BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18072_g2_i2 len=1014 path=[1995:0-280 1294:281-304 1318:305-506
1520:507-1013]

Length=1014
                                                                      Score     E

gb|AAS55867.2|  aquaporin-like protein                                  518   0.0      Ipomoea nil [qian niu]
gb|AAL49749.1|AF452011_1  aquaporin-like protein                        489   5e-171   Petunia x hybrida [garden petunia]
ref|XP_009759265.1|  PREDICTED: probable aquaporin PIP1-2               488   1e-170   
gb|AAT74898.1|  plasma membrane intrinsic protein PIP1-1                488   2e-170   Fraxinus excelsior
gb|ABB13429.1|  plasma membrane intrinsic protein                       487   3e-170   Olea europaea
ref|XP_011084932.1|  PREDICTED: probable aquaporin PIP1-2               484   4e-169   
dbj|BAA20074.1|  water channel protein                                  484   5e-169   Nicotiana excelsior
ref|XP_011076722.1|  PREDICTED: probable aquaporin PIP1-5               484   5e-169   
ref|XP_006362987.1|  PREDICTED: probable aquaporin PIP1-2-like          483   9e-169   
gb|AFJ44204.1|  plasma membrane intrinsic protein 1                     483   9e-169   
ref|XP_009762763.1|  PREDICTED: probable aquaporin PIP1-2               482   3e-168   
ref|XP_011076723.1|  PREDICTED: probable aquaporin PIP1-5               482   3e-168   
ref|XP_009631880.1|  PREDICTED: probable aquaporin PIP1-2               482   3e-168   
ref|XP_009400253.1|  PREDICTED: probable aquaporin PIP1-2               481   5e-168   
ref|XP_009380931.1|  PREDICTED: aquaporin PIP1-1                        481   6e-168   
gb|ACF84511.1|  unknown                                                 481   8e-168   Zea mays [maize]
ref|XP_002454508.1|  hypothetical protein SORBIDRAFT_04g032430          481   1e-167   Sorghum bicolor [broomcorn]
ref|XP_011076721.1|  PREDICTED: probable aquaporin PIP1-5               481   1e-167   
ref|NP_001104934.1|  aquaporin PIP1-2                                   481   1e-167   Zea mays [maize]
ref|XP_010095072.1|  Aquaporin PIP1-1                                   480   2e-167   
gb|ACL52629.1|  unknown                                                 480   2e-167   Zea mays [maize]
gb|ACC59097.1|  aquaporin                                               479   4e-167   Saccharum officinarum [noble cane]
dbj|BAF44223.1|  aquaporin                                              479   1e-166   Iris x hollandica [Dutch iris]
ref|XP_009386206.1|  PREDICTED: probable aquaporin PIP1-2 isoform X1    478   1e-166   
gb|EYU19988.1|  hypothetical protein MIMGU_mgv1a011277mg                478   2e-166   
ref|NP_001047672.1|  Os02g0666200                                       477   4e-166   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011092531.1|  PREDICTED: probable aquaporin PIP1-5 isoform X1    477   4e-166   
gb|ABG57184.1|  aquaporin                                               477   5e-166   Tamarix sp. ZDY-001908
gb|AEO79975.1|  plasma intrinsic protein 1                              476   6e-166   
ref|XP_009420459.1|  PREDICTED: probable aquaporin PIP1-2               476   7e-166   
gb|EYU41266.1|  hypothetical protein MIMGU_mgv1a011292mg                476   7e-166   
gb|AFM37319.1|  aquaporin                                               476   9e-166   
ref|XP_006647654.1|  PREDICTED: aquaporin PIP1-1-like isoform X2        476   1e-165   
ref|XP_008787474.1|  PREDICTED: probable aquaporin PIP1-2               476   1e-165   
ref|XP_004976483.1|  PREDICTED: aquaporin PIP1-1-like                   475   2e-165   
ref|XP_009382780.1|  PREDICTED: probable aquaporin PIP1-2               475   2e-165   
emb|CAH59432.1|  aquaporin 2                                            475   2e-165   Plantago major [cart-track plant]
gb|AGT36590.1|  aquaporin                                               475   2e-165   
ref|XP_009386050.1|  PREDICTED: probable aquaporin PIP1-2               474   3e-165   
ref|NP_001289851.1|  probable aquaporin PIP1-2                          474   4e-165   
gb|ACV60508.1|  aquaporin                                               474   4e-165   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002446929.1|  hypothetical protein SORBIDRAFT_06g025150          474   5e-165   Sorghum bicolor [broomcorn]
gb|AAO86706.1|  plasma membrane intrinsic protein                       474   5e-165   Zea mays [maize]
ref|XP_004953388.1|  PREDICTED: aquaporin PIP1-2-like                   474   6e-165   
sp|Q7XSQ9.3|PIP12_ORYSJ  RecName: Full=Probable aquaporin PIP1-2;...    474   7e-165   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010935853.1|  PREDICTED: probable aquaporin PIP1-2               474   7e-165   
dbj|BAA23746.2|  HvPIP1;5                                               473   1e-164   Hordeum vulgare [barley]
ref|XP_010940492.1|  PREDICTED: probable aquaporin PIP1-2               473   2e-164   
ref|XP_004954451.1|  PREDICTED: aquaporin PIP1-5-like                   472   3e-164   
gb|AFD32162.1|  plasma membrane intrinsic protein                       472   3e-164   
ref|XP_009386408.1|  PREDICTED: probable aquaporin PIP1-2               472   4e-164   
gb|AFM37320.1|  aquaporin                                               471   5e-164   
gb|AIP86906.1|  aquaporin                                               471   7e-164   
gb|AAF71817.1|  putative aquaporin PIP1-1                               471   8e-164   Vitis cinerea var. helleri x Vitis rupestris
ref|NP_001267918.1|  aquaporin-like                                     471   8e-164   
gb|ABH09322.1|  putative aquaporin                                      471   9e-164   Vitis vinifera
dbj|BAA24016.1|  water channel protein                                  471   1e-163   Oryza sativa Japonica Group [Japonica rice]
gb|AFM37318.1|  aquaporin                                               471   1e-163   
emb|CAA04652.1|  major intrinsic protein PIPa2                          470   2e-163   Craterostigma plantagineum
gb|AAZ91447.1|  PIP1 aquaporin                                          469   6e-163   Xerophyta humilis
gb|AFH36340.1|  aquaporin PIP1;2                                        468   8e-163   
ref|XP_006648149.1|  PREDICTED: aquaporin PIP 1-3-like                  468   8e-163   
ref|NP_001105131.1|  aquaporin PIP1-5                                   468   9e-163   Zea mays [maize]
gb|AFV92901.1|  putative PIP-type aquaporin                             468   1e-162   
gb|ACZ51371.1|  plasma membrane intrinsic protein                       468   1e-162   
ref|XP_010262799.1|  PREDICTED: probable aquaporin PIP1-2               468   1e-162   
gb|ABW34453.1|  aquaporin 1.1                                           468   1e-162   Triticum turgidum [cone wheat]
gb|ABJ98538.1|  PIP1 protein                                            468   1e-162   Stipa tianschanica var. gobica
gb|ABJ98535.1|  PIP1 protein                                            468   1e-162   Stipa baicalensis
ref|XP_009763188.1|  PREDICTED: aquaporin PIP1-2                        468   2e-162   
gb|AEO13899.1|  aquaporin 8                                             468   2e-162   
dbj|BAG68659.1|  plasma membrane intrinsic protein                      468   2e-162   Tulipa gesneriana
gb|AEH76327.1|  plasma membrane intrinsic protein 1                     468   2e-162   
gb|AAB86380.1|  aquaporin-like transmembrane channel protein            468   2e-162   Medicago sativa [alfalfa]
ref|XP_003600863.1|  Aquaporin protein PIP11                            468   2e-162   
gb|AFH36339.1|  aquaporin PIP1;1                                        468   2e-162   
gb|ACJ84222.1|  unknown                                                 468   2e-162   Medicago truncatula
ref|XP_006429323.1|  hypothetical protein CICLE_v10012384mg             467   2e-162   
gb|KDP44816.1|  hypothetical protein JCGZ_01316                         467   3e-162   
gb|AFK38136.1|  unknown                                                 467   3e-162   
gb|KDP25424.1|  hypothetical protein JCGZ_20580                         466   4e-162   
ref|XP_006439529.1|  hypothetical protein CICLE_v10021502mg             466   5e-162   
gb|ABJ98541.1|  PIP1 protein                                            466   5e-162   Stipa tianschanica var. klemenzii
ref|XP_010523742.1|  PREDICTED: aquaporin PIP1-1                        466   6e-162   
ref|XP_006476548.1|  PREDICTED: probable aquaporin PIP1-2-like is...    466   6e-162   
ref|XP_009383904.1|  PREDICTED: probable aquaporin PIP1-2               466   9e-162   
ref|XP_002509815.1|  Aquaporin PIP1.3, putative                         466   1e-161   Ricinus communis
emb|CAA54233.1|  transmembrane protein                                  465   1e-161   Hordeum vulgare [barley]
dbj|BAF41978.1|  aquaporin                                              465   1e-161   Hordeum vulgare [barley]
gb|EMS49467.1|  Aquaporin PIP1-2                                        473   1e-161   
gb|ABJ98540.1|  PIP1 protein                                            465   1e-161   Stipa breviflora
gb|KHG25052.1|  putative aquaporin PIP1-2                               465   2e-161   
gb|ACV66985.1|  plasma membrane aquaporin 1                             465   2e-161   Hevea brasiliensis [jebe]
emb|CDY15165.1|  BnaC05g00440D                                          466   2e-161   
ref|NP_001105022.1|  aquaporin PIP1-3/PIP1-4                            465   3e-161   Zea mays [maize]
ref|XP_010544738.1|  PREDICTED: aquaporin PIP1-1-like                   464   3e-161   
ref|XP_003616586.1|  Aquaporin PIP11                                    464   4e-161   
ref|XP_010089092.1|  putative aquaporin PIP1-4                          464   5e-161   
ref|XP_007040270.1|  Plasma membrane intrinsic protein 1,4 isoform 3    464   5e-161   
ref|XP_009134562.1|  PREDICTED: probable aquaporin PIP1-4               464   5e-161   
gb|ABD63904.1|  aquaporin 1                                             464   6e-161   Gossypium hirsutum [American cotton]
gb|KHG01288.1|  putative aquaporin PIP-type 7a                          464   6e-161   
ref|XP_002312147.1|  plasma membrane intrinsic protein 1-1              464   6e-161   Populus trichocarpa [western balsam poplar]
ref|XP_002315171.1|  hypothetical protein POPTR_0010s19930g             464   7e-161   Populus trichocarpa [western balsam poplar]
gb|AAB61378.1|  aquaporin                                               463   7e-161   Brassica rapa
ref|XP_006396241.1|  hypothetical protein EUTSA_v10028860mg             463   7e-161   
gb|AFQ98315.1|  MIP2                                                    463   7e-161   
gb|ACA50530.1|  putative aquaporin                                      463   7e-161   Brassica napus [oilseed rape]
emb|CDY51161.1|  BnaA09g51960D                                          463   7e-161   
gb|ABO71659.2|  trans-membrane water channel protein                    463   8e-161   Brassica juncea [brown mustard]
emb|CDX91911.1|  BnaC03g32130D                                          463   9e-161   
ref|XP_009630280.1|  PREDICTED: probable aquaporin PIP-type pTOM75      463   1e-160   
ref|XP_009629839.1|  PREDICTED: probable aquaporin PIP1-5 isoform X1    463   1e-160   
ref|XP_010506589.1|  PREDICTED: aquaporin PIP1-2                        463   1e-160   
emb|CDY48920.1|  BnaA09g39170D                                          463   1e-160   
gb|AAV41024.1|  plasma membrane intrinsic protein                       463   1e-160   Glycyrrhiza uralensis [Chinese licorice]
dbj|BAA20076.1|  water channel protein                                  463   1e-160   Nicotiana excelsior
gb|ACB56912.1|  aquaporin                                               463   1e-160   Ananas comosus
emb|CDX71738.1|  BnaC08g31360D                                          463   1e-160   
ref|XP_003570439.1|  PREDICTED: aquaporin PIP1-5                        463   1e-160   
ref|XP_010508083.1|  PREDICTED: aquaporin PIP1-2-like isoform X1        463   1e-160   
tpg|DAA33858.1|  TPA: aquaporin PIP1;4                                  463   1e-160   
ref|NP_567178.1|  plasma membrane intrinsic protein 1;4                 463   1e-160   Arabidopsis thaliana [mouse-ear cress]
dbj|BAO18622.1|  plasmamembrane intrinsic protein 1;2                   463   1e-160   
gb|ACL14797.1|  plasma membrane intrinsic protein 1                     463   1e-160   Populus alba x Populus glandulosa
ref|XP_007040268.1|  Plasma membrane intrinsic protein 1,4 isoform 1    462   1e-160   
gb|ADE34282.1|  aquaporin PIP1;13                                       462   1e-160   
ref|XP_002872953.1|  hypothetical protein ARALYDRAFT_912203             462   1e-160   
ref|XP_009118823.1|  PREDICTED: aquaporin PIP1-3                        462   2e-160   
ref|XP_011022675.1|  PREDICTED: aquaporin PIP1-2                        462   2e-160   
gb|ADE34281.1|  aquaporin PIP1;12                                       462   2e-160   
gb|ACR56612.1|  plasma intrinsic protein 1;3                            462   2e-160   Juglans regia
ref|XP_008437293.1|  PREDICTED: aquaporin PIP1-2                        462   2e-160   
gb|ACU87553.1|  PIP protein                                             462   2e-160   
ref|NP_001234139.1|  probable aquaporin PIP-type pTOM75                 462   2e-160   
ref|XP_009793682.1|  PREDICTED: probable aquaporin PIP-type pTOM75      462   2e-160   
ref|NP_001234413.1|  Aqp2 protein                                       462   2e-160   
emb|CDX95670.1|  BnaC03g25510D                                          462   2e-160   
ref|XP_010067506.1|  PREDICTED: probable aquaporin PIP1-2               462   2e-160   
dbj|BAD90696.1|  plasma membrane intrinsic protein 1;1                  462   2e-160   Mimosa pudica [sensitive-plant]
ref|XP_009411509.1|  PREDICTED: aquaporin PIP1-1-like                   462   2e-160   
gb|AAV80228.1|  aquaporin 1                                             462   2e-160   Aegiceras corniculatum
gb|EMS53768.1|  Aquaporin PIP1-5                                        462   2e-160   
gb|AFK41734.1|  unknown                                                 462   2e-160   
dbj|BAA92258.1|  plasma membrane aquaporin 1b                           462   3e-160   Raphanus sativus
emb|CAH60719.1|  putative plasma membrane intrinsic protein             462   3e-160   Populus tremula x Populus tremuloides
dbj|BAA20075.1|  water channel protein                                  462   3e-160   Nicotiana excelsior
gb|AFH36341.1|  aquaporin PIP1;3                                        462   3e-160   
ref|XP_011047429.1|  PREDICTED: probable aquaporin PIP1-4               462   3e-160   
ref|XP_009779003.1|  PREDICTED: probable aquaporin PIP-type pTOM75      462   3e-160   
ref|XP_008778916.1|  PREDICTED: probable aquaporin PIP1-2 isoform X1    462   3e-160   
dbj|BAI94500.1|  plasma membrane intrinsic protein                      462   3e-160   
gb|EYU32131.1|  hypothetical protein MIMGU_mgv1a011344mg                462   4e-160   
gb|ABJ97677.1|  major intrinsic protein                                 462   4e-160   Solanum tuberosum [potatoes]
ref|XP_009609568.1|  PREDICTED: probable aquaporin PIP-type pTOM75      461   4e-160   
emb|CDY07221.1|  BnaCnng02360D                                          461   4e-160   
ref|XP_003611079.1|  Aquaporin                                          461   5e-160   
gb|AGD98710.1|  aquaporin protein 7                                     461   5e-160   
ref|XP_007051783.1|  Plasma membrane intrinsic protein 1B               461   5e-160   
gb|AAT76618.1|  aquaporin                                               461   6e-160   Vicia faba [broad bean]
ref|XP_009600058.1|  PREDICTED: probable aquaporin PIP-type pTOM75      461   6e-160   
gb|AAL33585.1|AF440271_1  aquaporin                                     461   6e-160   Nicotiana tabacum [American tobacco]
ref|NP_001241050.1|  uncharacterized protein LOC100791447               461   7e-160   
ref|XP_002889360.1|  hypothetical protein ARALYDRAFT_470115             461   7e-160   
ref|XP_010109640.1|  hypothetical protein L484_015595                   466   8e-160   
gb|ABC01892.1|  major intrinsic protein 1-like protein                  461   8e-160   Solanum tuberosum [potatoes]
ref|XP_011035995.1|  PREDICTED: probable aquaporin PIP1-2               461   8e-160   
gb|AFC92657.1|  aquaporin PIP1;3                                        461   8e-160   
gb|AHI54567.1|  aquaporin protein 7                                     461   9e-160   
emb|CAA64896.1|  transmembrane channel protein                          461   1e-159   Brassica oleracea
ref|XP_006848145.1|  hypothetical protein AMTR_s00029p00227660          461   1e-159   
ref|NP_001048566.1|  Os02g0823100                                       461   1e-159   Oryza sativa Japonica Group [Japonica rice]
gb|ACU00100.1|  plasma membrane intrinsic protein PIP1.3                461   1e-159   Populus trichocarpa x Populus deltoides
ref|XP_009116806.1|  PREDICTED: aquaporin PIP1-1 isoform X1             460   1e-159   
gb|AGG39695.1|  aquaporin protein AQU17                                 460   1e-159   
gb|AGQ21873.1|  putative PIP-type aquaporin                             460   1e-159   
gb|AGQ21874.1|  putative PIP-type aquaporin                             460   1e-159   
ref|XP_011042268.1|  PREDICTED: probable aquaporin PIP1-2               460   1e-159   
ref|XP_010053244.1|  PREDICTED: aquaporin PIP1-3                        460   1e-159   
ref|XP_006352272.1|  PREDICTED: probable aquaporin PIP-type pTOM7...    460   2e-159   
dbj|BAG68660.1|  plasma membrane intrinsic protein                      460   2e-159   Tulipa gesneriana
gb|ABI96812.1|  plasma membrane intrinsic protein                       460   2e-159   Triticum aestivum [Canadian hard winter wheat]
gb|KHG19073.1|  Aquaporin PIP1-3 -like protein                          460   2e-159   
ref|NP_001274291.1|  probable aquaporin PIP-type pTOM75-like            460   2e-159   
gb|EAY88074.1|  hypothetical protein OsI_09504                          460   2e-159   Oryza sativa Indica Group [Indian rice]
ref|XP_007009059.1|  Plasma membrane intrinsic protein 1,4              460   2e-159   
gb|KFK30621.1|  hypothetical protein AALP_AA6G005800                    460   2e-159   
ref|XP_006827580.1|  hypothetical protein AMTR_s00009p00231200          460   2e-159   
ref|NP_001275388.1|  major intrinsic protein 1-like protein             460   2e-159   
ref|NP_001274378.1|  probable aquaporin PIP1-4-like                     460   2e-159   
emb|CDX90046.1|  BnaA10g00360D                                          460   2e-159   
ref|XP_008232887.1|  PREDICTED: aquaporin PIP1-2-like                   460   2e-159   
ref|XP_011072833.1|  PREDICTED: probable aquaporin PIP-type pTOM75      460   2e-159   
gb|AAL49748.1|AF452010_1  channel-like protein                          459   2e-159   Petunia x hybrida [garden petunia]
ref|XP_002453072.1|  hypothetical protein SORBIDRAFT_04g037800          460   2e-159   Sorghum bicolor [broomcorn]
gb|AFU61115.1|  water channel protein PIP                               459   2e-159   
gb|AFD61600.1|  aquaporin PIP1                                          459   3e-159   
ref|XP_009780083.1|  PREDICTED: probable aquaporin PIP-type pTOM75      459   3e-159   
tpg|DAA33861.1|  TPA: aquaporin PIP1;7                                  459   3e-159   
gb|KHG18900.1|  putative aquaporin PIP1-4 -like protein                 459   3e-159   
ref|XP_007218332.1|  hypothetical protein PRUPE_ppa008510mg             461   3e-159   
gb|KFK37381.1|  hypothetical protein AALP_AA4G249600                    459   3e-159   
gb|AEN95117.1|  aquaporin PIP1                                          460   3e-159   
dbj|BAA32777.1|  plasma membrane aquaporin (PAQ1)                       459   3e-159   Raphanus sativus
gb|ADT91650.1|  putative major intrinsic protein                        459   3e-159   
ref|XP_002526867.1|  Aquaporin PIP1.3, putative                         459   3e-159   Ricinus communis
ref|XP_010480063.1|  PREDICTED: aquaporin PIP1-3                        459   3e-159   
gb|AAB09747.1|  mipA                                                    459   4e-159   Mesembryanthemum crystallinum
gb|AHX99531.1|  aquaporin PIP1                                          459   4e-159   
gb|AGD98706.1|  aquaporin protein 3                                     459   4e-159   
gb|ABR68794.1|  aquaporin PIP1-2                                        459   4e-159   Gossypium hirsutum [American cotton]
ref|XP_010543744.1|  PREDICTED: probable aquaporin PIP1-4               459   5e-159   
gb|ACF39901.1|  aquaporin                                               459   5e-159   Camellia oleifera [abura-tsubaki]
ref|XP_004143901.1|  PREDICTED: probable aquaporin PIP1-2-like          459   6e-159   
gb|EYU41267.1|  hypothetical protein MIMGU_mgv1a011292mg                457   6e-159   
ref|XP_006339582.1|  PREDICTED: probable aquaporin PIP1-5-like is...    458   6e-159   
ref|NP_001267949.1|  aquaporin PIP1;2                                   458   7e-159   
ref|XP_006413559.1|  hypothetical protein EUTSA_v10025910mg             458   7e-159   
ref|XP_004503235.1|  PREDICTED: probable aquaporin PIP-type 7a-like     459   7e-159   
ref|XP_002303596.1|  plasma membrane aquaporin family protein           458   7e-159   Populus trichocarpa [western balsam poplar]
gb|AAG23179.1|AF299050_1  aquaporin PIP1b1                              458   8e-159   Brassica oleracea
gb|AEA40491.1|  aquaporin PIP1-3                                        458   8e-159   
ref|XP_009119712.1|  PREDICTED: aquaporin PIP1-3                        458   9e-159   
emb|CAH60718.1|  putative plasma membrane intrinsic protein             458   1e-158   Populus tremula x Populus tremuloides
ref|XP_006294736.1|  hypothetical protein CARUB_v10023782mg             458   1e-158   
ref|XP_002526866.1|  Aquaporin PIP1.3, putative                         458   1e-158   Ricinus communis
ref|XP_003552231.1|  PREDICTED: probable aquaporin PIP1-2               458   1e-158   
ref|NP_182120.1|  aquaporin PIP1-2                                      457   1e-158   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009138772.1|  PREDICTED: aquaporin PIP1-1                        457   1e-158   
ref|XP_006288376.1|  hypothetical protein CARUB_v10001627mg             457   1e-158   
gb|AGG39696.1|  aquaporin protein AQU18                                 457   1e-158   
ref|XP_010556545.1|  PREDICTED: aquaporin PIP1-3-like                   457   1e-158   
gb|AAM61041.1|  aquaporin (plasma membrane intrinsic protein 1B)        457   2e-158   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011080941.1|  PREDICTED: probable aquaporin PIP-type pTOM75      457   2e-158   
ref|XP_006284249.1|  hypothetical protein CARUB_v10005414mg             457   2e-158   
ref|XP_006435692.1|  hypothetical protein CICLE_v10032298mg             457   2e-158   
emb|CAA04750.1|  aquaporin 1                                            457   2e-158   Nicotiana tabacum [American tobacco]
ref|XP_010456290.1|  PREDICTED: probable aquaporin PIP1-4               457   2e-158   
gb|ADN94473.1|  aquaporin                                               457   2e-158   
gb|AFB83065.1|  plasma intrinsic protein PIP1.1                         457   3e-158   
gb|ABB16979.1|  major intrinsic protein 1-like protein                  457   3e-158   Solanum tuberosum [potatoes]
gb|AHG32322.1|  PIP1-2                                                  457   3e-158   
gb|AIA83103.1|  putative aquaporin PIP1                                 457   3e-158   
gb|AIA83105.1|  putative aquaporin PIP1                                 457   3e-158   
ref|XP_008463222.1|  PREDICTED: probable aquaporin PIP1-4               457   3e-158   
gb|AAG23180.1|AF299051_1  aquaporin PIP1b2                              457   3e-158   Brassica oleracea
gb|AAF80556.1|AF188843_1  plasma membrane aquaporin                     457   3e-158   Vitis vinifera
ref|XP_010448716.1|  PREDICTED: probable aquaporin PIP1-5               457   3e-158   
ref|XP_002531349.1|  Aquaporin PIP1.1, putative                         457   3e-158   Ricinus communis
ref|XP_004490962.1|  PREDICTED: probable aquaporin PIP-type 7a-li...    457   4e-158   
emb|CAA04653.1|  major intrinsic protein PIPB                           457   4e-158   Craterostigma plantagineum
ref|XP_002880210.1|  hypothetical protein ARALYDRAFT_483737             456   4e-158   
ref|XP_006647653.1|  PREDICTED: aquaporin PIP1-1-like isoform X1        457   4e-158   
gb|AEA40489.1|  aquaporin PIP1-1                                        456   4e-158   
ref|XP_009386207.1|  PREDICTED: probable aquaporin PIP1-2 isoform X2    458   4e-158   
gb|ABN14348.1|  aquaporin PIP1;2                                        456   4e-158   Vitis vinifera
emb|CAA64895.1|  transmembrane channel protein                          456   4e-158   Brassica oleracea
gb|AAF71818.1|AF141898_1  putative aquaporin PIP1-2                     456   4e-158   Vitis cinerea var. helleri x Vitis rupestris
gb|EMS50328.1|  Aquaporin PIP1-5                                        456   4e-158   
ref|XP_010439184.1|  PREDICTED: probable aquaporin PIP1-5               456   4e-158   
dbj|BAF33067.1|  aquaporin                                              456   4e-158   Hordeum vulgare [barley]
gb|ABK96216.1|  unknown                                                 456   5e-158   Populus trichocarpa x Populus deltoides
sp|P25794.2|PIP2_PEA  RecName: Full=Probable aquaporin PIP-type 7...    456   5e-158   Pisum sativum [garden pea]
gb|ACG39699.1|  aquaporin PIP1.1                                        456   5e-158   Zea mays [maize]
gb|KCW65649.1|  hypothetical protein EUGRSUZ_G03037                     456   5e-158   
emb|CDY38017.1|  BnaCnng08780D                                          456   5e-158   
gb|ACR54285.1|  aquaporin                                               456   5e-158   Juglans regia
ref|NP_001289835.1|  probable aquaporin PIP-type pTOM75                 456   6e-158   
ref|XP_006418439.1|  hypothetical protein EUTSA_v10008397mg             456   6e-158   
tpg|DAA33860.1|  TPA: aquaporin PIP1;6                                  456   6e-158   
gb|ACU24274.1|  unknown                                                 456   6e-158   Glycine max [soybeans]
ref|XP_010433914.1|  PREDICTED: probable aquaporin PIP1-5               456   6e-158   
gb|ACB38232.1|  aquaporin                                               456   6e-158   Gerbera hybrid cultivar
emb|CAB56217.1|  PM28B protein                                          456   7e-158   Spinacia oleracea
ref|NP_001289902.1|  probable aquaporin PIP1-4                          456   7e-158   
ref|NP_001242504.1|  uncharacterized protein LOC100793242               456   7e-158   
ref|XP_003532817.1|  PREDICTED: probable aquaporin PIP1-2               456   8e-158   
gb|AAA93521.1|  aquaporin                                               456   8e-158   Mesembryanthemum crystallinum
ref|XP_007160075.1|  hypothetical protein PHAVU_002G290400g             456   1e-157   
gb|KHM99966.1|  Putative aquaporin PIP1-2                               456   1e-157   
gb|AAF02782.1|AF195115_2  Similar to transmembrane protein; coded...    456   1e-157   
gb|AEA40490.1|  aquaporin PIP1-2                                        455   1e-157   
dbj|BAA22097.1|  transmembrane protein                                  455   1e-157   
ref|XP_009142386.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin PI...    455   1e-157   
gb|AHX84137.1|  aquaporin                                               455   1e-157   
gb|AAC17528.1|  aquaporin 1                                             455   2e-157   
gb|AHB33476.1|  plasma intrinsic protein 1-3                            455   2e-157   
ref|XP_010670234.1|  PREDICTED: probable aquaporin PIP1-5               455   2e-157   
dbj|BAF33068.1|  aquaporin                                              455   2e-157   
ref|XP_011092540.1|  PREDICTED: aquaporin PIP1-1-like isoform X2        456   2e-157   
gb|KCW50515.1|  hypothetical protein EUGRSUZ_J00237                     456   2e-157   
ref|XP_006435690.1|  hypothetical protein CICLE_v10032308mg             454   2e-157   
gb|AAY22204.1|  putative aquaporin                                      454   3e-157   
emb|CAA38241.1|  unnamed protein product                                454   3e-157   
ref|NP_001290008.1|  probable aquaporin PIP1-4                          454   4e-157   
gb|AAF71819.1|AF141899_1  putative aquaporin PIP1-3                     454   4e-157   
ref|XP_009340095.1|  PREDICTED: aquaporin PIP1-3 isoform X1             454   4e-157   
gb|KHN35027.1|  Putative aquaporin PIP1-2                               454   4e-157   
gb|ACR56611.1|  plasma intrinsic protein 1;2                            454   4e-157   
gb|AGG39697.1|  aquaporin protein AQU19                                 454   4e-157   
gb|ACR56610.1|  plasma intrinsic protein 1;1                            454   4e-157   
gb|EYU23442.1|  hypothetical protein MIMGU_mgv1a011177mg                454   5e-157   
ref|XP_010256616.1|  PREDICTED: aquaporin PIP1-1-like                   454   5e-157   
gb|ABH09323.1|  putative aquaporin                                      454   6e-157   
ref|XP_004149243.1|  PREDICTED: probable aquaporin PIP1-4-like is...    454   6e-157   
gb|AEA40492.1|  aquaporin PIP1-4                                        453   6e-157   
ref|XP_007026768.1|  Plasma membrane intrinsic protein 1,4              453   6e-157   
ref|XP_009143195.1|  PREDICTED: aquaporin PIP1-2 isoform X1             453   7e-157   
ref|NP_001267686.1|  uncharacterized protein LOC101215145               454   7e-157   
ref|XP_003517470.1|  PREDICTED: aquaporin PIP1-3-like                   453   7e-157   
gb|KHN31579.1|  Putative aquaporin PIP1-4                               453   8e-157   
gb|AIL92621.1|  plasma membrane intrinsic protein 1                     453   8e-157   
ref|XP_008360708.1|  PREDICTED: aquaporin PIP1-3 isoform X1             453   8e-157   
gb|AAR23268.1|  PIP1;2                                                  453   9e-157   
ref|NP_001290534.1|  uncharacterized protein LOC105042909               453   1e-156   
ref|XP_006652632.1|  PREDICTED: probable aquaporin PIP1-2-like          453   1e-156   
ref|XP_007209434.1|  hypothetical protein PRUPE_ppa009588mg             453   1e-156   
gb|AAB67870.1|  plasma membrane major intrinsic protein 3               452   1e-156   
ref|XP_010055664.1|  PREDICTED: aquaporin PIP1-2-like                   452   2e-156   
gb|AAB09757.1|  similar to mipB gene product in Mesembryanthemum ...    452   2e-156   
ref|XP_002511872.1|  Aquaporin PIP1.3, putative                         452   2e-156   
gb|AHI54572.1|  aquaporin protein AQU19                                 452   2e-156   
gb|ACC85598.1|  aquaporin                                               452   2e-156   
gb|ABH09324.1|  putative aquaporin                                      452   2e-156   
gb|AAM00368.1|AF366564_1  aquaporin PIP1                                452   2e-156   
gb|KEH21072.1|  major intrinsic protein (MIP) family transporter        452   3e-156   
ref|XP_010031252.1|  PREDICTED: probable aquaporin PIP1-4               452   3e-156   
ref|XP_007163523.1|  hypothetical protein PHAVU_001G241200g             452   3e-156   
gb|ABE03629.1|  plasma membrane major intrinsic protein                 451   3e-156   
gb|KHN13075.1|  Putative aquaporin PIP-type 7a                          451   4e-156   
gb|AAF65846.1|AF255796_1  aquaporin 2                                   451   7e-156   
ref|XP_003519383.1|  PREDICTED: probable aquaporin PIP-type 7a-like     451   7e-156   
gb|AAB82140.1|  transmembrane protein                                   451   7e-156   
ref|NP_001267921.1|  aquaporin-like                                     450   1e-155   
dbj|BAA23745.2|  HvPIP1;3                                               450   1e-155   
gb|AAF80557.1|AF188844_1  plasma membrane aquaporin                     450   2e-155   
ref|NP_001241148.1|  uncharacterized protein LOC100812711               450   2e-155   
ref|XP_004503705.1|  PREDICTED: probable aquaporin PIP1-2-like          449   2e-155   
gb|ACU00101.1|  plasma membrane intrinsic protein PIP1.5                449   2e-155   
emb|CAN74419.1|  hypothetical protein VITISV_016461                     449   2e-155   
ref|NP_001105466.1|  aquaporin PIP1-1                                   449   2e-155   
gb|KEH34782.1|  major intrinsic protein (MIP) family transporter        449   2e-155   
gb|KHG13859.1|  putative aquaporin PIP-type 7a                          449   3e-155   
ref|XP_006343971.1|  PREDICTED: probable aquaporin PIP-type pTOM7...    449   3e-155   
gb|KHG11128.1|  putative aquaporin PIP1-2                               449   4e-155   
gb|AHB33474.1|  plasma intrinsic protein 1-1                            449   4e-155   
ref|XP_003544110.1|  PREDICTED: probable aquaporin PIP-type 7a-li...    449   4e-155   
ref|NP_001276263.1|  probable aquaporin PIP1-4-like                     449   4e-155   
ref|XP_007141791.1|  hypothetical protein PHAVU_008G226000g             449   4e-155   
ref|XP_004511567.1|  PREDICTED: probable aquaporin PIP1-2-like          449   5e-155   
gb|ADD59911.1|  aquaporin                                               450   5e-155   
ref|XP_007133932.1|  hypothetical protein PHAVU_010G004500g             449   5e-155   
ref|XP_008238916.1|  PREDICTED: aquaporin PIP1-2 isoform X1             448   6e-155   
tpg|DAA33859.1|  TPA: aquaporin PIP1;5                                  448   6e-155   
gb|KDO76245.1|  hypothetical protein CISIN_1g023107mg                   447   7e-155   
gb|KFK28910.1|  hypothetical protein AALP_AA7G063900                    448   9e-155   
gb|ABH09325.1|  putative aquaporin                                      447   1e-154   
gb|ACB10396.1|  aquaporin                                               447   1e-154   
gb|KEH28859.1|  major intrinsic protein (MIP) family transporter        447   2e-154   
ref|XP_004298806.1|  PREDICTED: probable aquaporin PIP1-4-like          447   2e-154   
ref|XP_009367824.1|  PREDICTED: aquaporin PIP1-1-like isoform X1        447   2e-154   
gb|AGV54711.1|  aquaporin PIP-type 7a-like protein                      447   2e-154   
ref|XP_010241866.1|  PREDICTED: aquaporin PIP1-2                        447   2e-154   
gb|KDP28617.1|  hypothetical protein JCGZ_14388                         447   3e-154   
ref|NP_001105023.1|  aquaporin PIP1-6                                   447   3e-154   
gb|AHA84147.1|  plasma membrane intrinsic protein 1                     446   5e-154   
ref|XP_010255327.1|  PREDICTED: aquaporin PIP1-2-like                   446   7e-154   
ref|NP_001280950.1|  aquaporin PIP1-1                                   445   1e-153   
gb|KHN15211.1|  Aquaporin PIP1-2                                        449   1e-153   
dbj|BAA81820.1|  water channel protein RWC3                             445   1e-153   
gb|AGV54650.1|  plasma membrane intrinsic protein 1;3                   445   1e-153   
gb|ACJ84965.1|  unknown                                                 445   2e-153   
gb|AFK45475.1|  unknown                                                 445   2e-153   
gb|ABH85411.1|  plasma membrane intrinsic protein 1;3                   445   2e-153   
ref|XP_010240237.1|  PREDICTED: probable aquaporin PIP1-2               444   2e-153   
gb|ABK60194.1|  PIP1 protein                                            444   3e-153   
gb|AFK41358.1|  unknown                                                 444   3e-153   
gb|AFW85290.1|  plasma membrane intrinsic protein1                      444   3e-153   
dbj|BAA32081.1|  RWC-3                                                  444   4e-153   
emb|CAC85292.1|  putative plasma membrane intrinsic protein             444   4e-153   
dbj|BAB40142.1|  plasma membrane intrinsic protein 1-1                  444   5e-153   
ref|XP_006476549.1|  PREDICTED: probable aquaporin PIP1-2-like is...    444   6e-153   
ref|XP_002309126.1|  plasma membrane intrinsic protein 1-1              443   7e-153   
ref|XP_008804034.1|  PREDICTED: probable aquaporin PIP1-2               443   8e-153   
ref|XP_010518253.1|  PREDICTED: aquaporin PIP1-2 isoform X2             443   9e-153   
ref|XP_010508084.1|  PREDICTED: aquaporin PIP1-2-like isoform X2        443   1e-152   
emb|CAG27864.2|  aquaporin PIP1                                         442   1e-152   
gb|ADE34280.1|  aquaporin PIP1;11                                       442   1e-152   
ref|XP_009350886.1|  PREDICTED: probable aquaporin PIP1-4               442   1e-152   
ref|XP_009629840.1|  PREDICTED: aquaporin PIP1-2-like isoform X2        443   2e-152   
gb|ACA50529.1|  putative aquaporin                                      442   2e-152   
ref|XP_010533655.1|  PREDICTED: aquaporin PIP1-3-like                   442   2e-152   
ref|XP_011019143.1|  PREDICTED: probable aquaporin PIP1-4               442   2e-152   
ref|XP_006291433.1|  hypothetical protein CARUB_v10017571mg             444   2e-152   
gb|AGC24023.1|  plasma membrane intrinsic protein 1                     442   2e-152   
gb|AFO63680.1|  plasma intrinsic protein 1                              442   2e-152   
ref|XP_009367825.1|  PREDICTED: aquaporin PIP1-3-like isoform X2        442   2e-152   
ref|XP_010323861.1|  PREDICTED: aqp2 protein isoform X1                 442   2e-152   
emb|CAB06080.1|  porin                                                  441   4e-152   
ref|XP_010512489.1|  PREDICTED: aquaporin PIP1-1                        441   4e-152   
ref|NP_171668.1|  aquaporin PIP1-3                                      441   5e-152   
ref|NP_001280922.1|  probable aquaporin PIP1-4                          441   6e-152   
gb|ABK24473.1|  unknown                                                 441   6e-152   
ref|XP_006304071.1|  hypothetical protein CARUB_v10009929mg             441   7e-152   
dbj|BAC11804.1|  plasma membrane intrinsic protein                      441   7e-152   
ref|XP_009116807.1|  PREDICTED: aquaporin PIP1-1 isoform X2             441   8e-152   
gb|AGV54605.1|  aquaporin-1                                             441   9e-152   
gb|ABK22355.1|  unknown                                                 440   1e-151   
ref|NP_001078066.1|  aquaporin PIP1-2                                   440   1e-151   
ref|XP_009344552.1|  PREDICTED: probable aquaporin PIP1-4               440   1e-151   
ref|XP_010469077.1|  PREDICTED: aquaporin PIP1-1-like                   440   1e-151   
ref|XP_002876612.1|  hypothetical protein ARALYDRAFT_486618             440   1e-151   
ref|XP_004306776.1|  PREDICTED: probable aquaporin PIP1-4-like          440   2e-151   
ref|NP_191702.1|  aquaporin PIP1-1                                      440   2e-151   
gb|ADP24189.1|  aquaporin-like transmembrane channel protein            440   2e-151   
ref|XP_007218768.1|  hypothetical protein PRUPE_ppa009506mg             440   2e-151   
ref|XP_008778924.1|  PREDICTED: probable aquaporin PIP1-2 isoform X2    441   2e-151   
ref|XP_004307619.1|  PREDICTED: probable aquaporin PIP-type 7a-like     439   2e-151   
gb|ACN40976.1|  unknown                                                 439   2e-151   
gb|AFB83066.1|  plasma intrinsic protein PIP1.2                         439   2e-151   
ref|NP_001280914.1|  probable aquaporin PIP1-4                          439   3e-151   
gb|AGR83935.1|  aquaporin PIP1-1                                        438   3e-151   
gb|AEY75243.1|  plasma membrane intrinsic protein                       439   3e-151   
gb|AAL32688.1|  plasma membrane intrinsic protein 1C (transmembra...    439   3e-151   
ref|XP_008233728.1|  PREDICTED: probable aquaporin PIP1-4               439   4e-151   
ref|XP_006360691.1|  PREDICTED: probable aquaporin PIP-type pTOM7...    439   4e-151   
gb|AGR83936.1|  aquaporin PIP1-2                                        437   5e-151   
emb|CAB37860.1|  PIP1b protein                                          438   7e-151   
ref|XP_006402482.1|  hypothetical protein EUTSA_v10006141mg             438   8e-151   
emb|CAA53476.1|  plasma membrane intrinsic protein 1c                   438   9e-151   
emb|CAA53475.1|  plasma membrane intrinsic protein 1a                   437   1e-150   
gb|AGR83938.1|  aquaporin PIP1-4                                        436   1e-150   
ref|NP_194071.1|  putative aquaporin PIP1-5                             437   2e-150   
emb|CAB46350.1|  major intrinsic protein 1                              437   2e-150   
ref|XP_002438067.1|  hypothetical protein SORBIDRAFT_10g007610          437   2e-150   
gb|AAB72149.1|  putative aquaporin-1                                    437   2e-150   
ref|XP_010661719.1|  PREDICTED: aquaporin PIP1;2 isoform X1             438   2e-150   
ref|NP_001078067.1|  aquaporin PIP1-2                                   437   2e-150   
gb|EPS61960.1|  hypothetical protein M569_12834                         436   3e-150   
gb|KCW50514.1|  hypothetical protein EUGRSUZ_J00237                     439   3e-150   
gb|ACU81080.1|  aquaporin                                               436   3e-150   
gb|AAX92682.1|  probable aquaporin                                      436   3e-150   
ref|XP_006339584.1|  PREDICTED: probable aquaporin PIP1-5-like is...    437   5e-150   
gb|KDO69067.1|  hypothetical protein CISIN_1g018895mg                   435   5e-150   
gb|AHA84165.1|  aquaporin                                               436   7e-150   
gb|AAM65975.1|  plasma membrane intrinsic protein 1a                    436   7e-150   
ref|XP_004490961.1|  PREDICTED: probable aquaporin PIP-type 7a-li...    436   9e-150   
gb|AHA90706.1|  aquaporin                                               435   1e-149   
gb|EPS60284.1|  plasma membrane intrinsic protein                       435   1e-149   
gb|KDO69063.1|  hypothetical protein CISIN_1g018895mg                   436   1e-149   
emb|CDY10936.1|  BnaA03g45950D                                          434   2e-149   
ref|XP_002869782.1|  PIP1_5/PIP1D                                       434   2e-149   
ref|XP_006573347.1|  PREDICTED: aquaporin PIP1-2-like                   434   2e-149   
tpg|DAA33862.1|  TPA: aquaporin PIP1;8                                  433   2e-149   
emb|CAA70156.1|  transmembrane protein                                  434   3e-149   
ref|XP_009143196.1|  PREDICTED: aquaporin PIP1-2 isoform X2             434   3e-149   
ref|XP_009340096.1|  PREDICTED: aquaporin PIP1-2 isoform X2             434   5e-149   
ref|XP_009137342.1|  PREDICTED: probable aquaporin PIP1-5 isoform X1    432   1e-148   
gb|KDO69062.1|  hypothetical protein CISIN_1g018895mg                   434   1e-148   
gb|ADJ57598.1|  plasma membrane intrinsic protein PIP1;1                432   2e-148   
gb|AAM65493.1|  water channel-like protein                              431   5e-148   
ref|XP_008360709.1|  PREDICTED: aquaporin PIP1-3 isoform X2             431   8e-148   
emb|CDX94185.1|  BnaC07g38190D                                          429   2e-147   
gb|AFW63312.1|  plasma membrane intrinsic protein1                      429   2e-147   
ref|XP_006595872.1|  PREDICTED: probable aquaporin PIP-type 7a-li...    431   2e-147   
dbj|BAF62342.1|  aquaporin                                              429   2e-147   
gb|EYU38340.1|  hypothetical protein MIMGU_mgv1a018376mg                428   4e-147   
emb|CAA11025.1|  aquaporin                                              427   1e-146   
ref|XP_009367826.1|  PREDICTED: aquaporin PIP1-2-like isoform X3        427   2e-146   
ref|XP_008341694.1|  PREDICTED: aquaporin PIP1-2 isoform X2             426   3e-146   
ref|XP_002275303.1|  PREDICTED: aquaporin PIP1-2                        425   1e-145   
gb|EAZ24111.1|  hypothetical protein OsJ_07850                          424   2e-145   
ref|XP_008238917.1|  PREDICTED: aquaporin PIP1-2 isoform X2             424   5e-145   
gb|ABK24157.1|  unknown                                                 423   7e-145   
ref|XP_004964964.1|  PREDICTED: aquaporin PIP1-6-like                   422   3e-144   
ref|XP_003570076.1|  PREDICTED: aquaporin PIP1-1-like                   421   5e-144   
gb|EMT22814.1|  Putative aquaporin PIP1-2                               415   4e-142   
tpg|DAA33863.1|  TPA: aquaporin PIP1;9                                  413   1e-141   
gb|AAB04757.1|  aquaporin                                               414   2e-141   
ref|XP_002980090.1|  hypothetical protein SELMODRAFT_271415             413   4e-141   
emb|CCI55667.1|  EaPIP1,1                                               413   6e-141   
ref|XP_010037720.1|  PREDICTED: aquaporin PIP1-3-like                   412   1e-140   
ref|XP_009137343.1|  PREDICTED: probable aquaporin PIP1-5 isoform X2    413   3e-140   
ref|XP_007140374.1|  hypothetical protein PHAVU_008G1064001g            407   3e-139   
ref|XP_002323565.2|  hypothetical protein POPTR_0016s12070g             407   5e-139   
gb|AFC98465.1|  aquaporin                                               405   2e-137   
gb|ABN14355.1|  aquaporin PIP1;5                                        399   3e-136   
ref|XP_010670223.1|  PREDICTED: aquaporin PIP1-2                        402   3e-136   
ref|XP_001751574.1|  predicted protein                                  400   4e-136   
gb|ABB87103.1|  water channel protein-like                              399   8e-136   
gb|AAY83359.1|  plasma membrane aquaporin                               398   5e-135   
gb|AEC45512.1|  plasma membrane intrinsic protein                       397   7e-135   
ref|XP_001768432.1|  predicted protein                                  393   5e-133   
ref|XP_001781525.1|  predicted protein                                  392   8e-133   
ref|XP_010521765.1|  PREDICTED: aquaporin PIP2-7-like                   381   2e-128   
gb|ACR56613.1|  plasma intrinsic protein 2;3                            379   8e-128   
ref|XP_010264685.1|  PREDICTED: aquaporin PIP2-1-like                   377   9e-127   
ref|XP_006402481.1|  hypothetical protein EUTSA_v10006141mg             375   1e-126   
ref|XP_004291577.1|  PREDICTED: aquaporin PIP2-2-like                   376   2e-126   
emb|CDX76314.1|  BnaA08g10860D                                          375   2e-126   



>gb|AAS55867.2| aquaporin-like protein [Ipomoea nil]
Length=284

 Score =   518 bits (1334),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/262 (96%), Positives = 257/262 (98%), Gaps = 0/262 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQDKDYTEAPPTALFEPSELSSWSFYRAGIAEFIAT  408
             MEHREEDVRLGANKFPEKQAIGTAAQDKDYTEAPPTALFEPSELSSWSFYRAGIAEFIAT
Sbjct  1     MEHREEDVRLGANKFPEKQAIGTAAQDKDYTEAPPTALFEPSELSSWSFYRAGIAEFIAT  60

Query  409   FLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  588
             FLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL
Sbjct  61    FLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  120

Query  589   FLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGAE  768
             FLARK+SLTR V+Y+VMQCLGAICGAGVVKGFGKT+YN KGGGANVV PGYTKGDGLGAE
Sbjct  121   FLARKVSLTRLVYYIVMQCLGAICGAGVVKGFGKTLYNSKGGGANVVNPGYTKGDGLGAE  180

Query  769   IVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSLG  948
             IVGTF+LVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSLG
Sbjct  181   IVGTFVLVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSLG  240

Query  949   AAIIYNRDEAWNDHWIFWVGPF  1014
             AAIIYN + AWNDHWIFWVGPF
Sbjct  241   AAIIYNNEHAWNDHWIFWVGPF  262



>gb|AAL49749.1|AF452011_1 aquaporin-like protein [Petunia x hybrida]
Length=286

 Score =   489 bits (1259),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 238/264 (90%), Positives = 249/264 (94%), Gaps = 2/264 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ--DKDYTEAPPTALFEPSELSSWSFYRAGIAEFI  402
             MEHREEDV LGANK+ E+QAIGTAAQ  DKDY E PP  LFE  EL SWSFYRAGIAEF+
Sbjct  1     MEHREEDVNLGANKYSERQAIGTAAQSQDKDYIEPPPAPLFESGELMSWSFYRAGIAEFM  60

