BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18061_g2_i1 len=883 path=[520:0-488 1009:489-514 1035:515-518
1009:519-544 1035:545-548 1009:549-574 1062:575-882]

Length=883
                                                                      Score     E

emb|CDP18718.1|  unnamed protein product                                142   2e-36   
ref|XP_011082933.1|  PREDICTED: protodermal factor 1-like               140   1e-35   
ref|XP_011098078.1|  PREDICTED: protodermal factor 1-like               131   2e-32   
ref|XP_009620538.1|  PREDICTED: protodermal factor 1                    133   4e-32   
ref|XP_004251814.1|  PREDICTED: protodermal factor 1-like               133   4e-32   
ref|XP_009800987.1|  PREDICTED: protodermal factor 1                    129   6e-31   
gb|EYU31571.1|  hypothetical protein MIMGU_mgv1a013646mg                125   9e-31   
ref|XP_006350016.1|  PREDICTED: leucine-rich repeat extensin-like...    129   4e-30   
gb|EYU29573.1|  hypothetical protein MIMGU_mgv1a010287mg                126   4e-30   
ref|XP_009798270.1|  PREDICTED: protodermal factor 1-like               126   7e-30   
gb|EPS57238.1|  hypothetical protein M569_17582                         121   2e-29   
ref|XP_009598266.1|  PREDICTED: protodermal factor 1-like               123   7e-29   
ref|XP_002520383.1|  copper ion binding protein, putative               121   1e-28   Ricinus communis
ref|XP_010035900.1|  PREDICTED: protodermal factor 1-like               121   2e-28   
ref|XP_008229397.1|  PREDICTED: protodermal factor 1                    120   3e-28   
ref|XP_006437196.1|  hypothetical protein CICLE_v10032169mg             120   4e-28   
ref|XP_006437197.1|  hypothetical protein CICLE_v10032169mg             120   6e-28   
ref|XP_004303856.1|  PREDICTED: protodermal factor 1-like               119   7e-28   
ref|XP_002307539.2|  hypothetical protein POPTR_0005s22280g             118   1e-27   Populus trichocarpa [western balsam poplar]
ref|XP_011044808.1|  PREDICTED: protodermal factor 1-like               117   2e-27   
ref|XP_006386286.1|  hypothetical protein POPTR_0002s06160g             119   2e-27   
ref|XP_007217461.1|  hypothetical protein PRUPE_ppa027080mg             117   2e-27   
gb|EPS67338.1|  hypothetical protein M569_07441                         115   2e-27   
gb|KDP42653.1|  hypothetical protein JCGZ_00157                         118   2e-27   
ref|XP_009142865.1|  PREDICTED: protodermal factor 1                    119   4e-27   
emb|CDX79858.1|  BnaA05g02980D                                          119   4e-27   
emb|CDY50826.1|  BnaC04g52630D                                          118   5e-27   
ref|XP_002283883.1|  PREDICTED: protodermal factor 1                    116   7e-27   Vitis vinifera
gb|ACU19260.1|  unknown                                                 116   7e-27   Glycine max [soybeans]
gb|EPS67965.1|  protodermal factor 1.3                                  115   8e-27   
ref|XP_009597208.1|  PREDICTED: protodermal factor 1-like               115   1e-26   
ref|XP_006601837.1|  PREDICTED: uncharacterized protein LOC100810...    115   1e-26   
ref|XP_009771855.1|  PREDICTED: protodermal factor 1-like               115   1e-26   
ref|XP_008380226.1|  PREDICTED: protodermal factor 1-like               115   1e-26   
ref|XP_011026338.1|  PREDICTED: protodermal factor 1-like               115   1e-26   
gb|KHG14479.1|  hypothetical protein F383_09534                         116   1e-26   
gb|AEA50960.1|  protodermal factor 1.3                                  116   1e-26   
ref|NP_001240242.1|  uncharacterized protein LOC100810866 precursor     115   1e-26   
ref|XP_004248209.2|  PREDICTED: protodermal factor 1-like               117   2e-26   
ref|XP_004169671.1|  PREDICTED: uncharacterized LOC101217126            114   2e-26   
gb|AEA50959.1|  protodermal factor 1.2                                  115   2e-26   
gb|AEA50962.1|  protodermal factor 1.3                                  115   2e-26   
ref|XP_004143175.1|  PREDICTED: uncharacterized protein LOC101217126    114   2e-26   
ref|XP_003532099.1|  PREDICTED: protodermal factor 1-like isoform 2     114   3e-26   
ref|XP_003532098.1|  PREDICTED: protodermal factor 1-like isoform 1     114   3e-26   
ref|XP_009356648.1|  PREDICTED: protodermal factor 1-like               114   4e-26   
ref|XP_008456355.1|  PREDICTED: protodermal factor 1-like               113   6e-26   
gb|ABL86674.1|  PDF                                                     114   6e-26   Gossypium barbadense [Egyptian cotton]
ref|XP_006360063.1|  PREDICTED: protodermal factor 1-like               115   6e-26   
ref|XP_006411555.1|  hypothetical protein EUTSA_v10016927mg             114   6e-26   
gb|AEA50961.1|  protodermal factor 1.1                                  114   8e-26   
ref|XP_006294534.1|  hypothetical protein CARUB_v10023570mg             114   8e-26   
ref|XP_009142091.1|  PREDICTED: protodermal factor 1-like               113   1e-25   
emb|CDY47992.1|  BnaA04g24700D                                          113   1e-25   
ref|XP_010506127.1|  PREDICTED: protodermal factor 1-like               114   1e-25   
emb|CDY14858.1|  BnaC04g48550D                                          113   1e-25   
ref|XP_007048835.1|  Protodermal factor 1.3, putative                   114   1e-25   
ref|XP_007141386.1|  hypothetical protein PHAVU_008G190900g             114   1e-25   
ref|XP_007141385.1|  hypothetical protein PHAVU_008G190900g             114   2e-25   
ref|XP_010508517.1|  PREDICTED: protodermal factor 1                    114   2e-25   
ref|XP_007146358.1|  hypothetical protein PHAVU_006G033900g             112   2e-25   
ref|XP_007146359.1|  hypothetical protein PHAVU_006G033900g             112   2e-25   
gb|KFK37128.1|  protodermal factor                                      112   2e-25   
ref|XP_010273406.1|  PREDICTED: protodermal factor 1                    111   4e-25   
ref|XP_010517829.1|  PREDICTED: protodermal factor 1-like               112   4e-25   
ref|XP_009377653.1|  PREDICTED: protodermal factor 1-like               111   5e-25   
ref|XP_008342372.1|  PREDICTED: protodermal factor 1                    111   5e-25   
ref|XP_010272672.1|  PREDICTED: protodermal factor 1-like               110   8e-25   
ref|XP_003518516.1|  PREDICTED: leucine-rich repeat extensin-like...    112   2e-24   
ref|XP_006575665.1|  PREDICTED: leucine-rich repeat extensin-like...    112   2e-24   
gb|AFK43320.1|  unknown                                                 109   2e-24   
ref|XP_010525366.1|  PREDICTED: protodermal factor 1                    110   2e-24   
ref|XP_009395219.1|  PREDICTED: protodermal factor 1-like               109   2e-24   
ref|XP_003602116.1|  hypothetical protein MTR_3g089570                  109   2e-24   
ref|XP_004171602.1|  PREDICTED: uncharacterized protein LOC101225955    106   2e-24   
ref|NP_181812.1|  protodermal factor 1                                  108   6e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009415185.1|  PREDICTED: protodermal factor 1-like               105   8e-24   
ref|XP_008449530.1|  PREDICTED: protodermal factor 1-like isoform...    108   1e-23   
ref|XP_008449524.1|  PREDICTED: protodermal factor 1-like isoform X5    108   1e-23   
ref|XP_008449526.1|  PREDICTED: protodermal factor 1-like isoform X7    108   1e-23   
ref|XP_008449528.1|  PREDICTED: protodermal factor 1-like isoform X9    108   1e-23   
ref|XP_008449527.1|  PREDICTED: protodermal factor 1-like isoform X8    108   1e-23   
ref|XP_008449525.1|  PREDICTED: protodermal factor 1-like isoform X6    108   1e-23   
ref|XP_008449522.1|  PREDICTED: protodermal factor 1-like isoform X3    108   1e-23   
ref|XP_008449520.1|  PREDICTED: protodermal factor 1-like isoform X2    108   2e-23   
ref|XP_008449519.1|  PREDICTED: protodermal factor 1-like isoform X1    108   2e-23   
ref|XP_008449523.1|  PREDICTED: protodermal factor 1-like isoform X4    108   2e-23   
ref|XP_004513725.1|  PREDICTED: protodermal factor 1-like               107   2e-23   
ref|XP_004243231.1|  PREDICTED: protodermal factor 1                    106   3e-23   
ref|XP_010102174.1|  hypothetical protein L484_021408                   106   3e-23   
ref|XP_006348944.1|  PREDICTED: protodermal factor 1-like               104   8e-23   
ref|XP_004140248.1|  PREDICTED: uncharacterized protein LOC101219879    107   8e-23   
gb|EEE55322.1|  hypothetical protein OsJ_03322                          108   1e-22   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001044120.1|  Os01g0726700                                       107   1e-22   Oryza sativa Japonica Group [Japonica rice]
gb|EEC71412.1|  hypothetical protein OsI_03588                          107   2e-22   Oryza sativa Indica Group [Indian rice]
ref|XP_004491347.1|  PREDICTED: extensin-like                           106   2e-22   
gb|KGN47994.1|  hypothetical protein Csa_6G423360                       106   2e-22   
ref|XP_009407017.1|  PREDICTED: protodermal factor 1-like               102   1e-21   
ref|XP_006646282.1|  PREDICTED: extensin-like                           105   1e-21   
gb|EMS52214.1|  hypothetical protein TRIUR3_33602                       102   4e-21   
emb|CDM84206.1|  unnamed protein product                                102   5e-21   
ref|XP_003567069.2|  PREDICTED: protodermal factor 1-like               100   1e-20   
dbj|BAJ92021.1|  predicted protein                                      100   4e-20   
ref|XP_010924678.1|  PREDICTED: protodermal factor 1-like             94.7    3e-19   
ref|XP_010667972.1|  PREDICTED: protodermal factor 1                  95.1    3e-19   
ref|NP_001151862.1|  DNA-directed RNA polymerase II largest subun...  96.3    9e-19   Zea mays [maize]
ref|XP_008673135.1|  PREDICTED: uncharacterized protein LOC100382...  95.9    1e-18   
ref|XP_009392539.1|  PREDICTED: protodermal factor 1-like             91.7    1e-18   
ref|NP_001148678.1|  meiosis 5 precursor                              91.3    2e-18   Zea mays [maize]
ref|XP_002456277.1|  hypothetical protein SORBIDRAFT_03g033390        94.7    2e-18   Sorghum bicolor [broomcorn]
gb|EMT14417.1|  hypothetical protein F775_04470                       92.0    3e-18   
ref|XP_006859008.1|  hypothetical protein AMTR_s00068p00158450        91.3    5e-18   
gb|AFW71223.1|  meiosis 5                                             89.7    7e-18   
ref|XP_004951386.1|  PREDICTED: protodermal factor 1-like             89.4    8e-18   
ref|XP_006576119.1|  PREDICTED: protodermal factor 1-like             88.2    9e-18   
ref|XP_009381201.1|  PREDICTED: protodermal factor 1-like             89.7    1e-17   
ref|XP_008791849.1|  PREDICTED: protodermal factor 1                  92.4    1e-17   
ref|XP_008792281.1|  PREDICTED: protodermal factor 1-like             88.6    3e-17   
ref|XP_002451823.1|  hypothetical protein SORBIDRAFT_04g008270        86.7    8e-17   Sorghum bicolor [broomcorn]
ref|XP_004969811.1|  PREDICTED: sialidase-like                        90.5    8e-17   
ref|XP_003571819.1|  PREDICTED: protodermal factor 1-like             86.3    1e-16   
ref|XP_010915432.1|  PREDICTED: leucine-rich repeat extensin-like...  89.0    2e-16   
gb|KHN38375.1|  hypothetical protein glysoja_004040                   83.6    3e-16   
ref|XP_010053227.1|  PREDICTED: protodermal factor 1                  85.9    5e-16   
ref|XP_009409605.1|  PREDICTED: protodermal factor 1-like             80.9    1e-15   
emb|CDM81708.1|  unnamed protein product                              82.4    3e-15   
gb|AAV58857.1|  meiosis 5                                             82.4    7e-15   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ91952.1|  predicted protein                                    80.9    1e-14   
ref|XP_002436628.1|  hypothetical protein SORBIDRAFT_10g006190        81.6    2e-14   Sorghum bicolor [broomcorn]
ref|NP_001172867.1|  Os02g0230300                                     79.3    3e-14   
ref|XP_006647097.1|  PREDICTED: protodermal factor 1-like             79.0    3e-14   
gb|AEJ07953.1|  meiosis 5-like protein                                80.5    6e-14   
gb|EAY85105.1|  hypothetical protein OsI_06457                        78.6    6e-14   Oryza sativa Indica Group [Indian rice]
dbj|BAJ89562.1|  predicted protein                                    77.8    8e-14   
dbj|BAJ86629.1|  predicted protein                                    79.3    2e-13   
gb|EMT07136.1|  hypothetical protein F775_31687                       76.6    2e-13   
gb|EMT03246.1|  hypothetical protein F775_31546                       77.0    6e-13   
gb|AAT71304.1|  proline- and threonine-rich protein                   75.5    7e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004965593.1|  PREDICTED: keratin-3, type I cytoskeletal 51...  75.1    7e-13   
emb|CDM82145.1|  unnamed protein product                              77.0    7e-13   
gb|AFW86949.1|  meiosis 5                                             73.9    1e-12   
gb|AFW86950.1|  hypothetical protein ZEAMMB73_132004                  73.6    2e-12   
ref|NP_001148016.1|  meiosis 5 precursor                              73.2    2e-12   Zea mays [maize]
gb|ACG27615.1|  meiosis 5                                             73.2    2e-12   Zea mays [maize]
gb|AFW86951.1|  meiosis 5                                             73.2    2e-12   
ref|NP_001168480.1|  uncharacterized protein LOC100382257 precursor   73.2    3e-12   Zea mays [maize]
gb|ACG28466.1|  meiosis 5                                             73.2    3e-12   Zea mays [maize]
ref|NP_001183948.1|  uncharacterized protein LOC100502555 precursor   73.2    3e-12   
ref|NP_001148184.1|  meiosis 5 precursor                              73.2    4e-12   Zea mays [maize]
gb|ADE77644.1|  unknown                                               74.7    6e-12   
gb|AFW86948.1|  hypothetical protein ZEAMMB73_132004                  71.6    1e-11   
gb|AFV13467.1|  meiosis 5-like protein                                73.6    2e-11   
ref|XP_004968555.1|  PREDICTED: keratin, type I cytoskeletal 9-like   73.2    2e-11   
ref|XP_002438553.1|  hypothetical protein SORBIDRAFT_10g021810        70.5    3e-11   Sorghum bicolor [broomcorn]
ref|NP_001057844.1|  Os06g0553200                                     70.1    3e-11   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ01309.1|  hypothetical protein OsI_23340                        70.1    4e-11   Oryza sativa Indica Group [Indian rice]
ref|NP_001150305.1|  meiosis 5 precursor                              72.4    4e-11   Zea mays [maize]
ref|XP_002457165.1|  hypothetical protein SORBIDRAFT_03g002540        71.2    9e-11   Sorghum bicolor [broomcorn]
ref|NP_001150889.1|  LOC100284522 precursor                           68.6    1e-10   Zea mays [maize]
ref|XP_006656154.1|  PREDICTED: protodermal factor 1-like             68.2    2e-10   
ref|XP_003563769.1|  PREDICTED: protodermal factor 1-like             67.4    4e-10   
gb|AFW76536.1|  hypothetical protein ZEAMMB73_750604                  66.2    4e-10   
ref|XP_003565471.1|  PREDICTED: protodermal factor 1-like             68.9    5e-10   
ref|NP_001042324.2|  Os01g0201600                                     66.2    4e-09   Oryza sativa Japonica Group [Japonica rice]
gb|ACG27324.1|  hypothetical protein                                  57.0    5e-07   Zea mays [maize]
gb|EMS60822.1|  hypothetical protein TRIUR3_20400                     52.4    1e-04   



