSYGSVEVNKPSKELENAYREYLKLKGRFEALQRTQRNLMGEDLGPLNSKELEQLERQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
             SLK IRST+T+ M+DQLS+L  KEQ+L+E N+AL +KL E    +    PWE    +M 
Sbjct  133  ASLKHIRSTKTQCMLDQLSDLQDKEQSLMEANRALTLKLDEVCARNNLRPPWEAGDPSMT  192

Query  542  YGQ-HSSSQ------QCQNTAQIGYNP-TSMQANNNVGT--STMNGAGVLPGWML  676
            YGQ H  SQ      +C  T QIGY+   S Q N +  T  +    +G LPGWML
Sbjct  193  YGQPHPQSQEFFQPLECNPTLQIGYDAGGSDQLNTSAATPNAPQQASGFLPGWML  247



>ref|XP_009773224.1| PREDICTED: MADS-box protein CMB1-like isoform X2 [Nicotiana sylvestris]
Length=244

 Score =   264 bits (674),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 141/234 (60%), Positives = 169/234 (72%), Gaps = 16/234 (7%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS RGKLYEFCSSSS+SKT+E+YHK
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCSSSSMSKTVEKYHK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
             +Y A+E +Q S DSQ+ YQEYLKLK  VEVLQQSQRH+LGEDL QL  KDLEQLE QVD
Sbjct  73   YNYAAVEGSQPSTDSQNTYQEYLKLKTRVEVLQQSQRHILGEDLGQLNTKDLEQLERQVD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
            +SL+ IRSTRT+HMID+L+EL QKE++L E+NK+LR+KL E     A  T W+   Q++Q
Sbjct  133  SSLRQIRSTRTQHMIDELTELQQKEESLTEMNKSLRMKLEELGV--ALQTSWQYGEQSLQ  190

Query  542  YGQHSSS-----QQCQNTAQIGYNPTSMQAN----NNVGTSTMNGAGVLPGWML  676
            Y +           C NT      P  +Q       +   ST +   V+PG+  
Sbjct  191  YREQQPDGFFHPVDCNNTM-----PLRLQVQYCEPEDAEPSTQHATEVVPGYQF  239



>ref|XP_006482430.1| PREDICTED: developmental protein SEPALLATA 1-like [Citrus sinensis]
 dbj|BAF95941.1| SEPALLATA1 homolog [Citrus unshiu]
Length=243

 Score =   263 bits (673),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 139/233 (60%), Positives = 173/233 (74%), Gaps = 10/233 (4%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSSS+ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYGA+E N+ +K+ +S+Y+EYLKLK   E LQ++QR+LLGEDL  L  K+LEQLE Q++
Sbjct  73   CSYGAVEVNKPAKELESSYREYLKLKTRFESLQRTQRNLLGEDLGPLNSKELEQLERQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
            +SLK +RST+T++M+DQLS+L  KEQ LL+ N+AL IKL E +        WE   Q + 
Sbjct  133  SSLKHVRSTKTQYMLDQLSDLQNKEQLLLDTNRALTIKLDEINAKTQLRPSWEGGEQQLG  192

Query  542  YG-QHSSSQ------QCQNTAQIGYNPTSMQANNNVGTS-TMNGAGVLPGWML  676
            Y  QH+ +Q      +C  T QIGYNP+   ++    TS     +G +PGWML
Sbjct  193  YNPQHAQTQGLFQPIECNPTLQIGYNPSC--SDQMTATSHAQQVSGFIPGWML  243



>gb|AIU94287.1| SEPALLATA1-like protein [Prunus pseudocerasus]
Length=251

 Score =   264 bits (674),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 141/239 (59%), Positives = 172/239 (72%), Gaps = 14/239 (6%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS+RGKLYEFCSS S+ KTLE+Y +
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFCSSLSMLKTLEKYQR  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYG+LEAN+   ++Q++YQEYLKLKA VEVLQQSQR+LLGEDL  L  K+LEQLE+Q++
Sbjct  73   CSYGSLEANKPVNETQNSYQEYLKLKARVEVLQQSQRNLLGEDLAPLNTKELEQLEHQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQG----  529
             SL  IRST+T+ M+DQL +L  KEQ L+E NKALR K+ E+S     L  WE  G    
Sbjct  133  ASLNQIRSTKTQFMLDQLCDLQNKEQMLVEANKALRRKMEETSGQAPPLLAWEAAGHGHN  192

Query  530  --QNMQYGQHSSSQQC------QNTAQIGYNPTSMQANN--NVGTSTMNGAGVLPGWML  676
              Q+ +   H  SQ         +T+QIGY P     ++  NVG    +  G +PGWML
Sbjct  193  NVQHTRLPHHPHSQGFFHPLGNNSTSQIGYTPLGSDHHDQMNVGNHGQHVNGFIPGWML  251



>ref|XP_007209505.1| hypothetical protein PRUPE_ppa010391mg [Prunus persica]
 gb|AAZ16241.1| MADS box protein [Prunus persica]
 gb|EMJ10704.1| hypothetical protein PRUPE_ppa010391mg [Prunus persica]
Length=251

 Score =   263 bits (673),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 143/239 (60%), Positives = 172/239 (72%), Gaps = 14/239 (6%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS+RGKLYEFCSS S+ KTLE+Y +
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFCSSMSMLKTLEKYQR  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYG+LEAN+   ++Q++YQEYLKLKA VEVLQQSQR+LLGEDL  L  K+LEQLE+Q++
Sbjct  73   CSYGSLEANRPVNETQNSYQEYLKLKARVEVLQQSQRNLLGEDLAPLNTKELEQLEHQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQ---  532
             SL  IRST+T+ M+DQL +L  KEQ L+E NKALR KL E+S     L  WE  G    
Sbjct  133  ASLNQIRSTKTQFMLDQLCDLQNKEQMLVEANKALRRKLEETSGQAPPLLAWEAAGHGNN  192

Query  533  NMQY---GQHSSSQQC------QNTAQIGYNP--TSMQANNNVGTSTMNGAGVLPGWML  676
            N+Q+     H  SQ         +T+QIGY P  +      NVG    +  G +PGWML
Sbjct  193  NVQHTGLPHHPHSQGFFHPLGNNSTSQIGYTPLGSDHHEQMNVGNHGQHVNGFIPGWML  251



>ref|XP_004154725.1| PREDICTED: developmental protein SEPALLATA 2-like [Cucumis sativus]
Length=246

 Score =   263 bits (673),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 138/236 (58%), Positives = 175/236 (74%), Gaps = 13/236 (6%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCS+S++ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSTSNMLKTLERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYGA+E  + +K+ +S+Y+EYLKLK+  E LQ++QR+LLGEDL  L  K+LEQLE Q++
Sbjct  73   CSYGAVEVTKPAKELESSYREYLKLKSRFESLQRTQRNLLGEDLGPLNSKELEQLERQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
            +SLK +RST+T++M+DQLS+L  KEQ L+E N+AL+IKL E S+ +     W+   Q+M 
Sbjct  133  SSLKQVRSTKTQYMLDQLSDLQNKEQMLIETNRALQIKLEEISSRNNIRLTWDGGDQSMS  192

Query  542  YGQHSSSQQ-------CQNTAQIGYNPTSMQANNNVGTSTMNGA----GVLPGWML  676
            YG  ++  Q       C  T QIGY  TS  ++    T+T   A    G LPGWML
Sbjct  193  YGPQNAQTQGFFQPLECNPTLQIGY--TSAVSDQITSTTTPTHAQQVNGFLPGWML  246



>ref|XP_008240082.1| PREDICTED: MADS-box protein CMB1-like [Prunus mume]
Length=251

 Score =   263 bits (673),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 142/239 (59%), Positives = 170/239 (71%), Gaps = 14/239 (6%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS+RGKLYEFCSS S+ KTLE+Y +
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFCSSMSMLKTLEKYQR  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYG+LEAN+   D+Q++YQEYLKLKA VEVLQQSQR+LLGEDL  L  K+LEQLE+Q++
Sbjct  73   CSYGSLEANRPVNDTQNSYQEYLKLKARVEVLQQSQRNLLGEDLAPLNTKELEQLEHQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQG----  529
             SL  IRST+T+ M+DQL +L  KEQ L+E NKALR KL E+S        WE  G    
Sbjct  133  ASLNQIRSTKTQFMLDQLCDLQNKEQMLVEANKALRRKLEETSGQAPPPLAWEAAGHGNN  192

Query  530  --QNMQYGQHSSSQQC------QNTAQIGYNP--TSMQANNNVGTSTMNGAGVLPGWML  676
              Q+ +   H  SQ         +T+QIGY P  +      NVG    +  G +PGWML
Sbjct  193  NDQHTRLPHHPHSQGFFHPLGNNSTSQIGYTPLGSDHHEQMNVGNHGQHVNGFIPGWML  251



>ref|XP_010694134.1| PREDICTED: developmental protein SEPALLATA 1 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=250

 Score =   263 bits (672),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 139/233 (60%), Positives = 168/233 (72%), Gaps = 10/233 (4%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCS  S+ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSGPSMLKTLERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYG +E N+ SK+ +S+Y+EYLKLKA  E LQ++QR+LLGEDL  L +K+L+QLE Q++
Sbjct  73   CSYGGVEVNKPSKELESSYREYLKLKARHESLQRTQRNLLGEDLGPLNVKELDQLERQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDA--FLTPWEPQGQN  535
            +SLK IRST+T+ M+DQL++L  KE  L+E NK L+ +L      D   F   W+   QN
Sbjct  133  SSLKQIRSTKTQSMLDQLTDLQNKEHALMEANKTLKTELDRIMVKDTQQFRQTWDGSEQN  192

Query  536  MQYG-QHSSSQ------QCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWM  673
            + YG QH+ SQ       C  T QIGYNP S +    V TS     G LPGWM
Sbjct  193  VHYGQQHAQSQGLFQPLDCNPTLQIGYNPESSE-QMTVATSHTQVPGFLPGWM  244



>gb|AAK21254.1|AF335241_1 MADS-box transcription factor FBP23 [Petunia x hybrida]
Length=245

 Score =   263 bits (671),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 138/234 (59%), Positives = 166/234 (71%), Gaps = 10/234 (4%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCS+SS++KT+E+Y +
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSTSSMTKTIEKYQR  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSY  LEANQ++ D+Q+NY EYL+LKA VE+LQ+SQR+LLGEDL  L  KDLEQLENQ++
Sbjct  73   CSYATLEANQSATDNQNNYHEYLRLKARVELLQRSQRNLLGEDLGTLSTKDLEQLENQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
            +SLK IRS +T+ M+DQL++L Q+EQ L E NK LR KL ES         WE   Q MQ
Sbjct  133  SSLKQIRSRKTQFMLDQLADLQQREQMLAESNKQLRQKLEESVAGIPHRLCWEDGLQAMQ  192

Query  542  YGQHSSSQQ---------CQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
            +       +           N+ Q GYNP      N   T T N  G + GWML
Sbjct  193  HNSRLPQTEGFFQPLGLNSSNSPQFGYNPAGTDVENAAAT-THNMNGFIHGWML  245



>ref|XP_006440804.1| hypothetical protein CICLE_v10021357mg [Citrus clementina]
 gb|ESR54044.1| hypothetical protein CICLE_v10021357mg [Citrus clementina]
Length=301

 Score =   264 bits (675),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 143/241 (59%), Positives = 173/241 (72%), Gaps = 19/241 (8%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS SI KTLERYH+
Sbjct  64   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSPSIMKTLERYHR  123

Query  182  CSYGALEANQTSKDS-QSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQV  358
            CS+GALEAN+   ++ QS YQEYL+LK  VE+LQ+SQR+LLGEDL  L  K+LEQLE+Q+
Sbjct  124  CSFGALEANRPPIETQQSTYQEYLRLKTAVELLQRSQRNLLGEDLEPLSTKELEQLEHQL  183

Query  359  DTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTP-----WEP  523
            +TSLK +RST+T+ M+DQLS+L ++EQ LLE+NK LR KL ES  N A   P     WE 
Sbjct  184  ETSLKHVRSTKTQCMVDQLSDLQKREQVLLELNKGLRKKLDES--NIAHQVPPHRLAWEA  241

Query  524  --QGQNMQYGQHSSSQQ--------CQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWM  673
               GQN+ Y ++    +             QIGYNP   +   ++     N  G +PGWM
Sbjct  242  ASAGQNITYNRYPVQSEGFFQPLSGGTPILQIGYNPMGSE-EAHIPVHAQNVTGFIPGWM  300

Query  674  L  676
            L
Sbjct  301  L  301



>ref|NP_001233976.1| MADS-box transcription factor MADS-rin [Solanum lycopersicum]
 gb|AAM15776.1|AF448523_1 MADS-box transcription factor MADS-rin [Solanum lycopersicum]
Length=397

 Score =   267 bits (683),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 141/212 (67%), Positives = 163/212 (77%), Gaps = 15/212 (7%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELSILCDAE+ALIIFS+RGKLYEFCS+SS+SKTLERYH+
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSILCDAEIALIIFSSRGKLYEFCSNSSMSKTLERYHR  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
             +YG LE  QTS DSQ+NYQEYLKLK  VE+LQQSQRHLLGEDL QLG KDLEQLE Q+D
Sbjct  73   YNYGTLEGTQTSSDSQNNYQEYLKLKTRVEMLQQSQRHLLGEDLGQLGTKDLEQLERQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
            +SL+ IRST+T+H++DQL+EL QKEQ+L E+NK+LRIKL E      F T W    Q++Q
Sbjct  133  SSLRQIRSTKTQHILDQLAELQQKEQSLTEMNKSLRIKLEELG--VTFQTSWHCGEQSVQ  190

Query  542  YGQHSSSQQ--------CQNTAQIGYNPTSMQ  613
            Y     S          C NT      P SM+
Sbjct  191  YRHEQPSHHEGFFQHVNCNNTL-----PISME  217


 Score = 83.6 bits (205),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 75/115 (65%), Gaps = 3/115 (3%)
 Frame = +2

Query  149  SISKTLERYHKCSYGA--LEANQTSKDSQSNYQ-EYLKLKAGVEVLQQSQRHLLGEDLVQ  319
            S+ + LERY + SY    L AN +    Q N+  EY KLKA +++LQ++ +H +GEDL  
Sbjct  215  SMEQILERYERYSYAERRLLANNSESPVQENWSLEYTKLKARIDLLQRNHKHYMGEDLDS  274

Query  320  LGIKDLEQLENQVDTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGE  484
            + +KDL+ LE Q+D++LK IRS + + M + +SEL +KE+ +LE N  L  K+ E
Sbjct  275  MSLKDLQNLEQQLDSALKLIRSRKNQLMHESISELQKKERAILEENNMLTKKIKE  329



>ref|XP_007139420.1| hypothetical protein PHAVU_008G027900g [Phaseolus vulgaris]
 gb|ESW11414.1| hypothetical protein PHAVU_008G027900g [Phaseolus vulgaris]
Length=248

 Score =   262 bits (669),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 139/239 (58%), Positives = 180/239 (75%), Gaps = 17/239 (7%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS+S+ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSTSMLKTLERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYGA+E ++ +K+ +S+Y+EYLKLKA  E LQ++QR+LLGEDL  L  K+LEQLE Q+D
Sbjct  73   CSYGAVEVSKPAKELESSYREYLKLKARFESLQRTQRNLLGEDLGPLNTKELEQLERQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
            +SLK +RST+T+ M+DQL++L  KEQ L+E N++L +KL E ++ + +   WE   Q+MQ
Sbjct  133  SSLKQVRSTKTQFMLDQLADLQNKEQMLVEANRSLTMKLDEINSRNHYRQSWEAGDQSMQ  192

Query  542  YG--QHSSSQ------QCQNTAQIG----YNPTSMQANNNVGTST--MNGAGVLPGWML  676
            YG  Q+S SQ      +C  T QIG    YN   + A++ +  +T     +G +PGWML
Sbjct  193  YGGPQNSHSQGFFQPLECNPTLQIGPDYRYN---VVASDQITATTPAQQVSGFIPGWML  248



>gb|ADU15479.1| SEP4 [Actinidia chinensis]
Length=245

 Score =   261 bits (668),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 139/236 (59%), Positives = 171/236 (72%), Gaps = 14/236 (6%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSN GKLYEFCSSSS+ KTLE+Y +
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNHGKLYEFCSSSSMMKTLEKYQR  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYG+L+A+Q   DS+++Y EYL+LK  VE+LQQSQR+LLGEDL  L  K+LEQLE+Q++
Sbjct  73   CSYGSLDASQPVHDSENSYHEYLRLKTRVEILQQSQRNLLGEDLGPLSTKELEQLEHQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
             SLK IRST+T+ M+DQL++L ++EQ L E NKALR KL ES+        WE  GQ + 
Sbjct  133  VSLKQIRSTKTQAMLDQLADLQRREQMLAESNKALRRKLEESTAEIPLRHSWEAGGQTIP  192

Query  542  YGQHSSSQ-------QCQNTAQIGYN----PTSMQANNNVGTSTMNGAGVLPGWML  676
            Y  H  +Q       +  ++ QIGYN    PT M A        +N  G +PGWML
Sbjct  193  YN-HVPAQSEFFQPLRLNSSLQIGYNHAGGPTEMNAVAPAQDDPVN--GFIPGWML  245



>ref|NP_001267667.1| developmental protein SEPALLATA 2-like [Cucumis sativus]
 gb|AAF23363.1|AF135962_1 CAGL2 [Cucumis sativus]
Length=246

 Score =   261 bits (668),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 138/236 (58%), Positives = 174/236 (74%), Gaps = 13/236 (6%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCS+S++ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSTSNMLKTLERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYGA+E  + +K+ +S+Y+EYLKLK+  E LQ++QR+LLGEDL  L  K+LEQLE Q+ 
Sbjct  73   CSYGAVEVTKPAKELESSYREYLKLKSRFESLQRTQRNLLGEDLGPLNSKELEQLERQLV  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
            +SLK +RST+T++M+DQLS+L  KEQ L+E N+AL+IKL E S+ +     W+   Q+M 
Sbjct  133  SSLKQVRSTKTQYMLDQLSDLQNKEQMLIETNRALQIKLEEISSRNNIRLTWDGGDQSMS  192

Query  542  YGQHSSSQQ-------CQNTAQIGYNPTSMQANNNVGTSTMNGA----GVLPGWML  676
            YG  ++  Q       C  T QIGY  TS  ++    T+T   A    G LPGWML
Sbjct  193  YGPQNAQTQGFFQPLECNPTLQIGY--TSAVSDQITSTTTPTHAQQVNGFLPGWML  246



>gb|ACJ64681.1| MADS-box protein MADS4 [Musa acuminata AAA Group]
Length=243

 Score =   261 bits (668),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 136/233 (58%), Positives = 167/233 (72%), Gaps = 12/233 (5%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            N INRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FSNRGKLYEFCSSSS+ +TLERY K
Sbjct  13   NSINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSSSSMLRTLERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            C+YGA E N  S+++QS+ QEYLKLKA V+ LQ+SQR+LLGEDL  L IK+LEQLE Q+D
Sbjct  73   CNYGAPETNIISRETQSSQQEYLKLKARVDGLQRSQRNLLGEDLGPLNIKELEQLERQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
             SL+ IRSTRT++M+DQL +L ++EQ L E NKAL+I+L ESS  D     W+P    + 
Sbjct  133  ASLRQIRSTRTQYMLDQLGDLQRREQMLCEANKALKIRLEESSEADQQQL-WDPNTHAVA  191

Query  542  YGQHSSSQQ---------CQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWM  673
            YG+     Q         C+ T QIGY+P  M        +   G   +PGW+
Sbjct  192  YGRQQPQPQGDGFFQSIDCEPTLQIGYHPDQMAIAAA--AAAAPGPSYMPGWL  242



>ref|XP_008801852.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X3 [Phoenix dactylifera]
Length=242

 Score =   261 bits (667),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 137/233 (59%), Positives = 166/233 (71%), Gaps = 13/233 (6%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSSS+ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            C+YGA E N  S+++QS+ QEYLKLKA VE LQ+SQR+LLGEDL  L  K+LEQLE Q+D
Sbjct  73   CNYGAPETNIVSRETQSSQQEYLKLKARVEALQRSQRNLLGEDLGPLSSKELEQLERQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
             SLK IRSTRT++M+DQL++L ++EQ L E NK+L+ +L E SN       W+P    + 
Sbjct  133  ASLKQIRSTRTQYMLDQLADLQRREQMLCEANKSLKRRL-EESNQATQQQVWDPNAHAVG  191

Query  542  YGQHSSSQQ---------CQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWM  673
            YG+     Q         C+ T  IGY+P  +      G S  N    +PGW+
Sbjct  192  YGRQPPQPQGDGFYQPIECEPTLHIGYHPEQITIAAGPGPSVSN---YMPGWL  241



>ref|XP_004507288.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X2 
[Cicer arietinum]
Length=247

 Score =   261 bits (667),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 137/237 (58%), Positives = 172/237 (73%), Gaps = 14/237 (6%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS S+ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSPSMLKTLERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYGA+E N+ +K+ +S+Y+EYLKLKA  E LQ++QR+LLGEDL  LG KDLEQLE+Q+D
Sbjct  73   CSYGAVEVNKPAKELESSYREYLKLKARFESLQRTQRNLLGEDLGPLGTKDLEQLEHQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
            +SLK +RST+T+ M+DQL++L  KE  L++ N++L +KL E ++ + +   WE   Q+M 
Sbjct  133  SSLKQVRSTKTQFMLDQLADLQNKEHMLVDANRSLNMKLEEINSRNQYRQTWEAGDQSMA  192

Query  542  YGQHSSSQQ-------CQNTAQIG----YNPT-SMQANNNVGTSTMNGAGVLPGWML  676
            YG  +   Q       C  T QIG    Y+P  S Q         +N  G +PGWML
Sbjct  193  YGTQNPHSQSFFQPLDCNPTLQIGSDYRYSPVASDQLTATTQAQQVN--GFIPGWML  247



>gb|AAF77579.1|AF072534_1 pepper MADS-box protein [Capsicum annuum]
Length=175

 Score =   258 bits (660),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAE+ALIIFS+RGKLYEFCSSSS+SKTLERYHK
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEIALIIFSSRGKLYEFCSSSSMSKTLERYHK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
             +YGALE  Q S DSQ+NYQEYLKLK  VEVLQQSQRH+LGEDL +L  KDLEQLE Q+D
Sbjct  73   HNYGALEGTQPSADSQNNYQEYLKLKTRVEVLQQSQRHMLGEDLGELNTKDLEQLERQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKL  478
            +SL+ IRST+T+HM DQL+ELHQKEQ+L E+NK+L+ K+
Sbjct  133  SSLRQIRSTKTQHMFDQLAELHQKEQSLTEMNKSLKTKV  171



>ref|XP_009415892.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Musa acuminata 
subsp. malaccensis]
Length=243

 Score =   261 bits (666),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 138/236 (58%), Positives = 169/236 (72%), Gaps = 18/236 (8%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FSNRGKLYEFCSSSS+ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSSSSMLKTLERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            C+YGA E N  S++ Q++ QEYLKLKA VE LQ+SQR+LLGEDL  L IK+LEQLE Q+D
Sbjct  73   CNYGAPETNIISREIQTSQQEYLKLKARVEALQRSQRNLLGEDLGPLSIKELEQLERQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKL--GESSNNDAFLTPWEPQGQN  535
             SL+ IRSTRT+ M+DQL++L ++EQ L E NKAL+I++  G  +N       W+P  Q 
Sbjct  133  ASLRQIRSTRTQCMLDQLADLQRREQMLCEANKALKIRMDEGNQANQQQL---WDPNAQA  189

Query  536  MQYGQHSSSQQ---------CQNTAQIGYNPTSMQ-ANNNVGTSTMNGAGVLPGWM  673
            + Y +H    Q         C+ T QIGY+P  M  A    G S    +  +PGW+
Sbjct  190  VAYCRHQPQPQGDGFFQPIECEPTLQIGYHPDQMAIAAAAPGPSV---SSYVPGWL  242



>gb|AEW50208.1| SEP1 [Acca sellowiana]
Length=245

 Score =   261 bits (666),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 139/234 (59%), Positives = 168/234 (72%), Gaps = 10/234 (4%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FSNRGKLYEFCSSSS++KT+E+Y K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSSSSMTKTIEKYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYG+LEAN +  D Q++YQEYLKLKA VEVLQ+SQR+LLGEDL  L  K+LEQLE+Q++
Sbjct  73   CSYGSLEANCSINDMQNSYQEYLKLKARVEVLQRSQRNLLGEDLGPLNTKELEQLEHQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQN-M  538
             SLK IRST+T+ M+DQL+ L  KEQ L+E N+ LR KL ES+        WE +  N +
Sbjct  133  NSLKQIRSTKTQFMLDQLAHLQHKEQMLVEANRDLRKKLEESNARIPLRLGWEAEDHNSI  192

Query  539  QYGQHSSSQQC--------QNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
             Y +     Q           T QIGYNP       NV  +  +  G +PGWML
Sbjct  193  SYSRLPPQSQGLIFQPLGDNPTLQIGYNPAG-SNEANVSAADQHPNGFIPGWML  245



>ref|XP_006477713.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X3 
[Citrus sinensis]
Length=250

 Score =   261 bits (666),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 142/241 (59%), Positives = 172/241 (71%), Gaps = 19/241 (8%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS SI KTLERYH+
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSPSIMKTLERYHR  72

Query  182  CSYGALEANQTSKDS-QSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQV  358
            CS+GA EAN+   ++ QS YQEYL+LK  VE+LQ+SQR+LLGEDL  L  K+LEQLE+Q+
Sbjct  73   CSFGAHEANRPPIETQQSTYQEYLRLKTAVELLQRSQRNLLGEDLDPLSTKELEQLEHQL  132

Query  359  DTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTP-----WEP  523
            +TSLK +RST+T+ M+DQLS+L ++EQ LLE+NK LR KL ES  N A   P     WE 
Sbjct  133  ETSLKHVRSTKTQCMVDQLSDLQKREQVLLELNKGLRKKLDES--NIAHQVPPHRLAWEA  190

Query  524  --QGQNMQYGQHSSSQQ--------CQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWM  673
               GQN+ Y ++    +             QIGYNP   +   ++     N  G +PGWM
Sbjct  191  ASAGQNITYNRYPVQSEGFFQPLSGGNPILQIGYNPMGSE-EAHIPVHAQNVTGFIPGWM  249

Query  674  L  676
            L
Sbjct  250  L  250



>gb|KEH25149.1| MADS-box transcription factor [Medicago truncatula]
Length=250

 Score =   260 bits (665),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 138/238 (58%), Positives = 172/238 (72%), Gaps = 13/238 (5%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS S+ KTL+RY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSPSMLKTLDRYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYGA+E N+ +K+ +S+Y+EYLKLKA  E LQ++QR+LLGEDL  LG KDLEQLE Q+D
Sbjct  73   CSYGAVEVNKPAKELESSYREYLKLKARFESLQRTQRNLLGEDLGPLGTKDLEQLERQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNN--DAFLTPWEPQGQN  535
            +SLK +RST+T+ M+DQL++L  KE  L+E N++L +KL E + N  + +   WE   Q+
Sbjct  133  SSLKQVRSTKTQFMLDQLADLQNKEHMLVEANRSLSMKLEEININSRNQYRQTWEAGDQS  192

Query  536  MQYG-QHSSSQ------QCQNTAQIG----YNPTSMQANNNVGTSTMNGAGVLPGWML  676
            M YG Q++ SQ      +C  T QIG    Y+P          T      G +PGWML
Sbjct  193  MAYGNQNAHSQSFFQPLECNPTLQIGTDYRYSPPVASDQLTATTQAQQVNGFIPGWML  250



>gb|AEJ76841.1| MADS17 [Gossypium hirsutum]
Length=244

 Score =   260 bits (665),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 139/235 (59%), Positives = 176/235 (75%), Gaps = 13/235 (6%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSSS+ KTL+RY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLDRYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYGA+E ++ +K+ +S+Y+EYLKLKA  E LQ++QR+LLGEDL  L  K+LEQLE+Q++
Sbjct  73   CSYGAVEVSKPAKELESSYREYLKLKARYEELQRTQRNLLGEDLGPLNSKELEQLEHQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
            +SLK +RST+T++M+DQLSEL  KEQ L+E N+AL IKL E S  + F   WE   Q++ 
Sbjct  133  SSLKHVRSTKTQYMLDQLSELQNKEQMLMETNRALSIKLEEVSARNQFRVSWEGGEQSVA  192

Query  542  Y-GQHSSSQ------QCQNTAQIGY-NPTSMQANNNVGTST--MNGAGVLPGWML  676
            +  Q + S       +C  T QIGY NP    A++ +  +T      G +PGWML
Sbjct  193  FTNQQAQSMGLFQPLECNPTLQIGYCNPV---ASDQMAATTHAQQVNGFIPGWML  244



>ref|XP_010694125.1| PREDICTED: developmental protein SEPALLATA 1 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=251

 Score =   260 bits (665),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 140/234 (60%), Positives = 168/234 (72%), Gaps = 11/234 (5%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCS  S+ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSGPSMLKTLERYQK  72

Query  182  CSYGALEANQTSKD-SQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQV  358
            CSYG +E N+ SK+  QS+Y+EYLKLKA  E LQ++QR+LLGEDL  L +K+L+QLE Q+
Sbjct  73   CSYGGVEVNKPSKELEQSSYREYLKLKARHESLQRTQRNLLGEDLGPLNVKELDQLERQL  132

Query  359  DTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDA--FLTPWEPQGQ  532
            ++SLK IRST+T+ M+DQL++L  KE  L+E NK L+ +L      D   F   W+   Q
Sbjct  133  ESSLKQIRSTKTQSMLDQLTDLQNKEHALMEANKTLKTELDRIMVKDTQQFRQTWDGSEQ  192

Query  533  NMQYG-QHSSSQ------QCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWM  673
            N+ YG QH+ SQ       C  T QIGYNP S +    V TS     G LPGWM
Sbjct  193  NVHYGQQHAQSQGLFQPLDCNPTLQIGYNPESSE-QMTVATSHTQVPGFLPGWM  245



>ref|XP_007215876.1| hypothetical protein PRUPE_ppa010548mg [Prunus persica]
 gb|EMJ17075.1| hypothetical protein PRUPE_ppa010548mg [Prunus persica]
Length=244

 Score =   260 bits (664),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 141/240 (59%), Positives = 172/240 (72%), Gaps = 23/240 (10%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSI KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSILKTLERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYG +E N+ +K+ +S+Y+EYLKLK   E LQ++QR+LLGEDL  L  K+LEQLE Q++
Sbjct  73   CSYGQVEVNKPAKELESSYREYLKLKGRFESLQRTQRNLLGEDLGPLNTKELEQLERQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQ-NM  538
            +SLK +RST+T++M+DQLS+L  KEQ L+E N+ L +KL + S+ +     WE   Q  M
Sbjct  133  SSLKQVRSTKTQYMLDQLSDLQNKEQMLIEANRDLSLKLDDISSRNQIRQSWEGGNQGGM  192

Query  539  QYG-QHSSSQ------QCQNTAQIGYNPTSMQANNNVGTSTMNGA-------GVLPGWML  676
             YG QH+ SQ       C  T QIGY        +NVG+  M+         G +PGWML
Sbjct  193  AYGSQHAQSQGFFQPLDCNPTLQIGY--------SNVGSEQMSATTHAQQVNGFIPGWML  244



>ref|XP_003544012.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X1 
[Glycine max]
Length=248