Query  403   ATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  582
             ATFLFLYIT+LTVMGVSKSDSKC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61    ATFLFLYITVLTVMGVSKSDSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  583   GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLG  762
             GLFLARKLSLTRA+FYMVMQCLGAICGAGVVKGFGKT+Y  KGGGANVVAPGYTKGDGLG
Sbjct  121   GLFLARKLSLTRALFYMVMQCLGAICGAGVVKGFGKTLYQTKGGGANVVAPGYTKGDGLG  180

Query  763   AEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARS  942
             AEIVGTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARS
Sbjct  181   AEIVGTFVLVYTVFSATDAKRSARDSHVPLLAPLPIGFAVFLVHLATIPITGTGINPARS  240

Query  943   LGAAIIYNRDEAWNDHWIFWVGPF  1014
             LGAAIIYN++ AWNDHWIFWVGPF
Sbjct  241   LGAAIIYNQEHAWNDHWIFWVGPF  264



>ref|XP_009759265.1| PREDICTED: probable aquaporin PIP1-2 [Nicotiana sylvestris]
Length=286

 Score =   488 bits (1256),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 236/264 (89%), Positives = 250/264 (95%), Gaps = 2/264 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAA--QDKDYTEAPPTALFEPSELSSWSFYRAGIAEFI  402
             MEHREEDVR+GANK+ E+QAIGTAA  QDKDY E PP  LFEP EL SWSFYRAGIAEF+
Sbjct  1     MEHREEDVRVGANKYSERQAIGTAAHSQDKDYKEPPPAPLFEPGELMSWSFYRAGIAEFM  60

Query  403   ATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  582
             ATFLFLYIT+LTVMGVSKS+SKC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61    ATFLFLYITVLTVMGVSKSESKCPTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  583   GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLG  762
             GLFLARKLS+TRA+FYMVMQCLGAICGAGVVKGFGKT+Y  KGGGANVV PGYTKGDGLG
Sbjct  121   GLFLARKLSVTRALFYMVMQCLGAICGAGVVKGFGKTLYQTKGGGANVVNPGYTKGDGLG  180

Query  763   AEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARS  942
             AEIVGTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARS
Sbjct  181   AEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS  240

Query  943   LGAAIIYNRDEAWNDHWIFWVGPF  1014
             LGAAIIYN++ AWNDHWIFWVGPF
Sbjct  241   LGAAIIYNKEHAWNDHWIFWVGPF  264



>gb|AAT74898.1| plasma membrane intrinsic protein PIP1-1 [Fraxinus excelsior]
Length=286

 Score =   488 bits (1255),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 238/264 (90%), Positives = 249/264 (94%), Gaps = 2/264 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ--DKDYTEAPPTALFEPSELSSWSFYRAGIAEFI  402
             ME +EEDVR+GANKF E+Q IGTAAQ  DKDY E PP  LF+P ELSSWSFYRAGIAEFI
Sbjct  1     MESKEEDVRVGANKFNERQPIGTAAQSQDKDYKEPPPAPLFDPGELSSWSFYRAGIAEFI  60

Query  403   ATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  582
             ATFLFLYI ILTVMGVSKSDSKC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61    ATFLFLYIAILTVMGVSKSDSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  583   GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLG  762
             GLFLARKLSLTRA+FYMVMQCLGAICGAGVVKGFGKT+Y  KGGGANVVAPGYTKGDGLG
Sbjct  121   GLFLARKLSLTRAIFYMVMQCLGAICGAGVVKGFGKTLYMTKGGGANVVAPGYTKGDGLG  180

Query  763   AEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARS  942
             AEIVGTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARS
Sbjct  181   AEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS  240

Query  943   LGAAIIYNRDEAWNDHWIFWVGPF  1014
             LGAAIIYN+D AW+DHWIFWVGPF
Sbjct  241   LGAAIIYNKDHAWDDHWIFWVGPF  264



>gb|ABB13429.1| plasma membrane intrinsic protein [Olea europaea]
Length=285

 Score =   487 bits (1254),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 238/264 (90%), Positives = 250/264 (95%), Gaps = 2/264 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ--DKDYTEAPPTALFEPSELSSWSFYRAGIAEFI  402
             ME +EEDVR+GANKF E+Q IGTAAQ  DKDY E PP  LFEP ELSSWSFYRAGIAEFI
Sbjct  1     MESKEEDVRVGANKFAERQPIGTAAQSQDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFI  60

Query  403   ATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  582
             ATFLFLYIT+LTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61    ATFLFLYITVLTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  583   GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLG  762
             GLFL RKLSLTRAVFYMVMQCLGAICGAGVVKGFGKT+Y  KGGGANVVA GYTKGDGLG
Sbjct  121   GLFLGRKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTLYMTKGGGANVVAHGYTKGDGLG  180

Query  763   AEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARS  942
             AEI+GTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARS
Sbjct  181   AEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS  240

Query  943   LGAAIIYNRDEAWNDHWIFWVGPF  1014
             LGAAIIYN+D+AW+DHWIFWVGPF
Sbjct  241   LGAAIIYNKDKAWDDHWIFWVGPF  264



>ref|XP_011084932.1| PREDICTED: probable aquaporin PIP1-2 [Sesamum indicum]
Length=286

 Score =   484 bits (1246),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 236/264 (89%), Positives = 247/264 (94%), Gaps = 2/264 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ--DKDYTEAPPTALFEPSELSSWSFYRAGIAEFI  402
             ME +EEDVRLGANKF E+Q IGTAAQ  DKDY E PP  LFEP EL+SWSFYRAGIAEFI
Sbjct  1     MESKEEDVRLGANKFSERQPIGTAAQSQDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFI  60

Query  403   ATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  582
             ATFLFLYITILTVMGVSKSDSKC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61    ATFLFLYITILTVMGVSKSDSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  583   GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLG  762
             GLFLARKLSLTRA+FYMVMQCLGAICGAGVVKGFGKT+Y  KGGGAN VA GYTKGDGLG
Sbjct  121   GLFLARKLSLTRALFYMVMQCLGAICGAGVVKGFGKTLYQTKGGGANAVAHGYTKGDGLG  180

Query  763   AEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARS  942
             AEI+GTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARS
Sbjct  181   AEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS  240

Query  943   LGAAIIYNRDEAWNDHWIFWVGPF  1014
             LGAAIIYN+  AW+DHWIFWVGPF
Sbjct  241   LGAAIIYNKSHAWDDHWIFWVGPF  264



>dbj|BAA20074.1| water channel protein [Nicotiana excelsior]
Length=285

 Score =   484 bits (1246),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 236/263 (90%), Positives = 249/263 (95%), Gaps = 1/263 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME++EEDVRLGANK+ E+QAIGTAAQ DKDYTE PP  LFE  EL+SWSFYRAGIAEF+A
Sbjct  1     MENKEEDVRLGANKYSERQAIGTAAQSDKDYTEPPPAPLFEAGELTSWSFYRAGIAEFMA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYITILTVMGVSKS+SKC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITILTVMGVSKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGA  765
             LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKT+Y  KGGGANVV  GYTKG GLGA
Sbjct  121   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTLYQTKGGGANVVNHGYTKGSGLGA  180

Query  766   EIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSL  945
             EIVGTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSL
Sbjct  181   EIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSL  240

Query  946   GAAIIYNRDEAWNDHWIFWVGPF  1014
             GAAIIYN+D AW+DHWIFWVGPF
Sbjct  241   GAAIIYNQDHAWDDHWIFWVGPF  263



>ref|XP_011076722.1| PREDICTED: probable aquaporin PIP1-5 [Sesamum indicum]
Length=286

 Score =   484 bits (1246),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 236/264 (89%), Positives = 249/264 (94%), Gaps = 2/264 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ--DKDYTEAPPTALFEPSELSSWSFYRAGIAEFI  402
             ME +EEDV LGANKF E+Q IGTAAQ  DKDYTE PP  LF PSEL+SWSFYRAGIAEFI
Sbjct  1     MESKEEDVNLGANKFSERQPIGTAAQSQDKDYTEPPPEPLFVPSELTSWSFYRAGIAEFI  60

Query  403   ATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  582
             ATFLFLY++ILTVMGV+KSDSKC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61    ATFLFLYVSILTVMGVNKSDSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  583   GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLG  762
             GLFLARKLSLTRA+FYMVMQCLGAICGAGVVKGFGKT+Y  KGGGANVVA GYTKGDGLG
Sbjct  121   GLFLARKLSLTRALFYMVMQCLGAICGAGVVKGFGKTLYQTKGGGANVVAHGYTKGDGLG  180

Query  763   AEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARS  942
             AEIVGTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARS
Sbjct  181   AEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS  240

Query  943   LGAAIIYNRDEAWNDHWIFWVGPF  1014
             LGAAIIYN+D AW+DHWIFWVGPF
Sbjct  241   LGAAIIYNKDHAWDDHWIFWVGPF  264



>ref|XP_006362987.1| PREDICTED: probable aquaporin PIP1-2-like [Solanum tuberosum]
Length=286

 Score =   483 bits (1244),  Expect = 9e-169, Method: Compositional matrix adjust.
 Identities = 234/264 (89%), Positives = 245/264 (93%), Gaps = 2/264 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ--DKDYTEAPPTALFEPSELSSWSFYRAGIAEFI  402
             MEHREEDVRLGANK+ E+QAIG AAQ  DKDY E PP  LFEP EL SWSFYRAGIAEF+
Sbjct  1     MEHREEDVRLGANKYSERQAIGIAAQSQDKDYKEPPPAPLFEPGELMSWSFYRAGIAEFV  60

Query  403   ATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  582
             ATFLFLYIT+LTVMGVSKSDSKC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61    ATFLFLYITVLTVMGVSKSDSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  583   GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLG  762
             GLFLARKLSLTRAVFYMVMQCLGAICGAGVVK FGKT+Y  KGGGANVV  GYT GDGLG
Sbjct  121   GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKAFGKTLYQTKGGGANVVNVGYTNGDGLG  180

Query  763   AEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARS  942
             AEI+GTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARS
Sbjct  181   AEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS  240

Query  943   LGAAIIYNRDEAWNDHWIFWVGPF  1014
             LGAA+IYN + AWNDHWIFWVGPF
Sbjct  241   LGAAVIYNNEHAWNDHWIFWVGPF  264



>gb|AFJ44204.1| plasma membrane intrinsic protein 1 [Hedychium coronarium]
Length=286

 Score =   483 bits (1244),  Expect = 9e-169, Method: Compositional matrix adjust.
 Identities = 237/263 (90%), Positives = 248/263 (94%), Gaps = 1/263 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDVRLGANKFPE+Q IGTAAQ DKDYTE P   LFEP ELSSWSFYRAGIAEF+A
Sbjct  1     MEGKEEDVRLGANKFPERQPIGTAAQGDKDYTEPPAAPLFEPGELSSWSFYRAGIAEFVA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYI+ILTVMGV K+DSKC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYISILTVMGVVKADSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGA  765
             LFLARKLSLTRAVFY+VMQCLGAICGAGVVKGF K +Y  KGGGANVVAPGYTKGDGLGA
Sbjct  121   LFLARKLSLTRAVFYIVMQCLGAICGAGVVKGFKKGLYESKGGGANVVAPGYTKGDGLGA  180

Query  766   EIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSL  945
             EIVGTFILVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSL
Sbjct  181   EIVGTFILVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSL  240

Query  946   GAAIIYNRDEAWNDHWIFWVGPF  1014
             GAAIIYN+D AW+DHWIFWVGPF
Sbjct  241   GAAIIYNKDHAWDDHWIFWVGPF  263



>ref|XP_009762763.1| PREDICTED: probable aquaporin PIP1-2 [Nicotiana sylvestris]
Length=285

 Score =   482 bits (1241),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 236/263 (90%), Positives = 249/263 (95%), Gaps = 1/263 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME++EEDVRLGANK+ E+QAIGTAAQ DKDYTE PP  LFE  EL+SWSFYRAGIAEF+A
Sbjct  1     MENKEEDVRLGANKYSERQAIGTAAQSDKDYTEPPPAPLFEAGELTSWSFYRAGIAEFMA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYITILTVMGVSKS+SKC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITILTVMGVSKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGA  765
             LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKT+Y  KGGGANVV  GYTKG GLGA
Sbjct  121   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTLYQTKGGGANVVNLGYTKGSGLGA  180

Query  766   EIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSL  945
             EIVGTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSL
Sbjct  181   EIVGTFVLVYTVFSATDAKRSARDSHVPLLAPLPIGFAVFLVHLATIPITGTGINPARSL  240

Query  946   GAAIIYNRDEAWNDHWIFWVGPF  1014
             GAAIIYN+D AW+DHWIFWVGPF
Sbjct  241   GAAIIYNQDHAWDDHWIFWVGPF  263



>ref|XP_011076723.1| PREDICTED: probable aquaporin PIP1-5 [Sesamum indicum]
Length=286

 Score =   482 bits (1241),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 235/264 (89%), Positives = 248/264 (94%), Gaps = 2/264 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ--DKDYTEAPPTALFEPSELSSWSFYRAGIAEFI  402
             ME +EEDV +GANKF E+Q IGTAAQ  DKDY E PP  LF PSEL+SWSFYRAGIAEFI
Sbjct  1     MESKEEDVNVGANKFSERQPIGTAAQSQDKDYREPPPEPLFVPSELTSWSFYRAGIAEFI  60

Query  403   ATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  582
             ATFLFLY++ILTVMGVSKSDSKC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61    ATFLFLYVSILTVMGVSKSDSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  583   GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLG  762
             GLFLARKLSLTRA+FYMVMQCLGAICGAGVVKGFGKT+Y  KGGGANVVA GYTKGDGLG
Sbjct  121   GLFLARKLSLTRALFYMVMQCLGAICGAGVVKGFGKTLYQTKGGGANVVAHGYTKGDGLG  180

Query  763   AEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARS  942
             AEIVGTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARS
Sbjct  181   AEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS  240

Query  943   LGAAIIYNRDEAWNDHWIFWVGPF  1014
             LGAAIIYN+D AW+DHWIFWVGPF
Sbjct  241   LGAAIIYNKDHAWDDHWIFWVGPF  264



>ref|XP_009631880.1| PREDICTED: probable aquaporin PIP1-2 [Nicotiana tomentosiformis]
 tpg|DAA64671.1| TPA_exp: aquaporin PIP1 4 [Nicotiana tabacum]
Length=285

 Score =   482 bits (1240),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 235/263 (89%), Positives = 248/263 (94%), Gaps = 1/263 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME++EEDVRLGANK+ E+QAIGTAAQ DKDY E PP  LFE  EL+SWSFYRAGIAEF+A
Sbjct  1     MENKEEDVRLGANKYSERQAIGTAAQSDKDYKEPPPAPLFEAGELTSWSFYRAGIAEFMA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYITILTVMGVSKS+SKC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITILTVMGVSKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGA  765
             LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKT+Y  KGGGANVV  GYTKG GLGA
Sbjct  121   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTLYQTKGGGANVVNLGYTKGSGLGA  180

Query  766   EIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSL  945
             EIVGTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSL
Sbjct  181   EIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSL  240

Query  946   GAAIIYNRDEAWNDHWIFWVGPF  1014
             GAAIIYN+D AW+DHWIFWVGPF
Sbjct  241   GAAIIYNQDHAWDDHWIFWVGPF  263



>ref|XP_009400253.1| PREDICTED: probable aquaporin PIP1-2 [Musa acuminata subsp. malaccensis]
Length=285

 Score =   481 bits (1239),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 234/262 (89%), Positives = 244/262 (93%), Gaps = 0/262 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQDKDYTEAPPTALFEPSELSSWSFYRAGIAEFIAT  408
             ME +EEDV+LGANKF E+Q IGTAAQDKDY E PP  LFEP EL SWSFYRAGIAEF+AT
Sbjct  1     MEGKEEDVKLGANKFSERQPIGTAAQDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFMAT  60

Query  409   FLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  588
             FLFLYITILTVMGV KS+SKC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL
Sbjct  61    FLFLYITILTVMGVVKSNSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  120

Query  589   FLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGAE  768
             FLARKLSLTRAVFYMVMQCLGA+CGAGVVKGF K VY   GGGANVVA GY+KGDGLGAE
Sbjct  121   FLARKLSLTRAVFYMVMQCLGAVCGAGVVKGFQKGVYESNGGGANVVASGYSKGDGLGAE  180

Query  769   IVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSLG  948
             IVGTFILVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSLG
Sbjct  181   IVGTFILVYTVFSATDAKRNARDSHVPLLAPLPIGFAVFLVHLATIPITGTGINPARSLG  240

Query  949   AAIIYNRDEAWNDHWIFWVGPF  1014
             AAIIYN+D AW+DHWIFWVGPF
Sbjct  241   AAIIYNKDHAWDDHWIFWVGPF  262



>ref|XP_009380931.1| PREDICTED: aquaporin PIP1-1 [Musa acuminata subsp. malaccensis]
Length=285

 Score =   481 bits (1239),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 232/262 (89%), Positives = 243/262 (93%), Gaps = 0/262 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQDKDYTEAPPTALFEPSELSSWSFYRAGIAEFIAT  408
             ME +EEDV++GANKF E+Q IGTAAQDKDY E PP  LFEP EL SWSFYRAGIAEF+AT
Sbjct  1     MEGKEEDVKIGANKFSERQPIGTAAQDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFVAT  60

Query  409   FLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  588
             FLFLYITILTVMGV KS SKC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL
Sbjct  61    FLFLYITILTVMGVVKSSSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  120

Query  589   FLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGAE  768
             FLARKLSLTRA+FYMVMQCLGAICGAGVVKGF K VY   GGGANVVA GY+KGDGLGAE
Sbjct  121   FLARKLSLTRAIFYMVMQCLGAICGAGVVKGFQKGVYQSNGGGANVVASGYSKGDGLGAE  180

Query  769   IVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSLG  948
             IVGTFILVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSLG
Sbjct  181   IVGTFILVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLG  240

Query  949   AAIIYNRDEAWNDHWIFWVGPF  1014
             AA+IYN+D AW+DHWIFWVGPF
Sbjct  241   AAVIYNKDHAWDDHWIFWVGPF  262



>gb|ACF84511.1| unknown [Zea mays]
 gb|ACG37183.1| aquaporin PIP1.1 [Zea mays]
 gb|AFW72702.1| plasma membrane intrinsic protein1 [Zea mays]
Length=289

 Score =   481 bits (1238),  Expect = 8e-168, Method: Compositional matrix adjust.
 Identities = 236/266 (89%), Positives = 246/266 (92%), Gaps = 4/266 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ----DKDYTEAPPTALFEPSELSSWSFYRAGIAE  396
             ME +EEDVRLGANKF E+Q IGTAAQ    DKDY E PP  LFEP EL SWSFYRAGIAE
Sbjct  1     MEGKEEDVRLGANKFSERQPIGTAAQGAADDKDYKEPPPAPLFEPGELKSWSFYRAGIAE  60

Query  397   FIATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  576
             F+ATFLFLYITILTVMGVSKS SKC TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAV
Sbjct  61    FVATFLFLYITILTVMGVSKSTSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAV  120

Query  577   TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDG  756
             TFGLFLARKLSLTRA+FY++MQCLGAICGAGVVKGF + +Y G GGGANVVAPGYTKGDG
Sbjct  121   TFGLFLARKLSLTRALFYIIMQCLGAICGAGVVKGFQQGLYMGNGGGANVVAPGYTKGDG  180

Query  757   LGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPA  936
             LGAEIVGTFILVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPA
Sbjct  181   LGAEIVGTFILVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPA  240

Query  937   RSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             RSLGAAIIYNRD AWNDHWIFWVGPF
Sbjct  241   RSLGAAIIYNRDHAWNDHWIFWVGPF  266



>ref|XP_002454508.1| hypothetical protein SORBIDRAFT_04g032430 [Sorghum bicolor]
 gb|EES07484.1| hypothetical protein SORBIDRAFT_04g032430 [Sorghum bicolor]
Length=289

 Score =   481 bits (1237),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 235/266 (88%), Positives = 247/266 (93%), Gaps = 4/266 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ----DKDYTEAPPTALFEPSELSSWSFYRAGIAE  396
             ME +EEDVRLGANKF E+Q IGTAAQ    DKDY E PP  LFEP EL SWSFYRAGIAE
Sbjct  1     MEGKEEDVRLGANKFSERQPIGTAAQGAGDDKDYKEPPPAPLFEPGELKSWSFYRAGIAE  60

Query  397   FIATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  576
             F+ATFLFLYITILTVMGVSKS+SKC TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAV
Sbjct  61    FVATFLFLYITILTVMGVSKSNSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAV  120

Query  577   TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDG  756
             TFGLFLARKLSLTRA+FY++MQCLGAICGAGVVKGF + +Y G GGGANVVAPGYTKGDG
Sbjct  121   TFGLFLARKLSLTRAIFYIIMQCLGAICGAGVVKGFQQGLYMGNGGGANVVAPGYTKGDG  180

Query  757   LGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPA  936
             LGAEIVGTFILVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPA
Sbjct  181   LGAEIVGTFILVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPA  240

Query  937   RSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             RSLGAAIIYNRD AW+DHWIFWVGPF
Sbjct  241   RSLGAAIIYNRDHAWSDHWIFWVGPF  266



>ref|XP_011076721.1| PREDICTED: probable aquaporin PIP1-5 [Sesamum indicum]
Length=286

 Score =   481 bits (1237),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 234/264 (89%), Positives = 248/264 (94%), Gaps = 2/264 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ--DKDYTEAPPTALFEPSELSSWSFYRAGIAEFI  402
             ME +EEDV +GANKF E+Q IGTAAQ  DKDY E PP  LF PSEL+SWSFYRAGIAEFI
Sbjct  1     MESKEEDVNVGANKFSERQPIGTAAQSQDKDYREPPPEPLFVPSELTSWSFYRAGIAEFI  60

Query  403   ATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  582
             ATFLFLY++ILTVMGV+KSDSKC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61    ATFLFLYVSILTVMGVNKSDSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  583   GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLG  762
             GLFLARKLSLTRA+FYMVMQCLGAICGAGVVKGFGKT+Y  KGGGANVVA GYTKGDGLG
Sbjct  121   GLFLARKLSLTRALFYMVMQCLGAICGAGVVKGFGKTLYQTKGGGANVVAHGYTKGDGLG  180

Query  763   AEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARS  942
             AEIVGTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARS
Sbjct  181   AEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS  240

Query  943   LGAAIIYNRDEAWNDHWIFWVGPF  1014
             LGAAIIYN+D AW+DHWIFWVGPF
Sbjct  241   LGAAIIYNKDHAWDDHWIFWVGPF  264



>ref|NP_001104934.1| aquaporin PIP1-2 [Zea mays]
 sp|Q9XF59.1|PIP12_MAIZE RecName: Full=Aquaporin PIP1-2; AltName: Full=Plasma membrane 
intrinsic protein 1-2; AltName: Full=ZmPIP1-2; AltName: Full=ZmPIP1;2; 
AltName: Full=ZmPIP1b [Zea mays]
 gb|AAD29676.1|AF131201_1 plasma membrane MIP protein [Zea mays]
Length=289

 Score =   481 bits (1237),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 235/266 (88%), Positives = 246/266 (92%), Gaps = 4/266 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ----DKDYTEAPPTALFEPSELSSWSFYRAGIAE  396
             ME +EEDVRLGANKF E+Q IGTAAQ    DKDY E PP  LFEP EL SWSFYRAGIAE
Sbjct  1     MEGKEEDVRLGANKFSERQPIGTAAQGAADDKDYKEPPPAPLFEPGELKSWSFYRAGIAE  60

Query  397   FIATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  576
             F+ATFLFLYITILTVMGVSKS SKC TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAV
Sbjct  61    FVATFLFLYITILTVMGVSKSTSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAV  120

Query  577   TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDG  756
             TFGLFLARKLSLTRA+FY++MQCLGA+CGAGVVKGF + +Y G GGGANVVAPGYTKGDG
Sbjct  121   TFGLFLARKLSLTRALFYIIMQCLGAVCGAGVVKGFQQGLYMGNGGGANVVAPGYTKGDG  180

Query  757   LGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPA  936
             LGAEIVGTFILVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPA
Sbjct  181   LGAEIVGTFILVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPA  240

Query  937   RSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             RSLGAAIIYNRD AWNDHWIFWVGPF
Sbjct  241   RSLGAAIIYNRDHAWNDHWIFWVGPF  266



>ref|XP_010095072.1| Aquaporin PIP1-1 [Morus notabilis]
 gb|EXB58178.1| Aquaporin PIP1-1 [Morus notabilis]
Length=288

 Score =   480 bits (1236),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 237/266 (89%), Positives = 247/266 (93%), Gaps = 4/266 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQD----KDYTEAPPTALFEPSELSSWSFYRAGIAE  396
             ME +EEDVRLGANKF E+Q IGTAAQ     KDY E PP  LFEP EL+SWSFYRAGIAE
Sbjct  1     MEGKEEDVRLGANKFSERQPIGTAAQTQDDGKDYKEPPPAPLFEPGELTSWSFYRAGIAE  60

Query  397   FIATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  576
             FIATFLFLYITILTVMGV K DSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV
Sbjct  61    FIATFLFLYITILTVMGVVKEDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  120

Query  577   TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDG  756
             TFGLFLARKLSLTRAVFY+VMQCLGAICGAGVVKGF K++YNG GGGANVVA GYTKGDG
Sbjct  121   TFGLFLARKLSLTRAVFYIVMQCLGAICGAGVVKGFKKSIYNGHGGGANVVAHGYTKGDG  180

Query  757   LGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPA  936
             LGAEIVGTFILVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPA
Sbjct  181   LGAEIVGTFILVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPA  240

Query  937   RSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             RSLGAAIIYN+D AW+DHWIFWVGPF
Sbjct  241   RSLGAAIIYNKDHAWDDHWIFWVGPF  266



>gb|ACL52629.1| unknown [Zea mays]
Length=289

 Score =   480 bits (1236),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 235/266 (88%), Positives = 245/266 (92%), Gaps = 4/266 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ----DKDYTEAPPTALFEPSELSSWSFYRAGIAE  396
             ME +EEDVRLGANKF E+Q IGTAAQ    DKDY E PP  LFEP EL SWSFYRAGI E
Sbjct  1     MEGKEEDVRLGANKFSERQPIGTAAQGAADDKDYKEPPPAPLFEPGELKSWSFYRAGITE  60

Query  397   FIATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  576
             F+ATFLFLYITILTVMGVSKS SKC TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAV
Sbjct  61    FVATFLFLYITILTVMGVSKSTSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAV  120

Query  577   TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDG  756
             TFGLFLARKLSLTRA+FY++MQCLGAICGAGVVKGF + +Y G GGGANVVAPGYTKGDG
Sbjct  121   TFGLFLARKLSLTRALFYIIMQCLGAICGAGVVKGFQQGLYMGNGGGANVVAPGYTKGDG  180

Query  757   LGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPA  936
             LGAEIVGTFILVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPA
Sbjct  181   LGAEIVGTFILVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPA  240

Query  937   RSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             RSLGAAIIYNRD AWNDHWIFWVGPF
Sbjct  241   RSLGAAIIYNRDHAWNDHWIFWVGPF  266



>gb|ACC59097.1| aquaporin [Saccharum officinarum]
Length=289

 Score =   479 bits (1234),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 234/266 (88%), Positives = 246/266 (92%), Gaps = 4/266 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ----DKDYTEAPPTALFEPSELSSWSFYRAGIAE  396
             ME +EEDVRLGANKF E+Q IGTAAQ    DKDY E PP  LFEP EL SWSFYRAGIAE
Sbjct  1     MEGKEEDVRLGANKFSERQPIGTAAQGAGDDKDYKEPPPAPLFEPGELKSWSFYRAGIAE  60

Query  397   FIATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  576
             F+ATFLFLYITILTVMGVSKS SKC TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAV
Sbjct  61    FVATFLFLYITILTVMGVSKSTSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAV  120

Query  577   TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDG  756
             TFGLFLARKLSLTRA+FY++MQCLGAICGAGVVKGF + +Y G GGGANVVAPGYTKGDG
Sbjct  121   TFGLFLARKLSLTRAIFYIIMQCLGAICGAGVVKGFQQGLYMGNGGGANVVAPGYTKGDG  180

Query  757   LGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPA  936
             LGAEIVGTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPA
Sbjct  181   LGAEIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPA  240

Query  937   RSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             RSLGAAIIYNRD AW+DHWIFWVGPF
Sbjct  241   RSLGAAIIYNRDHAWSDHWIFWVGPF  266



>dbj|BAF44223.1| aquaporin [Iris x hollandica]
Length=327

 Score =   479 bits (1234),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 235/266 (88%), Positives = 245/266 (92%), Gaps = 4/266 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ----DKDYTEAPPTALFEPSELSSWSFYRAGIAE  396
             ME +EEDV+LGANKF E+Q IGTAAQ     KDY E PP  LFEP EL SWSFYRAGIAE
Sbjct  1     MEGKEEDVKLGANKFSERQPIGTAAQVADESKDYKEPPPAPLFEPGELKSWSFYRAGIAE  60

Query  397   FIATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  576
             FIATFLFLYITILTVMGVSKS SKC TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAV
Sbjct  61    FIATFLFLYITILTVMGVSKSKSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAV  120

Query  577   TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDG  756
             TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKG+GK +Y  +GGGANVVAPGYTKGDG
Sbjct  121   TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGYGKMLYQTQGGGANVVAPGYTKGDG  180

Query  757   LGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPA  936
             LGAEIVGTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPA
Sbjct  181   LGAEIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPA  240

Query  937   RSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             RSLGAAIIYN D AW+DHWIFWVGPF
Sbjct  241   RSLGAAIIYNNDHAWDDHWIFWVGPF  266



>ref|XP_009386206.1| PREDICTED: probable aquaporin PIP1-2 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=286

 Score =   478 bits (1230),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 234/263 (89%), Positives = 245/263 (93%), Gaps = 1/263 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDVRLGANKF E+Q IGTAAQ DKDY E PP  LFEP EL+SWSFYRAGIAEF+A
Sbjct  1     MEGKEEDVRLGANKFSERQPIGTAAQSDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFMA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYITILTVMGV KS+SKC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITILTVMGVVKSNSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGA  765
             LFLARKLSLTRA+FYMVMQCLGAICGAGVVKG+ K +Y   GGGANVVAPGYTKGDGLGA
Sbjct  121   LFLARKLSLTRALFYMVMQCLGAICGAGVVKGYQKGLYESNGGGANVVAPGYTKGDGLGA  180

Query  766   EIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSL  945
             EIVGTFILVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSL
Sbjct  181   EIVGTFILVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSL  240

Query  946   GAAIIYNRDEAWNDHWIFWVGPF  1014
             GAAIIYN+  AW+DHWIFWVGPF
Sbjct  241   GAAIIYNKKHAWDDHWIFWVGPF  263



>gb|EYU19988.1| hypothetical protein MIMGU_mgv1a011277mg [Erythranthe guttata]
Length=287

 Score =   478 bits (1229),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 230/264 (87%), Positives = 245/264 (93%), Gaps = 2/264 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ--DKDYTEAPPTALFEPSELSSWSFYRAGIAEFI  402
             ME +EEDVR+GAN+F E+Q IGTAAQ  DKDY E PP  LFEP EL+SWSFYRAGIAEF+
Sbjct  1     MESKEEDVRVGANRFDERQPIGTAAQTQDKDYKEPPPAPLFEPGELASWSFYRAGIAEFV  60

Query  403   ATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  582
             ATFLFLYIT+LTVMGVSKS+SKC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61    ATFLFLYITVLTVMGVSKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  583   GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLG  762
             GLFLARKLSLTRAV+YMVMQCLGAICGAGVVKGFGK +Y   GGGANVVA GYTKG GLG
Sbjct  121   GLFLARKLSLTRAVYYMVMQCLGAICGAGVVKGFGKALYQSNGGGANVVAHGYTKGSGLG  180

Query  763   AEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARS  942
             AEI+GTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARS
Sbjct  181   AEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS  240

Query  943   LGAAIIYNRDEAWNDHWIFWVGPF  1014
             LGAAIIYN+  AWNDHWIFWVGPF
Sbjct  241   LGAAIIYNKSHAWNDHWIFWVGPF  264



>ref|NP_001047672.1| Os02g0666200 [Oryza sativa Japonica Group]
 sp|Q6EU94.1|PIP11_ORYSJ RecName: Full=Aquaporin PIP1-1; AltName: Full=OsPIP1;1; AltName: 
Full=Plasma membrane intrinsic protein 1-1; AltName: Full=Plasma 
membrane intrinsic protein 1a; Short=PIP1a; AltName: 
Full=Water channel protein RWC1; Short=RWC-1 [Oryza sativa 
Japonica Group]
 emb|CAA11896.1| aquaporin [Oryza sativa]
 dbj|BAD28398.1| aquaporin [Oryza sativa Japonica Group]
 dbj|BAD27775.1| aquaporin [Oryza sativa Japonica Group]
 dbj|BAF09586.1| Os02g0666200 [Oryza sativa Japonica Group]
 gb|EAY86995.1| hypothetical protein OsI_08388 [Oryza sativa Indica Group]
 gb|ACA50520.1| aquaporin [Oryza sativa Japonica Group]
 gb|AEV58397.1| aquaporin [Oryza sativa Japonica Group]
 gb|AIR95997.1| aquaporin [Oryza sativa Japonica Group]
Length=289

 Score =   477 bits (1227),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 233/266 (88%), Positives = 245/266 (92%), Gaps = 4/266 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ----DKDYTEAPPTALFEPSELSSWSFYRAGIAE  396
             ME +EEDVRLGAN++ E+Q IGTAAQ    DKDY E PP  LFEP EL SWSFYRAGIAE
Sbjct  1     MEGKEEDVRLGANRYSERQPIGTAAQGAGDDKDYKEPPPAPLFEPGELKSWSFYRAGIAE  60

Query  397   FIATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  576
             F+ATFLFLYITILTVMGVSKS SKC TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAV
Sbjct  61    FVATFLFLYITILTVMGVSKSSSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAV  120

Query  577   TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDG  756
             TFGLFLARKLSLTRA+FY+VMQCLGAICGAGVVKGF + +Y G GGGANVVA GYTKGDG
Sbjct  121   TFGLFLARKLSLTRAIFYIVMQCLGAICGAGVVKGFQQGLYMGNGGGANVVASGYTKGDG  180

Query  757   LGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPA  936
             LGAEIVGTFILVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPA
Sbjct  181   LGAEIVGTFILVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPA  240

Query  937   RSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             RSLGAAIIYN+D AWNDHWIFWVGPF
Sbjct  241   RSLGAAIIYNKDHAWNDHWIFWVGPF  266



>ref|XP_011092531.1| PREDICTED: probable aquaporin PIP1-5 isoform X1 [Sesamum indicum]
Length=285

 Score =   477 bits (1227),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 230/262 (88%), Positives = 245/262 (94%), Gaps = 0/262 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQDKDYTEAPPTALFEPSELSSWSFYRAGIAEFIAT  408
             ME +EEDV+LGANKF E+Q IGT+AQ KDY EAPP  LFEP EL SWSF+RAGIAEF+AT
Sbjct  1     MEGKEEDVKLGANKFTERQPIGTSAQSKDYKEAPPAPLFEPGELQSWSFWRAGIAEFMAT  60

Query  409   FLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  588
             FLFLYITILTVMGVSKS SKC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL
Sbjct  61    FLFLYITILTVMGVSKSGSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  120

Query  589   FLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGAE  768
             FLARKLSLTRA+FY+VMQCLGAICGAGVVKGF  ++Y  KGGGANVVA GYTKGDGLGAE
Sbjct  121   FLARKLSLTRAIFYIVMQCLGAICGAGVVKGFQPSLYQTKGGGANVVAHGYTKGDGLGAE  180

Query  769   IVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSLG  948
             I+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSLG
Sbjct  181   IIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLG  240

Query  949   AAIIYNRDEAWNDHWIFWVGPF  1014
             AAIIYN+D AW+DHWIFWVGPF
Sbjct  241   AAIIYNKDHAWDDHWIFWVGPF  262



>gb|ABG57184.1| aquaporin [Tamarix sp. ZDY-001908]
Length=287

 Score =   477 bits (1227),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 233/265 (88%), Positives = 246/265 (93%), Gaps = 3/265 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ---DKDYTEAPPTALFEPSELSSWSFYRAGIAEF  399
             ME +EEDVRLGANKFPE+Q IGTAAQ   +KDY E PP  LFEPSEL+SWSFYRAGIAEF
Sbjct  1     MEGKEEDVRLGANKFPERQPIGTAAQTHEEKDYREPPPAPLFEPSELTSWSFYRAGIAEF  60

Query  400   IATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  579
             IATFLFLYITILTVMGV +SDS CK+VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61    IATFLFLYITILTVMGVKRSDSMCKSVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  580   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGL  759
             FGLFLARKLSLTRA+FYM+MQCLGAICGAGVVKGF  T+Y  +GGGAN VA GYTKGDGL
Sbjct  121   FGLFLARKLSLTRALFYMIMQCLGAICGAGVVKGFMPTIYQVQGGGANEVAHGYTKGDGL  180

Query  760   GAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPAR  939
             GAEIVGTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPAR
Sbjct  181   GAEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR  240

Query  940   SLGAAIIYNRDEAWNDHWIFWVGPF  1014
             SLGAAIIYNR  AWNDHWIFWVGPF
Sbjct  241   SLGAAIIYNRSAAWNDHWIFWVGPF  265



>gb|AEO79975.1| plasma intrinsic protein 1 [Gladiolus communis]
 gb|AFU52635.1| plasma membrane intrinsic protein, partial [Gladiolus hybrid 
cultivar]
Length=288

 Score =   476 bits (1226),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 233/265 (88%), Positives = 245/265 (92%), Gaps = 3/265 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ---DKDYTEAPPTALFEPSELSSWSFYRAGIAEF  399
             ME +EEDV+LGANKF E Q IGTAAQ    KDY E PP  LFEP EL SWSFYRAGIAEF
Sbjct  1     MEGKEEDVKLGANKFSEGQPIGTAAQVSDSKDYKEPPPAPLFEPGELKSWSFYRAGIAEF  60

Query  400   IATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  579
             IATFLFLYITILTVMGVSKS SKC+TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61    IATFLFLYITILTVMGVSKSPSKCQTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  580   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGL  759
             FGLFLARKLSLTRA+FYMVMQCLGAICGAGVVKG+ K +Y  KGGGANVVAPGYTKGDGL
Sbjct  121   FGLFLARKLSLTRAIFYMVMQCLGAICGAGVVKGYQKGLYETKGGGANVVAPGYTKGDGL  180

Query  760   GAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPAR  939
             GAEI+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPAR
Sbjct  181   GAEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR  240

Query  940   SLGAAIIYNRDEAWNDHWIFWVGPF  1014
             SLGAAIIYN++ AW+DHWIFWVGPF
Sbjct  241   SLGAAIIYNKEHAWSDHWIFWVGPF  265



>ref|XP_009420459.1| PREDICTED: probable aquaporin PIP1-2 [Musa acuminata subsp. malaccensis]
Length=287

 Score =   476 bits (1225),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 234/264 (89%), Positives = 244/264 (92%), Gaps = 2/264 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ--DKDYTEAPPTALFEPSELSSWSFYRAGIAEFI  402
             ME +EEDVRLGANKF E+Q IGTAAQ  DKDY E PP  LFEP ELSSWSFYRAGIAEF+
Sbjct  1     MEGKEEDVRLGANKFTERQPIGTAAQSQDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFV  60

Query  403   ATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  582
             ATFLFLYITILTVMGV KS +KC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61    ATFLFLYITILTVMGVVKSSTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  583   GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLG  762
             GLFLARKLSLTRA+FYMVMQCLGAICGAGVVKGF K +Y   GGGANVVAPGYTKGDGLG
Sbjct  121   GLFLARKLSLTRALFYMVMQCLGAICGAGVVKGFQKGLYENNGGGANVVAPGYTKGDGLG  180

Query  763   AEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARS  942
             AEIVGTFILVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARS
Sbjct  181   AEIVGTFILVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS  240

Query  943   LGAAIIYNRDEAWNDHWIFWVGPF  1014
             LGAAIIYN+  AW+DHWIFWVGPF
Sbjct  241   LGAAIIYNKGHAWDDHWIFWVGPF  264



>gb|EYU41266.1| hypothetical protein MIMGU_mgv1a011292mg [Erythranthe guttata]
Length=286

 Score =   476 bits (1225),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 230/264 (87%), Positives = 246/264 (93%), Gaps = 2/264 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ--DKDYTEAPPTALFEPSELSSWSFYRAGIAEFI  402
             ME +EEDVR+GANK+ E+Q IGTAAQ  DKDY E PP  LFEP EL+SWSFYRAGIAEF+
Sbjct  1     MESKEEDVRVGANKYSERQPIGTAAQSQDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  60

Query  403   ATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  582
             ATFLFLYITILTVMGVSKSDSKC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61    ATFLFLYITILTVMGVSKSDSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  583   GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLG  762
             GLFLARKLSLTRAVFY+VMQCLGAICGAGVVKGFG+T+Y  KGGGAN VA GYTKG GLG
Sbjct  121   GLFLARKLSLTRAVFYIVMQCLGAICGAGVVKGFGETLYMTKGGGANTVAHGYTKGSGLG  180

Query  763   AEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARS  942
             AEI+GTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARS
Sbjct  181   AEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS  240

Query  943   LGAAIIYNRDEAWNDHWIFWVGPF  1014
             LGAAIIYN+  AW+DHW+FWVGPF
Sbjct  241   LGAAIIYNKSHAWDDHWVFWVGPF  264



>gb|AFM37319.1| aquaporin [Oryza sativa Japonica Group]
Length=289

 Score =   476 bits (1225),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 233/266 (88%), Positives = 245/266 (92%), Gaps = 4/266 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ----DKDYTEAPPTALFEPSELSSWSFYRAGIAE  396
             ME +EEDVRLGAN++ E+Q IGTAAQ    DKDY E PP  LFEP EL SWSFYRAGIAE
Sbjct  1     MEGKEEDVRLGANRYSERQPIGTAAQGAGDDKDYKEPPPAPLFEPGELKSWSFYRAGIAE  60

Query  397   FIATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  576
             F+ATFLFLYITILTVMGVSKS SKC TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAV
Sbjct  61    FVATFLFLYITILTVMGVSKSSSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAV  120

Query  577   TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDG  756
             TFGLFLARKLSLTRA+FY+VMQCLGAICGAGVVKGF + +Y G GGGANVVA GYTKGDG
Sbjct  121   TFGLFLARKLSLTRAIFYIVMQCLGAICGAGVVKGFQQGLYMGNGGGANVVASGYTKGDG  180

Query  757   LGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPA  936
             LGAEIVGTFILVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPA
Sbjct  181   LGAEIVGTFILVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPA  240

Query  937   RSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             RSLGAAIIYN+D AWNDHWIFWVGPF
Sbjct  241   RSLGAAIIYNKDHAWNDHWIFWVGPF  266



>ref|XP_006647654.1| PREDICTED: aquaporin PIP1-1-like isoform X2 [Oryza brachyantha]
Length=289

 Score =   476 bits (1225),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 233/266 (88%), Positives = 245/266 (92%), Gaps = 4/266 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ----DKDYTEAPPTALFEPSELSSWSFYRAGIAE  396
             ME +EEDVRLGAN+F E+Q IGTAAQ    DKDY E PP  LFEP EL SWSFYRAGIAE
Sbjct  1     MEGKEEDVRLGANRFSERQPIGTAAQGAGDDKDYKEPPPAPLFEPGELKSWSFYRAGIAE  60

Query  397   FIATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  576
             F+ATFLFLYIT+LTVMGVSKS SKC TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAV
Sbjct  61    FVATFLFLYITVLTVMGVSKSPSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAV  120

Query  577   TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDG  756
             TFGLFLARKLSLTRA+FY+VMQCLGAICGAGVVKGF + +Y G GGGANVVA GYTKGDG
Sbjct  121   TFGLFLARKLSLTRAIFYIVMQCLGAICGAGVVKGFQQGLYMGNGGGANVVASGYTKGDG  180

Query  757   LGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPA  936
             LGAEIVGTFILVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPA
Sbjct  181   LGAEIVGTFILVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPA  240

Query  937   RSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             RSLGAAIIYNRD AW+DHWIFWVGPF
Sbjct  241   RSLGAAIIYNRDHAWDDHWIFWVGPF  266



>ref|XP_008787474.1| PREDICTED: probable aquaporin PIP1-2 [Phoenix dactylifera]
Length=287

 Score =   476 bits (1224),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 232/264 (88%), Positives = 242/264 (92%), Gaps = 2/264 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ--DKDYTEAPPTALFEPSELSSWSFYRAGIAEFI  402
             ME +EEDVRLGANKF E+Q IGTAAQ  DKDY E PP  LFEP EL SWSFYRAGIAEF+
Sbjct  1     MEGKEEDVRLGANKFSERQPIGTAAQSQDKDYKEPPPAPLFEPGELQSWSFYRAGIAEFM  60

Query  403   ATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  582
             ATFLFLYITILTVMGV KS+SKC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61    ATFLFLYITILTVMGVVKSNSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  583   GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLG  762
             GL LARKLSLTRAVFYMVMQCLGAICGAGVVKGF K +Y   GGGANVVAPGYTKGDGLG
Sbjct  121   GLLLARKLSLTRAVFYMVMQCLGAICGAGVVKGFQKGLYESNGGGANVVAPGYTKGDGLG  180

Query  763   AEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARS  942
             AEI+GTF+LVYTV SATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARS
Sbjct  181   AEIIGTFVLVYTVLSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS  240

Query  943   LGAAIIYNRDEAWNDHWIFWVGPF  1014
             LGAAIIYN+D AW+D WIFWVGPF
Sbjct  241   LGAAIIYNKDHAWDDQWIFWVGPF  264



>ref|XP_004976483.1| PREDICTED: aquaporin PIP1-1-like [Setaria italica]
Length=288

 Score =   475 bits (1223),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 231/265 (87%), Positives = 245/265 (92%), Gaps = 3/265 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ---DKDYTEAPPTALFEPSELSSWSFYRAGIAEF  399
             ME +EEDVRLGANK+ E+Q IGTAAQ   DKDY E PP  LFEP EL SWSFYRAGIAEF
Sbjct  1     MEGKEEDVRLGANKYSERQPIGTAAQGSDDKDYKEPPPAPLFEPGELKSWSFYRAGIAEF  60

Query  400   IATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  579
             +ATFLFLYI+ILTVMGVSKS SKC TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAVT
Sbjct  61    VATFLFLYISILTVMGVSKSQSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVT  120

Query  580   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGL  759
             FGLFLARKLSLTRAVFYM+MQCLGAICGAGVVKGF + +Y G GGGAN+VA GYTKGDGL
Sbjct  121   FGLFLARKLSLTRAVFYMIMQCLGAICGAGVVKGFQQGLYMGNGGGANMVAAGYTKGDGL  180

Query  760   GAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPAR  939
             GAEIVGTFILVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPAR
Sbjct  181   GAEIVGTFILVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR  240

Query  940   SLGAAIIYNRDEAWNDHWIFWVGPF  1014
             SLGAA+IYNR +AW+DHWIFWVGPF
Sbjct  241   SLGAAVIYNRRQAWDDHWIFWVGPF  265



>ref|XP_009382780.1| PREDICTED: probable aquaporin PIP1-2 [Musa acuminata subsp. malaccensis]
Length=287

 Score =   475 bits (1223),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 233/264 (88%), Positives = 244/264 (92%), Gaps = 2/264 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ--DKDYTEAPPTALFEPSELSSWSFYRAGIAEFI  402
             ME +EEDVRLGAN+F E+Q IGTAAQ  DKDY E P   LFEP ELSSWSFYRAGIAEF+
Sbjct  1     MEGKEEDVRLGANRFSERQPIGTAAQSQDKDYKEPPLAPLFEPGELSSWSFYRAGIAEFV  60

Query  403   ATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  582
             ATFLFLYITILTVMGV KSD+KC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61    ATFLFLYITILTVMGVVKSDTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  583   GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLG  762
             GLFLARKLSLTRA+FYMVMQCLGAICGAGVVKGF K +Y   GGGANVVA GYTKGDGLG
Sbjct  121   GLFLARKLSLTRALFYMVMQCLGAICGAGVVKGFRKGLYESNGGGANVVAAGYTKGDGLG  180

Query  763   AEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARS  942
             AEIVGTFILVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARS
Sbjct  181   AEIVGTFILVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS  240

Query  943   LGAAIIYNRDEAWNDHWIFWVGPF  1014
             LGAA+IYN+D AW+DHWIFWVGPF
Sbjct  241   LGAAVIYNKDHAWDDHWIFWVGPF  264



>emb|CAH59432.1| aquaporin 2 [Plantago major]
Length=282

 Score =   475 bits (1222),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 232/260 (89%), Positives = 244/260 (94%), Gaps = 3/260 (1%)
 Frame = +1

Query  244   EDVRLGANKFPEKQAIGTAAQ---DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIATFL  414
             EDV LGANK+ E+Q IGTAAQ   DKDY E PP  LFEP ELSSWSFYRAGIAEF+ATFL
Sbjct  1     EDVNLGANKYSERQPIGTAAQTHDDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFVATFL  60

Query  415   FLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGLFL  594
             FLYIT+LTVMGVSKSDSKC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGLFL
Sbjct  61    FLYITVLTVMGVSKSDSKCATVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGLFL  120

Query  595   ARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGAEIV  774
             ARKLSLTRAVFYM+MQCLGAICGAGVVKGFG+T+Y  KGGGANVVA GYTKGDGLGAEI+
Sbjct  121   ARKLSLTRAVFYMIMQCLGAICGAGVVKGFGQTLYMTKGGGANVVAHGYTKGDGLGAEII  180

Query  775   GTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSLGAA  954
             GTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSLGAA
Sbjct  181   GTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAA  240