>emb|CDP18718.1| unnamed protein product [Coffea canephora]
Length=294

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 100/122 (82%), Gaps = 4/122 (3%)
 Frame = -3

Query  416  PPTGFDPNSPPFPCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALS  237
            PP GFDPNSPPF C +W+ HPTLIWG++GW G T+    G  +  IPGF  ++++L+ALS
Sbjct  173  PPYGFDPNSPPFSCNYWRTHPTLIWGLLGWWG-TVGQTLGATS--IPGFGSNMSVLQALS  229

Query  236  NTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLAN  57
            NTRTDG+GALYREGTA+ LNSM+ +NFPYTTQQVRD+F   ALSSN+AAA QA+LFKLAN
Sbjct  230  NTRTDGFGALYREGTASFLNSMVHRNFPYTTQQVRDTF-VGALSSNKAAAHQAQLFKLAN  288

Query  56   EG  51
            EG
Sbjct  289  EG  290



>ref|XP_011082933.1| PREDICTED: protodermal factor 1-like [Sesamum indicum]
Length=291

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 104/129 (81%), Gaps = 5/129 (4%)
 Frame = -3

Query  419  TPPTGFDPNSPPFPCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEAL  240
            +PP  FDPNSPPF C +W+ HPTLIWG+ GW G T+ S FG+ +  +PGFS ++NLL+AL
Sbjct  167  SPPFPFDPNSPPFTCIYWRNHPTLIWGLFGWWG-TLGSAFGLTS--VPGFSPNMNLLQAL  223

Query  239  SNTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLA  60
            SNTRTDG G LYREGTAA+LNSM    FPYTT QVRDSF  AALSSN+AAAAQA+LFKLA
Sbjct  224  SNTRTDGLGDLYREGTAALLNSMAHTRFPYTTSQVRDSF-VAALSSNKAAAAQAQLFKLA  282

Query  59   NEGH-RPKA  36
            NEG  +P+A
Sbjct  283  NEGRNKPRA  291



>ref|XP_011098078.1| PREDICTED: protodermal factor 1-like [Sesamum indicum]
Length=270

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 99/129 (77%), Gaps = 5/129 (4%)
 Frame = -3

Query  419  TPPTGFDPNSPPFPCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEAL  240
            +PP  FDPNSPPF CT+W+ HPTLIWG+ GW   TI + FG+ +  +PG    +NLL+AL
Sbjct  146  SPPFPFDPNSPPFTCTYWRNHPTLIWGLFGWWA-TIGNAFGVTS--LPGTGAHMNLLQAL  202

Query  239  SNTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLA  60
            SNTR DG G LYREGTAA+LNSM    FPYTT  VRDSF  AALSSN+AAAAQA+LFKLA
Sbjct  203  SNTRADGVGELYREGTAALLNSMTHPKFPYTTTHVRDSF-VAALSSNKAAAAQAQLFKLA  261

Query  59   NEGH-RPKA  36
            NEG  +P+A
Sbjct  262  NEGRIKPRA  270



>ref|XP_009620538.1| PREDICTED: protodermal factor 1 [Nicotiana tomentosiformis]
Length=389

 Score =   133 bits (334),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 102/128 (80%), Gaps = 5/128 (4%)
 Frame = -3

Query  416  PPTGFDPNSPPFPCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALS  237
            PP  FDPNSPPFP  +W+ +P LIWG+ GW   T+ S FG+ +   PGF G++NLL+ALS
Sbjct  266  PPPLFDPNSPPFPLDYWRTNPALIWGLFGWWA-TVGSAFGVAST--PGFGGNLNLLQALS  322

Query  236  NTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLAN  57
            N R DG G LYREGTA++LNSM++KNF Y+T+QVRDSF  AALSS++AAAAQAR+FKLAN
Sbjct  323  NPRADGVGDLYREGTASLLNSMVSKNFAYSTKQVRDSF-VAALSSDKAAAAQARVFKLAN  381

Query  56   EGH-RPKA  36
            EG  +PKA
Sbjct  382  EGRFKPKA  389



>ref|XP_004251814.1| PREDICTED: protodermal factor 1-like [Solanum lycopersicum]
Length=407

 Score =   133 bits (334),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 98/118 (83%), Gaps = 4/118 (3%)
 Frame = -3

Query  404  FDPNSPPFPCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRT  225
             DPNSPPF C +W+ HPTLIWG+ GW G T+ + FG+ +  +PGF  ++NLL+ALSN+RT
Sbjct  292  IDPNSPPFTCNYWRTHPTLIWGLFGWLG-TVGNSFGVAS--VPGFGSNMNLLQALSNSRT  348

Query  224  DGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEG  51
            D YG LYREGTA++LNSM++K+F YTT QVRDSF  +ALSS+++AAAQA+LFKLANEG
Sbjct  349  DAYGDLYREGTASLLNSMVSKSFTYTTNQVRDSF-VSALSSDKSAAAQAQLFKLANEG  405



>ref|XP_009800987.1| PREDICTED: protodermal factor 1 [Nicotiana sylvestris]
Length=394

 Score =   129 bits (325),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 99/127 (78%), Gaps = 5/127 (4%)
 Frame = -3

Query  416  PPTGFDPNSPPFPCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALS  237
            PP  FDPNSPPFP  +W+ +P LIWG+ GW   T+ S FG+     PGF G++NLL+ALS
Sbjct  271  PPPLFDPNSPPFPLDYWRTNPALIWGLFGWWA-TVGSAFGVAG--APGFGGNLNLLQALS  327

Query  236  NTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLAN  57
            N R DG G LYREGTA++LNSM +KNF Y+T+QVRDSF  AALSS++AAAAQAR+FKLAN
Sbjct  328  NPRADGVGELYREGTASLLNSMGSKNFAYSTKQVRDSF-VAALSSDKAAAAQARIFKLAN  386

Query  56   EGH-RPK  39
            EG  +PK
Sbjct  387  EGRLKPK  393



>gb|EYU31571.1| hypothetical protein MIMGU_mgv1a013646mg [Erythranthe guttata]
Length=214

 Score =   125 bits (314),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 93/123 (76%), Gaps = 3/123 (2%)
 Frame = -3

Query  419  TPPTGFDPNSPPFPCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEAL  240
            +PP  FDPNSPPF CT+WK HPT++WG+VGW G T+ + FG+    IPGF   +N LEAL
Sbjct  93   SPPFAFDPNSPPFNCTYWKNHPTIVWGLVGWWG-TVGNAFGVTGT-IPGFGAHLNPLEAL  150

Query  239  SNTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLA  60
            +NTRTDG+G L R+GTAA+LN +    FP T  QVR SF  AAL S++AAAAQA++FKLA
Sbjct  151  TNTRTDGFGELCRQGTAALLNCLAHTKFPLTAAQVRSSF-VAALGSDKAAAAQAQIFKLA  209

Query  59   NEG  51
            NEG
Sbjct  210  NEG  212



>ref|XP_006350016.1| PREDICTED: leucine-rich repeat extensin-like protein 5-like [Solanum 
tuberosum]
Length=656

 Score =   129 bits (325),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 97/118 (82%), Gaps = 4/118 (3%)
 Frame = -3

Query  404  FDPNSPPFPCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRT  225
             DPNSPPF C +W+ HPTLIWG+ GW G T+ + FG+ +  +PGF  ++NLL+ALSN+R 
Sbjct  541  IDPNSPPFTCNYWRTHPTLIWGLFGWWG-TVGNSFGVAS--VPGFGSNMNLLQALSNSRN  597

Query  224  DGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEG  51
            D YG LYREGTA++LNSM++K+F YT+ QVRDSF  +ALSS+++AAAQA+LFKLANEG
Sbjct  598  DAYGDLYREGTASLLNSMVSKSFTYTSNQVRDSF-VSALSSDKSAAAQAQLFKLANEG  654



>gb|EYU29573.1| hypothetical protein MIMGU_mgv1a010287mg [Erythranthe guttata]
Length=317

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 98/119 (82%), Gaps = 4/119 (3%)
 Frame = -3

Query  404  FDPNSPPFPCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRT  225
            FDPNSPPF C +W+ HPTL+WG++GW G T+ + FG+  ++ PG   ++NL++ALSNTR+
Sbjct  200  FDPNSPPFSCNYWRNHPTLVWGLIGWWG-TVGNAFGVPTSS-PGLGSNMNLIQALSNTRS  257

Query  224  DGYGALYREGTAAMLNSMM-TKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEG  51
            DG+G LYR+GTAA+LNSM  + +FPYTT QVRDSF  A+L SN+AA+AQARLFKLANEG
Sbjct  258  DGFGELYRQGTAALLNSMAHSTSFPYTTTQVRDSF-IASLGSNRAASAQARLFKLANEG  315



>ref|XP_009798270.1| PREDICTED: protodermal factor 1-like [Nicotiana sylvestris]
Length=348

 Score =   126 bits (316),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 99/124 (80%), Gaps = 5/124 (4%)
 Frame = -3

Query  404  FDPNSPPFPCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRT  225
             DPNSPPF C +W+ HPTLIWG++GW G ++ + FG+++  +P    ++NLL+ALSNTR 
Sbjct  229  IDPNSPPFTCDYWRTHPTLIWGILGWWG-SVGNAFGVSS--VPALGANMNLLQALSNTRP  285

Query  224  DGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEGH-  48
            DG G LYREGTA++LNSM+++ F YTT QVR+SF   ALSS+++A+AQA+LFKLANEG  
Sbjct  286  DGLGELYREGTASLLNSMVSRRFTYTTDQVRNSF-VTALSSDKSASAQAQLFKLANEGRL  344

Query  47   RPKA  36
            +P+A
Sbjct  345  KPRA  348



>gb|EPS57238.1| hypothetical protein M569_17582, partial [Genlisea aurea]
Length=189

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 93/120 (78%), Gaps = 4/120 (3%)
 Frame = -3

Query  407  GFDPNSPPFPCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTR  228
            GFDP+SPPF C FW+ HPTL+WG++G    T+ + FG+  +++PGF    N+L+ALSNTR
Sbjct  71   GFDPHSPPFTCIFWRNHPTLVWGLLGGWWGTLGNAFGI--SSVPGFGSHANVLQALSNTR  128

Query  227  TDGYGALYREGTAAMLNSMM-TKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEG  51
             DGYG LYREGTAA+LN++  T+ FPY+  +VRD F  AAL+S + AAAQA+LFKLANEG
Sbjct  129  EDGYGELYREGTAALLNAVARTRFFPYSANEVRDGF-VAALASEKDAAAQAQLFKLANEG  187



>ref|XP_009598266.1| PREDICTED: protodermal factor 1-like [Nicotiana tomentosiformis]
Length=325

 Score =   123 bits (308),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 98/124 (79%), Gaps = 5/124 (4%)
 Frame = -3

Query  404  FDPNSPPFPCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRT  225
             DPNSPPF C +W+ HPTLIWG++GW G ++ + FG+ +  +P    ++NLL+ALSNTR 
Sbjct  206  IDPNSPPFTCDYWRTHPTLIWGILGWWG-SVGNAFGVAS--VPALGANMNLLQALSNTRP  262

Query  224  DGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEGH-  48
            DG G LYREGTA++LNSM+++ F YTT QV++SF   AL+S+++AAAQA+LFKLANEG  
Sbjct  263  DGLGELYREGTASLLNSMVSRRFTYTTNQVKNSF-VTALNSDKSAAAQAQLFKLANEGRL  321