 Score =   260 bits (664),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 135/236 (57%), Positives = 172/236 (73%), Gaps = 11/236 (5%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS RGKLYEFCS++S+ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCSTNSMLKTLERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYGA+E ++  K+ +S+Y+EYLKLKA  E LQ++QR+LLGEDL  L  KDLEQLE Q+D
Sbjct  73   CSYGAVEVSKPGKELESSYREYLKLKARFESLQRTQRNLLGEDLGPLNTKDLEQLERQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
            +SLK +RST+T+ M+DQL++L  KE  L+E N++L +KL E ++ + +   WE   Q+M 
Sbjct  133  SSLKQVRSTKTQFMLDQLADLQNKEHMLVEANRSLTMKLEEINSRNQYRQTWEAGEQSMS  192

Query  542  YG-QHSSSQ------QCQNTAQIG----YNPTSMQANNNVGTSTMNGAGVLPGWML  676
            YG Q++ SQ      +C  T QIG    YNP + +      T      G +PGWML
Sbjct  193  YGTQNAHSQGFFQPLECNPTLQIGSDYRYNPEASEQQLAATTQAQQVNGFIPGWML  248



>ref|NP_001238296.1| MADS-box protein [Glycine max]
 gb|AAZ86071.1| MADS-box protein [Glycine max]
Length=248

 Score =   260 bits (664),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 135/236 (57%), Positives = 172/236 (73%), Gaps = 11/236 (5%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS RGKLYEFCS++S+ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCSTNSMLKTLERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYGA+E ++  K+ +S+Y+EYLKLKA  E LQ++QR+LLGEDL  L  KDLEQLE Q+D
Sbjct  73   CSYGAVEVSKPGKELESSYREYLKLKARFESLQRTQRNLLGEDLGPLNTKDLEQLERQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
            +SLK +RST+T+ M+DQL++L  KE  L+E N++L +KL E ++ + +   WE   Q+M 
Sbjct  133  SSLKQVRSTKTQFMLDQLADLQNKEHMLVEANRSLTMKLEEINSRNQYRQTWEAGEQSMP  192

Query  542  YG-QHSSSQ------QCQNTAQIG----YNPTSMQANNNVGTSTMNGAGVLPGWML  676
            YG Q++ SQ      +C  T QIG    YNP + +      T      G +PGWML
Sbjct  193  YGTQNAHSQGFFQPLECNPTLQIGSDYRYNPEASEQQLAATTQAQQVNGFIPGWML  248



>ref|XP_009788128.1| PREDICTED: MADS-box protein CMB1-like [Nicotiana sylvestris]
Length=242

 Score =   259 bits (663),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 136/231 (59%), Positives = 165/231 (71%), Gaps = 7/231 (3%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCS+SS+ KT+E+Y +
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSTSSMMKTIEKYQR  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSY  LEA+Q++ D+Q+NY EYL+LKA VE+LQ+SQR+LLGEDL  L  KDLEQLENQ++
Sbjct  73   CSYATLEASQSATDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGTLSTKDLEQLENQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
             SLK IRS +T  M+DQL++L Q+EQ L E NK LR KL ES+        WE   Q MQ
Sbjct  133  ASLKQIRSRKTHFMLDQLADLQQREQMLAESNKHLRRKLEESAAGIPLRLCWEDGAQAMQ  192

Query  542  YGQHSSSQ------QCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
              +   ++         ++ Q GYN       N  G S  N  G +PGWML
Sbjct  193  LNRLPQTEGFFQPLGLTSSPQFGYNHVGTDEVNG-GASAHNMNGFIPGWML  242



>ref|XP_007151389.1| hypothetical protein PHAVU_004G042300g [Phaseolus vulgaris]
 gb|ESW23383.1| hypothetical protein PHAVU_004G042300g [Phaseolus vulgaris]
Length=247

 Score =   260 bits (664),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 136/237 (57%), Positives = 173/237 (73%), Gaps = 14/237 (6%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS RGKLYEFCSSSS+ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCSSSSMLKTLERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYGA+E ++ +K+ +S+Y+EYLKLK   E LQ++QR+LLGEDL  L  K+LEQLE Q+D
Sbjct  73   CSYGAVEVSKPAKELESSYREYLKLKGRFESLQRTQRNLLGEDLGPLNTKELEQLERQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
            +SLK +RST+T+ M+DQL++L  KEQ L+E N+AL +KL E ++ + +   WE   Q+M 
Sbjct  133  SSLKQVRSTKTQFMLDQLADLQNKEQMLVEANRALTMKLDEINSRNQYRQTWEAGDQSMP  192

Query  542  YGQHSSSQQ-------CQNTAQIG----YNPTSMQANNNVGTSTMNGA-GVLPGWML  676
            YG  ++  Q       C  T QIG    YNP +  ++   GT+      G +PGWML
Sbjct  193  YGTPNAHSQGFFQPLECNPTLQIGSDYRYNPEA--SDQLTGTTQAQQVNGFIPGWML  247



>gb|AIU94433.1| MADS-box transcription factor 2 isoform 1, partial [Musa balbisiana]
Length=243

 Score =   259 bits (663),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 138/236 (58%), Positives = 168/236 (71%), Gaps = 18/236 (8%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FSNRGKLYEFCSSSS+ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSSSSMLKTLERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            C+YGA E N  S++ Q++ QEYLKLKA VE LQ+SQR+LLGEDL  L IK+LEQLE Q+D
Sbjct  73   CNYGAPETNIISREIQTSQQEYLKLKARVEALQRSQRNLLGEDLGPLSIKELEQLERQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKL--GESSNNDAFLTPWEPQGQN  535
             SL+ IRSTRT+ M+DQL++L ++EQ L E NKAL+I+L  G  +N       W+P    
Sbjct  133  ASLRQIRSTRTQCMLDQLADLQRREQMLCEANKALKIRLDEGNQANQQQL---WDPNAHA  189

Query  536  MQYGQHSSSQQ---------CQNTAQIGYNPTSMQ-ANNNVGTSTMNGAGVLPGWM  673
            + Y +H    Q         C+ T QIGY+P  M  A    G S    +  +PGW+
Sbjct  190  VAYCRHQPQPQGDGFFQPIECEPTLQIGYHPDQMAIAAAAPGPSV---SSYVPGWL  242



>emb|CAX65570.1| GRCD4 protein [Gerbera hybrid cultivar]
Length=249

 Score =   259 bits (663),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 138/237 (58%), Positives = 167/237 (70%), Gaps = 12/237 (5%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSSS+ KTLE+YH 
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMVKTLEKYHS  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYG+L+A+Q   +SQ NY EYL+LKA VEVLQ+SQR+LLGEDL  L  K+LEQLE+Q++
Sbjct  73   CSYGSLKASQPENESQYNYHEYLRLKARVEVLQRSQRNLLGEDLAPLNTKELEQLEHQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
             SL+ IRST+T+ M+DQL++L +KEQ L E NKALR KL ES+        WE   Q + 
Sbjct  133  MSLRKIRSTKTQSMLDQLADLQRKEQVLAETNKALRKKLEESAQEYPVRQMWEGGAQTIP  192

Query  542  YGQ---HS---------SSQQCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
            Y     HS         +S    +   + YNP      N  G +  +  G+ PGWML
Sbjct  193  YNPLPTHSDEFFQPLGLNSTMHNSFNGLRYNPIVSDEMNVAGANNNSPNGLFPGWML  249



>gb|ADJ67241.1| MADS box transcription factor 11 [Oncidium hybrid cultivar]
Length=248

 Score =   259 bits (662),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 135/236 (57%), Positives = 168/236 (71%), Gaps = 12/236 (5%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRG+L+EFCSSSSI+KT+ERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGRLFEFCSSSSITKTIERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSY + EA   SK++Q++YQEYLKLKA VE LQ+SQR+LLGEDL QL  K+LEQLE+Q++
Sbjct  73   CSYNSSEATIPSKETQNSYQEYLKLKARVEYLQRSQRNLLGEDLGQLSTKELEQLEHQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWE-------  520
            TSLK IRST+++ M+DQL +L +KEQ L E N+ALR+KL E          W        
Sbjct  133  TSLKQIRSTKSQLMLDQLCDLKRKEQMLQEANRALRMKLQEEEPEIPLQLSWPGSGGGGG  192

Query  521  -----PQGQNMQYGQHSSSQQCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWM  673
                 P  +  Q         C  + QIGY+P  ++   N G+S+ +  G +PGWM
Sbjct  193  RNGRGPCERQPQSDVFFQPLTCDPSLQIGYSPVCIEQQLNNGSSSHSVNGFIPGWM  248



>sp|Q39685.1|CMB1_DIACA RecName: Full=MADS-box protein CMB1 [Dianthus caryophyllus]
 gb|AAA62761.1| MADS box protein [Dianthus caryophyllus]
Length=233

 Score =   259 bits (661),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 134/225 (60%), Positives = 169/225 (75%), Gaps = 4/225 (2%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FSNRGKLYEFCS+S ++KTLERY +
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSTSCMNKTLERYQR  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYG+LE +Q SK+++S+YQEYLKLKA V+VLQ+S R+LLGEDL +L  K+LEQLE+Q+D
Sbjct  73   CSYGSLETSQPSKETESSYQEYLKLKAKVDVLQRSHRNLLGEDLGELSTKELEQLEHQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
             SL+ IRS +T+HM+DQL++L +KE+ L E N+AL+ KL ES    +F   W+ +     
Sbjct  133  KSLRQIRSIKTQHMLDQLADLQKKEEMLFESNRALKTKLEESCA--SFRPNWDVRQPGDG  190

Query  542  YGQHSSSQQCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
            + +      C N  QIGYN  + Q   N  TS  N  G   GWML
Sbjct  191  FFE-PLPLPCNNNLQIGYNEAT-QDQMNATTSAQNVHGFAQGWML  233



>ref|XP_004507289.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X3 
[Cicer arietinum]
Length=247

 Score =   259 bits (662),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 136/235 (58%), Positives = 172/235 (73%), Gaps = 10/235 (4%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS S+ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSPSMLKTLERYQK  72

Query  182  CSYGALEANQTSKD-SQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQV  358
            CSYGA+E N+ +K+  QS+Y+EYLKLKA  E LQ++QR+LLGEDL  LG KDLEQLE+Q+
Sbjct  73   CSYGAVEVNKPAKELEQSSYREYLKLKARFESLQRTQRNLLGEDLGPLGTKDLEQLEHQL  132

Query  359  DTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNM  538
            D+SLK +RST+T+ M+DQL++L  KE  L++ N++L +KL E ++ + +   WE   Q+M
Sbjct  133  DSSLKQVRSTKTQFMLDQLADLQNKEHMLVDANRSLNMKLEEINSRNQYRQTWEAGDQSM  192

Query  539  QYGQHSSSQQ-------CQNTAQIGYNPTSMQANNNVGTSTMNGA--GVLPGWML  676
             YG  +   Q       C  T QIG    S  A++ +  +T      G +PGWML
Sbjct  193  AYGTQNPHSQSFFQPLDCNPTLQIGDYRYSPVASDQLTATTQAQQVNGFIPGWML  247



>gb|AIE44769.1| putative MADS-domain transcription factor AGL2 [Nuphar advena]
Length=245

 Score =   259 bits (661),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 135/234 (58%), Positives = 172/234 (74%), Gaps = 10/234 (4%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTF+KRRNGLLKKAYELS+LCD EVALIIFSNRG+LYEFCS+SS+ KTLERY K
Sbjct  13   NKINRQVTFSKRRNGLLKKAYELSVLCDVEVALIIFSNRGRLYEFCSTSSMLKTLERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            C+YG++EA+  S+++Q++YQEYLKLK+ VE LQ SQR+LLGEDL  L  K+LE LE Q++
Sbjct  73   CNYGSIEASVPSRETQNSYQEYLKLKSKVEALQHSQRNLLGEDLGPLNSKELEHLEQQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKL-GESSNNDAFLTPWEPQGQNM  538
             SLK +RST+T+ M+DQLS+L  KEQ L + N AL  KL G + + +     WE  GQ++
Sbjct  133  VSLKHVRSTKTQFMLDQLSDLKGKEQILQDANMALVRKLEGAAGSANHQQLSWENGGQHL  192

Query  539  QYGQHSSSQ--------QCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
            QYG+HS  Q        +C +T QIGYNPT+ Q    V     N  G +P W++
Sbjct  193  QYGRHSGPQKDGFYHPLECDSTLQIGYNPTA-QEQITVAAPAHNVNGFIPSWLV  245



>gb|KHG17252.1| Developmental SEPALLATA 2 -like protein [Gossypium arboreum]
Length=244

 Score =   259 bits (661),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 138/235 (59%), Positives = 176/235 (75%), Gaps = 13/235 (6%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSSS+ KTL+RY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLDRYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYGA+E ++ +K+ +S+Y+EYLKLKA  E LQ++QR+LLGEDL  L  K+LEQLE+Q++
Sbjct  73   CSYGAVEVSKPAKELESSYREYLKLKARYEELQRTQRNLLGEDLGPLNSKELEQLEHQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
            +SLK +RST+T++M+DQL+EL  KEQ L+E N+AL IKL E S  + F   WE   Q++ 
Sbjct  133  SSLKHVRSTKTQYMLDQLTELQNKEQMLMETNRALSIKLEEISARNQFRASWEGGEQSVA  192

Query  542  Y-GQHSSSQ------QCQNTAQIGY-NPTSMQANNNVGTST--MNGAGVLPGWML  676
            +  Q + S       +C  T QIGY NP    A++ +  +T      G +PGWML
Sbjct  193  FTNQQAQSMGLFQPLECNPTLQIGYCNPV---ASDQMAATTHAQQVNGFIPGWML  244



>gb|ADC79707.1| SEPALLATA1-like protein [Euptelea pleiosperma]
Length=243

 Score =   259 bits (661),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 142/232 (61%), Positives = 171/232 (74%), Gaps = 8/232 (3%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELSILCDAEV LIIFSNRGKLYEFCSS+S+ KTL+RY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSILCDAEVGLIIFSNRGKLYEFCSSNSMLKTLDRYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYGALEA+   KD+QS+Y EYLKLKA VEVLQ+SQR+LLGEDL  L  K+LEQLE+Q++
Sbjct  73   CSYGALEASMPPKDTQSSYHEYLKLKARVEVLQRSQRNLLGEDLGSLNTKELEQLEHQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
             SLK IRST+T+ ++DQLS+L ++EQ+L E N+ALR KL ESS        WE   QN+ 
Sbjct  133  MSLKQIRSTKTQLLLDQLSDLQRQEQHLQETNRALRRKLDESSGEIPLQLSWETGAQNIS  192

Query  542  YGQHSSSQ-------QCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
            Y +  +         +C +T QIGY+P       N+     N  G +PGWML
Sbjct  193  YSRQPAQSERFFQPLECNSTLQIGYHPLGPD-QLNIAAPAQNVNGFIPGWML  243



>gb|ACJ64678.1| MADS-box protein MADS2 [Musa acuminata AAA Group]
 gb|AIU94429.1| MADS-box transcription factor 2 isoform 1 [Musa acuminata]
Length=243

 Score =   259 bits (661),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 137/236 (58%), Positives = 168/236 (71%), Gaps = 18/236 (8%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FSNRGKLYEFCSSSS+ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSSSSMLKTLERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            C+YGA E N  S++ Q++ QEYLKLKA VE LQ+SQR+LLGEDL  L IK+LEQLE Q+D
Sbjct  73   CNYGAPETNIISREIQTSQQEYLKLKARVEALQRSQRNLLGEDLGPLSIKELEQLERQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKL--GESSNNDAFLTPWEPQGQN  535
             SL+ IRSTRT+ M+DQL++L ++EQ L E NKAL+I++  G  +N       W+P    
Sbjct  133  ASLRQIRSTRTQCMLDQLADLQRREQMLCEANKALKIRMDEGNQANQQQL---WDPNAHA  189

Query  536  MQYGQHSSSQQ---------CQNTAQIGYNPTSMQ-ANNNVGTSTMNGAGVLPGWM  673
            + Y +H    Q         C+ T QIGY+P  M  A    G S    +  +PGW+
Sbjct  190  VAYCRHQPQPQGDGFFQPIECEPTLQIGYHPDQMAIAAAAPGPSV---SSYVPGWL  242



>ref|XP_004507287.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X1 
[Cicer arietinum]
Length=248

 Score =   259 bits (661),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 138/238 (58%), Positives = 172/238 (72%), Gaps = 15/238 (6%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS S+ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSPSMLKTLERYQK  72

Query  182  CSYGALEANQTSKD-SQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQV  358
            CSYGA+E N+ +K+  QS+Y+EYLKLKA  E LQ++QR+LLGEDL  LG KDLEQLE+Q+
Sbjct  73   CSYGAVEVNKPAKELEQSSYREYLKLKARFESLQRTQRNLLGEDLGPLGTKDLEQLEHQL  132

Query  359  DTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNM  538
            D+SLK +RST+T+ M+DQL++L  KE  L++ N++L +KL E ++ + +   WE   Q+M
Sbjct  133  DSSLKQVRSTKTQFMLDQLADLQNKEHMLVDANRSLNMKLEEINSRNQYRQTWEAGDQSM  192

Query  539  QYGQHSSSQQ-------CQNTAQIG----YNPT-SMQANNNVGTSTMNGAGVLPGWML  676
             YG  +   Q       C  T QIG    Y+P  S Q         +N  G +PGWML
Sbjct  193  AYGTQNPHSQSFFQPLDCNPTLQIGSDYRYSPVASDQLTATTQAQQVN--GFIPGWML  248



>gb|AIU94434.1| MADS-box transcription factor 2 isoform 2, partial [Musa balbisiana]
Length=247

 Score =   258 bits (660),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 139/240 (58%), Positives = 169/240 (70%), Gaps = 22/240 (9%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FSNRGKLYEFCSSSS+ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSSSSMLKTLERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            C+YGA E N  S++ Q++ QEYLKLKA VE LQ+SQR+LLGEDL  L IK+LEQLE Q+D
Sbjct  73   CNYGAPETNIISREIQTSQQEYLKLKARVEALQRSQRNLLGEDLGPLSIKELEQLERQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKL--GESSNNDAFLTPWEPQGQN  535
             SL+ IRSTRT+ M+DQL++L ++EQ L E NKAL+I++  G  +N       W+P  Q 
Sbjct  133  ASLRQIRSTRTQCMLDQLADLQRREQMLCEANKALKIRMDEGNQANQQQL---WDPNAQA  189

Query  536  MQYGQHSSSQQ---------CQNTAQIGYNPTSM-----QANNNVGTSTMNGAGVLPGWM  673
            + Y +H    Q         C+ T QIGY+P  M      A    G S  N    +PGW+
Sbjct  190  VAYCRHQPQPQGDGFFQPIDCEPTLQIGYHPDQMAIAAAAAAAAAGPSVSN---YVPGWL  246



>ref|XP_003552609.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X1 
[Glycine max]
Length=254

 Score =   259 bits (661),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 137/242 (57%), Positives = 175/242 (72%), Gaps = 17/242 (7%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSSS+ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYGA+E ++ +K+ +S+Y+EYLKLKA  E LQ++QR+LLGEDL  L IK+LE LE Q+D
Sbjct  73   CSYGAVEVSKPAKELESSYREYLKLKARFESLQRTQRNLLGEDLGPLNIKELEHLERQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
            +SLK +RST+T+ M+DQLS+L  KEQ L+E N++L +KL E ++ + +   WE   Q+M 
Sbjct  133  SSLKQVRSTKTQFMLDQLSDLQTKEQMLVEANRSLTVKLEEINSRNHYRQSWEAGDQSMP  192

Query  542  YG--------QHSSSQ------QCQNTAQIG--YNPTSMQANNNVGTS-TMNGAGVLPGW  670
            YG         HS SQ      +C  T  IG  Y   ++ ++    T+     +G +PGW
Sbjct  193  YGGGGPENSHSHSHSQGFFQPLECNPTLHIGPDYRYNAVASDQITATTQPQQVSGFIPGW  252

Query  671  ML  676
            ML
Sbjct  253  ML  254



>ref|XP_008230292.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X4 
[Prunus mume]
Length=244

 Score =   258 bits (660),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 140/240 (58%), Positives = 172/240 (72%), Gaps = 23/240 (10%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSI KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSILKTLERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYG +E N+ +K+ +S+Y+EYLKLK   E LQ++QR+LLGE+L  L  K+LEQLE Q++
Sbjct  73   CSYGQVEVNKPAKELESSYREYLKLKGRFESLQRTQRNLLGEELGPLNTKELEQLERQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQ-NM  538
            +SLK +RST+T++M+DQLS+L  KEQ L+E N+ L +KL + S+ +     WE   Q  M
Sbjct  133  SSLKQVRSTKTQYMLDQLSDLQNKEQMLIEANRDLSLKLDDISSRNQIRQSWEGGNQGGM  192

Query  539  QYG-QHSSSQ------QCQNTAQIGYNPTSMQANNNVGTSTMNGA-------GVLPGWML  676
             YG QH+ SQ       C  T QIGY        +NVG+  M+         G +PGWML
Sbjct  193  AYGTQHAQSQGFFQPLDCNPTLQIGY--------SNVGSEQMSATTHAQQVNGFIPGWML  244



>ref|XP_006585806.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X2 
[Glycine max]
Length=250

 Score =   258 bits (659),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 139/241 (58%), Positives = 175/241 (73%), Gaps = 19/241 (8%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSSS+ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYGA+E  + +K+ +S+Y+EYLKLKA  E LQ++QR+LLGEDL  L  K+LE LE Q+D
Sbjct  73   CSYGAVEVTKPAKELESSYREYLKLKARFESLQRTQRNLLGEDLGPLNTKELEHLERQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
            +SLK +RST+T+ M+DQLS+L  KEQ L+E N++L +KL E ++ + +   WE   Q+M 
Sbjct  133  SSLKQVRSTKTQFMLDQLSDLQTKEQMLVEANRSLTVKLEEINSRNHYRQSWEAGDQSMP  192

Query  542  YG---QHSSSQQ-------CQNTAQIG----YNPTSMQANNNVGTST--MNGAGVLPGWM  673
            YG   Q+S S Q       C  T QIG    YN     A++ +  +T     +G +PGWM
Sbjct  193  YGGGPQNSHSHQGFFQPLECNPTLQIGPDYRYNDV---ASDQITATTQPQQVSGFIPGWM  249

Query  674  L  676
            L
Sbjct  250  L  250



>ref|XP_011021072.1| PREDICTED: developmental protein SEPALLATA 2-like [Populus euphratica]
 ref|XP_011021073.1| PREDICTED: developmental protein SEPALLATA 2-like [Populus euphratica]
Length=244

 Score =   258 bits (658),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 138/240 (58%), Positives = 172/240 (72%), Gaps = 23/240 (10%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCS+S++ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSTSNMLKTLERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYGA E N+ +K+ +S+Y+EYLK+KA  E LQ++QR+LLGEDL  L  K+LEQLE  ++
Sbjct  73   CSYGADEVNKPAKELESSYREYLKVKAKFETLQRTQRNLLGEDLGPLNTKELEQLERHLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQG-QNM  538
            +SLK +RST+T++M+DQL +L  KE  LLE N+AL +KL E S  +     WE    Q+M
Sbjct  133  SSLKQVRSTKTQYMLDQLGDLQNKEHMLLEANRALTMKLDEISARNNLRPSWEGDDQQSM  192

Query  539  QYG-QHSSSQ------QCQNTAQIGYNPTSMQANNNVGTSTMNGA-------GVLPGWML  676
             YG QH+ SQ      +C  T QIGY        N+VG+  +  A       G +PGWML
Sbjct  193  SYGHQHAQSQGLFQHLECNPTLQIGY--------NSVGSDQITAAHAAQQVHGFIPGWML  244



>gb|AFM30904.1| transcription factor MADS4 [Prunus avium]
Length=244

 Score =   258 bits (658),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 140/240 (58%), Positives = 171/240 (71%), Gaps = 23/240 (10%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSI KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSILKTLERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYG +E N+ +K+ +S+Y+EYLKLK   E LQ++QR+LLGEDL  L  K+LEQLE Q++
Sbjct  73   CSYGQVEVNKPAKELESSYREYLKLKGRFESLQRTQRNLLGEDLGPLNTKELEQLERQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQ-NM  538
            +SLK +RST+T++M+DQLS+L  KEQ L+E N+ L +KL + S+ +     WE   Q  M
Sbjct  133  SSLKQVRSTKTQYMLDQLSDLQNKEQMLIEANRDLTLKLDDISSRNQIRQSWEGGNQGGM  192

Query  539  QYG-QHSSSQ------QCQNTAQIGYNPTSMQANNNVGTSTMNGA-------GVLPGWML  676
             YG QH+ SQ       C    QIGY        +NVG+  M+         G +PGWML
Sbjct  193  AYGTQHAQSQGFFQPLDCNPPLQIGY--------SNVGSEQMSATTHAQQVNGFIPGWML  244



>gb|ABK41485.1| putative MADS box protein [Elaeis guineensis]
Length=242

 Score =   257 bits (657),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 137/233 (59%), Positives = 163/233 (70%), Gaps = 13/233 (6%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSSS+ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMMKTLERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            C+YGA E N  S+++QS+ QEYLKLKA  E LQ+SQR+LLGEDL  L  K+LEQLE Q+D
Sbjct  73   CNYGAPETNIISRETQSSQQEYLKLKARAEALQRSQRNLLGEDLGPLSSKELEQLERQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
             SLK IRSTRT++M+DQL++L +KEQ L E NK+LR +L E SN       W+P    + 
Sbjct  133  ASLKQIRSTRTQYMLDQLADLQRKEQMLCEANKSLRRRL-EESNQAGQQQVWDPTAHAVG  191

Query  542  YGQHSSSQQ---------CQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWM  673
            YG+     Q          + T QIGY P  +      G S       +PGW+
Sbjct  192  YGRQPPQPQSDGFYQQIDSEPTLQIGYPPEQITIAAAPGPSVNT---YMPGWL  241



>ref|XP_010917558.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Elaeis 
guineensis]
 gb|AAQ03224.1|AF411843_1 MADS box transcription factor [Elaeis guineensis]
Length=242

 Score =   257 bits (657),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 137/233 (59%), Positives = 163/233 (70%), Gaps = 13/233 (6%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSSS+ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMMKTLERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            C+YGA E N  S+++QS+ QEYLKLKA  E LQ+SQR+LLGEDL  L  K+LEQLE Q+D
Sbjct  73   CNYGAPETNIISRETQSSQQEYLKLKARAEALQRSQRNLLGEDLGPLSSKELEQLERQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
             SLK IRSTRT++M+DQL++L +KEQ L E NK+LR +L E SN       W+P    + 
Sbjct  133  ASLKQIRSTRTQYMLDQLADLQRKEQMLCEANKSLRRRL-EESNQAGQQQVWDPTAHAVG  191

Query  542  YGQHSSSQQ---------CQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWM  673
            YG+     Q          + T QIGY P  +      G S       +PGW+
Sbjct  192  YGRQPPQPQSDGFYQQIDSEPTLQIGYPPEQITIAAAPGPSVNT---YMPGWL  241



>ref|XP_006593703.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X2 
[Glycine max]
 gb|KHN08352.1| Developmental protein SEPALLATA 2 [Glycine soja]
Length=249

 Score =   258 bits (658),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 136/237 (57%), Positives = 172/237 (73%), Gaps = 12/237 (5%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS RGKLYEFCS++S+ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCSTNSMLKTLERYQK  72

Query  182  CSYGALEANQTSKD-SQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQV  358
            CSYGA+E ++  K+  QS+Y+EYLKLKA  E LQ++QR+LLGEDL  L  KDLEQLE Q+
Sbjct  73   CSYGAVEVSKPGKELEQSSYREYLKLKARFESLQRTQRNLLGEDLGPLNTKDLEQLERQL  132

Query  359  DTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNM  538
            D+SLK +RST+T+ M+DQL++L  KE  L+E N++L +KL E ++ + +   WE   Q+M
Sbjct  133  DSSLKQVRSTKTQFMLDQLADLQNKEHMLVEANRSLTMKLEEINSRNQYRQTWEAGEQSM  192

Query  539  QYG-QHSSSQ------QCQNTAQIG----YNPTSMQANNNVGTSTMNGAGVLPGWML  676
             YG Q++ SQ      +C  T QIG    YNP + +      T      G +PGWML
Sbjct  193  SYGTQNAHSQGFFQPLECNPTLQIGSDYRYNPEASEQQLAATTQAQQVNGFIPGWML  249



>ref|XP_009608616.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X2 
[Nicotiana tomentosiformis]
Length=245

 Score =   257 bits (657),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 136/233 (58%), Positives = 167/233 (72%), Gaps = 8/233 (3%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LC+AEVALI+FSNRGKLYEFCSS+++ KTL+RY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCEAEVALIVFSNRGKLYEFCSSNNMLKTLDRYQK  72

Query  182  CSYGALEANQTSKDSQSN-YQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQV  358
            CSYG LE N++ KD++ N Y+EYLKLKA  E LQ+ QRHLLGEDL  L I DL+ LE Q+
Sbjct  73   CSYGTLEVNRSIKDNEQNSYREYLKLKAKYESLQRYQRHLLGEDLGPLNIDDLDHLEVQL  132

Query  359  DTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNM  538
            D SLK IRSTRT+ M+DQL++L  KE+  LE NK L  KL E    +    PW    Q++
Sbjct  133  DNSLKHIRSTRTQLMLDQLTDLQSKEKLWLEANKVLERKLEEIYAENNLQQPWGGGEQSI  192

Query  539  QYG-QHSSSQ------QCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
             YG QH+ SQ       C +  QIGY+P +  +     T+  N  G++PGWML
Sbjct  193  TYGQQHAQSQGFFQPLDCNSILQIGYDPITTSSQITAVTNAQNVNGMVPGWML  245



>gb|AFO68789.1| floral-binding protein 9, partial [Gunnera manicata]
Length=226

 Score =   256 bits (655),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 137/229 (60%), Positives = 167/229 (73%), Gaps = 11/229 (5%)
 Frame = +2

Query  14   RQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHKCSYG  193
            RQVTF KRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCS+SS++KTLERYHKCS G
Sbjct  1    RQVTFCKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSTSSMAKTLERYHKCSQG  60

Query  194  ALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVDTSLK  373
             LEA++   ++Q+NYQEYLKLK  VEVLQQSQR+LLGEDL  L  K+LEQLE+Q++ SLK
Sbjct  61   RLEASRPVNETQTNYQEYLKLKGRVEVLQQSQRNLLGEDLGPLNTKELEQLESQLEASLK  120

Query  374  SIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQYGQ-  550
             IRST+T+ M+DQL EL  KE+ LLE N+AL +KL E S  +     WE + QN+ +   
Sbjct  121  QIRSTKTQLMLDQLFELRMKEEMLLEANRALWMKLEELSIENPI--SWEAESQNIPFSCN  178

Query  551  -HSSSQ------QCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
             H+ S+       C +T Q+GYNP        +  +T N    +PGWML
Sbjct  179  IHAHSEGFFQPLPCNSTQQLGYNPLC-SDELRMAATTQNVNRFIPGWML  226



>gb|ABQ85952.1| MADS-box transcription factor SEP-like 3 [Trochodendron aralioides]
Length=230

 Score =   256 bits (655),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 140/231 (61%), Positives = 170/231 (74%), Gaps = 8/231 (3%)
 Frame = +2