Query  955   IIYNRDEAWNDHWIFWVGPF  1014
             IIYNRD AW+DHWIFWVGPF
Sbjct  241   IIYNRDHAWDDHWIFWVGPF  260



>gb|AGT36590.1| aquaporin [Musa acuminata AAA Group]
Length=286

 Score =   475 bits (1222),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 233/263 (89%), Positives = 244/263 (93%), Gaps = 1/263 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDVRLGANKF E+Q IGTAAQ DK Y E PP  LFEP EL+SWSFYRAGIAEF+A
Sbjct  1     MEGKEEDVRLGANKFSERQPIGTAAQSDKGYKEPPPAPLFEPGELTSWSFYRAGIAEFMA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYITILTVMGV KS+SKC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITILTVMGVVKSNSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGA  765
             LFLARKLSLTRA+FYMVMQCLGAICGAGVVKG+ K +Y   GGGANVVAPGYTKGDGLGA
Sbjct  121   LFLARKLSLTRALFYMVMQCLGAICGAGVVKGYQKGLYESNGGGANVVAPGYTKGDGLGA  180

Query  766   EIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSL  945
             EIVGTFILVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSL
Sbjct  181   EIVGTFILVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSL  240

Query  946   GAAIIYNRDEAWNDHWIFWVGPF  1014
             GAAIIYN+  AW+DHWIFWVGPF
Sbjct  241   GAAIIYNKKHAWDDHWIFWVGPF  263



>ref|XP_009386050.1| PREDICTED: probable aquaporin PIP1-2 [Musa acuminata subsp. malaccensis]
Length=287

 Score =   474 bits (1221),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 233/264 (88%), Positives = 243/264 (92%), Gaps = 2/264 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ--DKDYTEAPPTALFEPSELSSWSFYRAGIAEFI  402
             ME +EEDVR+GANKFPE+Q IGTAAQ  +KDY E P   LFEP EL SWSFYRAGIAEF+
Sbjct  1     MEGKEEDVRVGANKFPERQPIGTAAQSEEKDYKEPPLAPLFEPGELKSWSFYRAGIAEFM  60

Query  403   ATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  582
             ATFLFLYITILTVMGV KS SKC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61    ATFLFLYITILTVMGVVKSSSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  583   GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLG  762
             GLFLARKLSLTRA+FYMVMQCLGAICGAGVVKGF K VY   GGGANVVA GY+KGDGLG
Sbjct  121   GLFLARKLSLTRAIFYMVMQCLGAICGAGVVKGFQKGVYENNGGGANVVAAGYSKGDGLG  180

Query  763   AEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARS  942
             AEIVGTFILVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARS
Sbjct  181   AEIVGTFILVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS  240

Query  943   LGAAIIYNRDEAWNDHWIFWVGPF  1014
             LGAAIIYN+D AW+DHWIFWVGPF
Sbjct  241   LGAAIIYNKDHAWDDHWIFWVGPF  264



>ref|NP_001289851.1| probable aquaporin PIP1-2 [Solanum lycopersicum]
 dbj|BAO18625.1| plasmamembrane intrinsic protein 1;7 [Solanum lycopersicum]
Length=286

 Score =   474 bits (1220),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 229/264 (87%), Positives = 243/264 (92%), Gaps = 2/264 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ--DKDYTEAPPTALFEPSELSSWSFYRAGIAEFI  402
             MEHREEDVRLGANK+ E+QAIG AAQ  DKDY E PP  LFEP EL SWSFYRAGIAEF+
Sbjct  1     MEHREEDVRLGANKYSERQAIGIAAQSEDKDYKEPPPAPLFEPGELMSWSFYRAGIAEFV  60

Query  403   ATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  582
             ATFLFLYIT+LTVMGVSKSDSKC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61    ATFLFLYITVLTVMGVSKSDSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  583   GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLG  762
             GLFLARKLSLTRAVFYMVMQCLGAICGA +VK FGKT+Y  KGGGANVV  GYTKGDGLG
Sbjct  121   GLFLARKLSLTRAVFYMVMQCLGAICGAALVKAFGKTLYQTKGGGANVVNVGYTKGDGLG  180

Query  763   AEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARS  942
             AEI+GTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIP+ GTGINPARS
Sbjct  181   AEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPVPGTGINPARS  240

Query  943   LGAAIIYNRDEAWNDHWIFWVGPF  1014
             LGAA+IYN ++AW D WIFWVGPF
Sbjct  241   LGAAVIYNNEQAWKDPWIFWVGPF  264



>gb|ACV60508.1| aquaporin [Triticum aestivum]
Length=290

 Score =   474 bits (1221),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 230/266 (86%), Positives = 245/266 (92%), Gaps = 4/266 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ----DKDYTEAPPTALFEPSELSSWSFYRAGIAE  396
             ME +EEDVRLGAN++ E+Q IGTAAQ    DKDY E PP  LFEP EL SWSFYRAGIAE
Sbjct  1     MEGKEEDVRLGANRYSERQPIGTAAQGGGDDKDYKEPPPAPLFEPGELKSWSFYRAGIAE  60

Query  397   FIATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  576
             FIATFLFLY+T+LTVMGVSKS SKC TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAV
Sbjct  61    FIATFLFLYVTVLTVMGVSKSPSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAV  120

Query  577   TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDG  756
             TFGLFLARKLSLTRA+FY++MQCLGAICGAGVVKGF + +Y G GGGANVVA GYTKGDG
Sbjct  121   TFGLFLARKLSLTRAIFYIIMQCLGAICGAGVVKGFQQGLYMGNGGGANVVASGYTKGDG  180

Query  757   LGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPA  936
             LGAEI+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPA
Sbjct  181   LGAEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPA  240

Query  937   RSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             RSLGAAIIYNRD AWNDHWIFWVGPF
Sbjct  241   RSLGAAIIYNRDHAWNDHWIFWVGPF  266



>ref|XP_002446929.1| hypothetical protein SORBIDRAFT_06g025150 [Sorghum bicolor]
 gb|EES11257.1| hypothetical protein SORBIDRAFT_06g025150 [Sorghum bicolor]
Length=288

 Score =   474 bits (1220),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 229/265 (86%), Positives = 246/265 (93%), Gaps = 3/265 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ---DKDYTEAPPTALFEPSELSSWSFYRAGIAEF  399
             ME +EEDVRLGANK+ E+Q IGTAAQ   DKDY E PP  LFEP EL SWSFYRAGIAEF
Sbjct  1     MEGKEEDVRLGANKYSERQPIGTAAQGTDDKDYKEPPPAPLFEPGELKSWSFYRAGIAEF  60

Query  400   IATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  579
             +ATFLFLYI+ILTVMGVSKS SKC TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAVT
Sbjct  61    VATFLFLYISILTVMGVSKSTSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVT  120

Query  580   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGL  759
             FGLFLARKLSLTRAVFY++MQCLGAICGAGVVKGF + +Y G GGGANVVAPGYTKGDGL
Sbjct  121   FGLFLARKLSLTRAVFYIIMQCLGAICGAGVVKGFQQGLYMGNGGGANVVAPGYTKGDGL  180

Query  760   GAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPAR  939
             GAEIVGTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPAR
Sbjct  181   GAEIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR  240

Query  940   SLGAAIIYNRDEAWNDHWIFWVGPF  1014
             SLGAA++YN++ AW+DHWIFWVGPF
Sbjct  241   SLGAAVVYNQNHAWSDHWIFWVGPF  265



>gb|AAO86706.1| plasma membrane intrinsic protein [Zea mays]
 gb|ACF82668.1| unknown [Zea mays]
 gb|ACF84488.1| unknown [Zea mays]
 tpg|DAA36473.1| TPA: aquaporin PIP1-1(ZmPIP1-1) [Zea mays]
Length=288

 Score =   474 bits (1220),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 232/265 (88%), Positives = 244/265 (92%), Gaps = 3/265 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ---DKDYTEAPPTALFEPSELSSWSFYRAGIAEF  399
             ME +EEDVRLGANKF E+Q IGTAAQ   DKDY E PP  LFEP EL SWSFYRAGIAEF
Sbjct  1     MEGKEEDVRLGANKFSERQPIGTAAQGTDDKDYKEPPPAPLFEPGELKSWSFYRAGIAEF  60

Query  400   IATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  579
             +ATFLFLYI+ILTVMGVSKS SKC TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAVT
Sbjct  61    VATFLFLYISILTVMGVSKSTSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVT  120

Query  580   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGL  759
             FGLFLARKLSLTRAVFY++MQCLGAICGAGVVKGF + +Y G GGGANVVAPGYTKGDGL
Sbjct  121   FGLFLARKLSLTRAVFYIIMQCLGAICGAGVVKGFQQGLYMGNGGGANVVAPGYTKGDGL  180

Query  760   GAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPAR  939
             GAEIVGTFILVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPAR
Sbjct  181   GAEIVGTFILVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR  240

Query  940   SLGAAIIYNRDEAWNDHWIFWVGPF  1014
             SLGAA+IYN+  AW DHWIFWVGPF
Sbjct  241   SLGAAVIYNQHHAWADHWIFWVGPF  265



>ref|XP_004953388.1| PREDICTED: aquaporin PIP1-2-like [Setaria italica]
Length=289

 Score =   474 bits (1220),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 231/266 (87%), Positives = 245/266 (92%), Gaps = 4/266 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ----DKDYTEAPPTALFEPSELSSWSFYRAGIAE  396
             ME +EEDVRLGANKF E+Q IGTAAQ    DKDY E PP  LFEP EL SWSFYRAGIAE
Sbjct  1     MEGKEEDVRLGANKFSERQPIGTAAQGAGDDKDYKEPPPAPLFEPGELKSWSFYRAGIAE  60

Query  397   FIATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  576
             F+ATFLFLYITILTVMGVSKS+SKC TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAV
Sbjct  61    FVATFLFLYITILTVMGVSKSNSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAV  120

Query  577   TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDG  756
             TFGLFLARKLSLTRA+FY++MQCLGAICGAGVVKGF + +Y G GGGANVVAPGYTKG G
Sbjct  121   TFGLFLARKLSLTRAIFYIIMQCLGAICGAGVVKGFQQGLYMGNGGGANVVAPGYTKGSG  180

Query  757   LGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPA  936
             LGAEIVGTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPA
Sbjct  181   LGAEIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPA  240

Query  937   RSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             RSLGAAIIYNR+ AW+ HWIFWVGPF
Sbjct  241   RSLGAAIIYNREHAWSHHWIFWVGPF  266



>sp|Q7XSQ9.3|PIP12_ORYSJ RecName: Full=Probable aquaporin PIP1-2; AltName: Full=OsPIP1;2; 
AltName: Full=Plasma membrane intrinsic protein 1-2 [Oryza 
sativa Japonica Group]
 emb|CAH68052.1| B0103C08-B0602B01.9 [Oryza sativa Indica Group]
 gb|EAY95145.1| hypothetical protein OsI_16963 [Oryza sativa Indica Group]
 gb|EAZ31617.1| hypothetical protein OsJ_15761 [Oryza sativa Japonica Group]
Length=288

 Score =   474 bits (1219),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 233/265 (88%), Positives = 243/265 (92%), Gaps = 3/265 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ---DKDYTEAPPTALFEPSELSSWSFYRAGIAEF  399
             ME +EEDVRLGANKF E+Q IGTAAQ   DKDY E PP  LFEP EL SWSFYRAGIAEF
Sbjct  1     MEGKEEDVRLGANKFSERQPIGTAAQGSDDKDYKEPPPAPLFEPGELKSWSFYRAGIAEF  60

Query  400   IATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  579
             +ATFLFLYIT+LTVMGV+ S SKC TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAVT
Sbjct  61    MATFLFLYITVLTVMGVNNSTSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVT  120

Query  580   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGL  759
             FGLFLARKLSLTRA+FYMVMQCLGAICGAGVVKGF K +Y   GGGANVVAPGYTKGDGL
Sbjct  121   FGLFLARKLSLTRALFYMVMQCLGAICGAGVVKGFQKGLYETTGGGANVVAPGYTKGDGL  180

Query  760   GAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPAR  939
             GAEIVGTFILVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPAR
Sbjct  181   GAEIVGTFILVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR  240

Query  940   SLGAAIIYNRDEAWNDHWIFWVGPF  1014
             SLGAAIIYNR  AW+DHWIFWVGPF
Sbjct  241   SLGAAIIYNRGHAWDDHWIFWVGPF  265



>ref|XP_010935853.1| PREDICTED: probable aquaporin PIP1-2 [Elaeis guineensis]
Length=287

 Score =   474 bits (1219),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 231/264 (88%), Positives = 241/264 (91%), Gaps = 2/264 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ--DKDYTEAPPTALFEPSELSSWSFYRAGIAEFI  402
             ME +EEDVRLG +KFPE+Q IGTAAQ  DKDY E PP  LFEP EL SWSFYRAGIAEF+
Sbjct  1     MEGKEEDVRLGVDKFPERQPIGTAAQTQDKDYKEPPPAPLFEPGELQSWSFYRAGIAEFM  60

Query  403   ATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  582
             ATFLFLYITILTVMGV KS SKC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61    ATFLFLYITILTVMGVVKSPSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  583   GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLG  762
             GL LARKLSL RA+FYMVMQCLGAICGAGVVKGF K +Y   GGGANVVAPGYTKGDGLG
Sbjct  121   GLLLARKLSLIRALFYMVMQCLGAICGAGVVKGFQKGLYESNGGGANVVAPGYTKGDGLG  180

Query  763   AEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARS  942
             AEI+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARS
Sbjct  181   AEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS  240

Query  943   LGAAIIYNRDEAWNDHWIFWVGPF  1014
             LGAAIIYNRD AW+D WIFWVGPF
Sbjct  241   LGAAIIYNRDHAWDDQWIFWVGPF  264



>dbj|BAA23746.2| HvPIP1;5 [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90537.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91636.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=290

 Score =   473 bits (1217),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 228/266 (86%), Positives = 245/266 (92%), Gaps = 4/266 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ----DKDYTEAPPTALFEPSELSSWSFYRAGIAE  396
             ME +EEDVRLGAN++ E+Q IGTAAQ    DKDY E PP  LFEP EL SWSFYRAGIAE
Sbjct  1     MEGKEEDVRLGANRYSERQPIGTAAQGGGDDKDYKEPPPAPLFEPGELKSWSFYRAGIAE  60

Query  397   FIATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  576
             FIATFLFLY+T+LTVMGVSK+ SKC TVG+QGIAW+FGGMIFALVYCTAGISGGHINPAV
Sbjct  61    FIATFLFLYVTVLTVMGVSKAPSKCATVGVQGIAWSFGGMIFALVYCTAGISGGHINPAV  120

Query  577   TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDG  756
             TFGLFLARKLSLTRA+FY++MQCLGAICGAGVVKGF + +Y G GGGANVVA GYTKGDG
Sbjct  121   TFGLFLARKLSLTRAIFYIIMQCLGAICGAGVVKGFQQGLYMGNGGGANVVASGYTKGDG  180

Query  757   LGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPA  936
             LGAEI+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPA
Sbjct  181   LGAEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPA  240

Query  937   RSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             RSLGAAIIYNRD AWNDHWIFWVGPF
Sbjct  241   RSLGAAIIYNRDHAWNDHWIFWVGPF  266



>ref|XP_010940492.1| PREDICTED: probable aquaporin PIP1-2 [Elaeis guineensis]
Length=287

 Score =   473 bits (1216),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 231/264 (88%), Positives = 242/264 (92%), Gaps = 2/264 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAA--QDKDYTEAPPTALFEPSELSSWSFYRAGIAEFI  402
             ME +EEDVRLGANKF E+Q IGTAA  QDKDY E PP  LFEP EL SWSFYRAGIAEF+
Sbjct  1     MEGKEEDVRLGANKFSERQPIGTAAPSQDKDYKEPPPAPLFEPGELRSWSFYRAGIAEFM  60

Query  403   ATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  582
             ATFLFLYITILTVMGV KS SKC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61    ATFLFLYITILTVMGVVKSKSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  583   GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLG  762
             GL LARKLSLTRA+FYMVMQCLGAICGAGVVKGF K +Y   GGGANVVAPGYTKGDGLG
Sbjct  121   GLLLARKLSLTRALFYMVMQCLGAICGAGVVKGFQKGIYESNGGGANVVAPGYTKGDGLG  180

Query  763   AEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARS  942
             AEI+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARS
Sbjct  181   AEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS  240

Query  943   LGAAIIYNRDEAWNDHWIFWVGPF  1014
             LGAAIIY++D AW+D WIFWVGPF
Sbjct  241   LGAAIIYDKDHAWDDQWIFWVGPF  264



>ref|XP_004954451.1| PREDICTED: aquaporin PIP1-5-like [Setaria italica]
 gb|AET81042.1| plasma membrane intrinsic protein 1 [Setaria italica]
Length=288

 Score =   472 bits (1215),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 228/265 (86%), Positives = 245/265 (92%), Gaps = 3/265 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ---DKDYTEAPPTALFEPSELSSWSFYRAGIAEF  399
             ME +EEDVRLGAN++ E+Q IGTAAQ   DKDY E PP  LFE  EL+SWSFYRAGIAEF
Sbjct  1     MEGKEEDVRLGANRYSERQPIGTAAQGSDDKDYKEPPPAPLFEAEELTSWSFYRAGIAEF  60

Query  400   IATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  579
             +ATFLFLYI+ILTVMGVSKS SKC TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAVT
Sbjct  61    VATFLFLYISILTVMGVSKSPSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVT  120

Query  580   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGL  759
             FGLFLARKLSLTRA+FYMVMQCLGAICGAGVVKGF +++Y G GGGAN V PGYTKGDGL
Sbjct  121   FGLFLARKLSLTRALFYMVMQCLGAICGAGVVKGFQQSLYMGNGGGANAVNPGYTKGDGL  180

Query  760   GAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPAR  939
             GAEIVGTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPAR
Sbjct  181   GAEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR  240

Query  940   SLGAAIIYNRDEAWNDHWIFWVGPF  1014
             SLGAAI+YNR +AWNDHWIFWVGPF
Sbjct  241   SLGAAIVYNRSQAWNDHWIFWVGPF  265



>gb|AFD32162.1| plasma membrane intrinsic protein [Chrysopogon zizanioides]
Length=288

 Score =   472 bits (1215),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 231/265 (87%), Positives = 244/265 (92%), Gaps = 3/265 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ---DKDYTEAPPTALFEPSELSSWSFYRAGIAEF  399
             ME + EDVRLGANKF E+Q IGTAAQ   DKDY E PP  LFEP EL SWSFYRAGIAEF
Sbjct  1     MEGKAEDVRLGANKFSERQPIGTAAQGTDDKDYKEPPPAPLFEPGELKSWSFYRAGIAEF  60

Query  400   IATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  579
             +ATFLFLYI+ILTVMGVSKS+SKC TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAVT
Sbjct  61    VATFLFLYISILTVMGVSKSNSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVT  120

Query  580   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGL  759
             FGLFLARKLSLTRAVFY++MQCLGAICGAGVVKGF + +Y G GGGANVVAPGYTKGDGL
Sbjct  121   FGLFLARKLSLTRAVFYIIMQCLGAICGAGVVKGFQQGLYMGNGGGANVVAPGYTKGDGL  180

Query  760   GAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPAR  939
             GAEIVGTFILVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPAR
Sbjct  181   GAEIVGTFILVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR  240

Query  940   SLGAAIIYNRDEAWNDHWIFWVGPF  1014
             SLGAA+IYN+  AW DHWIFWVGPF
Sbjct  241   SLGAAVIYNQHHAWADHWIFWVGPF  265



>ref|XP_009386408.1| PREDICTED: probable aquaporin PIP1-2 [Musa acuminata subsp. malaccensis]
Length=287

 Score =   472 bits (1214),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 230/264 (87%), Positives = 244/264 (92%), Gaps = 2/264 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ--DKDYTEAPPTALFEPSELSSWSFYRAGIAEFI  402
             ME REEDVR+GANKF E+QAIGTAAQ  D+DY E PP  LFEP+ELSSWSFYRAGIAEF+
Sbjct  1     MEGREEDVRVGANKFSERQAIGTAAQSQDRDYQEPPPAPLFEPAELSSWSFYRAGIAEFM  60

Query  403   ATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  582
             ATFLFLYI+ILTVMGV KS++KC TVGIQGIAWAFGGMIF LVYCTAGISGGHINPAVTF
Sbjct  61    ATFLFLYISILTVMGVVKSNTKCSTVGIQGIAWAFGGMIFILVYCTAGISGGHINPAVTF  120

Query  583   GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLG  762
             GL LARKLSLTRA+FYMVMQCLGAICGAGVVKGF K +Y   GGGANVVAPGYTKG GLG
Sbjct  121   GLLLARKLSLTRALFYMVMQCLGAICGAGVVKGFKKGLYENNGGGANVVAPGYTKGGGLG  180

Query  763   AEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARS  942
             AEIVGTFILVYTVFSATDAKR+ARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARS
Sbjct  181   AEIVGTFILVYTVFSATDAKRSARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARS  240

Query  943   LGAAIIYNRDEAWNDHWIFWVGPF  1014
             LGAAI+Y++  AWNDHWIFWVGPF
Sbjct  241   LGAAIVYDKSHAWNDHWIFWVGPF  264



>gb|AFM37320.1| aquaporin [Oryza sativa Japonica Group]
Length=289

 Score =   471 bits (1213),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 230/266 (86%), Positives = 244/266 (92%), Gaps = 4/266 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ----DKDYTEAPPTALFEPSELSSWSFYRAGIAE  396
             ME +EEDVRLGAN++ ++Q IGTAAQ    DKDY E PP  LFEP EL SWSFYRAGIAE
Sbjct  1     MEGKEEDVRLGANRYSDRQPIGTAAQGAGDDKDYKEPPPAPLFEPGELKSWSFYRAGIAE  60

Query  397   FIATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  576
             F+ATFLFLYITILTVMGVSKS SKC TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAV
Sbjct  61    FVATFLFLYITILTVMGVSKSSSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAV  120

Query  577   TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDG  756
             TFGLFLARKLSLTRA+FY+VMQCLGAICGAGVVKGF + +Y G GGGANVVA GYTKGDG
Sbjct  121   TFGLFLARKLSLTRAIFYIVMQCLGAICGAGVVKGFQQGLYMGNGGGANVVASGYTKGDG  180

Query  757   LGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPA  936
             LGAEIVGTFILVYTVFSATDAKRNARDSHVP+LAPLP+GFAVFLVHLATIPITGTGINPA
Sbjct  181   LGAEIVGTFILVYTVFSATDAKRNARDSHVPILAPLPVGFAVFLVHLATIPITGTGINPA  240

Query  937   RSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             RSL AAIIYN+D AWNDHWIFWVGPF
Sbjct  241   RSLCAAIIYNKDHAWNDHWIFWVGPF  266



>gb|AIP86906.1| aquaporin [Vitis heyneana]
Length=286

 Score =   471 bits (1212),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 230/264 (87%), Positives = 243/264 (92%), Gaps = 2/264 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ--DKDYTEAPPTALFEPSELSSWSFYRAGIAEFI  402
             ME +EEDVR+GANKF E+Q IGTAAQ  DKDY E PP  LFEP EL SWSFYRAGIAEFI
Sbjct  1     MEGKEEDVRVGANKFSERQPIGTAAQGDDKDYKEPPPAPLFEPGELCSWSFYRAGIAEFI  60

Query  403   ATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  582
             ATFLFLY+++LTVMGV ++DSKC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61    ATFLFLYVSVLTVMGVVRADSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  583   GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLG  762
             GLFLARKLSLTRAV+YMVMQCLGAICGAGVVKGF K  YN  GGGANVV  GYTKGDGLG
Sbjct  121   GLFLARKLSLTRAVYYMVMQCLGAICGAGVVKGFEKGRYNSLGGGANVVNAGYTKGDGLG  180

Query  763   AEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARS  942
             AEIVGTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARS
Sbjct  181   AEIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS  240

Query  943   LGAAIIYNRDEAWNDHWIFWVGPF  1014
             LGAAIIYN+D AW+DHWIFWVGPF
Sbjct  241   LGAAIIYNKDHAWDDHWIFWVGPF  264



>gb|AAF71817.1| putative aquaporin PIP1-1 [Vitis cinerea var. helleri x Vitis 
rupestris]
 gb|ABN14347.1| aquaporin PIP1;1 [Vitis vinifera]
 emb|CAN77353.1| hypothetical protein VITISV_038809 [Vitis vinifera]
Length=286

 Score =   471 bits (1212),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 230/264 (87%), Positives = 243/264 (92%), Gaps = 2/264 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ--DKDYTEAPPTALFEPSELSSWSFYRAGIAEFI  402
             ME +EEDVR+GANKF E+Q IGTAAQ  DKDY E PP  LFEP EL SWSFYRAGIAEFI
Sbjct  1     MEGKEEDVRVGANKFSERQPIGTAAQGDDKDYKEPPPAPLFEPGELCSWSFYRAGIAEFI  60

Query  403   ATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  582
             ATFLFLY+++LTVMGV ++DSKC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61    ATFLFLYVSVLTVMGVVRADSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  583   GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLG  762
             GLFLARKLSLTRAV+YMVMQCLGAICGAGVVKGF K  YN  GGGANVV  GYTKGDGLG
Sbjct  121   GLFLARKLSLTRAVYYMVMQCLGAICGAGVVKGFEKGRYNSLGGGANVVNAGYTKGDGLG  180

Query  763   AEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARS  942
             AEIVGTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARS
Sbjct  181   AEIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS  240

Query  943   LGAAIIYNRDEAWNDHWIFWVGPF  1014
             LGAAIIYN+D AW+DHWIFWVGPF
Sbjct  241   LGAAIIYNKDHAWDDHWIFWVGPF  264



>ref|NP_001267918.1| aquaporin-like [Vitis vinifera]
 gb|AEZ35024.1| plasma membrane 1;1 aquaporin [Vitis vinifera]
Length=286

 Score =   471 bits (1212),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 230/264 (87%), Positives = 243/264 (92%), Gaps = 2/264 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ--DKDYTEAPPTALFEPSELSSWSFYRAGIAEFI  402
             ME +EEDVR+GANKF E+Q IGTAAQ  DKDY E PP  LFEP EL SWSFYRAGIAEFI
Sbjct  1     MEGKEEDVRVGANKFSERQPIGTAAQGDDKDYKEPPPAPLFEPGELCSWSFYRAGIAEFI  60

Query  403   ATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  582
             ATFLFLY+++LTVMGV ++DSKC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61    ATFLFLYVSVLTVMGVVRADSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  583   GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLG  762
             GLFLARKLSLTRAV+YMVMQCLGAICGAGVVKGF K  YN  GGGANVV  GYTKGDGLG
Sbjct  121   GLFLARKLSLTRAVYYMVMQCLGAICGAGVVKGFEKGRYNSLGGGANVVNAGYTKGDGLG  180

Query  763   AEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARS  942
             AEIVGTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARS
Sbjct  181   AEIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS  240

Query  943   LGAAIIYNRDEAWNDHWIFWVGPF  1014
             LGAAIIYN+D AW+DHWIFWVGPF
Sbjct  241   LGAAIIYNKDHAWDDHWIFWVGPF  264



>gb|ABH09322.1| putative aquaporin [Vitis vinifera]
Length=286

 Score =   471 bits (1211),  Expect = 9e-164, Method: Compositional matrix adjust.
 Identities = 230/264 (87%), Positives = 243/264 (92%), Gaps = 2/264 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ--DKDYTEAPPTALFEPSELSSWSFYRAGIAEFI  402
             ME +EEDVR+GANKF E+Q IGTAAQ  DKDY E PP  LFEP EL SWSFYRAGIAEFI
Sbjct  1     MEGKEEDVRVGANKFSERQPIGTAAQGDDKDYKEPPPAPLFEPGELCSWSFYRAGIAEFI  60

Query  403   ATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  582
             ATFLFLY+++LTVMGV ++DSKC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61    ATFLFLYVSVLTVMGVVRADSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  583   GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLG  762
             GLFLARKLSLTRAV+YMVMQCLGAICGAGVVKGF K  YN  GGGANVV  GYTKGDGLG
Sbjct  121   GLFLARKLSLTRAVYYMVMQCLGAICGAGVVKGFEKGRYNSLGGGANVVNAGYTKGDGLG  180

Query  763   AEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARS  942
             AEIVGTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARS
Sbjct  181   AEIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS  240

Query  943   LGAAIIYNRDEAWNDHWIFWVGPF  1014
             LGAAIIYN+D AW+DHWIFWVGPF
Sbjct  241   LGAAIIYNKDHAWDDHWIFWVGPF  264



>dbj|BAA24016.1| water channel protein [Oryza sativa Japonica Group]
Length=289

 Score =   471 bits (1211),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 231/266 (87%), Positives = 243/266 (91%), Gaps = 4/266 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ----DKDYTEAPPTALFEPSELSSWSFYRAGIAE  396
             ME +EEDVR  AN++ E+Q IGTAAQ    DKDY E PP  LFEP EL SWSFYRAGIAE
Sbjct  1     MEGKEEDVRPRANRYSERQPIGTAAQGAGDDKDYKEPPPAPLFEPGELKSWSFYRAGIAE  60

Query  397   FIATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  576
             F+ATFLFLYITILTVMGVSKS SKC TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAV
Sbjct  61    FVATFLFLYITILTVMGVSKSSSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAV  120

Query  577   TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDG  756
             TFGLFLARKLSLTRA+FY+VMQCLGAICGAGVVKGF + +Y G GGGANVVA GYTKGDG
Sbjct  121   TFGLFLARKLSLTRAIFYIVMQCLGAICGAGVVKGFQQGLYMGNGGGANVVASGYTKGDG  180

Query  757   LGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPA  936
             LGAEIVGTFILVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPA
Sbjct  181   LGAEIVGTFILVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPA  240

Query  937   RSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             RSLGAAIIYN+D AWNDHWIFWVGPF
Sbjct  241   RSLGAAIIYNKDHAWNDHWIFWVGPF  266



>gb|AFM37318.1| aquaporin [Oryza sativa Japonica Group]
Length=289

 Score =   471 bits (1211),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 231/266 (87%), Positives = 243/266 (91%), Gaps = 4/266 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ----DKDYTEAPPTALFEPSELSSWSFYRAGIAE  396
             ME +EEDVRLGAN++ + Q IGTAAQ    DKDY E PP  LFEP EL SWSFYRAGIAE
Sbjct  1     MEGKEEDVRLGANRYSDMQPIGTAAQGAGDDKDYKEPPPAPLFEPGELKSWSFYRAGIAE  60

Query  397   FIATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  576
             F+ATFLFLYITILTVMGVSKS SKC TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAV
Sbjct  61    FVATFLFLYITILTVMGVSKSSSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAV  120

Query  577   TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDG  756
             TFGLFLARKLSLTRA+FY+VMQCLGAICGAGVVKGF + +Y G GGGANVVA GYTKGDG
Sbjct  121   TFGLFLARKLSLTRAIFYIVMQCLGAICGAGVVKGFQQGLYMGNGGGANVVASGYTKGDG  180

Query  757   LGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPA  936
             LGAEIVGTFILVYTVFSATDAKRNARDSHVP+ APLPIGFAVFLVHLATIPITGTGINPA
Sbjct  181   LGAEIVGTFILVYTVFSATDAKRNARDSHVPIPAPLPIGFAVFLVHLATIPITGTGINPA  240

Query  937   RSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             RSLGAAIIYN+D AWNDHWIFWVGPF
Sbjct  241   RSLGAAIIYNKDHAWNDHWIFWVGPF  266



>emb|CAA04652.1| major intrinsic protein PIPa2 [Craterostigma plantagineum]
Length=287

 Score =   470 bits (1209),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 230/265 (87%), Positives = 245/265 (92%), Gaps = 3/265 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ---DKDYTEAPPTALFEPSELSSWSFYRAGIAEF  399
             ME +EEDVRLGANKF E+  IGTAAQ   DKDYTE PP  LFEP ELSSWSFYRAGIAEF
Sbjct  1     MEAKEEDVRLGANKFSERNPIGTAAQTHDDKDYTEPPPAPLFEPGELSSWSFYRAGIAEF  60

Query  400   IATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  579
             +ATFLFLYITILTVMGV+++ +KC +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61    MATFLFLYITILTVMGVNRAPNKCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  580   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGL  759
             FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF K  YN +GGGANVVA GYTKGDGL
Sbjct  121   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFYKPTYNLEGGGANVVANGYTKGDGL  180

Query  760   GAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPAR  939
             GAEI+GTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPAR
Sbjct  181   GAEILGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR  240

Query  940   SLGAAIIYNRDEAWNDHWIFWVGPF  1014
             SLGAAIIYN D AW+DHW+FWVGPF
Sbjct  241   SLGAAIIYNHDRAWHDHWVFWVGPF  265



>gb|AAZ91447.1| PIP1 aquaporin [Xerophyta humilis]
Length=286

 Score =   469 bits (1206),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 229/263 (87%), Positives = 242/263 (92%), Gaps = 1/263 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDVRLGANKF E+Q IGT+AQ ++DY E PP  LFEP ELSSWSFYRAGIAEFIA
Sbjct  1     MEGKEEDVRLGANKFSERQPIGTSAQTERDYVEPPPAPLFEPGELSSWSFYRAGIAEFIA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYITILTVMGV KS +KC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITILTVMGVVKSPTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGA  765
             LFLARKLSLTRA+FYMVMQ LGAICGAGVVKGF K +Y  +GGGAN V PGYTKGDGLGA
Sbjct  121   LFLARKLSLTRALFYMVMQRLGAICGAGVVKGFQKGLYMSQGGGANAVNPGYTKGDGLGA  180

Query  766   EIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSL  945
             EI+GTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSL
Sbjct  181   EIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSL  240

Query  946   GAAIIYNRDEAWNDHWIFWVGPF  1014
             GAAIIYNR  AWNDHWIFWVGPF
Sbjct  241   GAAIIYNRSHAWNDHWIFWVGPF  263



>gb|AFH36340.1| aquaporin PIP1;2 [Quercus petraea]
Length=286

 Score =   468 bits (1205),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 228/263 (87%), Positives = 243/263 (92%), Gaps = 1/263 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDV++GANK+ E+Q +GT+AQ DKDY E PP  LFEP ELSSWSFYRAGIAEFIA
Sbjct  1     MEGKEEDVKVGANKYSERQPLGTSAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFIA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYITILTVMG +KS +KC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITILTVMGYNKSTNKCTTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGA  765
             L LARKLSLTRAVFY++MQCLGAICGAGVVKGFG T Y G GGGANVV  GYTKGDGLGA
Sbjct  121   LLLARKLSLTRAVFYIIMQCLGAICGAGVVKGFGPTFYEGNGGGANVVNHGYTKGDGLGA  180

Query  766   EIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSL  945
             EIVGTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSL
Sbjct  181   EIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSL  240

Query  946   GAAIIYNRDEAWNDHWIFWVGPF  1014
             GAAIIYN+D AW+DHWIFWVGPF
Sbjct  241   GAAIIYNKDHAWDDHWIFWVGPF  263



>ref|XP_006648149.1| PREDICTED: aquaporin PIP 1-3-like [Oryza brachyantha]
Length=288

 Score =   468 bits (1205),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 229/265 (86%), Positives = 243/265 (92%), Gaps = 3/265 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ---DKDYTEAPPTALFEPSELSSWSFYRAGIAEF  399
             ME +EEDVRLGAN++ E+Q IGTAAQ   +KDY E P   LFE  EL+SWSFYRAGIAEF
Sbjct  1     MEGKEEDVRLGANRYTERQPIGTAAQGTEEKDYREPPAAPLFEAEELASWSFYRAGIAEF  60

Query  400   IATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  579
             +ATFLFLYI+ILTVMGVSKS SKC +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61    VATFLFLYISILTVMGVSKSASKCGSVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  580   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGL  759
             FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF KT+Y G GGGAN V PGYTKGDGL
Sbjct  121   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFQKTLYMGSGGGANAVNPGYTKGDGL  180

Query  760   GAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPAR  939
             GAEIVGTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPAR
Sbjct  181   GAEIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR  240

Query  940   SLGAAIIYNRDEAWNDHWIFWVGPF  1014
             SLGAAI+YNR  AW+DHWIFWVGPF
Sbjct  241   SLGAAIVYNRAHAWHDHWIFWVGPF  265



>ref|NP_001105131.1| aquaporin PIP1-5 [Zea mays]
 sp|Q9AR14.1|PIP15_MAIZE RecName: Full=Aquaporin PIP1-5; AltName: Full=Plasma membrane 
intrinsic protein 1-5; AltName: Full=ZmPIP1-5; AltName: Full=ZmPIP1-5b; 
AltName: Full=ZmPIP1;5 [Zea mays]
 emb|CAC33802.1| plasma membrane intrinsic protein [Zea mays]
 gb|AAK26756.1| plasma membrane integral protein ZmPIP1-5 [Zea mays]
 gb|ACF78166.1| unknown [Zea mays]
 gb|ACR34169.1| unknown [Zea mays]
 gb|AFW63933.1| plasma membrane intrinsic protein1 [Zea mays]
Length=288

 Score =   468 bits (1205),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 227/265 (86%), Positives = 243/265 (92%), Gaps = 3/265 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ---DKDYTEAPPTALFEPSELSSWSFYRAGIAEF  399
             ME +EEDVRLGAN++ E+Q IGTAAQ   +KDY E PP  LFE  EL+SWSFYRAGIAEF
Sbjct  1     MEGKEEDVRLGANRYSERQPIGTAAQGTEEKDYKEPPPAPLFEAEELTSWSFYRAGIAEF  60

Query  400   IATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  579
             +ATFLFLYI+ILTVMGVSKS SKC TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAVT
Sbjct  61    VATFLFLYISILTVMGVSKSSSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVT  120

Query  580   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGL  759
             FGLFLARKLSLTRA+FYMVMQCLGAICGAGVVKGF + +Y G GGGAN V PGYTKGDGL
Sbjct  121   FGLFLARKLSLTRALFYMVMQCLGAICGAGVVKGFQEGLYMGAGGGANAVNPGYTKGDGL  180

Query  760   GAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPAR  939
             GAEIVGTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPAR
Sbjct  181   GAEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR  240

Query  940   SLGAAIIYNRDEAWNDHWIFWVGPF  1014
             SLGAAI+YNR  AWNDHWIFWVGPF
Sbjct  241   SLGAAIVYNRSHAWNDHWIFWVGPF  265



>gb|AFV92901.1| putative PIP-type aquaporin [Lolium perenne]
Length=288

 Score =   468 bits (1205),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 228/265 (86%), Positives = 241/265 (91%), Gaps = 3/265 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ---DKDYTEAPPTALFEPSELSSWSFYRAGIAEF  399
             ME +EEDVRLGANKF E+Q IGTAAQ   DKDY E PP  LFEP EL SWSFYRAGIAEF
Sbjct  1     MEGKEEDVRLGANKFSERQPIGTAAQGSEDKDYKEPPPAPLFEPGELKSWSFYRAGIAEF  60

Query  400   IATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  579
             +ATFLFLY+TILTVMGV+ S SKC TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAVT
Sbjct  61    MATFLFLYVTILTVMGVNNSPSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVT  120

Query  580   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGL  759
             FGLFLARKLSLTRAVFY+VMQCLGAICGAGVVKGF + +Y   GGGAN V PGYTKGDGL
Sbjct  121   FGLFLARKLSLTRAVFYIVMQCLGAICGAGVVKGFQQGLYMSSGGGANAVNPGYTKGDGL  180

Query  760   GAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPAR  939
             GAEIVGTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPAR
Sbjct  181   GAEIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR  240

Query  940   SLGAAIIYNRDEAWNDHWIFWVGPF  1014
             SLGAAIIYNR+  W+DHWIFWVGPF
Sbjct  241   SLGAAIIYNREHTWSDHWIFWVGPF  265



>gb|ACZ51371.1| plasma membrane intrinsic protein [Triticum aestivum]
 gb|AEG80463.1| plasma membrane intrinsic protein [Leymus chinensis]
Length=288

 Score =   468 bits (1205),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 227/265 (86%), Positives = 243/265 (92%), Gaps = 3/265 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ---DKDYTEAPPTALFEPSELSSWSFYRAGIAEF  399
             ME +EEDVRLGANK+ E+Q IGTAAQ   DKDY E PP  LFEP EL SWSFYRAGIAEF
Sbjct  1     MEGKEEDVRLGANKYSERQPIGTAAQGSEDKDYKEPPPAPLFEPGELKSWSFYRAGIAEF  60

Query  400   IATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  579
             +ATFLFLY+TILTVMG S + SKC TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAVT
Sbjct  61    MATFLFLYVTILTVMGYSGATSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVT  120

Query  580   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGL  759
             FGLFLARKLSLTRAVFY++MQCLGAICGAGVVKGF + +Y G GGGANVVAPGYTKG GL
Sbjct  121   FGLFLARKLSLTRAVFYIIMQCLGAICGAGVVKGFQQGLYMGNGGGANVVAPGYTKGSGL  180

Query  760   GAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPAR  939
             GAEI+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPAR
Sbjct  181   GAEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR  240

Query  940   SLGAAIIYNRDEAWNDHWIFWVGPF  1014
             SLGAAIIYNR+ AW+DHWIFWVGPF
Sbjct  241   SLGAAIIYNREHAWSDHWIFWVGPF  265



>ref|XP_010262799.1| PREDICTED: probable aquaporin PIP1-2 [Nelumbo nucifera]
Length=286

 Score =   468 bits (1204),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 230/264 (87%), Positives = 243/264 (92%), Gaps = 2/264 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ--DKDYTEAPPTALFEPSELSSWSFYRAGIAEFI  402
             ME +EEDVR+GANK+ EKQ IGTAAQ  D+DY E PP  LFEP ELSSWSFYRAGIAEF+
Sbjct  1     MEGKEEDVRVGANKYSEKQPIGTAAQSDDRDYKEPPPAPLFEPGELSSWSFYRAGIAEFM  60

Query  403   ATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  582
             ATFLFLYITILTVMGVS+S +KC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61    ATFLFLYITILTVMGVSRSSNKCATVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  583   GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLG  762
             GL LARKLSLTRA+FYMVMQCLGAICGAGVVKGF KT Y   GGGANVVA GYTKGDGLG
Sbjct  121   GLLLARKLSLTRALFYMVMQCLGAICGAGVVKGFQKTQYEMLGGGANVVAHGYTKGDGLG  180

Query  763   AEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARS  942
             AEIVGTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARS
Sbjct  181   AEIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS  240

Query  943   LGAAIIYNRDEAWNDHWIFWVGPF  1014
             LGAAIIY++  AW+DHWIFWVGPF
Sbjct  241   LGAAIIYDKAHAWHDHWIFWVGPF  264



>gb|ABW34453.1| aquaporin 1.1 [Triticum turgidum]
Length=290

 Score =   468 bits (1204),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 226/266 (85%), Positives = 243/266 (91%), Gaps = 4/266 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ----DKDYTEAPPTALFEPSELSSWSFYRAGIAE  396
             ME +EEDVRLGAN++ E+Q IGTAAQ    D DY E PP  LFEP EL SWSFYRAGIAE
Sbjct  1     MEGKEEDVRLGANRYSERQPIGTAAQGGGDDNDYKEPPPAPLFEPGELKSWSFYRAGIAE  60

Query  397   FIATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  576
             FIATFLFLY+T+LTVMGVS+S SKC TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAV
Sbjct  61    FIATFLFLYVTVLTVMGVSRSPSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAV  120

Query  577   TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDG  756
             TFGLFLARKLSLTRA+FY++MQCLGAICGAGVVKGF + +Y G GGGANVVA GYTKGDG
Sbjct  121   TFGLFLARKLSLTRAIFYIIMQCLGAICGAGVVKGFQQGLYMGNGGGANVVASGYTKGDG  180

Query  757   LGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPA  936
             LGAEI+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPA
Sbjct  181   LGAEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPA  240

Query  937   RSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             RSLGAAIIYNR+ AWND WIFWVGPF
Sbjct  241   RSLGAAIIYNRNNAWNDQWIFWVGPF  266



>gb|ABJ98538.1| PIP1 protein [Stipa tianschanica var. gobica]
Length=288

 Score =   468 bits (1204),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 227/266 (85%), Positives = 244/266 (92%), Gaps = 4/266 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ----DKDYTEAPPTALFEPSELSSWSFYRAGIAE  396
             ME +EEDVRLGAN++ E+Q IGTAAQ    +KDY E PP  LFE  EL+SWSFYRAGIAE
Sbjct  1     MEGKEEDVRLGANRYSERQPIGTAAQGGGEEKDYKEPPPAPLFEAEELTSWSFYRAGIAE  60

Query  397   FIATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  576
             F+ATFLFLYI+ILTVMGV+ S SKC TVGIQGIAW+FGGMIF LVYCTAGISGGHINPAV
Sbjct  61    FLATFLFLYISILTVMGVNNSSSKCGTVGIQGIAWSFGGMIFVLVYCTAGISGGHINPAV  120

Query  577   TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDG  756
             TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  T+Y GKGGGAN VAPGYTKGDG
Sbjct  121   TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFQTTLYMGKGGGANSVAPGYTKGDG  180

Query  757   LGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPA  936
             LGAEIVGTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPA
Sbjct  181   LGAEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPA  240

Query  937   RSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             RSLGAAIIYNR ++W+DHWIFWVGPF
Sbjct  241   RSLGAAIIYNRSQSWDDHWIFWVGPF  266



>gb|ABJ98535.1| PIP1 protein [Stipa baicalensis]
 gb|ABJ98536.1| PIP1 protein [Stipa krylovii]
 gb|ABJ98537.1| PIP1 protein [Stipa bungeana]
 gb|ABJ98539.1| PIP1 protein [Stipa grandis]
Length=288

 Score =   468 bits (1204),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 227/266 (85%), Positives = 244/266 (92%), Gaps = 4/266 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ----DKDYTEAPPTALFEPSELSSWSFYRAGIAE  396
             ME +EEDVRLGAN++ E+Q IGTAAQ    +KDY E PP  LFE  EL+SWSFYRAGIAE
Sbjct  1     MEGKEEDVRLGANRYSERQPIGTAAQGGGEEKDYKEPPPAPLFEAEELTSWSFYRAGIAE  60

Query  397   FIATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  576
             F+ATFLFLYI+ILTVMGVS S SKC TVGIQGIAW+FGGMIF LVYCTAGISGGHINPAV
Sbjct  61    FLATFLFLYISILTVMGVSNSSSKCGTVGIQGIAWSFGGMIFVLVYCTAGISGGHINPAV  120

Query  577   TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDG  756
             TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  T+Y GKGGGAN VAPGYTKGDG
Sbjct  121   TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFQTTLYMGKGGGANSVAPGYTKGDG  180

Query  757   LGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPA  936
             LGAEIVGTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPA
Sbjct  181   LGAEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPA  240

Query  937   RSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             RSLGAAIIYN+ ++W+DHWIFWVGPF
Sbjct  241   RSLGAAIIYNKSQSWDDHWIFWVGPF  266



>ref|XP_009763188.1| PREDICTED: aquaporin PIP1-2 [Nicotiana sylvestris]
 tpg|DAA64672.1| TPA_exp: aquaporin PIP1 5 [Nicotiana tabacum]
Length=287

 Score =   468 bits (1203),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 223/262 (85%), Positives = 244/262 (93%), Gaps = 0/262 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQDKDYTEAPPTALFEPSELSSWSFYRAGIAEFIAT  408
             ME +EEDV++GANK+ E+Q +GT+AQ KDY E PP  LFEP EL SWSF+RAGIAEF+AT
Sbjct  1     MEGKEEDVKVGANKYSERQPLGTSAQSKDYKEPPPAPLFEPGELHSWSFWRAGIAEFMAT  60

Query  409   FLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  588
             FLFLYIT+LTVMG S+++SKC TVG+QGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL
Sbjct  61    FLFLYITVLTVMGYSRANSKCSTVGVQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  120

Query  589   FLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGAE  768
             FLARKLSLTRAVFY+VMQCLGAICGAGVVKGF  ++Y  KGGGANVV  GYTKGDGLGAE
Sbjct  121   FLARKLSLTRAVFYIVMQCLGAICGAGVVKGFQPSLYQVKGGGANVVNHGYTKGDGLGAE  180

Query  769   IVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSLG  948
             IVGTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSLG
Sbjct  181   IVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLG  240

Query  949   AAIIYNRDEAWNDHWIFWVGPF  1014
             AAIIYNRD+AW+DHWIFWVGPF
Sbjct  241   AAIIYNRDQAWDDHWIFWVGPF  262



>gb|AEO13899.1| aquaporin 8 [Triticum aestivum]
Length=288

 Score =   468 bits (1203),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 226/265 (85%), Positives = 243/265 (92%), Gaps = 3/265 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ---DKDYTEAPPTALFEPSELSSWSFYRAGIAEF  399
             ME +EEDVRLGANK+ E+Q IGTAAQ   DKDY E PP  LFEP EL SWSFYRAGIAEF
Sbjct  1     MEGKEEDVRLGANKYSERQPIGTAAQGSEDKDYKEPPPAPLFEPGELKSWSFYRAGIAEF  60

Query  400   IATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  579
             +ATFLFLY+TILTVMG S + SKC +VGIQGIAW+FGGMIFALVYCTAGISGGHINPAVT
Sbjct  61    MATFLFLYVTILTVMGYSGATSKCASVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVT  120

Query  580   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGL  759
             FGLFLARKLSLTRAVFY++MQCLGAICGAGVVKGF + +Y G GGGANVVAPGYTKG GL
Sbjct  121   FGLFLARKLSLTRAVFYIIMQCLGAICGAGVVKGFQQGLYMGNGGGANVVAPGYTKGSGL  180

Query  760   GAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPAR  939
             GAEI+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPAR
Sbjct  181   GAEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR  240

Query  940   SLGAAIIYNRDEAWNDHWIFWVGPF  1014
             SLGAAIIYNR+ AW+DHWIFWVGPF
Sbjct  241   SLGAAIIYNREHAWSDHWIFWVGPF  265



>dbj|BAG68659.1| plasma membrane intrinsic protein [Tulipa gesneriana]
Length=286