Query  47   RPKA  36
            +P+A
Sbjct  322  KPRA  325



>ref|XP_002520383.1| copper ion binding protein, putative [Ricinus communis]
 gb|EEF41999.1| copper ion binding protein, putative [Ricinus communis]
Length=284

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 91/117 (78%), Gaps = 5/117 (4%)
 Frame = -3

Query  401  DPNSPPFPCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTD  222
            DPNSP F C +W+ HP +IWG++GW G T+ S FG    ++PG   S++L +ALSNTRTD
Sbjct  167  DPNSP-FSCNYWRTHPAIIWGLLGWWG-TVGSAFG--TTSVPGLGASMSLQQALSNTRTD  222

Query  221  GYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEG  51
            GYG LYREGTA++LNSM++  FP+TT+QVR+SF  AAL SN+ AAAQ  LFKLANEG
Sbjct  223  GYGTLYREGTASLLNSMVSNKFPFTTRQVRESF-IAALGSNKVAAAQGHLFKLANEG  278



>ref|XP_010035900.1| PREDICTED: protodermal factor 1-like [Eucalyptus grandis]
 gb|KCW47405.1| hypothetical protein EUGRSUZ_K01198 [Eucalyptus grandis]
Length=318

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 96/126 (76%), Gaps = 8/126 (6%)
 Frame = -3

Query  419  TPPTGFDPNSPPFP--CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLE  246
            TPP  FDPNS PF   C FW+ HP +IWG++GW G T+   FG  +  +PGF  ++NL++
Sbjct  194  TPP--FDPNSNPFTGTCNFWRTHPGVIWGLLGWWG-TVGGTFGATS--MPGFPSNLNLMQ  248

Query  245  ALSNTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFK  66
            ALSNTRTDG G LYREGTA++LNSM+   FPYTTQQV++ F  AAL SN AAAAQARLF+
Sbjct  249  ALSNTRTDGLGQLYREGTASLLNSMVNARFPYTTQQVKERF-TAALGSNSAAAAQARLFR  307

Query  65   LANEGH  48
            LANEGH
Sbjct  308  LANEGH  313



>ref|XP_008229397.1| PREDICTED: protodermal factor 1 [Prunus mume]
Length=301

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 101/130 (78%), Gaps = 6/130 (5%)
 Frame = -3

Query  419  TPPTGFDPNSPPFPCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGF-SGSVNLLEA  243
            TPP   DPNSPPF C +W+ HPT+IWG++GW G T+   FG+N+  +PGF S +++L +A
Sbjct  176  TPPFLPDPNSPPFTCIYWRNHPTVIWGLLGWWG-TLGHAFGVNS--LPGFGSSTMSLQQA  232

Query  242  LSNTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKL  63
            LSNT TDG G LYR+GTAA+LNSM+   F +TT+QVRDSF   AL SN+AAA+QAR+FKL
Sbjct  233  LSNTHTDGLGELYRQGTAALLNSMVDNRFHFTTKQVRDSF-VGALGSNKAAASQARVFKL  291

Query  62   ANEGH-RPKA  36
            ANEG  +P+A
Sbjct  292  ANEGKLKPRA  301



>ref|XP_006437196.1| hypothetical protein CICLE_v10032169mg [Citrus clementina]
 ref|XP_006484837.1| PREDICTED: protodermal factor 1-like [Citrus sinensis]
 gb|ESR50436.1| hypothetical protein CICLE_v10032169mg [Citrus clementina]
Length=294

 Score =   120 bits (300),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 94/120 (78%), Gaps = 6/120 (5%)
 Frame = -3

Query  404  FDPNSP-PFPCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTR  228
            FDPNSP P  CT+W +HP LIWG++GW G    ++ G+   ++PGF  S +LL+ALSNT 
Sbjct  175  FDPNSPVPGTCTYWSSHPGLIWGLLGWWG----TLGGIGVPSVPGFGSSTSLLQALSNTH  230

Query  227  TDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEGH  48
            TDG+GALYREGTA+ LNS+ +  FP+TT QVR+SF  AAL S++AAAAQARLFKLANEGH
Sbjct  231  TDGFGALYREGTASWLNSVASHRFPFTTNQVRNSF-VAALHSDKAAAAQARLFKLANEGH  289



>ref|XP_006437197.1| hypothetical protein CICLE_v10032169mg [Citrus clementina]
 gb|ESR50437.1| hypothetical protein CICLE_v10032169mg [Citrus clementina]
 gb|KDO60926.1| hypothetical protein CISIN_1g021427mg [Citrus sinensis]
Length=312

 Score =   120 bits (300),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 94/120 (78%), Gaps = 6/120 (5%)
 Frame = -3

Query  404  FDPNSP-PFPCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTR  228
            FDPNSP P  CT+W +HP LIWG++GW G    ++ G+   ++PGF  S +LL+ALSNT 
Sbjct  193  FDPNSPVPGTCTYWSSHPGLIWGLLGWWG----TLGGIGVPSVPGFGSSTSLLQALSNTH  248

Query  227  TDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEGH  48
            TDG+GALYREGTA+ LNS+ +  FP+TT QVR+SF  AAL S++AAAAQARLFKLANEGH
Sbjct  249  TDGFGALYREGTASWLNSVASHRFPFTTNQVRNSF-VAALHSDKAAAAQARLFKLANEGH  307



>ref|XP_004303856.1| PREDICTED: protodermal factor 1-like [Fragaria vesca subsp. vesca]
Length=296

 Score =   119 bits (299),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 95/124 (77%), Gaps = 6/124 (5%)
 Frame = -3

Query  401  DPNSPPFPCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGF-SGSVNLLEALSNTRT  225
            +PNSPPF CT+W+ HPT+IWG+VGW   T+   FG+ +  +PGF S ++NL +ALSNTRT
Sbjct  177  NPNSPPFTCTYWRNHPTVIWGLVGWWA-TMGHTFGLTS--LPGFGSSTMNLQQALSNTRT  233

Query  224  DGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEGH-  48
            DG G LYREGTAA+LNSM+   F +TT QVRDSF    LSSN+AA  QARLF+LANEG  
Sbjct  234  DGVGELYREGTAALLNSMVDNRFHFTTTQVRDSF-VRGLSSNKAAKNQARLFRLANEGKL  292

Query  47   RPKA  36
            +P+A
Sbjct  293  KPRA  296



>ref|XP_002307539.2| hypothetical protein POPTR_0005s22280g [Populus trichocarpa]
 gb|EEE94535.2| hypothetical protein POPTR_0005s22280g [Populus trichocarpa]
Length=291

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 97/123 (79%), Gaps = 6/123 (5%)
 Frame = -3

Query  401  DPNSPPFPCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTD  222
            DPNSP F C +W+ HP LIWG++GW G T+ + FG+ +  +PGF  S+ + +ALSNTRTD
Sbjct  174  DPNSP-FSCNYWRTHPALIWGVLGWWG-TMGNAFGVGS--LPGFGTSMTVQQALSNTRTD  229

Query  221  GYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEGH-R  45
            GYG LYREGTA++LNSM++  FP+TT+QVR++F  +AL+SN+AA AQ  LFKLANEG  +
Sbjct  230  GYGTLYREGTASLLNSMVSNRFPFTTRQVRENF-ISALASNKAAGAQGHLFKLANEGRLK  288

Query  44   PKA  36
            P+A
Sbjct  289  PRA  291



>ref|XP_011044808.1| PREDICTED: protodermal factor 1-like [Populus euphratica]
Length=259

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 96/123 (78%), Gaps = 6/123 (5%)
 Frame = -3

Query  401  DPNSPPFPCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTD  222
            DPNSP F C +W+ HP LIWG++GW G T+ + FG+ +  +PGF  S+ + +ALSNTRTD
Sbjct  142  DPNSP-FSCNYWRTHPALIWGVLGWWG-TMGNAFGVGS--LPGFGTSMTVQQALSNTRTD  197

Query  221  GYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEGH-R  45
            GYG LYREGTA++LNSM++  FP+TT QVR++F  +AL+SN+AA AQ  LFKLANEG  +
Sbjct  198  GYGTLYREGTASLLNSMVSNRFPFTTTQVRENF-ISALASNKAARAQGHLFKLANEGRLK  256

Query  44   PKA  36
            P+A
Sbjct  257  PRA  259



>ref|XP_006386286.1| hypothetical protein POPTR_0002s06160g [Populus trichocarpa]
 gb|ERP64083.1| hypothetical protein POPTR_0002s06160g [Populus trichocarpa]
Length=308

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 92/118 (78%), Gaps = 5/118 (4%)
 Frame = -3

Query  401  DPNSPPFPCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTD  222
            DPNSP F C +W+ HP LIWG++GW G T+ + FG+    +PGF  S+ L +ALSNTRTD
Sbjct  191  DPNSP-FSCNYWRTHPALIWGVLGWWG-TMGNAFGVTR--LPGFGTSMTLQQALSNTRTD  246

Query  221  GYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEGH  48
            GYG LYREGTA++LNSM++  FP+TT+QVR++F  A+L+SN+AA AQ  LFKLANEG 
Sbjct  247  GYGTLYREGTASLLNSMVSNRFPFTTRQVRENF-VASLASNKAAGAQGHLFKLANEGR  303



>ref|XP_007217461.1| hypothetical protein PRUPE_ppa027080mg, partial [Prunus persica]
 gb|EMJ18660.1| hypothetical protein PRUPE_ppa027080mg, partial [Prunus persica]
Length=255

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 96/124 (77%), Gaps = 5/124 (4%)
 Frame = -3

Query  419  TPPTGFDPNSPPFPCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGF-SGSVNLLEA  243
            TPP   DPNSPPF C +W+ HPT+IWG++GW G T+   FG+ +  +PGF S +++L +A
Sbjct  130  TPPFLPDPNSPPFTCIYWRNHPTVIWGLLGWWG-TLGHAFGVTS--LPGFGSSTMSLQQA  186

Query  242  LSNTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKL  63
            LSNT TDG G LYR+GTAA+LNSM+   F +TT+QVRDSF   AL SN+AAA+QAR+FKL
Sbjct  187  LSNTHTDGLGELYRQGTAALLNSMVDNRFHFTTKQVRDSF-VGALGSNKAAASQARVFKL  245

Query  62   ANEG  51
            ANEG
Sbjct  246  ANEG  249



>gb|EPS67338.1| hypothetical protein M569_07441, partial [Genlisea aurea]
Length=173

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 89/124 (72%), Gaps = 4/124 (3%)
 Frame = -3

Query  419  TPPTGFDPNSPPFPCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEAL  240
            TP  GFDPNSPPF C FW+ +P ++W ++G+ G T+ + FG++    PGF    N L+AL
Sbjct  54   TPRFGFDPNSPPFTCNFWRTNPAMVWRLLGYLG-TLGNAFGIST--FPGFGPRTNALQAL  110

Query  239  SNTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLA  60
            SNTR DGYG LYREGTAA+LN+M    FP+T  +VR+ F  AAL+S + AA QA+LFKLA
Sbjct  111  SNTRNDGYGELYREGTAALLNAMTHTRFPFTATEVRNGFA-AALASEKDAATQAQLFKLA  169

Query  59   NEGH  48
            NEG 
Sbjct  170  NEGR  173



>gb|KDP42653.1| hypothetical protein JCGZ_00157 [Jatropha curcas]
Length=293

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 97/123 (79%), Gaps = 5/123 (4%)
 Frame = -3

Query  419  TPPTGFDPNSPPFPCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEAL  240
            +PP   DPNSP + C +WK HP L+WG++GW G T+ + FG+ +  +P F  S+N+ +AL
Sbjct  170  SPPFTPDPNSP-YTCNYWKNHPGLVWGLLGWWG-TVGNAFGVTS--LPSFGTSMNVQQAL  225

Query  239  SNTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLA  60
            +NTR DGYG+LYREGTAA+LNSM++  FP+TT+QVR+SF  AALS+N+AAAAQ  LF+LA
Sbjct  226  ANTRADGYGSLYREGTAALLNSMVSNKFPFTTRQVRESF-IAALSTNKAAAAQGHLFRLA  284

Query  59   NEG  51
            NEG
Sbjct  285  NEG  287



>ref|XP_009142865.1| PREDICTED: protodermal factor 1 [Brassica rapa]
Length=410

 Score =   119 bits (297),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 95/140 (68%), Gaps = 17/140 (12%)
 Frame = -3

Query  422  GTPPTGF-DPNSP-------PFP-----CTFWKAHPTLIWGMVGWNGNTIRSMFGMNN--  288
            GTPPT F DP +P       PFP     C +W+ HPTLIWG++GW G T+   FG  +  
Sbjct  268  GTPPTPFIDPGTPGTPFLPAPFPPITGTCDYWRNHPTLIWGLLGWWG-TVGGAFGAVSIP  326

Query  287  NNIPGFSGSVNLLEALSNTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraal  108
            ++IPGF   +NLL+ALSNTRTD  G+LYREGTA+ LNSM+   FP+TT QVRD F  A L
Sbjct  327  SSIPGFDPHMNLLQALSNTRTDAIGSLYREGTASWLNSMVNNQFPFTTSQVRDQF-LAGL  385

Query  107  ssnqaaaaqarLFKLANEGH  48
            SS +AA  QA+ FKLANEG 
Sbjct  386  SSTKAATKQAQTFKLANEGR  405



>emb|CDX79858.1| BnaA05g02980D [Brassica napus]
Length=410

 Score =   119 bits (297),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 95/140 (68%), Gaps = 17/140 (12%)
 Frame = -3

Query  422  GTPPTGF-DPNSP-------PFP-----CTFWKAHPTLIWGMVGWNGNTIRSMFGMNN--  288
            GTPPT F DP +P       PFP     C +W+ HPTLIWG++GW G T+   FG  +  
Sbjct  268  GTPPTPFIDPGTPGTPFLPAPFPPITGTCDYWRNHPTLIWGLLGWWG-TVGGAFGAVSIP  326