Query  5    KINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHKC  184
            KINRQVTFAKRRNG+LKKAYELS+LCDAEVALIIFSNRGKLYEFCS+SS+ KTLERY KC
Sbjct  1    KINRQVTFAKRRNGMLKKAYELSVLCDAEVALIIFSNRGKLYEFCSTSSMLKTLERYQKC  60

Query  185  SYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVDT  364
            SYGALEA+Q + ++Q++YQEYLKLK  VEVLQ+SQR+LLGEDL  L  K+LEQLE Q++ 
Sbjct  61   SYGALEASQPAIETQNSYQEYLKLKGRVEVLQRSQRNLLGEDLGPLNTKELEQLEQQLEM  120

Query  365  SLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQY  544
            SLK IRST+T+ M+DQLS+L +KEQ L E N+AL  KLGESS  +     WE  GQ++ Y
Sbjct  121  SLKQIRSTKTQFMLDQLSDLQRKEQMLQEANRALGRKLGESSAENTLRLSWEAGGQSIPY  180

Query  545  GQHSSSQ-------QCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
             +  +         +C ++  IGYNP        V     N  G +PGWML
Sbjct  181  SRQPAEPEGFFQPLECNSSMHIGYNPVGPD-QITVAAPGQNVNGFIPGWML  230



>ref|XP_009773225.1| PREDICTED: MADS-box protein CMB1-like isoform X3 [Nicotiana sylvestris]
Length=173

 Score =   254 bits (649),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS RGKLYEFCSSSS+SKT+E+YHK
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCSSSSMSKTVEKYHK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
             +Y A+E +Q S DSQ+ YQEYLKLK  VEVLQQSQRH+LGEDL QL  KDLEQLE QVD
Sbjct  73   YNYAAVEGSQPSTDSQNTYQEYLKLKTRVEVLQQSQRHILGEDLGQLNTKDLEQLERQVD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKL  478
            +SL+ IRSTRT+HMID+L+EL QKE++L E+NK+LR+K+
Sbjct  133  SSLRQIRSTRTQHMIDELTELQQKEESLTEMNKSLRMKV  171



>ref|XP_003621519.1| MADS-box protein [Medicago truncatula]
Length=245

 Score =   256 bits (655),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 132/233 (57%), Positives = 171/233 (73%), Gaps = 8/233 (3%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS RGKLYEFCS+S++ KTL+RY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCSTSNMLKTLDRYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYGA+E ++ +K+ +S+Y+EYLKLK   E LQ++QR+LLGEDL  L  KDLEQLE Q+D
Sbjct  73   CSYGAVEVSKPAKELESSYREYLKLKQRFENLQRAQRNLLGEDLGPLSSKDLEQLERQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
            +SLK +RST+T+ M+DQL++L  KE  L+E N++L IKL E ++ + +   WE   Q+MQ
Sbjct  133  SSLKQVRSTKTQFMLDQLADLQNKEHMLVEANRSLSIKLEEINSRNHYRQSWEASDQSMQ  192

Query  542  YG--QHSSSQ------QCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
            Y   Q++ SQ      +C  T QIGYN  +     +   +     G +PGWML
Sbjct  193  YEAQQNAHSQSFFQQLECNPTLQIGYNNVASDQIASTSQAQQQVNGFVPGWML  245



>ref|XP_010913017.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X1 [Elaeis guineensis]
 gb|AAQ03226.1|AF411845_1 MADS box transcription factor [Elaeis guineensis]
Length=242

 Score =   256 bits (655),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 134/233 (58%), Positives = 164/233 (70%), Gaps = 13/233 (6%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FSNRGKLYEFCSSSS+ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSSSSMLKTLERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            C+YGA E N  S+++Q++ QEYLKLKA VE LQ+SQR+LLG+DL  L  K+LEQLE Q+D
Sbjct  73   CNYGAPETNIVSRETQTSQQEYLKLKARVEALQRSQRNLLGDDLGPLSSKELEQLERQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
             SLK IRSTRT++M+DQL++L ++EQ L E NK+L+ +L E SN       W+P    + 
Sbjct  133  ASLKQIRSTRTQYMLDQLADLQRREQMLCEANKSLKQRL-EESNQATQQQVWDPNAPAVG  191

Query  542  YGQHSSSQQ---------CQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWM  673
            YG+     Q         C  T  IGY P  +      G S  N    +PGW+
Sbjct  192  YGRQPPQPQGDGFYQQIECDPTLHIGYPPEQITIAAAPGPSVSN---YMPGWL  241



>ref|XP_011014957.1| PREDICTED: developmental protein SEPALLATA 2-like [Populus euphratica]
 ref|XP_011014958.1| PREDICTED: developmental protein SEPALLATA 2-like [Populus euphratica]
 ref|XP_011014959.1| PREDICTED: developmental protein SEPALLATA 2-like [Populus euphratica]
Length=244

 Score =   256 bits (655),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 137/240 (57%), Positives = 172/240 (72%), Gaps = 23/240 (10%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKL+EFCS+S++ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLFEFCSTSNMLKTLERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYGA E N+ +K+ +S+Y+EYLK+KA  E LQ++QR+LLGEDL  L  K+LEQLE  ++
Sbjct  73   CSYGADEVNKPAKELESSYREYLKVKAKFETLQRTQRNLLGEDLGPLNTKELEQLERHLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQG-QNM  538
            +SLK +RST+T++M+DQL +L  KE  LLE N+AL +KL E S  +     WE    Q+M
Sbjct  133  SSLKQVRSTKTQYMLDQLGDLQNKEHMLLEANRALTMKLDEISARNNLRPSWEGDDQQSM  192

Query  539  QYG-QHSSSQ------QCQNTAQIGYNPTSMQANNNVGTSTMNGA-------GVLPGWML  676
             YG QH+ SQ      +C  T QIGY        N+VG+  +  A       G +PGWML
Sbjct  193  SYGHQHAQSQGLFQHLECNPTLQIGY--------NSVGSDQITAAHAAQQVHGFIPGWML  244



>ref|XP_010917559.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Elaeis 
guineensis]
 gb|AAQ03225.1|AF411844_1 MADS box transcription factor [Elaeis guineensis]
 gb|AAY96424.1| putative MADS box protein [Elaeis guineensis]
Length=242

 Score =   256 bits (655),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 136/233 (58%), Positives = 165/233 (71%), Gaps = 13/233 (6%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSSS+ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMMKTLERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            C+YGA E N  S+++QS+ QEYLKLKA VE LQ+SQR+LLGEDL  L  K+LEQLE Q+D
Sbjct  73   CNYGAPETNIISRETQSSQQEYLKLKARVEALQRSQRNLLGEDLGPLSSKELEQLERQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
             SLK IRSTRT++M+DQL++L ++EQ L E NK+LR +L E SN       W+P    + 
Sbjct  133  ASLKQIRSTRTQYMLDQLADLQRREQMLCEANKSLRRRL-EESNQAGQQQVWDPTAHAVG  191

Query  542  YGQHSSSQQC---------QNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWM  673
            YG+     Q          + T QI Y P  +      G+S    +  +PGW+
Sbjct  192  YGRQPPQPQSDGFYQQIDGEPTLQIRYPPEQITIAAAPGSSV---STYMPGWL  241



>ref|XP_010694117.1| PREDICTED: developmental protein SEPALLATA 1 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=252

 Score =   256 bits (655),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 138/235 (59%), Positives = 168/235 (71%), Gaps = 12/235 (5%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCS  S+ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSGPSMLKTLERYQK  72

Query  182  CSYGALEANQTSKD-SQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQV  358
            CSYG +E N+ SK+  QS+Y+EYLKLKA  E LQ++QR+LLGEDL  L +K+L+QLE Q+
Sbjct  73   CSYGGVEVNKPSKELEQSSYREYLKLKARHESLQRTQRNLLGEDLGPLNVKELDQLERQL  132

Query  359  DTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGES---SNNDAFLTPWEPQG  529
            ++SLK IRST+T+ M+DQL++L  KE  L+E NK L+ +  +     +   F   W+   
Sbjct  133  ESSLKQIRSTKTQSMLDQLTDLQNKEHALMEANKTLKTEQLDRIMVKDTQQFRQTWDGSE  192

Query  530  QNMQYG-QHSSSQ------QCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWM  673
            QN+ YG QH+ SQ       C  T QIGYNP S +    V TS     G LPGWM
Sbjct  193  QNVHYGQQHAQSQGLFQPLDCNPTLQIGYNPESSE-QMTVATSHTQVPGFLPGWM  246



>gb|AFK42306.1| unknown [Medicago truncatula]
Length=250

 Score =   256 bits (655),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 136/238 (57%), Positives = 171/238 (72%), Gaps = 13/238 (5%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINR+VTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYE CSS S+ KTL+RY K
Sbjct  13   NKINRRVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYELCSSPSMLKTLDRYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYGA+E N+ +K+ +S+Y+EYLKLKA  E LQ++QR+LLGEDL  LG KDLEQLE Q+D
Sbjct  73   CSYGAVEVNKPAKELESSYREYLKLKARFESLQRTQRNLLGEDLGPLGTKDLEQLERQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNN--DAFLTPWEPQGQN  535
            +SLK +RST+T+ M+DQL++L  KE  L+E N++L +KL E + N  + +   WE   Q+
Sbjct  133  SSLKQVRSTKTQFMLDQLADLQNKEHMLVEANRSLSMKLEEININSRNQYRQTWEAGDQS  192

Query  536  MQYG-QHSSSQ------QCQNTAQIG----YNPTSMQANNNVGTSTMNGAGVLPGWML  676
            M YG Q++ SQ      +C  T QIG    Y+P          T      G +PGWML
Sbjct  193  MAYGNQNAHSQSFFQPLECNPTLQIGTDYRYSPPVASDQLTATTQAQQVNGFIPGWML  250



>gb|AIU94430.1| MADS-box transcription factor 2 isoform 2 [Musa acuminata]
 gb|AIU94431.1| MADS-box transcription factor 2 isoform 2 [Musa acuminata]
Length=244

 Score =   256 bits (654),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 137/236 (58%), Positives = 167/236 (71%), Gaps = 17/236 (7%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKL+EFCSSSS+ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLFEFCSSSSMLKTLERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            C+YGA E N  S+++Q++ QEYLKLKA VE LQ+SQR+LLGEDL  L IK+LEQLE Q+D
Sbjct  73   CNYGAPETNVMSRETQNSQQEYLKLKARVEALQRSQRNLLGEDLGPLNIKELEQLERQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
             SL+ IRSTRT++M+DQL++L ++EQ L E NKAL+ +L E SN       W+P      
Sbjct  133  ASLRQIRSTRTQYMLDQLTDLQRREQMLCEANKALKRRL-EESNQANQQQLWDPNT----  187

Query  542  YGQHSSSQQ---------CQNTAQIGYNPTSMQANNNVGTSTMNGAGV---LPGWM  673
            YG+     Q         C+ T QIGY+P  M        +   G  V   +PGW+
Sbjct  188  YGRQQPQPQGDGFFQPIDCEPTLQIGYHPDKMAIAAAAAAAAAAGPSVSNYVPGWL  243



>ref|XP_006602962.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X2 
[Glycine max]
 gb|KHN37943.1| Developmental protein SEPALLATA 2 [Glycine soja]
Length=255

 Score =   256 bits (655),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 138/243 (57%), Positives = 175/243 (72%), Gaps = 18/243 (7%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSSS+ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQK  72

Query  182  CSYGALEANQTSKD-SQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQV  358
            CSYGA+E ++ +K+  QS+Y+EYLKLKA  E LQ++QR+LLGEDL  L IK+LE LE Q+
Sbjct  73   CSYGAVEVSKPAKELEQSSYREYLKLKARFESLQRTQRNLLGEDLGPLNIKELEHLERQL  132

Query  359  DTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNM  538
            D+SLK +RST+T+ M+DQLS+L  KEQ L+E N++L +KL E ++ + +   WE   Q+M
Sbjct  133  DSSLKQVRSTKTQFMLDQLSDLQTKEQMLVEANRSLTVKLEEINSRNHYRQSWEAGDQSM  192

Query  539  QYG--------QHSSSQ------QCQNTAQIG--YNPTSMQANNNVGTS-TMNGAGVLPG  667
             YG         HS SQ      +C  T  IG  Y   ++ ++    T+     +G +PG
Sbjct  193  PYGGGGPENSHSHSHSQGFFQPLECNPTLHIGPDYRYNAVASDQITATTQPQQVSGFIPG  252

Query  668  WML  676
            WML
Sbjct  253  WML  255



>ref|XP_008230291.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X3 
[Prunus mume]
Length=245

 Score =   256 bits (653),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 141/241 (59%), Positives = 172/241 (71%), Gaps = 24/241 (10%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSI KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSILKTLERYQK  72

Query  182  CSYGALEANQTSKD-SQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQV  358
            CSYG +E N+ +K+  QS+Y+EYLKLK   E LQ++QR+LLGE+L  L  K+LEQLE Q+
Sbjct  73   CSYGQVEVNKPAKELEQSSYREYLKLKGRFESLQRTQRNLLGEELGPLNTKELEQLERQL  132

Query  359  DTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQ-N  535
            ++SLK +RST+T++M+DQLS+L  KEQ L+E N+ L +KL + S+ +     WE   Q  
Sbjct  133  ESSLKQVRSTKTQYMLDQLSDLQNKEQMLIEANRDLSLKLDDISSRNQIRQSWEGGNQGG  192

Query  536  MQYG-QHSSSQ------QCQNTAQIGYNPTSMQANNNVGTSTMNGA-------GVLPGWM  673
            M YG QH+ SQ       C  T QIGY        +NVG+  M+         G +PGWM
Sbjct  193  MAYGTQHAQSQGFFQPLDCNPTLQIGY--------SNVGSEQMSATTHAQQVNGFIPGWM  244

Query  674  L  676
            L
Sbjct  245  L  245



>gb|ADD25177.1| SEP1-1 [Cabomba caroliniana]
Length=226

 Score =   255 bits (651),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 137/229 (60%), Positives = 166/229 (72%), Gaps = 13/229 (6%)
 Frame = +2

Query  14   RQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHKCSYG  193
            RQVTF+KRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSS + KTLERY KCSYG
Sbjct  1    RQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSGMLKTLERYQKCSYG  60

Query  194  ALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVDTSLK  373
             +EA   S+++Q +YQEYLKLK+ VE LQ++QR+LLG+DL  L  K+LE LE Q++ SLK
Sbjct  61   TVEATVPSRETQRSYQEYLKLKSKVEALQRTQRNLLGDDLGPLNSKELEHLEQQLEGSLK  120

Query  374  SIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKL-GESSNNDAFLTPWEPQGQNMQYGQ  550
             +RST+T++M+DQL EL QKEQNL EVN+AL  KL G  S++     PWE  GQ++QY +
Sbjct  121  HVRSTKTQYMLDQLGELKQKEQNLQEVNRALIRKLEGGVSHHQ---IPWESSGQHIQYVR  177

Query  551  HSSSQ--------QCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWM  673
             S  Q         C  T QIGYNP S Q    +  S  N  G LP W+
Sbjct  178  QSDPQSNGFYQRLDCDPTLQIGYNP-SGQETITISASAQNVNGYLPTWL  225



>ref|XP_008360083.1| PREDICTED: MADS-box protein CMB1-like [Malus domestica]
Length=235

 Score =   255 bits (652),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 135/226 (60%), Positives = 158/226 (70%), Gaps = 4/226 (2%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FS  GKLYEFCS  SI+KTLER+ +
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSTSGKLYEFCSGPSIAKTLERHQR  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            C+YG L A+Q+++D QS YQEYLKLK  VE LQ++QRHLLGEDLV LG K+L+QLENQ+D
Sbjct  73   CTYGELGASQSAEDEQSRYQEYLKLKTKVEALQRTQRHLLGEDLVHLGTKELQQLENQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
             S+K IRST+T+ M  Q+SEL +KE+ LLE N  LR KL E +        W    Q  Q
Sbjct  133  VSMKKIRSTKTQFMHVQISELQRKEEMLLEANTGLRRKLEEITAGHQ--RSWNGNHQAAQ  190

Query  542  YGQHSSSQQCQNTAQIGYNPTSMQANNNVGTSTM-NGAGVLPGWML  676
                    Q  N  QIG  P       NV TS+  NG G  PGWML
Sbjct  191  LEGFPEHLQYNNALQIG-TPVVXNDEANVATSSAQNGTGFFPGWML  235



>ref|XP_009356441.1| PREDICTED: MADS-box protein CMB1-like [Pyrus x bretschneideri]
Length=235

 Score =   255 bits (652),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 135/226 (60%), Positives = 158/226 (70%), Gaps = 4/226 (2%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FS  GKLYEFCS  SI+KTLERY +
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSTSGKLYEFCSGPSIAKTLERYQR  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            C+YG L A+Q+++D QS YQEYLKLK  VE LQ +QRH+LGEDLV LG+K+L+QLENQ+D
Sbjct  73   CTYGELGASQSAEDEQSRYQEYLKLKTKVEALQCTQRHILGEDLVHLGMKELQQLENQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
             SLK IRST+T+ M  Q+SEL +KE+ LLE N  LR KL E +        W    Q  Q
Sbjct  133  ISLKKIRSTKTQFMHVQISELQRKEEMLLEANTGLRRKLEEITAGPQ--RSWNSNHQAAQ  190

Query  542  YGQHSSSQQCQNTAQIGYNPTSMQANNNVGTSTM-NGAGVLPGWML  676
                    Q  N  QIG  P       NV TS+  +G G  PGWML
Sbjct  191  LEGFPEHLQSTNALQIG-TPVVTNDEANVATSSAQSGTGFFPGWML  235



>ref|XP_008801853.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X4 [Phoenix dactylifera]
Length=234

 Score =   255 bits (652),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 135/225 (60%), Positives = 163/225 (72%), Gaps = 5/225 (2%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSSS+ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            C+YGA E N  S+++QS+ QEYLKLKA VE LQ+SQR+LLGEDL  L  K+LEQLE Q+D
Sbjct  73   CNYGAPETNIVSRETQSSQQEYLKLKARVEALQRSQRNLLGEDLGPLSSKELEQLERQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
             SLK IRSTRT++M+DQL++L ++EQ L E NK+L+ +L E SN       W+P    + 
Sbjct  133  ASLKQIRSTRTQYMLDQLADLQRREQMLCEANKSLKRRL-EESNQATQQQVWDPNAHAVG  191

Query  542  YGQHSSSQQCQNTAQ-IGYNPTSMQANNNVGTSTMNGAGVLPGWM  673
            YG+     Q     Q I Y+P  +      G S  N    +PGW+
Sbjct  192  YGRQPPQPQGDGFYQPIEYHPEQITIAAGPGPSVSN---YMPGWL  233



>ref|XP_008350888.1| PREDICTED: MADS-box protein CMB1-like [Malus domestica]
 gb|AAD51423.1|U78950_1 MADS-box protein 4 [Malus domestica]
Length=235

 Score =   255 bits (652),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 135/226 (60%), Positives = 158/226 (70%), Gaps = 4/226 (2%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FS  GKLYEFCS  SI+KTLER+ +
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSTSGKLYEFCSGPSIAKTLERHQR  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            C+YG L A+Q+++D QS YQEYLKLK  VE LQ++QRHLLGEDLV LG K+L+QLENQ+D
Sbjct  73   CTYGELGASQSAEDEQSRYQEYLKLKTKVEALQRTQRHLLGEDLVHLGTKELQQLENQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
             S+K IRST+T+ M  Q+SEL +KE+ LLE N  LR KL E +        W    Q  Q
Sbjct  133  VSMKKIRSTKTQFMHVQISELQRKEEMLLEANTGLRRKLEEITAGHQ--RSWNGNHQAAQ  190

Query  542  YGQHSSSQQCQNTAQIGYNPTSMQANNNVGTSTM-NGAGVLPGWML  676
                    Q  N  QIG  P       NV TS+  NG G  PGWML
Sbjct  191  LEGFPEHLQYNNALQIG-TPVVTNDEANVATSSAQNGTGFFPGWML  235



>ref|XP_007215877.1| hypothetical protein PRUPE_ppa010548mg [Prunus persica]
 gb|ABO27622.1| transcription factor MADS7 [Prunus persica]
 gb|EMJ17076.1| hypothetical protein PRUPE_ppa010548mg [Prunus persica]
Length=245

 Score =   255 bits (652),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 141/241 (59%), Positives = 172/241 (71%), Gaps = 24/241 (10%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSS-ISKTLERYH  178
            NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSS I KTLERY 
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSSILKTLERYQ  72

Query  179  KCSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQV  358
            KCSYG +E N+ +K+ +S+Y+EYLKLK   E LQ++QR+LLGEDL  L  K+LEQLE Q+
Sbjct  73   KCSYGQVEVNKPAKELESSYREYLKLKGRFESLQRTQRNLLGEDLGPLNTKELEQLERQL  132

Query  359  DTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQ-N  535
            ++SLK +RST+T++M+DQLS+L  KEQ L+E N+ L +KL + S+ +     WE   Q  
Sbjct  133  ESSLKQVRSTKTQYMLDQLSDLQNKEQMLIEANRDLSLKLDDISSRNQIRQSWEGGNQGG  192

Query  536  MQYG-QHSSSQ------QCQNTAQIGYNPTSMQANNNVGTSTMNGA-------GVLPGWM  673
            M YG QH+ SQ       C  T QIGY        +NVG+  M+         G +PGWM
Sbjct  193  MAYGSQHAQSQGFFQPLDCNPTLQIGY--------SNVGSEQMSATTHAQQVNGFIPGWM  244

Query  674  L  676
            L
Sbjct  245  L  245



>ref|XP_003531877.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X1 
[Glycine max]
 gb|KHN30313.1| Developmental protein SEPALLATA 2 [Glycine soja]
Length=251

 Score =   256 bits (653),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 140/242 (58%), Positives = 175/242 (72%), Gaps = 20/242 (8%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSSS+ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQK  72

Query  182  CSYGALEANQTSKD-SQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQV  358
            CSYGA+E  + +K+  QS+Y+EYLKLKA  E LQ++QR+LLGEDL  L  K+LE LE Q+
Sbjct  73   CSYGAVEVTKPAKELEQSSYREYLKLKARFESLQRTQRNLLGEDLGPLNTKELEHLERQL  132

Query  359  DTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNM  538
            D+SLK +RST+T+ M+DQLS+L  KEQ L+E N++L +KL E ++ + +   WE   Q+M
Sbjct  133  DSSLKQVRSTKTQFMLDQLSDLQTKEQMLVEANRSLTVKLEEINSRNHYRQSWEAGDQSM  192

Query  539  QYG---QHSSSQQ-------CQNTAQIG----YNPTSMQANNNVGTST--MNGAGVLPGW  670
             YG   Q+S S Q       C  T QIG    YN     A++ +  +T     +G +PGW
Sbjct  193  PYGGGPQNSHSHQGFFQPLECNPTLQIGPDYRYNDV---ASDQITATTQPQQVSGFIPGW  249

Query  671  ML  676
            ML
Sbjct  250  ML  251



>gb|KHN29767.1| Developmental protein SEPALLATA 2 [Glycine soja]
Length=248

 Score =   255 bits (651),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 133/236 (56%), Positives = 171/236 (72%), Gaps = 11/236 (5%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRR+GLLKKAYELS+LCDAEVALIIFS RGKLYEFCS++S+ KTLERY K
Sbjct  13   NKINRQVTFAKRRDGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCSTNSMLKTLERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYGA+E ++  K+ +S+Y+EYLKLKA  E LQ++QR+LLGEDL  L  KDLEQLE Q+D
Sbjct  73   CSYGAVEVSKPGKELESSYREYLKLKARFESLQRTQRNLLGEDLGPLNTKDLEQLERQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
            +SLK +RST+T+ M+DQL++L  KE  L+E N++L +KL E ++ + +   WE   Q+M 
Sbjct  133  SSLKQVRSTKTQFMLDQLADLQNKEHMLVEANRSLTMKLEEINSRNQYRQTWEAGEQSMP  192

Query  542  YG-QHSSSQ------QCQNTAQIG----YNPTSMQANNNVGTSTMNGAGVLPGWML  676
            YG Q++ SQ      +C  T QIG    Y P + +      T      G +PGWML
Sbjct  193  YGTQNAHSQGFFQPLECNPTLQIGSDYRYIPEASEQQLAATTQAQQVNGFIPGWML  248



>gb|AGW23364.1| MADS box protein MADS62 [Gossypium hirsutum]
Length=244

 Score =   255 bits (651),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 136/235 (58%), Positives = 173/235 (74%), Gaps = 13/235 (6%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSS + KTL+RY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSGMLKTLDRYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYGA+E ++ +K+ +S+Y+EYLKLKA  E LQ++QR+ LGEDL  L  K+LEQLE+Q++
Sbjct  73   CSYGAVEVSKPAKELESSYREYLKLKARYEELQRTQRNFLGEDLGPLNSKELEQLEHQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
            +SLK +RST+T++M+DQLSEL  KE+ L+E N+AL IKL E S  + F   WE   Q + 
Sbjct  133  SSLKHVRSTKTQYMLDQLSELQNKERMLMETNRALSIKLEEVSARNQFRVSWEGGEQGVA  192

Query  542  Y-GQHSSSQ------QCQNTAQIGY-NPTSMQANNNVGTST--MNGAGVLPGWML  676
            +  Q + S       +C  T QIGY NP    A++ +  +T      G +PGWML
Sbjct  193  FTNQQAQSMGLFQPLECNPTLQIGYCNPV---ASDQMAATTHAQQVNGFIPGWML  244



>ref|XP_006477712.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X2 
[Citrus sinensis]
Length=265

 Score =   256 bits (653),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 141/254 (56%), Positives = 173/254 (68%), Gaps = 30/254 (12%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS SI KTLERYH+
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSPSIMKTLERYHR  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CS+GA EAN+   ++QS YQEYL+LK  VE+LQ+SQR+LLGEDL  L  K+LEQLE+Q++
Sbjct  73   CSFGAHEANRPPIETQSTYQEYLRLKTAVELLQRSQRNLLGEDLDPLSTKELEQLEHQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIK--LGESS------------NND  499
            TSLK +RST+T+ M+DQLS+L ++EQ LLE+NK LR K  LG  +            +N 
Sbjct  133  TSLKHVRSTKTQCMVDQLSDLQKREQVLLELNKGLRKKAFLGNYTCLTTPPFTQLDESNI  192

Query  500  AFLTP-----WEP--QGQNMQYGQHSSSQQ--------CQNTAQIGYNPTSMQANNNVGT  634
            A   P     WE    GQN+ Y ++    +             QIGYNP   +   ++  
Sbjct  193  AHQVPPHRLAWEAASAGQNITYNRYPVQSEGFFQPLSGGNPILQIGYNPMGSE-EAHIPV  251

Query  635  STMNGAGVLPGWML  676
               N  G +PGWML
Sbjct  252  HAQNVTGFIPGWML  265



>gb|AAF22138.1|AF129875_1 MADS box transcription factor MADS1 [Capsicum annuum]
Length=245

 Score =   254 bits (650),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 134/235 (57%), Positives = 165/235 (70%), Gaps = 12/235 (5%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCS+SS+ KT+E+Y +
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSTSSMVKTIEKYQR  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSY  LEANQ++ D+Q+NY EYL+LKA VE+LQ+SQR+ LGEDL  L  KDLEQLENQ++
Sbjct  73   CSYATLEANQSATDTQNNYHEYLRLKARVELLQRSQRNFLGEDLGTLSTKDLEQLENQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
            +SLK IRS +T+ M+DQL++L Q+EQ L E N+ LR KL ES+        WE  G +  
Sbjct  133  SSLKQIRSRKTQFMLDQLADLQQREQMLAESNRLLRRKLEESTAGFPVRLSWE-DGADQA  191

Query  542  YGQHSSSQQCQNTAQ----------IGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
              QH+     +   Q           GYNP +    N   T+  N  G + GWML
Sbjct  192  MHQHNRLPHTEGFLQPLGLHSSPPHFGYNPVNTDEVNAAATA-HNMNGFIHGWML  245



>gb|AJC01940.1| MADS-box protein [Ficus carica]
Length=248

 Score =   254 bits (649),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 141/239 (59%), Positives = 176/239 (74%), Gaps = 17/239 (7%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LC+AEVALIIFSNRGKLYEFCS SS+ KTLE+YHK
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCEAEVALIIFSNRGKLYEFCSGSSMVKTLEKYHK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
             SYG+LEA Q + D+QS+YQEYLKLK  VEVLQ+SQR+LLGEDL  L  K+LE LENQ++
Sbjct  73   YSYGSLEATQPTNDTQSSYQEYLKLKTRVEVLQRSQRNLLGEDLGPLSSKELEHLENQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTP----WEPQG  529
            TSL+ IRSTRT+ M+DQL+ L Q+E  LLE N+ALR +L E  NN++   P    WE  G
Sbjct  133  TSLRHIRSTRTQSMLDQLANLQQREHTLLEANRALRRQLEE--NNNSAQIPLRLAWEAAG  190

Query  530  Q--NMQYGQHSSSQQCQNTAQIGYNPTSMQ-ANNNVGTSTMN-GA------GVLPGWML  676
            +  ++ + +H +  +      +G N  ++Q  NN++G   MN GA      G + GWML
Sbjct  191  EQDSIPFTRHPTQPEW-FFQPLGSNSAALQIGNNSMGPDGMNVGAQAQSFNGYVHGWML  248



>ref|NP_001234201.1| TAGL2 transcription factor [Solanum lycopersicum]
 gb|AAM33104.2| TAGL2 transcription factor [Solanum lycopersicum]
Length=246

 Score =   254 bits (649),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 135/234 (58%), Positives = 168/234 (72%), Gaps = 9/234 (4%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVAL++FSNRGKLYEFCS+S++ KTL+RY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALLVFSNRGKLYEFCSTSNMLKTLDRYQK  72

Query  182  CSYGALEANQTSKDS-QSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQV  358
            CSYG LE N++ KD+ QS+Y+EYLKLKA  E LQ+ QRHLLG++L  L I DLE LE Q+
Sbjct  73   CSYGTLEVNRSIKDNEQSSYREYLKLKAKYESLQRYQRHLLGDELGPLTIDDLEHLEVQL  132

Query  359  DTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNM  538
            DTSLK IRSTRT+ M+DQLS+L  KE+   E NK L  K+ E    +     W    Q++
Sbjct  133  DTSLKHIRSTRTQMMLDQLSDLQTKEKLWNEANKVLERKMEEIYAENNMQQAWGGGEQSL  192

Query  539  QYG--QHSSSQ------QCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
             YG  QH  SQ      +C ++ QIGY+P +  +     T+  N  G++PGWML
Sbjct  193  NYGQQQHPQSQGFFQPLECNSSLQIGYDPITTSSQITAVTNAQNVNGMIPGWML  246



>ref|XP_004304204.1| PREDICTED: developmental protein SEPALLATA 2-like [Fragaria vesca 
subsp. vesca]
 gb|AAO49380.1| MADS-RIN-like protein [Fragaria x ananassa]
Length=249

 Score =   254 bits (649),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 140/239 (59%), Positives = 166/239 (69%), Gaps = 16/239 (7%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSS+ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQK  72

Query  182  CSYGALEANQTSKD-SQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQV  358
            CSYGA+E  + +K+  +S+Y+EYLKLK   E LQQ+QR+LLGEDL  L  K+LEQLE Q+
Sbjct  73   CSYGAMEVQKPAKELEESSYREYLKLKTRCESLQQTQRNLLGEDLGPLNTKELEQLERQL  132