 Score =   468 bits (1203),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 231/265 (87%), Positives = 243/265 (92%), Gaps = 3/265 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ--DKDYTEAPPTALFEPSELSSWSFYRAGIAEFI  402
             ME +EEDVRLGANKF E+Q IGT+AQ  DKDYTE PP  LFEP EL+SWSFYRAGIAEF+
Sbjct  1     MEGKEEDVRLGANKFTERQPIGTSAQTQDKDYTEPPPAPLFEPGELASWSFYRAGIAEFV  60

Query  403   ATFLFLYITILTVMGVSKSDSK-CKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  579
             ATFLFLYITILTVMGVSKS +K C TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61    ATFLFLYITILTVMGVSKSPTKKCTTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  580   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGL  759
             FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKG  KT+Y G GGGAN V  GYTKG GL
Sbjct  121   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGHQKTLYMGAGGGANAVNHGYTKGSGL  180

Query  760   GAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPAR  939
             GAEI+GTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPAR
Sbjct  181   GAEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR  240

Query  940   SLGAAIIYNRDEAWNDHWIFWVGPF  1014
             SLGAAIIYN+D  WNDHWIFWVGPF
Sbjct  241   SLGAAIIYNKDHTWNDHWIFWVGPF  265



>gb|AEH76327.1| plasma membrane intrinsic protein 1 [Jatropha curcas]
Length=289

 Score =   468 bits (1203),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 229/266 (86%), Positives = 245/266 (92%), Gaps = 4/266 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ---DKDYTEAPPTALFEPSELSSWSFYRAGIAEF  399
             ME +EEDVRLGANKF E Q IGTAAQ   DKDYTE PP  LFEP+EL+SWSFYRAGIAEF
Sbjct  1     MEGKEEDVRLGANKFRETQPIGTAAQSQDDKDYTEPPPAPLFEPTELTSWSFYRAGIAEF  60

Query  400   IATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  579
             IATFLFLYI++LTVMGV K+ +KC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61    IATFLFLYISVLTVMGVVKAPTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  580   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGDG  756
             FGLFLARKLSLTRA++YMVMQCLGAICGAGVVKGF G+  Y   GGGAN VAPGYTKGDG
Sbjct  121   FGLFLARKLSLTRAIYYMVMQCLGAICGAGVVKGFEGRKQYTLLGGGANSVAPGYTKGDG  180

Query  757   LGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPA  936
             LGAEIVGTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPA
Sbjct  181   LGAEIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPA  240

Query  937   RSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             RSLGAAII+N+D+ W+DHWIFWVGPF
Sbjct  241   RSLGAAIIFNKDQGWDDHWIFWVGPF  266



>gb|AAB86380.1| aquaporin-like transmembrane channel protein [Medicago sativa]
Length=290

 Score =   468 bits (1203),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 229/267 (86%), Positives = 245/267 (92%), Gaps = 5/267 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQD----KDYTEAPPTALFEPSELSSWSFYRAGIAE  396
             ME +E+DV LGANKFPE+Q IG AAQ     KDY E PP  LFEPSEL+SWSFYRAGIAE
Sbjct  1     MEAKEQDVSLGANKFPERQPIGIAAQSHDDGKDYKEPPPAPLFEPSELTSWSFYRAGIAE  60

Query  397   FIATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  576
             F+ATFLFLYIT+LTVMGV++S+SKCKTVGIQGIAW+FGGMIFALVYCTAGISGGHINPAV
Sbjct  61    FVATFLFLYITLLTVMGVNRSESKCKTVGIQGIAWSFGGMIFALVYCTAGISGGHINPAV  120

Query  577   TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGD  753
             TFGLFLARKLSLTRA+FYMVMQ LGAICGAGVVKGF GKT Y  K GGAN VAPGYTKGD
Sbjct  121   TFGLFLARKLSLTRALFYMVMQTLGAICGAGVVKGFEGKTFYTNKNGGANFVAPGYTKGD  180

Query  754   GLGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINP  933
             GLGAEIVGTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINP
Sbjct  181   GLGAEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINP  240

Query  934   ARSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             ARSLGAAII+N+D  WNDHWIFWVGPF
Sbjct  241   ARSLGAAIIFNKDLGWNDHWIFWVGPF  267



>ref|XP_003600863.1| Aquaporin protein PIP11 [Medicago truncatula]
 gb|AES71114.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=290

 Score =   468 bits (1203),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 230/267 (86%), Positives = 245/267 (92%), Gaps = 5/267 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQD----KDYTEAPPTALFEPSELSSWSFYRAGIAE  396
             ME +E+DV LGANKFPE+Q IG AAQ     KDY E PP  LFEPSEL+SWSFYRAGIAE
Sbjct  1     MEAKEQDVSLGANKFPERQPIGIAAQSHDDGKDYKEPPPAPLFEPSELTSWSFYRAGIAE  60

Query  397   FIATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  576
             F+ATFLFLYITILTVMGV++S+SKCKTVGIQGIAW+FGGMIFALVYCTAGISGGHINPAV
Sbjct  61    FVATFLFLYITILTVMGVNRSESKCKTVGIQGIAWSFGGMIFALVYCTAGISGGHINPAV  120

Query  577   TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGD  753
             TFGLFLARKLSLTRAVFYMVMQ LGAICGAGVVKGF GKT Y  K GGAN VAPGYTKGD
Sbjct  121   TFGLFLARKLSLTRAVFYMVMQTLGAICGAGVVKGFEGKTFYTNKNGGANFVAPGYTKGD  180

Query  754   GLGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINP  933
             GLGAEIVGTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINP
Sbjct  181   GLGAEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINP  240

Query  934   ARSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             ARSLGAAII+N+D  W+DHWIFWVGPF
Sbjct  241   ARSLGAAIIFNKDLGWDDHWIFWVGPF  267



>gb|AFH36339.1| aquaporin PIP1;1 [Quercus petraea]
Length=289

 Score =   468 bits (1203),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 229/267 (86%), Positives = 243/267 (91%), Gaps = 5/267 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQD-----KDYTEAPPTALFEPSELSSWSFYRAGIA  393
             ME +EEDVRLGANKFPE+Q IGTAAQ      KDY E PP  LFEP EL+SWSFYRAGIA
Sbjct  1     MEGKEEDVRLGANKFPERQPIGTAAQSQDDEAKDYKEPPPAPLFEPGELTSWSFYRAGIA  60

Query  394   EFIATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPA  573
             EF+ATFLFLYITILTVMGV KS +KC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPA
Sbjct  61    EFVATFLFLYITILTVMGVVKSPTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPA  120

Query  574   VTFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGD  753
             VTFGLFLARKLSLTRAV+Y+VMQCLGAICGAGVVKGF K+ Y  + GGAN VAPGYTKGD
Sbjct  121   VTFGLFLARKLSLTRAVYYIVMQCLGAICGAGVVKGFEKSQYEIQKGGANFVAPGYTKGD  180

Query  754   GLGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINP  933
             GLGAEIVGTF+LV+TVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINP
Sbjct  181   GLGAEIVGTFVLVHTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINP  240

Query  934   ARSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             ARSLGAAIIYNRD AW+D WIFWVGPF
Sbjct  241   ARSLGAAIIYNRDHAWDDQWIFWVGPF  267



>gb|ACJ84222.1| unknown [Medicago truncatula]
Length=290

 Score =   468 bits (1203),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 230/267 (86%), Positives = 245/267 (92%), Gaps = 5/267 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQD----KDYTEAPPTALFEPSELSSWSFYRAGIAE  396
             ME +E+DV LGANKFPE+Q IG AAQ     KDY E PP  LFEPSEL+SWSFYRAGIAE
Sbjct  1     MEAKEQDVSLGANKFPERQPIGIAAQSHDDGKDYKEPPPAPLFEPSELTSWSFYRAGIAE  60

Query  397   FIATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  576
             F+ATFLFLYITILTVMGV++S+SKCKTVGIQGIAW+FGGMIFALVYCTAGISGGHINPAV
Sbjct  61    FVATFLFLYITILTVMGVNRSESKCKTVGIQGIAWSFGGMIFALVYCTAGISGGHINPAV  120

Query  577   TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGD  753
             TFGLFLARKLSLTRAVFYMVMQ LGAICGAGVVKGF GKT Y  K GGAN VAPGYTKGD
Sbjct  121   TFGLFLARKLSLTRAVFYMVMQTLGAICGAGVVKGFEGKTFYTNKNGGANFVAPGYTKGD  180

Query  754   GLGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINP  933
             GLGAEIVGTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINP
Sbjct  181   GLGAEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINP  240

Query  934   ARSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             ARSLGAAII+N+D  W+DHWIFWVGPF
Sbjct  241   ARSLGAAIIFNKDLGWDDHWIFWVGPF  267



>ref|XP_006429323.1| hypothetical protein CICLE_v10012384mg [Citrus clementina]
 ref|XP_006480986.1| PREDICTED: probable aquaporin PIP1-2-like [Citrus sinensis]
 gb|ESR42563.1| hypothetical protein CICLE_v10012384mg [Citrus clementina]
 gb|KDO53256.1| hypothetical protein CISIN_1g023069mg [Citrus sinensis]
Length=287

 Score =   467 bits (1202),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 225/265 (85%), Positives = 243/265 (92%), Gaps = 3/265 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQD---KDYTEAPPTALFEPSELSSWSFYRAGIAEF  399
             ME +EEDVR+GAN++ E Q IGTAAQ    KDYTE PP  LFEP ELSSWSFYRAGIAEF
Sbjct  1     MEGKEEDVRVGANRYRESQPIGTAAQTQDVKDYTEPPPAPLFEPGELSSWSFYRAGIAEF  60

Query  400   IATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  579
             +ATFLFLYIT+LTVMGVSKS SKC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61    VATFLFLYITVLTVMGVSKSKSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  580   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGL  759
             FGLFLARKLSLTRAVFYM+MQCLGAICGA VVKGF K+ Y   GGGAN+++ GY+KGDGL
Sbjct  121   FGLFLARKLSLTRAVFYMIMQCLGAICGAAVVKGFQKSQYEMLGGGANMLSKGYSKGDGL  180

Query  760   GAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPAR  939
             GAEIVGTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPAR
Sbjct  181   GAEIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR  240

Query  940   SLGAAIIYNRDEAWNDHWIFWVGPF  1014
             SLGAA+IYN+D+AW+DHWIFW GPF
Sbjct  241   SLGAALIYNKDQAWDDHWIFWAGPF  265



>gb|KDP44816.1| hypothetical protein JCGZ_01316 [Jatropha curcas]
Length=287

 Score =   467 bits (1202),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 229/266 (86%), Positives = 245/266 (92%), Gaps = 4/266 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ---DKDYTEAPPTALFEPSELSSWSFYRAGIAEF  399
             ME +EEDVRLGANKF E Q IGTAAQ   DKDYTE PP  LFEP+EL+SWSFYRAGIAEF
Sbjct  1     MEGKEEDVRLGANKFRETQPIGTAAQSQDDKDYTEPPPAPLFEPTELTSWSFYRAGIAEF  60

Query  400   IATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  579
             IATFLFLYI++LTVMGV K+ +KC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61    IATFLFLYISVLTVMGVVKAPTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  580   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGDG  756
             FGLFLARKLSLTRA++YMVMQCLGAICGAGVVKGF G+  Y   GGGAN VAPGYTKGDG
Sbjct  121   FGLFLARKLSLTRAIYYMVMQCLGAICGAGVVKGFEGRKQYTLLGGGANSVAPGYTKGDG  180

Query  757   LGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPA  936
             LGAEIVGTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPA
Sbjct  181   LGAEIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPA  240

Query  937   RSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             RSLGAAII+N+D+ W+DHWIFWVGPF
Sbjct  241   RSLGAAIIFNKDQGWDDHWIFWVGPF  266



>gb|AFK38136.1| unknown [Medicago truncatula]
Length=290

 Score =   467 bits (1202),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 229/267 (86%), Positives = 245/267 (92%), Gaps = 5/267 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQD----KDYTEAPPTALFEPSELSSWSFYRAGIAE  396
             ME +E+DV LGANKFPE+Q IG AAQ     KDY E PP  LFEPSEL+SWSFYRAGIAE
Sbjct  1     MEAKEQDVSLGANKFPERQPIGIAAQSHDDGKDYKEPPPAPLFEPSELTSWSFYRAGIAE  60

Query  397   FIATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  576
             F+ATFLFLYITILTVMGV++S+SKCKTVGIQGIAW+FGGM+FALVYCTAGISGGHINPAV
Sbjct  61    FVATFLFLYITILTVMGVNRSESKCKTVGIQGIAWSFGGMVFALVYCTAGISGGHINPAV  120

Query  577   TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGD  753
             TFGLFLARKLSLTRAVFYMVMQ LGAICGAGVVKGF GKT Y  K GGAN VAPGYTKGD
Sbjct  121   TFGLFLARKLSLTRAVFYMVMQTLGAICGAGVVKGFEGKTFYTNKNGGANFVAPGYTKGD  180

Query  754   GLGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINP  933
             GLGAEIVGTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINP
Sbjct  181   GLGAEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINP  240

Query  934   ARSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             ARSLGAAII+N+D  W+DHWIFWVGPF
Sbjct  241   ARSLGAAIIFNKDLGWDDHWIFWVGPF  267



>gb|KDP25424.1| hypothetical protein JCGZ_20580 [Jatropha curcas]
Length=287

 Score =   466 bits (1200),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 229/264 (87%), Positives = 244/264 (92%), Gaps = 2/264 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDVRLGANKF E+Q IGTAAQ DKDY E PP  LFEP ELSSWSFYRAGIAEF+A
Sbjct  1     MEGKEEDVRLGANKFTERQPIGTAAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFVA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYIT+LTVMGVSKS +KC TVG QGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITVLTVMGVSKSGNKCATVGTQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGDGLG  762
             LFLARKLSLTRA+FY++MQCLGAICGAGVVKGF G  VY   GGGANVVA GYTKGDGLG
Sbjct  121   LFLARKLSLTRALFYIIMQCLGAICGAGVVKGFEGNRVYESLGGGANVVASGYTKGDGLG  180

Query  763   AEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARS  942
             AEIVGTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARS
Sbjct  181   AEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS  240

Query  943   LGAAIIYNRDEAWNDHWIFWVGPF  1014
             LGAAII+N+D AW+DHW+FWVGPF
Sbjct  241   LGAAIIFNKDHAWDDHWVFWVGPF  264



>ref|XP_006439529.1| hypothetical protein CICLE_v10021502mg [Citrus clementina]
 gb|ESR52769.1| hypothetical protein CICLE_v10021502mg [Citrus clementina]
Length=287

 Score =   466 bits (1200),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 229/264 (87%), Positives = 243/264 (92%), Gaps = 2/264 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDV+LGANKF E+Q IGT+AQ DKDY E PP  LFEP EL SWSFYRAGIAEF+A
Sbjct  1     MEGKEEDVKLGANKFSERQPIGTSAQSDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFMA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYIT+LTVMGVSKS++KC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITVLTVMGVSKSNTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGDGLG  762
             L LARKLSLTRAVFYMVMQCLGAICGAGVVKGF G   Y   GGGANVVA GYTKGDGLG
Sbjct  121   LLLARKLSLTRAVFYMVMQCLGAICGAGVVKGFEGSKNYERLGGGANVVAHGYTKGDGLG  180

Query  763   AEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARS  942
             AEI+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARS
Sbjct  181   AEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS  240

Query  943   LGAAIIYNRDEAWNDHWIFWVGPF  1014
             LGAAII+N+D AW+DHWIFWVGPF
Sbjct  241   LGAAIIFNKDHAWDDHWIFWVGPF  264



>gb|ABJ98541.1| PIP1 protein [Stipa tianschanica var. klemenzii]
Length=288

 Score =   466 bits (1200),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 226/266 (85%), Positives = 243/266 (91%), Gaps = 4/266 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ----DKDYTEAPPTALFEPSELSSWSFYRAGIAE  396
             ME +EEDVRLGAN++ E+Q IGTAAQ    +KDY E PP  LFE  EL+SWSFYRAGIAE
Sbjct  1     MEGKEEDVRLGANRYSERQPIGTAAQGGGEEKDYKEPPPAPLFEAEELTSWSFYRAGIAE  60

Query  397   FIATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  576
             F+ATFLFLYI+ILTVMGVS S SKC TVGIQGIAW+FGGMIF LVYCTAGISGGHINPAV
Sbjct  61    FLATFLFLYISILTVMGVSNSSSKCGTVGIQGIAWSFGGMIFVLVYCTAGISGGHINPAV  120

Query  577   TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDG  756
             TFGLFLARKLSLTR VFYMVMQCLGAICGAGVVKGF  T+Y GKGGGAN VAPGYTKGDG
Sbjct  121   TFGLFLARKLSLTRVVFYMVMQCLGAICGAGVVKGFQTTLYMGKGGGANSVAPGYTKGDG  180

Query  757   LGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPA  936
             LGAEIVGTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPA
Sbjct  181   LGAEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPA  240

Query  937   RSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             RSLGAAIIYN+ ++W+DHWIFWVGPF
Sbjct  241   RSLGAAIIYNKSQSWDDHWIFWVGPF  266



>ref|XP_010523742.1| PREDICTED: aquaporin PIP1-1 [Tarenaya hassleriana]
 ref|XP_010523743.1| PREDICTED: aquaporin PIP1-1 [Tarenaya hassleriana]
 ref|XP_010523744.1| PREDICTED: aquaporin PIP1-1 [Tarenaya hassleriana]
 ref|XP_010523746.1| PREDICTED: aquaporin PIP1-1 [Tarenaya hassleriana]
 ref|XP_010523747.1| PREDICTED: aquaporin PIP1-1 [Tarenaya hassleriana]
 ref|XP_010523748.1| PREDICTED: aquaporin PIP1-1 [Tarenaya hassleriana]
Length=286

 Score =   466 bits (1199),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 225/263 (86%), Positives = 242/263 (92%), Gaps = 1/263 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDVR+GANKFPE+Q IGT+AQ DKDY E PP  LFEP ELSSWSF+RAGIAEFIA
Sbjct  1     MEGKEEDVRVGANKFPERQPIGTSAQTDKDYKEPPPAPLFEPGELSSWSFWRAGIAEFIA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLY+T+LTVMGV +S S C +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYVTVLTVMGVKRSPSMCSSVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGA  765
             LFLARKLSLTRAV+YMVMQCLGAICGAGVVKGF  + Y  +GGGAN V  GYTKGDGLGA
Sbjct  121   LFLARKLSLTRAVYYMVMQCLGAICGAGVVKGFQPSQYQIQGGGANTVNHGYTKGDGLGA  180

Query  766   EIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSL  945
             EI+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSL
Sbjct  181   EIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSL  240

Query  946   GAAIIYNRDEAWNDHWIFWVGPF  1014
             GAAIIYN+D AW+DHWIFWVGPF
Sbjct  241   GAAIIYNKDHAWDDHWIFWVGPF  263



>ref|XP_006476548.1| PREDICTED: probable aquaporin PIP1-2-like isoform X1 [Citrus 
sinensis]
 gb|KDO76244.1| hypothetical protein CISIN_1g023107mg [Citrus sinensis]
Length=287

 Score =   466 bits (1199),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 228/264 (86%), Positives = 243/264 (92%), Gaps = 2/264 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDV+LGANKF E+Q IGT+AQ DKDY E PP  LFEP EL SWSFYRAGIAEF+A
Sbjct  1     MEGKEEDVKLGANKFSERQPIGTSAQSDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFMA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYIT+LTVMGVSKS++KC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITVLTVMGVSKSNTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGDGLG  762
             L LARKLSLTRAVFYMVMQCLGA+CGAGVVKGF G   Y   GGGANVVA GYTKGDGLG
Sbjct  121   LLLARKLSLTRAVFYMVMQCLGAVCGAGVVKGFEGSKNYERLGGGANVVAHGYTKGDGLG  180

Query  763   AEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARS  942
             AEI+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARS
Sbjct  181   AEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS  240

Query  943   LGAAIIYNRDEAWNDHWIFWVGPF  1014
             LGAAII+N+D AW+DHWIFWVGPF
Sbjct  241   LGAAIIFNKDHAWDDHWIFWVGPF  264



>ref|XP_009383904.1| PREDICTED: probable aquaporin PIP1-2 [Musa acuminata subsp. malaccensis]
Length=287

 Score =   466 bits (1198),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 227/264 (86%), Positives = 240/264 (91%), Gaps = 2/264 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ--DKDYTEAPPTALFEPSELSSWSFYRAGIAEFI  402
             ME +EEDVRLGAN+F E+Q IGTAAQ  +KDY E PP  LFEP+E  SWSFYRAGIAEF+
Sbjct  1     MEGKEEDVRLGANRFSERQPIGTAAQNQEKDYKEPPPAPLFEPAEFFSWSFYRAGIAEFM  60

Query  403   ATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  582
             ATFLFLYITILTVMGV KS +KC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61    ATFLFLYITILTVMGVVKSTTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  583   GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLG  762
             GL LARKLSL RA+FYMVMQCLGAICGAGVVKGF K +Y   GGGANVVA GYTKGDGLG
Sbjct  121   GLLLARKLSLNRALFYMVMQCLGAICGAGVVKGFQKGLYQSNGGGANVVAAGYTKGDGLG  180

Query  763   AEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARS  942
             AEIVGTFILVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARS
Sbjct  181   AEIVGTFILVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS  240

Query  943   LGAAIIYNRDEAWNDHWIFWVGPF  1014
              GAA+IYN+D AW+DHWIFWVGPF
Sbjct  241   FGAAVIYNKDHAWDDHWIFWVGPF  264



>ref|XP_002509815.1| Aquaporin PIP1.3, putative [Ricinus communis]
 gb|EEF51202.1| Aquaporin PIP1.3, putative [Ricinus communis]
Length=287

 Score =   466 bits (1198),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 230/264 (87%), Positives = 242/264 (92%), Gaps = 2/264 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDVRLGANKF E+Q IGT+AQ DKDY E PP  LFEP ELSSWSFYRAGIAEF+A
Sbjct  1     MEGKEEDVRLGANKFTERQPIGTSAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFMA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYIT+LTVMGVSKS +KC TVG QGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITVLTVMGVSKSGNKCATVGTQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGDGLG  762
             LFLARKLSLTRA+FYMVMQCLGAICGAGVVKGF G   Y   GGGANVV  GYTKGDGLG
Sbjct  121   LFLARKLSLTRALFYMVMQCLGAICGAGVVKGFEGDRTYETLGGGANVVNAGYTKGDGLG  180

Query  763   AEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARS  942
             AEIVGTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARS
Sbjct  181   AEIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS  240

Query  943   LGAAIIYNRDEAWNDHWIFWVGPF  1014
             LGAAII+N+D AW+DHWIFWVGPF
Sbjct  241   LGAAIIFNKDHAWDDHWIFWVGPF  264



>emb|CAA54233.1| transmembrane protein [Hordeum vulgare subsp. vulgare]
Length=288

 Score =   465 bits (1197),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 226/265 (85%), Positives = 242/265 (91%), Gaps = 3/265 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ---DKDYTEAPPTALFEPSELSSWSFYRAGIAEF  399
             ME +EEDVRLGANK+ E+ AIGTAAQ   DKDY E PP  LFEP EL SWSFYRAGIAEF
Sbjct  1     MEGKEEDVRLGANKYSERHAIGTAAQGSEDKDYKEPPPAPLFEPGELKSWSFYRAGIAEF  60

Query  400   IATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  579
             +ATFLFLY+TILTVMG S + SKC TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAVT
Sbjct  61    MATFLFLYVTILTVMGYSGAASKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVT  120

Query  580   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGL  759
             FGLFLARKLSLTRAVFY++MQCLGAICGAGVVKGF + +Y G GGGANVVA GYTKG GL
Sbjct  121   FGLFLARKLSLTRAVFYIIMQCLGAICGAGVVKGFQQGLYMGNGGGANVVASGYTKGSGL  180

Query  760   GAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPAR  939
             GAEI+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPAR
Sbjct  181   GAEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR  240

Query  940   SLGAAIIYNRDEAWNDHWIFWVGPF  1014
             SLGAAIIYNR+ AW+DHWIFWVGPF
Sbjct  241   SLGAAIIYNREHAWSDHWIFWVGPF  265



>dbj|BAF41978.1| aquaporin [Hordeum vulgare]
Length=288

 Score =   465 bits (1197),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 226/265 (85%), Positives = 242/265 (91%), Gaps = 3/265 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ---DKDYTEAPPTALFEPSELSSWSFYRAGIAEF  399
             ME +EEDVRLGANK+ E+Q IGTAAQ   DKDY E PP  LFEP EL SWSFYRAGIAEF
Sbjct  1     MEGKEEDVRLGANKYSERQPIGTAAQGSEDKDYKEPPPAPLFEPGELKSWSFYRAGIAEF  60

Query  400   IATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  579
             +ATFLFLY+TILTVMG S + SKC TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAVT
Sbjct  61    MATFLFLYVTILTVMGYSGAASKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVT  120

Query  580   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGL  759
             FGLFLARKLSLTRAVFY++MQCLGAICGAGVVKGF + +Y G GGGANVVA GYTKG GL
Sbjct  121   FGLFLARKLSLTRAVFYIIMQCLGAICGAGVVKGFQQGLYMGNGGGANVVASGYTKGSGL  180

Query  760   GAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPAR  939
             GAEI+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPAR
Sbjct  181   GAEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR  240

Query  940   SLGAAIIYNRDEAWNDHWIFWVGPF  1014
             SLGAAIIYNR+ AW+DHWIFWVGPF
Sbjct  241   SLGAAIIYNREHAWSDHWIFWVGPF  265



>gb|EMS49467.1| Aquaporin PIP1-2 [Triticum urartu]
Length=492

 Score =   473 bits (1217),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 226/265 (85%), Positives = 243/265 (92%), Gaps = 3/265 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ---DKDYTEAPPTALFEPSELSSWSFYRAGIAEF  399
             ME +EEDVRLGANK+ E+Q IGTAAQ   DKDY E PP  LFEP EL SWSFYRAGIAEF
Sbjct  205   MEGKEEDVRLGANKYSERQPIGTAAQGSEDKDYKEPPPAPLFEPGELKSWSFYRAGIAEF  264

Query  400   IATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  579
             +ATFLFLY+TILTVMG S + SKC +VGIQGIAW+FGGMIFALVYCTAGISGGHINPAVT
Sbjct  265   MATFLFLYVTILTVMGYSGATSKCASVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVT  324

Query  580   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGL  759
             FGLFLARKLSLTRAVFY++MQCLGAICGAGVVKGF + +Y G GGGANVVAPGYTKG GL
Sbjct  325   FGLFLARKLSLTRAVFYIIMQCLGAICGAGVVKGFQQGLYMGNGGGANVVAPGYTKGSGL  384

Query  760   GAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPAR  939
             GAEI+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPAR
Sbjct  385   GAEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR  444

Query  940   SLGAAIIYNRDEAWNDHWIFWVGPF  1014
             SLGAAIIYNR+ AW+DHWIFWVGPF
Sbjct  445   SLGAAIIYNREHAWSDHWIFWVGPF  469



>gb|ABJ98540.1| PIP1 protein [Stipa breviflora]
Length=287

 Score =   465 bits (1197),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 228/265 (86%), Positives = 242/265 (91%), Gaps = 3/265 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ---DKDYTEAPPTALFEPSELSSWSFYRAGIAEF  399
             ME +EEDVRLGANKF E+Q +GTAAQ   DKDY E PP  LFEP EL SWSFYRAGIAEF
Sbjct  1     MEGKEEDVRLGANKFSERQPVGTAAQGSNDKDYKEPPPAPLFEPGELKSWSFYRAGIAEF  60

Query  400   IATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  579
              ATFLFLYI+ILTVMGVS S SKC TVGIQGIAW+FGGMIF LVYCTAGISGGHINPAVT
Sbjct  61    PATFLFLYISILTVMGVSNSSSKCGTVGIQGIAWSFGGMIFVLVYCTAGISGGHINPAVT  120

Query  580   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGL  759
             FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  T+Y GKGGGAN VAPGYTKGDGL
Sbjct  121   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFQTTLYMGKGGGANSVAPGYTKGDGL  180

Query  760   GAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPAR  939
             GAEIVGTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLV+LATIPITGTGINPAR
Sbjct  181   GAEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVYLATIPITGTGINPAR  240

Query  940   SLGAAIIYNRDEAWNDHWIFWVGPF  1014
             SLGAAIIYN+ ++W+DHWIF VGPF
Sbjct  241   SLGAAIIYNKSQSWDDHWIFRVGPF  265



>gb|KHG25052.1| putative aquaporin PIP1-2 [Gossypium arboreum]
Length=287

 Score =   465 bits (1196),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 229/264 (87%), Positives = 242/264 (92%), Gaps = 2/264 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDV+LGANKF E+Q IGT+AQ DKDY E PP  LFEP EL SWSFYRAGIAEF+A
Sbjct  1     MEGKEEDVKLGANKFSERQPIGTSAQTDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFVA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYIT+LTVMGVS+S +KC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITVLTVMGVSQSKTKCTTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGDGLG  762
             L LARKLSLTRAVFYM+MQCLGAICGAGVVKGF G + Y   GGGANVV  GYTKGDGLG
Sbjct  121   LLLARKLSLTRAVFYMIMQCLGAICGAGVVKGFEGDSRYEMLGGGANVVNHGYTKGDGLG  180

Query  763   AEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARS  942
             AEIVGTFILVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARS
Sbjct  181   AEIVGTFILVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS  240

Query  943   LGAAIIYNRDEAWNDHWIFWVGPF  1014
             LGAAIIYN+D AW+DHWIFWVGPF
Sbjct  241   LGAAIIYNKDHAWDDHWIFWVGPF  264



>gb|ACV66985.1| plasma membrane aquaporin 1 [Hevea brasiliensis]
Length=287

 Score =   465 bits (1196),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 229/264 (87%), Positives = 242/264 (92%), Gaps = 2/264 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDVRLGANKF E+Q IGT+AQ DKDY E PP  LFEP ELSSWSFYRAGIAEFIA
Sbjct  1     MEGKEEDVRLGANKFTERQPIGTSAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFIA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYIT+LTVMG SK ++KC TVG QGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITVLTVMGFSKPNNKCTTVGTQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGDGLG  762
             LFLARKLSLTRA+FYM+MQCLGAICGAGVVKGF G   Y   GGGANVVA GYTKGDGLG
Sbjct  121   LFLARKLSLTRALFYMIMQCLGAICGAGVVKGFEGNRAYETLGGGANVVAHGYTKGDGLG  180

Query  763   AEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARS  942
             AEIVGTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARS
Sbjct  181   AEIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS  240

Query  943   LGAAIIYNRDEAWNDHWIFWVGPF  1014
             LGAAII+N+D AW+DHWIFWVGPF
Sbjct  241   LGAAIIFNKDHAWDDHWIFWVGPF  264



>emb|CDY15165.1| BnaC05g00440D [Brassica napus]
Length=324

 Score =   466 bits (1199),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 231/302 (76%), Positives = 256/302 (85%), Gaps = 8/302 (3%)
 Frame = +1

Query  112   LLTHSPLHYCNNFTQRSTLNFAELSFSW**FGRSIEELRMEHREEDVRLGANKFPEKQAI  291
             L++HS   +C    +R   NF              ++ +ME +EEDVR+GANKFPE+Q I
Sbjct  7     LISHSLTIHCR--IKRKPQNFNVQRER-----ERKDKGKMEGKEEDVRVGANKFPERQPI  59

Query  292   GTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIATFLFLYITILTVMGVSKSDSK  468
             GT+AQ DKDY E PP  LFEP ELSSWSF+RAGIAEFIATFLFLYIT+LTVMGV ++ + 
Sbjct  60    GTSAQTDKDYKEPPPAPLFEPGELSSWSFWRAGIAEFIATFLFLYITVLTVMGVKRAPNM  119

Query  469   CKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGLFLARKLSLTRAVFYMVMQCL  648
             C +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGLFLARKLSLTRAVFYMVMQCL
Sbjct  120   CASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGLFLARKLSLTRAVFYMVMQCL  179

Query  649   GAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGAEIVGTFILVYTVFSATDAKRN  828
             GAICGAGVVKGF  + Y   GGGAN VAPGYTKG GLGAEI+GTF+LVYTVFSATDAKR+
Sbjct  180   GAICGAGVVKGFQPSPYQTLGGGANTVAPGYTKGSGLGAEIIGTFVLVYTVFSATDAKRS  239

Query  829   ARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIYNRDEAWNDHWIFWVG  1008
             ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIYN+D +W+DHWIFWVG
Sbjct  240   ARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIYNKDHSWDDHWIFWVG  299

Query  1009  PF  1014
             PF
Sbjct  300   PF  301



>ref|NP_001105022.1| aquaporin PIP1-3/PIP1-4 [Zea mays]
 sp|Q9AQU5.1|PIP13_MAIZE RecName: Full=Aquaporin PIP1-3/PIP1-4; AltName: Full=Plasma membrane 
intrinsic protein 1-3; AltName: Full=Plasma membrane 
intrinsic protein 1-4; AltName: Full=ZmPIP1-3; AltName: Full=ZmPIP1-4; 
AltName: Full=ZmPIP1;3; AltName: Full=ZmPIP1;4 [Zea 
mays]
 gb|AAK26754.1| plasma membrane integral protein ZmPIP1-3 [Zea mays]
 gb|AAK26755.1| plasma membrane integral protein ZmPIP1-4 [Zea mays]
 gb|ACF85817.1| unknown [Zea mays]
 gb|AFW63313.1| plasma membrane intrinsic protein1 isoform 1 [Zea mays]
 gb|AFW63314.1| plasma membrane intrinsic protein1 isoform 2 [Zea mays]
Length=292

 Score =   465 bits (1196),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 233/269 (87%), Positives = 245/269 (91%), Gaps = 7/269 (3%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQD-------KDYTEAPPTALFEPSELSSWSFYRAG  387
             ME +EEDVRLGANKF E+Q IGTAAQ        KDY E PP  LFEP EL SWSFYRAG
Sbjct  1     MEGKEEDVRLGANKFSERQPIGTAAQGAGAGDDDKDYKEPPPAPLFEPGELKSWSFYRAG  60

Query  388   IAEFIATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHIN  567
             IAEF+ATFLFLYIT+LTVMGVSKS SKC TVGIQGIAW+FGGMIFALVYCTAGISGGHIN
Sbjct  61    IAEFVATFLFLYITVLTVMGVSKSTSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHIN  120

Query  568   PAVTFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTK  747
             PAVTFGLFLARKLSLTRA+FY++MQCLGAICGAGVVKGF + +Y G GGGANVVAPGYTK
Sbjct  121   PAVTFGLFLARKLSLTRAIFYIIMQCLGAICGAGVVKGFQQGLYMGNGGGANVVAPGYTK  180

Query  748   GDGLGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGI  927
             GDGLGAEIVGTFILVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGI
Sbjct  181   GDGLGAEIVGTFILVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGI  240

Query  928   NPARSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             NPARSLGAAIIYNRD AW+DHWIFWVGPF
Sbjct  241   NPARSLGAAIIYNRDHAWSDHWIFWVGPF  269



>ref|XP_010544738.1| PREDICTED: aquaporin PIP1-1-like [Tarenaya hassleriana]
Length=286

 Score =   464 bits (1194),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 225/263 (86%), Positives = 242/263 (92%), Gaps = 1/263 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDVR+GANKFPE+Q IGT+AQ DKDY E PP  LFEP ELSSWSF+RAGIAEFIA
Sbjct  1     MEGKEEDVRVGANKFPERQPIGTSAQTDKDYKEPPPAPLFEPGELSSWSFWRAGIAEFIA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYIT+LTVMGV +S S C +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITVLTVMGVKRSPSMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGA  765
             LFLARKLSLTRAV+YMVMQCLGAICGAGVVKGF  + Y  +GGGAN V  GYTKGDGLGA
Sbjct  121   LFLARKLSLTRAVYYMVMQCLGAICGAGVVKGFQPSQYQIQGGGANTVNHGYTKGDGLGA  180

Query  766   EIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSL  945
             EI+GTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSL
Sbjct  181   EIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSL  240

Query  946   GAAIIYNRDEAWNDHWIFWVGPF  1014
             GAAIIYN+D AW+DHWIFWVGPF
Sbjct  241   GAAIIYNKDHAWDDHWIFWVGPF  263



>ref|XP_003616586.1| Aquaporin PIP11 [Medicago truncatula]
 gb|AAK66766.1|AF386739_1 aquaporin protein PIP1;1 [Medicago truncatula]
 gb|AES99544.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=289

 Score =   464 bits (1194),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 228/267 (85%), Positives = 244/267 (91%), Gaps = 5/267 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQD----KDYTEAPPTALFEPSELSSWSFYRAGIAE  396
             ME +E+DV LGANKFPE+Q +G AAQ     KDY E PP  LFEPSEL+SWSFYRAGIAE
Sbjct  1     MEAKEQDVSLGANKFPERQPLGIAAQSQDDPKDYQEPPPAPLFEPSELTSWSFYRAGIAE  60

Query  397   FIATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  576
             F+ATFLFLYIT+LTVMGV ++DSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV
Sbjct  61    FVATFLFLYITVLTVMGVVRADSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  120

Query  577   TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGD  753
             TFGLFLARKLSLTRA+FYMVMQCLGAICGAGVVKGF GKT +    GGAN VAPGYTKGD
Sbjct  121   TFGLFLARKLSLTRALFYMVMQCLGAICGAGVVKGFEGKTRFGDLKGGANFVAPGYTKGD  180

Query  754   GLGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINP  933
             GLGAEIVGTFILVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINP
Sbjct  181   GLGAEIVGTFILVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINP  240

Query  934   ARSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             ARSLGAAII+N+D  W+DHWIFWVGPF
Sbjct  241   ARSLGAAIIFNKDLGWDDHWIFWVGPF  267



>ref|XP_010089092.1| putative aquaporin PIP1-4 [Morus notabilis]
 gb|EXB37339.1| putative aquaporin PIP1-4 [Morus notabilis]
Length=287

 Score =   464 bits (1194),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 229/264 (87%), Positives = 244/264 (92%), Gaps = 2/264 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDV+LGANKF E+Q IGT+AQ DKDY E PP  LFEP EL+SWSFYRAGIAEFIA
Sbjct  1     MEGKEEDVKLGANKFSERQPIGTSAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFIA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYITILTVMGVSK+ +KC TVG+QGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITILTVMGVSKAPTKCSTVGVQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGK-TVYNGKGGGANVVAPGYTKGDGLG  762
             LFLARKLSLTRAVFY++MQ LGAICGAGVVKGF K + +   GGGANVVA GYTKGDGLG
Sbjct  121   LFLARKLSLTRAVFYIIMQTLGAICGAGVVKGFEKSSTFERLGGGANVVAHGYTKGDGLG  180

Query  763   AEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARS  942
             AEIVGTFILVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARS
Sbjct  181   AEIVGTFILVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS  240

Query  943   LGAAIIYNRDEAWNDHWIFWVGPF  1014
             LGAAIIYN+D AW+DHWIFWVGPF
Sbjct  241   LGAAIIYNKDHAWDDHWIFWVGPF  264



>ref|XP_007040270.1| Plasma membrane intrinsic protein 1,4 isoform 3, partial [Theobroma 
cacao]
 gb|EOY24771.1| Plasma membrane intrinsic protein 1,4 isoform 3, partial [Theobroma 
cacao]
Length=289

 Score =   464 bits (1194),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 226/265 (85%), Positives = 243/265 (92%), Gaps = 2/265 (1%)
 Frame = +1

Query  226   RMEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFI  402
             +ME +EEDV+LGANKFPE+Q IGT+AQ DKDY E PP  LFEP EL SWSFYRAGIAEF+
Sbjct  2     KMEGKEEDVKLGANKFPERQPIGTSAQTDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFV  61

Query  403   ATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  582
             ATFLFLYITILTVMGVS+S +KC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  62    ATFLFLYITILTVMGVSQSKTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  121

Query  583   GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGDGL  759
             GL LARKLSLTRAVFY++MQCLGAICGAGVVKGF G + Y    GGANVV  GYTKGDGL
Sbjct  122   GLLLARKLSLTRAVFYIIMQCLGAICGAGVVKGFQGDSRYEMLRGGANVVNHGYTKGDGL  181

Query  760   GAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPAR  939
             GAEI+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPAR
Sbjct  182   GAEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR  241

Query  940   SLGAAIIYNRDEAWNDHWIFWVGPF  1014
             SLGAA+IYN+D AW+DHWIFWVGPF
Sbjct  242   SLGAAVIYNKDHAWDDHWIFWVGPF  266



>ref|XP_009134562.1| PREDICTED: probable aquaporin PIP1-4 [Brassica rapa]
 emb|CDX74334.1| BnaA03g27130D [Brassica napus]
Length=288

 Score =   464 bits (1193),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 223/263 (85%), Positives = 242/263 (92%), Gaps = 1/263 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDVR+GANKFPE+Q IGT+AQ DKDY E PP  LFEP ELSSWSF+RAGIAEFIA
Sbjct  1     MEGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELSSWSFWRAGIAEFIA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYIT+LTVMGV ++ + C +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGA  765
             LFLARKLSLTRAVFYM+MQCLGAICGAGVVKGF  T Y   GGGAN VAPGY+KG GLGA
Sbjct  121   LFLARKLSLTRAVFYMIMQCLGAICGAGVVKGFQPTPYQTLGGGANTVAPGYSKGSGLGA  180

Query  766   EIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSL  945
             EI+GTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSL
Sbjct  181   EIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSL  240

Query  946   GAAIIYNRDEAWNDHWIFWVGPF  1014
             GAAIIYN+D +W+DHWIFWVGPF
Sbjct  241   GAAIIYNKDHSWDDHWIFWVGPF  263



>gb|ABD63904.1| aquaporin 1 [Gossypium hirsutum]
Length=287

 Score =   464 bits (1193),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 227/264 (86%), Positives = 242/264 (92%), Gaps = 2/264 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDV+LGANKF E+Q IGT+AQ DKDY E PP  LFEP EL SWSFYRAGIAEF+A
Sbjct  1     MEGKEEDVKLGANKFSERQPIGTSAQTDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFVA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYIT+LTVMGVS+S +KC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITVLTVMGVSQSKTKCTTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGDGLG  762
             L LARKLSLTRAVFYM+MQCLGAICGAGVVKGF G + Y   GGGANVV  GYTKGDGLG
Sbjct  121   LLLARKLSLTRAVFYMIMQCLGAICGAGVVKGFEGDSRYEMLGGGANVVNHGYTKGDGLG  180

Query  763   AEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARS  942
             AEI+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARS
Sbjct  181   AEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS  240

Query  943   LGAAIIYNRDEAWNDHWIFWVGPF  1014
             LGAAIIYN+D AW+DHWIFWVGPF
Sbjct  241   LGAAIIYNKDHAWDDHWIFWVGPF  264



>gb|KHG01288.1| putative aquaporin PIP-type 7a [Gossypium arboreum]
Length=288

 Score =   464 bits (1193),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 228/266 (86%), Positives = 243/266 (91%), Gaps = 4/266 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ---DKDYTEAPPTALFEPSELSSWSFYRAGIAEF  399
             ME +EEDVRLGANKF E+Q IGTAAQ   DKDYTE PP  LFEPSEL+SWSFYRAGIAEF
Sbjct  1     MEGKEEDVRLGANKFSERQPIGTAAQSQDDKDYTEPPPAPLFEPSELTSWSFYRAGIAEF  60

Query  400   IATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  579
             +ATFLFLYI++LTVMGV K  +KC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61    VATFLFLYISVLTVMGVLKDKTKCTTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  580   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGDG  756
             FGLFL RKLSLTRA+FYMVMQCLGAICGAGVVKGF GKT Y   GGGAN V  GYTKGDG
Sbjct  121   FGLFLGRKLSLTRAIFYMVMQCLGAICGAGVVKGFMGKTRYGALGGGANSVNHGYTKGDG  180

Query  757   LGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPA  936
             LGAEIVGTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPA
Sbjct  181   LGAEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPA  240

Query  937   RSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             RSLGAAII+N+D+ W+DHWIFWVGPF
Sbjct  241   RSLGAAIIFNKDKGWDDHWIFWVGPF  266



>ref|XP_002312147.1| plasma membrane intrinsic protein 1-1 [Populus trichocarpa]
 gb|ABK96483.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE89514.1| plasma membrane intrinsic protein 1-1 [Populus trichocarpa]
Length=287

 Score =   464 bits (1193),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 230/266 (86%), Positives = 243/266 (91%), Gaps = 4/266 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ---DKDYTEAPPTALFEPSELSSWSFYRAGIAEF  399
             ME +EEDVRLGAN+F E+Q IGTAAQ   DKDY E PP  LFEP EL+SWSFYRAGIAEF
Sbjct  1     MEGKEEDVRLGANRFNERQPIGTAAQSLDDKDYKEPPPAPLFEPGELTSWSFYRAGIAEF  60

Query  400   IATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  579
             +ATFLFLYIT+LTVMGV K  +KC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61    MATFLFLYITVLTVMGVVKDQTKCTTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  580   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGDG  756
             FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF GKT Y    GGAN+VA GYTKGDG
Sbjct  121   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFYGKTNYELHNGGANMVAHGYTKGDG  180

Query  757   LGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPA  936
             LGAEIVGTFILVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPA
Sbjct  181   LGAEIVGTFILVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPA  240

Query  937   RSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             RSLGAAII+N+D AW+DHWIFWVGPF
Sbjct  241   RSLGAAIIFNKDSAWDDHWIFWVGPF  266



>ref|XP_002315171.1| hypothetical protein POPTR_0010s19930g [Populus trichocarpa]
 gb|ABK95101.1| unknown [Populus trichocarpa]
 gb|EEF01342.1| hypothetical protein POPTR_0010s19930g [Populus trichocarpa]
Length=287

 Score =   464 bits (1193),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 228/266 (86%), Positives = 245/266 (92%), Gaps = 4/266 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ---DKDYTEAPPTALFEPSELSSWSFYRAGIAEF  399
             ME +EEDVRLGANKF E+Q +GTAAQ   DKDY E PP  LFEPSEL+SWSFYRAGIAEF
Sbjct  1     MEGKEEDVRLGANKFNERQPLGTAAQSQDDKDYKEPPPAPLFEPSELTSWSFYRAGIAEF  60

Query  400   IATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  579
             +ATFLFLYIT+LTVMGV K  +KC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61    MATFLFLYITVLTVMGVFKDTTKCTTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  580   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGDG  756
             FGLFLARKLSLTRAVFYM+MQCLGAICGAGVVKGF GK  Y    GGAN+V+PGYTKGDG
Sbjct  121   FGLFLARKLSLTRAVFYMLMQCLGAICGAGVVKGFYGKKNYELLNGGANMVSPGYTKGDG  180

Query  757   LGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPA  936
             LGAEIVGTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPA
Sbjct  181   LGAEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPA  240

Query  937   RSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             RSLGAAII+N+D+AW+DHWIFWVGPF
Sbjct  241   RSLGAAIIFNKDKAWDDHWIFWVGPF  266



>gb|AAB61378.1| aquaporin [Brassica rapa subsp. oleifera]
 emb|CDX83385.1| BnaA03g21210D [Brassica napus]
Length=286

 Score =   463 bits (1192),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 223/263 (85%), Positives = 241/263 (92%), Gaps = 1/263 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDVR+GANKFPE+Q IGT+AQ DKDY E PP  LFEP EL+SWSF+RAGIAEFIA
Sbjct  1     MEGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELASWSFWRAGIAEFIA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYIT+LTVMGV +S S C +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITVLTVMGVKRSPSMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGA  765
             LFLARKLSLTRAV+Y+VMQCLGAICGAGVVKGF    Y   GGGAN VAPGYTKG GLGA
Sbjct  121   LFLARKLSLTRAVYYIVMQCLGAICGAGVVKGFQPKQYQALGGGANTVAPGYTKGSGLGA  180

Query  766   EIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSL  945
             EI+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSL
Sbjct  181   EIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSL  240

Query  946   GAAIIYNRDEAWNDHWIFWVGPF  1014
             GAAII+N+D AW+DHW+FWVGPF
Sbjct  241   GAAIIFNKDNAWDDHWVFWVGPF  263



>ref|XP_006396241.1| hypothetical protein EUTSA_v10028860mg [Eutrema salsugineum]
 dbj|BAJ34288.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ37694.1| hypothetical protein EUTSA_v10028860mg [Eutrema salsugineum]
Length=286

 Score =   463 bits (1192),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 223/263 (85%), Positives = 242/263 (92%), Gaps = 1/263 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             M+ +EEDVR+GANKFPE+Q IGT+AQ DKDY E PP  LFEP ELSSWSF+RAGIAEFIA
Sbjct  1     MDGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELSSWSFWRAGIAEFIA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYIT+LTVMGV ++ + C +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGA  765
             LFLARKLSLTRAVFYM+MQCLGAICGAGVVKGF  T Y   GGGAN VAPGYTKG GLGA
Sbjct  121   LFLARKLSLTRAVFYMIMQCLGAICGAGVVKGFQPTPYQTLGGGANTVAPGYTKGSGLGA  180

Query  766   EIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSL  945
             EI+GTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSL
Sbjct  181   EIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSL  240

Query  946   GAAIIYNRDEAWNDHWIFWVGPF  1014
             GAAIIYN+D +W+DHWIFWVGPF
Sbjct  241   GAAIIYNKDHSWDDHWIFWVGPF  263



>gb|AFQ98315.1| MIP2 [Eutrema halophilum]
Length=284

 Score =   463 bits (1192),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 223/263 (85%), Positives = 242/263 (92%), Gaps = 1/263 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             M+ +EEDVR+GANKFPE+Q IGT+AQ DKDY E PP  LFEP ELSSWSF+RAGIAEFIA
Sbjct  1     MDGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELSSWSFWRAGIAEFIA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYIT+LTVMGV ++ + C +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGA  765
             LFLARKLSLTRAVFYM+MQCLGAICGAGVVKGF  T Y   GGGAN VAPGYTKG GLGA
Sbjct  121   LFLARKLSLTRAVFYMIMQCLGAICGAGVVKGFQPTPYQTLGGGANTVAPGYTKGSGLGA  180