Query  287  NNIPGFSGSVNLLEALSNTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraal  108
            ++IPGF   +NLL+ALSNTRTD  G+LYREGTA+ LNSM+   FP+TT QVRD F  A L
Sbjct  327  SSIPGFDPHMNLLQALSNTRTDAIGSLYREGTASWLNSMVNNQFPFTTSQVRDQF-LAGL  385

Query  107  ssnqaaaaqarLFKLANEGH  48
            SS +AA  QA+ FKLANEG 
Sbjct  386  SSTKAATKQAQTFKLANEGR  405



>emb|CDY50826.1| BnaC04g52630D [Brassica napus]
Length=391

 Score =   118 bits (296),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 95/140 (68%), Gaps = 17/140 (12%)
 Frame = -3

Query  422  GTPPTGF-DPNSP-------PFP-----CTFWKAHPTLIWGMVGWNGNTIRSMFGMNN--  288
            GTPPT F DP +P       PFP     C +W+ HPTLIWG++GW G T+   FG  +  
Sbjct  249  GTPPTPFIDPGTPGTPFLPAPFPPITGTCDYWRNHPTLIWGLLGWWG-TVGGAFGAVSIP  307

Query  287  NNIPGFSGSVNLLEALSNTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraal  108
            ++IPGF   +NLL+ALSNTRTD  G+LYREGTA+ LNSM+   FP+TT QVRD F  A L
Sbjct  308  SSIPGFDPHMNLLQALSNTRTDAIGSLYREGTASWLNSMVNNQFPFTTSQVRDQF-LAGL  366

Query  107  ssnqaaaaqarLFKLANEGH  48
            SS +AA  QA+ FKLANEG 
Sbjct  367  SSTKAATKQAQTFKLANEGR  386



>ref|XP_002283883.1| PREDICTED: protodermal factor 1 [Vitis vinifera]
Length=281

 Score =   116 bits (291),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 97/130 (75%), Gaps = 6/130 (5%)
 Frame = -3

Query  419  TPPTGFDPNSP-PFPCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEA  243
            TPP   DPNSP    C +W  HP  IWG++GW G T+   FG+ +  +PGF  +++L +A
Sbjct  156  TPPFLPDPNSPFTGTCNYWSTHPGAIWGLLGWWG-TLGGAFGVAS--VPGFGANISLQQA  212

Query  242  LSNTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKL  63
            LSNTRTDG G LYREGTA++LNSM+ K FP+TT+QVRD F  AALSSN+AAAAQA LFKL
Sbjct  213  LSNTRTDGLGELYREGTASLLNSMVNKRFPFTTKQVRDRFA-AALSSNKAAAAQAHLFKL  271

Query  62   ANEGH-RPKA  36
            ANEG  +P+A
Sbjct  272  ANEGKLKPRA  281



>gb|ACU19260.1| unknown [Glycine max]
Length=264

 Score =   116 bits (290),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 85/109 (78%), Gaps = 2/109 (2%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTDGYGALYRE  198
            C +W+ HP +IWG++GW G T+ S FG+    +PGFS  ++L +ALSNTRTDG GALYRE
Sbjct  152  CNYWRNHPAIIWGILGWWG-TLGSAFGVTGTTVPGFSPGLSLPQALSNTRTDGLGALYRE  210

Query  197  GTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEG  51
            GTA+ LNSM+   FPYTT QVRD F  A+L+SN+AA AQA+LFK+ANEG
Sbjct  211  GTASFLNSMVNNKFPYTTNQVRDRF-VASLNSNKAAEAQAQLFKMANEG  258



>gb|EPS67965.1| protodermal factor 1.3 [Genlisea aurea]
Length=250

 Score =   115 bits (289),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 88/122 (72%), Gaps = 3/122 (2%)
 Frame = -3

Query  416  PPTGFDPNSPPFPCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALS  237
            PP G +PNSPPFP  FW+ +P L+W +VGW G T+ + FG++    PGF    N+L+ALS
Sbjct  129  PPLGLNPNSPPFPFVFWRNNPQLVWRLVGWWGGTLGNAFGISQ--FPGFGSHANVLQALS  186

Query  236  NTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLAN  57
            N R DGYG LYREGTA +LN+M    + Y+  +VRD+F  AAL+S+ AAA QA+LFK+AN
Sbjct  187  NDRNDGYGELYREGTAGLLNAMARTRYAYSVNEVRDNF-VAALASDAAAATQAQLFKVAN  245

Query  56   EG  51
            EG
Sbjct  246  EG  247



>ref|XP_009597208.1| PREDICTED: protodermal factor 1-like [Nicotiana tomentosiformis]
Length=268

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 98/131 (75%), Gaps = 6/131 (5%)
 Frame = -3

Query  422  GTPPTGFDPN-SPPFPCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLE  246
            GTP T   P  SPPF C +W+ HP LIWG+ GW G T+   FG+     PG   ++NLL+
Sbjct  142  GTPSTPAIPTPSPPFTCDYWRTHPGLIWGLFGWWG-TVGGAFGVAT--APGLGSNMNLLQ  198

Query  245  ALSNTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFK  66
            ALSNT TDG+G LYREGTA++LNSM++K F YTT QV+++F  AALSS++AAAAQA+LFK
Sbjct  199  ALSNTHTDGFGQLYREGTASLLNSMVSKRFSYTTTQVKNNFA-AALSSDKAAAAQAQLFK  257

Query  65   LANEGH-RPKA  36
            LANEG  +P+A
Sbjct  258  LANEGRLKPRA  268



>ref|XP_006601837.1| PREDICTED: uncharacterized protein LOC100810866 isoform X1 [Glycine 
max]
Length=264

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 85/109 (78%), Gaps = 2/109 (2%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTDGYGALYRE  198
            C +W+ HP +IWG++GW G T+ S FG+    +PGFS  ++L +ALSNTRTDG GALYRE
Sbjct  152  CNYWRNHPAIIWGILGWWG-TLGSAFGVTGTTVPGFSPGLSLPQALSNTRTDGLGALYRE  210

Query  197  GTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEG  51
            GTA+ LNSM+   FPYTT QVRD F  A+L+SN+AA AQA+LFK+ANEG
Sbjct  211  GTASFLNSMVNNKFPYTTNQVRDRF-VASLNSNKAAEAQAQLFKMANEG  258



>ref|XP_009771855.1| PREDICTED: protodermal factor 1-like [Nicotiana sylvestris]
Length=268

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 97/131 (74%), Gaps = 6/131 (5%)
 Frame = -3

Query  422  GTPPTGFDPN-SPPFPCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLE  246
            GTP T   P  SPPF C +W+ HP LIWG+ GW G T+   FG+     PG    +NLL+
Sbjct  142  GTPSTPAIPTPSPPFTCDYWRTHPGLIWGLFGWWG-TVGGAFGVAT--APGLGAHMNLLQ  198

Query  245  ALSNTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFK  66
            ALSNT TDG+G LYREGTA++LNSM++K F YTT QV+++F  AALSS++AAAAQA+LFK
Sbjct  199  ALSNTHTDGFGQLYREGTASLLNSMVSKRFAYTTTQVKNNFA-AALSSDKAAAAQAQLFK  257

Query  65   LANEGH-RPKA  36
            +ANEG  +P+A
Sbjct  258  IANEGRLKPRA  268



>ref|XP_008380226.1| PREDICTED: protodermal factor 1-like [Malus domestica]
Length=282

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 98/125 (78%), Gaps = 7/125 (6%)
 Frame = -3

Query  401  DPNS-PPFPCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGF-SGSVNLLEALSNTR  228
            DPNS PPF C +W++HPTLIWG++GW GN   S FG+++  +PG  SG+++L +ALSNTR
Sbjct  162  DPNSLPPFTCNYWRSHPTLIWGLLGWWGNLGHS-FGVSS--LPGIGSGTMSLPQALSNTR  218

Query  227  TDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEGH  48
            TDG G LYR+GTAA+LN+M+   F +TT QVRDSF   AL SN+AAA QAR+FKLANEG 
Sbjct  219  TDGLGELYRQGTAALLNAMVDNRFHFTTNQVRDSF-VRALGSNKAAATQARVFKLANEGK  277

Query  47   -RPKA  36
             +P+A
Sbjct  278  LKPRA  282



>ref|XP_011026338.1| PREDICTED: protodermal factor 1-like [Populus euphratica]
Length=260

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 92/118 (78%), Gaps = 5/118 (4%)
 Frame = -3

Query  401  DPNSPPFPCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTD  222
            DPNSP F C +W+ HP LIWG++GW G T+ + FG+ +  +PGF  S+ L +ALSNTRTD
Sbjct  143  DPNSP-FSCNYWRTHPALIWGVMGWWG-TMGNAFGVTS--LPGFGTSMTLQQALSNTRTD  198

Query  221  GYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEGH  48
            GYG LYREGTA++LNSM++  F +TT+QVR++F  A+L+SN+AA AQ  LFKLANEG 
Sbjct  199  GYGTLYREGTASLLNSMVSNRFSFTTRQVRENF-VASLASNKAAGAQGHLFKLANEGR  255



>gb|KHG14479.1| hypothetical protein F383_09534 [Gossypium arboreum]
Length=317

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 89/110 (81%), Gaps = 4/110 (4%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTDGYGALYRE  198
            C FW++HPTLIWG++GW G T+ + FG+ N  +PG   S++L +ALSNTRTDG GALYRE
Sbjct  207  CDFWRSHPTLIWGLLGWWG-TVGNAFGVTN--VPGLGTSMSLPQALSNTRTDGLGALYRE  263

Query  197  GTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEGH  48
            GTA+ LNSM+   FP++T+QVR++F  AAL SN AAAAQARLFKLANEGH
Sbjct  264  GTASFLNSMVNNRFPFSTKQVRETF-VAALGSNSAAAAQARLFKLANEGH  312



>gb|AEA50960.1| protodermal factor 1.3 [Gossypium barbadense]
Length=325

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 89/110 (81%), Gaps = 4/110 (4%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTDGYGALYRE  198
            C FW++HPTLIWG++GW G T+ + FG+ N  +PG   S++L +ALSNTRTDG GALYRE
Sbjct  215  CDFWRSHPTLIWGLLGWWG-TVGNAFGVTN--VPGLGTSMSLPQALSNTRTDGLGALYRE  271

Query  197  GTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEGH  48
            GTA+ LNSM+   FP++T+QVR++F  AAL SN AAAAQARLFKLANEGH
Sbjct  272  GTASFLNSMVNNRFPFSTKQVRETF-VAALGSNSAAAAQARLFKLANEGH  320



>ref|NP_001240242.1| uncharacterized protein LOC100810866 precursor [Glycine max]
 gb|ACU23938.1| unknown [Glycine max]
 gb|KHN18102.1| hypothetical protein glysoja_020875 [Glycine soja]
Length=270

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 85/109 (78%), Gaps = 2/109 (2%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTDGYGALYRE  198
            C +W+ HP +IWG++GW G T+ S FG+    +PGFS  ++L +ALSNTRTDG GALYRE
Sbjct  158  CNYWRNHPAIIWGILGWWG-TLGSAFGVTGTTVPGFSPGLSLPQALSNTRTDGLGALYRE  216

Query  197  GTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEG  51
            GTA+ LNSM+   FPYTT QVRD F  A+L+SN+AA AQA+LFK+ANEG
Sbjct  217  GTASFLNSMVNNKFPYTTNQVRDRF-VASLNSNKAAEAQAQLFKMANEG  264



>ref|XP_004248209.2| PREDICTED: protodermal factor 1-like [Solanum lycopersicum]
Length=415

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 91/123 (74%), Gaps = 4/123 (3%)
 Frame = -3

Query  416  PPTGFDPNSPPFPCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALS  237
            PP  FDPNSPPF   +W+ +P LIW + GW   TI S FG+     PG   + NLL+AL+
Sbjct  292  PPPLFDPNSPPFSIDYWRTNPALIWALCGWWA-TIGSAFGVAP--APGLGSNFNLLQALT  348

Query  236  NTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLAN  57
            NTR+DG G LYREGTA++LNSM+ K FPYTT+QVR++F  AALSSN+AAAAQA  FKLAN
Sbjct  349  NTRSDGVGELYREGTASLLNSMVNKKFPYTTKQVRENF-VAALSSNKAAAAQAARFKLAN  407

Query  56   EGH  48
            EG 
Sbjct  408  EGR  410



>ref|XP_004169671.1| PREDICTED: uncharacterized LOC101217126 [Cucumis sativus]
Length=241

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 89/117 (76%), Gaps = 5/117 (4%)
 Frame = -3

Query  383  FPCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTDGYGALY  204
            F CT+W  HP LIWG++GW G T+ + FG  N  +PGF  ++NLL+ALSNTR DGYGAL 
Sbjct  129  FTCTYWLNHPGLIWGVLGWWG-TLGNAFGATN--VPGFGTNLNLLQALSNTRNDGYGALL  185

Query  203  REGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEGH-RPKA  36
            REGTA+ LNS+ +  FPYTT+QVR SF  +ALSSN+AA +QA  FKLANEG  +P+A
Sbjct  186  REGTASYLNSLASNRFPYTTKQVRTSF-VSALSSNKAAGSQANTFKLANEGKIKPRA  241



>gb|AEA50959.1| protodermal factor 1.2 [Gossypium barbadense]
Length=294

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 89/110 (81%), Gaps = 4/110 (4%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTDGYGALYRE  198
            C FW++HPTLIWG++GW G T+ + FG+ N  +PG   S++L +ALSNTRTDG GALYRE
Sbjct  184  CDFWRSHPTLIWGLLGWWG-TVGNAFGVTN--VPGLGTSMSLPQALSNTRTDGLGALYRE  240