Query  359  DTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWE--PQGQ  532
            ++SLK +RST+T+HMID LS+L  KE  L+E N+ L+ KL E  +       WE     Q
Sbjct  133  ESSLKHVRSTKTQHMIDLLSDLQSKEHMLIEANRDLKTKLDEIDSRTQLRQTWEHGHDHQ  192

Query  533  NMQYG-QHSSSQ-------QCQNTAQIGYNPT---SMQANNNVGTSTMNGAGVLPGWML  676
             M YG QH+ +Q        C  T QIGYN      M A        +N  G +PGWML
Sbjct  193  TMLYGTQHAQTQGLMFQPLDCNPTLQIGYNAVVSQEMPAATPAHAQPVN--GFIPGWML  249



>gb|AFX72877.1| MADS-box protein SEP2A [Aquilegia coerulea]
Length=243

 Score =   254 bits (648),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 131/232 (56%), Positives = 165/232 (71%), Gaps = 8/232 (3%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS RGKLYEFCS+SS+ KTL++Y K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCSTSSMLKTLDKYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
             SY ALE + ++K++Q+NYQEYL+LKA VE+LQQSQR+LLGE+L  L  K+L+QLE+Q+D
Sbjct  73   SSYAALETSTSAKETQNNYQEYLRLKARVEILQQSQRNLLGEELGSLSTKELDQLEHQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
             SLK IR T+T+ M+DQLS+L  KEQ L E N +LR KL E    +A   PW    QN+ 
Sbjct  133  MSLKQIRCTKTQFMLDQLSDLQGKEQVLEEANSSLRRKLDERIAENALRLPWASGEQNIP  192

Query  542  YGQHSSSQQ-------CQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
            Y +  +  +       C +T  +GYN    +    V     N  G +PGWM+
Sbjct  193  YCRQPAQSEEFFQPLGCNSTLHVGYNHVGPE-QITVAAPAQNINGFIPGWMV  243



>gb|AAP83390.1| SEPALLATA1-like MADS-box [Pachysandra terminalis]
Length=238

 Score =   253 bits (647),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 132/233 (57%), Positives = 168/233 (72%), Gaps = 10/233 (4%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS RGKLYEFCSSSS+  TLERY K
Sbjct  8    NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSARGKLYEFCSSSSMQNTLERYQK  67

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYG LE +Q +K++QS+Y EY++LKA VE LQ+SQR+L GE+L  L  K+LEQLE+Q++
Sbjct  68   CSYGPLEPSQPAKETQSSYLEYMRLKARVEGLQRSQRNLFGENLGPLSTKELEQLEHQLE  127

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
             SL  IRST+T+ M+DQLS+L +KEQ L E N++L+ KL ES+  ++    WE  G  + 
Sbjct  128  MSLNQIRSTKTQFMLDQLSDLQRKEQMLQEANRSLKRKLEESNAENSLGPSWESGGHGVP  187

Query  542  YGQHSSSQ--------QCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
            +G H  +Q        +C +T QIGYN        ++     N  G +PGWM+
Sbjct  188  FG-HQPAQSEGFFQPLECNSTLQIGYNHVGAD-QMSITVPPQNVNGFVPGWMV  238



>ref|XP_006603756.1| PREDICTED: MADS-box protein isoform X1 [Glycine max]
Length=249

 Score =   254 bits (648),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 135/237 (57%), Positives = 171/237 (72%), Gaps = 12/237 (5%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS RGKLYEFCS++S+ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCSTNSMLKTLERYQK  72

Query  182  CSYGALEANQTSKD-SQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQV  358
            CSYGA+E ++  K+  QS+Y+EYLKLKA  E LQ++QR+LLGEDL  L  KDLEQLE Q+
Sbjct  73   CSYGAVEVSKPGKELEQSSYREYLKLKARFESLQRTQRNLLGEDLGPLNTKDLEQLERQL  132

Query  359  DTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNM  538
            D+SLK +RST+T+ M+DQL++L  KE  L+E N++L +KL E ++ + +   WE   Q+M
Sbjct  133  DSSLKQVRSTKTQFMLDQLADLQNKEHMLVEANRSLTMKLEEINSRNQYRQTWEAGEQSM  192

Query  539  QYG-QHSSSQ------QCQNTAQIG----YNPTSMQANNNVGTSTMNGAGVLPGWML  676
             YG Q++ SQ      +C  T QIG    Y P + +      T      G +PGWML
Sbjct  193  PYGTQNAHSQGFFQPLECNPTLQIGSDYRYIPEASEQQLAATTQAQQVNGFIPGWML  249



>gb|AIU94432.1| MADS-box transcription factor 2 isoform 3, partial [Musa acuminata]
Length=243

 Score =   254 bits (648),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 140/238 (59%), Positives = 168/238 (71%), Gaps = 22/238 (9%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKL+EFCSSSS+ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLFEFCSSSSMLKTLERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            C+YGA E N  S+++QS+ QEYLKLKA VE LQ+SQR+LLGEDL  L IK+LEQLE Q+D
Sbjct  73   CNYGAPETNVISRETQSSQQEYLKLKARVEALQRSQRNLLGEDLGPLNIKELEQLERQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
             SL+ IRSTRT++M+DQL++L ++EQ L E NKAL+ +L E SN       W+P      
Sbjct  133  ASLRQIRSTRTQYMLDQLTDLQRREQMLCEANKALKRRL-EESNQANQQQLWDPNT----  187

Query  542  YGQHSSSQQ---------CQNTAQIGYNPTSM-----QANNNVGTSTMNGAGVLPGWM  673
            YG+     Q         C+ T QIGY+P  M      A    G S  N    +PGW+
Sbjct  188  YGRQQPQPQGDGFFQPIDCEPTLQIGYHPDQMAIAAAAAAAAAGPSVSN---YVPGWL  242



>ref|XP_009615088.1| PREDICTED: MADS-box protein CMB1-like isoform X1 [Nicotiana tomentosiformis]
Length=235

 Score =   253 bits (647),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 136/223 (61%), Positives = 161/223 (72%), Gaps = 7/223 (3%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSN GKLYEFCSSSS+  TLERYH+
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNTGKLYEFCSSSSMPTTLERYHR  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
             +Y A+E +Q S DSQ+ YQEYL LK  VE+LQQSQRH+LGEDL QL  KDLEQLE Q+D
Sbjct  73   YNYAAVEGSQPSTDSQNTYQEYLNLKTRVEMLQQSQRHVLGEDLGQLSNKDLEQLERQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
            +SL+ IRSTRT+HM+DQL+EL Q E++L E+NK+LR+K  E     A  T W+   Q   
Sbjct  133  SSLRQIRSTRTQHMLDQLTELQQTEESLTEMNKSLRMKFEELGV--ALQTSWQSGQQQPD  190

Query  542  YGQHSSSQQCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGW  670
               H  +    N+  I YN        N   ST +  GV+PG+
Sbjct  191  GFFHPVA--SNNSMPIRYNTV---LPENAEPSTQHATGVVPGY  228



>gb|AEF59025.1| MADS-1 [Fragaria x ananassa]
Length=249

 Score =   254 bits (648),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 141/240 (59%), Positives = 168/240 (70%), Gaps = 18/240 (8%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSS+ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQK  72

Query  182  CSYGALEANQTSKD-SQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQV  358
            CSYGA+E  + +K+  +S+Y+EYLKLK   E LQQ+QR+LLGEDL  L  K+LEQLE Q+
Sbjct  73   CSYGAMEVQKPAKELEESSYREYLKLKTRCESLQQTQRNLLGEDLGPLNTKELEQLERQL  132

Query  359  DTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWE--PQGQ  532
            ++SLK +RST+T+HMID LS+L  KE  L+E N+ L+ KL E  +       WE     Q
Sbjct  133  ESSLKHVRSTKTQHMIDLLSDLQSKEHMLIEANRDLKTKLDEIDSRTQLRQTWEHGHDHQ  192

Query  533  NMQYG-QHSSSQ-------QCQNTAQIGYNPTSMQANNNVGTSTMNGA----GVLPGWML  676
             M YG QH+ +Q        C  T QIGYN    Q    + T+T   A    G +PGWML
Sbjct  193  TMLYGTQHAQTQGLMFQPLDCNPTLQIGYNAVVSQ---EMPTATPAHAQPVNGFIPGWML  249



>ref|XP_008230290.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X2 
[Prunus mume]
Length=245

 Score =   254 bits (648),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 140/241 (58%), Positives = 172/241 (71%), Gaps = 24/241 (10%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSS-ISKTLERYH  178
            NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSS I KTLERY 
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSSILKTLERYQ  72

Query  179  KCSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQV  358
            KCSYG +E N+ +K+ +S+Y+EYLKLK   E LQ++QR+LLGE+L  L  K+LEQLE Q+
Sbjct  73   KCSYGQVEVNKPAKELESSYREYLKLKGRFESLQRTQRNLLGEELGPLNTKELEQLERQL  132

Query  359  DTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQ-N  535
            ++SLK +RST+T++M+DQLS+L  KEQ L+E N+ L +KL + S+ +     WE   Q  
Sbjct  133  ESSLKQVRSTKTQYMLDQLSDLQNKEQMLIEANRDLSLKLDDISSRNQIRQSWEGGNQGG  192

Query  536  MQYG-QHSSSQ------QCQNTAQIGYNPTSMQANNNVGTSTMNGA-------GVLPGWM  673
            M YG QH+ SQ       C  T QIGY        +NVG+  M+         G +PGWM
Sbjct  193  MAYGTQHAQSQGFFQPLDCNPTLQIGY--------SNVGSEQMSATTHAQQVNGFIPGWM  244

Query  674  L  676
            L
Sbjct  245  L  245



>dbj|BAM71401.1| transcription factor [Pyrus pyrifolia]
Length=236

 Score =   253 bits (647),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 132/226 (58%), Positives = 158/226 (70%), Gaps = 3/226 (1%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FS  GKLYEFCS  SI++TLERY +
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSTSGKLYEFCSGPSIAETLERYQR  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            C+YG L A+Q+++D QS YQEYL LK  VE LQ++QRH+LGEDLV LG+K+L+QLENQ+D
Sbjct  73   CTYGELGASQSAEDEQSRYQEYLNLKTKVEALQRTQRHILGEDLVHLGMKELQQLENQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
             SLK IRST+T+ M  Q+SEL +KE+ LLE N  LR KL E +        W    Q  Q
Sbjct  133  MSLKKIRSTKTQFMHVQISELQKKEEMLLEANTGLRRKLEEITAGPQ--RSWNSNHQAAQ  190

Query  542  YGQHSSSQQCQNTAQIGYNPTSMQANNNVGTSTM-NGAGVLPGWML  676
                    Q  N  QIG    +     NV TS+  +G G  PGWML
Sbjct  191  LEGFPEHLQSTNALQIGTPVVTNDEAANVATSSAQSGTGFFPGWML  236



>gb|AAX15924.1| AGL9.2 [Persea americana]
Length=242

 Score =   253 bits (647),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 132/234 (56%), Positives = 165/234 (71%), Gaps = 15/234 (6%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSSS+ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            C+YGA E   +++++QS++QEYLKLKA VE LQ+SQR+LLGEDL  L  K+L+ LE Q+D
Sbjct  73   CNYGAPETTVSTRETQSSHQEYLKLKARVEALQRSQRNLLGEDLGPLTSKELDTLEKQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
             SLK IRSTRT++M+DQL++L ++EQ L E NK L+ +L E    +  +  W+P G  + 
Sbjct  133  ASLKQIRSTRTQYMLDQLADLQRREQMLSEANKNLKRRLEEGMQANPQV--WDPNGHPVT  190

Query  542  YGQHSSSQQ----------CQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWM  673
            YG+  +  Q          C+ T  IGY P         G S  N    +PGW+
Sbjct  191  YGRQQAPPQSDGFFHPLDTCEPTLHIGYQPADQITIAAPGPSVNN---YMPGWL  241



>ref|XP_008243812.1| PREDICTED: MADS-box protein CMB1-like isoform X1 [Prunus mume]
 ref|XP_008243813.1| PREDICTED: MADS-box protein CMB1-like isoform X1 [Prunus mume]
Length=249

 Score =   253 bits (647),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 138/240 (58%), Positives = 173/240 (72%), Gaps = 18/240 (8%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKIN+QVTFAKRRNGLLKKAYELS+LCDAEVALI+FS RGKLYEFCS SS+ KTLERY +
Sbjct  13   NKINQQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSTRGKLYEFCSGSSMEKTLERYQR  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSY ALEA+Q ++DSQS YQ+Y+ LKA VEVLQ +QR+ LGEDL  LG K+L+QLENQ+D
Sbjct  73   CSYSALEASQPAQDSQSRYQDYVNLKAKVEVLQLTQRNFLGEDLGHLGTKELQQLENQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPW----EPQG  529
             SL+ IRST+T+ M  Q+S+L +KEQ LLE N  LR KL E    DA +  +    E Q 
Sbjct  133  MSLRQIRSTKTQVMHGQISDLLRKEQMLLEANNELRRKLEEC---DAAIERYSWTTEEQN  189

Query  530  QNMQYGQHSSS---------QQCQNTAQIGYNPTSMQANNNVGTSTMNGAG-VLPG-WML  676
            QN+    H  +          QC NT QIGYNP ++  ++ + +ST + +G + PG W+L
Sbjct  190  QNVPNSSHHQAAQFEGVLDHSQCNNTLQIGYNPAAVTDHHELQSSTQSHSGLIFPGTWVL  249



>ref|XP_003516451.1| PREDICTED: developmental protein SEPALLATA 1-like [Glycine max]
 gb|KHN28441.1| MADS-box protein CMB1 [Glycine soja]
Length=246

 Score =   253 bits (646),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 137/235 (58%), Positives = 168/235 (71%), Gaps = 13/235 (6%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCS  S +KTLERYH+
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSGHSTAKTLERYHR  72

Query  182  CSYGALEA-NQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQV  358
            CSYGALE  +Q   ++Q  YQEYLKLK+ VE LQQ+QR+LLGE+L  L + DLEQLE Q+
Sbjct  73   CSYGALEVQHQPEIETQRRYQEYLKLKSRVEALQQTQRNLLGEELEHLDVNDLEQLERQL  132

Query  359  DTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNM  538
            D+SLK IRS +T+ M+DQLS+LH+KE+ LLE N  LR KL E   N A    WE + QN 
Sbjct  133  DSSLKQIRSNKTQQMLDQLSDLHRKEEMLLETNNILRNKLEEI--NVALQPTWEAREQNA  190

Query  539  QYGQH---------SSSQQCQNTAQIGYNPTSM-QANNNVGTSTMNGAGVLPGWM  673
             Y  H         +++  C +T +IGY+ + + +A    G S  N +  + GWM
Sbjct  191  PYNCHPPQTEGYYETATAHCSSTLRIGYDSSGLNEAGGAAGASAQNASEFMHGWM  245



>gb|AAY30858.1| MADS-box transcription factor [Prunus dulcis]
Length=246

 Score =   253 bits (646),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 142/242 (59%), Positives = 172/242 (71%), Gaps = 25/242 (10%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSS-ISKTLERYH  178
            NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSS I KTLERY 
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSSILKTLERYQ  72

Query  179  KCSYGALEANQTSKD-SQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQ  355
            KCSYG +E N+ +K+  QS+Y+EYLKLK   E LQ++QR+LLGEDL  L  K+LEQLE Q
Sbjct  73   KCSYGQVEVNKPAKELEQSSYREYLKLKGRFESLQRTQRNLLGEDLGPLNTKELEQLERQ  132

Query  356  VDTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQ-  532
            +++SLK +RST+T++M+DQLS+L  KEQ L+E N+ L +KL + S+ +     WE   Q 
Sbjct  133  LESSLKQVRSTKTQYMLDQLSDLQNKEQMLIEANRDLSLKLDDISSRNQIRQSWEGGNQG  192

Query  533  NMQYG-QHSSSQ------QCQNTAQIGYNPTSMQANNNVGTSTMNGA-------GVLPGW  670
             M YG QH+ SQ       C  T QIGY        +NVG+  M+         G +PGW
Sbjct  193  GMAYGSQHAQSQGFFQPLDCNPTLQIGY--------SNVGSEQMSATTHAQQVNGFIPGW  244

Query  671  ML  676
            ML
Sbjct  245  ML  246



>gb|AHM92083.1| MADS-box protein 7 [Erycina pusilla]
Length=249

 Score =   253 bits (646),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 133/237 (56%), Positives = 167/237 (70%), Gaps = 13/237 (5%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRG+L+EFCSSSSI KT+ERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGRLFEFCSSSSILKTIERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSY + E +  SK++Q++YQEYLKLKA VE LQ+SQR+LLGEDL QL  K+LEQLE+Q++
Sbjct  73   CSYNSTETSIPSKETQNSYQEYLKLKARVEYLQRSQRNLLGEDLGQLSTKELEQLEHQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWE-------  520
             SLK IRST+++ M+DQL +L +KEQ L E N+ALR+KL E          W        
Sbjct  133  MSLKQIRSTKSQLMLDQLCDLKRKEQLLQEANRALRMKLQEEEPEIPLQLSWPGGGGGGG  192

Query  521  ------PQGQNMQYGQHSSSQQCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWM  673
                  P  +  Q         C  + QIGY+P  ++ + N G+S+ +  G +PGWM
Sbjct  193  GQNGRVPCDRQPQSDVFFQPLNCDPSLQIGYSPICIEQHLNNGSSSHSVNGFVPGWM  249



>ref|XP_007221848.1| hypothetical protein PRUPE_ppa1027139mg [Prunus persica]
 gb|EMJ23047.1| hypothetical protein PRUPE_ppa1027139mg [Prunus persica]
Length=249

 Score =   253 bits (646),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 136/237 (57%), Positives = 173/237 (73%), Gaps = 12/237 (5%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKIN+QVTFAKRRNGLLKKAYELS+LCDAEVALI+FS RGKLYEFCS SS+ KTLERY +
Sbjct  13   NKINQQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSTRGKLYEFCSGSSMEKTLERYQR  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSY ALEA+Q ++DSQS YQ+YL LKA VEVLQ++QR+ LGEDL  LG K+L+QLENQ+D
Sbjct  73   CSYSALEASQPAQDSQSRYQDYLNLKAKVEVLQRTQRNFLGEDLGHLGTKELQQLENQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGE-SSNNDAFLTPWEPQGQNM  538
             SL+ IRST+T+ M  Q+S+L +KEQ LLE N  LR KL E  +  + +    + Q QN+
Sbjct  133  MSLRQIRSTKTQVMHGQISDLLRKEQMLLEANHELRRKLEECDATIERYSRTTKEQNQNV  192

Query  539  QYGQHSSS---------QQCQNTAQIGYNPTSMQANNNVGTSTMNGAGV-LPG-WML  676
                H  +          QC NT QIGYNP  +  ++ + +ST + +G+ +PG W+L
Sbjct  193  PNSSHHQAAQFEGVLDHSQCNNTLQIGYNPPEVTDHHGLQSSTQSHSGLFVPGTWVL  249



>ref|XP_011099041.1| PREDICTED: developmental protein SEPALLATA 1 isoform X2 [Sesamum 
indicum]
Length=246

 Score =   253 bits (645),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 137/234 (59%), Positives = 162/234 (69%), Gaps = 9/234 (4%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSS++ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSNMLKTLERYQK  72

Query  182  CSYGALEANQTSKD-SQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQV  358
            CSYG+LE N   KD  QS+Y+EYLKLKA  E LQ+ QR LLG+DL  L I DLE +E+Q+
Sbjct  73   CSYGSLEVNHPGKDIEQSSYREYLKLKAKYESLQRYQRQLLGDDLGPLNINDLEHIEHQL  132

Query  359  DTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQG-QN  535
            +TSLK IRSTRT+ M+DQL++L  KE+ +L+ NKAL  KL E    +     W   G Q+
Sbjct  133  ETSLKHIRSTRTQVMLDQLADLQTKEKLMLDANKALERKLEEIYAANQLQQSWVGGGEQS  192

Query  536  MQYGQHSSSQQ-------CQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
              Y  H    Q       C +T QIGYN     +     T   N  G++PGWML
Sbjct  193  STYTHHHPHSQGFFQPLDCNSTLQIGYNDPVSSSQMTAATDVQNVNGLIPGWML  246



>ref|XP_009608615.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X1 
[Nicotiana tomentosiformis]
Length=246

 Score =   253 bits (645),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 136/234 (58%), Positives = 167/234 (71%), Gaps = 9/234 (4%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LC+AEVALI+FSNRGKLYEFCSS+++ KTL+RY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCEAEVALIVFSNRGKLYEFCSSNNMLKTLDRYQK  72

Query  182  CSYGALEANQTSKDSQSN-YQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQV  358
            CSYG LE N++ KD++ N Y+EYLKLKA  E LQ+ QRHLLGEDL  L I DL+ LE Q+
Sbjct  73   CSYGTLEVNRSIKDNEQNSYREYLKLKAKYESLQRYQRHLLGEDLGPLNIDDLDHLEVQL  132

Query  359  DTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNM  538
            D SLK IRSTRT+ M+DQL++L  KE+  LE NK L  KL E    +    PW    Q++
Sbjct  133  DNSLKHIRSTRTQLMLDQLTDLQSKEKLWLEANKVLERKLEEIYAENNLQQPWGGGEQSI  192

Query  539  QYG-QHSSSQ------QCQNTAQIG-YNPTSMQANNNVGTSTMNGAGVLPGWML  676
             YG QH+ SQ       C +  QIG Y+P +  +     T+  N  G++PGWML
Sbjct  193  TYGQQHAQSQGFFQPLDCNSILQIGRYDPITTSSQITAVTNAQNVNGMVPGWML  246



>emb|CDP02339.1| unnamed protein product [Coffea canephora]
Length=245

 Score =   253 bits (645),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 139/234 (59%), Positives = 170/234 (73%), Gaps = 10/234 (4%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSS++ +TLERY +
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSNMLRTLERYQR  72

Query  182  CSYGALEANQTSKD-SQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQV  358
            CSYGA+E + ++K+  QS+Y+EYLKLK   E LQ+ QRHLLG+DL  L I DLE LE+Q+
Sbjct  73   CSYGAVEVSHSAKEIEQSSYKEYLKLKGKYESLQRYQRHLLGDDLGPLNINDLEHLEHQL  132

Query  359  DTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQG-QN  535
            ++SLK +RSTRT+ M+DQLS+L  KE+  LE NKAL  KL E    +     W   G Q+
Sbjct  133  ESSLKLVRSTRTQVMLDQLSDLQTKEKLWLEANKALERKLEEIYAENHLHQSWGGGGEQS  192

Query  536  MQYG-QHSSSQ------QCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
              Y  QHS SQ      +C +  QIGYNP S      V T+  N +G++PGWML
Sbjct  193  STYSQQHSQSQGFFQPLECSSGLQIGYNPASSSQITAV-TNAQNVSGLVPGWML  245



>ref|NP_001233911.1| MADS-box protein [Solanum lycopersicum]
 emb|CAC83066.1| MADS-box protein [Solanum lycopersicum]
Length=246

 Score =   253 bits (645),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 134/234 (57%), Positives = 168/234 (72%), Gaps = 9/234 (4%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVAL++FSNRGKLYEFCS++++ KTL+RY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALLVFSNRGKLYEFCSTNNMLKTLDRYQK  72

Query  182  CSYGALEANQTSKDS-QSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQV  358
            CSYG LE N++ KD+ QS+Y+EYLKLKA  E LQ+ QRHLLG++L  L I DLE LE Q+
Sbjct  73   CSYGTLEVNRSIKDNEQSSYREYLKLKAKYESLQRYQRHLLGDELGPLTIDDLEHLEVQL  132

Query  359  DTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNM  538
            DTSLK IRSTRT+ M+DQLS+L  KE+   E NK L  K+ E    +     W    Q++
Sbjct  133  DTSLKHIRSTRTQMMLDQLSDLQTKEKLWNEANKVLERKMEEIYAENNMQQAWGGGEQSL  192

Query  539  QYG--QHSSSQ------QCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
             YG  QH  SQ      +C ++ QIGY+P +  +     T+  N  G++PGWML
Sbjct  193  NYGQQQHPQSQGFFQPLECNSSLQIGYDPITTSSQITAVTNAQNVNGMIPGWML  246



>gb|AEJ76843.1| MADS19 [Gossypium hirsutum]
Length=244

 Score =   252 bits (644),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 134/234 (57%), Positives = 155/234 (66%), Gaps = 11/234 (5%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEF S  S + TLE Y+ 
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFXSXXSXAXTLEXYNX  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
             +YGALE  QT    Q NYQ YLKLK  VEVLQ SQRH LGE+   LG K+LEQLE+Q+D
Sbjct  73   XTYGALEPGQTEIXXQXNYQXYLKLKXKVEVLQXSQRHFLGEEJXDLGXKELEQLEHQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
             SLK IRS + + M  QLSEL  KE+ LLE N+ LR+KL  S  +    + WE   Q++ 
Sbjct  133  FSLKKIRSXKMZXMXXQLSELQTKEEVLLETNRNLRMKLDGSGPSXR--SSWETGEQSIP  190

Query  542  YGQHSSSQQ---------CQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
            Y       Q         C N+ QIGYNP S+   N    S +  +G +PGWML
Sbjct  191  YNHPPPPPQSEGFFEPLHCNNSXQIGYNPISVTVENXATASALAPSGFIPGWML  244



>ref|XP_011099040.1| PREDICTED: developmental protein SEPALLATA 1 isoform X1 [Sesamum 
indicum]
Length=247

 Score =   253 bits (645),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 137/235 (58%), Positives = 162/235 (69%), Gaps = 10/235 (4%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSS++ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSNMLKTLERYQK  72

Query  182  CSYGALEANQTSKD--SQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQ  355
            CSYG+LE N   KD   QS+Y+EYLKLKA  E LQ+ QR LLG+DL  L I DLE +E+Q
Sbjct  73   CSYGSLEVNHPGKDIEQQSSYREYLKLKAKYESLQRYQRQLLGDDLGPLNINDLEHIEHQ  132

Query  356  VDTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQG-Q  532
            ++TSLK IRSTRT+ M+DQL++L  KE+ +L+ NKAL  KL E    +     W   G Q
Sbjct  133  LETSLKHIRSTRTQVMLDQLADLQTKEKLMLDANKALERKLEEIYAANQLQQSWVGGGEQ  192

Query  533  NMQYGQHSSSQQ-------CQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
            +  Y  H    Q       C +T QIGYN     +     T   N  G++PGWML
Sbjct  193  SSTYTHHHPHSQGFFQPLDCNSTLQIGYNDPVSSSQMTAATDVQNVNGLIPGWML  247



>ref|XP_009419371.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Musa acuminata 
subsp. malaccensis]
Length=245

 Score =   252 bits (644),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 138/237 (58%), Positives = 167/237 (70%), Gaps = 18/237 (8%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKL+EFCSSSS+ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLFEFCSSSSMLKTLERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            C+YGA E N  S+++QS+ QEYLKLKA VE LQ+SQR+LLGEDL  L IK+LEQLE Q+D
Sbjct  73   CNYGAPETNVISRETQSSQQEYLKLKARVEALQRSQRNLLGEDLGPLNIKELEQLERQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
             SL+ IRSTRT++M+DQL++L ++EQ L E NKAL+ +L E SN       W+P      
Sbjct  133  ASLRQIRSTRTQYMLDQLTDLQRREQMLCEANKALKRRL-EESNQANQQQLWDPN----T  187

Query  542  YGQHSSSQQ---------CQNTAQIGYNPTSMQANNNVGTSTMNGAGV---LP-GWM  673
            YG+     Q         C+ T QIGY+P  M        +   G  V   +P GW+
Sbjct  188  YGRQQPQPQGDGFFQPIDCEPTLQIGYHPDQMAIAAAAAAAAAAGPSVSNYVPGGWL  244



>ref|XP_004491904.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X2 
[Cicer arietinum]
Length=249

 Score =   253 bits (645),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 133/237 (56%), Positives = 172/237 (73%), Gaps = 12/237 (5%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS RGKLYEFCS+S++ KTL+RY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCSTSNMLKTLDRYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYGA+E ++ +K+ +S+Y+EYLKLK   E LQ++QR+LLGEDL  L  KDLEQLE Q+D
Sbjct  73   CSYGAVEVSKPAKELESSYREYLKLKQRFENLQKTQRNLLGEDLGPLNSKDLEQLERQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
            +SLK +RST+T+ M+DQL++L  KE  L+E N++L IKL E ++ + +   WE   Q+MQ
Sbjct  133  SSLKQVRSTKTQFMLDQLADLQNKEHMLVEANRSLSIKLDEINSRNHYRQSWEAGDQSMQ  192

Query  542  YG--QHSSSQ------QCQNTAQIG----YNPTSMQANNNVGTSTMNGAGVLPGWML  676
            YG  Q++ SQ      +C  T QIG    YN  +     +   +     G +PGWML
Sbjct  193  YGGPQNAHSQSFFQQLECNPTLQIGPDYRYNNVTSDQIASTSQAQQQVNGFVPGWML  249



>ref|XP_006338336.1| PREDICTED: developmental protein SEPALLATA 1-like [Solanum tuberosum]
Length=246

 Score =   252 bits (644),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 134/234 (57%), Positives = 168/234 (72%), Gaps = 9/234 (4%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVAL++FSNRGKLYEFCS++++ KTL+RY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALLVFSNRGKLYEFCSTNNMLKTLDRYQK  72

Query  182  CSYGALEANQTSKDS-QSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQV  358
            CSYG LE N++ KD+ QS+Y+EYLKLKA  E LQ+ QRHLLG++L  L I DLE LE Q+
Sbjct  73   CSYGTLEVNRSIKDNEQSSYREYLKLKAKYESLQRYQRHLLGDELGPLTIDDLEHLEVQL  132

Query  359  DTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNM  538
            DTSLK IRSTRT+ M+DQLS+L  KE+   E NK L  K+ E    +     W    Q++
Sbjct  133  DTSLKHIRSTRTQMMLDQLSDLQTKEKLWNEANKVLERKMEEIYAENNLQQTWGGGEQSL  192

Query  539  QYG--QHSSSQ------QCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
             YG  QH  SQ      +C ++ QIGY+P +  +     T+  N  G++PGWML
Sbjct  193  NYGQQQHPQSQGFFQPLECNSSLQIGYDPITTSSQITAVTNAQNVNGMIPGWML  246



>gb|AFO68779.1| agamous-like protein 3, partial [Nyssa sylvatica]
Length=215

 Score =   251 bits (641),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 129/219 (59%), Positives = 161/219 (74%), Gaps = 11/219 (5%)
 Frame = +2

Query  41   NGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHKCSYGALEANQTSK  220
            NG LKKAYELS+LCDAEVALIIFSNRGKL+EFCSSSS++KTLERY +CSY  LEA Q   
Sbjct  1    NGFLKKAYELSVLCDAEVALIIFSNRGKLFEFCSSSSMTKTLERYQRCSYSTLEARQPEN  60

Query  221  DSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVDTSLKSIRSTRTKH  400
            D+QS YQEYL LKA VE+LQQSQRH LGEDL Q+G K+L+QLE Q++TSLK IR+T+T+ 
Sbjct  61   DTQS-YQEYLSLKAKVEILQQSQRHFLGEDLGQMGTKELDQLERQLETSLKQIRATKTQF  119

Query  401  MIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQYGQHSSSQ-----  565
            M DQLS+L +KEQ L EVN++L  KL ES+   A  + W+    N+ Y +  +       
Sbjct  120  MFDQLSDLQKKEQKLQEVNRSLMKKLEESTA--ALQSSWDAGENNIPYRRQPTQSELFFE  177