Query  766   EIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSL  945
             EI+GTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSL
Sbjct  181   EIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSL  240

Query  946   GAAIIYNRDEAWNDHWIFWVGPF  1014
             GAAIIYN+D +W+DHWIFWVGPF
Sbjct  241   GAAIIYNKDHSWDDHWIFWVGPF  263



>gb|ACA50530.1| putative aquaporin [Brassica napus]
Length=286

 Score =   463 bits (1192),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 223/263 (85%), Positives = 241/263 (92%), Gaps = 1/263 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME REEDVR+GANKFPE+Q IGT+AQ DKDY E PP  LFEP EL+SWSF+RAGIAEFIA
Sbjct  1     MEGREEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELASWSFWRAGIAEFIA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYIT+LTVMGV +S + C +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITVLTVMGVKRSPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGA  765
             LFLARKLSLTRAV+Y+VMQCLGAICGAGVVKGF    Y   GGGAN VAPGYTKG GLGA
Sbjct  121   LFLARKLSLTRAVYYIVMQCLGAICGAGVVKGFQPKQYQALGGGANTVAPGYTKGSGLGA  180

Query  766   EIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSL  945
             EI+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSL
Sbjct  181   EIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSL  240

Query  946   GAAIIYNRDEAWNDHWIFWVGPF  1014
             GAAII+N+D AW+DHW+FWVGPF
Sbjct  241   GAAIIFNKDNAWDDHWVFWVGPF  263



>emb|CDY51161.1| BnaA09g51960D [Brassica napus]
Length=286

 Score =   463 bits (1192),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 223/263 (85%), Positives = 242/263 (92%), Gaps = 1/263 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDVR+GANKFPE+Q IGT+AQ DKDY E PP  LFEP ELSSWSF+RAGIAEFIA
Sbjct  1     MEGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELSSWSFWRAGIAEFIA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYIT+LTVMGV ++ + C +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGA  765
             LFLARKLSLTRAVFYM+MQCLGAICGAGVVKGF  T Y   GGGAN VAPGY+KG GLGA
Sbjct  121   LFLARKLSLTRAVFYMIMQCLGAICGAGVVKGFQPTPYQTLGGGANTVAPGYSKGSGLGA  180

Query  766   EIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSL  945
             EI+GTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSL
Sbjct  181   EIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSL  240

Query  946   GAAIIYNRDEAWNDHWIFWVGPF  1014
             GAAIIYN+D +W+DHWIFWVGPF
Sbjct  241   GAAIIYNKDHSWDDHWIFWVGPF  263



>gb|ABO71659.2| trans-membrane water channel protein [Brassica juncea]
Length=288

 Score =   463 bits (1192),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 222/263 (84%), Positives = 242/263 (92%), Gaps = 1/263 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDVR+GANKFPE+Q IGT+AQ DKDY E PP  LFEP ELSSWSF+RAGIAEFIA
Sbjct  1     MEGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELSSWSFWRAGIAEFIA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYIT+LTVMGV ++ + C +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGA  765
             LFLARKLSLTRAVFYM+MQCLGAICGAGV+KGF  T Y   GGGAN VAPGY+KG GLGA
Sbjct  121   LFLARKLSLTRAVFYMIMQCLGAICGAGVIKGFQPTPYQTLGGGANTVAPGYSKGSGLGA  180

Query  766   EIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSL  945
             EI+GTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSL
Sbjct  181   EIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSL  240

Query  946   GAAIIYNRDEAWNDHWIFWVGPF  1014
             GAAIIYN+D +W+DHWIFWVGPF
Sbjct  241   GAAIIYNKDHSWDDHWIFWVGPF  263



>emb|CDX91911.1| BnaC03g32130D [Brassica napus]
Length=288

 Score =   463 bits (1192),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 222/263 (84%), Positives = 242/263 (92%), Gaps = 1/263 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDVR+GANKFPE+Q IGT+AQ DKDY E PP  LFEP ELSSWSF+RAGIAEFIA
Sbjct  1     MEGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELSSWSFWRAGIAEFIA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYIT+LTVMGV ++ + C +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGA  765
             LFLARKLSLTRAVFYM+MQCLGA+CGAGVVKGF  T Y   GGGAN VAPGY+KG GLGA
Sbjct  121   LFLARKLSLTRAVFYMIMQCLGAVCGAGVVKGFQPTPYQTLGGGANTVAPGYSKGSGLGA  180

Query  766   EIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSL  945
             EI+GTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSL
Sbjct  181   EIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSL  240

Query  946   GAAIIYNRDEAWNDHWIFWVGPF  1014
             GAAIIYN+D +W+DHWIFWVGPF
Sbjct  241   GAAIIYNKDHSWDDHWIFWVGPF  263



>ref|XP_009630280.1| PREDICTED: probable aquaporin PIP-type pTOM75 [Nicotiana tomentosiformis]
 tpg|DAA64670.1| TPA_exp: aquaporin PIP1 2b [Nicotiana tabacum]
Length=287

 Score =   463 bits (1191),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 225/262 (86%), Positives = 241/262 (92%), Gaps = 1/262 (0%)
 Frame = +1

Query  232   EHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIAT  408
             E++EEDV+LGANK+ E Q +GTAAQ DKDY E PP  LFEP ELSSWSFYRAGIAEF+AT
Sbjct  3     ENKEEDVKLGANKYRETQPLGTAAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFMAT  62

Query  409   FLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  588
             FLFLYITILTVMG+ +SDS C +VGIQG+AWAFGGMIFALVYCTAGISGGHINPAVTFGL
Sbjct  63    FLFLYITILTVMGLKRSDSLCSSVGIQGVAWAFGGMIFALVYCTAGISGGHINPAVTFGL  122

Query  589   FLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGAE  768
             FLARKLSLTRA+FYMVMQCLGAICGAGVVKGF    Y   GGGANVV PGYTKGDGLGAE
Sbjct  123   FLARKLSLTRALFYMVMQCLGAICGAGVVKGFMVGPYQRLGGGANVVQPGYTKGDGLGAE  182

Query  769   IVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSLG  948
             IVGTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSLG
Sbjct  183   IVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLG  242

Query  949   AAIIYNRDEAWNDHWIFWVGPF  1014
             AAII+N+D AW+DHWIFWVGPF
Sbjct  243   AAIIFNQDRAWDDHWIFWVGPF  264



>ref|XP_009629839.1| PREDICTED: probable aquaporin PIP1-5 isoform X1 [Nicotiana tomentosiformis]
Length=285

 Score =   463 bits (1191),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 220/262 (84%), Positives = 243/262 (93%), Gaps = 0/262 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQDKDYTEAPPTALFEPSELSSWSFYRAGIAEFIAT  408
             ME +EEDV++GANK+ E+Q +GT+AQ KDY E P   LFEP EL SWSF+RAGIAEF+AT
Sbjct  1     MEGKEEDVKVGANKYSERQPLGTSAQSKDYKEPPAAPLFEPGELHSWSFWRAGIAEFMAT  60

Query  409   FLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  588
             FLFLYIT+LTVMG S+++SKC TVG+QGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL
Sbjct  61    FLFLYITVLTVMGYSRANSKCSTVGVQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  120

Query  589   FLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGAE  768
             FLARKLSLTRAVFY+VMQCLGAICGAGVVKGF  ++Y  KGGGAN++  GYTKGDGLGAE
Sbjct  121   FLARKLSLTRAVFYIVMQCLGAICGAGVVKGFQPSLYQVKGGGANIMNHGYTKGDGLGAE  180

Query  769   IVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSLG  948
             IVGTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSLG
Sbjct  181   IVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLG  240

Query  949   AAIIYNRDEAWNDHWIFWVGPF  1014
             AAIIYNRD+AW+DHWIFWVGPF
Sbjct  241   AAIIYNRDQAWDDHWIFWVGPF  262



>ref|XP_010506589.1| PREDICTED: aquaporin PIP1-2 [Camelina sativa]
 ref|XP_010518252.1| PREDICTED: aquaporin PIP1-2 isoform X1 [Camelina sativa]
Length=286

 Score =   463 bits (1191),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 222/263 (84%), Positives = 241/263 (92%), Gaps = 1/263 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDVR+GANKFPE+Q IGT+AQ DKDY E PP  LFEP EL+SWSF+RAGIAEFIA
Sbjct  1     MEGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELASWSFWRAGIAEFIA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYIT+LTVMGV +S S C +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITVLTVMGVKRSPSMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGA  765
             LFLARKLSLTRAV+Y+VMQCLGAICGAGVVKGF    Y   GGGAN +APGYTKG GLGA
Sbjct  121   LFLARKLSLTRAVYYIVMQCLGAICGAGVVKGFQPKQYQALGGGANTIAPGYTKGSGLGA  180

Query  766   EIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSL  945
             EI+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSL
Sbjct  181   EIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSL  240

Query  946   GAAIIYNRDEAWNDHWIFWVGPF  1014
             GAAII+N+D AW+DHW+FWVGPF
Sbjct  241   GAAIIFNKDNAWDDHWVFWVGPF  263



>emb|CDY48920.1| BnaA09g39170D [Brassica napus]
Length=286

 Score =   463 bits (1191),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 222/263 (84%), Positives = 241/263 (92%), Gaps = 1/263 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDVR+GANKFPE+Q IGT+AQ DKDY E PP  LFEP ELSSWSF+RAGIAEFIA
Sbjct  1     MEGKEEDVRVGANKFPERQPIGTSAQSDKDYNEPPPAPLFEPGELSSWSFWRAGIAEFIA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYIT+LTVMGV +S + C +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITVLTVMGVKRSPNMCSSVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGA  765
             LFLARKLSLTRA++Y+VMQCLGAICGAGVVKGF    Y   GGGAN VAPGYTKG GLGA
Sbjct  121   LFLARKLSLTRALYYIVMQCLGAICGAGVVKGFQPNQYQALGGGANTVAPGYTKGSGLGA  180

Query  766   EIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSL  945
             EI+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSL
Sbjct  181   EIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSL  240

Query  946   GAAIIYNRDEAWNDHWIFWVGPF  1014
             GAAIIYN+D +W+DHW+FWVGPF
Sbjct  241   GAAIIYNKDHSWDDHWVFWVGPF  263



>gb|AAV41024.1| plasma membrane intrinsic protein [Glycyrrhiza uralensis]
Length=289

 Score =   463 bits (1191),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 228/267 (85%), Positives = 244/267 (91%), Gaps = 5/267 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQD----KDYTEAPPTALFEPSELSSWSFYRAGIAE  396
             ME +E+DV LGANKFPE+Q IGTAAQ     KDY E PP  LFEP+EL+SWSFYRAGIAE
Sbjct  1     MEGKEQDVSLGANKFPERQPIGTAAQTQDDGKDYKEPPPAPLFEPNELTSWSFYRAGIAE  60

Query  397   FIATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  576
             F+ATFLFLYITILTVMGV++S+SKCK+VGIQGIAWAFGGMIFALVYCTAGISGGHINPAV
Sbjct  61    FVATFLFLYITILTVMGVNRSESKCKSVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  120

Query  577   TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGD  753
             TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF GKT+Y    GGAN V  GYTKGD
Sbjct  121   TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFEGKTLYGKYNGGANFVNSGYTKGD  180

Query  754   GLGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINP  933
             GLGAEIVGTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLV LATIPITGTGINP
Sbjct  181   GLGAEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVRLATIPITGTGINP  240

Query  934   ARSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             ARSLGAAII+N+D  WNDHWIFWVGPF
Sbjct  241   ARSLGAAIIFNKDRGWNDHWIFWVGPF  267



>dbj|BAA20076.1| water channel protein [Nicotiana excelsior]
Length=287

 Score =   463 bits (1191),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 224/262 (85%), Positives = 241/262 (92%), Gaps = 1/262 (0%)
 Frame = +1

Query  232   EHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIAT  408
             E++EEDV+LGANK+ E Q +GTAAQ DKDY E PP  LFEP ELSSWSFYRAGIAEF+AT
Sbjct  3     ENKEEDVKLGANKYRETQPLGTAAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFMAT  62

Query  409   FLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  588
             FLFLYITILTVMG+ +SDS C +VGIQG+AWAFGGMIFALVYCTAGISGGHINPAVTFGL
Sbjct  63    FLFLYITILTVMGLKRSDSLCSSVGIQGVAWAFGGMIFALVYCTAGISGGHINPAVTFGL  122

Query  589   FLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGAE  768
             FLARKLSLTRA+FYMVMQCLGAICGAGVVKGF    Y   GGGANVV PGYTKGDGLGAE
Sbjct  123   FLARKLSLTRALFYMVMQCLGAICGAGVVKGFMVGPYQRLGGGANVVQPGYTKGDGLGAE  182

Query  769   IVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSLG  948
             I+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSLG
Sbjct  183   IIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLG  242

Query  949   AAIIYNRDEAWNDHWIFWVGPF  1014
             AAII+N D+AW+DHWIFWVGPF
Sbjct  243   AAIIFNHDQAWDDHWIFWVGPF  264



>gb|ACB56912.1| aquaporin [Ananas comosus]
Length=288

 Score =   463 bits (1191),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 226/265 (85%), Positives = 240/265 (91%), Gaps = 3/265 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQD---KDYTEAPPTALFEPSELSSWSFYRAGIAEF  399
             ME +EEDV LGANKF E+Q IGTAAQ    KDY E P   LFEP EL SWSFYRAGIAEF
Sbjct  1     MEGKEEDVSLGANKFSERQPIGTAAQSQDSKDYKEPPAAPLFEPGELKSWSFYRAGIAEF  60

Query  400   IATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  579
             +ATFLFLY++ILTVMGV KS SKC TVG+QGIAWAFGGMIFALVYCTAGISGGHIN AVT
Sbjct  61    MATFLFLYVSILTVMGVVKSPSKCSTVGVQGIAWAFGGMIFALVYCTAGISGGHINXAVT  120

Query  580   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGL  759
             FGL LARKLSLTRA+FY+VMQCLGAICGAGVVKGF K +Y G GGGANVVAPGYTKGDGL
Sbjct  121   FGLLLARKLSLTRAIFYIVMQCLGAICGAGVVKGFQKGLYMGNGGGANVVAPGYTKGDGL  180

Query  760   GAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPAR  939
             GAEI+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPAR
Sbjct  181   GAEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR  240

Query  940   SLGAAIIYNRDEAWNDHWIFWVGPF  1014
             SLGAAIIYNR+ AW+DHWIFWVGPF
Sbjct  241   SLGAAIIYNREHAWDDHWIFWVGPF  265



>emb|CDX71738.1| BnaC08g31360D [Brassica napus]
Length=286

 Score =   463 bits (1191),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 222/263 (84%), Positives = 241/263 (92%), Gaps = 1/263 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDVR+GANKFPE+Q IGT+AQ DKDY E PP  LFEP ELSSWSF+RAGIAEFIA
Sbjct  1     MEGKEEDVRVGANKFPERQPIGTSAQSDKDYNEPPPAPLFEPGELSSWSFWRAGIAEFIA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYIT+LTVMGV +S + C +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITVLTVMGVKRSPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGA  765
             LFLARKLSLTRA++Y+VMQCLGAICGAGVVKGF    Y   GGGAN VAPGYTKG GLGA
Sbjct  121   LFLARKLSLTRALYYIVMQCLGAICGAGVVKGFQPNQYQALGGGANTVAPGYTKGSGLGA  180

Query  766   EIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSL  945
             EI+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSL
Sbjct  181   EIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSL  240

Query  946   GAAIIYNRDEAWNDHWIFWVGPF  1014
             GAAIIYN+D +W+DHW+FWVGPF
Sbjct  241   GAAIIYNKDHSWDDHWVFWVGPF  263



>ref|XP_003570439.1| PREDICTED: aquaporin PIP1-5 [Brachypodium distachyon]
Length=289

 Score =   463 bits (1191),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 226/266 (85%), Positives = 242/266 (91%), Gaps = 4/266 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ----DKDYTEAPPTALFEPSELSSWSFYRAGIAE  396
             ME +EEDVRLGAN++ E+Q IGTAAQ    +KDY E PP  +FE  EL+SWSFYRAGIAE
Sbjct  1     MEGKEEDVRLGANRYSERQPIGTAAQGGDSEKDYKEPPPAPIFEAEELTSWSFYRAGIAE  60

Query  397   FIATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  576
             FIATFLFLYI++LTVMGVS S SKC TVGIQGIAW+FGGMIF LVYCTAGISGGHINPAV
Sbjct  61    FIATFLFLYISVLTVMGVSSSSSKCGTVGIQGIAWSFGGMIFVLVYCTAGISGGHINPAV  120

Query  577   TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDG  756
             TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF   +Y GKGGGAN VA GYTKGDG
Sbjct  121   TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFQTGLYMGKGGGANSVAVGYTKGDG  180

Query  757   LGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPA  936
             LGAEIVGTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPA
Sbjct  181   LGAEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPA  240

Query  937   RSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             RSLGAAIIYNR +AW+DHWIFWVGPF
Sbjct  241   RSLGAAIIYNRKQAWDDHWIFWVGPF  266



>ref|XP_010508083.1| PREDICTED: aquaporin PIP1-2-like isoform X1 [Camelina sativa]
Length=286

 Score =   463 bits (1191),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 222/263 (84%), Positives = 241/263 (92%), Gaps = 1/263 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDVR+GANKFPE+Q IGT+AQ DKDY E PP  LFEP EL+SWSF+RAGIAEFIA
Sbjct  1     MEGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELASWSFWRAGIAEFIA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYIT+LTVMGV +S S C +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITVLTVMGVKRSPSMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGA  765
             LFLARKLSLTRAV+Y+VMQCLGAICGAGVVKGF    Y   GGGAN +APGYTKG GLGA
Sbjct  121   LFLARKLSLTRAVYYIVMQCLGAICGAGVVKGFQPKQYQALGGGANTIAPGYTKGSGLGA  180

Query  766   EIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSL  945
             EI+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSL
Sbjct  181   EIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSL  240

Query  946   GAAIIYNRDEAWNDHWIFWVGPF  1014
             GAAII+N+D AW+DHW+FWVGPF
Sbjct  241   GAAIIFNKDNAWDDHWVFWVGPF  263



>tpg|DAA33858.1| TPA_inf: aquaporin PIP1;4 [Gossypium hirsutum]
Length=287

 Score =   463 bits (1191),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 228/264 (86%), Positives = 241/264 (91%), Gaps = 2/264 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDV+LGANKF E+Q IGT+AQ DKDY E PP  LFEP EL SWSFYRAGIAEF+A
Sbjct  1     MEGKEEDVKLGANKFSERQPIGTSAQTDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFVA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYIT+LTVMGVS+S +KC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITVLTVMGVSQSKTKCTTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGDGLG  762
             L LARKLSLTRAVFYM+MQCLGAICGAGVVKGF G + Y   GGGANVV  GYTKGDGLG
Sbjct  121   LLLARKLSLTRAVFYMIMQCLGAICGAGVVKGFEGDSRYEMLGGGANVVNHGYTKGDGLG  180

Query  763   AEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARS  942
             AEIVGTFILVYTVFSATDAKRNARDSHVP+LAPLPIGFAVF VHLATIPITGTGINPARS
Sbjct  181   AEIVGTFILVYTVFSATDAKRNARDSHVPILAPLPIGFAVFFVHLATIPITGTGINPARS  240

Query  943   LGAAIIYNRDEAWNDHWIFWVGPF  1014
             LGAAIIYN+D AW+DHWIFWVGPF
Sbjct  241   LGAAIIYNKDHAWDDHWIFWVGPF  264



>ref|NP_567178.1| plasma membrane intrinsic protein 1;4 [Arabidopsis thaliana]
 sp|Q39196.1|PIP14_ARATH RecName: Full=Probable aquaporin PIP1-4; AltName: Full=Plasma 
membrane intrinsic protein 1-4; Short=AtPIP1;4; AltName: Full=Transmembrane 
protein C; Short=TMP-C [Arabidopsis thaliana]
 dbj|BAA05654.1| transmembrane protein [Arabidopsis thaliana]
 gb|AAM20676.1| probable plasma membrane intrinsic protein 1c [Arabidopsis thaliana]
 gb|AAM53343.1| probable plasma membrane intrinsic protein 1c [Arabidopsis thaliana]
 gb|AAN15649.1| probable plasma membrane intrinsic protein 1c [Arabidopsis thaliana]
 gb|AAP13421.1| At4g00430 [Arabidopsis thaliana]
 gb|AEE81879.1| plasma membrane intrinsic protein 1;4 [Arabidopsis thaliana]
Length=287

 Score =   463 bits (1191),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 224/264 (85%), Positives = 241/264 (91%), Gaps = 2/264 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ--DKDYTEAPPTALFEPSELSSWSFYRAGIAEFI  402
             ME +EEDVR+GANKFPE+Q IGT+AQ  DKDY E PP  LFEP ELSSWSFYRAGIAEFI
Sbjct  1     MEGKEEDVRVGANKFPERQPIGTSAQSTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFI  60

Query  403   ATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  582
             ATFLFLYIT+LTVMGV ++ + C +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61    ATFLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  583   GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLG  762
             GLFLARKLSLTRAVFYM+MQCLGAICGAGVVKGF  T Y   GGGAN VA GYTKG GLG
Sbjct  121   GLFLARKLSLTRAVFYMIMQCLGAICGAGVVKGFQPTPYQTLGGGANTVAHGYTKGSGLG  180

Query  763   AEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARS  942
             AEI+GTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARS
Sbjct  181   AEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS  240

Query  943   LGAAIIYNRDEAWNDHWIFWVGPF  1014
             LGAAIIYN+D +W+DHWIFWVGPF
Sbjct  241   LGAAIIYNKDHSWDDHWIFWVGPF  264



>dbj|BAO18622.1| plasmamembrane intrinsic protein 1;2 [Solanum lycopersicum]
Length=285

 Score =   463 bits (1191),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 219/262 (84%), Positives = 244/262 (93%), Gaps = 0/262 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQDKDYTEAPPTALFEPSELSSWSFYRAGIAEFIAT  408
             ME +EEDV++GANK+ E+Q +GT+AQ KDY EAPP  LFE  EL SWSF+RAGIAEF+AT
Sbjct  1     MEGKEEDVKVGANKYSERQPLGTSAQSKDYKEAPPAPLFEAGELHSWSFWRAGIAEFMAT  60

Query  409   FLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  588
             FLFLYIT+LTVMG S+++SKC TVG+QGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL
Sbjct  61    FLFLYITVLTVMGYSRANSKCSTVGVQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  120

Query  589   FLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGAE  768
             FLARKLSLTRAVFY+VMQCLGAICGAGVVKGF  +++  KGGGANVVA GYTKGDGLGAE
Sbjct  121   FLARKLSLTRAVFYIVMQCLGAICGAGVVKGFQPSLFETKGGGANVVAHGYTKGDGLGAE  180

Query  769   IVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSLG  948
             I+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSLG
Sbjct  181   IIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLG  240

Query  949   AAIIYNRDEAWNDHWIFWVGPF  1014
             AAI+YN++ AW+DHWIFWVGPF
Sbjct  241   AAIVYNKEHAWDDHWIFWVGPF  262



>gb|ACL14797.1| plasma membrane intrinsic protein 1 [Populus alba x Populus glandulosa]
Length=287

 Score =   463 bits (1191),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 230/266 (86%), Positives = 243/266 (91%), Gaps = 4/266 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ---DKDYTEAPPTALFEPSELSSWSFYRAGIAEF  399
             ME +EEDVRLGAN+F E+Q IGTAAQ   DKDY E PP  LFEP EL+SWSFYRAGIAEF
Sbjct  1     MEGKEEDVRLGANRFNERQPIGTAAQSLDDKDYKEPPPAPLFEPGELTSWSFYRAGIAEF  60

Query  400   IATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  579
             +ATFLFLYIT+LTVMGV K  +KC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61    MATFLFLYITVLTVMGVVKDKTKCTTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  580   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGDG  756
             FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF GKT Y    GGAN+VA GYTKGDG
Sbjct  121   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFYGKTNYELLNGGANMVAHGYTKGDG  180

Query  757   LGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPA  936
             LGAEIVGTFILVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPA
Sbjct  181   LGAEIVGTFILVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPA  240

Query  937   RSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             RSLGAAII+N+D AW+DHWIFWVGPF
Sbjct  241   RSLGAAIIFNKDSAWDDHWIFWVGPF  266



>ref|XP_007040268.1| Plasma membrane intrinsic protein 1,4 isoform 1 [Theobroma cacao]
 ref|XP_007040269.1| Plasma membrane intrinsic protein 1,4 isoform 1 [Theobroma cacao]
 gb|EOY24769.1| Plasma membrane intrinsic protein 1,4 isoform 1 [Theobroma cacao]
 gb|EOY24770.1| Plasma membrane intrinsic protein 1,4 isoform 1 [Theobroma cacao]
Length=287

 Score =   462 bits (1190),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 226/264 (86%), Positives = 242/264 (92%), Gaps = 2/264 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDV+LGANKFPE+Q IGT+AQ DKDY E PP  LFEP EL SWSFYRAGIAEF+A
Sbjct  1     MEGKEEDVKLGANKFPERQPIGTSAQTDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFVA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYITILTVMGVS+S +KC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITILTVMGVSQSKTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGDGLG  762
             L LARKLSLTRAVFY++MQCLGAICGAGVVKGF G + Y    GGANVV  GYTKGDGLG
Sbjct  121   LLLARKLSLTRAVFYIIMQCLGAICGAGVVKGFQGDSRYEMLRGGANVVNHGYTKGDGLG  180

Query  763   AEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARS  942
             AEI+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARS
Sbjct  181   AEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS  240

Query  943   LGAAIIYNRDEAWNDHWIFWVGPF  1014
             LGAA+IYN+D AW+DHWIFWVGPF
Sbjct  241   LGAAVIYNKDHAWDDHWIFWVGPF  264



>gb|ADE34282.1| aquaporin PIP1;13 [Gossypium hirsutum]
Length=267

 Score =   462 bits (1188),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 226/264 (86%), Positives = 242/264 (92%), Gaps = 2/264 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDV+LGANKF E+Q IGT+AQ DKDY E PP  LFEP EL SWSFYRAGIAEF+A
Sbjct  1     MEGKEEDVKLGANKFSERQPIGTSAQTDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFVA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYIT+LTVMGVS+S +KC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITVLTVMGVSQSKTKCTTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGDGLG  762
             L LARKLSLTRAVFYM+MQCLGAICGAGVVKGF G + Y   GGGANVV  GYTKGDGLG
Sbjct  121   LLLARKLSLTRAVFYMIMQCLGAICGAGVVKGFEGDSRYEMLGGGANVVNHGYTKGDGLG  180

Query  763   AEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARS  942
             AEI+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARS
Sbjct  181   AEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS  240

Query  943   LGAAIIYNRDEAWNDHWIFWVGPF  1014
             LGAAIIYN+D AW+DHWIFW+GPF
Sbjct  241   LGAAIIYNKDHAWDDHWIFWLGPF  264



>ref|XP_002872953.1| hypothetical protein ARALYDRAFT_912203 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49212.1| hypothetical protein ARALYDRAFT_912203 [Arabidopsis lyrata subsp. 
lyrata]
Length=287

 Score =   462 bits (1190),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 224/264 (85%), Positives = 241/264 (91%), Gaps = 2/264 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ--DKDYTEAPPTALFEPSELSSWSFYRAGIAEFI  402
             ME +EEDVR+GANKFPE+Q IGT+AQ  DKDY E PP  LFEP ELSSWSFYRAGIAEFI
Sbjct  1     MEGKEEDVRVGANKFPERQPIGTSAQSTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFI  60

Query  403   ATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  582
             ATFLFLYIT+LTVMGV ++ + C +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61    ATFLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  583   GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLG  762
             GLFLARKLSLTRAVFYM+MQCLGAICGAGVVKGF  T Y   GGGAN VA GYTKG GLG
Sbjct  121   GLFLARKLSLTRAVFYMIMQCLGAICGAGVVKGFQPTHYQTLGGGANTVAHGYTKGSGLG  180

Query  763   AEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARS  942
             AEI+GTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARS
Sbjct  181   AEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS  240

Query  943   LGAAIIYNRDEAWNDHWIFWVGPF  1014
             LGAAIIYN+D +W+DHWIFWVGPF
Sbjct  241   LGAAIIYNKDHSWDDHWIFWVGPF  264



>ref|XP_009118823.1| PREDICTED: aquaporin PIP1-3 [Brassica rapa]
Length=286

 Score =   462 bits (1190),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 223/263 (85%), Positives = 242/263 (92%), Gaps = 1/263 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDVR+GANKFPE+Q IGT+AQ DKDY E PP  LFEP ELSSWSF+RAGIAEFIA
Sbjct  1     MEGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELSSWSFWRAGIAEFIA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYIT+LTVMGV ++ + C +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGA  765
             LFLARKLSLTRAVFY+VMQCLGA+CGAGVVKGF  + Y   GGGAN VAPGYTKG GLGA
Sbjct  121   LFLARKLSLTRAVFYIVMQCLGAVCGAGVVKGFQPSPYQTLGGGANTVAPGYTKGSGLGA  180

Query  766   EIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSL  945
             EI+GTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSL
Sbjct  181   EIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSL  240

Query  946   GAAIIYNRDEAWNDHWIFWVGPF  1014
             GAAIIYN+D AW+DHWIFWVGPF
Sbjct  241   GAAIIYNKDHAWDDHWIFWVGPF  263



>ref|XP_011022675.1| PREDICTED: aquaporin PIP1-2 [Populus euphratica]
Length=288

 Score =   462 bits (1190),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 229/265 (86%), Positives = 244/265 (92%), Gaps = 3/265 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDV+LGANKF E+Q IGT+AQ DKDY EAPP  LFEP EL SWSFYRAGIAEFIA
Sbjct  1     MEGKEEDVKLGANKFSERQPIGTSAQTDKDYKEAPPAPLFEPGELKSWSFYRAGIAEFIA  60

Query  406   TFLFLYITILTVMGVSK-SDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  582
             TFLFLYIT+LTVMGV+K   SKC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61    TFLFLYITVLTVMGVTKPGTSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  583   GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGDGL  759
             GLFLARKLSLTRAVFY++MQCLGAICGAGVVKGF G + Y  +GGGANVV  GYTKGDGL
Sbjct  121   GLFLARKLSLTRAVFYIIMQCLGAICGAGVVKGFQGSSSYEVQGGGANVVNHGYTKGDGL  180

Query  760   GAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPAR  939
             GAEIVGTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPAR
Sbjct  181   GAEIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR  240

Query  940   SLGAAIIYNRDEAWNDHWIFWVGPF  1014
             SLGAAII+N+D AW+DHWIFWVGPF
Sbjct  241   SLGAAIIFNKDRAWDDHWIFWVGPF  265



>gb|ADE34281.1| aquaporin PIP1;12, partial [Gossypium hirsutum]
Length=267

 Score =   462 bits (1188),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 228/264 (86%), Positives = 241/264 (91%), Gaps = 2/264 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDV+LGANKF E+Q IGT+AQ DKDY E PP  LFEP EL SWSFYRAGIAEF+A
Sbjct  1     MEGKEEDVKLGANKFSERQPIGTSAQTDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFVA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYIT+LTVMGVS+S +KC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITVLTVMGVSQSKTKCTTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGDGLG  762
             L LARKLSLTRAVFYM+MQCLGAICGAGVVKGF G + Y   GGGANVV  GYTKGDGLG
Sbjct  121   LLLARKLSLTRAVFYMIMQCLGAICGAGVVKGFEGDSRYEMLGGGANVVNHGYTKGDGLG  180

Query  763   AEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARS  942
             AEIVGTFILVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARS
Sbjct  181   AEIVGTFILVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS  240

Query  943   LGAAIIYNRDEAWNDHWIFWVGPF  1014
             LGAAIIYN+D AW+DHWIFWVGP 
Sbjct  241   LGAAIIYNKDHAWDDHWIFWVGPL  264



>gb|ACR56612.1| plasma intrinsic protein 1;3 [Juglans regia]
Length=285

 Score =   462 bits (1190),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 221/265 (83%), Positives = 243/265 (92%), Gaps = 3/265 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQD---KDYTEAPPTALFEPSELSSWSFYRAGIAEF  399
             ME ++EDVRLGAN++ E+Q IGT AQ    KDY E PP  LFEP ELSSWSFYRAGIAEF
Sbjct  1     MEGKDEDVRLGANRYRERQPIGTTAQSQDVKDYQEPPPAPLFEPGELSSWSFYRAGIAEF  60

Query  400   IATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  579
             +ATFLFLYIT+LTVMGV++S SKC +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61    VATFLFLYITVLTVMGVARSPSKCSSVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  580   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGL  759
             FGLFLARKLSLTRAVFY++MQCLGAICGAGVVKGF KT Y   GGGAN ++ GYTKGDGL
Sbjct  121   FGLFLARKLSLTRAVFYIIMQCLGAICGAGVVKGFQKTQYERLGGGANTISKGYTKGDGL  180

Query  760   GAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPAR  939
             GAEIVGTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPAR
Sbjct  181   GAEIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR  240

Query  940   SLGAAIIYNRDEAWNDHWIFWVGPF  1014
             SLGAA+I+N+D+AW+DHW+FWVGPF
Sbjct  241   SLGAALIFNKDQAWDDHWVFWVGPF  265



>ref|XP_008437293.1| PREDICTED: aquaporin PIP1-2 [Cucumis melo]
Length=286

 Score =   462 bits (1190),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 226/263 (86%), Positives = 241/263 (92%), Gaps = 1/263 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDV+LGANKF E+Q IGT+AQ DKDY E PP  L+EP EL+SWSFYRAGIAEF+A
Sbjct  1     MEGKEEDVKLGANKFSERQPIGTSAQTDKDYKEPPPAPLYEPGELTSWSFYRAGIAEFMA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYITILTVMGVS+S SKC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITILTVMGVSRSPSKCNTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGA  765
             LFLARKLSLTRA+FY++MQCLGAICGAGVVKGF  + Y  K GGAN VA GYTKG GLGA
Sbjct  121   LFLARKLSLTRALFYIIMQCLGAICGAGVVKGFEGSTYVQKLGGANFVASGYTKGSGLGA  180

Query  766   EIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSL  945
             EIVGTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSL
Sbjct  181   EIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSL  240

Query  946   GAAIIYNRDEAWNDHWIFWVGPF  1014
             GAAIIYNR  AW+DHWIFWVGPF
Sbjct  241   GAAIIYNRQHAWDDHWIFWVGPF  263



>gb|ACU87553.1| PIP protein [Gossypium hirsutum]
 gb|ACU87554.1| PIP protein [Gossypium hirsutum]
Length=288

 Score =   462 bits (1190),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 227/266 (85%), Positives = 243/266 (91%), Gaps = 4/266 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ---DKDYTEAPPTALFEPSELSSWSFYRAGIAEF  399
             ME +EEDVRLGANKF E+Q IGTAAQ   DKDYTE PP  LFEPSEL+SWSFYRAGIAEF
Sbjct  1     MEGKEEDVRLGANKFSERQPIGTAAQSQDDKDYTEPPPAPLFEPSELTSWSFYRAGIAEF  60

Query  400   IATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  579
             +ATFLFLYI++LTVMGV K  +KC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61    VATFLFLYISVLTVMGVLKDKTKCTTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  580   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGDG  756
             FGLFL RKLSLTRA++YMVMQCLGAICGAGVVKGF GKT Y   GGGAN V  GYTKGDG
Sbjct  121   FGLFLGRKLSLTRAIYYMVMQCLGAICGAGVVKGFMGKTRYGALGGGANSVNHGYTKGDG  180

Query  757   LGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPA  936
             LGAEIVGTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPA
Sbjct  181   LGAEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPA  240

Query  937   RSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             RSLGAAII+N+D+ W+DHWIFWVGPF
Sbjct  241   RSLGAAIIFNKDKGWDDHWIFWVGPF  266



>ref|NP_001234139.1| probable aquaporin PIP-type pTOM75 [Solanum lycopersicum]
 sp|Q08451.1|PIP1_SOLLC RecName: Full=Probable aquaporin PIP-type pTOM75; AltName: Full=Ripening-associated 
membrane protein; Short=RAMP [Solanum 
lycopersicum]
 emb|CAA52068.1| tomato ripening associated membrane protein [Solanum lycopersicum]
 dbj|BAO18624.1| plasmamembrane intrinsic protein 1;5 [Solanum lycopersicum]
Length=286

 Score =   462 bits (1190),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 226/262 (86%), Positives = 239/262 (91%), Gaps = 1/262 (0%)
 Frame = +1

Query  232   EHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIAT  408
             E++EEDV+LGANKF E Q +GTAAQ DKDY E PP  LFEP ELSSWSFYRAGIAEF+AT
Sbjct  3     ENKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFMAT  62

Query  409   FLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  588
             FLFLYITILTVMG+ +SDS C +VGIQG+AWAFGGMIFALVYCTAGISGGHINPAVTFGL
Sbjct  63    FLFLYITILTVMGLKRSDSLCSSVGIQGVAWAFGGMIFALVYCTAGISGGHINPAVTFGL  122

Query  589   FLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGAE  768
             FLARKLSLTRAVFYMVMQCLGAICGAGVVKGF    Y   GGGANVV PGYTKGDGLGAE
Sbjct  123   FLARKLSLTRAVFYMVMQCLGAICGAGVVKGFMVGPYQRLGGGANVVNPGYTKGDGLGAE  182

Query  769   IVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSLG  948
             I+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSLG
Sbjct  183   IIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLG  242

Query  949   AAIIYNRDEAWNDHWIFWVGPF  1014
             AAIIYN + AWNDHWIFWVGP 
Sbjct  243   AAIIYNDEHAWNDHWIFWVGPM  264



>ref|XP_009793682.1| PREDICTED: probable aquaporin PIP-type pTOM75 [Nicotiana sylvestris]
 tpg|DAA64669.1| TPA_exp: aquaporin PIP1 2a [Nicotiana tabacum]
Length=287

 Score =   462 bits (1190),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 223/262 (85%), Positives = 242/262 (92%), Gaps = 1/262 (0%)
 Frame = +1

Query  232   EHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIAT  408
             E++EEDV+LGANK+ E Q +GTAAQ DKDY E PP  LFEP ELSSWSFYRAGIAEF+AT
Sbjct  3     ENKEEDVKLGANKYRETQPLGTAAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFMAT  62

Query  409   FLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  588
             FLFLYITILTVMG+ +SDS C +VGIQG+AWAFGGMIFALVYCTAGISGGHINPAVTFGL
Sbjct  63    FLFLYITILTVMGLKRSDSLCSSVGIQGVAWAFGGMIFALVYCTAGISGGHINPAVTFGL  122

Query  589   FLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGAE  768
             FLARKLSLTRA+FYMVMQCLGAICGAGVVKGF    Y   GGGAN+V PGYTKGDGLGAE
Sbjct  123   FLARKLSLTRALFYMVMQCLGAICGAGVVKGFMVGPYQRLGGGANMVQPGYTKGDGLGAE  182

Query  769   IVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSLG  948
             I+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSLG
Sbjct  183   IIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLG  242

Query  949   AAIIYNRDEAWNDHWIFWVGPF  1014
             AAII+N+D+AW+DHWIFWVGPF
Sbjct  243   AAIIFNQDQAWDDHWIFWVGPF  264



>ref|NP_001234413.1| Aqp2 protein [Solanum lycopersicum]
 gb|AAF44085.1| putative water channel protein [Solanum lycopersicum]
Length=285

 Score =   462 bits (1189),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 219/262 (84%), Positives = 244/262 (93%), Gaps = 0/262 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQDKDYTEAPPTALFEPSELSSWSFYRAGIAEFIAT  408
             ME +EEDV++GANK+ E+Q +GT+AQ KDY EAPP  LFE  EL SWSF+RAGIAEF+AT
Sbjct  1     MEGKEEDVKVGANKYSERQPLGTSAQSKDYKEAPPAPLFEAGELHSWSFWRAGIAEFMAT  60

Query  409   FLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  588
             FLFLYIT+LTVMG S+++SKC TVG+QGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL
Sbjct  61    FLFLYITVLTVMGYSRANSKCSTVGVQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  120

Query  589   FLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGAE  768
             FLARKLSLTRAVFY+VMQCLGAICGAGVVKGF  +++  KGGGANVVA GYTKGDGLGAE
Sbjct  121   FLARKLSLTRAVFYIVMQCLGAICGAGVVKGFQPSLFGTKGGGANVVAHGYTKGDGLGAE  180

Query  769   IVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSLG  948
             I+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSLG
Sbjct  181   IIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLG  240

Query  949   AAIIYNRDEAWNDHWIFWVGPF  1014
             AAI+YN++ AW+DHWIFWVGPF
Sbjct  241   AAIVYNKEHAWDDHWIFWVGPF  262



>emb|CDX95670.1| BnaC03g25510D [Brassica napus]
Length=286

 Score =   462 bits (1189),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 222/263 (84%), Positives = 241/263 (92%), Gaps = 1/263 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDVR+GANKFPE+Q IGT+AQ DKDY E PP  LFEP EL+SWSF+RAGIAEFIA
Sbjct  1     MEGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELASWSFWRAGIAEFIA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYIT+LTVMGV +S S C +VGIQGIAWAFGGMIFALVYCTAG+SGGHINPAVTFG
Sbjct  61    TFLFLYITVLTVMGVKRSPSMCASVGIQGIAWAFGGMIFALVYCTAGVSGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGA  765
             LFLARKLSLTRAV+Y+VMQCLGAICGAGVVKGF    Y   GGGAN VAPGYTKG GLGA
Sbjct  121   LFLARKLSLTRAVYYIVMQCLGAICGAGVVKGFQPKRYQALGGGANTVAPGYTKGSGLGA  180

Query  766   EIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSL  945
             EI+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSL
Sbjct  181   EIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSL  240

Query  946   GAAIIYNRDEAWNDHWIFWVGPF  1014
             GAAII+N+D AW+DHW+FWVGPF
Sbjct  241   GAAIIFNKDNAWDDHWVFWVGPF  263



>ref|XP_010067506.1| PREDICTED: probable aquaporin PIP1-2 [Eucalyptus grandis]
 ref|XP_010067507.1| PREDICTED: probable aquaporin PIP1-2 [Eucalyptus grandis]
 gb|KCW65650.1| hypothetical protein EUGRSUZ_G03037 [Eucalyptus grandis]
Length=287

 Score =   462 bits (1190),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 225/265 (85%), Positives = 242/265 (91%), Gaps = 3/265 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQD---KDYTEAPPTALFEPSELSSWSFYRAGIAEF  399
             ME REEDVR+GANKF E+Q IGTAAQ    KDY E PP  L EPSEL+SWSFYRAGIAEF
Sbjct  1     MEGREEDVRVGANKFSERQPIGTAAQTQDGKDYREPPPAPLIEPSELTSWSFYRAGIAEF  60

Query  400   IATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  579
             +ATFLFLYIT+LTVMGVS+S +KC +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61    VATFLFLYITVLTVMGVSRSPTKCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  580   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGL  759
             FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVK FGK+ Y    GGAN+V+ GY+KGDGL
Sbjct  121   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKAFGKSQYELHNGGANMVSAGYSKGDGL  180

Query  760   GAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPAR  939
             GAEIVGTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPAR
Sbjct  181   GAEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR  240

Query  940   SLGAAIIYNRDEAWNDHWIFWVGPF  1014
             SLGAAIIYN+D AW+D WIFWVGPF
Sbjct  241   SLGAAIIYNKDPAWDDQWIFWVGPF  265



>dbj|BAD90696.1| plasma membrane intrinsic protein 1;1 [Mimosa pudica]
Length=289

 Score =   462 bits (1190),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 228/267 (85%), Positives = 244/267 (91%), Gaps = 5/267 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQD----KDYTEAPPTALFEPSELSSWSFYRAGIAE  396
             ME +E+DV LGANKFPE+Q IGTAAQ     KDY E PP  LFEPSEL+SWSFYRAGIAE
Sbjct  1     MEGKEQDVSLGANKFPERQPIGTAAQSQDDGKDYQEPPPAPLFEPSELTSWSFYRAGIAE  60

Query  397   FIATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  576
             F+ATFLFLYITILTVMGV KSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV
Sbjct  61    FVATFLFLYITILTVMGVVKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  120

Query  577   TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGD  753
             TFGLFL RKLSLTRA+FY+VMQCLGAICGAGVVKGF GKTV+  KGGGAN V  GYTKGD
Sbjct  121   TFGLFLGRKLSLTRAIFYIVMQCLGAICGAGVVKGFEGKTVFGDKGGGANYVHDGYTKGD  180

Query  754   GLGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINP  933
             GLGAEIVGTFILVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINP
Sbjct  181   GLGAEIVGTFILVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINP  240

Query  934   ARSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             ARSLGAAI++N+   W++HW+FWVGPF
Sbjct  241   ARSLGAAIVFNKHLGWHEHWVFWVGPF  267



>ref|XP_009411509.1| PREDICTED: aquaporin PIP1-1-like [Musa acuminata subsp. malaccensis]
Length=287

 Score =   462 bits (1189),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 226/264 (86%), Positives = 240/264 (91%), Gaps = 2/264 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQD--KDYTEAPPTALFEPSELSSWSFYRAGIAEFI  402
             ME +EEDVR+GA  F E+Q IGTAAQ   KDY E PP  LFEP+EL SWSFYRAGIAEF+
Sbjct  1     MEGKEEDVRIGAIMFSERQPIGTAAQTHAKDYKEPPPAPLFEPAELRSWSFYRAGIAEFM  60

Query  403   ATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  582
             ATFLF+Y++ILTVMGV KSDSKC TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61    ATFLFIYVSILTVMGVVKSDSKCSTVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVTF  120

Query  583   GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLG  762
             GL LARKLSLTRA+FY+VMQCLGAICGAGVVKGF K VY   GGGANVVA GYTKGDGLG
Sbjct  121   GLLLARKLSLTRAIFYVVMQCLGAICGAGVVKGFQKGVYESNGGGANVVAAGYTKGDGLG  180

Query  763   AEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARS  942
             AEIVGTFILVYTVFSATDAKR+ARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARS
Sbjct  181   AEIVGTFILVYTVFSATDAKRSARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARS  240

Query  943   LGAAIIYNRDEAWNDHWIFWVGPF  1014
             LGAAIIYN++ AWNDHWIFWVGP 
Sbjct  241   LGAAIIYNKEHAWNDHWIFWVGPL  264



>gb|AAV80228.1| aquaporin 1 [Aegiceras corniculatum]
Length=288

 Score =   462 bits (1189),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 227/266 (85%), Positives = 243/266 (91%), Gaps = 4/266 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ---DKDYTEAPPTALFEPSELSSWSFYRAGIAEF  399
             ME +EEDVRLGANKF E+Q IGTAAQ   DKDY E P   LFEP ELSSWSFYRAGIAEF
Sbjct  1     MEGKEEDVRLGANKFAERQPIGTAAQGAGDKDYKEPPAAPLFEPGELSSWSFYRAGIAEF  60

Query  400   IATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  579
             +ATFLFLYIT+LTVMGVS+S SKC +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61    MATFLFLYITVLTVMGVSRSGSKCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  580   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGDG  756
             FGL LARKLSLTRA FYM+MQCLGAICGAGVVKGF G + +   GGGANVV PG+TKGDG
Sbjct  121   FGLLLARKLSLTRAXFYMIMQCLGAICGAGVVKGFEGSSRFTIAGGGANVVQPGHTKGDG  180

Query  757   LGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPA  936
             LGAEIVGTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPA
Sbjct  181   LGAEIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPA  240

Query  937   RSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             RSLGAAIIYN+D+AW++HWIFWVGPF
Sbjct  241   RSLGAAIIYNKDQAWDEHWIFWVGPF  266



>gb|EMS53768.1| Aquaporin PIP1-5 [Triticum urartu]
Length=290

 Score =   462 bits (1189),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 226/267 (85%), Positives = 244/267 (91%), Gaps = 5/267 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ---DKDYTEAPPTALFEPSELSSWSFYRAGIAEF  399
             ME +EEDVRLGAN++PE+Q IGTAAQ   DKDY E PP  LFE  EL+SWSFYRAGIAEF
Sbjct  1     MEGKEEDVRLGANRYPERQPIGTAAQGADDKDYKEPPPAPLFEAEELTSWSFYRAGIAEF  60

Query  400   IATFLFLYITILTVMGV--SKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPA  573
             +ATFLFLYI++LTVMGV  + S SKC TVGIQGIAW+FGGMIF LVYCTAGISGGHINPA
Sbjct  61    LATFLFLYISVLTVMGVVGNPSGSKCGTVGIQGIAWSFGGMIFVLVYCTAGISGGHINPA  120

Query  574   VTFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGD  753
             VTFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  T+Y G GGGAN VAPGYTKGD
Sbjct  121   VTFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFQTTLYMGNGGGANSVAPGYTKGD  180

Query  754   GLGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINP  933
             GLGAEIVGTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINP
Sbjct  181   GLGAEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINP  240

Query  934   ARSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             ARSLGAAIIYN+ ++W+DHWIFWVGPF
Sbjct  241   ARSLGAAIIYNKKQSWDDHWIFWVGPF  267



>gb|AFK41734.1| unknown [Medicago truncatula]
Length=289

 Score =   462 bits (1189),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 227/267 (85%), Positives = 243/267 (91%), Gaps = 5/267 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQD----KDYTEAPPTALFEPSELSSWSFYRAGIAE  396
             ME +E+DV LGANKFPE+Q +G AAQ     KDY E PP  LFEPSEL+SWSFYRAGIAE
Sbjct  1     MEAKEQDVSLGANKFPERQPLGIAAQSQDDPKDYQEPPPAPLFEPSELTSWSFYRAGIAE  60

Query  397   FIATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  576
             F+ATFLFLYI +LTVMGV ++DSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV
Sbjct  61    FVATFLFLYIAVLTVMGVVRADSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  120