Query  197  GTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEGH  48
            GTA+ LNSM+   FP++T+QVR++F  AAL SN AAAAQARLFKLANEGH
Sbjct  241  GTASFLNSMVNNRFPFSTKQVRETF-VAALGSNSAAAAQARLFKLANEGH  289



>gb|AEA50962.1| protodermal factor 1.3 [Gossypium hirsutum]
Length=309

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 89/110 (81%), Gaps = 4/110 (4%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTDGYGALYRE  198
            C FW++HPTLIWG++GW G T+ + FG+ N  +PG   S++L +ALSNTRTDG GALYRE
Sbjct  199  CDFWRSHPTLIWGLLGWWG-TVGNAFGVTN--VPGLGTSMSLPQALSNTRTDGLGALYRE  255

Query  197  GTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEGH  48
            GTA+ LNSM+   FP++T+QVR++F  AAL SN AAAAQARLFKLANEGH
Sbjct  256  GTASFLNSMVNNRFPFSTKQVRETF-VAALGSNSAAAAQARLFKLANEGH  304



>ref|XP_004143175.1| PREDICTED: uncharacterized protein LOC101217126 [Cucumis sativus]
 gb|KGN47037.1| hypothetical protein Csa_6G178950 [Cucumis sativus]
Length=241

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 88/117 (75%), Gaps = 5/117 (4%)
 Frame = -3

Query  383  FPCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTDGYGALY  204
            F CT+W  HP LIWG++GW G T+ + FG  N  +PGF  ++NLL+ALSNTR DGYGAL 
Sbjct  129  FTCTYWLNHPGLIWGVLGWWG-TLGNAFGATN--VPGFGTNLNLLQALSNTRNDGYGALL  185

Query  203  REGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEGH-RPKA  36
            REGTA+ LNS+ +  FPYTT+QVR SF  +ALSSN+AA  QA  FKLANEG  +P+A
Sbjct  186  REGTASYLNSLASNRFPYTTKQVRTSF-VSALSSNKAAGNQANTFKLANEGKIKPRA  241



>ref|XP_003532099.1| PREDICTED: protodermal factor 1-like isoform 2 [Glycine max]
Length=272

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 85/109 (78%), Gaps = 2/109 (2%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTDGYGALYRE  198
            C +W+ HP +IWG++GW G T+ S FG+    +PGFS  ++L +ALSNTRTDG GALYRE
Sbjct  160  CNYWRNHPAIIWGILGWWG-TLGSAFGVTGTTVPGFSPGLSLPQALSNTRTDGLGALYRE  218

Query  197  GTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEG  51
            GTA+ LNSM+   FPYTT QVRD F  A+L+SN+AA AQA+LFK+ANEG
Sbjct  219  GTASFLNSMVNNKFPYTTNQVRDRF-VASLNSNKAAEAQAQLFKMANEG  266



>ref|XP_003532098.1| PREDICTED: protodermal factor 1-like isoform 1 [Glycine max]
 gb|KHM99623.1| hypothetical protein glysoja_006466 [Glycine soja]
Length=266

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 85/110 (77%), Gaps = 2/110 (2%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTDGYGALYRE  198
            C +W+ HP +IWG++GW G T+ S FG+    +PGFS  ++L +ALSNTRTDG GALYRE
Sbjct  154  CNYWRNHPAIIWGILGWWG-TLGSAFGVTGTTVPGFSPGLSLPQALSNTRTDGLGALYRE  212

Query  197  GTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEGH  48
            GTA+ LNSM+   FPYTT QVRD F  A+L+SN+AA AQA+LFK+ANEG 
Sbjct  213  GTASFLNSMVNNKFPYTTNQVRDRF-VASLNSNKAAEAQAQLFKMANEGR  261



>ref|XP_009356648.1| PREDICTED: protodermal factor 1-like [Pyrus x bretschneideri]
Length=284

 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 97/125 (78%), Gaps = 7/125 (6%)
 Frame = -3

Query  401  DPNS-PPFPCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGF-SGSVNLLEALSNTR  228
            DPNS PPF C +W++HPTLIWG++GW GN   S FG+++  +PG  SG ++L +ALSNTR
Sbjct  164  DPNSLPPFTCNYWRSHPTLIWGLLGWWGNLGHS-FGVSS--LPGIGSGIMSLPQALSNTR  220

Query  227  TDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEGH  48
            TDG G LYR+GTAA+LN+M+   F +TT QVRDSF   AL SN+AAA QAR+FKLANEG 
Sbjct  221  TDGLGELYRQGTAALLNAMVDNRFHFTTNQVRDSF-VRALGSNKAAATQARVFKLANEGK  279

Query  47   -RPKA  36
             +P+A
Sbjct  280  LKPRA  284



>ref|XP_008456355.1| PREDICTED: protodermal factor 1-like [Cucumis melo]
Length=237

 Score =   113 bits (282),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 87/117 (74%), Gaps = 5/117 (4%)
 Frame = -3

Query  383  FPCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTDGYGALY  204
            F C +W  HP LIWG++GW G T+ + FG  N  +PGF  ++NLL+ALSNTR DGYGAL 
Sbjct  125  FTCNYWLNHPGLIWGVLGWWG-TLGNAFGATN--VPGFGTNLNLLQALSNTRNDGYGALL  181

Query  203  REGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEGH-RPKA  36
            REGTA+ LNS+ +  FPYTT+QVR SF  +ALSSN+AA  QA  FKLANEG  +P+A
Sbjct  182  REGTASYLNSLASNRFPYTTKQVRTSF-VSALSSNKAAGDQANTFKLANEGKIKPRA  237



>gb|ABL86674.1| PDF [Gossypium barbadense]
 gb|AEA50958.1| protodermal factor 1.1 [Gossypium barbadense]
Length=294

 Score =   114 bits (285),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 88/110 (80%), Gaps = 4/110 (4%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTDGYGALYRE  198
            C FW++HPTLIWG++GW G T+ + FG+ N   PG   S++L +ALSNTRTDG GALYRE
Sbjct  184  CDFWRSHPTLIWGLLGWWG-TVGNAFGVTN--APGLGTSMSLPQALSNTRTDGLGALYRE  240

Query  197  GTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEGH  48
            GTA+ LNSM+   FP++T+QVR++F  AAL SN AAAAQARLFKLANEGH
Sbjct  241  GTASFLNSMVNNRFPFSTKQVRETF-VAALGSNSAAAAQARLFKLANEGH  289



>ref|XP_006360063.1| PREDICTED: protodermal factor 1-like, partial [Solanum tuberosum]
Length=347

 Score =   115 bits (287),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 91/122 (75%), Gaps = 4/122 (3%)
 Frame = -3

Query  416  PPTGFDPNSPPFPCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALS  237
            PP  F PNSPPF   +W+ +P LIWG+ GW   T+ S FG+  +  PG   + NLL+ALS
Sbjct  224  PPPLFYPNSPPFSIDYWRTNPALIWGLFGWWA-TVGSAFGVAAS--PGLGSNFNLLQALS  280

Query  236  NTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLAN  57
            NTR+DG G LYREGTA++LNSM+ K +PYTT+QVR+ F  AALSSN+AAAAQA  FKLAN
Sbjct  281  NTRSDGVGELYREGTASLLNSMVNKKYPYTTKQVREKF-VAALSSNKAAAAQAARFKLAN  339

Query  56   EG  51
            EG
Sbjct  340  EG  341



>ref|XP_006411555.1| hypothetical protein EUTSA_v10016927mg [Eutrema salsugineum]
 gb|ESQ53008.1| hypothetical protein EUTSA_v10016927mg [Eutrema salsugineum]
Length=325

 Score =   114 bits (286),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 90/131 (69%), Gaps = 11/131 (8%)
 Frame = -3

Query  422  GTPPTGFDPNSPPFP-----CTFWKAHPTLIWGMVGWNGNTIRSMFGMNN--NNIPGFSG  264
            GTP T F P   PFP     C +W+ HPTLIWG++GW G T+   FG  +  ++IPGF  
Sbjct  193  GTPGTPFLPA--PFPPITGTCDYWRNHPTLIWGLLGWWG-TVGGAFGTVSTPSSIPGFDP  249

Query  263  SVNLLEALSNTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaa  84
             +NLL+ALSNTRTD  GALYREGTA+ LNSM+   FP+TT QVRD F  A LSS +AA  
Sbjct  250  HMNLLQALSNTRTDAIGALYREGTASWLNSMVNHRFPFTTPQVRDHF-VAGLSSTKAATK  308

Query  83   qarLFKLANEG  51
            QA  FKLANEG
Sbjct  309  QAHTFKLANEG  319



>gb|AEA50961.1| protodermal factor 1.1 [Gossypium hirsutum]
Length=294

 Score =   114 bits (284),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 87/110 (79%), Gaps = 4/110 (4%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTDGYGALYRE  198
            C FW+ HPTLIWG++GW G T+ + FG+ N   PG   S++L +ALSNTRTDG GALYRE
Sbjct  184  CDFWRGHPTLIWGLLGWWG-TVGNAFGVTN--APGLGTSMSLPQALSNTRTDGLGALYRE  240

Query  197  GTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEGH  48
            GTA+ LNSM+   FP++T+QVR++F  AAL SN AAAAQARLFKLANEGH
Sbjct  241  GTASFLNSMVNNRFPFSTKQVRETF-VAALGSNSAAAAQARLFKLANEGH  289



>ref|XP_006294534.1| hypothetical protein CARUB_v10023570mg, partial [Capsella rubella]
 gb|EOA27432.1| hypothetical protein CARUB_v10023570mg, partial [Capsella rubella]
Length=340

 Score =   114 bits (286),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 94/139 (68%), Gaps = 17/139 (12%)
 Frame = -3

Query  422  GTPPTGF-DPNSP-------PFP-----CTFWKAHPTLIWGMVGWNGNTIRSMFGM--NN  288
            G+PPT   DP +P       PFP     C +W+ HPTLIWG++GW G T+   FG    +
Sbjct  198  GSPPTPIIDPGTPGTPFLPAPFPPITGTCDYWRNHPTLIWGLLGWWG-TVGGAFGTVSTS  256

Query  287  NNIPGFSGSVNLLEALSNTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraal  108
            ++IPGF   +NLL+ALSN+RTD  GALYREGTA+ LNSM+   FP+TT QVRD F  A L
Sbjct  257  SSIPGFDPHMNLLQALSNSRTDAIGALYREGTASWLNSMVNTRFPFTTPQVRDHF-VAGL  315

Query  107  ssnqaaaaqarLFKLANEG  51
            SSN+AA  QA  FKLANEG
Sbjct  316  SSNKAATKQAHTFKLANEG  334



>ref|XP_009142091.1| PREDICTED: protodermal factor 1-like [Brassica rapa]
Length=278

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 90/138 (65%), Gaps = 16/138 (12%)
 Frame = -3

Query  422  GTPPTGFDPNSPPFP------------CTFWKAHPTLIWGMVGWNGNTIRSMFGM--NNN  285
            G+PPT  DP +P  P            C +W+ HPTLIWG++GW G T+   FG    ++
Sbjct  137  GSPPTPIDPGTPGTPFVPTPFPPITGTCDYWRNHPTLIWGLLGWWG-TVGGAFGTVSTSS  195

Query  284  NIPGFSGSVNLLEALSNTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraals  105
            +IPGF   +NLL+ALSNTRTD  GALYREGTA+ LNSM+   FP TT QVRD F  A LS
Sbjct  196  SIPGFDPHMNLLQALSNTRTDAIGALYREGTASWLNSMVNNKFPLTTPQVRDHF-VAGLS  254

Query  104  snqaaaaqarLFKLANEG  51
            S +AA  QA  FKLANEG
Sbjct  255  STKAATKQAHTFKLANEG  272



>emb|CDY47992.1| BnaA04g24700D [Brassica napus]
Length=287

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 90/138 (65%), Gaps = 16/138 (12%)
 Frame = -3

Query  422  GTPPTGFDPNSPPFP------------CTFWKAHPTLIWGMVGWNGNTIRSMFGM--NNN  285
            G+PPT  DP +P  P            C +W+ HPTLIWG++GW G T+   FG    ++
Sbjct  146  GSPPTPIDPGTPGTPFVPTPFPPITGTCDYWRNHPTLIWGLLGWWG-TVGGAFGTVSTSS  204

Query  284  NIPGFSGSVNLLEALSNTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraals  105
            +IPGF   +NLL+ALSNTRTD  GALYREGTA+ LNSM+   FP TT QVRD F  A LS
Sbjct  205  SIPGFDPHMNLLQALSNTRTDAIGALYREGTASWLNSMVNNKFPLTTPQVRDHF-VAGLS  263

Query  104  snqaaaaqarLFKLANEG  51
            S +AA  QA  FKLANEG
Sbjct  264  STKAATKQAHTFKLANEG  281



>ref|XP_010506127.1| PREDICTED: protodermal factor 1-like [Camelina sativa]
Length=340

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 91/131 (69%), Gaps = 11/131 (8%)
 Frame = -3

Query  422  GTPPTGFDPNSPPFP-----CTFWKAHPTLIWGMVGWNGNTIRSMFGM--NNNNIPGFSG  264
            GTP T F P   PFP     C +W+ HPTLIWG++GW G T+   FG    +++IPGF  
Sbjct  208  GTPGTPFVPA--PFPPITGTCDYWRNHPTLIWGLLGWWG-TVGGAFGTVSTSSSIPGFDP  264

Query  263  SVNLLEALSNTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaa  84
             +NLL+ALSNTR+D  GALYREGTA+ LNSM+   FP+TT QVRD F  A LSSN+AA  
Sbjct  265  HMNLLQALSNTRSDSIGALYREGTASWLNSMVNTRFPFTTPQVRDHF-VAGLSSNKAATK  323