Query  566  --QCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
              +C NT QIGYNP + Q   +VG S+ +  G++PGWML
Sbjct  178  PLECNNTLQIGYNPVA-QDQMHVGNSSQHANGIIPGWML  215



>ref|NP_001234380.1| MADS-box protein 1 [Solanum lycopersicum]
 gb|AAP57412.1| MADS-box protein 1 [Solanum lycopersicum]
Length=246

 Score =   252 bits (644),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 137/241 (57%), Positives = 163/241 (68%), Gaps = 23/241 (10%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCS+SS+ KT+E+Y +
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSTSSMVKTIEKYQR  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSY  LEANQ+  D+Q+NY EYL+LKA VE+LQ+SQR+ LGEDL  L  KDLEQLENQ++
Sbjct  73   CSYATLEANQSVTDTQNNYHEYLRLKARVELLQRSQRNFLGEDLGTLSSKDLEQLENQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQN--  535
            +SLK IRS +T+ M+DQL++L QKEQ L E N+ LR KL ES         WE  G +  
Sbjct  133  SSLKQIRSRKTQFMLDQLADLQQKEQMLAESNRLLRRKLEESVAGFPLRLCWEDGGDHQL  192

Query  536  --------------MQYGQHSSSQQCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWM  673
                             G HSSS         GYNP +    N   T+  N  G + GWM
Sbjct  193  MHQQNRLPNTEGFFQPLGLHSSS------PHFGYNPVNTDEVNAAATAH-NMNGFIHGWM  245

Query  674  L  676
            L
Sbjct  246  L  246



>ref|XP_010913018.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X2 [Elaeis guineensis]
Length=234

 Score =   251 bits (642),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 132/225 (59%), Positives = 162/225 (72%), Gaps = 5/225 (2%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FSNRGKLYEFCSSSS+ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSSSSMLKTLERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            C+YGA E N  S+++Q++ QEYLKLKA VE LQ+SQR+LLG+DL  L  K+LEQLE Q+D
Sbjct  73   CNYGAPETNIVSRETQTSQQEYLKLKARVEALQRSQRNLLGDDLGPLSSKELEQLERQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
             SLK IRSTRT++M+DQL++L ++EQ L E NK+L+ +L E SN       W+P    + 
Sbjct  133  ASLKQIRSTRTQYMLDQLADLQRREQMLCEANKSLKQRL-EESNQATQQQVWDPNAPAVG  191

Query  542  YGQHSSSQQCQN-TAQIGYNPTSMQANNNVGTSTMNGAGVLPGWM  673
            YG+     Q      QI Y P  +      G S  N    +PGW+
Sbjct  192  YGRQPPQPQGDGFYQQIEYPPEQITIAAAPGPSVSN---YMPGWL  233



>ref|XP_010558530.1| PREDICTED: developmental protein SEPALLATA 1 [Tarenaya hassleriana]
 gb|ABD96896.1| hypothetical protein [Cleome spinosa]
Length=248

 Score =   252 bits (643),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 137/236 (58%), Positives = 168/236 (71%), Gaps = 11/236 (5%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSS++ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSNMLKTLERYQK  72

Query  182  CSYGALEA-NQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQV  358
            CSYG++E  N+ +K+ +++Y+EYLKLK+  E L + QR+LLGEDL  L  K+LEQLE Q+
Sbjct  73   CSYGSIEVNNRPAKELENSYREYLKLKSRYEGLHRQQRNLLGEDLGPLNSKELEQLERQL  132

Query  359  DTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGE--SSNNDAFLTPWEPQGQ  532
            D+SLK +RS +T+ M+D+LS+L  KEQ LLE N+AL +KL E   +    F   WE   Q
Sbjct  133  DSSLKQVRSIKTQSMLDELSDLQNKEQMLLEANRALSMKLEEMVGARTHQFGGAWEGSEQ  192

Query  533  NMQYGQHSSSQ------QCQNTAQIGY-NPT-SMQANNNVGTSTMNGAGVLPGWML  676
            N+ YG  + SQ      +C  T QIGY NP  S Q           G G +PGWML
Sbjct  193  NVSYGHQAQSQGLFQPLECNPTLQIGYNNPVCSEQMAATTQAPVQAGNGYIPGWML  248



>gb|AAX69068.1| MADS box protein M6 [Pisum sativum]
Length=249

 Score =   252 bits (643),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 134/237 (57%), Positives = 171/237 (72%), Gaps = 12/237 (5%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS RGKLYEFCS+S++ KTL+RY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCSTSNMLKTLDRYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYGA+E ++ +K+ +S+Y+EYLKLK   E LQ++QR+LLGEDL  L  KDLEQLE Q+D
Sbjct  73   CSYGAVEVSKPAKELESSYREYLKLKQRFENLQRTQRNLLGEDLGPLSSKDLEQLERQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
            +SLK +RST+T+ M+DQL++L  KE  L+E N++L +KL E ++ + +   WE   Q+MQ
Sbjct  133  SSLKHVRSTKTQFMLDQLADLQNKEHMLVEANRSLSMKLDEINSRNQYRQSWEAGDQSMQ  192

Query  542  YGQ----HSSS--QQ--CQNTAQIG----YNPTSMQANNNVGTSTMNGAGVLPGWML  676
            YG     HS S  QQ  C  T QIG    YN  +     +   +     G +PGWML
Sbjct  193  YGDQQNAHSQSFFQQLDCNPTLQIGSDYRYNNVASDQIASTSQAQQQVNGFVPGWML  249



>gb|AFS60086.1| MADS box transcription factor SEP1 [Paphiopedilum concolor]
Length=241

 Score =   251 bits (642),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 130/229 (57%), Positives = 161/229 (70%), Gaps = 5/229 (2%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FSNRG+L+EFCSSSS+ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGRLFEFCSSSSMMKTLERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSY A E+   SK++Q++YQEYLKLK  VE LQ+SQR+LLGEDL QL  K+L++LE+Q++
Sbjct  73   CSYSASESVTPSKETQNSYQEYLKLKLRVEHLQRSQRNLLGEDLEQLTTKELQELEHQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
             SL+ IRST+T+ M+DQL +L +KEQ L E N+A R KL E          W   G    
Sbjct  133  MSLRQIRSTKTQLMLDQLCDLKRKEQMLQEANRAFRKKLQEDGPEIPLQLSWPGGGGGSS  192

Query  542  YGQHSSSQ-----QCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWM  673
              Q  S +      C  + QIG++P  +    N G+ST    G  PGWM
Sbjct  193  TRQPQSEEFFQPLPCDPSLQIGFSPLCIDQQLNTGSSTHTANGFFPGWM  241



>ref|XP_006345102.1| PREDICTED: MADS-box protein CMB1-like [Solanum tuberosum]
Length=246

 Score =   251 bits (642),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 136/241 (56%), Positives = 164/241 (68%), Gaps = 23/241 (10%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCS+SS+ KT+E+Y +
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSTSSMVKTIEKYQR  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSY  LEANQ+  ++Q+NY EYL+LKA VE+LQ+SQR+ LGEDL  L  KDLEQLENQ++
Sbjct  73   CSYATLEANQSVTETQNNYHEYLRLKARVELLQRSQRNFLGEDLGTLNTKDLEQLENQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWE-------  520
            +SLK IRS +T+ M+DQL++L QKEQ L E N+ LR KL ES+        WE       
Sbjct  133  SSLKQIRSRKTQFMLDQLADLQQKEQMLAESNRLLRRKLEESAAGFPLRLCWEDGAEHQA  192

Query  521  ---------PQGQNMQYGQHSSSQQCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWM  673
                      +G     G HSSS         GYNP +    N   T+  N  G + GWM
Sbjct  193  MHQQNRLPNTEGFFQPLGLHSSS------PHFGYNPVNTDEVNAAATAH-NMNGFIHGWM  245

Query  674  L  676
            L
Sbjct  246  L  246



>ref|XP_009121545.1| PREDICTED: developmental protein SEPALLATA 1 [Brassica rapa]
Length=252

 Score =   251 bits (642),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 139/240 (58%), Positives = 168/240 (70%), Gaps = 15/240 (6%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSS++ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSNMIKTLERYQK  72

Query  182  CSYGALEA-NQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQV  358
            CSYG++E  N+ +K+ +++Y+EYLKLK   E LQ+ QR+LLGEDL  L  K+LEQLE Q+
Sbjct  73   CSYGSIEVNNKPAKELENSYREYLKLKGRYESLQRQQRNLLGEDLGPLNSKELEQLERQL  132

Query  359  DTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKL----GESSNNDAFLTPWEPQ  526
            D SLK +RS +T++M+DQLS+L  KEQ LLE N+AL IKL    G  S++      WE  
Sbjct  133  DGSLKQVRSIKTQYMLDQLSDLQSKEQMLLETNRALTIKLDDMIGVRSHHMGGGGGWEGN  192

Query  527  GQNMQYGQHSSSQ--------QCQNTAQIGY-NPT-SMQANNNVGTSTMNGAGVLPGWML  676
             QN+ Y  H  +Q        +C  T QIGY NP  S Q           G G +PGWML
Sbjct  193  EQNVPYEHHHQAQPQGLFQPLECNPTLQIGYDNPVGSEQITATTQAQAQPGNGYIPGWML  252



>ref|XP_008230289.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X1 
[Prunus mume]
Length=246

 Score =   251 bits (641),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 141/242 (58%), Positives = 172/242 (71%), Gaps = 25/242 (10%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSS-ISKTLERYH  178
            NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSS I KTLERY 
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSSILKTLERYQ  72

Query  179  KCSYGALEANQTSKD-SQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQ  355
            KCSYG +E N+ +K+  QS+Y+EYLKLK   E LQ++QR+LLGE+L  L  K+LEQLE Q
Sbjct  73   KCSYGQVEVNKPAKELEQSSYREYLKLKGRFESLQRTQRNLLGEELGPLNTKELEQLERQ  132

Query  356  VDTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQ-  532
            +++SLK +RST+T++M+DQLS+L  KEQ L+E N+ L +KL + S+ +     WE   Q 
Sbjct  133  LESSLKQVRSTKTQYMLDQLSDLQNKEQMLIEANRDLSLKLDDISSRNQIRQSWEGGNQG  192

Query  533  NMQYG-QHSSSQ------QCQNTAQIGYNPTSMQANNNVGTSTMNGA-------GVLPGW  670
             M YG QH+ SQ       C  T QIGY        +NVG+  M+         G +PGW
Sbjct  193  GMAYGTQHAQSQGFFQPLDCNPTLQIGY--------SNVGSEQMSATTHAQQVNGFIPGW  244

Query  671  ML  676
            ML
Sbjct  245  ML  246



>ref|XP_010099309.1| Developmental protein SEPALLATA 2 [Morus notabilis]
 gb|EXB77655.1| Developmental protein SEPALLATA 2 [Morus notabilis]
Length=248

 Score =   251 bits (641),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 137/238 (58%), Positives = 171/238 (72%), Gaps = 15/238 (6%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS S+ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSPSMVKTLERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYGA+E ++  K+ +S+Y+EYLKLK   E LQ++QR+LLGE+L  L  K+LEQ+E Q++
Sbjct  73   CSYGAMEVSKPGKELESSYREYLKLKGRFESLQRTQRNLLGEELGPLNTKELEQIERQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLT-PWEP---QG  529
            TSLK +RST+T++M+DQL++L  KE  L+E N+AL +KL E S+ + F +  WE      
Sbjct  133  TSLKQVRSTKTQYMLDQLTDLQSKEHMLIESNRALTLKLDEISSRNNFRSQSWEVGDHDQ  192

Query  530  QNMQYGQ-HSSSQ-------QCQNTAQIGYN-PTSMQANNNVGTSTMNGAGVLPGWML  676
            Q M YG  H+ SQ        C  T QIGYN   S Q  +      +N  G +PGWML
Sbjct  193  QAMPYGHNHAHSQGLIFHPLDCNPTLQIGYNAAVSEQITSTSQAQQVN--GFIPGWML  248



>gb|AES77737.2| MADS-box transcription factor [Medicago truncatula]
Length=249

 Score =   251 bits (641),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 132/237 (56%), Positives = 171/237 (72%), Gaps = 12/237 (5%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS RGKLYEFCS+S++ KTL+RY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCSTSNMLKTLDRYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYGA+E ++ +K+ +S+Y+EYLKLK   E LQ++QR+LLGEDL  L  KDLEQLE Q+D
Sbjct  73   CSYGAVEVSKPAKELESSYREYLKLKQRFENLQRAQRNLLGEDLGPLSSKDLEQLERQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
            +SLK +RST+T+ M+DQL++L  KE  L+E N++L IKL E ++ + +   WE   Q+MQ
Sbjct  133  SSLKQVRSTKTQFMLDQLADLQNKEHMLVEANRSLSIKLEEINSRNHYRQSWEASDQSMQ  192

Query  542  YG--QHSSSQ------QCQNTAQIG----YNPTSMQANNNVGTSTMNGAGVLPGWML  676
            Y   Q++ SQ      +C  T QIG    YN  +     +   +     G +PGWML
Sbjct  193  YEAQQNAHSQSFFQQLECNPTLQIGSDYRYNNVASDQIASTSQAQQQVNGFVPGWML  249



>ref|XP_010549963.1| PREDICTED: developmental protein SEPALLATA 1 [Tarenaya hassleriana]
 gb|ABD96852.1| hypothetical protein [Cleome spinosa]
Length=248

 Score =   251 bits (640),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 136/238 (57%), Positives = 165/238 (69%), Gaps = 15/238 (6%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS ++ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSPNMLKTLERYQK  72

Query  182  CSYGALEA-NQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQV  358
            CSYG++E  N+ +K+ +++Y+EYLKLK+  E LQ+ QR+LLGEDL  L  K+LEQ+E Q+
Sbjct  73   CSYGSIEVNNKPAKELENSYREYLKLKSRFEGLQRQQRNLLGEDLGPLNSKELEQIERQL  132

Query  359  DTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGE--SSNNDAFLTPWEPQGQ  532
            D SLK +RS +T++MIDQLSEL  +EQ LLE N+AL +KL E   +        WE   Q
Sbjct  133  DGSLKQVRSIKTQYMIDQLSELQSREQMLLEANRALSMKLDEMVGARTHHIGGGWEGSEQ  192

Query  533  NMQYGQHSSSQ------QCQNTAQIGYN----PTSMQANNNVGTSTMNGAGVLPGWML  676
            N+ YG     Q      +C  T QIGYN    P  M A          G G +PGWML
Sbjct  193  NVTYGHQPQPQGLFQPLECNPTLQIGYNNPECPEQMTATTQAPAQA--GNGYIPGWML  248



>gb|AHW58036.1| SEP1/2 [Coffea arabica]
Length=247

 Score =   251 bits (640),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 140/238 (59%), Positives = 173/238 (73%), Gaps = 16/238 (7%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSS++ +TLERY +
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSNMLRTLERYQR  72

Query  182  CSYGALEANQTSKD-SQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQV  358
            CSYGA+E + ++K+  QS+Y+EYLKLK   E LQ+ QRHLLG+DL  L I DLE LE+Q+
Sbjct  73   CSYGAVEVSHSAKEIEQSSYKEYLKLKGKYESLQRYQRHLLGDDLGPLNINDLEHLEHQL  132

Query  359  DTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGE---SSNNDAFLTPWEPQG  529
            ++SLK +RSTRTK M+DQLS+L  KE+  LE NKAL  KLG    + N+ +  + W   G
Sbjct  133  ESSLKLVRSTRTKVMLDQLSDLQTKEKLWLEANKALERKLGRYIYAENSPS--SSWGDGG  190

Query  530  -QNMQYG-QHSSSQQ-------CQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
             Q++ Y  QHS   Q       C +  QIGYNP S      V T+  N +G++PGWML
Sbjct  191  EQSITYSQQHSQYSQGFFQPLGCSSGLQIGYNPASSSHITAV-TNAQNVSGLVPGWML  247



>ref|XP_002263039.1| PREDICTED: MADS-box protein CMB1 isoform X2 [Vitis vinifera]
 emb|CBI15338.3| unnamed protein product [Vitis vinifera]
Length=246

 Score =   250 bits (639),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 134/235 (57%), Positives = 167/235 (71%), Gaps = 13/235 (6%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FS+RGKLYEFCS  S++KTLE+Y K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSSRGKLYEFCSGPSMAKTLEKYQK  72

Query  182  CSYGALEANQTSKD-SQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQV  358
            CSYGALEA+Q   + +QS+YQEYLKLK  VEVLQ+SQRHLLGEDL  L  K+LEQLE+Q+
Sbjct  73   CSYGALEASQPVYELTQSSYQEYLKLKTRVEVLQRSQRHLLGEDLDPLNTKELEQLEHQL  132

Query  359  DTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNM  538
            + SLK IRST+T++M+DQL++L  KE  L+E N ALR KL ES+        WE  G + 
Sbjct  133  EMSLKQIRSTKTQNMLDQLADLQNKEHMLIEANNALRRKLEESNGKHPLQQSWEAAGNSA  192

Query  539  QYGQHSSSQQC-------QNTAQIGYNPTSMQANNNV--GTSTMNGAGVLPGWML  676
             Y +  +  +         +T ++GYN      +N +     + N  G  PGWML
Sbjct  193  LYSRLPAQSEGFFQPLERNSTLEMGYNAA---GSNEITLAAPSQNDNGFGPGWML  244



>gb|AFU81295.1| SEPALLATA1 [Medicago polyceratia]
Length=249

 Score =   250 bits (639),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 132/237 (56%), Positives = 171/237 (72%), Gaps = 12/237 (5%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS RGKLYEFCS+S++ KTL+RY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCSTSNMLKTLDRYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYGA+E ++ +K+ +S+Y+EYLKLK   E LQ++QR+LLGEDL  L  KDLEQLE Q+D
Sbjct  73   CSYGAVEVSKPAKELESSYREYLKLKQRFENLQRTQRNLLGEDLGPLSSKDLEQLERQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
            +SLK +RST+T+ M+DQL++L  KE  L+E N++L IKL E ++ + +   WE   Q+MQ
Sbjct  133  SSLKQVRSTKTQFMLDQLADLQNKEHMLVEANRSLSIKLEEINSRNHYRQSWEAGEQSMQ  192

Query  542  YG--QHSSSQ------QCQNTAQIG----YNPTSMQANNNVGTSTMNGAGVLPGWML  676
            Y   Q++ SQ      +C  T QIG    YN  +     +   +     G +PGWML
Sbjct  193  YSAQQNAHSQSFFQQLECNPTLQIGSDYRYNNVASDQIASTSQAQQQVNGFVPGWML  249



>ref|XP_004491903.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X1 
[Cicer arietinum]
Length=250

 Score =   250 bits (639),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 134/238 (56%), Positives = 172/238 (72%), Gaps = 13/238 (5%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS RGKLYEFCS+S++ KTL+RY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCSTSNMLKTLDRYQK  72

Query  182  CSYGALEANQTSKD-SQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQV  358
            CSYGA+E ++ +K+  QS+Y+EYLKLK   E LQ++QR+LLGEDL  L  KDLEQLE Q+
Sbjct  73   CSYGAVEVSKPAKELEQSSYREYLKLKQRFENLQKTQRNLLGEDLGPLNSKDLEQLERQL  132

Query  359  DTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNM  538
            D+SLK +RST+T+ M+DQL++L  KE  L+E N++L IKL E ++ + +   WE   Q+M
Sbjct  133  DSSLKQVRSTKTQFMLDQLADLQNKEHMLVEANRSLSIKLDEINSRNHYRQSWEAGDQSM  192

Query  539  QYG--QHSSSQ------QCQNTAQIG----YNPTSMQANNNVGTSTMNGAGVLPGWML  676
            QYG  Q++ SQ      +C  T QIG    YN  +     +   +     G +PGWML
Sbjct  193  QYGGPQNAHSQSFFQQLECNPTLQIGPDYRYNNVTSDQIASTSQAQQQVNGFVPGWML  250



>ref|XP_009757151.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X1 
[Nicotiana sylvestris]
Length=245

 Score =   250 bits (638),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 136/234 (58%), Positives = 167/234 (71%), Gaps = 10/234 (4%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LC+AEVALIIFSNRGKLYEFCSS+++ KTL+RY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCEAEVALIIFSNRGKLYEFCSSNNMLKTLDRYQK  72

Query  182  CSYGALEANQT--SKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQ  355
            CSYG LE N++    + QS+ +EYLKLKA  E LQ+ QRHLLGEDL  L I DL+ LE Q
Sbjct  73   CSYGTLEVNRSIIKDNEQSSCREYLKLKAKYESLQRYQRHLLGEDLGPLNIDDLDHLEVQ  132

Query  356  VDTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQN  535
            +DTSLK IRSTRT+ M+DQL++L  KE+  LE NK L  KL E    +    PW  + Q+
Sbjct  133  LDTSLKHIRSTRTQLMLDQLTDLQSKEKLWLEANKLLERKLEEIYTENNLQQPWGGE-QS  191

Query  536  MQYG-QHSSSQ------QCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
            + Y  QH+ SQ       C +T QIGY+P +  +     T+  N  G++PGWML
Sbjct  192  VTYSQQHAQSQGFFQPLDCNSTLQIGYDPITTSSQITAVTNAQNVNGMVPGWML  245



>ref|XP_006477711.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X1 
[Citrus sinensis]
Length=266

 Score =   251 bits (640),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 141/255 (55%), Positives = 173/255 (68%), Gaps = 31/255 (12%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS SI KTLERYH+
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSPSIMKTLERYHR  72

Query  182  CSYGALEANQTSKDS-QSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQV  358
            CS+GA EAN+   ++ QS YQEYL+LK  VE+LQ+SQR+LLGEDL  L  K+LEQLE+Q+
Sbjct  73   CSFGAHEANRPPIETQQSTYQEYLRLKTAVELLQRSQRNLLGEDLDPLSTKELEQLEHQL  132

Query  359  DTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIK--LGESS------------NN  496
            +TSLK +RST+T+ M+DQLS+L ++EQ LLE+NK LR K  LG  +            +N
Sbjct  133  ETSLKHVRSTKTQCMVDQLSDLQKREQVLLELNKGLRKKAFLGNYTCLTTPPFTQLDESN  192

Query  497  DAFLTP-----WEP--QGQNMQYGQHSSSQQ--------CQNTAQIGYNPTSMQANNNVG  631
             A   P     WE    GQN+ Y ++    +             QIGYNP   +   ++ 
Sbjct  193  IAHQVPPHRLAWEAASAGQNITYNRYPVQSEGFFQPLSGGNPILQIGYNPMGSE-EAHIP  251

Query  632  TSTMNGAGVLPGWML  676
                N  G +PGWML
Sbjct  252  VHAQNVTGFIPGWML  266



>ref|XP_009373783.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X2 
[Pyrus x bretschneideri]
 ref|XP_009333662.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X2 
[Pyrus x bretschneideri]
 dbj|BAK18787.2| MADS-box protein [Pyrus pyrifolia var. culta]
Length=246

 Score =   250 bits (638),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 136/238 (57%), Positives = 171/238 (72%), Gaps = 17/238 (7%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSSSI KTL+RY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSILKTLDRYQK  72

Query  182  CSYGALE-ANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQV  358
            CSYGA++  N+ +K+ +S+Y+EY+KLK   E LQ++QR+LLGEDL  L  K+LEQLE Q+
Sbjct  73   CSYGAVDQVNRPAKELESSYREYMKLKGRYESLQRTQRNLLGEDLGPLNTKELEQLERQL  132

Query  359  DTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNM  538
            + SLK +RST+T++M+DQLS+L  KEQ L+E N+ L +KL E S+ +     WE   Q M
Sbjct  133  EGSLKQVRSTKTQYMLDQLSDLQNKEQLLIEANRDLTMKLDEISSRNQLRQSWEGGDQGM  192

Query  539  QYG---QHSSSQ------QCQNTAQIGYNPTSMQANNNVGTSTMNGAGV---LPGWML  676
             Y     H+ SQ       C  T Q+GY+     A +   ++T NG  V   +PGWML
Sbjct  193  AYATQHHHAQSQGFFQPLDCNPTLQMGYSA----AGSEQMSATTNGQQVNCFIPGWML  246



>gb|AET98846.1| SEPALLATA1 [Passiflora edulis]
Length=242

 Score =   249 bits (637),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 136/233 (58%), Positives = 170/233 (73%), Gaps = 11/233 (5%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FS RGKLYEFCS+S++ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSTRGKLYEFCSTSNMLKTLERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYG  + N+ +K+ +S+Y+EYLKLKA  E LQ++QR+LLGEDL  L  KDLEQLE Q++
Sbjct  73   CSYGVEDVNKPAKELESSYREYLKLKARFETLQRTQRNLLGEDLGPLNTKDLEQLERQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
             SLK +RST+T++M+DQL++L  KE  LLE N+ L IKL E S  +  L  WE   Q++ 
Sbjct  133  GSLKLVRSTKTQYMLDQLADLQNKEHLLLEANRTLTIKLDEISARNQ-LRQWEDGEQSVP  191

Query  542  YG-QHSSSQ------QCQNTAQIGYNPT-SMQANNNVGTSTMNGAGVLPGWML  676
            YG Q + SQ      +C  T QIGYN   S Q   +  +  +N  G +PGWML
Sbjct  192  YGHQQAHSQGLFHALECNPTLQIGYNSVGSDQIPASSHSQQVN--GFIPGWML  242



>dbj|BAM34478.1| MADS-box transcription factor [Alstroemeria ligtu subsp. ligtu]
Length=244

 Score =   249 bits (637),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 135/241 (56%), Positives = 167/241 (69%), Gaps = 28/241 (12%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEV LI+FSNRGKLYEFCSSSS+ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVGLIVFSNRGKLYEFCSSSSMMKTLERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            C+YGA E N  S+++QS+ QEYLKLKA VE LQ+ QR+LLGEDL  L  K+LEQLE Q+D
Sbjct  73   CNYGAPETNVISRETQSSQQEYLKLKARVEALQRYQRNLLGEDLGPLSSKELEQLERQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
             SLK IRSTRT+ M+DQL++L +KEQ L E NK+LR +L ESS+ +        Q Q   
Sbjct  133  ASLKQIRSTRTQFMLDQLADLQRKEQMLCEANKSLRRRLEESSHPN--------QQQVWD  184

Query  542  YGQHSSSQ-----------------QCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGW  670
            +  HS++                  +C+ T QIGY+P  +   +  G S    +  +PGW
Sbjct  185  HNAHSAAGYAREQAQPQGDGFFHPLECEPTLQIGYHPDQITIASAPGPS---ASSYMPGW  241

Query  671  M  673
            +
Sbjct  242  L  242



>ref|XP_004299281.1| PREDICTED: MADS-box protein CMB1-like [Fragaria vesca subsp. 
vesca]
Length=255

 Score =   250 bits (638),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 143/244 (59%), Positives = 178/244 (73%), Gaps = 20/244 (8%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS RGKLYEFCSS S+ KTLE+Y +
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSGRGKLYEFCSSLSMMKTLEKYQR  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYGALEANQ   ++Q++YQEYL+LKA VEVLQ+SQR+LLGEDL  L  K+LEQLE+Q++
Sbjct  73   CSYGALEANQPVNETQNSYQEYLRLKARVEVLQRSQRNLLGEDLGPLNTKELEQLEHQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFL-TPWE-PQGQN  535
            +SLK IRST+T+ M+D+LS+L  +EQ L+E NK+LR KL E++   A L   W+   GQN
Sbjct  133  SSLKHIRSTKTQFMLDELSDLQNREQMLVETNKSLRRKLEETNLQGAPLHLAWDGGYGQN  192

Query  536  MQYGQHSSS---------QQCQ---NTA-QIGYNPTSMQANN----NVGTSTMNGAGVLP  664
              + +H+S          QQ Q   N+A Q+GY P     ++    N G    N  G +P
Sbjct  193  NIH-EHNSRFPPQSQGFFQQLQGNNNSAMQMGYTPLGSDHHHHQQMNAGNPGQNVNGFIP  251

Query  665  GWML  676
            GWML
Sbjct  252  GWML  255



>gb|ABC70706.1| MADS-box transcription factor [Asparagus virgatus]
Length=239

 Score =   248 bits (634),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 139/235 (59%), Positives = 168/235 (71%), Gaps = 20/235 (9%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSSS+ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQK  72

Query  182  CSYGALEANQTSKDS---QSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLEN  352
            CSYGA + +   ++S   QS++QEYL+LKA VE LQ+SQR+LLGEDL  L  K+LEQLE 
Sbjct  73   CSYGAPDTSVQIRESQMLQSSHQEYLRLKARVEALQRSQRNLLGEDLGPLSSKELEQLER  132

Query  353  QVDTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWE---P  523
            Q+D+SLK IRSTRT++M+DQL++L ++EQ L E N++LR +L ESS  +     WE    
Sbjct  133  QLDSSLKQIRSTRTQYMLDQLADLQRREQMLCEANRSLRKRLEESSQANQQQV-WEDANA  191

Query  524  QGQNMQYGQHSSSQ-----QCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWM  673
             G N Q  Q    Q     +CQ T QIG+ P  M      G S  N    +PGW+
Sbjct  192  MGYNRQPNQPQGDQFFHPLECQPTLQIGFQPDQM-----PGPSVSN---YMPGWL  238



>emb|CAA04323.1| MADS-box protein [Malus domestica]
Length=248

 Score =   249 bits (635),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 137/238 (58%), Positives = 172/238 (72%), Gaps = 15/238 (6%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS+RGKLYEFCSS S+ KTLE+Y  
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFCSSFSMMKTLEKYQS  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYG+LEAN  + ++Q++YQ+YL LKA VEVLQQSQR+LLGEDL  L  K+LE LE+Q++
Sbjct  73   CSYGSLEANLPANETQNSYQDYLMLKARVEVLQQSQRNLLGEDLSHLNTKELEHLEHQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQG----  529
            TSLK IRS +T+ ++DQLS+L  +EQ L+E NKAL+ KL E+S +      WE  G    
Sbjct  133  TSLKQIRSRKTQFILDQLSDLQNREQMLVEANKALKRKLEETSVHAPEGMAWEAAGHGPN  192

Query  530  --QNMQYGQHSSS-----QQCQNTAQIGYNPTSMQANN--NVGTSTMNGAGVLPGWML  676
              Q  +   HS +     +   +++QIGY  T M ++N  NVG       G +PGWML
Sbjct  193  NIQQTRLPSHSEAFFHPLEGNNSSSQIGY--THMGSDNEMNVGNPGQYVNGYIPGWML  248



>ref|XP_010315869.1| PREDICTED: MADS-box protein isoform X1 [Solanum lycopersicum]
Length=247

 Score =   249 bits (635),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 134/235 (57%), Positives = 169/235 (72%), Gaps = 10/235 (4%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVAL++FSNRGKLYEFCS++++ KTL+RY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALLVFSNRGKLYEFCSTNNMLKTLDRYQK  72

Query  182  CSYGALEANQTSKDS-QSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQV  358
            CSYG LE N++ KD+ QS+Y+EYLKLKA  E LQ+ QRHLLG++L  L I DLE LE Q+
Sbjct  73   CSYGTLEVNRSIKDNEQSSYREYLKLKAKYESLQRYQRHLLGDELGPLTIDDLEHLEVQL  132