Query  577   TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGD  753
             TFGLFLARKLSLTRA+FYMVMQCLGAICGAGVVKGF GKT +    GGAN VAPGYTKGD
Sbjct  121   TFGLFLARKLSLTRALFYMVMQCLGAICGAGVVKGFEGKTRFGDLKGGANFVAPGYTKGD  180

Query  754   GLGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINP  933
             GLGAEIVGTFILVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINP
Sbjct  181   GLGAEIVGTFILVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINP  240

Query  934   ARSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             ARSLGAAII+N+D  W+DHWIFWVGPF
Sbjct  241   ARSLGAAIIFNKDLGWDDHWIFWVGPF  267



>dbj|BAA92258.1| plasma membrane aquaporin 1b [Raphanus sativus]
 gb|AHV84996.1| aquaporin [Brassica rapa]
 emb|CDX74777.1| BnaA05g05230D [Brassica napus]
Length=286

 Score =   462 bits (1189),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 222/263 (84%), Positives = 241/263 (92%), Gaps = 1/263 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDVR+GANKFPE+Q IGT+AQ DKDY E PP  LFEP EL+SWSF+RAGIAEFIA
Sbjct  1     MEGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELASWSFWRAGIAEFIA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYIT+LTVMGV +S + C +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITVLTVMGVKRSPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGA  765
             LFLARKLSLTRAV+Y+VMQCLGAICGAGVVKGF    Y   GGGAN VAPGYTKG GLGA
Sbjct  121   LFLARKLSLTRAVYYIVMQCLGAICGAGVVKGFQPKQYQALGGGANTVAPGYTKGSGLGA  180

Query  766   EIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSL  945
             EI+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSL
Sbjct  181   EIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSL  240

Query  946   GAAIIYNRDEAWNDHWIFWVGPF  1014
             GAAII+N+D AW+DHW+FWVGPF
Sbjct  241   GAAIIFNKDNAWDDHWVFWVGPF  263



>emb|CAH60719.1| putative plasma membrane intrinsic protein [Populus tremula x 
Populus tremuloides]
Length=278

 Score =   462 bits (1188),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 229/266 (86%), Positives = 243/266 (91%), Gaps = 4/266 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ---DKDYTEAPPTALFEPSELSSWSFYRAGIAEF  399
             ME +EEDVRLGANKF E+Q +GTAAQ   DKDY E PP  LFEP EL+SWSFYRAGIAEF
Sbjct  1     MEGKEEDVRLGANKFNERQPLGTAAQSQDDKDYKEPPPAPLFEPGELTSWSFYRAGIAEF  60

Query  400   IATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  579
             +ATFLFLYIT+LTVMGV K  +KC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61    MATFLFLYITVLTVMGVVKDPTKCTTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  580   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGDG  756
             FGLFLARKLSLTRAVFYM+MQCLGAICGAGVVKGF GKT Y    GGAN+VA GYTKGDG
Sbjct  121   FGLFLARKLSLTRAVFYMLMQCLGAICGAGVVKGFYGKTNYELHNGGANMVAHGYTKGDG  180

Query  757   LGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPA  936
             LGAEIVGTFILVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPA
Sbjct  181   LGAEIVGTFILVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPA  240

Query  937   RSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             RSLGAAII+N+D AW+DHWIFWVGPF
Sbjct  241   RSLGAAIIFNKDSAWDDHWIFWVGPF  266



>dbj|BAA20075.1| water channel protein [Nicotiana excelsior]
Length=287

 Score =   462 bits (1189),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 225/262 (86%), Positives = 240/262 (92%), Gaps = 1/262 (0%)
 Frame = +1

Query  232   EHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIAT  408
             E++EEDV+LGANKF E Q +GTAAQ DKDY E PP  LFEP ELSSWSFYRAGIAEF+AT
Sbjct  3     ENKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFMAT  62

Query  409   FLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  588
             FLFLYITILTVMG+ +SDS C +VGIQG+AWAFGGMIFALVYCTAGISGGHINPAVTFGL
Sbjct  63    FLFLYITILTVMGLKRSDSLCSSVGIQGVAWAFGGMIFALVYCTAGISGGHINPAVTFGL  122

Query  589   FLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGAE  768
             FLARKLSLTRA+FYMVMQCLGAICGAGVVKGF    Y   GGGANVV PGYTKGDGLGAE
Sbjct  123   FLARKLSLTRAIFYMVMQCLGAICGAGVVKGFMVGPYQRLGGGANVVNPGYTKGDGLGAE  182

Query  769   IVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSLG  948
             I+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSLG
Sbjct  183   IIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLG  242

Query  949   AAIIYNRDEAWNDHWIFWVGPF  1014
             AAIIYN + AW+DHWIFWVGPF
Sbjct  243   AAIIYNDEHAWDDHWIFWVGPF  264



>gb|AFH36341.1| aquaporin PIP1;3 [Quercus petraea]
Length=286

 Score =   462 bits (1188),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 225/263 (86%), Positives = 241/263 (92%), Gaps = 1/263 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDV+LGANKF E+Q IGT+AQ DKDY E PP  LFEP EL SWSF+RAGIAEFIA
Sbjct  1     MEGKEEDVKLGANKFSERQPIGTSAQTDKDYKEPPPAPLFEPGELHSWSFWRAGIAEFIA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYITILTVMG S++ +KC +VG QGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITILTVMGYSRTTNKCASVGAQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGA  765
             LFLARKLSLTRAVFY+VMQCLGAICGAGVVKGF K +Y   GGGANVV  GYTKGDGLGA
Sbjct  121   LFLARKLSLTRAVFYIVMQCLGAICGAGVVKGFEKGLYENSGGGANVVNHGYTKGDGLGA  180

Query  766   EIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSL  945
             EI+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSL
Sbjct  181   EIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSL  240

Query  946   GAAIIYNRDEAWNDHWIFWVGPF  1014
             GAAIIYN+D AW+DHWIFWVGPF
Sbjct  241   GAAIIYNKDHAWDDHWIFWVGPF  263



>ref|XP_011047429.1| PREDICTED: probable aquaporin PIP1-4 [Populus euphratica]
Length=287

 Score =   462 bits (1188),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 225/265 (85%), Positives = 240/265 (91%), Gaps = 3/265 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQD---KDYTEAPPTALFEPSELSSWSFYRAGIAEF  399
             ME REEDVR+GANK+ E+Q IGTAAQ    KDYTE PP  LFEP ELSSWSFYRAGIAEF
Sbjct  1     MEGREEDVRVGANKYGERQPIGTAAQARDVKDYTEPPPAPLFEPGELSSWSFYRAGIAEF  60

Query  400   IATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  579
             +ATFLFLYIT+LTVMGV+KS +KC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61    VATFLFLYITVLTVMGVAKSATKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  580   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGL  759
             FGL LARKLSLTRAVFYM+MQCLGAICGAGVVK F K  Y   GGGAN V+ GY KG GL
Sbjct  121   FGLLLARKLSLTRAVFYMIMQCLGAICGAGVVKAFQKNQYEILGGGANTVSTGYAKGSGL  180

Query  760   GAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPAR  939
             GAEIVGTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPAR
Sbjct  181   GAEIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR  240

Query  940   SLGAAIIYNRDEAWNDHWIFWVGPF  1014
             SLGAA+IYN+D+AW+DHWIFWVGPF
Sbjct  241   SLGAALIYNQDQAWDDHWIFWVGPF  265



>ref|XP_009779003.1| PREDICTED: probable aquaporin PIP-type pTOM75 [Nicotiana sylvestris]
Length=288

 Score =   462 bits (1188),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 224/263 (85%), Positives = 241/263 (92%), Gaps = 2/263 (1%)
 Frame = +1

Query  232   EHREEDVRLGANKFPEKQAIGTAAQ--DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             E++EEDV LGANK+ E Q +GTAAQ  +KDY E PP  LFEP ELSSWSFYRAGIAEF+A
Sbjct  3     ENKEEDVNLGANKYRETQPLGTAAQTENKDYVEPPPAPLFEPGELSSWSFYRAGIAEFMA  62

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYITILTVMG+ +SDS C +VGIQG+AWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  63    TFLFLYITILTVMGLKRSDSLCSSVGIQGVAWAFGGMIFALVYCTAGISGGHINPAVTFG  122

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGA  765
             LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF K  Y   GGGANVV PGYTKGDGLGA
Sbjct  123   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFMKGPYQRLGGGANVVNPGYTKGDGLGA  182

Query  766   EIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSL  945
             EI+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSL
Sbjct  183   EIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSL  242

Query  946   GAAIIYNRDEAWNDHWIFWVGPF  1014
             GAAII+N+ +AW+DHWIFWVGPF
Sbjct  243   GAAIIFNKKQAWDDHWIFWVGPF  265



>ref|XP_008778916.1| PREDICTED: probable aquaporin PIP1-2 isoform X1 [Phoenix dactylifera]
Length=287

 Score =   462 bits (1188),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 226/264 (86%), Positives = 240/264 (91%), Gaps = 2/264 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ--DKDYTEAPPTALFEPSELSSWSFYRAGIAEFI  402
             ME +EEDVR+GANKF E+Q IGTAAQ  DKDY E PP  LFE  EL SWSFYRAGIAEF+
Sbjct  1     MEGKEEDVRVGANKFAERQPIGTAAQTQDKDYKEPPPAPLFELEELWSWSFYRAGIAEFM  60

Query  403   ATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  582
             ATFLFLYITILTVMGV ++ SKC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61    ATFLFLYITILTVMGVVQAKSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  583   GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLG  762
             GL LARKLSLTRA+ YMVMQCLGAICGAGVVKGF K +Y   GGGANVVAPGYTKGDGLG
Sbjct  121   GLLLARKLSLTRALLYMVMQCLGAICGAGVVKGFQKGIYESNGGGANVVAPGYTKGDGLG  180

Query  763   AEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARS  942
             AEI+GTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARS
Sbjct  181   AEIIGTFVLVYTVFSATDAKRSARDSHVPLLAPLPIGFAVFLVHLATIPITGTGINPARS  240

Query  943   LGAAIIYNRDEAWNDHWIFWVGPF  1014
             LGAAIIYN+D AW+D WIFWVGPF
Sbjct  241   LGAAIIYNKDHAWDDQWIFWVGPF  264



>dbj|BAI94500.1| plasma membrane intrinsic protein [Dianthus caryophyllus]
Length=289

 Score =   462 bits (1188),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 221/262 (84%), Positives = 239/262 (91%), Gaps = 0/262 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQDKDYTEAPPTALFEPSELSSWSFYRAGIAEFIAT  408
             ME +EEDV+LGANK+ E+Q IGT+AQ KDY E PP  LFEP EL SWSFYRAGIAEFIAT
Sbjct  1     MEGKEEDVKLGANKYSERQPIGTSAQTKDYKEPPPAPLFEPGELKSWSFYRAGIAEFIAT  60

Query  409   FLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  588
             FLFLYIT+LTVMGV ++ + C +VG+QGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL
Sbjct  61    FLFLYITVLTVMGVKRAPNMCASVGVQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  120

Query  589   FLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGAE  768
              LARKLSLTRAVFYM+MQCLGAICGAGVVKGF  + Y   GGGANVV PGYTKGDGLGAE
Sbjct  121   LLARKLSLTRAVFYMIMQCLGAICGAGVVKGFQPSPYEVLGGGANVVNPGYTKGDGLGAE  180

Query  769   IVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSLG  948
             IVGTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSLG
Sbjct  181   IVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLG  240

Query  949   AAIIYNRDEAWNDHWIFWVGPF  1014
             AAII+NR+ AWNDHWIFWVGPF
Sbjct  241   AAIIFNREHAWNDHWIFWVGPF  262



>gb|EYU32131.1| hypothetical protein MIMGU_mgv1a011344mg [Erythranthe guttata]
Length=285

 Score =   462 bits (1188),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 222/262 (85%), Positives = 238/262 (91%), Gaps = 0/262 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQDKDYTEAPPTALFEPSELSSWSFYRAGIAEFIAT  408
             ME +EEDV LGANK+ E+Q +GT+AQ KDY E PP  LFEP EL SWSF+RAGIAEF+AT
Sbjct  1     MEGKEEDVSLGANKYSERQPLGTSAQTKDYKEPPPAPLFEPGELKSWSFWRAGIAEFVAT  60

Query  409   FLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  588
             FLFLYIT+LTVMGVSKS SKC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL
Sbjct  61    FLFLYITVLTVMGVSKSPSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  120

Query  589   FLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGAE  768
             FLARKLSLTRAVFY+VMQCLGAICGAGVVKGF   +Y   GGGANVV  GYTKG GLGAE
Sbjct  121   FLARKLSLTRAVFYIVMQCLGAICGAGVVKGFQPKIYQAMGGGANVVNHGYTKGSGLGAE  180

Query  769   IVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSLG  948
             I+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSLG
Sbjct  181   IIGTFVLVYTVFSATDAKRNARDSHVPLLAPLPIGFAVFLVHLATIPITGTGINPARSLG  240

Query  949   AAIIYNRDEAWNDHWIFWVGPF  1014
             AAII+N D AW+DHW+FWVGPF
Sbjct  241   AAIIFNNDHAWDDHWVFWVGPF  262



>gb|ABJ97677.1| major intrinsic protein [Solanum tuberosum]
Length=288

 Score =   462 bits (1188),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 225/262 (86%), Positives = 240/262 (92%), Gaps = 1/262 (0%)
 Frame = +1

Query  232   EHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIAT  408
             E++EEDV LGANK+ E Q +GTAAQ DKDY E PP  LFEP ELSSWSFYRAGIAEF+AT
Sbjct  3     ENKEEDVNLGANKYRETQPLGTAAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFMAT  62

Query  409   FLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  588
             FLFLYITILTVMG+ +SDS C +VGIQG+AWAFGGMIFALVYCTAGISGGHINPAVTFGL
Sbjct  63    FLFLYITILTVMGLKRSDSLCSSVGIQGVAWAFGGMIFALVYCTAGISGGHINPAVTFGL  122

Query  589   FLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGAE  768
             FLARKLSLTRAVFY+VMQCLGAICGAGVVKGF    Y    GGANVV PGYTKGDGLGAE
Sbjct  123   FLARKLSLTRAVFYIVMQCLGAICGAGVVKGFMVGPYERLNGGANVVNPGYTKGDGLGAE  182

Query  769   IVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSLG  948
             I+GTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSLG
Sbjct  183   IIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLG  242

Query  949   AAIIYNRDEAWNDHWIFWVGPF  1014
             AAIIYN+DEAWNDHWIFWVGPF
Sbjct  243   AAIIYNKDEAWNDHWIFWVGPF  264



>ref|XP_009609568.1| PREDICTED: probable aquaporin PIP-type pTOM75 [Nicotiana tomentosiformis]
Length=288

 Score =   461 bits (1187),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 224/263 (85%), Positives = 241/263 (92%), Gaps = 2/263 (1%)
 Frame = +1

Query  232   EHREEDVRLGANKFPEKQAIGTAAQ--DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             E++EEDV LGANK+ E Q +GTAAQ  +KDY E PP  LFEP ELSSWSFYRAGIAEF+A
Sbjct  3     ENKEEDVNLGANKYRETQPLGTAAQTENKDYIEPPPAPLFEPGELSSWSFYRAGIAEFMA  62

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYITILTVMG+ +SDS C +VGIQG+AWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  63    TFLFLYITILTVMGLKRSDSLCSSVGIQGVAWAFGGMIFALVYCTAGISGGHINPAVTFG  122

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGA  765
             LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF K  Y   GGGANVV PGYTKGDGLGA
Sbjct  123   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFMKGPYQRLGGGANVVNPGYTKGDGLGA  182

Query  766   EIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSL  945
             EI+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSL
Sbjct  183   EIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSL  242

Query  946   GAAIIYNRDEAWNDHWIFWVGPF  1014
             GAAII+N+ +AW+DHWIFWVGPF
Sbjct  243   GAAIIFNKKQAWDDHWIFWVGPF  265



>emb|CDY07221.1| BnaCnng02360D [Brassica napus]
Length=286

 Score =   461 bits (1187),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 222/263 (84%), Positives = 242/263 (92%), Gaps = 1/263 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDVR+GANKFPE+Q IGT+AQ DKDY E PP  LFEP ELSSWSF+RAGIAEFIA
Sbjct  1     MEGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELSSWSFWRAGIAEFIA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYIT+LTVMGV ++ + C +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGA  765
             LFLARKLSLTRAVFYM+MQCLGAICGAGVVKGF  T Y   GGGAN VAPGY+KG GLGA
Sbjct  121   LFLARKLSLTRAVFYMIMQCLGAICGAGVVKGFQPTPYETLGGGANTVAPGYSKGSGLGA  180

Query  766   EIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSL  945
             EI+GTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSL
Sbjct  181   EIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSL  240

Query  946   GAAIIYNRDEAWNDHWIFWVGPF  1014
             GAAIIYN+D +W++HWIFWVGPF
Sbjct  241   GAAIIYNKDHSWDNHWIFWVGPF  263



>ref|XP_003611079.1| Aquaporin [Medicago truncatula]
 gb|AES94037.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=287

 Score =   461 bits (1187),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 227/263 (86%), Positives = 239/263 (91%), Gaps = 3/263 (1%)
 Frame = +1

Query  235   HREEDVRLGANKFPEKQAIGTAAQD--KDYTEAPPTALFEPSELSSWSFYRAGIAEFIAT  408
              REEDV++GANKF EK A+GT AQ   KDY EAPP  LFEP EL SWSFYRAGIAEF+AT
Sbjct  2     EREEDVKVGANKFSEKNALGTGAQSDSKDYKEAPPAPLFEPGELKSWSFYRAGIAEFVAT  61

Query  409   FLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  588
             FLFLYIT+LTVMGV++S SKC +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL
Sbjct  62    FLFLYITVLTVMGVNRSPSKCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  589   FLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGDGLGA  765
             FLARKLSLTRAVFY++MQCLGAICGAGVVKGF G   Y    GGANVV PGYTKGDGLGA
Sbjct  122   FLARKLSLTRAVFYIIMQCLGAICGAGVVKGFEGNARYELYKGGANVVNPGYTKGDGLGA  181

Query  766   EIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSL  945
             EIVGTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSL
Sbjct  182   EIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSL  241

Query  946   GAAIIYNRDEAWNDHWIFWVGPF  1014
             GAAIIYNRD AWNDHWIFWVGPF
Sbjct  242   GAAIIYNRDHAWNDHWIFWVGPF  264



>gb|AGD98710.1| aquaporin protein 7 [Camellia sinensis]
Length=286

 Score =   461 bits (1187),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 224/263 (85%), Positives = 240/263 (91%), Gaps = 1/263 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDV+LGANKF E+Q IGTAAQ DKDY E PP  LFEP EL SWSFYRAGIAEF+A
Sbjct  1     MEGKEEDVKLGANKFTERQPIGTAAQTDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFMA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYIT+LTVMGV ++ +KC +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITLLTVMGVVRAPTKCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGA  765
             LFLARKLSLTRAVFY+VMQCLGAICGAGVVKGF  ++Y    GGAN VA GYTKGDGLGA
Sbjct  121   LFLARKLSLTRAVFYIVMQCLGAICGAGVVKGFQPSIYQANNGGANFVAHGYTKGDGLGA  180

Query  766   EIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSL  945
             EIVGTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSL
Sbjct  181   EIVGTFVLVYTVFSATDAKRNARDSHVPLLAPLPIGFAVFLVHLATIPITGTGINPARSL  240

Query  946   GAAIIYNRDEAWNDHWIFWVGPF  1014
             GAAII+NRD  W+DHWIFWVGPF
Sbjct  241   GAAIIFNRDHVWDDHWIFWVGPF  263



>ref|XP_007051783.1| Plasma membrane intrinsic protein 1B [Theobroma cacao]
 gb|EOX95940.1| Plasma membrane intrinsic protein 1B [Theobroma cacao]
Length=286

 Score =   461 bits (1186),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 224/263 (85%), Positives = 242/263 (92%), Gaps = 1/263 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDV+LGANKF E+Q IGT+AQ DKDY E PP  LFEP EL SWSF+RAGIAEF+A
Sbjct  1     MEGKEEDVKLGANKFTERQPIGTSAQTDKDYKEQPPAPLFEPGELQSWSFWRAGIAEFVA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYIT+LTVMGV+++ +KC +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITVLTVMGVNRAPTKCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGA  765
             LFLARKLSLTRA+FY+VMQCLGAICGAGVVKGF  + Y   GGGANVV  GYTKGDGLGA
Sbjct  121   LFLARKLSLTRAIFYIVMQCLGAICGAGVVKGFQPSRYEVLGGGANVVNHGYTKGDGLGA  180

Query  766   EIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSL  945
             EIVGTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSL
Sbjct  181   EIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSL  240

Query  946   GAAIIYNRDEAWNDHWIFWVGPF  1014
             GAAIIYNRD AW+DHWIFWVGPF
Sbjct  241   GAAIIYNRDHAWDDHWIFWVGPF  263



>gb|AAT76618.1| aquaporin [Vicia faba]
Length=290

 Score =   461 bits (1187),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 227/267 (85%), Positives = 242/267 (91%), Gaps = 5/267 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQD----KDYTEAPPTALFEPSELSSWSFYRAGIAE  396
             ME +E+DV LGANKFPE+Q IG AAQ     KDY E PP  LFEPSEL+SWSFYRAGIAE
Sbjct  1     MEAKEQDVSLGANKFPERQPIGIAAQSHDDGKDYKEPPPAPLFEPSELTSWSFYRAGIAE  60

Query  397   FIATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  576
             F+ATFLFLYITILTVMGV+KS SKC TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAV
Sbjct  61    FVATFLFLYITILTVMGVNKSQSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAV  120

Query  577   TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGD  753
             TFGLFLARKLSLTRAVFY+VMQ LGAICGAGVVKGF GK  +  KGGGAN VAPGYTKGD
Sbjct  121   TFGLFLARKLSLTRAVFYIVMQVLGAICGAGVVKGFEGKAFFGEKGGGANFVAPGYTKGD  180

Query  754   GLGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINP  933
             GLGAEI+GTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINP
Sbjct  181   GLGAEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINP  240

Query  934   ARSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             ARSLGAAII+N+D  WND WIFWVGPF
Sbjct  241   ARSLGAAIIFNQDRGWNDQWIFWVGPF  267



>ref|XP_009600058.1| PREDICTED: probable aquaporin PIP-type pTOM75 [Nicotiana tomentosiformis]
Length=287

 Score =   461 bits (1186),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 225/262 (86%), Positives = 240/262 (92%), Gaps = 1/262 (0%)
 Frame = +1

Query  232   EHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIAT  408
             E++EEDV+LGANKF E Q +GTAAQ DKDY E PP  LFEP ELSSWSFYRAGIAEF+AT
Sbjct  3     ENKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFMAT  62

Query  409   FLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  588
             FLFLYITILTVMG+ +SDS C +VGIQG+AWAFGGMIFALVYCTAGISGGHINPAVTFGL
Sbjct  63    FLFLYITILTVMGLKRSDSLCSSVGIQGVAWAFGGMIFALVYCTAGISGGHINPAVTFGL  122

Query  589   FLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGAE  768
             FLARKLSLTRAVFY+VMQCLGAICGAGVVKGF    Y   GGGANVV  GYTKGDGLGAE
Sbjct  123   FLARKLSLTRAVFYIVMQCLGAICGAGVVKGFMVGPYQRHGGGANVVNSGYTKGDGLGAE  182

Query  769   IVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSLG  948
             I+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSLG
Sbjct  183   IIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLG  242

Query  949   AAIIYNRDEAWNDHWIFWVGPF  1014
             AAIIYN D+AW+DHWIFWVGPF
Sbjct  243   AAIIYNTDQAWDDHWIFWVGPF  264



>gb|AAL33585.1|AF440271_1 aquaporin [Nicotiana tabacum]
Length=286

 Score =   461 bits (1186),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 224/263 (85%), Positives = 241/263 (92%), Gaps = 2/263 (1%)
 Frame = +1

Query  232   EHREEDVRLGANKFPEKQAIGTAAQ--DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             E++EEDV LGANK+ E Q +GTAAQ  +KDY E PP  LFEP ELSSWSFYRAGIAEF+A
Sbjct  3     ENKEEDVNLGANKYRETQPLGTAAQTENKDYIEPPPAPLFEPGELSSWSFYRAGIAEFMA  62

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYITILTVMG+ +SDS C +VGIQG+AWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  63    TFLFLYITILTVMGLKRSDSLCSSVGIQGVAWAFGGMIFALVYCTAGISGGHINPAVTFG  122

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGA  765
             LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF K  Y   GGGANVV PGYTKGDGLGA
Sbjct  123   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFMKGPYQRLGGGANVVNPGYTKGDGLGA  182

Query  766   EIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSL  945
             EI+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSL
Sbjct  183   EIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSL  242

Query  946   GAAIIYNRDEAWNDHWIFWVGPF  1014
             GAAII+N+ +AW+DHWIFWVGPF
Sbjct  243   GAAIIFNKKQAWDDHWIFWVGPF  265



>ref|NP_001241050.1| uncharacterized protein LOC100791447 [Glycine max]
 gb|ACU20400.1| unknown [Glycine max]
Length=289

 Score =   461 bits (1186),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 230/267 (86%), Positives = 242/267 (91%), Gaps = 5/267 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQD----KDYTEAPPTALFEPSELSSWSFYRAGIAE  396
             ME +EEDV LGANKF E+Q IGTAAQ     KDYTE PP  LFEPSEL+SWSFYRAGIAE
Sbjct  1     MEGKEEDVSLGANKFSERQPIGTAAQSQDDGKDYTEPPPAPLFEPSELTSWSFYRAGIAE  60

Query  397   FIATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  576
             F+ATFLFLYITILTVMGV++S SKC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV
Sbjct  61    FVATFLFLYITILTVMGVNRSSSKCATVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  120

Query  577   TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGD  753
             TFGLFLARKLSLTRA+FYMVMQ LGAI GAGVVKGF GKT Y    GGAN VAPGYTKGD
Sbjct  121   TFGLFLARKLSLTRALFYMVMQVLGAIVGAGVVKGFEGKTFYGQHNGGANFVAPGYTKGD  180

Query  754   GLGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINP  933
             GLGAEIVGTFILVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINP
Sbjct  181   GLGAEIVGTFILVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINP  240

Query  934   ARSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             ARSLGAAII+N+D  W+DHWIFWVGPF
Sbjct  241   ARSLGAAIIFNKDLGWDDHWIFWVGPF  267



>ref|XP_002889360.1| hypothetical protein ARALYDRAFT_470115 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65619.1| hypothetical protein ARALYDRAFT_470115 [Arabidopsis lyrata subsp. 
lyrata]
Length=286

 Score =   461 bits (1186),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 224/263 (85%), Positives = 240/263 (91%), Gaps = 1/263 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDVR+GANKFPE+Q IGT+AQ DKDY E PP  LFEP ELSSWSFYRAGIAEFIA
Sbjct  1     MEGKEEDVRVGANKFPERQPIGTSAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFIA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYIT+LTVMGV ++ + C +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGA  765
             LFLARKLSLTRAVFY+VMQCLGAICGAGVVKGF    Y   GGGAN VA GYTKG GLGA
Sbjct  121   LFLARKLSLTRAVFYIVMQCLGAICGAGVVKGFQPNPYQTLGGGANTVAHGYTKGSGLGA  180

Query  766   EIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSL  945
             EI+GTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSL
Sbjct  181   EIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSL  240

Query  946   GAAIIYNRDEAWNDHWIFWVGPF  1014
             GAAIIYN+D AW+DHWIFWVGPF
Sbjct  241   GAAIIYNKDHAWDDHWIFWVGPF  263



>ref|XP_010109640.1| hypothetical protein L484_015595 [Morus notabilis]
 gb|EXC23685.1| hypothetical protein L484_015595 [Morus notabilis]
Length=419

 Score =   466 bits (1199),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 228/265 (86%), Positives = 241/265 (91%), Gaps = 3/265 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQD---KDYTEAPPTALFEPSELSSWSFYRAGIAEF  399
             ME +EEDVRLGAN++ E+Q IGTAAQ    KDYTE PP  LFEP ELSSWSFYRAGIAEF
Sbjct  1     MEGKEEDVRLGANRYGERQPIGTAAQSQDVKDYTEPPPAPLFEPGELSSWSFYRAGIAEF  60

Query  400   IATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  579
             +ATFLFLYIT+LTVMGV KS SKC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61    VATFLFLYITVLTVMGVVKSPSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  580   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGL  759
             FGL LARKLSLTRAVFYM+MQCLGAICGAGVVKGF KT Y   GGGAN VA GY+K DGL
Sbjct  121   FGLLLARKLSLTRAVFYMIMQCLGAICGAGVVKGFQKTQYEVLGGGANTVAAGYSKSDGL  180

Query  760   GAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPAR  939
             GAEIVGTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPAR
Sbjct  181   GAEIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR  240

Query  940   SLGAAIIYNRDEAWNDHWIFWVGPF  1014
             SLGAA+IYNR+ AW+DHWIFWVGPF
Sbjct  241   SLGAALIYNREHAWDDHWIFWVGPF  265



>gb|ABC01892.1| major intrinsic protein 1-like protein [Solanum tuberosum]
Length=288

 Score =   461 bits (1186),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 224/262 (85%), Positives = 240/262 (92%), Gaps = 1/262 (0%)
 Frame = +1

Query  232   EHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIAT  408
             E++EEDV LGANK+ E Q +GTAAQ DKDY E PP  LFEP ELSSWSFYRAGIAEF+AT
Sbjct  3     ENKEEDVNLGANKYRETQPLGTAAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFMAT  62

Query  409   FLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  588
             FLFLYITILTVMG+ +SDS C +VGIQG+AWAFGGMIFALVYCTAGISGGHINPAVTFGL
Sbjct  63    FLFLYITILTVMGLKRSDSLCSSVGIQGVAWAFGGMIFALVYCTAGISGGHINPAVTFGL  122

Query  589   FLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGAE  768
             FLARKLSLTRAVFY+VMQCLGAICGAGVVKGF    Y    GGAN V+PGYTKGDGLGAE
Sbjct  123   FLARKLSLTRAVFYIVMQCLGAICGAGVVKGFMVGPYEKLKGGANFVSPGYTKGDGLGAE  182

Query  769   IVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSLG  948
             I+GTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSLG
Sbjct  183   IIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLG  242

Query  949   AAIIYNRDEAWNDHWIFWVGPF  1014
             AAIIYN+DEAWNDHWIFWVGPF
Sbjct  243   AAIIYNKDEAWNDHWIFWVGPF  264



>ref|XP_011035995.1| PREDICTED: probable aquaporin PIP1-2 [Populus euphratica]
Length=287

 Score =   461 bits (1185),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 227/266 (85%), Positives = 243/266 (91%), Gaps = 4/266 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ---DKDYTEAPPTALFEPSELSSWSFYRAGIAEF  399
             ME +EEDVRLGANKF E+Q +GTAAQ   DKDY E PP  LFEP EL+SWSFYRAGIAEF
Sbjct  1     MEGKEEDVRLGANKFNERQPLGTAAQSQDDKDYKEPPPAPLFEPGELTSWSFYRAGIAEF  60

Query  400   IATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  579
             +ATFLFLYIT+LTVMGVSK  +KC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61    MATFLFLYITVLTVMGVSKDTTKCTTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  580   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGDG  756
             FGLFLARKLSLTRAVFYM+MQCLGAICGAGVVKGF GK  Y    GGAN+V  GYTKGDG
Sbjct  121   FGLFLARKLSLTRAVFYMLMQCLGAICGAGVVKGFYGKENYEMFKGGANMVNTGYTKGDG  180

Query  757   LGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPA  936
             LGAEIVGTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIP+TGTGINPA
Sbjct  181   LGAEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPVTGTGINPA  240

Query  937   RSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             RSLGAAII+N+DEAW+DHWIFWVGPF
Sbjct  241   RSLGAAIIFNKDEAWDDHWIFWVGPF  266



>gb|AFC92657.1| aquaporin PIP1;3 [Eustoma exaltatum subsp. russellianum]
Length=287

 Score =   461 bits (1185),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 223/262 (85%), Positives = 240/262 (92%), Gaps = 1/262 (0%)
 Frame = +1

Query  232   EHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIAT  408
             E +EEDV+LGANKF E+Q +GTAAQ DKDY EAP   LFEP ELSSWSFYRAGIAEFIAT
Sbjct  3     ESKEEDVKLGANKFNERQPLGTAAQTDKDYKEAPAAPLFEPGELSSWSFYRAGIAEFIAT  62

Query  409   FLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  588
              LFLYIT+LTVMG  +SD+KCK+VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL
Sbjct  63    LLFLYITVLTVMGYGRSDNKCKSVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  122

Query  589   FLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGAE  768
             FLARKLSLTRA+FY+VMQCLGAICGAG+VKGF K+ Y    GGAN VA GYTKGDGLGAE
Sbjct  123   FLARKLSLTRALFYIVMQCLGAICGAGIVKGFQKSAYERLNGGANFVAHGYTKGDGLGAE  182

Query  769   IVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSLG  948
             I+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSLG
Sbjct  183   IIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLG  242

Query  949   AAIIYNRDEAWNDHWIFWVGPF  1014
             AAII+N+D  WNDHWIFWVGPF
Sbjct  243   AAIIFNKDLGWNDHWIFWVGPF  264



>gb|AHI54567.1| aquaporin protein 7 [Camellia japonica]
Length=286

 Score =   461 bits (1185),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 223/263 (85%), Positives = 240/263 (91%), Gaps = 1/263 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDV+LGANKF E+Q +GTAAQ DKDY E PP  LFEP EL SWSFYRAGIAEF+A
Sbjct  1     MEGKEEDVKLGANKFTERQPLGTAAQTDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFMA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYIT+LTVMGV ++ +KC +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITLLTVMGVVRAPTKCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGA  765
             LFLARKLSLTRAVFY+VMQCLGAICGAGVVKGF  ++Y    GGAN VA GYTKGDGLGA
Sbjct  121   LFLARKLSLTRAVFYIVMQCLGAICGAGVVKGFQPSIYQANNGGANFVAHGYTKGDGLGA  180

Query  766   EIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSL  945
             EIVGTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSL
Sbjct  181   EIVGTFVLVYTVFSATDAKRNARDSHVPLLAPLPIGFAVFLVHLATIPITGTGINPARSL  240

Query  946   GAAIIYNRDEAWNDHWIFWVGPF  1014
             GAAII+NRD  W+DHWIFWVGPF
Sbjct  241   GAAIIFNRDHVWDDHWIFWVGPF  263



>emb|CAA64896.1| transmembrane channel protein [Brassica oleracea]
 dbj|BAA92259.1| plasma membrane aquaporin 1c [Raphanus sativus]
 gb|ABD84431.1| aquaporin PIP1 [Noccaea caerulescens]
 emb|CDY37078.1| BnaA04g26560D [Brassica napus]
 emb|CDY27346.1| BnaC04g50590D [Brassica napus]
Length=286

 Score =   461 bits (1185),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 221/263 (84%), Positives = 241/263 (92%), Gaps = 1/263 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDVR+GANKFPE+Q IGT+AQ DKDY E PP  LFEP EL+SWSF+RAGIAEFIA
Sbjct  1     MEGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELASWSFWRAGIAEFIA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYIT+LTVMGV ++ + C +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGA  765
             LFLARKLSLTRAV+Y+VMQCLGAICGAGVVKGF    Y   GGGAN VAPGYTKG GLGA
Sbjct  121   LFLARKLSLTRAVYYIVMQCLGAICGAGVVKGFQPKQYQALGGGANTVAPGYTKGSGLGA  180

Query  766   EIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSL  945
             EI+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSL
Sbjct  181   EIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSL  240

Query  946   GAAIIYNRDEAWNDHWIFWVGPF  1014
             GAAII+N+D AW+DHW+FWVGPF
Sbjct  241   GAAIIFNKDNAWDDHWVFWVGPF  263



>ref|XP_006848145.1| hypothetical protein AMTR_s00029p00227660 [Amborella trichopoda]
 gb|ERN09726.1| hypothetical protein AMTR_s00029p00227660 [Amborella trichopoda]
Length=287

 Score =   461 bits (1185),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 225/264 (85%), Positives = 239/264 (91%), Gaps = 2/264 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ--DKDYTEAPPTALFEPSELSSWSFYRAGIAEFI  402
             ME +EEDV+LGANK+ E+Q IGTAAQ  DKDY E PP  LFEP EL SWSF+RAGIAEFI
Sbjct  1     MEGKEEDVKLGANKYSERQPIGTAAQSQDKDYKEPPPAPLFEPGELQSWSFWRAGIAEFI  60

Query  403   ATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  582
             ATFLFLYITILTVMGV K  + C +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61    ATFLFLYITILTVMGVKKETTLCSSVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  583   GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLG  762
             GL LARKLSLTRAVFYMVMQCLGAICGAGVVKGF K+ Y   GGGAN V  GYTKGDGLG
Sbjct  121   GLLLARKLSLTRAVFYMVMQCLGAICGAGVVKGFEKSQYQVHGGGANRVQNGYTKGDGLG  180

Query  763   AEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARS  942
             AEIVGTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARS
Sbjct  181   AEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS  240

Query  943   LGAAIIYNRDEAWNDHWIFWVGPF  1014
             LGAAII+NRD+AW+DHWIFWVGPF
Sbjct  241   LGAAIIFNRDQAWDDHWIFWVGPF  264



>ref|NP_001048566.1| Os02g0823100 [Oryza sativa Japonica Group]
 sp|Q9SXF8.2|PIP13_ORYSJ RecName: Full=Aquaporin PIP 1-3; AltName: Full=OsPIP1;3; AltName: 
Full=Plasma membrane intrinsic protein 1-3; AltName: Full=Water 
channel protein RWC3; Short=RWC-3 [Oryza sativa Japonica 
Group]
 dbj|BAD22920.1| putative plasma membrane intrinsic protein [Oryza sativa Japonica 
Group]
 dbj|BAF10480.1| Os02g0823100 [Oryza sativa Japonica Group]
 gb|EAZ25130.1| hypothetical protein OsJ_08930 [Oryza sativa Japonica Group]
 dbj|BAG95425.1| unnamed protein product [Oryza sativa Japonica Group]
Length=288

 Score =   461 bits (1185),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 224/265 (85%), Positives = 241/265 (91%), Gaps = 3/265 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ---DKDYTEAPPTALFEPSELSSWSFYRAGIAEF  399
             ME +EEDVRLGAN++ E+Q IGTAAQ   +KDY E P   +FE  EL+SWSFYRAGIAEF
Sbjct  1     MEGKEEDVRLGANRYTERQPIGTAAQGAEEKDYREPPAAPVFEVEELTSWSFYRAGIAEF  60

Query  400   IATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  579
             +ATFLFLYI+ILTVMGV+KS SKC TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAVT
Sbjct  61    VATFLFLYISILTVMGVNKSASKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVT  120

Query  580   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGL  759
             FGLFLARKLSLTRAVFYM MQCLGAICGAGVVKGF + +Y G GGGAN V PGYTKGDGL
Sbjct  121   FGLFLARKLSLTRAVFYMAMQCLGAICGAGVVKGFQRGLYMGSGGGANAVNPGYTKGDGL  180

Query  760   GAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPAR  939
             GAEIVGTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPAR
Sbjct  181   GAEIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR  240

Query  940   SLGAAIIYNRDEAWNDHWIFWVGPF  1014
             SLGAAI+YNR  AW+DHWIFWVGPF
Sbjct  241   SLGAAIVYNRAHAWHDHWIFWVGPF  265



>gb|ACU00100.1| plasma membrane intrinsic protein PIP1.3 [Populus trichocarpa 
x Populus deltoides]
Length=288

 Score =   461 bits (1185),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 229/265 (86%), Positives = 243/265 (92%), Gaps = 3/265 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDV+LGANKF E+Q IGT+AQ DKDY EAPP  LFEP EL SWSFYRAGIAEFIA
Sbjct  1     MEGKEEDVKLGANKFSERQPIGTSAQTDKDYKEAPPAPLFEPGELKSWSFYRAGIAEFIA  60

Query  406   TFLFLYITILTVMGVSK-SDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  582
             TFLFLYIT+LTVMGV+K   SKC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61    TFLFLYITVLTVMGVTKPGTSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  583   GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGDGL  759
             GLFLARKLSLTRAVFY++MQCLGAICGAGVVKGF G   Y  +GGGANVV  GYTKGDGL
Sbjct  121   GLFLARKLSLTRAVFYIIMQCLGAICGAGVVKGFQGSHNYELQGGGANVVNHGYTKGDGL  180

Query  760   GAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPAR  939
             GAEIVGTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPAR
Sbjct  181   GAEIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR  240

Query  940   SLGAAIIYNRDEAWNDHWIFWVGPF  1014
             SLGAAII+N+D AW+DHWIFWVGPF
Sbjct  241   SLGAAIIFNKDHAWDDHWIFWVGPF  265



>ref|XP_009116806.1| PREDICTED: aquaporin PIP1-1 isoform X1 [Brassica rapa]
Length=286

 Score =   460 bits (1184),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 221/263 (84%), Positives = 240/263 (91%), Gaps = 1/263 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDVR+GANKFPE+Q IGT+AQ DKDY E PP  LFEP ELSSWSF+RAGIAEFIA
Sbjct  1     MEGKEEDVRVGANKFPERQPIGTSAQSDKDYNEPPPAPLFEPGELSSWSFWRAGIAEFIA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYIT+LTVMGV +S + C +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITVLTVMGVKRSPNMCSSVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGA  765
             LFLARKLSLTRA++Y+VMQC GAICGAGVVKGF    Y   GGGAN VAPGYTKG GLGA
Sbjct  121   LFLARKLSLTRALYYIVMQCWGAICGAGVVKGFQPNQYQAIGGGANTVAPGYTKGSGLGA  180

Query  766   EIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSL  945
             EI+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSL
Sbjct  181   EIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSL  240

Query  946   GAAIIYNRDEAWNDHWIFWVGPF  1014
             GAAIIYN+D +W+DHW+FWVGPF
Sbjct  241   GAAIIYNKDHSWDDHWVFWVGPF  263



>gb|AGG39695.1| aquaporin protein AQU17 [Camellia sinensis]
Length=287

 Score =   460 bits (1184),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 227/265 (86%), Positives = 241/265 (91%), Gaps = 3/265 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ--DKDYTEAPPTALFEPSELSSWSFYRAGIAEFI  402
             ME +EEDVRLGANKFPE+Q IGT+AQ  DKDY E PP  LFEPSEL+SWSFYRAGIAEF+
Sbjct  1     MEGKEEDVRLGANKFPERQPIGTSAQGGDKDYMEPPPAPLFEPSELTSWSFYRAGIAEFM  60

Query  403   ATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  582
             ATFLFLYITILTVMGV  S +KC TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61    ATFLFLYITILTVMGVVSSKTKCSTVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVTF  120

Query  583   GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGDGL  759
             GL LARKLSLTRAVFY+VMQCLGAICGA VVKGF G T Y   GGGAN V  GYTKGDGL
Sbjct  121   GLLLARKLSLTRAVFYIVMQCLGAICGAAVVKGFEGTTRYELLGGGANSVNHGYTKGDGL  180

Query  760   GAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPAR  939
             GAEIVGTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPAR
Sbjct  181   GAEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR  240

Query  940   SLGAAIIYNRDEAWNDHWIFWVGPF  1014
             SLGAAI+YN+D AW+DHWIFWVGPF
Sbjct  241   SLGAAIVYNKDHAWDDHWIFWVGPF  265



>gb|AGQ21873.1| putative PIP-type aquaporin [Panicum virgatum]
Length=288

 Score =   460 bits (1184),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 225/265 (85%), Positives = 239/265 (90%), Gaps = 3/265 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ---DKDYTEAPPTALFEPSELSSWSFYRAGIAEF  399
             ME +EEDVRLGA KF E+Q IGTAAQ   DKDY E PP  LFEP EL SWSFYRAGIAEF
Sbjct  1     MEGKEEDVRLGAYKFSERQPIGTAAQGSEDKDYKEPPPAPLFEPGELKSWSFYRAGIAEF  60

Query  400   IATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  579
             +ATFLFLY+TILTVMGV+ S SKC +VGIQGIAW+FGGMIFALVYCTAGISGGHINPAVT
Sbjct  61    MATFLFLYVTILTVMGVNNSPSKCASVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVT  120

Query  580   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGL  759
             FGLFLARKLSLTRAVFY+VMQCLGAICGAGVVKGF + +Y   GGGAN V  GYTKGDGL
Sbjct  121   FGLFLARKLSLTRAVFYIVMQCLGAICGAGVVKGFQQGLYMSTGGGANAVNAGYTKGDGL  180

Query  760   GAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPAR  939
             GAEIVGTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPAR
Sbjct  181   GAEIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR  240

Query  940   SLGAAIIYNRDEAWNDHWIFWVGPF  1014
             SLGAAIIYNR+  W+DHWIFWVGPF
Sbjct  241   SLGAAIIYNREHTWSDHWIFWVGPF  265



>gb|AGQ21874.1| putative PIP-type aquaporin [Miscanthus sinensis]
Length=288

 Score =   460 bits (1184),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 225/265 (85%), Positives = 239/265 (90%), Gaps = 3/265 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ---DKDYTEAPPTALFEPSELSSWSFYRAGIAEF  399
             ME +EEDVRLGA KF E+Q IGTAAQ   DKDY E PP  LFEP EL SWSFYRAGIAEF
Sbjct  1     MEGKEEDVRLGAYKFSERQPIGTAAQGSEDKDYKEPPPAPLFEPGELKSWSFYRAGIAEF  60

Query  400   IATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  579
             +ATFLFLY+TILTVMGV+ S SKC +VGIQGIAW+FGGMIFALVYCTAGISGGHINPAVT
Sbjct  61    MATFLFLYVTILTVMGVNNSPSKCASVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVT  120

Query  580   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGL  759
             FGLFLARKLSLTRAVFY+VMQCLGAICGAGVVKGF + +Y   GGGAN V  GYTKGDGL
Sbjct  121   FGLFLARKLSLTRAVFYIVMQCLGAICGAGVVKGFQQGLYMSTGGGANAVNAGYTKGDGL  180

Query  760   GAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPAR  939
             GAEIVGTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPAR
Sbjct  181   GAEIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR  240

Query  940   SLGAAIIYNRDEAWNDHWIFWVGPF  1014
             SLGAAIIYNR+  W+DHWIFWVGPF
Sbjct  241   SLGAAIIYNREHTWSDHWIFWVGPF  265



>ref|XP_011042268.1| PREDICTED: probable aquaporin PIP1-2 [Populus euphratica]
Length=288

 Score =   460 bits (1184),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 229/266 (86%), Positives = 241/266 (91%), Gaps = 4/266 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ---DKDYTEAPPTALFEPSELSSWSFYRAGIAEF  399
             ME +EEDVRLGAN+F E+Q IGTAAQ   DKDY E PP  LFEP EL SWSFYRAGIAEF
Sbjct  1     MEGKEEDVRLGANRFNERQPIGTAAQSLDDKDYKEPPPAPLFEPGELISWSFYRAGIAEF  60

Query  400   IATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  579
             +ATFLFLYIT+LTVMGV K  +KC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61    MATFLFLYITVLTVMGVVKDQTKCTTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  580   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGDG  756
             FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF GK  Y    GGAN+VA GYTKGDG
Sbjct  121   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFYGKANYEMHNGGANMVAHGYTKGDG  180

Query  757   LGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPA  936
             LGAEIVGTFILVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPA
Sbjct  181   LGAEIVGTFILVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPA  240

Query  937   RSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             RSLGAAII+N+D AW+DHWIFWVGPF
Sbjct  241   RSLGAAIIFNKDSAWDDHWIFWVGPF  266



>ref|XP_010053244.1| PREDICTED: aquaporin PIP1-3 [Eucalyptus grandis]
 gb|KCW77501.1| hypothetical protein EUGRSUZ_D01836 [Eucalyptus grandis]
Length=287

 Score =   460 bits (1184),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 225/264 (85%), Positives = 240/264 (91%), Gaps = 2/264 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDVRLGANKF E+Q IGT+AQ DKDY E PP  LFEP EL SWSFYRAGIAEF+A
Sbjct  1     MEGKEEDVRLGANKFSERQPIGTSAQTDKDYKEPPPAPLFEPGELQSWSFYRAGIAEFVA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYIT+LTVMGVS+S +KC TVG+QGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITVLTVMGVSQSKTKCTTVGVQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGDGLG  762
             LFLARKLSLTRAVFY++MQCLGAICGAGVVKG  G T Y   GGGAN V  GYTKGDGLG
Sbjct  121   LFLARKLSLTRAVFYIIMQCLGAICGAGVVKGLQGDTRYELLGGGANSVNHGYTKGDGLG  180

Query  763   AEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARS  942
             AEI+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARS
Sbjct  181   AEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS  240

Query  943   LGAAIIYNRDEAWNDHWIFWVGPF  1014
             LGAAI+YNRD AW+D WIFWVGPF
Sbjct  241   LGAAIMYNRDHAWDDQWIFWVGPF  264



>ref|XP_006352272.1| PREDICTED: probable aquaporin PIP-type pTOM75-like [Solanum tuberosum]
Length=287

 Score =   460 bits (1184),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 223/262 (85%), Positives = 241/262 (92%), Gaps = 1/262 (0%)
 Frame = +1

Query  232   EHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIAT  408
             E++EEDV LGANKF E Q +GT+AQ DKDY E P   LFEP ELSSWSFYRAGIAEF+AT
Sbjct  3     ENKEEDVNLGANKFREPQPLGTSAQTDKDYNEPPAAPLFEPGELSSWSFYRAGIAEFMAT  62

Query  409   FLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  588
             FLFLYITILTVMG+ +SDS C +VGIQG+AWAFGGMIFALVYCTAGISGGHINPAVTFGL
Sbjct  63    FLFLYITILTVMGLKRSDSLCSSVGIQGVAWAFGGMIFALVYCTAGISGGHINPAVTFGL  122