Query  83   qarLFKLANEG  51
            QA  FKLANEG
Sbjct  324  QAHTFKLANEG  334



>emb|CDY14858.1| BnaC04g48550D [Brassica napus]
Length=287

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 90/138 (65%), Gaps = 16/138 (12%)
 Frame = -3

Query  422  GTPPTGFDPNSPPFP------------CTFWKAHPTLIWGMVGWNGNTIRSMFGM--NNN  285
            G+PPT  DP +P  P            C +W+ HPTLIWG++GW G T+   FG    ++
Sbjct  146  GSPPTPIDPGTPGTPFVPTPFPPITGTCDYWRNHPTLIWGLLGWWG-TVGGAFGTVSTSS  204

Query  284  NIPGFSGSVNLLEALSNTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraals  105
            +IPGF   +NLL+ALSNTRTD  GALYREGTA+ LNSM+   FP TT QVRD F  A LS
Sbjct  205  SIPGFDPHMNLLQALSNTRTDAIGALYREGTASWLNSMVNNKFPLTTPQVRDHF-VAGLS  263

Query  104  snqaaaaqarLFKLANEG  51
            S +AA  QA  FKLANEG
Sbjct  264  STKAATKQAHTFKLANEG  281



>ref|XP_007048835.1| Protodermal factor 1.3, putative [Theobroma cacao]
 gb|EOX92992.1| Protodermal factor 1.3, putative [Theobroma cacao]
Length=346

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 92/115 (80%), Gaps = 5/115 (4%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTDGYGALYRE  198
            C FW++HP LIWG++GW G T+ S FG+ +  IPGF  +++L +ALSNT TDG+GALYRE
Sbjct  236  CNFWRSHPALIWGVLGWWG-TLGSAFGVTS--IPGFGTTMSLPQALSNTHTDGFGALYRE  292

Query  197  GTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEGH-RPKA  36
            GTA++LNSM+   F ++T+QVR+SF  AAL SN AAAAQA LFKLANEGH +P+A
Sbjct  293  GTASLLNSMVNNRFSFSTKQVRESF-VAALGSNSAAAAQAHLFKLANEGHLKPRA  346



>ref|XP_007141386.1| hypothetical protein PHAVU_008G190900g [Phaseolus vulgaris]
 gb|ESW13380.1| hypothetical protein PHAVU_008G190900g [Phaseolus vulgaris]
Length=439

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 89/115 (77%), Gaps = 5/115 (4%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTDGYGALYRE  198
            C +W  HP +IWG++GW G T+  +FG++N  +P F  S++L +ALSNTRTDG GALYRE
Sbjct  329  CNYWSTHPGIIWGLLGWWG-TLGHVFGVSN--VPSFGASLSLPQALSNTRTDGLGALYRE  385

Query  197  GTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEGH-RPKA  36
            GTA+ LNS++   FPYTTQQVRDSF  A+L SN+ AAAQA LF++ANEG  +P+A
Sbjct  386  GTASFLNSLVNNRFPYTTQQVRDSF-VASLRSNKDAAAQANLFRMANEGRMKPRA  439



>ref|XP_007141385.1| hypothetical protein PHAVU_008G190900g [Phaseolus vulgaris]
 gb|ESW13379.1| hypothetical protein PHAVU_008G190900g [Phaseolus vulgaris]
Length=347

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 89/115 (77%), Gaps = 5/115 (4%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTDGYGALYRE  198
            C +W  HP +IWG++GW G T+  +FG++N  +P F  S++L +ALSNTRTDG GALYRE
Sbjct  237  CNYWSTHPGIIWGLLGWWG-TLGHVFGVSN--VPSFGASLSLPQALSNTRTDGLGALYRE  293

Query  197  GTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEGH-RPKA  36
            GTA+ LNS++   FPYTTQQVRDSF  A+L SN+ AAAQA LF++ANEG  +P+A
Sbjct  294  GTASFLNSLVNNRFPYTTQQVRDSF-VASLRSNKDAAAQANLFRMANEGRMKPRA  347



>ref|XP_010508517.1| PREDICTED: protodermal factor 1 [Camelina sativa]
Length=462

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 91/131 (69%), Gaps = 11/131 (8%)
 Frame = -3

Query  422  GTPPTGFDPNSPPFP-----CTFWKAHPTLIWGMVGWNGNTIRSMFGM--NNNNIPGFSG  264
            GTP T F P   PFP     C +W+ HPTLIWG++GW G T+   FG    +++IPGF  
Sbjct  330  GTPGTPFVPA--PFPPITGTCDYWRNHPTLIWGLLGWWG-TVGGAFGTVSTSSSIPGFDP  386

Query  263  SVNLLEALSNTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaa  84
             +NLL+ALSNTR+D  GALYREGTA+ LNSM+   FP+TT QVRD F  A LSSN+AA  
Sbjct  387  HMNLLQALSNTRSDSIGALYREGTASWLNSMVNTRFPFTTSQVRDHF-VAGLSSNKAATK  445

Query  83   qarLFKLANEG  51
            QA  FKLANEG
Sbjct  446  QAHTFKLANEG  456



>ref|XP_007146358.1| hypothetical protein PHAVU_006G033900g [Phaseolus vulgaris]
 gb|ESW18352.1| hypothetical protein PHAVU_006G033900g [Phaseolus vulgaris]
Length=262

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 90/114 (79%), Gaps = 5/114 (4%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTDGYGALYRE  198
            C +W+ HP +IWG++GW G T+ S FG+++  +PGFS  ++L +ALSNTR+DG GALYRE
Sbjct  152  CNYWRNHPAIIWGILGWWG-TLGSAFGVSS--VPGFSPGLSLPQALSNTRSDGIGALYRE  208

Query  197  GTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEGH-RPK  39
            GTA+ LNSM+   FPYTT QVRD F  A+LSSN+AA AQA+LFK+ANEG  +PK
Sbjct  209  GTASFLNSMVNSKFPYTTNQVRDRF-VASLSSNKAAQAQAQLFKMANEGRMKPK  261



>ref|XP_007146359.1| hypothetical protein PHAVU_006G033900g [Phaseolus vulgaris]
 gb|ESW18353.1| hypothetical protein PHAVU_006G033900g [Phaseolus vulgaris]
Length=268

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 90/114 (79%), Gaps = 5/114 (4%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTDGYGALYRE  198
            C +W+ HP +IWG++GW G T+ S FG+++  +PGFS  ++L +ALSNTR+DG GALYRE
Sbjct  158  CNYWRNHPAIIWGILGWWG-TLGSAFGVSS--VPGFSPGLSLPQALSNTRSDGIGALYRE  214

Query  197  GTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEGH-RPK  39
            GTA+ LNSM+   FPYTT QVRD F  A+LSSN+AA AQA+LFK+ANEG  +PK
Sbjct  215  GTASFLNSMVNSKFPYTTNQVRDRF-VASLSSNKAAQAQAQLFKMANEGRMKPK  267



>gb|KFK37128.1| protodermal factor [Arabis alpina]
Length=312

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 81/112 (72%), Gaps = 4/112 (4%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNN--IPGFSGSVNLLEALSNTRTDGYGALY  204
            C +W+ HPTLIWG++GW G T+   FG  + +  IPGF   +NLL+ALSNTRTD  G+LY
Sbjct  198  CDYWRNHPTLIWGLLGWWG-TVGGAFGTVSTSSIIPGFDPHMNLLQALSNTRTDAIGSLY  256

Query  203  REGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEGH  48
            REGTA+ LNSM+   FP+TT QVRD F  A LSS +AA  QA  FKLANEGH
Sbjct  257  REGTASWLNSMVNTRFPFTTPQVRDHF-VAGLSSTKAATKQAHTFKLANEGH  307



>ref|XP_010273406.1| PREDICTED: protodermal factor 1 [Nelumbo nucifera]
Length=272

 Score =   111 bits (278),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 91/120 (76%), Gaps = 5/120 (4%)
 Frame = -3

Query  404  FDPNSP-PF-PCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNT  231
            FDPN+P PF  C++W +HP LIWG+ GW G T+  +FG     +  FS S+ L +AL+NT
Sbjct  150  FDPNTPSPFGTCSYWGSHPGLIWGLFGWWG-TVAGIFGAACTPMI-FSPSLTLHQALTNT  207

Query  230  RTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEG  51
            RTDG+GALYREGTA++LNSM+ + FP+TTQQ++D F  A++ S + AAAQA++FK ANEG
Sbjct  208  RTDGFGALYREGTASLLNSMVNRGFPFTTQQIKDRFA-ASVVSEKTAAAQAQIFKQANEG  266



>ref|XP_010517829.1| PREDICTED: protodermal factor 1-like [Camelina sativa]
Length=341

 Score =   112 bits (280),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 91/131 (69%), Gaps = 11/131 (8%)
 Frame = -3

Query  422  GTPPTGFDPNSPPFP-----CTFWKAHPTLIWGMVGWNGNTIRSMFGM--NNNNIPGFSG  264
            GTP T F P   PFP     C +W+ HPTLIWG++GW G T+   FG    +++IPGF  
Sbjct  209  GTPGTPFVPA--PFPPITGTCDYWRNHPTLIWGLLGWWG-TVGGAFGTVSTSSSIPGFDP  265

Query  263  SVNLLEALSNTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaa  84
             +NLL+ALSNTR+D  GALYREGTA+ LNS++   FP+TT QVRD F  A LSSN+AA  
Sbjct  266  HMNLLQALSNTRSDSIGALYREGTASWLNSVVNTRFPFTTPQVRDHF-VAGLSSNKAATK  324

Query  83   qarLFKLANEG  51
            QA  FKLANEG
Sbjct  325  QAHTFKLANEG  335



>ref|XP_009377653.1| PREDICTED: protodermal factor 1-like [Pyrus x bretschneideri]
Length=294

 Score =   111 bits (278),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 101/131 (77%), Gaps = 7/131 (5%)
 Frame = -3

Query  419  TPPTGFDPNS-PPFPCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGF-SGSVNLLE  246
            +PP    PNS PPF C +W +HPTLIWG++GW G T+ + FG+++  +PG  SG+++L +
Sbjct  168  SPPFLPGPNSLPPFTCNYWGSHPTLIWGLLGWWG-TLGNSFGVSS--LPGIGSGTMSLPQ  224

Query  245  ALSNTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFK  66
            ALSNTRTDG G LYR+GTAA+LN+M+   F +TT QVRDSF  +AL SN+AAA QAR+FK
Sbjct  225  ALSNTRTDGLGELYRQGTAALLNAMVDNRFHFTTNQVRDSF-VSALGSNKAAATQARVFK  283

Query  65   LANEGH-RPKA  36
            LANEG  +P+A
Sbjct  284  LANEGKLKPRA  294



>ref|XP_008342372.1| PREDICTED: protodermal factor 1 [Malus domestica]
Length=294

 Score =   111 bits (278),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 101/131 (77%), Gaps = 7/131 (5%)
 Frame = -3

Query  419  TPPTGFDPNS-PPFPCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGF-SGSVNLLE  246
            +PP    PNS PPF C +W +HPTLIWG++GW G T+ + FG+++  +PG  SG+++L +
Sbjct  168  SPPFLPGPNSLPPFTCNYWGSHPTLIWGLLGWWG-TLGNSFGVSS--LPGIGSGTMSLPQ  224

Query  245  ALSNTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFK  66
            ALSNTRTDG G LYR+GTAA+LN+M+   F +TT QVRDSF  +AL SN+AAA QAR+FK
Sbjct  225  ALSNTRTDGLGELYRQGTAALLNAMVDNRFHFTTNQVRDSF-VSALGSNKAAATQARVFK  283

Query  65   LANEGH-RPKA  36
            LANEG  +P+A
Sbjct  284  LANEGKLKPRA  294



>ref|XP_010272672.1| PREDICTED: protodermal factor 1-like [Nelumbo nucifera]
Length=241

 Score =   110 bits (274),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 84/115 (73%), Gaps = 8/115 (7%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTDGYGALYRE  198
            C +W  HP LIWG+ GW G T+  +FG      P F  S+ L +AL+NTRTDGY ALYRE
Sbjct  134  CNYWATHPQLIWGLFGWWG-TVAGIFG-----TPTFGTSLTLPQALTNTRTDGYSALYRE  187

Query  197  GTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEGH-RPKA  36
            GTA++LNSM+ K FP+TTQQV+D F  A++ S ++AA QA++FK ANEGH +P+A
Sbjct  188  GTASLLNSMVNKRFPFTTQQVKDHFA-ASVVSERSAADQAKIFKQANEGHLKPRA  241



>ref|XP_003518516.1| PREDICTED: leucine-rich repeat extensin-like protein 5-like isoform 
X1 [Glycine max]
Length=571

 Score =   112 bits (281),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 88/115 (77%), Gaps = 5/115 (4%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTDGYGALYRE  198
            C +W  HP +IWG++GW G T+   FG+++  IPGF  S +L +ALSNTRTDG GALYRE
Sbjct  461  CNYWNTHPGIIWGLLGWWG-TLGHAFGVSS--IPGFGASRSLPQALSNTRTDGLGALYRE  517

Query  197  GTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEGH-RPKA  36
            GTA+ LNS++   FPYTTQQVRD F  A+L+SN AAAAQA LFK+ANEG  +P+A
Sbjct  518  GTASFLNSLVNNRFPYTTQQVRDRF-VASLASNNAAAAQANLFKMANEGRMKPRA  571



>ref|XP_006575665.1| PREDICTED: leucine-rich repeat extensin-like protein 5-like isoform 
X2 [Glycine max]
 gb|KHN38310.1| Sialidase [Glycine soja]
Length=519

 Score =   112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 88/115 (77%), Gaps = 5/115 (4%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTDGYGALYRE  198
            C +W  HP +IWG++GW G T+   FG+++  IPGF  S +L +ALSNTRTDG GALYRE
Sbjct  409  CNYWNTHPGIIWGLLGWWG-TLGHAFGVSS--IPGFGASRSLPQALSNTRTDGLGALYRE  465