Query  359  DTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKAL-RIKLGESSNNDAFLTPWEPQGQN  535
            DTSLK IRSTRT+ M+DQLS+L  KE+   E NK L R ++ E    +     W    Q+
Sbjct  133  DTSLKHIRSTRTQMMLDQLSDLQTKEKLWNEANKVLERKQMEEIYAENNMQQAWGGGEQS  192

Query  536  MQYG--QHSSSQ------QCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
            + YG  QH  SQ      +C ++ QIGY+P +  +     T+  N  G++PGWML
Sbjct  193  LNYGQQQHPQSQGFFQPLECNSSLQIGYDPITTSSQITAVTNAQNVNGMIPGWML  247



>gb|KCW48935.1| hypothetical protein EUGRSUZ_K02546 [Eucalyptus grandis]
Length=245

 Score =   249 bits (635),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 135/235 (57%), Positives = 166/235 (71%), Gaps = 12/235 (5%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSSS+ KT+E+Y K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMMKTIEKYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYG+LE N +  + Q++YQ+YLKLK  VEVLQ+SQR+LLGE+L  L  K+LEQLE+Q++
Sbjct  73   CSYGSLETNCSINEMQNSYQDYLKLKTRVEVLQRSQRNLLGEELGPLNSKELEQLEHQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQ-NM  538
             SLK IRS +T+ M DQL+ L  KEQ L+E N+ LR KL ES+        WE +   N+
Sbjct  133  NSLKQIRSAKTQFMFDQLAHLQHKEQMLVEANRELRKKLEESNTRIPLRLGWEAEDHNNI  192

Query  539  QYGQHSSSQQ--------CQNTAQIGYNPTSMQANN-NVGTSTMNGAGVLPGWML  676
             Y +  +  Q           T QIGYNP    +N  NV  +  +  G +PGWML
Sbjct  193  SYSRLPTQSQGLIFQPLGGNPTLQIGYNPAG--SNELNVSAADQHPNGFIPGWML  245



>gb|AHY82573.1| MADS-box protein 6 [Lilium formosanum]
Length=242

 Score =   248 bits (634),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 135/233 (58%), Positives = 166/233 (71%), Gaps = 13/233 (6%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEF S+SS+ +TLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFSSTSSMMRTLERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            C+YGA E N  S+++Q++ QEYLKLKA VE LQ+SQR+LLGEDL  L  K+LEQLE Q+D
Sbjct  73   CNYGAPETNIVSRETQNSQQEYLKLKAKVEALQRSQRNLLGEDLGPLNTKELEQLERQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
            TSLK IRSTRT+ M+DQLS+L ++EQ L E NK+LR +L E+S+ +     WE       
Sbjct  133  TSLKLIRSTRTQFMLDQLSDLQRREQMLCEANKSLRRRLEETSHANQQQV-WEANVHAAG  191

Query  542  YGQHSSSQ---------QCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWM  673
            Y    +           +C+ T QIGY P  +   +  G S   G+  LPGW+
Sbjct  192  YAAQQAQPQGNGFFHPLECEPTLQIGYPPDQITIASGPGPS---GSSYLPGWL  241



>gb|AAQ83834.1| MADS box protein [Asparagus officinalis]
 gb|ABC70709.1| MADS-box transcription factor [Asparagus officinalis]
Length=239

 Score =   248 bits (633),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 139/235 (59%), Positives = 168/235 (71%), Gaps = 20/235 (9%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSSS+ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQK  72

Query  182  CSYGALEANQTSKDS---QSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLEN  352
            CSYGA + +   ++S   QS++QEYL+LKA VE LQ+SQR+LLGEDL  L  K+LEQLE 
Sbjct  73   CSYGAPDTSVQIRESQMLQSSHQEYLRLKARVEALQRSQRNLLGEDLGPLSSKELEQLER  132

Query  353  QVDTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWE---P  523
            Q+D+SLK IRSTRT++M+DQL++L ++EQ L E N++LR +L ESS  +     WE    
Sbjct  133  QLDSSLKQIRSTRTQYMLDQLADLQRREQMLCEANRSLRKRLEESSQANQQQV-WEDANA  191

Query  524  QGQNMQYGQHSSSQ-----QCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWM  673
             G N Q  Q    Q     +CQ T QIG+ P  M      G S  N    +PGW+
Sbjct  192  MGYNRQPNQPHGDQFFHPLECQPTLQIGFQPDQM-----PGPSVSN---YMPGWL  238



>ref|NP_001281016.1| MADS-box protein CMB1-like [Malus domestica]
 gb|AAD51422.1|U78949_1 MADS-box protein 3 [Malus domestica]
 gb|ADL36749.1| MADS domain class transcription factor [Malus domestica]
Length=248

 Score =   248 bits (634),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 137/238 (58%), Positives = 171/238 (72%), Gaps = 15/238 (6%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS+RGKLYEFCSS S+ KTLE+Y  
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFCSSFSMMKTLEKYQS  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYG+LEAN  + ++Q++YQ+YL LKA VEVLQQSQR+LLGEDL  L  K+LE LE+Q++
Sbjct  73   CSYGSLEANLPANETQNSYQDYLMLKARVEVLQQSQRNLLGEDLSHLNTKELEHLEHQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQG----  529
            TSLK IRS +T+ ++DQLS+L  +EQ L+E NKAL+ KL E+S        WE  G    
Sbjct  133  TSLKQIRSRKTQFILDQLSDLQNREQMLVEANKALKRKLEETSVQAPEGMAWEAAGHGPN  192

Query  530  --QNMQYGQHSSS-----QQCQNTAQIGYNPTSMQANN--NVGTSTMNGAGVLPGWML  676
              Q  +   HS +     +   +++QIGY  T M ++N  NVG       G +PGWML
Sbjct  193  NIQQTRLPSHSEAFFHPLEGNNSSSQIGY--THMGSDNEMNVGNPGQYVNGYIPGWML  248



>dbj|BAC80255.1| MADS-box transcription factor [Houttuynia cordata]
Length=247

 Score =   248 bits (633),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 127/235 (54%), Positives = 164/235 (70%), Gaps = 10/235 (4%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTF+KRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSSS+  TLERY +
Sbjct  13   NKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMMTTLERYQE  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSY   EA   +++++ +YQEYLKLK  VE+LQ++QR+LLGEDL  L  K+LEQLENQ++
Sbjct  73   CSYSMPEATGPTRETEKSYQEYLKLKGKVELLQRTQRNLLGEDLGPLSSKELEQLENQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
             SL+ IRST+T+ ++DQLS+L +KEQ +LE NK L+ KL E    +     W+  GQ+  
Sbjct  133  HSLRQIRSTKTQALLDQLSDLRRKEQQMLESNKILKKKLAEHGPENLLQLAWQSCGQSNP  192

Query  542  YGQHSSSQQ-------CQNTAQIGYNPTSMQANNNVGTS---TMNGAGVLPGWML  676
            Y +  +  +       C  T QIGY+P   +       +     N  G +PGWM+
Sbjct  193  YSRQPAHSEAFFQPLDCNPTLQIGYHPVGQEEITMAAPAIAPPQNVNGFIPGWMV  247



>gb|ABD62860.1| SEP3.2 [Persea borbonia]
Length=225

 Score =   247 bits (631),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 126/210 (60%), Positives = 157/210 (75%), Gaps = 12/210 (6%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSSS+ KTLERY K
Sbjct  5    NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQK  64

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            C+YGA E   +++++QS++QEYLKLKA VE LQ+SQR+LLGEDL  L  K+L+ LE Q+D
Sbjct  65   CNYGAPETTVSTRETQSSHQEYLKLKARVEALQRSQRNLLGEDLGPLTSKELDTLEKQLD  124

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
             SLK IRSTRT++M+DQL++L ++EQ L E NK L+ +L E    +  +  W+P G  + 
Sbjct  125  ASLKQIRSTRTQYMLDQLADLQRREQMLSEANKNLKRRLEEGMQANPQV--WDPNGHPVT  182

Query  542  YGQHSSSQQ----------CQNTAQIGYNP  601
            YG+  +  Q          C+ T  IGY P
Sbjct  183  YGRQQAPPQSDGFFHPLDTCEPTLHIGYQP  212



>ref|XP_009337956.1| PREDICTED: MADS-box protein CMB1-like [Pyrus x bretschneideri]
Length=249

 Score =   248 bits (633),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 136/239 (57%), Positives = 171/239 (72%), Gaps = 16/239 (7%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS+RGKLYEFCSS S+ KTLE+Y  
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFCSSFSMMKTLEKYQS  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYG+LEAN  + ++Q++YQ+YL LKA VEVLQQSQR+LLGEDL  L  K+LE LE+Q++
Sbjct  73   CSYGSLEANLPANETQNSYQDYLTLKARVEVLQQSQRNLLGEDLQPLNTKELEHLEHQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
            TSLK IRS +T+ ++DQLS+L  +EQ L+E NK+L+ KL E+S        WE  G +  
Sbjct  133  TSLKQIRSRKTQFILDQLSDLQNREQMLVEANKSLKRKLEETSVQAPEGMAWEAAGHDHN  192

Query  542  YG-------QHSSS-----QQCQNTAQIGYNPTSMQANN--NVGTSTMNGAGVLPGWML  676
            Y         HS +     +   +++QIGY  T M ++N  NVG       G +PGWML
Sbjct  193  YNIQLTRLPSHSEAFFHPLEGNNSSSQIGY--THMGSDNEMNVGNPGQYVNGFIPGWML  249



>dbj|BAM71399.1| transcription factor [Pyrus pyrifolia]
Length=249

 Score =   248 bits (633),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 136/239 (57%), Positives = 171/239 (72%), Gaps = 16/239 (7%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS+RGKLYEFCSS S+ KTLE+Y  
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFCSSFSMMKTLEKYQS  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYG+LEAN  + ++Q++YQ+YL LKA VEVLQQSQR+LLGEDL  L  K+LE LE+Q++
Sbjct  73   CSYGSLEANLPANETQNSYQDYLTLKARVEVLQQSQRNLLGEDLQPLNTKELEHLEHQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
            TSLK IRS +T+ ++DQLS+L  +EQ L+E NK+L+ KL E+S        WE  G +  
Sbjct  133  TSLKQIRSRKTQFILDQLSDLQNREQMLVEANKSLKRKLEETSVQAPEGMAWEAAGHDHN  192

Query  542  YG-------QHSSS-----QQCQNTAQIGYNPTSMQANN--NVGTSTMNGAGVLPGWML  676
            Y         HS +     +   +++QIGY  T M ++N  NVG       G +PGWML
Sbjct  193  YNIQQTRLPSHSEAFFHPLEGNNSSSQIGY--THMGSDNEMNVGNPGQYVNGFIPGWML  249



>gb|AEL33631.1| SEPALLATA1 [Gossypium hirsutum]
Length=245

 Score =   248 bits (632),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 132/237 (56%), Positives = 170/237 (72%), Gaps = 16/237 (7%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSSS+ KTL+RY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLDRYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYGA+E ++ +K+ +S+Y+EYLKLKA  E LQ++QR+LLGEDL  L  K+LEQLE+Q++
Sbjct  73   CSYGAVEVSKPAKELESSYREYLKLKARYEELQRTQRNLLGEDLGPLNSKELEQLEHQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
            +SLK +RST+T++M+DQL+EL  KEQ L+E N+AL IKL E S  + F   WE   Q++ 
Sbjct  133  SSLKHVRSTKTQYMLDQLTELQNKEQMLMETNRALSIKLEEISARNQFRASWEGGEQSVA  192

Query  542  YGQHSSSQQCQNTA---QIGYNPT---------SMQANNNVGTSTMNGAGVLPGWML  676
            +    ++QQ Q+      +  NPT           + +           G +PGWML
Sbjct  193  F----TNQQAQSMGLFQPLECNPTFADRVLQSCCFRPDGLQQLMLRKSMGFIPGWML  245



>ref|NP_001280893.1| developmental protein SEPALLATA 1 [Malus domestica]
 emb|CAA04919.1| MdMADS8 [Malus domestica]
Length=246

 Score =   248 bits (632),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 132/234 (56%), Positives = 165/234 (71%), Gaps = 9/234 (4%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSSSI KTL+RY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSILKTLDRYQK  72

Query  182  CSYGALE-ANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQV  358
            CSYGA++  N+ +K+ +S+Y+EY+KLK   E LQ++QR+LLGEDL  L  K+LEQLE Q+
Sbjct  73   CSYGAVDQVNRPAKELESSYREYMKLKGRYESLQRTQRNLLGEDLGPLNTKELEQLERQL  132

Query  359  DTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNM  538
            + SLK +RST+T++M+DQLS+L  KEQ L+E N+ L +KL E S+ +     WE   Q M
Sbjct  133  EGSLKQVRSTKTQYMLDQLSDLQNKEQLLIEANRDLTMKLDEISSRNQLRQSWEGGDQGM  192

Query  539  QYGQHSSSQQCQNTAQ-IGYNPTSMQANNNVGTSTMNGAG-------VLPGWML  676
             Y       Q Q   Q +  NPT     + VG+  M+           +PGWML
Sbjct  193  AYATQHHHAQSQGFFQPLDCNPTLQMGYSAVGSEQMSATTNAQQVNCFIPGWML  246



>emb|CDY26462.1| BnaC09g42060D [Brassica napus]
Length=254

 Score =   248 bits (633),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 140/242 (58%), Positives = 168/242 (69%), Gaps = 17/242 (7%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSS++ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSNMIKTLERYQK  72

Query  182  CSYGALEA-NQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQV  358
            CSYG++E  N+ +K+ +++Y+EYLKLK   E LQ+ QR+LLGEDL  L  K+LEQLE Q+
Sbjct  73   CSYGSIEVNNKPAKELENSYREYLKLKGRYESLQRQQRNLLGEDLGPLNSKELEQLERQL  132

Query  359  DTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKL----GESSNN--DAFLTPWE  520
            D SLK +RS +T++M+DQLS+L  KEQ LLE N+AL IKL    G  S++        WE
Sbjct  133  DGSLKQVRSIKTQYMLDQLSDLQSKEQMLLETNRALAIKLDDMIGVRSHHMGGGGGGGWE  192

Query  521  PQGQNMQYGQHSSSQ--------QCQNTAQIGY-NPT-SMQANNNVGTSTMNGAGVLPGW  670
               QN+ Y  H  +Q        +C  T QIGY NP  S Q           G G +PGW
Sbjct  193  GNEQNVSYEHHHQAQPQGLFQPLECNPTLQIGYDNPVGSEQITATTQAQAQPGNGYIPGW  252

Query  671  ML  676
            ML
Sbjct  253  ML  254



>gb|AHH28254.1| MADS-box transcription factor, partial [Sapria himalayana]
Length=221

 Score =   247 bits (630),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 127/222 (57%), Positives = 157/222 (71%), Gaps = 8/222 (4%)
 Frame = +2

Query  32   KRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHKCSYGALEANQ  211
            KRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSS++ KTLERY KCSYGA+E N+
Sbjct  1    KRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSNMLKTLERYQKCSYGAIEVNK  60

Query  212  TSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVDTSLKSIRSTR  391
             +K+ +S+Y+EY+KLK+  E LQ++QR+LLGEDL  L  K+LEQLE Q+++SLK +RST+
Sbjct  61   PAKELESSYREYMKLKSRFESLQRTQRNLLGEDLGPLNTKELEQLERQLESSLKQVRSTK  120

Query  392  TKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQYGQHSSSQQ-  568
            T++M+DQLS+L  KEQ LLE N+AL IKL E    +     WE   Q+M Y  H    Q 
Sbjct  121  TQYMLDQLSDLQNKEQLLLEANRALTIKLDEMGARNNLRPSWEGPEQSMPYAHHHPQNQE  180

Query  569  ------CQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
                  C  T QIGYNP     +    T      G +PGWML
Sbjct  181  LFQPLECNPTLQIGYNPVG-SDHITATTHAQQVNGFIPGWML  221



>gb|AAZ77748.1| AGL2-like MADS box 3 [Castanea mollissima]
Length=243

 Score =   248 bits (632),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 133/232 (57%), Positives = 161/232 (69%), Gaps = 8/232 (3%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCS+SS+ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSTSSMLKTLERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYGA+E N+  K+ + +Y+EYLKLKA  E LQ++QR+LLGEDL  L   DLE+LE Q+D
Sbjct  73   CSYGAVEVNKPGKELEISYREYLKLKARFESLQRTQRNLLGEDLGPLNTNDLERLERQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
            +SLK     R ++M+DQLS+L  KE  L+E N+AL IKL E S  +     WE   Q+M 
Sbjct  133  SSLKKSGPLR-QYMLDQLSDLQNKEHLLVEANRALAIKLDEISPRNNLRQSWEGGEQSMS  191

Query  542  YGQHSSSQQ-------CQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
            YG  ++  Q       C  T QIGYN +      +  T      G +PGWML
Sbjct  192  YGPQNAHSQSFFQPLDCNPTLQIGYNASGSDQQLSGTTHAQQVNGFIPGWML  243



>ref|XP_007037631.1| K-box region and MADS-box transcription factor family protein 
[Theobroma cacao]
 gb|EOY22132.1| K-box region and MADS-box transcription factor family protein 
[Theobroma cacao]
Length=407

 Score =   253 bits (646),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 128/208 (62%), Positives = 160/208 (77%), Gaps = 7/208 (3%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FSNRGKLYEFCSSSS+ KTLE+Y K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSSSSMMKTLEKYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSY  ++ ++++ ++QS+YQEYLKLKA VEVLQ+SQR+LLGEDL  L  K+LEQLENQ++
Sbjct  73   CSYSTVDTSRSASETQSSYQEYLKLKARVEVLQRSQRNLLGEDLGPLNTKELEQLENQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
            TSLK IRST+++ M+DQL +L  +EQ L+E NK+LR KL E S        WE  GQN+ 
Sbjct  133  TSLKQIRSTKSQAMLDQLGDLQNREQMLVETNKSLRRKLEELSAQPHLRLAWETGGQNIP  192

Query  542  YGQHSSSQQ-------CQNTAQIGYNPT  604
            Y +  +  +         ++ QIGYNP 
Sbjct  193  YNRLPAQSEGFFQLLGGSSSLQIGYNPV  220


 Score =   130 bits (326),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 80/185 (43%), Positives = 105/185 (57%), Gaps = 27/185 (15%)
 Frame = +2

Query  200  EANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVDTSLKSI  379
            E N  +++  S+YQE LKLKA VEVLQ+SQR+LLGEDL  L  K+LEQLENQ++TSLK I
Sbjct  224  EMNVAAQNQNSSYQECLKLKARVEVLQRSQRNLLGEDLGPLNTKELEQLENQLETSLKQI  283

Query  380  RSTRTKHMIDQLSELHQKEQNLLEVNKALRIK-------------------LGESSNNDA  502
            RST+++ M+DQL +L  +EQ L+E NK+LR K                   L E S    
Sbjct  284  RSTKSQAMLDQLGDLQNREQMLVETNKSLRRKYSASLLSTVLILVQILFHLLEELSAQPP  343

Query  503  FLTPWEPQGQNMQYGQHSSSQQ-------CQNTAQIGYNPTSMQANNNVGTSTMNGAGVL  661
            F   WE  GQN+ Y +  +  +         ++ +IGYNP  +    NV     N  G  
Sbjct  344  FRLAWETGGQNIPYNRLPAQSEGFFQLLGGSSSFRIGYNPV-VSDEMNVAAQNQNVCGYF  402

Query  662  PGWML  676
            PGWML
Sbjct  403  PGWML  407



>gb|AGV54737.1| developmental protein SEPALLATA 2-like protein [Phaseolus vulgaris]
Length=247

 Score =   248 bits (632),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 132/237 (56%), Positives = 169/237 (71%), Gaps = 14/237 (6%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAK  NGL KKAYELS+L DAEVALIIFS RGKLYEFCSSSS+ KTLERY K
Sbjct  13   NKINRQVTFAKGGNGLFKKAYELSVLWDAEVALIIFSTRGKLYEFCSSSSMLKTLERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYGA+E ++ +K+ +S+Y+EYLKLK   E LQ++QR+LLGEDL  L  K+LEQLE Q+D
Sbjct  73   CSYGAVEVSKPAKELESSYREYLKLKGRFESLQRTQRNLLGEDLGPLNTKELEQLERQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
            +SLK +RST+T+ M+DQL++L  KEQ L+E N+AL +KL E ++ + +   WE   Q+M 
Sbjct  133  SSLKQVRSTKTQFMLDQLADLQNKEQMLVEANRALTMKLDEINSRNQYRQTWEAGDQSMP  192

Query  542  YGQHSSSQQ-------CQNTAQIG----YNPTSMQANNNVGTSTMNGA-GVLPGWML  676
            YG  ++  Q       C  T QIG    YNP +  ++   GT+      G +PGWML
Sbjct  193  YGTPNAHSQGFFQPLECNPTLQIGSDYRYNPEA--SDQLTGTTQAQQVNGFIPGWML  247



>gb|AEX58639.1| AGL2-1 [Epimedium sagittatum]
Length=242

 Score =   247 bits (631),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 132/233 (57%), Positives = 166/233 (71%), Gaps = 11/233 (5%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVA+IIFS+RGKLYEFCS SS+ KTLERY++
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVAVIIFSSRGKLYEFCSGSSMLKTLERYNQ  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            C+Y  LEAN   K+++S+Y EY+KLK  +E+LQQ+QR+LLGEDL  L   +L+QLENQ++
Sbjct  73   CNYNPLEANAPDKETESSYHEYMKLKGRLELLQQNQRNLLGEDLDSLTTNELDQLENQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
            TSLK IRST+T++M+DQLS+L QKEQ L E N  LR KL  +S        W+  GQ + 
Sbjct  133  TSLKQIRSTKTQYMLDQLSDLQQKEQMLKEANATLRTKLDGASAEIPLQLSWQLAGQKVT  192

Query  542  YGQHSSSQ-------QCQNTAQIGYNPT-SMQANNNVGTSTMNGAGVLPGWML  676
            Y   +S         +C  T Q+GY+   S Q  N     + N  G +PGWML
Sbjct  193  YNCQNSQPEPFFQPLECNPTNQMGYHQVGSHQLTNQ---PSQNRNGFIPGWML  242



>ref|XP_009373782.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X1 
[Pyrus x bretschneideri]
 ref|XP_009333661.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X1 
[Pyrus x bretschneideri]
Length=247

 Score =   247 bits (631),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 137/239 (57%), Positives = 171/239 (72%), Gaps = 18/239 (8%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSSSI KTL+RY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSILKTLDRYQK  72

Query  182  CSYGALE-ANQTSKD-SQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQ  355
            CSYGA++  N+ +K+  QS+Y+EY+KLK   E LQ++QR+LLGEDL  L  K+LEQLE Q
Sbjct  73   CSYGAVDQVNRPAKELEQSSYREYMKLKGRYESLQRTQRNLLGEDLGPLNTKELEQLERQ  132

Query  356  VDTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQN  535
            ++ SLK +RST+T++M+DQLS+L  KEQ L+E N+ L +KL E S+ +     WE   Q 
Sbjct  133  LEGSLKQVRSTKTQYMLDQLSDLQNKEQLLIEANRDLTMKLDEISSRNQLRQSWEGGDQG  192

Query  536  MQYG---QHSSSQ------QCQNTAQIGYNPTSMQANNNVGTSTMNGAGV---LPGWML  676
            M Y     H+ SQ       C  T Q+GY+     A +   ++T NG  V   +PGWML
Sbjct  193  MAYATQHHHAQSQGFFQPLDCNPTLQMGYSA----AGSEQMSATTNGQQVNCFIPGWML  247



>gb|AAX15918.1| AGL9 [Eschscholzia californica]
Length=241

 Score =   247 bits (630),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 139/235 (59%), Positives = 165/235 (70%), Gaps = 18/235 (8%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSSS+ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMFKTLERYQK  72

Query  182  CSYGALEANQTSKDSQ--SNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQ  355
             +YGA E N + ++SQ  S++QEYLKLKA VE LQ+SQR+LLGEDL  L  K+LE LE Q
Sbjct  73   SNYGAPETNVSVRESQEHSSHQEYLKLKARVEALQRSQRNLLGEDLGPLSGKELESLERQ  132

Query  356  VDTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQN  535
            +D SLK IRSTRT++M+DQL++L ++EQ L + NK LR +L E +        WE   QN
Sbjct  133  LDMSLKQIRSTRTQYMLDQLTDLQRREQMLSDANKTLRRRLEEGT---VTCHQWE---QN  186

Query  536  MQYGQHSSSQQ---------CQNTAQIGYNPTSMQANNNVGTS-TMNGAGVLPGW  670
            MQYGQ  +  Q         C+ T Q+GY    +      G S TMN     PGW
Sbjct  187  MQYGQQQAHAQGEGFFHPIECEPTLQMGYQQDQITVAAAAGPSMTMNSYMPGPGW  241



>ref|XP_003549578.1| PREDICTED: MADS-box protein CMB1-like [Glycine max]
Length=243

 Score =   247 bits (630),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 136/233 (58%), Positives = 168/233 (72%), Gaps = 10/233 (4%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEF S+SS+ KTLE+Y K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFSSTSSMMKTLEKYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
             SY ALE  +   DSQ NYQEYL+LKA VEVLQ SQR+LLGEDL Q+   +LEQLENQ++
Sbjct  73   YSYSALETTRPINDSQ-NYQEYLRLKARVEVLQCSQRNLLGEDLAQMNTNELEQLENQLE  131

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLT-PWEPQGQNM  538
            T+LK+IRST+T+ M+DQLS+LH +E  L+E N  LR KL E++N+   ++   E  G ++
Sbjct  132  TALKNIRSTKTQFMLDQLSDLHHRETLLIETNNVLRSKLEETNNSQVQVSLALEAGGPSI  191

Query  539  QYGQHSSSQQ-------CQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
            QY       +          T QIGYN T+   + NVG S+++  G    WML
Sbjct  192  QYTNFPPQSEGFFQPMGVNPTLQIGYNQTNPH-DANVGASSLSMHGFASEWML  243



>gb|KHN15201.1| MADS-box protein CMB1 [Glycine soja]
Length=243

 Score =   247 bits (630),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 133/233 (57%), Positives = 167/233 (72%), Gaps = 10/233 (4%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEF S+SS+ KTLE+Y K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFSSTSSMMKTLEKYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
             SY ALE  +   D+Q NYQEYL+LKA VEVLQ+SQR+LLGEDL Q+   +LEQLENQ++
Sbjct  73   YSYSALETTRPINDTQ-NYQEYLRLKARVEVLQRSQRNLLGEDLAQMNTNELEQLENQLE  131

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLT-PWEPQGQNM  538
             +L++IRST+T+ M+DQLS+LH +E  L+E N  LR KL E+ ++   ++   E  G ++
Sbjct  132  AALRNIRSTKTQFMLDQLSDLHHRETLLIETNNVLRSKLEETDHSQVQVSLALEAGGPSI  191

Query  539  QYGQHSSSQQ-------CQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
            QY       +          T QIGYN T    + NVG S+++  G   GWML
Sbjct  192  QYTNFPPQSEGFFEPVGVNPTLQIGYNQTG-PDDTNVGASSLSMHGFASGWML  243



>ref|XP_006856372.1| hypothetical protein AMTR_s00047p00190220 [Amborella trichopoda]
 gb|AAX15917.1| AGL2 [Amborella trichopoda]
 gb|AAY25578.1| AGL2 [Amborella trichopoda]
 gb|ERN17839.1| hypothetical protein AMTR_s00047p00190220 [Amborella trichopoda]
Length=243

 Score =   247 bits (630),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 140/233 (60%), Positives = 171/233 (73%), Gaps = 10/233 (4%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCS+SS+ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSTSSMVKTLERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            C+YGALE N  ++++QS+YQEYLKLKA VE LQ+SQR+LLGEDL  L  K+LEQLE Q++
Sbjct  73   CNYGALETNVPTRETQSSYQEYLKLKARVESLQRSQRNLLGEDLGPLSSKELEQLEQQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKL-GESSNNDAFLTPWEPQGQNM  538
             SLK IRST+T+ M DQL++L ++E  L E NKAL+ KL G S++N   L  WE  GQN+
Sbjct  133  MSLKQIRSTKTQCMFDQLADLRRRELALQETNKALKRKLEGASASNPPQLA-WENNGQNI  191

Query  539  QYGQHSSSQ-------QCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
             Y +  +         +C +T QIGY+P S      V     N    LPGW++
Sbjct  192  HYNRQPAHTEGFFHPLECDSTLQIGYHP-SCPDQMPVAAPVQNVNAFLPGWLV  243



>ref|XP_011071269.1| PREDICTED: floral homeotic protein APETALA 1 [Sesamum indicum]
Length=477

 Score =   254 bits (649),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 155/184 (84%), Gaps = 3/184 (2%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NK+NRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSN+GKLYEFCSSSS+  TLERYH+
Sbjct  13   NKVNRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNKGKLYEFCSSSSMGATLERYHR  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
             SYG LEA+Q+  + Q+ YQEY+KLKA VEVLQQSQRHLLGE+L QLGIK+L+QLEN +D
Sbjct  73   SSYGPLEAHQSPHNEQNKYQEYMKLKARVEVLQQSQRHLLGEELGQLGIKELDQLENVLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQ-NM  538
            TSLK IRS +   M++QLS+LHQKE+NLLE+N+ALR KL  +S   A  + W+ Q + N+
Sbjct  133  TSLKEIRSNKNHRMLNQLSDLHQKERNLLEINRALRSKLEGTS--AALQSTWQLQPELNV  190

Query  539  QYGQ  550
            QY Q
Sbjct  191  QYQQ  194


 Score =   159 bits (402),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 118/158 (75%), Gaps = 4/158 (3%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTF+KRR GLLKKA+E+S+LCDAEVALI+FS++GKL+E+ + S + + LE+Y +
Sbjct  248  NKINRQVTFSKRRAGLLKKAHEISVLCDAEVALIVFSHKGKLFEYSTDSCMDRILEKYER  307

Query  182  CSYGA--LEANQTSKDSQSNYQ-EYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLEN  352
             S+    L AN    DS +N+  EY KLKA +E+LQ++ RH +GEDL  + +KDL+ LE 
Sbjct  308  YSFAERQLVANDQP-DSPANWTLEYSKLKARIELLQRNHRHYMGEDLKSISMKDLQNLEQ  366

Query  353  QVDTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKAL  466
            Q+DT+LK+IRS + + + D +SEL +KE+ + E N  L
Sbjct  367  QLDTALKNIRSRKNQLLYDSISELQRKEKAIQEQNSML  404



>gb|ABV23569.2| MADS-box protein [Populus deltoides]
Length=241

 Score =   246 bits (629),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 132/232 (57%), Positives = 164/232 (71%), Gaps = 10/232 (4%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLL KAYELS LCDAEVALIIFSN GKL+EFCSSS+++ T+E+Y +
Sbjct  13   NKINRQVTFAKRRNGLLNKAYELSFLCDAEVALIIFSNSGKLFEFCSSSNMATTIEKYQR  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
             SYGALE  Q+ K++Q+NYQEYLKLK  V+VLQ+SQR+LLGEDL  LG  +L+QLENQ+D
Sbjct  73   FSYGALEGGQSEKETQNNYQEYLKLKTRVDVLQRSQRNLLGEDLGNLGTMELDQLENQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
            +SLK IRS + + ++D+LSEL +KE+ LLE N AL+ KL E+S   A    W+   Q + 
Sbjct  133  SSLKQIRSRKGQFVLDELSELQRKEELLLETNNALKRKLEETS--AAIRLSWKVGEQRVP  190