Query  589   FLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGAE  768
             FLARKLSLTRAVFY+VMQCLGAICGAGVVKGF +  Y   GGGANVV PGYTKGDGLGAE
Sbjct  123   FLARKLSLTRAVFYIVMQCLGAICGAGVVKGFMQGPYQRFGGGANVVQPGYTKGDGLGAE  182

Query  769   IVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSLG  948
             I+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSLG
Sbjct  183   IIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLG  242

Query  949   AAIIYNRDEAWNDHWIFWVGPF  1014
             AAII+N+D+AW+DHWIFWVGPF
Sbjct  243   AAIIFNQDQAWDDHWIFWVGPF  264



>dbj|BAG68660.1| plasma membrane intrinsic protein [Tulipa gesneriana]
Length=288

 Score =   460 bits (1183),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 227/265 (86%), Positives = 241/265 (91%), Gaps = 3/265 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ--DKDYTEAPPTALFEPSELSSWSFYRAGIAEFI  402
             ME +EEDV LGANKF E Q +GTAAQ  DKDYTE PP  LFEP EL+SWSFYRAGIAEF+
Sbjct  1     MEGKEEDVSLGANKFTEHQPLGTAAQTHDKDYTEPPPAPLFEPGELASWSFYRAGIAEFV  60

Query  403   ATFLFLYITILTVMGVSKSDS-KCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  579
             ATFLFLYITILTVMGVSKS + KC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61    ATFLFLYITILTVMGVSKSPTNKCTTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  580   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGL  759
             FGLFLARKLSLTRAVFYM+MQCLGAICGAGVVKG+ KT+Y G GGGAN V  GYTKG GL
Sbjct  121   FGLFLARKLSLTRAVFYMIMQCLGAICGAGVVKGYQKTLYMGAGGGANAVNHGYTKGSGL  180

Query  760   GAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPAR  939
             GAEI+GTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPAR
Sbjct  181   GAEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR  240

Query  940   SLGAAIIYNRDEAWNDHWIFWVGPF  1014
             SLGAAIIYN+   W+DHWIFWVGPF
Sbjct  241   SLGAAIIYNKAHTWDDHWIFWVGPF  265



>gb|ABI96812.1| plasma membrane intrinsic protein [Triticum aestivum]
Length=288

 Score =   460 bits (1183),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 224/265 (85%), Positives = 240/265 (91%), Gaps = 3/265 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ---DKDYTEAPPTALFEPSELSSWSFYRAGIAEF  399
             ME +EEDVRLGANK+ E+Q IGTAAQ   D+DY E PP  LFEP EL SWSFYRAGIAEF
Sbjct  1     MEAKEEDVRLGANKYSERQPIGTAAQGSEDEDYKEPPPAPLFEPGELKSWSFYRAGIAEF  60

Query  400   IATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  579
             +AT LFLY+TILTVMG S + SKC TVGIQGIAW+FGG IFALVYCTAGISGGHINPAVT
Sbjct  61    VATSLFLYVTILTVMGYSGATSKCATVGIQGIAWSFGGTIFALVYCTAGISGGHINPAVT  120

Query  580   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGL  759
             FGLFLARKLSLTRAVFY+VMQCLGAICGAGVVKGF + +Y G GGGANVVAPGYTKG GL
Sbjct  121   FGLFLARKLSLTRAVFYIVMQCLGAICGAGVVKGFQQGLYMGNGGGANVVAPGYTKGSGL  180

Query  760   GAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPAR  939
             GAEI+GTF+ VYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPAR
Sbjct  181   GAEIIGTFVPVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR  240

Query  940   SLGAAIIYNRDEAWNDHWIFWVGPF  1014
             SLGAAIIYNR+ AW+DHWIFWVGPF
Sbjct  241   SLGAAIIYNREHAWSDHWIFWVGPF  265



>gb|KHG19073.1| Aquaporin PIP1-3 -like protein [Gossypium arboreum]
Length=287

 Score =   460 bits (1183),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 225/264 (85%), Positives = 240/264 (91%), Gaps = 2/264 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDV+LGANKF E+Q IGT+AQ DKDY E P    FEP EL SWSFYRAGIAEF+A
Sbjct  1     MEGKEEDVKLGANKFSERQPIGTSAQTDKDYKEPPAAPFFEPGELKSWSFYRAGIAEFVA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYIT+LTVMGVS+S +KC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITVLTVMGVSQSKTKCATVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGDGLG  762
             LFLARKLSLTRAVFYM+MQCLGAICGAGVVKGF G   Y   GGGANVV  GYTKGDGLG
Sbjct  121   LFLARKLSLTRAVFYMIMQCLGAICGAGVVKGFQGDNRYEMLGGGANVVNHGYTKGDGLG  180

Query  763   AEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARS  942
             AEI+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARS
Sbjct  181   AEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS  240

Query  943   LGAAIIYNRDEAWNDHWIFWVGPF  1014
             LGAAIIYN+D AW+DHW+FWVGPF
Sbjct  241   LGAAIIYNKDHAWDDHWVFWVGPF  264



>ref|NP_001274291.1| probable aquaporin PIP-type pTOM75-like [Solanum lycopersicum]
 dbj|BAO18623.1| plasmamembrane intrinsic protein 1;3 [Solanum lycopersicum]
Length=288

 Score =   460 bits (1183),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 223/262 (85%), Positives = 241/262 (92%), Gaps = 1/262 (0%)
 Frame = +1

Query  232   EHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIAT  408
             E++EEDV LGANK+ E Q +GTAAQ DKDY E PP  LFEP ELSSWSFYRAGIAEF+AT
Sbjct  3     ENKEEDVNLGANKYRETQPLGTAAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFMAT  62

Query  409   FLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  588
             FLFLYITILTVMG+ +SDS C +VG+QG+AWAFGGMIFALVYCTAGISGGHINPAVTFGL
Sbjct  63    FLFLYITILTVMGLKRSDSLCSSVGVQGVAWAFGGMIFALVYCTAGISGGHINPAVTFGL  122

Query  589   FLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGAE  768
             FLARKLSLTRAVFY+VMQCLGAICGAGVVKGF    Y   GGGANVV PGYTKGDGLGAE
Sbjct  123   FLARKLSLTRAVFYIVMQCLGAICGAGVVKGFMVGPYERLGGGANVVNPGYTKGDGLGAE  182

Query  769   IVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSLG  948
             I+GTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSLG
Sbjct  183   IIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLG  242

Query  949   AAIIYNRDEAWNDHWIFWVGPF  1014
             AAII+N+DEAW+DHWIFWVGPF
Sbjct  243   AAIIFNKDEAWDDHWIFWVGPF  264



>gb|EAY88074.1| hypothetical protein OsI_09504 [Oryza sativa Indica Group]
Length=288

 Score =   460 bits (1183),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 224/265 (85%), Positives = 240/265 (91%), Gaps = 3/265 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ---DKDYTEAPPTALFEPSELSSWSFYRAGIAEF  399
             ME +EEDVRLGAN++ E+Q IGTAAQ   +KDY E P   +FE  EL+SWSFYRAGIAEF
Sbjct  1     MEGKEEDVRLGANRYTERQPIGTAAQGAEEKDYREPPAAPVFEAEELTSWSFYRAGIAEF  60

Query  400   IATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  579
             +ATFLFLYI ILTVMGV+KS SKC TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAVT
Sbjct  61    VATFLFLYIRILTVMGVNKSASKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVT  120

Query  580   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGL  759
             FGLFLARKLSLTRAVFYM MQCLGAICGAGVVKGF + +Y G GGGAN V PGYTKGDGL
Sbjct  121   FGLFLARKLSLTRAVFYMAMQCLGAICGAGVVKGFQRGLYMGSGGGANAVNPGYTKGDGL  180

Query  760   GAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPAR  939
             GAEIVGTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPAR
Sbjct  181   GAEIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR  240

Query  940   SLGAAIIYNRDEAWNDHWIFWVGPF  1014
             SLGAAI+YNR  AW+DHWIFWVGPF
Sbjct  241   SLGAAIVYNRAHAWHDHWIFWVGPF  265



>ref|XP_007009059.1| Plasma membrane intrinsic protein 1,4 [Theobroma cacao]
 gb|EOY17869.1| Plasma membrane intrinsic protein 1,4 [Theobroma cacao]
Length=289

 Score =   460 bits (1183),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 227/267 (85%), Positives = 241/267 (90%), Gaps = 5/267 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ----DKDYTEAPPTALFEPSELSSWSFYRAGIAE  396
             ME +EEDVRLGANKF E+Q IGTAAQ    +KDYTE PP  LFEP EL+SWSFYRAGIAE
Sbjct  1     MEGKEEDVRLGANKFSERQPIGTAAQSQDEEKDYTEPPPAPLFEPGELTSWSFYRAGIAE  60

Query  397   FIATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  576
             F+ATFLFLYITILTVMGV K  +KC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV
Sbjct  61    FVATFLFLYITILTVMGVVKETTKCPTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  120

Query  577   TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGD  753
             TFGLFLARKLSLTRA+FYMVMQCLGAICGAGVVKGF GK  Y    GGAN VA GYTKGD
Sbjct  121   TFGLFLARKLSLTRAIFYMVMQCLGAICGAGVVKGFMGKRRYGALNGGANFVAHGYTKGD  180

Query  754   GLGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINP  933
             GLGAEI+GTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINP
Sbjct  181   GLGAEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINP  240

Query  934   ARSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             ARSLGAAII+N++  WNDHWIFWVGPF
Sbjct  241   ARSLGAAIIFNKERGWNDHWIFWVGPF  267



>gb|KFK30621.1| hypothetical protein AALP_AA6G005800 [Arabis alpina]
Length=286

 Score =   460 bits (1183),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 223/263 (85%), Positives = 240/263 (91%), Gaps = 1/263 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDVR+GANKFPEKQ IGT+AQ DKDY E PP  LFEP ELSSWSF+RAGIAEFIA
Sbjct  1     MEGKEEDVRVGANKFPEKQPIGTSAQSDKDYKEPPPAPLFEPGELSSWSFWRAGIAEFIA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYIT+LTVMGV ++ + C +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGA  765
             LFLARKLSLTRAVFYM+MQCLGAICGAGVVKGF    Y  +GGGAN VA GYTKG GLGA
Sbjct  121   LFLARKLSLTRAVFYMIMQCLGAICGAGVVKGFQPNAYQLQGGGANTVAHGYTKGSGLGA  180

Query  766   EIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSL  945
             EI+GTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSL
Sbjct  181   EIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSL  240

Query  946   GAAIIYNRDEAWNDHWIFWVGPF  1014
             GAAIIYN+  AW+DHWIFWVGPF
Sbjct  241   GAAIIYNKGHAWDDHWIFWVGPF  263



>ref|XP_006827580.1| hypothetical protein AMTR_s00009p00231200 [Amborella trichopoda]
 gb|ERM94996.1| hypothetical protein AMTR_s00009p00231200 [Amborella trichopoda]
Length=287

 Score =   460 bits (1183),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 225/264 (85%), Positives = 238/264 (90%), Gaps = 2/264 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ--DKDYTEAPPTALFEPSELSSWSFYRAGIAEFI  402
             ME +EEDV+LGANKF E+Q IGTAAQ  DKDY E PP  LFEP EL SWSF+RAGIAEFI
Sbjct  1     MEGKEEDVKLGANKFSERQPIGTAAQSGDKDYKEPPPAPLFEPEELKSWSFWRAGIAEFI  60

Query  403   ATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  582
             ATFLFLYIT+LTVMGV K  + C +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61    ATFLFLYITVLTVMGVKKEKTMCTSVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  583   GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLG  762
             GL LARKLSLTRAVFYM+MQCLGAICGAGVVKGF K  Y   GGGAN V  GYTKGDGLG
Sbjct  121   GLLLARKLSLTRAVFYMIMQCLGAICGAGVVKGFEKGRYEVLGGGANTVNHGYTKGDGLG  180

Query  763   AEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARS  942
             AEIVGTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARS
Sbjct  181   AEIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS  240

Query  943   LGAAIIYNRDEAWNDHWIFWVGPF  1014
             LGAAII+NRD+AW+DHWIFWVGPF
Sbjct  241   LGAAIIFNRDQAWDDHWIFWVGPF  264



>ref|NP_001275388.1| major intrinsic protein 1-like protein [Solanum tuberosum]
 emb|CBI99235.1| major intrinsic protein 1 [Solanum tuberosum]
Length=288

 Score =   460 bits (1183),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 223/262 (85%), Positives = 240/262 (92%), Gaps = 1/262 (0%)
 Frame = +1

Query  232   EHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIAT  408
             E++EEDV LGANK+ E Q +GTAAQ DKDY E PP  LFEP ELSSWSFYRAGIAEF+AT
Sbjct  3     ENKEEDVNLGANKYRETQPLGTAAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFMAT  62

Query  409   FLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  588
             FLFLYITILTVMG+ +SDS C +VG+QG+AWAFGGMIFALVYCTAGISGGHINPAVTFGL
Sbjct  63    FLFLYITILTVMGLKRSDSLCSSVGVQGVAWAFGGMIFALVYCTAGISGGHINPAVTFGL  122

Query  589   FLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGAE  768
             FLARKLSLTRAVFY+VMQCLGAICGAGVVKGF    Y    GGAN V+PGYTKGDGLGAE
Sbjct  123   FLARKLSLTRAVFYIVMQCLGAICGAGVVKGFMVGPYERLKGGANFVSPGYTKGDGLGAE  182

Query  769   IVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSLG  948
             I+GTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSLG
Sbjct  183   IIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLG  242

Query  949   AAIIYNRDEAWNDHWIFWVGPF  1014
             AAIIYN+DEAWNDHWIFWVGPF
Sbjct  243   AAIIYNKDEAWNDHWIFWVGPF  264



>ref|NP_001274378.1| probable aquaporin PIP1-4-like [Cucumis sativus]
 gb|AHB33475.1| plasma intrinsic protein 1-2 [Cucumis sativus]
 gb|KGN50638.1| hypothetical protein Csa_5G198770 [Cucumis sativus]
Length=292

 Score =   460 bits (1183),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 230/270 (85%), Positives = 241/270 (89%), Gaps = 8/270 (3%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQD----KDYTEAPPTALFEPSELSSWSFYRAGIAE  396
             ME +EEDVRLGANKF E+Q IGTAAQ     KDY E PP  LFEP EL+SWSFYRAGIAE
Sbjct  1     MEGKEEDVRLGANKFNERQPIGTAAQSQDDAKDYKEPPPAPLFEPEELTSWSFYRAGIAE  60

Query  397   FIATFLFLYITILTVMGVSKSDS----KCKTVGIQGIAWAFGGMIFALVYCTAGISGGHI  564
             F ATFLFLYIT+LTVMGV +S S     CKTVGIQGIAWAFGGMIFALVYCTAGISGGHI
Sbjct  61    FFATFLFLYITVLTVMGVVRSKSIEGNTCKTVGIQGIAWAFGGMIFALVYCTAGISGGHI  120

Query  565   NPAVTFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYT  744
             NPAVTFGLFLARKLSLTRAVFY+VMQCLGAICGAGVVKGF    Y+  GGGAN+VA GYT
Sbjct  121   NPAVTFGLFLARKLSLTRAVFYIVMQCLGAICGAGVVKGFQPKPYDALGGGANMVAKGYT  180

Query  745   KGDGLGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTG  924
             KGDGLGAEIVGTFILVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTG
Sbjct  181   KGDGLGAEIVGTFILVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTG  240

Query  925   INPARSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             INPARSLGAAIIYN DEAW+DHWIFWVGPF
Sbjct  241   INPARSLGAAIIYNHDEAWDDHWIFWVGPF  270



>emb|CDX90046.1| BnaA10g00360D [Brassica napus]
Length=286

 Score =   460 bits (1183),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 221/263 (84%), Positives = 241/263 (92%), Gaps = 1/263 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDVR+GANKFPE+Q IGT+AQ DKDY E PP  LFEP ELSSWSF+RAGIAEFIA
Sbjct  1     MEGKEEDVRVGANKFPERQPIGTSAQTDKDYKEPPPAPLFEPGELSSWSFWRAGIAEFIA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYIT+LTVMGV ++ + C +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGA  765
             LFLARKLSLTRAV Y+VMQCLGA+CGAGVVKGF  T Y   GGGAN VAPGY+KG GLGA
Sbjct  121   LFLARKLSLTRAVLYIVMQCLGAVCGAGVVKGFQPTPYQTLGGGANTVAPGYSKGSGLGA  180

Query  766   EIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSL  945
             EI+GTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSL
Sbjct  181   EIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSL  240

Query  946   GAAIIYNRDEAWNDHWIFWVGPF  1014
             GAAIIYN+D +W+DHWIFWVGPF
Sbjct  241   GAAIIYNKDHSWDDHWIFWVGPF  263



>ref|XP_008232887.1| PREDICTED: aquaporin PIP1-2-like [Prunus mume]
Length=286

 Score =   460 bits (1183),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 228/263 (87%), Positives = 238/263 (90%), Gaps = 1/263 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDVRLGANKF E+Q IGT+AQ DKDY E PP  LFEP EL SWSF+RAGIAEFIA
Sbjct  1     MEGKEEDVRLGANKFSERQPIGTSAQTDKDYKEPPPAPLFEPGELKSWSFWRAGIAEFIA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYIT+LTVMGVS+S SKC TVGIQGIAWAFGG IFALVY TAGISGGHINPAVTFG
Sbjct  61    TFLFLYITVLTVMGVSRSRSKCSTVGIQGIAWAFGGSIFALVYSTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGA  765
             LFLARKLSLTRAVFY+VMQ LGAI GAGVVKGF K  Y   GGGANVV  GYTKGDGLGA
Sbjct  121   LFLARKLSLTRAVFYIVMQTLGAIVGAGVVKGFQKNQYELLGGGANVVNHGYTKGDGLGA  180

Query  766   EIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSL  945
             EIVGTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSL
Sbjct  181   EIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSL  240

Query  946   GAAIIYNRDEAWNDHWIFWVGPF  1014
             GAAIIYN+D AWNDHWIFWVGPF
Sbjct  241   GAAIIYNKDRAWNDHWIFWVGPF  263



>ref|XP_011072833.1| PREDICTED: probable aquaporin PIP-type pTOM75 [Sesamum indicum]
Length=288

 Score =   460 bits (1183),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 228/262 (87%), Positives = 238/262 (91%), Gaps = 1/262 (0%)
 Frame = +1

Query  232   EHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIAT  408
             E++EEDVRLGANKF E+Q +GTAAQ DKDY E PP  LFEP EL SWSFYRAGIAEF+AT
Sbjct  3     ENKEEDVRLGANKFTERQPLGTAAQTDKDYKEPPPAPLFEPGELQSWSFYRAGIAEFMAT  62

Query  409   FLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  588
             FLFLYITILTVMGV +S SKC +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL
Sbjct  63    FLFLYITILTVMGVGRSSSKCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  122

Query  589   FLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGAE  768
             FLARKLSLTRAVFYMVMQCLGAICGAGVVKGF K  Y    GGAN V  GYTKGDGLGAE
Sbjct  123   FLARKLSLTRAVFYMVMQCLGAICGAGVVKGFMKGPYERLNGGANFVNHGYTKGDGLGAE  182

Query  769   IVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSLG  948
             IVGTFILVYTVFSATDAK +ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSLG
Sbjct  183   IVGTFILVYTVFSATDAKGSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLG  242

Query  949   AAIIYNRDEAWNDHWIFWVGPF  1014
             AAIIYNRD AW+DHWIFWVGPF
Sbjct  243   AAIIYNRDHAWDDHWIFWVGPF  264



>gb|AAL49748.1|AF452010_1 channel-like protein [Petunia x hybrida]
Length=286

 Score =   459 bits (1182),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 226/262 (86%), Positives = 240/262 (92%), Gaps = 1/262 (0%)
 Frame = +1

Query  232   EHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIAT  408
             E++EEDV+LGANKF E Q +GTAAQ DKDY E PP  LFEP ELSSWSFYRAGIAEF+AT
Sbjct  3     ENKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFMAT  62

Query  409   FLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  588
             FLFLYITILTVMGV +SDS C +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL
Sbjct  63    FLFLYITILTVMGVKRSDSLCHSVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  122

Query  589   FLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGAE  768
             FLARKLSLTRA+FY+VMQCLGAICGAGVVKG+ +  Y   GGGAN VA GYTKGDGLGAE
Sbjct  123   FLARKLSLTRALFYIVMQCLGAICGAGVVKGYMQGPYQRLGGGANEVAHGYTKGDGLGAE  182

Query  769   IVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSLG  948
             IVGTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSLG
Sbjct  183   IVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLG  242

Query  949   AAIIYNRDEAWNDHWIFWVGPF  1014
             AAIIYN D AW+DHWIFWVGPF
Sbjct  243   AAIIYNTDAAWDDHWIFWVGPF  264



>ref|XP_002453072.1| hypothetical protein SORBIDRAFT_04g037800 [Sorghum bicolor]
 gb|EES06048.1| hypothetical protein SORBIDRAFT_04g037800 [Sorghum bicolor]
Length=290

 Score =   460 bits (1183),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 224/267 (84%), Positives = 239/267 (90%), Gaps = 5/267 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-----DKDYTEAPPTALFEPSELSSWSFYRAGIA  393
             ME +EEDVRLGAN++ E+Q IGTAAQ      KDY E P   LFE  EL+SWS YRAGIA
Sbjct  1     MEGKEEDVRLGANRYSERQPIGTAAQGTEENSKDYKEPPAAPLFEAEELTSWSLYRAGIA  60

Query  394   EFIATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPA  573
             EF+ATFLFLYI+ILTVMGVSKS SKC TVGIQGIAW+FGGMIFALVYCTAGISGGHINPA
Sbjct  61    EFVATFLFLYISILTVMGVSKSGSKCGTVGIQGIAWSFGGMIFALVYCTAGISGGHINPA  120

Query  574   VTFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGD  753
             VTFGL LARKLSLTRA+ YMVMQCLGAICGAGVVKGF +T+Y G GGGAN V PGYTKGD
Sbjct  121   VTFGLLLARKLSLTRALLYMVMQCLGAICGAGVVKGFQQTLYMGAGGGANSVNPGYTKGD  180

Query  754   GLGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINP  933
             GLGAEIVGTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINP
Sbjct  181   GLGAEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINP  240

Query  934   ARSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             ARSLGAAI+YNR  AWNDHWIFWVGPF
Sbjct  241   ARSLGAAIVYNRSNAWNDHWIFWVGPF  267



>gb|AFU61115.1| water channel protein PIP [Capsicum annuum]
Length=286

 Score =   459 bits (1182),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 223/262 (85%), Positives = 239/262 (91%), Gaps = 1/262 (0%)
 Frame = +1

Query  232   EHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIAT  408
             E++EEDV LGANK+ E Q +GTAAQ DKDY E PP  LFEP ELSSWSFYRAGIAEF+AT
Sbjct  3     ENKEEDVSLGANKYRETQPLGTAAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFMAT  62

Query  409   FLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  588
             FLFLYITILTVMG+ +SDS C +VGIQG+AWAFGGMIFALVYCTAGISGGHINPAVTFGL
Sbjct  63    FLFLYITILTVMGLKRSDSLCSSVGIQGVAWAFGGMIFALVYCTAGISGGHINPAVTFGL  122

Query  589   FLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGAE  768
             FLARKLSLTRA+FY+VMQCLGAICGAGVVKGF +  Y   GGGANVV PGYTKGDGLGAE
Sbjct  123   FLARKLSLTRAIFYIVMQCLGAICGAGVVKGFMQGPYQRLGGGANVVNPGYTKGDGLGAE  182

Query  769   IVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSLG  948
             I+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPI GTGINPARSLG
Sbjct  183   IIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPIAGTGINPARSLG  242

Query  949   AAIIYNRDEAWNDHWIFWVGPF  1014
             AAIIYN D AW+DHWIFWVGPF
Sbjct  243   AAIIYNTDAAWDDHWIFWVGPF  264



>gb|AFD61600.1| aquaporin PIP1 [Hevea brasiliensis]
Length=287

 Score =   459 bits (1182),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 227/266 (85%), Positives = 243/266 (91%), Gaps = 4/266 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ---DKDYTEAPPTALFEPSELSSWSFYRAGIAEF  399
             ME +EEDVRLGANK+ E Q IGTAAQ   DKDYTE PP  LFEP+EL+SWSFYRAGIAEF
Sbjct  1     MEGKEEDVRLGANKYRETQPIGTAAQSLDDKDYTEPPPAPLFEPTELTSWSFYRAGIAEF  60

Query  400   IATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  579
             IATFLFLYI+ILTVMGV K+ +KC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61    IATFLFLYISILTVMGVVKAPTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  580   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGDG  756
             FGLFLARKLSLTRA++YMVMQCLGAICGAGVVKGF G+  Y   GGGAN V P YTKGDG
Sbjct  121   FGLFLARKLSLTRALYYMVMQCLGAICGAGVVKGFEGRHQYTLLGGGANSVNPVYTKGDG  180

Query  757   LGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPA  936
             LGAEIVGTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPA
Sbjct  181   LGAEIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPA  240

Query  937   RSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             RSLGAAII+N+D+ W+DHWIFWVGPF
Sbjct  241   RSLGAAIIFNKDKGWDDHWIFWVGPF  266



>ref|XP_009780083.1| PREDICTED: probable aquaporin PIP-type pTOM75 [Nicotiana sylvestris]
 gb|ABI93215.1| water channel protein [Nicotiana tabacum]
Length=287

 Score =   459 bits (1182),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 224/262 (85%), Positives = 240/262 (92%), Gaps = 1/262 (0%)
 Frame = +1

Query  232   EHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIAT  408
             E++EEDV+LGANKF E Q +GTAAQ DKDY E PP  LFEP ELSSWSFYRAGIAEF+AT
Sbjct  3     ENKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFMAT  62

Query  409   FLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  588
             FLFLYITILTVMG+ +SDS C +VGIQG+AWAFGGMIFALVYCTAGISGGHINPAVTFGL
Sbjct  63    FLFLYITILTVMGLKRSDSLCSSVGIQGVAWAFGGMIFALVYCTAGISGGHINPAVTFGL  122

Query  589   FLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGAE  768
             FLARKLSLTRA+FY+VMQCLGAICGAGVVKGF    Y   GGGANVV  GYTKGDGLGAE
Sbjct  123   FLARKLSLTRAIFYIVMQCLGAICGAGVVKGFMVGPYQRLGGGANVVNHGYTKGDGLGAE  182

Query  769   IVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSLG  948
             I+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSLG
Sbjct  183   IIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLG  242

Query  949   AAIIYNRDEAWNDHWIFWVGPF  1014
             AAIIYN D+AW+DHWIFWVGPF
Sbjct  243   AAIIYNTDQAWDDHWIFWVGPF  264



>tpg|DAA33861.1| TPA_inf: aquaporin PIP1;7 [Gossypium hirsutum]
Length=288

 Score =   459 bits (1182),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 227/266 (85%), Positives = 241/266 (91%), Gaps = 4/266 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ---DKDYTEAPPTALFEPSELSSWSFYRAGIAEF  399
             ME +EEDVRLGANKF E+Q IGTAAQ   DKDYTE PP  LFEPSEL+SWSFYRAGIAEF
Sbjct  1     MEGKEEDVRLGANKFSERQPIGTAAQSQDDKDYTEPPPAPLFEPSELTSWSFYRAGIAEF  60

Query  400   IATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  579
             +ATFLFLYI++LTVMGV K  +KC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61    VATFLFLYISVLTVMGVLKDKTKCTTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  580   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGDG  756
             FGLFL RKLSLTRA+FYMVMQCLGAICGAGVVKGF GKT Y   GGGAN V  GYTKGDG
Sbjct  121   FGLFLGRKLSLTRAIFYMVMQCLGAICGAGVVKGFMGKTRYGALGGGANSVNHGYTKGDG  180

Query  757   LGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPA  936
             LGAEIVGTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPA
Sbjct  181   LGAEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPA  240

Query  937   RSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             RSLGAAII+N+D+ W  HWIFWVGPF
Sbjct  241   RSLGAAIIFNKDKGWGGHWIFWVGPF  266



>gb|KHG18900.1| putative aquaporin PIP1-4 -like protein [Gossypium arboreum]
Length=286

 Score =   459 bits (1182),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 224/263 (85%), Positives = 239/263 (91%), Gaps = 1/263 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDVRLGANKF E+Q IGT AQ DKDY E PP  LFE  EL SWSF+RAGIAEF+A
Sbjct  1     MEGKEEDVRLGANKFSERQPIGTTAQTDKDYNEPPPAPLFEHGELYSWSFWRAGIAEFVA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYIT+LTVMGV+++ SKC +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITVLTVMGVNRAPSKCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGA  765
             L LARKLSLTRA+FYMVMQCLGAICGAGVVKGF  + Y   GGGANVV  GYTKGDGLGA
Sbjct  121   LLLARKLSLTRAIFYMVMQCLGAICGAGVVKGFQPSRYEVLGGGANVVNHGYTKGDGLGA  180

Query  766   EIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSL  945
             EIVGTF+LVYTVFSATDAKRNARDSHVP+LAPLP+GFAVFLVHLATIP+TGTGINPARSL
Sbjct  181   EIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPVGFAVFLVHLATIPVTGTGINPARSL  240

Query  946   GAAIIYNRDEAWNDHWIFWVGPF  1014
             GAAIIYNRD AWNDHWIFWVGPF
Sbjct  241   GAAIIYNRDHAWNDHWIFWVGPF  263



>ref|XP_007218332.1| hypothetical protein PRUPE_ppa008510mg [Prunus persica]
 gb|EMJ19531.1| hypothetical protein PRUPE_ppa008510mg [Prunus persica]
Length=329

 Score =   461 bits (1186),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 230/272 (85%), Positives = 241/272 (89%), Gaps = 1/272 (0%)
 Frame = +1

Query  202   FGRSIEELRMEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFY  378
             F R  E   ME +EEDVRLGANKF E+Q IGT+AQ DKDY E PP  LFEP EL SWSF+
Sbjct  35    FLRERENREMEGKEEDVRLGANKFSERQPIGTSAQTDKDYKEPPPAPLFEPGELKSWSFW  94

Query  379   RAGIAEFIATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGG  558
             RAGIAEFIATFLFLYIT+LTVMGVS+S SKC TVGIQGIAWAFGG IFALVY TAGISGG
Sbjct  95    RAGIAEFIATFLFLYITVLTVMGVSRSRSKCSTVGIQGIAWAFGGSIFALVYSTAGISGG  154

Query  559   HINPAVTFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPG  738
             HINPAVTFGLFLARKLSLTRAVFY+VMQ LGAI GAGVVKGF K  Y   GGGANVV  G
Sbjct  155   HINPAVTFGLFLARKLSLTRAVFYIVMQTLGAIAGAGVVKGFQKNQYELLGGGANVVNHG  214

Query  739   YTKGDGLGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITG  918
             YTKGDGLGAEIVGTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITG
Sbjct  215   YTKGDGLGAEIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITG  274

Query  919   TGINPARSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             TGINPARSLGAAIIYN+D AW+DHWIFWVGPF
Sbjct  275   TGINPARSLGAAIIYNKDRAWDDHWIFWVGPF  306



>gb|KFK37381.1| hypothetical protein AALP_AA4G249600 [Arabis alpina]
Length=286

 Score =   459 bits (1181),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 221/263 (84%), Positives = 241/263 (92%), Gaps = 1/263 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDVR+GANKFPE+Q IGT+AQ DKDY E PP  LFEP EL+SWSF+RAGIAEFIA
Sbjct  1     MEGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELASWSFWRAGIAEFIA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYIT+LTVMGV ++ + C +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGA  765
             LFLARKLSLTRAV+Y+VMQCLGAICGAGVVKGF    Y   GGGAN VAPGYTKG GLGA
Sbjct  121   LFLARKLSLTRAVYYIVMQCLGAICGAGVVKGFQPKQYQLLGGGANTVAPGYTKGSGLGA  180

Query  766   EIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSL  945
             EI+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSL
Sbjct  181   EIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSL  240

Query  946   GAAIIYNRDEAWNDHWIFWVGPF  1014
             GAAII+N+D AW+DHW+FWVGPF
Sbjct  241   GAAIIFNKDNAWDDHWVFWVGPF  263



>gb|AEN95117.1| aquaporin PIP1 [Dimocarpus longan]
Length=299

 Score =   460 bits (1183),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 231/276 (84%), Positives = 243/276 (88%), Gaps = 14/276 (5%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDV+LGANKF E+Q IGT+AQ DKDY E PP  LFEP EL SWSFYRAGIAEF+A
Sbjct  1     MEGKEEDVKLGANKFSERQPIGTSAQGDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFMA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYITILTVMGVSKS+SKC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITILTVMGVSKSNSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLA------------RKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANV  726
             L LA            RKLSLTRAVFY++MQCLGAICGAGVVKGF G   Y    GGANV
Sbjct  121   LLLAINPAVTFGLLLARKLSLTRAVFYIIMQCLGAICGAGVVKGFEGSNNYETLKGGANV  180

Query  727   VAPGYTKGDGLGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATI  906
             VA GYTKGDGLGAEIVGTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATI
Sbjct  181   VAHGYTKGDGLGAEIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATI  240

Query  907   PITGTGINPARSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             PITGTGINPARSLGAAIIYNRD+AW+DHWIFWVGPF
Sbjct  241   PITGTGINPARSLGAAIIYNRDQAWDDHWIFWVGPF  276



>dbj|BAA32777.1| plasma membrane aquaporin (PAQ1) [Raphanus sativus]
Length=286

 Score =   459 bits (1181),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 221/263 (84%), Positives = 240/263 (91%), Gaps = 1/263 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDVR+GANKFPE+Q IGT+AQ DKDY E PP  LFEP ELSSWSF+RAGIAEFIA
Sbjct  1     MEGKEEDVRVGANKFPERQPIGTSAQSDKDYNEPPPAPLFEPGELSSWSFWRAGIAEFIA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYIT+LTVMGV +S + C +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITVLTVMGVKRSPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGA  765
             LFLARKLSLTRA++Y+VMQCLGAICGAGVVKGF    Y   GGGAN VA GYTKG GLGA
Sbjct  121   LFLARKLSLTRALYYIVMQCLGAICGAGVVKGFQPNQYQALGGGANTVAHGYTKGSGLGA  180

Query  766   EIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSL  945
             EI+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSL
Sbjct  181   EIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSL  240

Query  946   GAAIIYNRDEAWNDHWIFWVGPF  1014
             GAAIIYN+D +W+DHW+FWVGPF
Sbjct  241   GAAIIYNKDHSWDDHWVFWVGPF  263



>gb|ADT91650.1| putative major intrinsic protein [Galega orientalis]
Length=289

 Score =   459 bits (1182),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 227/267 (85%), Positives = 241/267 (90%), Gaps = 5/267 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQD----KDYTEAPPTALFEPSELSSWSFYRAGIAE  396
             ME +E+DV LGANKFPE+Q +G AAQ     KDY E PP  LFEPSEL+SWSFYRAGIAE
Sbjct  1     MEAKEQDVSLGANKFPERQPLGIAAQSQDEPKDYQEPPPAPLFEPSELTSWSFYRAGIAE  60

Query  397   FIATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  576
             FIATFLFLYIT+LTVMGV +  SKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV
Sbjct  61    FIATFLFLYITVLTVMGVVRESSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  120

Query  577   TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGD  753
             TFGLFLARKLSLTRA+FYMVMQ LGAICGAGVVKGF GKT +    GGAN VAPGYTKGD
Sbjct  121   TFGLFLARKLSLTRALFYMVMQVLGAICGAGVVKGFEGKTRFTDLKGGANFVAPGYTKGD  180

Query  754   GLGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINP  933
             GLGAEIVGTFILVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINP
Sbjct  181   GLGAEIVGTFILVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINP  240

Query  934   ARSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             ARSLGAAII+N+D  W+DHWIFWVGPF
Sbjct  241   ARSLGAAIIFNKDLGWDDHWIFWVGPF  267



>ref|XP_002526867.1| Aquaporin PIP1.3, putative [Ricinus communis]
 emb|CAE53882.1| aquaporin [Ricinus communis]
 gb|EEF35498.1| Aquaporin PIP1.3, putative [Ricinus communis]
Length=288

 Score =   459 bits (1181),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 227/266 (85%), Positives = 242/266 (91%), Gaps = 4/266 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ---DKDYTEAPPTALFEPSELSSWSFYRAGIAEF  399
             ME +EEDVRLGANK+ E Q IGTAAQ   DKDYTE PP  LFEP EL+SWSFYRAGIAEF
Sbjct  1     MEGKEEDVRLGANKYRETQPIGTAAQSQDDKDYTEPPPAPLFEPGELTSWSFYRAGIAEF  60

Query  400   IATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  579
             IATFLFLYI++LTVMGV K+ +KC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61    IATFLFLYISVLTVMGVVKAPTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  580   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGDG  756
             FGLFLARKLSLTRA+FYMVMQCLGAICGAGVVKGF G   Y   GGGAN V PGYTKGDG
Sbjct  121   FGLFLARKLSLTRALFYMVMQCLGAICGAGVVKGFEGSHDYTRLGGGANSVNPGYTKGDG  180

Query  757   LGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPA  936
             LGAEIVGTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPA
Sbjct  181   LGAEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPA  240

Query  937   RSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             RSLGAAII+N+D+ W+DHWIFWVGPF
Sbjct  241   RSLGAAIIFNKDQGWDDHWIFWVGPF  266



>ref|XP_010480063.1| PREDICTED: aquaporin PIP1-3 [Camelina sativa]
 ref|XP_010457103.1| PREDICTED: aquaporin PIP1-3 [Camelina sativa]
 ref|XP_010457104.1| PREDICTED: aquaporin PIP1-3 [Camelina sativa]
 ref|XP_010474769.1| PREDICTED: aquaporin PIP1-3 [Camelina sativa]
 gb|KFK42522.1| hypothetical protein AALP_AA1G005400 [Arabis alpina]
Length=286

 Score =   459 bits (1181),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 223/263 (85%), Positives = 240/263 (91%), Gaps = 1/263 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDVR+GANKFPE+Q IGT+AQ DKDY E PP  LFEP ELSSWSFYRAGIAEFIA
Sbjct  1     MEGKEEDVRVGANKFPERQPIGTSAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFIA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYIT+LTVMGV ++ + C +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGA  765
             LFLARKLSLTRAVFY+VMQCLGAICGAGVVKGF    Y   GGGAN VA GYTKG GLGA
Sbjct  121   LFLARKLSLTRAVFYIVMQCLGAICGAGVVKGFQPNPYQTFGGGANTVAHGYTKGSGLGA  180

Query  766   EIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSL  945
             EI+GTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSL
Sbjct  181   EIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSL  240

Query  946   GAAIIYNRDEAWNDHWIFWVGPF  1014
             GAAIIYN+D +W+DHWIFWVGPF
Sbjct  241   GAAIIYNKDHSWDDHWIFWVGPF  263



>gb|AAB09747.1| mipA [Mesembryanthemum crystallinum]
Length=283

 Score =   459 bits (1181),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 224/262 (85%), Positives = 239/262 (91%), Gaps = 1/262 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQDKDYTEAPPTALFEPSELSSWSFYRAGIAEFIAT  408
             ME +EEDVRLGANKF E+Q +GT AQD+DY E PP ALFE  EL+SWSFYRAGIAEFIAT
Sbjct  1     MEGKEEDVRLGANKFSERQPLGTVAQDRDYRE-PPRALFEAGELTSWSFYRAGIAEFIAT  59

Query  409   FLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  588
             FLFLYI+ILTVMGV++S SKC +VGIQGIAW+FGGMIFALVYCTAGISGGHINPAVTFGL
Sbjct  60    FLFLYISILTVMGVNRSPSKCASVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVTFGL  119

Query  589   FLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGAE  768
             FLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  T Y   GGGAN V PGYTKG GLGAE
Sbjct  120   FLARKLSLTRAVFYMVMQCLGAICGAGVVKGFQPTPYQLLGGGANSVNPGYTKGSGLGAE  179

Query  769   IVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSLG  948
             I+GTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIP+TGTGINPARSLG
Sbjct  180   IIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPVTGTGINPARSLG  239

Query  949   AAIIYNRDEAWNDHWIFWVGPF  1014
             AAIIYNR  AW DHWIFWVGPF
Sbjct  240   AAIIYNRPHAWADHWIFWVGPF  261



>gb|AHX99531.1| aquaporin PIP1 [Chrysanthemum x morifolium]
Length=287

 Score =   459 bits (1181),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 227/264 (86%), Positives = 242/264 (92%), Gaps = 2/264 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDV+LGANK+ E+Q IGT+AQ DKDY E PP  LFEP ELSSWSFYRAGIAEFIA
Sbjct  1     MEGKEEDVKLGANKYSERQPIGTSAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFIA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYI++LTVMGV KS +KC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYISVLTVMGVVKSPTKCGTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGDGLG  762
             L LARKLSLTRA+FYMVMQCLGAICGAGVVKGF GK  +   GGGANVVA GYTKGDGLG
Sbjct  121   LLLARKLSLTRALFYMVMQCLGAICGAGVVKGFQGKHEFTTLGGGANVVAHGYTKGDGLG  180

Query  763   AEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARS  942
             AEIVGTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARS
Sbjct  181   AEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS  240

Query  943   LGAAIIYNRDEAWNDHWIFWVGPF  1014
             LGAAIIYN+D AW+D WIFWVGPF
Sbjct  241   LGAAIIYNKDHAWDDQWIFWVGPF  264



>gb|AGD98706.1| aquaporin protein 3 [Camellia sinensis]
Length=287

 Score =   459 bits (1181),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 226/265 (85%), Positives = 241/265 (91%), Gaps = 3/265 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ--DKDYTEAPPTALFEPSELSSWSFYRAGIAEFI  402
             ME +EEDVRLGANKFPE+Q IGT+AQ  DKDY E PP  LFEPSEL+SWSFYRAGIAEF+
Sbjct  1     MEGKEEDVRLGANKFPERQPIGTSAQGGDKDYMEPPPAPLFEPSELTSWSFYRAGIAEFM  60

Query  403   ATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  582
             ATFLFLYITILTVMGV  S +KC TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61    ATFLFLYITILTVMGVVSSKTKCSTVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVTF  120

Query  583   GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGDGL  759
             GL LARKLSLTRAVFY+VMQCLGAICGA VVKGF G T Y   GGGAN V  GYTKGDGL
Sbjct  121   GLLLARKLSLTRAVFYIVMQCLGAICGAAVVKGFEGTTRYELLGGGANSVNHGYTKGDGL  180

Query  760   GAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPAR  939
             GAEIVGTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPAR
Sbjct  181   GAEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR  240

Query  940   SLGAAIIYNRDEAWNDHWIFWVGPF  1014
             SLGAAI++N+D AW+DHWIFWVGPF
Sbjct  241   SLGAAIVFNKDRAWDDHWIFWVGPF  265



>gb|ABR68794.1| aquaporin PIP1-2 [Gossypium hirsutum]
Length=287

 Score =   459 bits (1181),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 224/264 (85%), Positives = 240/264 (91%), Gaps = 2/264 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDV+LGANKF E+Q IGT+AQ DKDY E P    FEP EL SWSFYRAGIAEF+A
Sbjct  1     MEGKEEDVKLGANKFSERQPIGTSAQTDKDYKEPPAAPFFEPGELKSWSFYRAGIAEFVA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYIT+LTVMGVS+S +KC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITVLTVMGVSQSKTKCATVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGDGLG  762
             LFLARKLSLTRA+FYM+MQCLGAICGAGVVKGF G   Y   GGGANVV  GYTKGDGLG
Sbjct  121   LFLARKLSLTRALFYMIMQCLGAICGAGVVKGFQGDNRYEMLGGGANVVNHGYTKGDGLG  180

Query  763   AEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARS  942
             AEI+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARS
Sbjct  181   AEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS  240

Query  943   LGAAIIYNRDEAWNDHWIFWVGPF  1014
             LGAAIIYN+D AW+DHW+FWVGPF
Sbjct  241   LGAAIIYNKDHAWDDHWVFWVGPF  264



>ref|XP_010543744.1| PREDICTED: probable aquaporin PIP1-4 [Tarenaya hassleriana]
Length=287

 Score =   459 bits (1180),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 226/267 (85%), Positives = 241/267 (90%), Gaps = 5/267 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQD----KDYTEAPPTALFEPSELSSWSFYRAGIAE  396
             ME +EEDVR+GANKFPE+Q IGTAAQ     KDY E PP  LFE  EL+SWSFYRAGIAE
Sbjct  1     MEGKEEDVRVGANKFPERQPIGTAAQSQDEGKDYKEPPPAPLFEAGELTSWSFYRAGIAE  60

Query  397   FIATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  576
             FIATFLFLYI+ILTVMGV + DS C TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV
Sbjct  61    FIATFLFLYISILTVMGVKRGDSMCATVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  120

Query  577   TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGD  753
             T GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF GK+ +   GGGANVV  GYTKGD
Sbjct  121   TLGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFQGKSNFQSLGGGANVVNHGYTKGD  180

Query  754   GLGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINP  933
             GLGAEI+GTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINP
Sbjct  181   GLGAEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINP  240

Query  934   ARSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             ARSLGAAI+YN+D AW+DHWIFWVGPF
Sbjct  241   ARSLGAAIVYNKDHAWDDHWIFWVGPF  267



>gb|ACF39901.1| aquaporin [Camellia oleifera]
 gb|ACF39902.1| aquaporin [Camellia oleifera]
Length=287

 Score =   459 bits (1180),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 225/265 (85%), Positives = 241/265 (91%), Gaps = 3/265 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ--DKDYTEAPPTALFEPSELSSWSFYRAGIAEFI  402
             ME +EEDVRLGANKFPE+Q IGT+AQ  DKDYTE PP  LFEP EL+SWSFYRAGIAEF+
Sbjct  1     MEGKEEDVRLGANKFPERQPIGTSAQGGDKDYTEPPPAPLFEPDELTSWSFYRAGIAEFM  60

Query  403   ATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  582
             ATFLFLYITILTVMGV  S +KC TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61    ATFLFLYITILTVMGVVSSKTKCSTVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVTF  120

Query  583   GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGDGL  759
             GL LARKLSLTRAVFYMVMQCLGAICGA VV+GF G T Y+  GGGAN V  GYTKGDGL
Sbjct  121   GLLLARKLSLTRAVFYMVMQCLGAICGAAVVRGFEGTTQYDLLGGGANSVNHGYTKGDGL  180

Query  760   GAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPAR  939
             GAEIVGTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPAR
Sbjct  181   GAEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR  240

Query  940   SLGAAIIYNRDEAWNDHWIFWVGPF  1014
             SLGAAI++N+D  W+DHWIFWVGPF
Sbjct  241   SLGAAIVFNKDRGWDDHWIFWVGPF  265



>ref|XP_004143901.1| PREDICTED: probable aquaporin PIP1-2-like [Cucumis sativus]
 ref|XP_004159943.1| PREDICTED: probable aquaporin PIP1-2-like [Cucumis sativus]
 gb|KGN50087.1| Aquaporin 1 [Cucumis sativus]
Length=286

 Score =   459 bits (1180),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 223/263 (85%), Positives = 240/263 (91%), Gaps = 1/263 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDV+LGANKF E+Q IGT+AQ DKDY E PP  L+EP EL SWSFYRAGIAEF+A
Sbjct  1     MEGKEEDVKLGANKFSERQPIGTSAQTDKDYKEPPPAPLYEPGELKSWSFYRAGIAEFMA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYITILTVMGV++S SKC +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITILTVMGVNRSPSKCNSVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGA  765
             LFLARKLSLTRAVFY++MQCLGAICGAGVVKGF  + Y  K GGAN V+ GYTKG GLGA
Sbjct  121   LFLARKLSLTRAVFYIIMQCLGAICGAGVVKGFEGSSYVQKLGGANFVSSGYTKGSGLGA  180

Query  766   EIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSL  945
             EI+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSL
Sbjct  181   EIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSL  240

Query  946   GAAIIYNRDEAWNDHWIFWVGPF  1014
             GAAIIYNR  AW+DHWIFWVGPF
Sbjct  241   GAAIIYNRQHAWDDHWIFWVGPF  263



>gb|EYU41267.1| hypothetical protein MIMGU_mgv1a011292mg [Erythranthe guttata]
Length=258

 Score =   457 bits (1177),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 223/256 (87%), Positives = 238/256 (93%), Gaps = 2/256 (1%)
 Frame = +1

Query  229  MEHREEDVRLGANKFPEKQAIGTAAQ--DKDYTEAPPTALFEPSELSSWSFYRAGIAEFI  402
            ME +EEDVR+GANK+ E+Q IGTAAQ  DKDY E PP  LFEP EL+SWSFYRAGIAEF+
Sbjct  1    MESKEEDVRVGANKYSERQPIGTAAQSQDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  60

Query  403  ATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  582
            ATFLFLYITILTVMGVSKSDSKC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61   ATFLFLYITILTVMGVSKSDSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  583  GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLG  762
            GLFLARKLSLTRAVFY+VMQCLGAICGAGVVKGFG+T+Y  KGGGAN VA GYTKG GLG
Sbjct  121  GLFLARKLSLTRAVFYIVMQCLGAICGAGVVKGFGETLYMTKGGGANTVAHGYTKGSGLG  180

Query  763  AEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARS  942
            AEI+GTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARS
Sbjct  181  AEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS  240

Query  943  LGAAIIYNRDEAWNDH  990
            LGAAIIYN+  AW+DH
Sbjct  241  LGAAIIYNKSHAWDDH  256



>ref|XP_006339582.1| PREDICTED: probable aquaporin PIP1-5-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006339583.1| PREDICTED: probable aquaporin PIP1-5-like isoform X2 [Solanum 
tuberosum]
Length=285