Query  197  GTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEGH-RPKA  36
            GTA+ LNS++   FPYTTQQVRD F  A+L+SN AAAAQA LFK+ANEG  +P+A
Sbjct  466  GTASFLNSLVNNRFPYTTQQVRDRF-VASLASNNAAAAQANLFKMANEGRMKPRA  519



>gb|AFK43320.1| unknown [Medicago truncatula]
Length=272

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 83/109 (76%), Gaps = 4/109 (4%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTDGYGALYRE  198
            C +W+ HP +IWG++GW GN + + FG+ N  IPGFS  + L +ALSNTRTDG GALYRE
Sbjct  162  CNYWRTHPGIIWGILGWWGN-MGNAFGVTN--IPGFSPGLTLPQALSNTRTDGLGALYRE  218

Query  197  GTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEG  51
            GTA+ LNS++   FPYTT QV+D F  ++L SN+AAA QA LFK+ANEG
Sbjct  219  GTASFLNSLVNNKFPYTTDQVKDRFA-SSLHSNKAAATQAHLFKMANEG  266



>ref|XP_010525366.1| PREDICTED: protodermal factor 1 [Tarenaya hassleriana]
Length=292

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 90/135 (67%), Gaps = 12/135 (9%)
 Frame = -3

Query  422  GTPPTGFDPNSPPFP-----CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSV  258
            GTP T F P   P P     C +W+ HPTLIWG++GW                PGFS ++
Sbjct  164  GTPGTPFYPA--PLPPITGTCDYWRNHPTLIWGLLGW---WGTVGGVFGGTTAPGFSSNM  218

Query  257  NLLEALSNTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqa  78
            NLL+ALSN  TDGYGALYREGTA+ LNSM+   FP+TT QVRD+F   ALSSN+AAA QA
Sbjct  219  NLLQALSNAHTDGYGALYREGTASWLNSMVNNRFPFTTTQVRDNF-VRALSSNKAAATQA  277

Query  77   rLFKLANEGH-RPKA  36
              FKLANEGH +P++
Sbjct  278  HTFKLANEGHLKPRS  292



>ref|XP_009395219.1| PREDICTED: protodermal factor 1-like [Musa acuminata subsp. malaccensis]
Length=253

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 90/125 (72%), Gaps = 4/125 (3%)
 Frame = -3

Query  422  GTPPTGFDPNSPPFPCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEA  243
             TP   FDPN+ PF C +W+ H   IWG++G+ G T+  +FG        F  S++L EA
Sbjct  130  ATPLLPFDPNTFPFTCDYWRTHSAAIWGLIGYWG-TVSQLFGPPAAA--AFGRSLSLPEA  186

Query  242  LSNTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKL  63
            L+NTR DG GALYREGTA++LNS+  K+F ++TQQVRD+F  AA+ S++AAAAQAR+FK 
Sbjct  187  LANTRADGIGALYREGTASLLNSLANKSFVFSTQQVRDAFN-AAVVSDKAAAAQARVFKK  245

Query  62   ANEGH  48
            ANEGH
Sbjct  246  ANEGH  250



>ref|XP_003602116.1| hypothetical protein MTR_3g089570 [Medicago truncatula]
 ref|XP_003636551.1| hypothetical protein MTR_045s0046 [Medicago truncatula]
 gb|AES72367.1| pollen Ole e I family allergen [Medicago truncatula]
Length=272

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 83/109 (76%), Gaps = 4/109 (4%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTDGYGALYRE  198
            C +W+ HP +IWG++GW GN + + FG+ N  IPGFS  + L +ALSNTRTDG GALYRE
Sbjct  162  CNYWRTHPGIIWGILGWWGN-MGNAFGVTN--IPGFSPGLTLPQALSNTRTDGLGALYRE  218

Query  197  GTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEG  51
            GTA+ LNS++   FPYTT QV+D F  ++L SN+AAA QA LFK+ANEG
Sbjct  219  GTASFLNSLVNNKFPYTTDQVKDRFA-SSLHSNKAAATQAHLFKMANEG  266



>ref|XP_004171602.1| PREDICTED: uncharacterized protein LOC101225955, partial [Cucumis 
sativus]
Length=158

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 96/132 (73%), Gaps = 11/132 (8%)
 Frame = -3

Query  422  GTPPTGF------DPNSP-PFPCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSG  264
            GTPPT        DPNSP    C +W+ HP +IWG++GW G T+ S FG+ N   PGF  
Sbjct  26   GTPPTTSAPPFVPDPNSPFTGTCNYWRTHPGIIWGLLGWWG-TMGSAFGITN--APGFGA  82

Query  263  SVNLLEALSNTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaa  84
            +++L +ALSNTRTDG G+LYREG AA LNSM+   +P+TT QVR+SF  +ALSSN+AAAA
Sbjct  83   TLSLPQALSNTRTDGLGSLYREGAAAFLNSMVNNRYPFTTNQVRESF-VSALSSNKAAAA  141

Query  83   qarLFKLANEGH  48
            QA++F++ANEG 
Sbjct  142  QAQVFQMANEGR  153



>ref|NP_181812.1| protodermal factor 1 [Arabidopsis thaliana]
 sp|Q9S728.1|PDF1_ARATH RecName: Full=Protodermal factor 1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAD33868.1|AF141375_1 protodermal factor 1 [Arabidopsis thaliana]
 gb|AAD33869.1|AF141376_1 protodermal factor 1 [Arabidopsis thaliana]
 gb|AAD21725.1| En/Spm-like transposon protein [Arabidopsis thaliana]
 gb|AAM65640.1| En/Spm-like transposon protein [Arabidopsis thaliana]
 gb|ABD59119.1| At2g42840 [Arabidopsis thaliana]
 gb|AEC10176.1| protodermal factor 1 [Arabidopsis thaliana]
Length=306

 Score =   108 bits (270),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 82/112 (73%), Gaps = 4/112 (4%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNN--NNIPGFSGSVNLLEALSNTRTDGYGALY  204
            C +W+ HPTLIWG++GW G T+   FG  +  ++IPGF   +NLL+ALSNTR+D  GALY
Sbjct  192  CDYWRNHPTLIWGLLGWWG-TVGGAFGTVSIPSSIPGFDPHMNLLQALSNTRSDPIGALY  250

Query  203  REGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEGH  48
            REGTA+ LNSM+   FP+TT QVRD F  A LSSN+AA  QA  FKLANEG 
Sbjct  251  REGTASWLNSMVNHKFPFTTPQVRDHF-VAGLSSNKAATKQAHTFKLANEGR  301



>ref|XP_009415185.1| PREDICTED: protodermal factor 1-like [Musa acuminata subsp. malaccensis]
Length=174

 Score =   105 bits (262),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 87/124 (70%), Gaps = 4/124 (3%)
 Frame = -3

Query  419  TPPTGFDPNSPPFPCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEAL  240
             PP   +PNS PF C +W+AHP  I  ++G+   T+   FG+    +  F    +LLEAL
Sbjct  51   VPPAPTNPNSSPFSCDYWRAHPEAILALLGY-WCTLGEFFGLPA--VSAFGRDPSLLEAL  107

Query  239  SNTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLA  60
            SNTR+DG GALYREGTA++LNS++ +NF  TTQ+VR+ F  AA+ S++AAA QA+LFK A
Sbjct  108  SNTRSDGIGALYREGTASLLNSLVNRNFALTTQKVREEFN-AAVISDKAAATQAQLFKKA  166

Query  59   NEGH  48
            NEGH
Sbjct  167  NEGH  170



>ref|XP_008449530.1| PREDICTED: protodermal factor 1-like isoform X11 [Cucumis melo]
Length=342

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 96/131 (73%), Gaps = 11/131 (8%)
 Frame = -3

Query  422  GTPPTGF------DPNSP-PFPCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSG  264
            GTPPT        DPNSP    C +W+ HP +IWG++GW G T+ S FG+ N   PGF  
Sbjct  210  GTPPTTSAPPFVPDPNSPFTGTCNYWRTHPGIIWGLLGWWG-TMGSAFGITN--APGFGA  266

Query  263  SVNLLEALSNTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaa  84
            +++L +ALSNTRTDG GALYREG AA LNSM+   +P+TT QVR+SF  +ALSSN+AAAA
Sbjct  267  TLSLPQALSNTRTDGLGALYREGAAAFLNSMVNNRYPFTTNQVRESF-VSALSSNKAAAA  325

Query  83   qarLFKLANEG  51
            QA++F++ANEG
Sbjct  326  QAQVFQMANEG  336



>ref|XP_008449524.1| PREDICTED: protodermal factor 1-like isoform X5 [Cucumis melo]
Length=391

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 97/132 (73%), Gaps = 13/132 (10%)
 Frame = -3

Query  422  GTPPTGF------DPNSPPFP--CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFS  267
            GTPPT        DPNSP F   C +W+ HP +IWG++GW G T+ S FG+ N   PGF 
Sbjct  259  GTPPTTSAPPFVPDPNSP-FTGTCNYWRTHPGIIWGLLGWWG-TMGSAFGITN--APGFG  314

Query  266  GSVNLLEALSNTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaa  87
             +++L +ALSNTRTDG GALYREG AA LNSM+   +P+TT QVR+SF  +ALSSN+AAA
Sbjct  315  ATLSLPQALSNTRTDGLGALYREGAAAFLNSMVNNRYPFTTNQVRESF-VSALSSNKAAA  373

Query  86   aqarLFKLANEG  51
            AQA++F++ANEG
Sbjct  374  AQAQVFQMANEG  385



>ref|XP_008449526.1| PREDICTED: protodermal factor 1-like isoform X7 [Cucumis melo]
Length=390

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 97/132 (73%), Gaps = 13/132 (10%)
 Frame = -3

Query  422  GTPPTGF------DPNSPPFP--CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFS  267
            GTPPT        DPNSP F   C +W+ HP +IWG++GW G T+ S FG+ N   PGF 
Sbjct  258  GTPPTTSAPPFVPDPNSP-FTGTCNYWRTHPGIIWGLLGWWG-TMGSAFGITN--APGFG  313

Query  266  GSVNLLEALSNTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaa  87
             +++L +ALSNTRTDG GALYREG AA LNSM+   +P+TT QVR+SF  +ALSSN+AAA
Sbjct  314  ATLSLPQALSNTRTDGLGALYREGAAAFLNSMVNNRYPFTTNQVRESF-VSALSSNKAAA  372

Query  86   aqarLFKLANEG  51
            AQA++F++ANEG
Sbjct  373  AQAQVFQMANEG  384



>ref|XP_008449528.1| PREDICTED: protodermal factor 1-like isoform X9 [Cucumis melo]
 ref|XP_008449529.1| PREDICTED: protodermal factor 1-like isoform X10 [Cucumis melo]
Length=387

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 97/132 (73%), Gaps = 13/132 (10%)
 Frame = -3

Query  422  GTPPTGF------DPNSPPFP--CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFS  267
            GTPPT        DPNSP F   C +W+ HP +IWG++GW G T+ S FG+ N   PGF 
Sbjct  255  GTPPTTSAPPFVPDPNSP-FTGTCNYWRTHPGIIWGLLGWWG-TMGSAFGITN--APGFG  310

Query  266  GSVNLLEALSNTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaa  87
             +++L +ALSNTRTDG GALYREG AA LNSM+   +P+TT QVR+SF  +ALSSN+AAA
Sbjct  311  ATLSLPQALSNTRTDGLGALYREGAAAFLNSMVNNRYPFTTNQVRESF-VSALSSNKAAA  369

Query  86   aqarLFKLANEG  51
            AQA++F++ANEG
Sbjct  370  AQAQVFQMANEG  381



>ref|XP_008449527.1| PREDICTED: protodermal factor 1-like isoform X8 [Cucumis melo]
Length=388

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 97/132 (73%), Gaps = 13/132 (10%)
 Frame = -3

Query  422  GTPPTGF------DPNSPPFP--CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFS  267
            GTPPT        DPNSP F   C +W+ HP +IWG++GW G T+ S FG+ N   PGF 
Sbjct  256  GTPPTTSAPPFVPDPNSP-FTGTCNYWRTHPGIIWGLLGWWG-TMGSAFGITN--APGFG  311

Query  266  GSVNLLEALSNTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaa  87
             +++L +ALSNTRTDG GALYREG AA LNSM+   +P+TT QVR+SF  +ALSSN+AAA
Sbjct  312  ATLSLPQALSNTRTDGLGALYREGAAAFLNSMVNNRYPFTTNQVRESF-VSALSSNKAAA  370

Query  86   aqarLFKLANEG  51
            AQA++F++ANEG
Sbjct  371  AQAQVFQMANEG  382



>ref|XP_008449525.1| PREDICTED: protodermal factor 1-like isoform X6 [Cucumis melo]
Length=390

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 97/132 (73%), Gaps = 13/132 (10%)
 Frame = -3

Query  422  GTPPTGF------DPNSPPFP--CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFS  267
            GTPPT        DPNSP F   C +W+ HP +IWG++GW G T+ S FG+ N   PGF 
Sbjct  258  GTPPTTSAPPFVPDPNSP-FTGTCNYWRTHPGIIWGLLGWWG-TMGSAFGITN--APGFG  313

Query  266  GSVNLLEALSNTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaa  87
             +++L +ALSNTRTDG GALYREG AA LNSM+   +P+TT QVR+SF  +ALSSN+AAA
Sbjct  314  ATLSLPQALSNTRTDGLGALYREGAAAFLNSMVNNRYPFTTNQVRESF-VSALSSNKAAA  372

Query  86   aqarLFKLANEG  51
            AQA++F++ANEG
Sbjct  373  AQAQVFQMANEG  384



>ref|XP_008449522.1| PREDICTED: protodermal factor 1-like isoform X3 [Cucumis melo]
Length=395