Query  542  YGQHS-------SSQQCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
            Y              Q  +T Q GYNP        V +ST N  G +PGWML
Sbjct  191  YSFQPVQPYDPVEPLQYNSTFQFGYNPAETD-QATVTSSTQNVNGFIPGWML  241



>gb|AAC25922.1| MADS-box protein 1 [Malus domestica]
Length=246

 Score =   246 bits (629),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 131/234 (56%), Positives = 165/234 (71%), Gaps = 9/234 (4%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSSS+ KTL+RY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLDRYQK  72

Query  182  CSYGALE-ANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQV  358
            CSYGA++  N+ +K+ +S+Y+EY+KLK   E LQ++QR+LLGEDL  L  K+LEQLE Q+
Sbjct  73   CSYGAVDQVNRPAKELESSYREYMKLKGRYESLQRTQRNLLGEDLGPLNTKELEQLERQL  132

Query  359  DTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNM  538
            + SLK +RST+T++M+DQLS+L  KEQ L+E N+ L +KL E S+ +     WE   Q M
Sbjct  133  EGSLKQVRSTKTQYMLDQLSDLQNKEQLLIEANRDLTMKLDEISSRNQLRQSWEGGDQGM  192

Query  539  QYGQHSSSQQCQNTAQ-IGYNPTSMQANNNVGTSTMNGAG-------VLPGWML  676
             Y       Q Q   Q +  NPT     + VG+  M+           +PGWML
Sbjct  193  AYATQHHHAQSQGFFQPLDCNPTLQMGYSAVGSEQMSATTNAQQVNCFIPGWML  246



>gb|ACB69509.1| SEPALLATA3-like MADS-box protein [Crocus sativus]
Length=238

 Score =   246 bits (628),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 137/235 (58%), Positives = 166/235 (71%), Gaps = 21/235 (9%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FSNRGKLYEFCSSSSI KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSSSSIMKTLERYQK  72

Query  182  CSYGALEANQTSKDS---QSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLEN  352
            CSYGA +     +++   QS++QEYLKLKA VE LQ+SQR+LLGEDL  L  K+LEQLE 
Sbjct  73   CSYGAPDNIVQIRETQLLQSSHQEYLKLKAHVEALQRSQRNLLGEDLGPLSSKELEQLER  132

Query  353  QVDTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQ  532
            Q+D+SLK IRSTRT+ M+DQL +L +KE  L E N++LR +L ESS   A    WE    
Sbjct  133  QLDSSLKQIRSTRTQCMLDQLGDLQRKEHMLCEANRSLRKRLEESSQ--AHQQVWESNAN  190

Query  533  NMQYGQHSSSQQ--------CQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWM  673
             + Y + ++ Q+        CQ T QIG+     QA+   G S  N    +PGW+
Sbjct  191  AIAYARQANQQEEEFYQPLDCQPTLQIGF-----QADQMAGPSVTN---YMPGWL  237



>emb|CDX69499.1| BnaA10g18480D [Brassica napus]
Length=264

 Score =   246 bits (629),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 138/252 (55%), Positives = 174/252 (69%), Gaps = 27/252 (11%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSS++ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSNMIKTLERYQK  72

Query  182  CSYGALEA-NQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQV  358
            CSYG++E  N+ +K+ +++Y+EYLKLK   E LQ+ QR+LLGEDL  L  K+LEQLE Q+
Sbjct  73   CSYGSIEVNNKPAKELENSYREYLKLKGRYESLQRQQRNLLGEDLGPLNSKELEQLERQL  132

Query  359  DTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKL----GESSNNDAFLTPWEPQ  526
            D SLK +RS +T++M+DQLS+L  KEQ LLE N+AL IKL    G  S++      WE  
Sbjct  133  DGSLKQVRSIKTQYMLDQLSDLQSKEQMLLETNRALAIKLDDMIGVRSHHMGGGGGWEGN  192

Query  527  GQNMQYGQHSSSQ--------QCQNTAQIGY----NPTSMQ-ANNNVGTSTMN-------  646
             QN+ Y  H  +Q        +C  T QIG+     P +++  +N VG+  +        
Sbjct  193  EQNVPYEHHHQAQSQGLFQPLECNPTLQIGFLVLRGPYNLRWYDNPVGSEQITTTTQAQA  252

Query  647  --GAGVLPGWML  676
              G G +PGWML
Sbjct  253  QPGNGYIPGWML  264



>ref|XP_007151388.1| hypothetical protein PHAVU_004G042300g [Phaseolus vulgaris]
 gb|ESW23382.1| hypothetical protein PHAVU_004G042300g [Phaseolus vulgaris]
Length=217

 Score =   245 bits (625),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 157/205 (77%), Gaps = 8/205 (4%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS RGKLYEFCSSSS+ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCSSSSMLKTLERYQK  72

Query  182  CSYGALEANQTSKD-SQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQV  358
            CSYGA+E ++ +K+  QS+Y+EYLKLK   E LQ++QR+LLGEDL  L  K+LEQLE Q+
Sbjct  73   CSYGAVEVSKPAKELEQSSYREYLKLKGRFESLQRTQRNLLGEDLGPLNTKELEQLERQL  132

Query  359  DTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNM  538
            D+SLK +RST+T+ M+DQL++L  KEQ L+E N+AL +KL E ++ + +   WE   Q+M
Sbjct  133  DSSLKQVRSTKTQFMLDQLADLQNKEQMLVEANRALTMKLDEINSRNQYRQTWEAGDQSM  192

Query  539  QYGQHSSSQQ-------CQNTAQIG  592
             YG  ++  Q       C  T QIG
Sbjct  193  PYGTPNAHSQGFFQPLECNPTLQIG  217



>gb|AAD09206.1| putative MADS-box family transcription factor [Pinus radiata]
Length=245

 Score =   246 bits (627),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 134/235 (57%), Positives = 166/235 (71%), Gaps = 12/235 (5%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSSS+ KT+E+Y K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMMKTIEKYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYG+LE N +  + Q++YQ+YL+LKA VEVLQ+SQR+LLGE+L  L  K+LEQLE+Q++
Sbjct  73   CSYGSLETNCSINEMQNSYQDYLELKARVEVLQRSQRNLLGEELGPLNSKELEQLEHQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQ-NM  538
             SLK IRS +T+ M DQL+ L  KEQ L+E N+ LR KL ES+        WE +   N+
Sbjct  133  NSLKQIRSAKTQFMFDQLAHLQHKEQMLVEANRELRKKLEESNTRIPLRLGWEAEDHNNI  192

Query  539  QYGQHSSSQQ--------CQNTAQIGYNPTSMQANN-NVGTSTMNGAGVLPGWML  676
             Y +  +  Q             QIGYNP    +N  NV  +  +  G +PGWML
Sbjct  193  SYRRLPTQSQGLIFQPLGGYPNMQIGYNPAG--SNELNVSPADQHPNGFIPGWML  245



>emb|CAE46179.1| AGL2-like MADS box transcription factor [Elaeis guineensis]
Length=207

 Score =   244 bits (624),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 146/182 (80%), Gaps = 1/182 (1%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSSS+ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMMKTLERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            C+YGA E N  S+++QS+ QEYLKLKA  E LQ+SQR+LLGEDL  L  K+LEQLE Q+D
Sbjct  73   CNYGAPETNIISRETQSSQQEYLKLKARAEALQRSQRNLLGEDLGPLSSKELEQLEGQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
             SLK IRSTRT++M+DQL++L +KEQ L E NK+LR +L E SN       W+P    + 
Sbjct  133  ASLKQIRSTRTQYMLDQLADLQRKEQMLCEANKSLRRRL-EESNQAGQQQVWDPTAHAVG  191

Query  542  YG  547
            YG
Sbjct  192  YG  193



>gb|AAZ95252.1| MADS box protein SEP1 [Dendrobium crumenatum]
Length=243

 Score =   246 bits (627),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 137/236 (58%), Positives = 164/236 (69%), Gaps = 16/236 (7%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSS+ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            C+Y   E N  S+++QS+ QEYLKLKA VE LQ+SQR+LLGEDL  L  K+LE LE Q+D
Sbjct  73   CNYEGPETNIISRETQSSQQEYLKLKARVEALQRSQRNLLGEDLGPLSSKELEHLERQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQ-----  526
             SLK IRSTRT+ M+DQL++L ++EQ L E NKAL+ +  E SN  A    W+P      
Sbjct  133  ASLKQIRSTRTQFMLDQLADLQRREQMLCEANKALKRRF-EESNQTAHQQVWDPSTTHAV  191

Query  527  GQNMQYGQHSSSQ-----QCQNTAQIGYNPTSMQANNNVGTSTMNGAGVL-PGWML  676
            G   Q  QH         +C+ T QIGY+     A     T+  N +  + PGW++
Sbjct  192  GYGRQPAQHHGDAFYHPLECEPTLQIGYHSDITMA----PTTAPNVSNYMPPGWLV  243



>ref|XP_006400104.1| hypothetical protein EUTSA_v10014493mg [Eutrema salsugineum]
 gb|ESQ41557.1| hypothetical protein EUTSA_v10014493mg [Eutrema salsugineum]
Length=250

 Score =   246 bits (627),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 135/238 (57%), Positives = 167/238 (70%), Gaps = 13/238 (5%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSS++ KTL+RY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSNMIKTLDRYQK  72

Query  182  CSYGALEA-NQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQV  358
            CSYG++E  N+ +K+ +++Y+EYLKLK   E LQ+ QR+LLGEDL  L  K+LEQLE Q+
Sbjct  73   CSYGSIEVNNKPAKELENSYREYLKLKGRYENLQRQQRNLLGEDLGPLNSKELEQLERQL  132

Query  359  DTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGE---SSNNDAFLTPWEPQG  529
            D SLK +RS +T++M+DQLS+L  KEQ LLE N+AL +KL +     ++      WE   
Sbjct  133  DGSLKQVRSIKTQYMLDQLSDLQSKEQMLLETNRALSMKLDDMIGVRSHHMGGGGWEGNE  192

Query  530  QNMQYGQHSSSQQ-------CQNTAQIGY-NPT-SMQANNNVGTSTMNGAGVLPGWML  676
            QN+ Y  H +  Q       C  T QIGY NP  S Q          +G G +PGWML
Sbjct  193  QNVSYAHHQAQSQGLYQPLECNATLQIGYDNPVGSEQITATTQAQAQHGNGYIPGWML  250



>gb|AAX15920.1| AGL9 [Liriodendron tulipifera]
Length=242

 Score =   245 bits (626),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 132/233 (57%), Positives = 163/233 (70%), Gaps = 13/233 (6%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCS+SS+ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSTSSMFKTLERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            C+YGA EA  T+++ QS++QEYLKLKA VE LQ+SQR+LLGEDL  L  K+L+ LE Q+D
Sbjct  73   CNYGAPEAAVTTREIQSSHQEYLKLKARVEALQRSQRNLLGEDLGPLNGKELDTLERQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
             SLK IRSTRT++M+DQL++L ++EQ L E NKAL+ +L E    +     W      M+
Sbjct  133  VSLKQIRSTRTQYMLDQLTDLQRREQMLSEANKALKRRLDEGMQANPH-QGWNHNPHAME  191

Query  542  YGQHSSSQQ---------CQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWM  673
            Y +     Q         C+ T QIGY    +  +   G S  N    +PGW+
Sbjct  192  YVRQQGPPQGDGFFHPLDCEPTLQIGYQTDQITMSTAPGPSLNN---YMPGWL  241



>ref|XP_007155209.1| hypothetical protein PHAVU_003G182800g [Phaseolus vulgaris]
 gb|ESW27203.1| hypothetical protein PHAVU_003G182800g [Phaseolus vulgaris]
Length=243

 Score =   245 bits (626),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 132/233 (57%), Positives = 165/233 (71%), Gaps = 10/233 (4%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEF S+SS+ KTLE+Y K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFSSTSSMVKTLEKYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
             SY ALE  +   D Q NYQEYL+LKA VE+LQ+SQR+LLGEDL Q+   DLEQLENQ++
Sbjct  73   YSYSALETTRPINDIQ-NYQEYLRLKARVEILQRSQRNLLGEDLAQMNTTDLEQLENQLE  131

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLT-PWEPQGQNM  538
            T+LK+IRST+T+ M+DQL++LH +E  L+E N  LR KL E++N+   ++   E  G N+
Sbjct  132  TALKNIRSTKTQFMLDQLADLHHRETLLVETNNVLRSKLEETNNSQVPVSLALEAGGSNI  191

Query  539  QYGQHSSSQQ-------CQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
             Y       +            QIG+N      + NVG S+++  G   GWML
Sbjct  192  HYTNFPPQSEGFFQAMGVNPNLQIGFNQIG-PDDANVGASSLSMHGFASGWML  243



>gb|KHN18378.1| MADS-box protein CMB1 [Glycine soja]
Length=243

 Score =   245 bits (625),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 135/233 (58%), Positives = 167/233 (72%), Gaps = 10/233 (4%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEF S+SS+ KTLE+Y K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFSSTSSMMKTLEKYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
             SY ALE  +   DSQ NYQEYL+LKA VEVLQ SQR+LLGEDL Q+   +LEQLENQ++
Sbjct  73   YSYSALETTRPINDSQ-NYQEYLRLKARVEVLQCSQRNLLGEDLAQMNTNELEQLENQLE  131

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLT-PWEPQGQNM  538
             +LK+IRST+T+ M+DQLS+LH +E  L+E N  LR KL E++N+   ++   E  G ++
Sbjct  132  AALKNIRSTKTQFMLDQLSDLHHRETLLIETNNVLRSKLEETNNSQVQVSLALEAGGPSI  191

Query  539  QYGQHSSSQQ-------CQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
            QY       +          T QIGYN T+   + NVG S+++  G    WML
Sbjct  192  QYTNFPPQSEGFFQPMGVNPTLQIGYNQTNPH-DANVGASSLSMHGFASEWML  243



>emb|CAL36576.1| deficiens H49 homologue [Misopates orontium]
Length=247

 Score =   245 bits (625),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 132/235 (56%), Positives = 163/235 (69%), Gaps = 10/235 (4%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSS++ KT+ERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSNMLKTIERYQK  72

Query  182  CSYGALEANQTSKDSQ-SNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQV  358
             SYG+LE N  +KD + S+Y+EYLKLK+  E LQ  QRHLLG+DL  L + DLE LE+Q+
Sbjct  73   SSYGSLEVNHQAKDIEASSYKEYLKLKSKYESLQGYQRHLLGDDLGPLNMNDLEHLEHQL  132

Query  359  DTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNM  538
            +TSLK IRSTRT+ M+DQLS+L  KE+ +++ NKAL  KL E    +     W   G + 
Sbjct  133  ETSLKHIRSTRTQVMLDQLSDLQTKEKMMVDANKALERKLEEIYAANHIQQSWGGGGDHS  192

Query  539  Q-YGQHSSSQ--------QCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
              Y  H  +Q        +C +T QIG+N     +     T   N  G++PGWML
Sbjct  193  NAYNDHQHAQSQGFFQPLECNSTLQIGFNDPVASSQMTAPTDAQNMHGLVPGWML  247



>emb|CAA64741.1| DEFH49 [Antirrhinum majus]
Length=247

 Score =   245 bits (625),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 132/235 (56%), Positives = 163/235 (69%), Gaps = 10/235 (4%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSS++ KT+ERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSNMLKTIERYQK  72

Query  182  CSYGALEANQTSKDSQ-SNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQV  358
             SYG+LE N  +KD + S+Y+EYLKLK+  E LQ  QRHLLG+DL  L + DLE LE+Q+
Sbjct  73   SSYGSLEVNHQAKDIEASSYKEYLKLKSKYESLQGYQRHLLGDDLGPLNMNDLEHLEHQL  132

Query  359  DTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNM  538
            +TSLK IRSTRT+ M+DQLS+L  KE+ +++ NKAL  KL E    +     W   G + 
Sbjct  133  ETSLKHIRSTRTQVMLDQLSDLQTKEKMMVDANKALERKLEEIYAANHLQQSWGGGGDHS  192

Query  539  Q-YGQHSSSQ--------QCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
              Y  H  +Q        +C +T QIG+N     +     T   N  G++PGWML
Sbjct  193  NAYNDHQHAQSQGFFQPLECNSTLQIGFNDPVASSQMTAPTDAQNMHGLVPGWML  247



>gb|AAX15922.1| AGL2 [Acorus americanus]
Length=237

 Score =   244 bits (624),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 126/230 (55%), Positives = 168/230 (73%), Gaps = 12/230 (5%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            N INRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRG+L+EFCSSSS+ KTL+RY K
Sbjct  13   NNINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGRLFEFCSSSSMLKTLDRYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CS+ A E++  S++ QS+YQEYLKLKA VE LQ+SQR+LLGEDL  L  K+LEQLE+Q++
Sbjct  73   CSFHAAESSAPSRELQSSYQEYLKLKAKVEALQRSQRNLLGEDLGPLNSKELEQLESQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
             SLK +RST+T++M+DQL +L +KEQ L E NK+L+ KL E ++ +     W+  G N+ 
Sbjct  133  MSLKQVRSTKTQYMLDQLCDLKRKEQMLQEANKSLKRKLDEYNSENPLQLSWDNGGSNVP  192

Query  542  YGQHSSSQQCQNTAQIGYNPTSMQANNNVG------TSTMNGAGVLPGWM  673
            YG+  +       ++  + P S+  + ++G       +  N  G +PGWM
Sbjct  193  YGRQPTH------SEDFFQPLSVDPSLHIGYQVNAAATGQNVNGFIPGWM  236



>gb|AAY21913.2| putative MADS box protein [Musa acuminata]
Length=244

 Score =   245 bits (625),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 131/234 (56%), Positives = 163/234 (70%), Gaps = 13/234 (6%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FSNRGKLYEFCSSSS+ +TLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSSSSMLRTLERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            C+YGA E N  S+++QS+ QEYLKLKA V+ LQ+SQR+LLGEDL  L IK+LEQLE Q+D
Sbjct  73   CNYGAPETNIISRETQSSQQEYLKLKARVDGLQRSQRNLLGEDLGPLNIKELEQLERQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQN-LLEVNKALRIKLGESSNNDAFLTPWEPQGQNM  538
             SL+ IRSTRT++M+DQL +L +   N +  + K  +I+L ESS  D     W+P    +
Sbjct  133  ASLRQIRSTRTQYMLDQLGDLQRLGTNAMWSLIKPWKIRLEESSEADQQQL-WDPNTHAV  191

Query  539  QYGQHSSSQQ---------CQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWM  673
             YG+     Q         C+ T QIGY+P  M        +   G   +PGW+
Sbjct  192  AYGRQQPQPQGDGFFQFIDCEPTLQIGYHPDQMAIAAA--AAAAPGPSYMPGWL  243



>gb|AAA32732.1| transcription factor [Arabidopsis thaliana]
 gb|AAU81987.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU81989.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU81990.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU81991.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU81992.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU81993.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU81994.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU81995.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU81996.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU81997.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU81998.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU81999.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU82000.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU82001.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU82002.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU82004.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU82005.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU82006.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU82007.1| SEPALLATA1 [Arabidopsis thaliana]
Length=248

 Score =   245 bits (625),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 134/236 (57%), Positives = 165/236 (70%), Gaps = 11/236 (5%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSS++ KTL+RY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSNMLKTLDRYQK  72

Query  182  CSYGALEA-NQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQV  358
            CSYG++E  N+ +K+ +++Y+EYLKLK   E LQ+ QR+LLGEDL  L  K+LEQLE Q+
Sbjct  73   CSYGSIEVNNKPAKELENSYREYLKLKGRYENLQRQQRNLLGEDLGPLNSKELEQLERQL  132

Query  359  DTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSN-NDAFLTPWEPQGQN  535
            D SLK +RS +T++M+DQLS+L  KEQ LLE N+AL +KL +        +  WE   QN
Sbjct  133  DGSLKQVRSIKTQYMLDQLSDLQNKEQMLLETNRALAMKLDDMIGVRSHHMGGWEGGEQN  192

Query  536  MQYGQHSSSQQ-------CQNTAQIGY-NPT-SMQANNNVGTSTMNGAGVLPGWML  676
            + Y  H +  Q       C  T Q+GY NP  S Q           G G +PGWML
Sbjct  193  VTYAHHQAQSQGLYQPLECNPTLQMGYDNPVCSEQITATTQAQAQPGNGYIPGWML  248



>gb|AHW52539.1| SEPALLATA-like MADS-box protein 4 [Phalaenopsis equestris]
Length=246

 Score =   245 bits (625),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 135/234 (58%), Positives = 163/234 (70%), Gaps = 10/234 (4%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEV LI+FSNRG+L+EFCSSSS+ KT+ERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVGLIVFSNRGRLFEFCSSSSMMKTIERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSY   E    SK++Q+NYQEYLKLKA VE LQ+SQR+LLGEDL  L  K+LEQLE++++
Sbjct  73   CSYNTTETRIPSKETQNNYQEYLKLKAKVEYLQRSQRNLLGEDLALLTTKELEQLEHELE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPW--------  517
             SLK IRST+++ M+DQL +L +KEQ L E NKALR+KL E          W        
Sbjct  133  MSLKKIRSTKSQLMLDQLCDLKRKEQMLQEANKALRMKLQEDEPEMPLQLSWSGGRTAGN  192

Query  518  --EPQGQNMQYGQHSSSQQCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWM  673
               P G+  Q         C  T QIGYNP  ++   N G+S+ N  G LPGWM
Sbjct  193  ARSPCGRQPQSDVFFQPLPCDPTLQIGYNPICIEEQLNNGSSSHNINGFLPGWM  246



>ref|XP_009761698.1| PREDICTED: MADS-box protein CMB1-like [Nicotiana sylvestris]
Length=245

 Score =   244 bits (624),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 129/238 (54%), Positives = 167/238 (70%), Gaps = 18/238 (8%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS+RGKLYEFCS+SS+ +TLE+Y +
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFCSTSSMMQTLEKYQQ  72

Query  182  CSYGALEANQTSKD-SQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQV  358
            CSY +L+  Q++ D +Q+NY EYL+LKA VE+LQ+SQR+LLGEDL  L  ++LE LE+Q+
Sbjct  73   CSYASLDPMQSASDHTQNNYHEYLRLKARVELLQRSQRNLLGEDLGTLNSRELEHLEHQL  132

Query  359  DTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNM  538
            D+SLK IRS +T++M+DQL++L QKEQ L E NK LR KL ES+        W+  GQ M
Sbjct  133  DSSLKQIRSRKTQNMLDQLADLQQKEQMLAEANKQLRRKLEESAARVPLRLSWDNGGQTM  192

Query  539  QYGQHSSSQQCQNTAQIGYNPTSMQANNNVGTSTMNG------------AGVLPGWML  676
            Q+ +    Q      +  + P  + ++   G S M G             G +PGWML
Sbjct  193  QHNRQLPPQ-----TEGFFQPLGLNSSPQFGYSPMGGNEVNAAATANNMNGFIPGWML  245



>ref|XP_010250667.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Nelumbo 
nucifera]
Length=239

 Score =   244 bits (623),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 135/237 (57%), Positives = 165/237 (70%), Gaps = 24/237 (10%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSSS+ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMIKTLERYQK  72

Query  182  CSYGALEANQTSKDSQ--SNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQ  355
            C+YGA E   ++++S+  S  QEYLKLKA VE LQ+SQR+LLGEDL  L  K+LE LE Q
Sbjct  73   CNYGAPETTISTRESEELSCQQEYLKLKARVEALQRSQRNLLGEDLGPLSGKELESLERQ  132

Query  356  VDTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQN  535
            +D SLK IRSTRT++M+DQL++L ++EQ L E N+AL+ +  E S  +A    W+P    
Sbjct  133  LDMSLKQIRSTRTQYMLDQLADLQRREQMLSEANRALKRRFEEGSQANAH--QWDPNVHG  190

Query  536  MQYGQHSSSQQ---------CQNTAQIGYNPTSMQANNNVGTSTMNGAGV--LPGWM  673
              YG+H +  Q         C+ T QIGY P  +       T    G  V  +PGW+
Sbjct  191  --YGRHPAQTQGEGFFHPVECEPTLQIGYQPDQI-------TVAAPGPSVSYMPGWL  238



>ref|XP_008243814.1| PREDICTED: MADS-box protein CMB1-like isoform X2 [Prunus mume]
Length=247

 Score =   244 bits (624),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 136/240 (57%), Positives = 171/240 (71%), Gaps = 20/240 (8%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKIN+QVTFAKRRNGLLKKAYELS+LCDAEVALI+FS RGKLYEFCS SS+ KTLERY +
Sbjct  13   NKINQQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSTRGKLYEFCSGSSMEKTLERYQR  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSY ALEA+Q ++DSQS YQ+Y+ LKA VEVLQ +QR+ LGEDL  LG K+L+QLENQ+D
Sbjct  73   CSYSALEASQPAQDSQSRYQDYVNLKAKVEVLQLTQRNFLGEDLGHLGTKELQQLENQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPW----EPQG  529
             SL+ IRST+T+ M  Q+S+L +K   LLE N  LR KL E    DA +  +    E Q 
Sbjct  133  MSLRQIRSTKTQVMHGQISDLLRK--MLLEANNELRRKLEEC---DAAIERYSWTTEEQN  187

Query  530  QNMQYGQHSSS---------QQCQNTAQIGYNPTSMQANNNVGTSTMNGAG-VLPG-WML  676
            QN+    H  +          QC NT QIGYNP ++  ++ + +ST + +G + PG W+L
Sbjct  188  QNVPNSSHHQAAQFEGVLDHSQCNNTLQIGYNPAAVTDHHELQSSTQSHSGLIFPGTWVL  247



>emb|CBI27678.3| unnamed protein product [Vitis vinifera]
Length=242

 Score =   244 bits (623),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 133/235 (57%), Positives = 164/235 (70%), Gaps = 17/235 (7%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSSS+ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQK  72

Query  182  CSYGALEANQTSKDS--QSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQ  355
            C+YGA E N +++++   S+ QEYLKLKA  E LQ+SQR+LLGEDL  L  K+LE LE Q
Sbjct  73   CNYGAPETNVSTREALELSSQQEYLKLKARYEALQRSQRNLLGEDLGPLSTKELESLERQ  132

Query  356  VDTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQN  535
            +D SLK IRSTRT++M+DQL++L +KE  L E NK L+ +L E +  +     W P  Q+
Sbjct  133  LDVSLKQIRSTRTQYMLDQLTDLQRKEHMLNEANKTLKQRLLEGTQVNQL--QWNPNAQD  190

Query  536  MQYGQHSSSQQ---------CQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWM  673
            + YG+  +  Q         C+ T QIGY P  +      G S  N    +PGW+
Sbjct  191  VGYGRQQAQPQGDGFFHPLECEPTLQIGYQPDPITV-AAAGPSVNN---YMPGWL  241



>emb|CAN59955.1| hypothetical protein VITISV_006723 [Vitis vinifera]
Length=244

 Score =   244 bits (623),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 132/205 (64%), Positives = 157/205 (77%), Gaps = 8/205 (4%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS RGKLYEFCSSSS+ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCSSSSMLKTLERYQK  72

Query  182  CSYGALEANQTSKD-SQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQV  358
            CSYGA+E ++ SK+  QS+Y+EYLKLK+  E LQ++QR+LLGEDL  L  K+LEQLE Q+
Sbjct  73   CSYGAVEVSRPSKELEQSSYREYLKLKSKFEXLQRTQRNLLGEDLGPLNTKELEQLERQL  132

Query  359  DTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNM  538
            +TSLK +RST+T+ M+DQLS+L  KEQ L+E NKAL  KL E S  +     WE   Q+M
Sbjct  133  ETSLKQVRSTKTQFMLDQLSDLQNKEQVLVESNKALTRKLDEISVKNHLQLSWESGEQSM  192

Query  539  QYG-QHSSSQ------QCQNTAQIG  592
             YG Q + SQ      +C  T QIG
Sbjct  193  PYGHQQAQSQGFFQPLECNPTLQIG  217



>ref|XP_008801850.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X1 [Phoenix dactylifera]
Length=271

 Score =   245 bits (626),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 137/262 (52%), Positives = 166/262 (63%), Gaps = 42/262 (16%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSSS+ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            C+YGA E N  S+++QS+ QEYLKLKA VE LQ+SQR+LLGEDL  L  K+LEQLE Q+D
Sbjct  73   CNYGAPETNIVSRETQSSQQEYLKLKARVEALQRSQRNLLGEDLGPLSSKELEQLERQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQK-----------------------------EQNLLEV  454
             SLK IRSTRT++M+DQL++L ++                             EQ L E 
Sbjct  133  ASLKQIRSTRTQYMLDQLADLQRRVWLMQSNSFKKHLFFIPPFPSYYHCSFLQEQMLCEA  192

Query  455  NKALRIKLGESSNNDAFLTPWEPQGQNMQYGQHSSSQQ---------CQNTAQIGYNPTS  607
            NK+L+ +L E SN       W+P    + YG+     Q         C+ T  IGY+P  
Sbjct  193  NKSLKRRL-EESNQATQQQVWDPNAHAVGYGRQPPQPQGDGFYQPIECEPTLHIGYHPEQ  251

Query  608  MQANNNVGTSTMNGAGVLPGWM  673
            +      G S  N    +PGW+
Sbjct  252  ITIAAGPGPSVSN---YMPGWL  270



>ref|XP_009608617.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X3 
[Nicotiana tomentosiformis]
Length=241

 Score =   244 bits (623),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 134/234 (57%), Positives = 165/234 (71%), Gaps = 14/234 (6%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LC+AEVALI+FSNRGKLYEFCSS+++ KTL+RY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCEAEVALIVFSNRGKLYEFCSSNNMLKTLDRYQK  72

Query  182  CSYGALEANQTSKDSQSN-YQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQV  358
            CSYG LE N++ KD++ N Y+EYLKLKA  E LQ+ QRHLLGEDL  L I DL+ LE Q+
Sbjct  73   CSYGTLEVNRSIKDNEQNSYREYLKLKAKYESLQRYQRHLLGEDLGPLNIDDLDHLEVQL  132

Query  359  DTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNM  538
            D SLK IRSTRT+ M+DQL++L  KE+  LE N     KL E    +    PW    Q++
Sbjct  133  DNSLKHIRSTRTQLMLDQLTDLQSKEKLWLEAN-----KLEEIYAENNLQQPWGGGEQSI  187

Query  539  QYG-QHSSSQ------QCQNTAQIG-YNPTSMQANNNVGTSTMNGAGVLPGWML  676
             YG QH+ SQ       C +  QIG Y+P +  +     T+  N  G++PGWML
Sbjct  188  TYGQQHAQSQGFFQPLDCNSILQIGRYDPITTSSQITAVTNAQNVNGMVPGWML  241



>gb|AFO68778.1| agamous-like protein 2, partial [Gunnera manicata]
Length=227

 Score =   243 bits (621),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 130/228 (57%), Positives = 159/228 (70%), Gaps = 9/228 (4%)
 Frame = +2

Query  14   RQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHKCSYG  193
            RQVTF KRRNGLLKKAYELS+LCDAEVALI+FS RGKLYEFCSS S+ +TLERY KCSYG
Sbjct  1    RQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGKLYEFCSSPSMLRTLERYQKCSYG  60

Query  194  ALEANQTSKDS-QSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVDTSL  370
              E ++ +K++ QS+Y+EYLKLKA  E LQ+SQR+ LGEDL  L  K+LEQLE Q++T+L
Sbjct  61   TTEVSRPAKENEQSSYREYLKLKARFEALQRSQRNFLGEDLGPLNSKELEQLERQLETTL  120