 Score =   458 bits (1179),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 216/262 (82%), Positives = 242/262 (92%), Gaps = 0/262 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQDKDYTEAPPTALFEPSELSSWSFYRAGIAEFIAT  408
             ME +EEDV++GANK+ E+Q +GT+AQ KDY E PP   FE  EL SWSF+RAGIAEF+AT
Sbjct  1     MEGKEEDVKVGANKYSERQPLGTSAQSKDYKETPPAPFFEAGELHSWSFWRAGIAEFMAT  60

Query  409   FLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  588
             FLFLYIT+LTVMG S++++KC TVG+QGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL
Sbjct  61    FLFLYITVLTVMGYSRANNKCSTVGVQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  120

Query  589   FLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGAE  768
             FLARKLSLTRAVFY+VMQCLGAICGAGVVKGF  +++  KGGGANVVA GYTKGDGLGAE
Sbjct  121   FLARKLSLTRAVFYIVMQCLGAICGAGVVKGFQPSLFETKGGGANVVAHGYTKGDGLGAE  180

Query  769   IVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSLG  948
             I+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSLG
Sbjct  181   IIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLG  240

Query  949   AAIIYNRDEAWNDHWIFWVGPF  1014
             AAI+YN++ AW+DHWIFWVGPF
Sbjct  241   AAIVYNKEHAWDDHWIFWVGPF  262



>ref|NP_001267949.1| aquaporin PIP1;2 [Vitis vinifera]
 gb|ABN14350.1| aquaporin PIP1;4 [Vitis vinifera]
 gb|AIK66514.1| putative aquaporin [Vitis vinifera]
Length=286

 Score =   458 bits (1179),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 226/263 (86%), Positives = 239/263 (91%), Gaps = 1/263 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDVRLGANKF E+Q IGT+AQ DKDY E PP  LFEP EL SWSF+RAGIAEF+A
Sbjct  1     MEGKEEDVRLGANKFTERQPIGTSAQTDKDYREPPPAPLFEPGELHSWSFWRAGIAEFMA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYIT+LTVMGV +S SKC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITVLTVMGVVRSPSKCATVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGA  765
             L LARKLSLTRAVFYM+MQCLGAICGAGVVKGF    Y   GGGANVVA GY+KGDGLGA
Sbjct  121   LLLARKLSLTRAVFYMIMQCLGAICGAGVVKGFQGHQYEVLGGGANVVAAGYSKGDGLGA  180

Query  766   EIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSL  945
             EIVGTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSL
Sbjct  181   EIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSL  240

Query  946   GAAIIYNRDEAWNDHWIFWVGPF  1014
             GAAIIYNR+ AW+D WIFWVGPF
Sbjct  241   GAAIIYNREHAWDDMWIFWVGPF  263



>ref|XP_006413559.1| hypothetical protein EUTSA_v10025910mg [Eutrema salsugineum]
 gb|ESQ55012.1| hypothetical protein EUTSA_v10025910mg [Eutrema salsugineum]
Length=287

 Score =   458 bits (1179),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 224/264 (85%), Positives = 238/264 (90%), Gaps = 2/264 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ--DKDYTEAPPTALFEPSELSSWSFYRAGIAEFI  402
             ME +EEDV +GANKFPE+Q IGTAAQ   KDY E PP  LFEP EL SWSFYRAGIAEFI
Sbjct  1     MEGKEEDVNVGANKFPERQPIGTAAQTESKDYQEPPPAPLFEPGELKSWSFYRAGIAEFI  60

Query  403   ATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  582
             ATFLFLYIT+LTVMGV ++ + C +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61    ATFLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  583   GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLG  762
             GLFLARKLSLTRAVFY+VMQCLGAICGAGVVKGF    Y   GGGANVVA GYTKG GLG
Sbjct  121   GLFLARKLSLTRAVFYIVMQCLGAICGAGVVKGFQSGPYQANGGGANVVAHGYTKGSGLG  180

Query  763   AEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARS  942
             AEIVGTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARS
Sbjct  181   AEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS  240

Query  943   LGAAIIYNRDEAWNDHWIFWVGPF  1014
             LGAAIIYN+D AW+DHWIFWVGPF
Sbjct  241   LGAAIIYNKDHAWDDHWIFWVGPF  264



>ref|XP_004503235.1| PREDICTED: probable aquaporin PIP-type 7a-like [Cicer arietinum]
Length=289

 Score =   459 bits (1180),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 225/267 (84%), Positives = 244/267 (91%), Gaps = 5/267 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQD----KDYTEAPPTALFEPSELSSWSFYRAGIAE  396
             ME +E+DV LGANK+PE+Q IG AAQ     KDY E PP  LFEPSEL+SWSFYRAGIAE
Sbjct  1     MEAKEQDVSLGANKYPERQPIGIAAQSQDDGKDYKEPPPAPLFEPSELTSWSFYRAGIAE  60

Query  397   FIATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  576
             F+ATFLFLYITILTVMGV++SDSKCK+VGIQGIAW+FGGMIFALVYCTAGISGGHINPAV
Sbjct  61    FVATFLFLYITILTVMGVNRSDSKCKSVGIQGIAWSFGGMIFALVYCTAGISGGHINPAV  120

Query  577   TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGD  753
             TFGLFLARKLSLTRAVFY+VMQ LGAICGAGVVKGF GKT+Y    GGAN VAPGYTKGD
Sbjct  121   TFGLFLARKLSLTRAVFYIVMQVLGAICGAGVVKGFEGKTLYGKFHGGANFVAPGYTKGD  180

Query  754   GLGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINP  933
             GLGAEI+GTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINP
Sbjct  181   GLGAEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINP  240

Query  934   ARSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             ARSLGAAII+N+D  W+D WIFWVGPF
Sbjct  241   ARSLGAAIIFNKDLGWDDQWIFWVGPF  267



>ref|XP_002303596.1| plasma membrane aquaporin family protein [Populus trichocarpa]
 gb|ABK93430.1| unknown [Populus trichocarpa]
 gb|EEE78575.1| plasma membrane aquaporin family protein [Populus trichocarpa]
Length=288

 Score =   458 bits (1179),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 228/265 (86%), Positives = 242/265 (91%), Gaps = 3/265 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDV+LGANKF E+Q IGT+AQ DKDY EAPP  LFEP EL SWSFYRAGIAEFIA
Sbjct  1     MEGKEEDVKLGANKFSERQPIGTSAQTDKDYKEAPPAPLFEPGELKSWSFYRAGIAEFIA  60

Query  406   TFLFLYITILTVMGVSK-SDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  582
             TFLFLYIT+LTVMGV+K   SKC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61    TFLFLYITVLTVMGVTKPGTSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  583   GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGDGL  759
             GLFLARKLSLTRAVFY++MQCLGAICGAGVVKG  G   Y  +GGGANVV  GYTKGDGL
Sbjct  121   GLFLARKLSLTRAVFYIIMQCLGAICGAGVVKGLQGSHNYELQGGGANVVNHGYTKGDGL  180

Query  760   GAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPAR  939
             GAEIVGTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPAR
Sbjct  181   GAEIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR  240

Query  940   SLGAAIIYNRDEAWNDHWIFWVGPF  1014
             SLGAAII+N+D AW+DHWIFWVGPF
Sbjct  241   SLGAAIIFNKDHAWDDHWIFWVGPF  265



>gb|AAG23179.1|AF299050_1 aquaporin PIP1b1 [Brassica oleracea]
 emb|CDY18886.1| BnaC04g04640D [Brassica napus]
Length=286

 Score =   458 bits (1179),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 221/263 (84%), Positives = 240/263 (91%), Gaps = 1/263 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDVR+GANKFPE+Q IGT+AQ DKDY E PP  LFEP EL+SWSF+RAGIAEFIA
Sbjct  1     MEGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELASWSFWRAGIAEFIA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYIT+LTVMGV +S + C +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITVLTVMGVKRSPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGA  765
             LFLARKLSLTRAV+Y+VMQCLGAICGAGVVKGF    Y   GGGAN VA GYTKG GLGA
Sbjct  121   LFLARKLSLTRAVYYIVMQCLGAICGAGVVKGFQPKQYQALGGGANTVAHGYTKGSGLGA  180

Query  766   EIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSL  945
             EI+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSL
Sbjct  181   EIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSL  240

Query  946   GAAIIYNRDEAWNDHWIFWVGPF  1014
             GAAII+N+D AW+DHW+FWVGPF
Sbjct  241   GAAIIFNKDNAWDDHWVFWVGPF  263



>gb|AEA40491.1| aquaporin PIP1-3 [Brassica oleracea var. italica]
Length=280

 Score =   458 bits (1178),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 220/262 (84%), Positives = 240/262 (92%), Gaps = 1/262 (0%)
 Frame = +1

Query  232   EHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIAT  408
             E +EEDVR+GANKFPE+Q IGT+AQ DKDY E PP  LFEP EL+SWSF+RAGIAEFIAT
Sbjct  1     EGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELASWSFWRAGIAEFIAT  60

Query  409   FLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  588
             FLFLYIT+LTVMGV ++ + C +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL
Sbjct  61    FLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  120

Query  589   FLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGAE  768
             FLARKLSLTRAV+Y+VMQCLGAICGAGVVKGF    Y   GGGAN VAPGYTKG GLGAE
Sbjct  121   FLARKLSLTRAVYYIVMQCLGAICGAGVVKGFQPKQYQALGGGANTVAPGYTKGSGLGAE  180

Query  769   IVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSLG  948
             I+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSLG
Sbjct  181   IIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLG  240

Query  949   AAIIYNRDEAWNDHWIFWVGPF  1014
             AAII+N+D AW+DHW+FWVGPF
Sbjct  241   AAIIFNKDNAWDDHWVFWVGPF  262



>ref|XP_009119712.1| PREDICTED: aquaporin PIP1-3 [Brassica rapa]
Length=286

 Score =   458 bits (1178),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 221/263 (84%), Positives = 241/263 (92%), Gaps = 1/263 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDVR+GANKFPE+Q IGT+AQ DKDY E PP  LFEP ELSSWSF+RAGIAEFIA
Sbjct  1     MEGKEEDVRVGANKFPERQPIGTSAQTDKDYKEPPPAPLFEPGELSSWSFWRAGIAEFIA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYIT+LTVMGV ++ + C +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGA  765
             LFLARKLSLTRAV Y+VMQCLGA+CGAGVVKGF  T Y   GGGAN VAPGY+KG GLGA
Sbjct  121   LFLARKLSLTRAVPYIVMQCLGAVCGAGVVKGFQPTPYQTLGGGANTVAPGYSKGSGLGA  180

Query  766   EIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSL  945
             EI+GTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSL
Sbjct  181   EIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSL  240

Query  946   GAAIIYNRDEAWNDHWIFWVGPF  1014
             GAAIIYN+D +W+DHWIFWVGPF
Sbjct  241   GAAIIYNKDHSWDDHWIFWVGPF  263



>emb|CAH60718.1| putative plasma membrane intrinsic protein [Populus tremula x 
Populus tremuloides]
Length=288

 Score =   458 bits (1178),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 228/265 (86%), Positives = 243/265 (92%), Gaps = 3/265 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDV+LGANKF E+Q IGT+AQ DKDY EAPP  LFEP EL SWSFYRAGIAEFIA
Sbjct  1     MEGKEEDVKLGANKFSERQPIGTSAQTDKDYKEAPPAPLFEPGELKSWSFYRAGIAEFIA  60

Query  406   TFLFLYITILTVMGVSK-SDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  582
             TFLFLYIT+LTVMGV+K   SKC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61    TFLFLYITVLTVMGVTKPGTSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  583   GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGDGL  759
             GLFLARKLSLTRAVFY++MQCLGAICGAGVVKGF G   +  +GGGANVV  GYTKGDGL
Sbjct  121   GLFLARKLSLTRAVFYIIMQCLGAICGAGVVKGFQGSHNFELQGGGANVVNHGYTKGDGL  180

Query  760   GAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPAR  939
             GAEIVGTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPAR
Sbjct  181   GAEIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR  240

Query  940   SLGAAIIYNRDEAWNDHWIFWVGPF  1014
             SLGAAII+N+D AW+DHWIFWVGPF
Sbjct  241   SLGAAIIFNKDHAWDDHWIFWVGPF  265



>ref|XP_006294736.1| hypothetical protein CARUB_v10023782mg [Capsella rubella]
 gb|EOA27634.1| hypothetical protein CARUB_v10023782mg [Capsella rubella]
Length=286

 Score =   458 bits (1178),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 220/263 (84%), Positives = 240/263 (91%), Gaps = 1/263 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDVR+GANKFPE+Q IGT+AQ DKDY E PP  LFEP E++SWSF+RAGIAEFIA
Sbjct  1     MEGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGEIASWSFWRAGIAEFIA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYIT+LTVMGV +S S C +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITVLTVMGVKRSPSMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGA  765
             LFLARKLSLTRAV+Y+VMQCLGAICGAGVVKGF    Y   GGGAN +A GYTKG GLGA
Sbjct  121   LFLARKLSLTRAVYYIVMQCLGAICGAGVVKGFQPKQYQALGGGANTIAHGYTKGSGLGA  180

Query  766   EIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSL  945
             EI+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSL
Sbjct  181   EIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSL  240

Query  946   GAAIIYNRDEAWNDHWIFWVGPF  1014
             GAAII+N+D AW+DHW+FWVGPF
Sbjct  241   GAAIIFNKDNAWDDHWVFWVGPF  263



>ref|XP_002526866.1| Aquaporin PIP1.3, putative [Ricinus communis]
 gb|EEF35497.1| Aquaporin PIP1.3, putative [Ricinus communis]
Length=287

 Score =   458 bits (1178),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 226/266 (85%), Positives = 242/266 (91%), Gaps = 4/266 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ---DKDYTEAPPTALFEPSELSSWSFYRAGIAEF  399
             ME +EEDVRLGANK+ E Q IGTAAQ   DKDYTE PP  LFEP EL+SWSFYRAGIAEF
Sbjct  1     MEGKEEDVRLGANKYRETQPIGTAAQSQDDKDYTEPPPAPLFEPGELTSWSFYRAGIAEF  60

Query  400   IATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  579
             IATFLFLYI++LTVMGV K+ +KC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61    IATFLFLYISVLTVMGVVKAPTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  580   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGDG  756
             FGLFLARKLSLTRA+FYMVMQCLGAICGAGVVKGF G   Y   GGGAN V PGYTKGDG
Sbjct  121   FGLFLARKLSLTRALFYMVMQCLGAICGAGVVKGFEGSHDYTRLGGGANSVNPGYTKGDG  180

Query  757   LGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPA  936
             LGAEIVGTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPA
Sbjct  181   LGAEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPA  240

Query  937   RSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             RSLGAAII+N+D+ W++HWIFWVGPF
Sbjct  241   RSLGAAIIFNKDQGWDEHWIFWVGPF  266



>ref|XP_003552231.1| PREDICTED: probable aquaporin PIP1-2 [Glycine max]
 gb|KHN07501.1| Putative aquaporin PIP1-2 [Glycine soja]
Length=287

 Score =   458 bits (1178),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 218/265 (82%), Positives = 241/265 (91%), Gaps = 3/265 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQD---KDYTEAPPTALFEPSELSSWSFYRAGIAEF  399
             ME R+EDVR+GAN++ E+Q IGTAAQ    KDY EAPP  LFEP EL+SWSFYRAGIAEF
Sbjct  1     MEGRDEDVRVGANRYGERQPIGTAAQTQDAKDYREAPPAPLFEPRELTSWSFYRAGIAEF  60

Query  400   IATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  579
             +ATFLFLY+T+LTVMGV+KS SKC TVG+QGIAW+FGGMIFALVYCTAGISGGHINPAVT
Sbjct  61    VATFLFLYVTVLTVMGVAKSPSKCSTVGVQGIAWSFGGMIFALVYCTAGISGGHINPAVT  120

Query  580   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGL  759
             FGLFLARKLSLTR VFYM+MQCLGAICGA VVKGF    Y   GGGAN ++ GY+KGDGL
Sbjct  121   FGLFLARKLSLTRTVFYMIMQCLGAICGAAVVKGFQSNQYERLGGGANTLSKGYSKGDGL  180

Query  760   GAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPAR  939
             GAEIVGTFILVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPAR
Sbjct  181   GAEIVGTFILVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR  240

Query  940   SLGAAIIYNRDEAWNDHWIFWVGPF  1014
             SLGAA++YN+D+AW++HWIFWVGPF
Sbjct  241   SLGAALVYNKDQAWDNHWIFWVGPF  265



>ref|NP_182120.1| aquaporin PIP1-2 [Arabidopsis thaliana]
 ref|XP_006397781.1| hypothetical protein EUTSA_v10001573mg [Eutrema salsugineum]
 sp|Q06611.1|PIP12_ARATH RecName: Full=Aquaporin PIP1-2; Short=AtPIP1;2; AltName: Full=Plasma 
membrane intrinsic protein 1b; Short=PIP1b; AltName: 
Full=Transmembrane protein A; Short=AthH2; Short=TMP-A [Arabidopsis 
thaliana]
 emb|CAA48356.1| transmembrane protein [Arabidopsis thaliana]
 gb|AAC28529.1| aquaporin (plasma membrane intrinsic protein 1B) [Arabidopsis 
thaliana]
 gb|AAK82556.1| At2g45960/F4I18.6 [Arabidopsis thaliana]
 gb|AAL36287.1| putative aquaporin, plasma membrane intrinsic protein 1B [Arabidopsis 
thaliana]
 gb|AAM14193.1| putative aquaporin protein [Arabidopsis thaliana]
 gb|ADJ21813.1| aquaporin [Arabidopsis thaliana]
 gb|AEC10622.1| aquaporin PIP1-2 [Arabidopsis thaliana]
 gb|AFT64208.1| MIP4 [Eutrema halophilum]
 gb|ESQ39234.1| hypothetical protein EUTSA_v10001573mg [Eutrema salsugineum]
Length=286

 Score =   457 bits (1177),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 220/263 (84%), Positives = 240/263 (91%), Gaps = 1/263 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDVR+GANKFPE+Q IGT+AQ DKDY E PP  LFEP EL+SWSF+RAGIAEFIA
Sbjct  1     MEGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELASWSFWRAGIAEFIA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYIT+LTVMGV +S + C +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITVLTVMGVKRSPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGA  765
             LFLARKLSLTRAV+Y+VMQCLGAICGAGVVKGF    Y   GGGAN +A GYTKG GLGA
Sbjct  121   LFLARKLSLTRAVYYIVMQCLGAICGAGVVKGFQPKQYQALGGGANTIAHGYTKGSGLGA  180

Query  766   EIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSL  945
             EI+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSL
Sbjct  181   EIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSL  240

Query  946   GAAIIYNRDEAWNDHWIFWVGPF  1014
             GAAII+N+D AW+DHW+FWVGPF
Sbjct  241   GAAIIFNKDNAWDDHWVFWVGPF  263



>ref|XP_009138772.1| PREDICTED: aquaporin PIP1-1 [Brassica rapa]
Length=286

 Score =   457 bits (1177),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 219/263 (83%), Positives = 240/263 (91%), Gaps = 1/263 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EED+R+GANKFPE+Q IGT+AQ DKDY E PP  LFEP ELSSWSF+RAGIAEFIA
Sbjct  1     MEGKEEDIRVGANKFPERQPIGTSAQSDKDYNEPPPAPLFEPGELSSWSFWRAGIAEFIA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYIT+LTVMGV +S + C +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITVLTVMGVKRSPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGA  765
             LFLARKLSLTRA++Y+VMQCLGAICGAGVVKGF    Y   GGGAN VAPGYTKG GLGA
Sbjct  121   LFLARKLSLTRALYYIVMQCLGAICGAGVVKGFQPKQYQALGGGANTVAPGYTKGSGLGA  180

Query  766   EIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSL  945
             EI+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATI +TGTGINPARSL
Sbjct  181   EIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIRMTGTGINPARSL  240

Query  946   GAAIIYNRDEAWNDHWIFWVGPF  1014
             GAAIIYN+D +W+DHW+FWVGPF
Sbjct  241   GAAIIYNKDHSWDDHWVFWVGPF  263



>ref|XP_006288376.1| hypothetical protein CARUB_v10001627mg [Capsella rubella]
 gb|EOA21274.1| hypothetical protein CARUB_v10001627mg [Capsella rubella]
Length=287

 Score =   457 bits (1177),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 221/264 (84%), Positives = 240/264 (91%), Gaps = 2/264 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ--DKDYTEAPPTALFEPSELSSWSFYRAGIAEFI  402
             ME +EEDVR+GANKFPE+Q IGT+AQ  +KDY E PP  LFEP ELSSWSFYRAGIAEFI
Sbjct  1     MEGKEEDVRVGANKFPERQPIGTSAQSTEKDYKEPPPAPLFEPGELSSWSFYRAGIAEFI  60

Query  403   ATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  582
             ATFLFLYIT+LTVMGV ++ + C +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61    ATFLFLYITVLTVMGVKRAPTMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  583   GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLG  762
             GLFLARKLSLTRAVFYM+MQCLGAICGAGVVKGF    Y   GGGAN VA GY+KG GLG
Sbjct  121   GLFLARKLSLTRAVFYMIMQCLGAICGAGVVKGFQPKQYQTLGGGANGVADGYSKGSGLG  180

Query  763   AEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARS  942
             AEI+GTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARS
Sbjct  181   AEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS  240

Query  943   LGAAIIYNRDEAWNDHWIFWVGPF  1014
             LGAAIIYN+D +W+DHWIFWVGPF
Sbjct  241   LGAAIIYNKDHSWDDHWIFWVGPF  264



>gb|AGG39696.1| aquaporin protein AQU18 [Camellia sinensis]
Length=286

 Score =   457 bits (1177),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 222/263 (84%), Positives = 240/263 (91%), Gaps = 1/263 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDV+LGANKF E+Q IGTAAQ DKDY E PP  LFEP EL SWSFYRAGIAEF+A
Sbjct  1     MEGKEEDVKLGANKFTERQPIGTAAQTDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFMA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYIT+LTVMGV ++ +KC +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITLLTVMGVVRAPTKCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGA  765
             LFLARKLSLTRAVFY+VMQCLGAICGAGVVKGF  ++Y    GGAN VA GYTKGDGLGA
Sbjct  121   LFLARKLSLTRAVFYIVMQCLGAICGAGVVKGFQPSIYQANNGGANFVAHGYTKGDGLGA  180

Query  766   EIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSL  945
             EIVGTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSL
Sbjct  181   EIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSL  240

Query  946   GAAIIYNRDEAWNDHWIFWVGPF  1014
             GAAI++NRD AW+D WIFWVGPF
Sbjct  241   GAAIVFNRDLAWDDQWIFWVGPF  263



>ref|XP_010556545.1| PREDICTED: aquaporin PIP1-3-like [Tarenaya hassleriana]
Length=286

 Score =   457 bits (1177),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 224/263 (85%), Positives = 240/263 (91%), Gaps = 1/263 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDVR+GANKF E+Q IGT+AQ DKDY E PP  LFEP EL+SWSF+RAGIAEF+A
Sbjct  1     MEGKEEDVRVGANKFTERQPIGTSAQTDKDYKEPPPAPLFEPGELTSWSFWRAGIAEFMA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYIT+LTVMGV +S + C +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITVLTVMGVKRSPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGA  765
             LFLARKLSLTRAVFYMVMQ LGAICGAGVVKGF  + Y   GGGAN VA GYTKGDGLGA
Sbjct  121   LFLARKLSLTRAVFYMVMQSLGAICGAGVVKGFMPSHYQRLGGGANTVAHGYTKGDGLGA  180

Query  766   EIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSL  945
             EIVGTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSL
Sbjct  181   EIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSL  240

Query  946   GAAIIYNRDEAWNDHWIFWVGPF  1014
             GAAIIYN+D AW+DHWIFWVGPF
Sbjct  241   GAAIIYNKDHAWDDHWIFWVGPF  263



>gb|AAM61041.1| aquaporin (plasma membrane intrinsic protein 1B) [Arabidopsis 
thaliana]
Length=285

 Score =   457 bits (1177),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 218/262 (83%), Positives = 238/262 (91%), Gaps = 0/262 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQDKDYTEAPPTALFEPSELSSWSFYRAGIAEFIAT  408
             ME +EEDVR+GANKFPE+Q IGT+AQ  DY E PP  LFEP EL+SWSF+RAGIAEFIAT
Sbjct  1     MEGKEEDVRVGANKFPERQPIGTSAQSDDYKEPPPAPLFEPGELASWSFWRAGIAEFIAT  60

Query  409   FLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  588
             FLFLYIT+LTVMGV +S + C +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL
Sbjct  61    FLFLYITVLTVMGVKRSPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  120

Query  589   FLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGAE  768
             FLARKLSLTRAV+Y+VMQCLGAICGAGVVKGF    Y   GGGAN +A GYTKG GLGAE
Sbjct  121   FLARKLSLTRAVYYIVMQCLGAICGAGVVKGFQPKQYQALGGGANTIAHGYTKGSGLGAE  180

Query  769   IVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSLG  948
             I+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSLG
Sbjct  181   IIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLG  240

Query  949   AAIIYNRDEAWNDHWIFWVGPF  1014
             AAII+N+D AW+DHW+FWVGPF
Sbjct  241   AAIIFNKDNAWDDHWVFWVGPF  262



>ref|XP_011080941.1| PREDICTED: probable aquaporin PIP-type pTOM75 [Sesamum indicum]
Length=289

 Score =   457 bits (1177),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 224/262 (85%), Positives = 239/262 (91%), Gaps = 1/262 (0%)
 Frame = +1

Query  232   EHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIAT  408
             E+REEDV+LGANKF E+Q +GTAAQ DKDY E PP  LFEP EL SWSFYRAGIAEF+A 
Sbjct  3     ENREEDVKLGANKFTERQPLGTAAQTDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFMAI  62

Query  409   FLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  588
             FLFLYITILTVMGV ++++KC +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL
Sbjct  63    FLFLYITILTVMGVGRANNKCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  122

Query  589   FLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGAE  768
             FLARKLSLTRA+FY+VMQCLGAICGAGVVKGF K  Y    GGAN V  GYTKGDGLGAE
Sbjct  123   FLARKLSLTRALFYIVMQCLGAICGAGVVKGFMKGPYQTLKGGANFVNHGYTKGDGLGAE  182

Query  769   IVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSLG  948
             IVGTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSLG
Sbjct  183   IVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLG  242

Query  949   AAIIYNRDEAWNDHWIFWVGPF  1014
             AAIIYNRD AW+DHWIFWVGPF
Sbjct  243   AAIIYNRDHAWDDHWIFWVGPF  264



>ref|XP_006284249.1| hypothetical protein CARUB_v10005414mg [Capsella rubella]
 gb|EOA17147.1| hypothetical protein CARUB_v10005414mg [Capsella rubella]
Length=287

 Score =   457 bits (1177),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 223/264 (84%), Positives = 238/264 (90%), Gaps = 2/264 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ--DKDYTEAPPTALFEPSELSSWSFYRAGIAEFI  402
             ME +EEDV +GANKFPE+Q IGTAAQ   KDY E PP  LFEP EL SWSFYRAGIAEFI
Sbjct  1     MEGKEEDVNVGANKFPERQPIGTAAQTESKDYKEPPPAPLFEPGELKSWSFYRAGIAEFI  60

Query  403   ATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  582
             ATFLFLYIT+LTVMGV ++ + C +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61    ATFLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  583   GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLG  762
             GLFLARKLSLTRAVFY+VMQCLGAICGAGVVKGF    Y   GGGANVVA GYTKG GLG
Sbjct  121   GLFLARKLSLTRAVFYIVMQCLGAICGAGVVKGFQSGPYQSNGGGANVVAHGYTKGSGLG  180

Query  763   AEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARS  942
             AEI+GTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARS
Sbjct  181   AEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS  240

Query  943   LGAAIIYNRDEAWNDHWIFWVGPF  1014
             LGAAIIYN+D AW+DHWIFWVGPF
Sbjct  241   LGAAIIYNKDHAWDDHWIFWVGPF  264



>ref|XP_006435692.1| hypothetical protein CICLE_v10032298mg [Citrus clementina]
 ref|XP_006486356.1| PREDICTED: probable aquaporin PIP1-2-like [Citrus sinensis]
 gb|ESR48932.1| hypothetical protein CICLE_v10032298mg [Citrus clementina]
 gb|KDO69061.1| hypothetical protein CISIN_1g023021mg [Citrus sinensis]
Length=288

 Score =   457 bits (1176),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 226/266 (85%), Positives = 240/266 (90%), Gaps = 4/266 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQD---KDYTEAPPTALFEPSELSSWSFYRAGIAEF  399
             ME +EEDVRLGANKF E+Q IGTAAQ    KDY E PP  LFE  EL+SWSFYRAGIAEF
Sbjct  1     MEGKEEDVRLGANKFTERQPIGTAAQSQDGKDYVEPPPAPLFEEEELTSWSFYRAGIAEF  60

Query  400   IATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  579
             IATFLFLYI++LTVMGV KS++KC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61    IATFLFLYISVLTVMGVVKSNTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  580   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGDG  756
             FGLFLARKLSLTRA+FYMVMQCLGAICGAGVVKGF G   Y   GGGAN VA GYTKGDG
Sbjct  121   FGLFLARKLSLTRALFYMVMQCLGAICGAGVVKGFMGAGQYGRLGGGANAVAHGYTKGDG  180

Query  757   LGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPA  936
             LGAEI+GTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPA
Sbjct  181   LGAEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPA  240

Query  937   RSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             RSLGAAIIYN+D  W+DHWIFWVGPF
Sbjct  241   RSLGAAIIYNKDHGWDDHWIFWVGPF  266



>emb|CAA04750.1| aquaporin 1 [Nicotiana tabacum]
 gb|AAB81601.1| aquaporin 1 [Nicotiana tabacum]
Length=287

 Score =   457 bits (1176),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 223/262 (85%), Positives = 240/262 (92%), Gaps = 1/262 (0%)
 Frame = +1

Query  232   EHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIAT  408
             E++EEDV+LGANKF E Q +GTAAQ DKDY E PP  LFEP ELSSWSFYRAGIAEF+AT
Sbjct  3     ENKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFMAT  62

Query  409   FLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  588
             FLFLYITILTVMG+ +SDS C +VGIQG+AWAFGGMIFALVYCTAGISGGHINPAVTFGL
Sbjct  63    FLFLYITILTVMGLKRSDSLCSSVGIQGVAWAFGGMIFALVYCTAGISGGHINPAVTFGL  122

Query  589   FLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGAE  768
             FLARKLSLTRA+FY+VMQCLGAICGAGVVKGF    Y   GGGANVV  GYTKGDGLGAE
Sbjct  123   FLARKLSLTRAIFYIVMQCLGAICGAGVVKGFMVGPYQRLGGGANVVNHGYTKGDGLGAE  182

Query  769   IVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSLG  948
             I+GTF+LVYTVFSATDAKRNARDS+VP+LAPLPIGFAVFLVHLATIPITGTGINPARSLG
Sbjct  183   IIGTFVLVYTVFSATDAKRNARDSYVPILAPLPIGFAVFLVHLATIPITGTGINPARSLG  242

Query  949   AAIIYNRDEAWNDHWIFWVGPF  1014
             AAIIYN D+AW+DHWIFWVGPF
Sbjct  243   AAIIYNTDQAWDDHWIFWVGPF  264



>ref|XP_010456290.1| PREDICTED: probable aquaporin PIP1-4 [Camelina sativa]
Length=287

 Score =   457 bits (1176),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 221/264 (84%), Positives = 240/264 (91%), Gaps = 2/264 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ--DKDYTEAPPTALFEPSELSSWSFYRAGIAEFI  402
             ME +EEDVR+GANKFPE+Q IGT+AQ  +KDY E PP  LFEP ELSSWSFYRAGIAEFI
Sbjct  1     MEGKEEDVRVGANKFPERQPIGTSAQSTEKDYKEPPPAPLFEPGELSSWSFYRAGIAEFI  60

Query  403   ATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  582
             ATFLFLYIT+LTVMGV ++ + C TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61    ATFLFLYITVLTVMGVKRAPTMCATVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  583   GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLG  762
             GLFLARKLSLTRAVFY++MQCLGAICGAGVVKGF    Y   GGGAN VA GY+KG GLG
Sbjct  121   GLFLARKLSLTRAVFYIIMQCLGAICGAGVVKGFQPKQYQTLGGGANGVADGYSKGSGLG  180

Query  763   AEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARS  942
             AEI+GTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARS
Sbjct  181   AEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS  240

Query  943   LGAAIIYNRDEAWNDHWIFWVGPF  1014
             LGAAIIYN+D +W+DHWIFWVGPF
Sbjct  241   LGAAIIYNKDHSWDDHWIFWVGPF  264



>gb|ADN94473.1| aquaporin [Hevea brasiliensis]
Length=287

 Score =   457 bits (1176),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 224/266 (84%), Positives = 243/266 (91%), Gaps = 4/266 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ---DKDYTEAPPTALFEPSELSSWSFYRAGIAEF  399
             ME +EEDVRLGANK+ E Q IGT+AQ   DKDYTE P   LFEP+EL+SWSFYRAGIAEF
Sbjct  1     MEGKEEDVRLGANKYRETQPIGTSAQSQDDKDYTEPPAAPLFEPTELTSWSFYRAGIAEF  60

Query  400   IATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  579
             IATFLFLYI++LTVMGV K+ +KC TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAVT
Sbjct  61    IATFLFLYISVLTVMGVVKAPTKCSTVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVT  120

Query  580   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGDG  756
             FGLFLARKLSLTRA++YMVMQCLGAICGAGVVKGF G+  Y   GGGAN V PGYTKGDG
Sbjct  121   FGLFLARKLSLTRALYYMVMQCLGAICGAGVVKGFEGRHQYTLLGGGANSVNPGYTKGDG  180

Query  757   LGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPA  936
             LGAEIVGTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPA
Sbjct  181   LGAEIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPA  240

Query  937   RSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             RSLGAAII+N+D+ W+DHWIFWVGPF
Sbjct  241   RSLGAAIIFNKDKGWDDHWIFWVGPF  266



>gb|AFB83065.1| plasma intrinsic protein PIP1.1 [Helianthemum almeriense]
Length=290

 Score =   457 bits (1176),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 225/268 (84%), Positives = 243/268 (91%), Gaps = 6/268 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQD-----KDYTEAPPTALFEPSELSSWSFYRAGIA  393
             ME +EEDVRLGANK+ E+Q +GTAAQ      KDY+E PP  LFEPSELSSWSFYRAGIA
Sbjct  1     MEGKEEDVRLGANKYSERQPLGTAAQSQDDNGKDYSEPPPAPLFEPSELSSWSFYRAGIA  60

Query  394   EFIATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPA  573
             EFIATFLFLYI+++TVMGV K+ SKC+TVGIQGIAWAFGGMIFALVYCTAGISGGHINPA
Sbjct  61    EFIATFLFLYISVMTVMGVVKAPSKCQTVGIQGIAWAFGGMIFALVYCTAGISGGHINPA  120

Query  574   VTFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKG  750
             VTFGLFLARKLSLTRA++YMVMQCLGAICGAGVVKGF G   Y    GGAN VA GYTKG
Sbjct  121   VTFGLFLARKLSLTRAIYYMVMQCLGAICGAGVVKGFMGGPQYQLLNGGANFVANGYTKG  180

Query  751   DGLGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGIN  930
             DGLGAEIVGTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGIN
Sbjct  181   DGLGAEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGIN  240

Query  931   PARSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             PARSLGAAII+N+D AW+DHWIFWVGPF
Sbjct  241   PARSLGAAIIFNKDRAWDDHWIFWVGPF  268



>gb|ABB16979.1| major intrinsic protein 1-like protein [Solanum tuberosum]
Length=288

 Score =   457 bits (1176),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 222/262 (85%), Positives = 239/262 (91%), Gaps = 1/262 (0%)
 Frame = +1

Query  232   EHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIAT  408
             E++EEDV LGANK+ E Q +GTAAQ DKDY E PP  LFEP ELSSWSFYRAGIAEF+AT
Sbjct  3     ENKEEDVNLGANKYRETQPLGTAAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFMAT  62

Query  409   FLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  588
             FLFLYITILTVMG+ +SDS C +VG+QG+AWAFGGMIFALVYCTAGISGGHINPAVTFGL
Sbjct  63    FLFLYITILTVMGLKRSDSLCSSVGVQGVAWAFGGMIFALVYCTAGISGGHINPAVTFGL  122

Query  589   FLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGAE  768
             FLARKLSLTRAVFY+VMQCLGAICGAGVVKGF    Y    GGAN V PGYTKGDGLGAE
Sbjct  123   FLARKLSLTRAVFYIVMQCLGAICGAGVVKGFMVGPYERLQGGANFVNPGYTKGDGLGAE  182

Query  769   IVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSLG  948
             I+GTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSLG
Sbjct  183   IIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLG  242

Query  949   AAIIYNRDEAWNDHWIFWVGPF  1014
             AAIIYN+DEAW+DHWIFWVGPF
Sbjct  243   AAIIYNKDEAWDDHWIFWVGPF  264



>gb|AHG32322.1| PIP1-2 [Pisum sativum]
Length=289

 Score =   457 bits (1176),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 226/267 (85%), Positives = 242/267 (91%), Gaps = 5/267 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQD----KDYTEAPPTALFEPSELSSWSFYRAGIAE  396
             ME +EEDV LGANKFPE+Q IG AAQ     KDY E PP  LFEPSEL+SWSF+RAGIAE
Sbjct  1     MEAKEEDVSLGANKFPERQPIGIAAQSHDDGKDYKEPPPAPLFEPSELTSWSFWRAGIAE  60

Query  397   FIATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  576
             F+ATFLFLYITILT+MGV+KSDSKCKTVGIQGIAW+FGGMIFALVYCTAGISGGHINPAV
Sbjct  61    FVATFLFLYITILTIMGVNKSDSKCKTVGIQGIAWSFGGMIFALVYCTAGISGGHINPAV  120

Query  577   TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGD  753
             TFGLFLARKLSLTRAVFY+VMQ LGAICGAGVVKGF GK  Y    GGAN VAPGYTKGD
Sbjct  121   TFGLFLARKLSLTRAVFYIVMQVLGAICGAGVVKGFEGKAFYGKVHGGANFVAPGYTKGD  180

Query  754   GLGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINP  933
             GLGAEI+GTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINP
Sbjct  181   GLGAEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINP  240

Query  934   ARSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             ARSLGAAII+N+D  W+D WIFWVGPF
Sbjct  241   ARSLGAAIIFNKDLGWDDQWIFWVGPF  267



>gb|AIA83103.1| putative aquaporin PIP1 [Citrus sinensis x Citrus trifoliata]
Length=288

 Score =   457 bits (1175),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 226/266 (85%), Positives = 240/266 (90%), Gaps = 4/266 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQD---KDYTEAPPTALFEPSELSSWSFYRAGIAEF  399
             ME +EEDVRLGANKF E+Q IGTAAQ    KDY E PP  LFE  EL+SWSFYRAGIAEF
Sbjct  1     MEGKEEDVRLGANKFNERQPIGTAAQSQDGKDYVEPPPAPLFEEEELTSWSFYRAGIAEF  60

Query  400   IATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  579
             IATFLFLYI++LTVMGV KS++KC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61    IATFLFLYISVLTVMGVVKSNTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  580   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGDG  756
             FGLFLARKLSLTRA+FYMVMQCLGAICGAGVVKGF G   Y   GGGAN VA GYTKGDG
Sbjct  121   FGLFLARKLSLTRALFYMVMQCLGAICGAGVVKGFMGAGQYGRLGGGANAVAHGYTKGDG  180

Query  757   LGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPA  936
             LGAEI+GTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPA
Sbjct  181   LGAEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPA  240

Query  937   RSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             RSLGAAIIYN+D  W+DHWIFWVGPF
Sbjct  241   RSLGAAIIYNKDHGWDDHWIFWVGPF  266



>gb|AIA83105.1| putative aquaporin PIP1 [Citrus x paradisi x Citrus trifoliata]
Length=288

 Score =   457 bits (1175),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 226/266 (85%), Positives = 240/266 (90%), Gaps = 4/266 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQD---KDYTEAPPTALFEPSELSSWSFYRAGIAEF  399
             ME +EEDVRLGANKF E+Q IGTAAQ    KDY E PP  LFE  EL+SWSFYRAGIAEF
Sbjct  1     MEGKEEDVRLGANKFNERQPIGTAAQSQDGKDYVEPPPAPLFEEEELTSWSFYRAGIAEF  60

Query  400   IATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  579
             IATFLFLYI++LTVMGV KS++KC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61    IATFLFLYISVLTVMGVVKSNTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  580   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGDG  756
             FGLFLARKLSLTRA+FYMVMQCLGAICGAGVVKGF G   Y   GGGAN VA GYTKGDG
Sbjct  121   FGLFLARKLSLTRALFYMVMQCLGAICGAGVVKGFMGAGQYGRLGGGANAVAHGYTKGDG  180

Query  757   LGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPA  936
             LGAEI+GTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPA
Sbjct  181   LGAEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPA  240

Query  937   RSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             RSLGAAIIYN+D  W+DHWIFWVGPF
Sbjct  241   RSLGAAIIYNKDHGWDDHWIFWVGPF  266



>ref|XP_008463222.1| PREDICTED: probable aquaporin PIP1-4 [Cucumis melo]
 gb|ADN33892.1| aquaporin [Cucumis melo subsp. melo]
Length=292

 Score =   457 bits (1176),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 226/270 (84%), Positives = 242/270 (90%), Gaps = 8/270 (3%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQD----KDYTEAPPTALFEPSELSSWSFYRAGIAE  396
             ME +EEDVRLGANKF E+Q IGTAAQ     KDY E PP  LFEP EL+SWSFYRAGIAE
Sbjct  1     MEGKEEDVRLGANKFNERQPIGTAAQSQDDAKDYKEPPPAPLFEPEELTSWSFYRAGIAE  60

Query  397   FIATFLFLYITILTVMGVSKSDS----KCKTVGIQGIAWAFGGMIFALVYCTAGISGGHI  564
             F ATFLFLYIT+LTVMGV +S +     CKTVGIQGIAWAFGGMIFALVYCTAGISGGHI
Sbjct  61    FFATFLFLYITVLTVMGVVRSKNIEGNTCKTVGIQGIAWAFGGMIFALVYCTAGISGGHI  120

Query  565   NPAVTFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYT  744
             NPAVTFGLFLARKLSLTRA+FYMVMQCLGAICGAGVVKGF   +Y+  GGGAN+V+ GYT
Sbjct  121   NPAVTFGLFLARKLSLTRAIFYMVMQCLGAICGAGVVKGFQPKLYDTLGGGANIVSEGYT  180

Query  745   KGDGLGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTG  924
             KGDGLGAEIVGTFILVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTG
Sbjct  181   KGDGLGAEIVGTFILVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTG  240

Query  925   INPARSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             INPARSLGAAIIYN ++AW+DHWIFWVGPF
Sbjct  241   INPARSLGAAIIYNNEKAWDDHWIFWVGPF  270



>gb|AAG23180.1|AF299051_1 aquaporin PIP1b2 [Brassica oleracea]
Length=286

 Score =   457 bits (1175),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 220/263 (84%), Positives = 240/263 (91%), Gaps = 1/263 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDVR+GANKFPE+Q IGT+AQ DKDY E PP  LFEP EL+SWSF+RAGIAEFIA
Sbjct  1     MEGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELASWSFWRAGIAEFIA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYIT+LTVMGV ++ + C +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGA  765
             LFLARKLSLTRAV+Y+VMQCLGAICGAGVVKGF    Y   GGGAN VA GYTKG GLGA
Sbjct  121   LFLARKLSLTRAVYYIVMQCLGAICGAGVVKGFQPKQYQALGGGANTVAHGYTKGSGLGA  180

Query  766   EIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSL  945
             EI+GTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSL
Sbjct  181   EIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSL  240

Query  946   GAAIIYNRDEAWNDHWIFWVGPF  1014
             GAAII+N+D AW+DHW+FWVGPF
Sbjct  241   GAAIIFNKDNAWDDHWVFWVGPF  263



>gb|AAF80556.1|AF188843_1 plasma membrane aquaporin [Vitis vinifera]
Length=286

 Score =   457 bits (1175),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 225/263 (86%), Positives = 238/263 (90%), Gaps = 1/263 (0%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  405
             ME +EEDVRLGANKF E+Q IGT+AQ DKDY E PP  LFEP EL SWSF+RAGIAEF+A
Sbjct  1     MEGKEEDVRLGANKFTERQPIGTSAQTDKDYREPPPAPLFEPGELHSWSFWRAGIAEFMA  60

Query  406   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  585
             TFLFLYIT+LTVMGV +S SKC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61    TFLFLYITVLTVMGVVRSPSKCATVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  586   LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLGA  765
             L LARKLSLTRAVFYM+MQCLGAICGA VVKGF    Y   GGGANVVA GY+KGDGLGA
Sbjct  121   LLLARKLSLTRAVFYMIMQCLGAICGASVVKGFQGHQYEVLGGGANVVAAGYSKGDGLGA  180

Query  766   EIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARSL  945
             EIVGTF+LVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARSL
Sbjct  181   EIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSL  240

Query  946   GAAIIYNRDEAWNDHWIFWVGPF  1014
             GAAIIYNR+ AW+D WIFWVGPF
Sbjct  241   GAAIIYNREHAWDDMWIFWVGPF  263



>ref|XP_010448716.1| PREDICTED: probable aquaporin PIP1-5 [Camelina sativa]
Length=287

 Score =   457 bits (1175),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 222/264 (84%), Positives = 238/264 (90%), Gaps = 2/264 (1%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQ--DKDYTEAPPTALFEPSELSSWSFYRAGIAEFI  402
             ME +EEDV +GANKFPEKQ IGTAAQ   KDY E PP  LFEP EL SWSFYRAGIAEFI
Sbjct  1     MEGKEEDVNVGANKFPEKQPIGTAAQTESKDYKEPPPAPLFEPGELKSWSFYRAGIAEFI  60

Query  403   ATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  582
             ATFLFLY+T+LTVMGV ++ + C +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61    ATFLFLYVTVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  583   GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTVYNGKGGGANVVAPGYTKGDGLG  762
             GLFLARKLSLTRA++Y+VMQCLGAICGAGVVKGF    Y   GGGANVVA GYTKG GLG
Sbjct  121   GLFLARKLSLTRALYYIVMQCLGAICGAGVVKGFQSGPYQANGGGANVVAHGYTKGSGLG  180

Query  763   AEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARS  942
             AEIVGTF+LVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPARS
Sbjct  181   AEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS  240

Query  943   LGAAIIYNRDEAWNDHWIFWVGPF  1014
             LGAAIIYN+D AW+DHWIFWVGPF
Sbjct  241   LGAAIIYNKDHAWDDHWIFWVGPF  264



>ref|XP_002531349.1| Aquaporin PIP1.1, putative [Ricinus communis]
 gb|EEF31033.1| Aquaporin PIP1.1, putative [Ricinus communis]
Length=288

 Score =   457 bits (1175),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 225/266 (85%), Positives = 240/266 (90%), Gaps = 4/266 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQD---KDYTEAPPTALFEPSELSSWSFYRAGIAEF  399
             ME REEDV +GAN++ E+Q IGTAAQ    KDY+E PP  LFEP ELSSWSFYRAGIAEF
Sbjct  1     MEGREEDVSVGANRYGERQPIGTAAQTQDVKDYSEPPPAPLFEPGELSSWSFYRAGIAEF  60

Query  400   IATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  579
             +ATFLFLYIT+LTVMGV KS SKC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61    VATFLFLYITVLTVMGVVKSPSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  580   FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGK-TVYNGKGGGANVVAPGYTKGDG  756
             FGLFLARKLSLTRAVFYM+MQCLGAICGAGVVK   K   Y   GGGAN V+ GY+KGDG
Sbjct  121   FGLFLARKLSLTRAVFYMIMQCLGAICGAGVVKALEKGHEYERLGGGANTVSSGYSKGDG  180

Query  757   LGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPA  936
             LGAEIVGTFILVYTVFSATDAKRNARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINPA
Sbjct  181   LGAEIVGTFILVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPA  240

Query  937   RSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             RSLGAA+IYN+D+AW+DHWIFWVGPF
Sbjct  241   RSLGAALIYNKDQAWDDHWIFWVGPF  266



>ref|XP_004490962.1| PREDICTED: probable aquaporin PIP-type 7a-like isoform X2 [Cicer 
arietinum]
Length=289

 Score =   457 bits (1175),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 226/267 (85%), Positives = 240/267 (90%), Gaps = 5/267 (2%)
 Frame = +1

Query  229   MEHREEDVRLGANKFPEKQAIGTAAQD----KDYTEAPPTALFEPSELSSWSFYRAGIAE  396
             ME +E+DV LGANKFPE+Q +G AAQ     KDY E PP  LFEPSEL+SWSFYRAGIAE
Sbjct  1     MEAKEQDVSLGANKFPERQPLGIAAQSQDEPKDYQEPPPAPLFEPSELTSWSFYRAGIAE  60

Query  397   FIATFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  576
             FIATFLFLYIT+LTVMGV +  SKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV
Sbjct  61    FIATFLFLYITVLTVMGVVRESSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  120

Query  577   TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GKTVYNGKGGGANVVAPGYTKGD  753
             TFGLFLARKLSLTRA+FYMVMQ LGAICGAGVVKGF GKT +    GGAN V PGYTKGD
Sbjct  121   TFGLFLARKLSLTRALFYMVMQVLGAICGAGVVKGFEGKTRFGDLKGGANFVNPGYTKGD  180

Query  754   GLGAEIVGTFILVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINP  933
             GLGAEIVGTFILVYTVFSATDAKR+ARDSHVP+LAPLPIGFAVFLVHLATIPITGTGINP
Sbjct  181   GLGAEIVGTFILVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINP  240

Query  934   ARSLGAAIIYNRDEAWNDHWIFWVGPF  1014
             ARSLGAAII+N+D  W+DHWIFWVGPF
Sbjct  241   ARSLGAAIIFNKDLGWDDHWIFWVGPF  267



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2290717995426