Query  371  KSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQYG-  547
            K IRST+T+ ++DQLS+L  KE  L+E NKALR KL E    + F   WE   Q++ YG 
Sbjct  121  KQIRSTKTQFVLDQLSDLQSKEHMLIEANKALRTKLDEFGTENHFRPTWEGGEQSIPYGH  180

Query  548  QHSSSQ------QCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWM  673
            QH  S       +C  T QIGYN        N  T T N    +PGW+
Sbjct  181  QHVQSHGFYQPIECNPTLQIGYNHVGSD-EINASTHTQNVNSFIPGWL  227



>gb|AFO68784.1| floral-binding protein 9, partial [Clethra tomentosa]
Length=220

 Score =   243 bits (620),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 126/226 (56%), Positives = 165/226 (73%), Gaps = 11/226 (5%)
 Frame = +2

Query  14   RQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHKCSYG  193
            RQVT++KRRNGLLKKAYELS+LCDAEVALI+FSN GKLYEFCSSSS+ KTLE+Y +CSYG
Sbjct  1    RQVTYSKRRNGLLKKAYELSVLCDAEVALIMFSNHGKLYEFCSSSSMLKTLEKYQRCSYG  60

Query  194  ALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVDTSLK  373
            +LEA+Q   ++Q+ Y EY+KLKA V++LQQSQR+LLGEDL  L  K+LEQLE+Q+++SLK
Sbjct  61   SLEASQLVNETQNTYHEYMKLKARVDILQQSQRNLLGEDLEPLSTKELEQLEHQLESSLK  120

Query  374  SIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESS-----NNDAFLTPWEPQGQNM  538
             IRST+T+ M+DQLS+L ++EQ L+E NKAL+ KL  S+     +   F + + PQ    
Sbjct  121  QIRSTKTQAMLDQLSDLQRREQMLVESNKALKRKLEASTTEFLPSRRDFFSVFPPQSDGF  180

Query  539  QYGQHSSSQQCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
                     +  ++ QIGY+P S    N+ G    N  G +PGWML
Sbjct  181  -----YQPLRLNSSLQIGYDPMSTDEIND-GAHPQNVNGFIPGWML  220



>dbj|BAC80253.1| MADS-box transcription factor [Houttuynia cordata]
Length=243

 Score =   244 bits (622),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 130/236 (55%), Positives = 165/236 (70%), Gaps = 18/236 (8%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGL+KKA+ELS+LCDAEVALI+FS+RGKLYEFCSSS + KT+ERY K
Sbjct  13   NKINRQVTFAKRRNGLMKKAFELSVLCDAEVALIVFSSRGKLYEFCSSSGMMKTIERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            C+YGA EA  ++K+ QS+YQEY+KLKA VE LQ+SQR+LLGEDL  L  K+LEQLE Q+D
Sbjct  73   CNYGAPEATVSTKEIQSSYQEYMKLKARVESLQRSQRNLLGEDLGPLTGKELEQLERQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALR---IKLGESSNNDAFLTPWEPQGQ  532
             SLK IRSTRT+ M+DQLS+L ++EQ L E NKALR   ++L + S  +   + W+P   
Sbjct  133  MSLKQIRSTRTQCMLDQLSDLQRREQMLSEANKALRRRLLQLDDGSQTNPHHS-WDPNAH  191

Query  533  NMQYGQHSSSQQ---------CQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWM  673
             + Y +H    Q         C+ T  IGY P  +     +     NG   + GW+
Sbjct  192  GVGYSRHPGQPQGEVIFDPLDCEPTLHIGYQPDQI----TIAAPGPNG-NYMQGWL  242



>ref|XP_002311352.1| MADS-box protein 4 [Populus trichocarpa]
 gb|EEE88719.1| MADS-box protein 4 [Populus trichocarpa]
Length=242

 Score =   243 bits (621),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 132/233 (57%), Positives = 166/233 (71%), Gaps = 11/233 (5%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSN GKL+EFCSSS+++ T+E+Y +
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNSGKLFEFCSSSNMATTIEKYQR  72

Query  182  CSYGALEANQTSKDS-QSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQV  358
             SYGALE  Q+ K++ Q+NYQEYLKLK  V+VLQ+SQR+LLGEDL  LG  +L+QLENQ+
Sbjct  73   FSYGALEGGQSEKETQQNNYQEYLKLKTRVDVLQRSQRNLLGEDLGNLGTMELDQLENQL  132

Query  359  DTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNM  538
            D+SLK IRS + + ++D+LSEL +KE+ LLE N AL+ KL E+S   A    W+   Q +
Sbjct  133  DSSLKQIRSRKGQFVLDELSELQRKEELLLETNNALKRKLEETS--AAIRLSWKVGEQRV  190

Query  539  QYGQHS-------SSQQCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
             Y              Q  +T Q GYNP        V +S+ N  G +PGWML
Sbjct  191  PYSFQPVQPYDPIEPLQYNSTFQFGYNPAETD-QATVTSSSQNVNGFIPGWML  242



>ref|NP_001242365.1| uncharacterized protein LOC100797819 [Glycine max]
 gb|ACU17644.1| unknown [Glycine max]
Length=243

 Score =   243 bits (621),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 132/233 (57%), Positives = 166/233 (71%), Gaps = 10/233 (4%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEF S+SS+ KTLE+Y K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFSSTSSMMKTLEKYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
             SY ALE  +   D+Q NYQEYL+LKA VEVLQ+SQR+LLGE L Q+   +LEQLENQ++
Sbjct  73   YSYSALETTRPINDTQ-NYQEYLRLKARVEVLQRSQRNLLGEGLAQMNTNELEQLENQLE  131

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLT-PWEPQGQNM  538
             +L++IRST+T+ M+DQLS+LH +E  L+E N  LR KL E+ ++   ++   E  G ++
Sbjct  132  AALRNIRSTKTQFMLDQLSDLHHRETLLIETNNVLRSKLEETDHSQVQVSLALEAGGPSI  191

Query  539  QYGQHSSSQQ-------CQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
            QY       +          T QIGYN T    + NVG S+++  G   GWML
Sbjct  192  QYTNFPPQSEGFFEPVGVNPTLQIGYNQTG-PDDTNVGASSLSMHGFASGWML  243



>dbj|BAO74162.1| MADS-box transcription factor SEP1.2 [Torenia fournieri]
Length=252

 Score =   244 bits (622),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 136/240 (57%), Positives = 163/240 (68%), Gaps = 15/240 (6%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSS++ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSNMMKTLERYQK  72

Query  182  CSYGALEANQTSKD-SQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQV  358
            CSYG++E N  SKD  QS+Y+EYLKLK+  E LQ+ QR LLG++L  L I D+E LE+Q+
Sbjct  73   CSYGSVEVNNPSKDIEQSSYREYLKLKSKYESLQRYQRQLLGDELGNLNINDIEHLEHQL  132

Query  359  DTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGE--SSNNDAFLTPW--EPQ  526
            DTSLK IRSTRT+ M+DQLS+L  KE+ +++ NKAL  KL E  ++ N      W    Q
Sbjct  133  DTSLKLIRSTRTQVMLDQLSDLQAKEKMMMDANKALEGKLQEIYATTNHNIQQYWIAGEQ  192

Query  527  GQNMQYGQHSSSQ----------QCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
              N  YG H               C +T QIGYN           +   N  G++PGWML
Sbjct  193  HHNNSYGHHQQQHAHSQGFFQPLDCNSTLQIGYNDPVSSGQITAASDVNNVNGLVPGWML  252



>gb|AHC54178.1| sepallata-like MADS box transcription factor 3, partial [Orchidantha 
siamensis]
Length=168

 Score =   241 bits (614),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 141/162 (87%), Gaps = 0/162 (0%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSSS+ KTLERY K
Sbjct  6    NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQK  65

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            C+YGA E N  S+++QS+ QEYLKLKA VE LQ+SQR+LLGEDL  L IK+LEQLE Q+D
Sbjct  66   CNYGAPETNIISRETQSSQQEYLKLKARVEALQRSQRNLLGEDLGPLSIKELEQLERQLD  125

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGES  487
             SL+ IRSTRT++M+DQL++L ++EQ L E NKAL+ +L ES
Sbjct  126  ASLRQIRSTRTQYMLDQLADLQRREQMLCEANKALKRRLEES  167



>ref|XP_008341807.1| PREDICTED: developmental protein SEPALLATA 1 isoform X1 [Malus 
domestica]
Length=247

 Score =   243 bits (621),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 132/235 (56%), Positives = 164/235 (70%), Gaps = 10/235 (4%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTF KRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSSSI KTL+RY K
Sbjct  13   NKINRQVTFXKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSILKTLDRYQK  72

Query  182  CSYGALE-ANQTSKD-SQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQ  355
            CSYGA++  N+ +K+  QS+Y+EY+KLK   E LQ++QR+LLGEDL  L  K+LEQLE Q
Sbjct  73   CSYGAVDQVNRPAKELEQSSYREYMKLKGRYESLQRTQRNLLGEDLGPLNTKELEQLERQ  132

Query  356  VDTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQN  535
            ++ SLK +RST+T++M+DQLS+L  KEQ L+E N+ L +KL E S+ +     WE   Q 
Sbjct  133  LEGSLKQVRSTKTQYMLDQLSDLQNKEQLLIEANRDLTMKLDEISSRNQLRQSWEGGDQG  192

Query  536  MQYGQHSSSQQCQNTAQ-IGYNPTSMQANNNVGTSTMNGAG-------VLPGWML  676
            M Y       Q Q   Q +  NPT     + VG+  M+           +PGWML
Sbjct  193  MAYATQHHHAQSQGFFQPLDCNPTLQMGYSAVGSEQMSATTNAQQVNCFIPGWML  247



>ref|NP_001275579.1| MADS-box protein CMB1-like [Solanum lycopersicum]
 gb|AHB86542.1| MADS-box protein EBI [Solanum lycopersicum]
Length=250

 Score =   243 bits (620),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 132/239 (55%), Positives = 165/239 (69%), Gaps = 15/239 (6%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFS+RGKLYEF S+SS+  TLE+Y +
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSSRGKLYEFSSASSMMTTLEKYQQ  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSY +L+      D+Q NY EY++LKA VE+LQ+SQRH+LGEDL  L  K+LEQLE+Q+D
Sbjct  73   CSYASLDPMLPVSDTQMNYNEYVRLKARVELLQRSQRHILGEDLGTLNSKELEQLEHQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPW-EPQGQNM  538
             SLK +RS +T+ M+DQL++L +KEQ L E NK L+ KL ES+        W    GQ M
Sbjct  133  ASLKKVRSKKTQSMLDQLADLQEKEQMLEEANKQLKNKLEESAARIPLGLSWGNNGGQTM  192

Query  539  QYGQHSSSQQCQ----------NTAQIGYNPTSMQANN---NVGTSTMNGAGVLPGWML  676
            +Y +       Q          ++ Q GYNP +M AN+   N  T+  N  G +PGWML
Sbjct  193  EYNRLPPQTTAQPFFQPLRLNSSSPQFGYNP-NMGANDHEVNAATTAHNINGFIPGWML  250



>dbj|BAM34481.1| MADS-box transcription factor [Alstroemeria ligtu subsp. ligtu]
Length=247

 Score =   243 bits (620),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 138/238 (58%), Positives = 163/238 (68%), Gaps = 17/238 (7%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRR+GLLKKAYELS+LCDAEVALIIFS RG+L+EFCSSSS+ KTLERY K
Sbjct  13   NKINRQVTFAKRRSGLLKKAYELSVLCDAEVALIIFSTRGRLFEFCSSSSMLKTLERYKK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSY A EA   SK+++++YQEYLKLK+ VE LQ+SQR+LLGEDL QL  K+LEQLE Q++
Sbjct  73   CSYSASEAVAPSKETENSYQEYLKLKSRVEFLQRSQRNLLGEDLSQLSTKELEQLERQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKL-GESSNNDAFLTPWEPQG---  529
             SLK IRST+T+ M+DQL +L +KEQ L E NKALR KL GE + N A    WE  G   
Sbjct  133  MSLKQIRSTKTQLMLDQLCDLKRKEQMLQEANKALRRKLQGEDAGN-ALQLSWENAGCSE  191

Query  530  ----------QNMQYGQHSSSQQCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWM  673
                      Q  Q        QC +  QIGY P  +   NN G +  N  G    WM
Sbjct  192  PGAPSTSCDHQPAQSQGFFQPLQC-DPLQIGYQPICIDQLNN-GVNAQNVNGFFSAWM  247



>gb|ADD25191.1| SEP3, partial [Nelumbo nucifera]
Length=226

 Score =   242 bits (618),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 134/236 (57%), Positives = 164/236 (69%), Gaps = 24/236 (10%)
 Frame = +2

Query  5    KINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHKC  184
            KINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSSS+ KTLERY KC
Sbjct  1    KINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMIKTLERYQKC  60

Query  185  SYGALEANQTSKDSQ--SNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQV  358
            +YGA E   ++++S+  S  QEYLKLKA VE LQ+SQR+LLGEDL  L  K+LE LE Q+
Sbjct  61   NYGAPETTISTRESEELSCQQEYLKLKARVEALQRSQRNLLGEDLGPLSGKELESLERQL  120

Query  359  DTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNM  538
            D SLK IRSTRT++M+DQL++L ++EQ L E N+AL+ +  E S  +A    W+P     
Sbjct  121  DMSLKQIRSTRTQYMLDQLADLQRREQMLSEANRALKRRFEEGSQANAH--QWDPNVHG-  177

Query  539  QYGQHSSSQQ---------CQNTAQIGYNPTSMQANNNVGTSTMNGAGV--LPGWM  673
             YG+H +  Q         C+ T QIGY P  +       T    G  V  +PGW+
Sbjct  178  -YGRHPAQTQGEGFFHPVECEPTLQIGYQPDQI-------TVAAPGPSVSYMPGWL  225



>ref|XP_002873742.1| hypothetical protein ARALYDRAFT_909555 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AAU82008.1| SEPALLATA1 [Arabidopsis lyrata subsp. petraea]
 gb|EFH50001.1| hypothetical protein ARALYDRAFT_909555 [Arabidopsis lyrata subsp. 
lyrata]
Length=249

 Score =   243 bits (620),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 134/237 (57%), Positives = 165/237 (70%), Gaps = 12/237 (5%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSS++ KTL+RY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSNMLKTLDRYQK  72

Query  182  CSYGALEA-NQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQV  358
            CSYG++E  N+ +K+ +++Y+EYLKLK   E LQ+ QR+LLGEDL  L  K+LEQLE Q+
Sbjct  73   CSYGSIEVNNKPAKELENSYREYLKLKGRYENLQRQQRNLLGEDLGPLNSKELEQLERQL  132

Query  359  DTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGE--SSNNDAFLTPWEPQGQ  532
            D SLK +RS +T++M+DQLS+L  KEQ LLE N+AL +KL +     +      WE   Q
Sbjct  133  DGSLKQVRSIKTQYMLDQLSDLQNKEQMLLETNRALAMKLDDMIGVRSHHMGGGWEGGEQ  192

Query  533  NMQYGQHSSSQQ-------CQNTAQIGY-NPT-SMQANNNVGTSTMNGAGVLPGWML  676
            N+ Y  H +  Q       C  T Q+GY NP  S Q           G G +PGWML
Sbjct  193  NVTYAHHQAQSQGLYQPLECNPTLQMGYDNPVCSEQITATTQAQAQQGNGYIPGWML  249



>ref|NP_001268114.1| MADS-box protein 4 [Vitis vinifera]
 gb|AAM21344.1|AF373603_1 MADS-box protein 4 [Vitis vinifera]
Length=242

 Score =   243 bits (619),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 133/235 (57%), Positives = 163/235 (69%), Gaps = 17/235 (7%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSSS+ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQK  72

Query  182  CSYGALEANQTSKDS--QSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQ  355
            C+YGA E N +++++   S+ QEYLKLKA  E LQ SQR+LLGEDL  L  K+LE LE Q
Sbjct  73   CNYGAPETNVSTREALELSSQQEYLKLKARYEALQLSQRNLLGEDLGPLSTKELESLERQ  132

Query  356  VDTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQN  535
            +D SLK IRSTRT++M+DQL++L +KE  L E NK L+ +L E +  +     W P  Q+
Sbjct  133  LDVSLKQIRSTRTQYMLDQLTDLQRKEHMLNEANKTLKQRLLEGTQVNQL--QWNPNAQD  190

Query  536  MQYGQHSSSQQ---------CQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWM  673
            + YG+  +  Q         C+ T QIGY P  +      G S  N    +PGW+
Sbjct  191  VGYGRQQAQPQGDGFFHPLECEPTLQIGYQPDPITV-AAAGPSVNN---YMPGWL  241



>gb|AHM92082.1| MADS-box protein 6 [Erycina pusilla]
Length=240

 Score =   243 bits (619),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 133/228 (58%), Positives = 161/228 (71%), Gaps = 4/228 (2%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FS RG+L+EFCSSSS++KTLE+Y K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLFEFCSSSSMTKTLEKYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSY A E+   SKD+QS YQEYLKLK  VE LQ+S R+LLGEDLV+L  KDL+QLE Q++
Sbjct  73   CSYNASESMVPSKDTQSTYQEYLKLKGRVEFLQRSHRNLLGEDLVELSSKDLDQLELQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
             SLK IRST+T+ M+DQL +L +KEQ L E N+AL+ KL E          W  + Q  Q
Sbjct  133  MSLKQIRSTKTQLMLDQLCDLKRKEQMLHETNRALKKKLEEVGPETPLELSWPAERQQPQ  192

Query  542  YGQ-HSSSQQCQNTA-QIGYNPTSM-QANNNVGTSTM-NGAGVLPGWM  673
              +       C + + QIGY P    Q   N G+ST  N  G + GWM
Sbjct  193  SDELFFHPLPCVHPSLQIGYGPICTDQQQLNTGSSTAHNINGFISGWM  240



>gb|AAX53103.1| AGL2-like protein [Magnolia grandiflora]
Length=228

 Score =   242 bits (617),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 129/225 (57%), Positives = 160/225 (71%), Gaps = 13/225 (6%)
 Frame = +2

Query  32   KRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHKCSYGALEANQ  211
            KRRNGLLKKAYELS+LCDAEVALIIFS RGKLYEFCSS S+ +TLERY KCSY  LE + 
Sbjct  1    KRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCSSPSMLQTLERYQKCSYSTLEVSA  60

Query  212  TSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVDTSLKSIRSTR  391
             + ++QS+YQEYLKLKA VE+LQ++QR+LLGEDL  L  K+LEQLENQ++ SLK IRST+
Sbjct  61   PTNETQSSYQEYLKLKARVEILQRTQRNLLGEDLGPLSTKELEQLENQLEMSLKQIRSTK  120

Query  392  TKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNM-QYGQHSSSQQ  568
            T+ M+DQLS+L +KEQ L+E NKAL+ KL ES   +     W+   QNM  Y +  S+ +
Sbjct  121  TQFMLDQLSDLKRKEQMLVEANKALKRKLEESGRENLLQLSWDTGAQNMSSYNRQPSNYE  180

Query  569  -------CQNTAQIGYNPT---SMQANNNVGTSTMNGAGVLPGWM  673
                   CQ T Q+GY+P     M    N G +  N  G +PGWM
Sbjct  181  GFFQPLDCQPTLQMGYHPVYEDQMTVATNHGQN--NVHGFMPGWM  223



>ref|XP_011018962.1| PREDICTED: MADS-box protein CMB1-like [Populus euphratica]
Length=241

 Score =   242 bits (618),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 128/232 (55%), Positives = 169/232 (73%), Gaps = 10/232 (4%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSN GKL+EFCSSS+++ T+E+Y +
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNSGKLFEFCSSSNMAATIEKYQR  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
             SYGALE  Q+ K++Q+ YQEYL+LK  V+VLQ+SQR++LGEDL  LG  +L+QLE+Q+D
Sbjct  73   FSYGALEGGQSEKETQNKYQEYLQLKTRVDVLQRSQRNVLGEDLGNLGTMELDQLEDQLD  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
            +SLK IR+ + + ++D+LSEL +KE+ LLE N AL+ KL E++   A    W+   Q++ 
Sbjct  133  SSLKQIRNRKAQFILDELSELQRKEELLLETNNALKRKLEETTA--AIRLSWKVGEQHVP  190

Query  542  YG-----QHSSSQQCQ--NTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
            Y       + S +  Q  +T Q GYNP        V +ST N  G +PGWML
Sbjct  191  YSFQPVQPYDSVEPLQYNSTFQFGYNPAETD-QGTVTSSTQNVNGFIPGWML  241



>ref|XP_009757152.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X2 
[Nicotiana sylvestris]
Length=240

 Score =   242 bits (618),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 134/234 (57%), Positives = 165/234 (71%), Gaps = 15/234 (6%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LC+AEVALIIFSNRGKLYEFCSS+++ KTL+RY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCEAEVALIIFSNRGKLYEFCSSNNMLKTLDRYQK  72

Query  182  CSYGALEANQT--SKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQ  355
            CSYG LE N++    + QS+ +EYLKLKA  E LQ+ QRHLLGEDL  L I DL+ LE Q
Sbjct  73   CSYGTLEVNRSIIKDNEQSSCREYLKLKAKYESLQRYQRHLLGEDLGPLNIDDLDHLEVQ  132

Query  356  VDTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQN  535
            +DTSLK IRSTRT+ M+DQL++L  KE+  LE N     KL E    +    PW  + Q+
Sbjct  133  LDTSLKHIRSTRTQLMLDQLTDLQSKEKLWLEAN-----KLEEIYTENNLQQPWGGE-QS  186

Query  536  MQYG-QHSSSQ------QCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
            + Y  QH+ SQ       C +T QIGY+P +  +     T+  N  G++PGWML
Sbjct  187  VTYSQQHAQSQGFFQPLDCNSTLQIGYDPITTSSQITAVTNAQNVNGMVPGWML  240



>gb|AHC54147.1| sepallata-like MADS box transcription factor 3, partial [Costus 
spicatus]
 gb|AHC54187.1| sepallata-like MADS box transcription factor 3, partial [Strelitzia 
sp. RY-2013]
Length=167

 Score =   239 bits (611),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 119/163 (73%), Positives = 141/163 (87%), Gaps = 0/163 (0%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEF SSSS+ KTLERY K
Sbjct  5    NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFSSSSSMLKTLERYQK  64

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSYGA E N  S+++Q++ QEYLKLKA VE LQ+SQR+LLGEDL  L IK+LEQLE Q+D
Sbjct  65   CSYGAPETNTISRETQTSQQEYLKLKARVEALQRSQRNLLGEDLGPLSIKELEQLERQLD  124

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESS  490
             SL+ IRSTRT++M+DQL++L ++EQ L E NKAL+ +L ES+
Sbjct  125  VSLRQIRSTRTQYMLDQLTDLQRREQMLCEANKALKRRLDESA  167



>ref|XP_008811037.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X4 [Phoenix dactylifera]
Length=245

 Score =   242 bits (618),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 128/234 (55%), Positives = 164/234 (70%), Gaps = 11/234 (5%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTF+KRRNGLLKKAYELS+LCD EVA IIFSNRG+L+EFCS+SS+ +T+ERY K
Sbjct  13   NKINRQVTFSKRRNGLLKKAYELSVLCDVEVAAIIFSNRGRLFEFCSTSSMLETIERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSY A +A    K++Q++Y EYLKLKA VE LQ+SQR+LLGEDL  L +K+LEQL+NQ++
Sbjct  73   CSYNASDAIVPPKETQNSYHEYLKLKARVEFLQRSQRNLLGEDLGPLSVKELEQLDNQIE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQ---  532
             SLK IRST+T+ M+DQL ++ +KEQ L E NKALR KL E +NN   L+ W+       
Sbjct  133  ISLKHIRSTKTQLMLDQLCDVKRKEQMLQEANKALRRKLEEGTNNPLQLS-WQNGANDVG  191

Query  533  NMQYGQHSSSQQ-------CQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWM  673
            N   G+     Q       C+ + QIGY+P  +   N    +T N  G  P W+
Sbjct  192  NAPCGREPPQSQGFFQPLGCEPSLQIGYHPVCIDQLNTEAAATQNVNGYFPWWI  245



>gb|AFO68783.1| floral-binding protein 9, partial [Clethra tomentosa]
Length=217

 Score =   241 bits (615),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 124/226 (55%), Positives = 164/226 (73%), Gaps = 14/226 (6%)
 Frame = +2

Query  14   RQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHKCSYG  193
            RQVT++KRRNGLLKKAYELS+LCDAEVALI+FSN GKLYEFCSSSS+ KTLE+Y +CSYG
Sbjct  1    RQVTYSKRRNGLLKKAYELSVLCDAEVALIMFSNHGKLYEFCSSSSMQKTLEKYQRCSYG  60

Query  194  ALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVDTSLK  373
            +LEA+Q+  ++Q+ Y EY+KLK  V++LQQSQR+LLGEDL  L  K+L+QLE+Q+++SLK
Sbjct  61   SLEASQSVNETQNTYHEYMKLKTRVDILQQSQRNLLGEDLEPLSTKELDQLEHQLESSLK  120

Query  374  SIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESS-----NNDAFLTPWEPQGQNM  538
             IRST+T+ M+DQLS+L ++EQ L+E NKAL+ KL  S+     +   F + + PQ    
Sbjct  121  QIRSTKTQAMLDQLSDLQRREQMLVESNKALKRKLEASTTEFLPSRRDFFSLFPPQSDGF  180

Query  539  QYGQHSSSQQCQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWML  676
                     +  +T QIGY+P S     + G    N  G +PGWML
Sbjct  181  -----YQPLRLNSTLQIGYDPMS----TDDGAPPQNVNGFIPGWML  217



>gb|AAT46095.1| SEPALLATA-like protein [Akebia trifoliata]
Length=242

 Score =   242 bits (617),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 133/235 (57%), Positives = 165/235 (70%), Gaps = 17/235 (7%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSSSS+ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMFKTLERYQK  72

Query  182  CSYGALEANQTSKDS--QSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQ  355
            C++GA E N +++++   S++QEYLKLKA VE LQ+SQR+LLGEDL  L  K+LE LE Q
Sbjct  73   CNFGAPEPNVSTREALEHSSHQEYLKLKARVEGLQRSQRNLLGEDLGPLSGKELETLERQ  132

Query  356  VDTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQN  535
            +D SLK IRSTRT++M+DQLS+  ++EQ L E NKALR +L E S  +     W+P  Q 
Sbjct  133  LDMSLKQIRSTRTQYMLDQLSDYQRREQMLSEANKALRRRLEEGSQPNPH--QWDPNVQV  190

Query  536  MQYGQHSSSQQ---------CQNTAQIGYNPTSMQANNNVGTSTMNGAGVLPGWM  673
            + +G+  +  Q         C+ T  IGY P   Q        +MN    + GW+
Sbjct  191  VNFGRQQAPAQGEGFFQHIECEPTLHIGYQPD--QITVAAAGPSMN--NYMQGWI  241



>ref|XP_004490238.1| PREDICTED: MADS-box protein CMB1-like isoform X2 [Cicer arietinum]
Length=243

 Score =   242 bits (617),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 131/232 (56%), Positives = 164/232 (71%), Gaps = 10/232 (4%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCS SS++KTLERY +
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSGSSMAKTLERYQR  72

Query  182  CSYGALEANQTSK-DSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQV  358
             SYGALE +   + ++Q  YQEYLKLK+ VE LQQ+QR++LGE L  L I +LEQLE+Q+
Sbjct  73   SSYGALEVHHPQEHETQRRYQEYLKLKSKVETLQQTQRNILGEKLEHLDINELEQLESQL  132

Query  359  DTSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNM  538
            D+SL+ IR  +T+ M+DQLS+L +KE+ LLE N  LR KL E   N A    WE + QN 
Sbjct  133  DSSLRQIRWKKTQQMLDQLSDLQRKEEMLLETNNILRNKLEEI--NVALQPTWEAREQNA  190

Query  539  QYGQHSSSQQ------CQNTAQIGYNPTSM-QANNNVGTSTMNGAGVLPGWM  673
             Y  H    +        NT QIG N + + ++   +G+S  N +  + GWM
Sbjct  191  HYSCHPPQSEEYYEKAHSNTLQIGCNSSGLNESREVIGSSAHNVSDFMHGWM  242



>ref|XP_010678363.1| PREDICTED: MADS-box protein CMB1-like [Beta vulgaris subsp. vulgaris]
Length=252

 Score =   242 bits (617),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 137/240 (57%), Positives = 168/240 (70%), Gaps = 15/240 (6%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKL+EFCSSSS+ KT+E+Y +
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLFEFCSSSSMLKTIEKYQR  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            C+YGALEAN    D Q+ Y EYLKLK  VE LQQSQR+LLGEDL  L IK+LEQLE+Q++
Sbjct  73   CNYGALEANGVLNDPQATYHEYLKLKTRVEFLQQSQRNLLGEDLAPLAIKELEQLEHQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQG----  529
             SLK IRST+++HM+DQL+EL ++EQ L+E N+ L  KL ES+        WE       
Sbjct  133  LSLKQIRSTKSQHMLDQLAELRKREQALVENNRNLMKKLEESNPQFPQQLAWEGDNHQDQ  192

Query  530  QNMQYGQ----HSSSQQ-----CQNTA-QIGYNP-TSMQANNNVGTSTMNGAGVLPGWML  676
            QN+ + +    H SS+      C N   Q GY+   S Q +    +  +NG   + GWML
Sbjct  193  QNIPFSRIPTHHQSSEGFFQPLCGNPPLQNGYHHLDSTQISVATPSQNLNGYNNVHGWML  252



>dbj|BAC80254.1| MADS-box transcription factor [Houttuynia cordata]
Length=246

 Score =   241 bits (616),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 130/235 (55%), Positives = 159/235 (68%), Gaps = 11/235 (5%)
 Frame = +2

Query  2    NKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSSSSISKTLERYHK  181
            NKINRQVTFAKRRNGLLKKAYELS+LCDAEV LIIFSN GKLYEFCSSSS+ KTLERY K
Sbjct  13   NKINRQVTFAKRRNGLLKKAYELSVLCDAEVTLIIFSNSGKLYEFCSSSSMMKTLERYQK  72

Query  182  CSYGALEANQTSKDSQSNYQEYLKLKAGVEVLQQSQRHLLGEDLVQLGIKDLEQLENQVD  361
            CSY   EA   S++++ +YQEYLKLK  VE LQ+ QR+LLGEDL  L  K+LEQLENQ++
Sbjct  73   CSYSMPEATGPSRETEKSYQEYLKLKGKVEHLQRIQRNLLGEDLGPLSSKELEQLENQLE  132

Query  362  TSLKSIRSTRTKHMIDQLSELHQKEQNLLEVNKALRIKLGESSNNDAFLTPWEPQGQNMQ  541
             SL+ IRST+T+ ++DQLS+L +KEQ LLE  K L  KL E    +     W+  GQ+  
Sbjct  133  QSLRQIRSTKTQSLLDQLSDLRRKEQQLLESKKILNKKLAEHGPENPLQLSWQSCGQSNP  192

Query  542  YGQHSSSQQ-------CQNTAQIGYNPTSMQANNNVGTSTM---NGAGVLPGWML  676
            Y    +  +       C  T QIGY P+  Q       +T    N  G +PGW++
Sbjct  193  YSSQPAHSEAFFQPLDCNPTLQIGY-PSVGQEQIMAAPATAAPQNANGFIPGWLV  246



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2875161397914