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 97/132 (73%), Gaps = 13/132 (10%)
 Frame = -3

Query  422  GTPPTGF------DPNSPPFP--CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFS  267
            GTPPT        DPNSP F   C +W+ HP +IWG++GW G T+ S FG+ N   PGF 
Sbjct  263  GTPPTTSAPPFVPDPNSP-FTGTCNYWRTHPGIIWGLLGWWG-TMGSAFGITN--APGFG  318

Query  266  GSVNLLEALSNTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaa  87
             +++L +ALSNTRTDG GALYREG AA LNSM+   +P+TT QVR+SF  +ALSSN+AAA
Sbjct  319  ATLSLPQALSNTRTDGLGALYREGAAAFLNSMVNNRYPFTTNQVRESF-VSALSSNKAAA  377

Query  86   aqarLFKLANEG  51
            AQA++F++ANEG
Sbjct  378  AQAQVFQMANEG  389



>ref|XP_008449520.1| PREDICTED: protodermal factor 1-like isoform X2 [Cucumis melo]
Length=400

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 97/132 (73%), Gaps = 13/132 (10%)
 Frame = -3

Query  422  GTPPTGF------DPNSPPFP--CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFS  267
            GTPPT        DPNSP F   C +W+ HP +IWG++GW G T+ S FG+ N   PGF 
Sbjct  268  GTPPTTSAPPFVPDPNSP-FTGTCNYWRTHPGIIWGLLGWWG-TMGSAFGITN--APGFG  323

Query  266  GSVNLLEALSNTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaa  87
             +++L +ALSNTRTDG GALYREG AA LNSM+   +P+TT QVR+SF  +ALSSN+AAA
Sbjct  324  ATLSLPQALSNTRTDGLGALYREGAAAFLNSMVNNRYPFTTNQVRESF-VSALSSNKAAA  382

Query  86   aqarLFKLANEG  51
            AQA++F++ANEG
Sbjct  383  AQAQVFQMANEG  394



>ref|XP_008449519.1| PREDICTED: protodermal factor 1-like isoform X1 [Cucumis melo]
Length=405

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 97/132 (73%), Gaps = 13/132 (10%)
 Frame = -3

Query  422  GTPPTGF------DPNSPPFP--CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFS  267
            GTPPT        DPNSP F   C +W+ HP +IWG++GW G T+ S FG+ N   PGF 
Sbjct  273  GTPPTTSAPPFVPDPNSP-FTGTCNYWRTHPGIIWGLLGWWG-TMGSAFGITN--APGFG  328

Query  266  GSVNLLEALSNTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaa  87
             +++L +ALSNTRTDG GALYREG AA LNSM+   +P+TT QVR+SF  +ALSSN+AAA
Sbjct  329  ATLSLPQALSNTRTDGLGALYREGAAAFLNSMVNNRYPFTTNQVRESF-VSALSSNKAAA  387

Query  86   aqarLFKLANEG  51
            AQA++F++ANEG
Sbjct  388  AQAQVFQMANEG  399



>ref|XP_008449523.1| PREDICTED: protodermal factor 1-like isoform X4 [Cucumis melo]
Length=395

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 97/132 (73%), Gaps = 13/132 (10%)
 Frame = -3

Query  422  GTPPTGF------DPNSPPFP--CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFS  267
            GTPPT        DPNSP F   C +W+ HP +IWG++GW G T+ S FG+ N   PGF 
Sbjct  263  GTPPTTSAPPFVPDPNSP-FTGTCNYWRTHPGIIWGLLGWWG-TMGSAFGITN--APGFG  318

Query  266  GSVNLLEALSNTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaa  87
             +++L +ALSNTRTDG GALYREG AA LNSM+   +P+TT QVR+SF  +ALSSN+AAA
Sbjct  319  ATLSLPQALSNTRTDGLGALYREGAAAFLNSMVNNRYPFTTNQVRESF-VSALSSNKAAA  377

Query  86   aqarLFKLANEG  51
            AQA++F++ANEG
Sbjct  378  AQAQVFQMANEG  389



>ref|XP_004513725.1| PREDICTED: protodermal factor 1-like [Cicer arietinum]
Length=284

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 83/109 (76%), Gaps = 3/109 (3%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTDGYGALYRE  198
            C +W++HP +IWG++GW G T  + FG+ N+ +PGFS  + L +ALSNTRTDG G LYRE
Sbjct  173  CNYWRSHPGIIWGILGWWG-TTGNAFGITNS-VPGFSPGLTLPQALSNTRTDGLGELYRE  230

Query  197  GTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEG  51
            GTA+ LNS++   FPYTT QVR+ F  ++L SN+AAA QA LFK+ANEG
Sbjct  231  GTASFLNSLVNHKFPYTTDQVRERFA-SSLHSNKAAATQAHLFKMANEG  278



>ref|XP_004243231.1| PREDICTED: protodermal factor 1 [Solanum lycopersicum]
Length=258

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 88/115 (77%), Gaps = 5/115 (4%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTDGYGALYRE  198
            C +W+ HP LIWG+ GW GN + S FG+ +   PG   ++NLL+ALSN  TDG+G LYRE
Sbjct  148  CDYWRTHPGLIWGLFGWWGN-VGSAFGVAS--APGLGSNMNLLQALSNQHTDGFGQLYRE  204

Query  197  GTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEGH-RPKA  36
            GTA++LNSM++K F Y+T QV+++F   ALSS+ AAAAQA+LFKLAN+G  +P+A
Sbjct  205  GTASLLNSMVSKRFSYSTTQVKNNFA-TALSSDGAAAAQAQLFKLANQGRLKPRA  258



>ref|XP_010102174.1| hypothetical protein L484_021408 [Morus notabilis]
 gb|EXB92424.1| hypothetical protein L484_021408 [Morus notabilis]
Length=272

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 90/118 (76%), Gaps = 5/118 (4%)
 Frame = -3

Query  395  NSPPFPCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTDGY  216
            NSPPF CT+W+ HP LI+G++GW G T+ + FG+    +PG   +++L +ALSNTRTDGY
Sbjct  159  NSPPFTCTYWRNHPQLIFGVLGWWG-TLGNAFGVPT--VPGLGSNISLKDALSNTRTDGY  215

Query  215  GALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEG-HR  45
            G L R+ TA++LNSM+   F +TT+QVR++F  AAL SN+AAA QA LFKLAN+G HR
Sbjct  216  GELCRQATASLLNSMIDNRFAFTTKQVRENF-IAALGSNKAAAHQASLFKLANQGNHR  272



>ref|XP_006348944.1| PREDICTED: protodermal factor 1-like [Solanum tuberosum]
Length=253

 Score =   104 bits (260),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 87/115 (76%), Gaps = 5/115 (4%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTDGYGALYRE  198
            C +W+ HP LIWG+ GW G T+   FG+ +   PG   ++NLL+ALSN  TDG G LYRE
Sbjct  143  CDYWRTHPGLIWGLFGWWG-TVGGAFGVAS--APGLGSNMNLLQALSNQHTDGLGQLYRE  199

Query  197  GTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEGH-RPKA  36
            GTA++LNSM++K F Y+T QV+++F   ALSS++AAA+QA+LFKLANEG  +P+A
Sbjct  200  GTASLLNSMVSKRFSYSTTQVKNNFA-TALSSDEAAASQAQLFKLANEGQLKPRA  253



>ref|XP_004140248.1| PREDICTED: uncharacterized protein LOC101219879 [Cucumis sativus]
Length=468

 Score =   107 bits (266),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 97/132 (73%), Gaps = 13/132 (10%)
 Frame = -3

Query  422  GTPPTGF------DPNSPPFP--CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFS  267
            GTPPT        DPNSP F   C +W+ HP +IWG++GW G T+ S FG+ N   PGF 
Sbjct  336  GTPPTTSAPPFVPDPNSP-FTGTCNYWRTHPGIIWGLLGWWG-TMGSAFGITN--APGFG  391

Query  266  GSVNLLEALSNTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaa  87
             +++L +ALSNTRTDG G+LYREG AA LNSM+   +P+TT QVR+SF  +ALSSN+AAA
Sbjct  392  ATLSLPQALSNTRTDGLGSLYREGAAAFLNSMVNNRYPFTTNQVRESF-VSALSSNKAAA  450

Query  86   aqarLFKLANEG  51
            AQA++F++ANEG
Sbjct  451  AQAQVFQMANEG  462



>gb|EEE55322.1| hypothetical protein OsJ_03322 [Oryza sativa Japonica Group]
Length=650

 Score =   108 bits (269),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 85/127 (67%), Gaps = 4/127 (3%)
 Frame = -3

Query  425  SGTPPTGFDPNSPPFPCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLE  246
            S T P  FDPN+ PFPC++W +HP +IWG+ G+     R +FG        F   + + E
Sbjct  524  SSTTPMPFDPNTAPFPCSYWLSHPGVIWGLFGFWCPMAR-LFGPTAAAP--FGHDLTVPE  580

Query  245  ALSNTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnq-aaaaqarLF  69
            AL+NTR DG G LYREGTA++LNSM+   FP+TTQQV+D+F  A  S    AAAAQA+LF
Sbjct  581  ALANTRADGVGELYREGTASLLNSMVNSRFPFTTQQVKDAFSAALSSGGDHAAAAQAQLF  640

Query  68   KLANEGH  48
            K ANEGH
Sbjct  641  KKANEGH  647



>ref|NP_001044120.1| Os01g0726700 [Oryza sativa Japonica Group]
 dbj|BAF06034.1| Os01g0726700 [Oryza sativa Japonica Group]
Length=662

 Score =   107 bits (268),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 85/127 (67%), Gaps = 4/127 (3%)
 Frame = -3

Query  425  SGTPPTGFDPNSPPFPCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLE  246
            S T P  FDPN+ PFPC++W +HP +IWG+ G+     R +FG        F   + + E
Sbjct  536  SSTTPMPFDPNTAPFPCSYWLSHPGVIWGLFGFWCPMAR-LFGPTAAAP--FGHDLTVPE  592

Query  245  ALSNTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnq-aaaaqarLF  69
            AL+NTR DG G LYREGTA++LNSM+   FP+TTQQV+D+F  A  S    AAAAQA+LF
Sbjct  593  ALANTRADGVGELYREGTASLLNSMVNSRFPFTTQQVKDAFSAALSSGGDHAAAAQAQLF  652

Query  68   KLANEGH  48
            K ANEGH
Sbjct  653  KKANEGH  659



>gb|EEC71412.1| hypothetical protein OsI_03588 [Oryza sativa Indica Group]
Length=625

 Score =   107 bits (268),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 82/120 (68%), Gaps = 4/120 (3%)
 Frame = -3

Query  404  FDPNSPPFPCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRT  225
            FDPN+ PFPC++W +HP +IWG+ G+     R +FG        F   + + EAL+NTR 
Sbjct  506  FDPNTAPFPCSYWLSHPGVIWGLFGFWCPMAR-LFGPTAAAP--FGHDLTVPEALANTRA  562

Query  224  DGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnq-aaaaqarLFKLANEGH  48
            DG G LYREGTA++LNSM+   FP+TTQQV+D+F  A  S    AAAAQA+LFK ANEGH
Sbjct  563  DGVGELYREGTASLLNSMVNSRFPFTTQQVKDAFSAALSSGGDHAAAAQAQLFKKANEGH  622



>ref|XP_004491347.1| PREDICTED: extensin-like [Cicer arietinum]
Length=504

 Score =   106 bits (265),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 83/110 (75%), Gaps = 4/110 (4%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTDGYGALYRE  198
            C +W  HP +IWG++GW G T+ + F + +  +PGF  S++L +ALSNTRTDG GALYRE
Sbjct  394  CNYWNTHPQIIWGLLGWWG-TLGNAFHVPS--LPGFGSSLSLPQALSNTRTDGLGALYRE  450

Query  197  GTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEGH  48
            G A+ LNS++   FPYTTQQVRD F  A+LSSN+AAA QA LF++ANEG 
Sbjct  451  GAASFLNSLVNNRFPYTTQQVRDRF-VASLSSNKAAATQAHLFRMANEGR  499



>gb|KGN47994.1| hypothetical protein Csa_6G423360 [Cucumis sativus]
Length=520

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 92/119 (77%), Gaps = 7/119 (6%)
 Frame = -3

Query  401  DPNSPPFP--CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTR  228
            DPNSP F   C +W+ HP +IWG++GW G T+ S FG+ N   PGF  +++L +ALSNTR
Sbjct  401  DPNSP-FTGTCNYWRTHPGIIWGLLGWWG-TMGSAFGITN--APGFGATLSLPQALSNTR  456

Query  227  TDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEG  51
            TDG G+LYREG AA LNSM+   +P+TT QVR+SF  +ALSSN+AAAAQA++F++ANEG
Sbjct  457  TDGLGSLYREGAAAFLNSMVNNRYPFTTNQVRESF-VSALSSNKAAAAQAQVFQMANEG  514



>ref|XP_009407017.1| PREDICTED: protodermal factor 1-like [Musa acuminata subsp. malaccensis]
Length=281

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 87/122 (71%), Gaps = 4/122 (3%)
 Frame = -3

Query  413  PTGFDPNSPPFPCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSN  234
            P   DPN+PPF C +W+ HPT IW ++G+    +  +FGM   +   F  + +L+EA+S+
Sbjct  160  PMDPDPNTPPFSCDYWRTHPTAIWALLGF-WCPLSQIFGMPAASF--FGSNPSLVEAMSD  216

Query  233  TRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANE  54
             R+DG GALYREGTA+ LNS++ ++F +TTQQVRD+   AA+ S++ AAAQA LFK AN+
Sbjct  217  ARSDGIGALYREGTASFLNSLVDRDFFFTTQQVRDAVN-AAVVSDEGAAAQAELFKKANK  275

Query  53   GH  48
            GH
Sbjct  276  GH  277



>ref|XP_006646282.1| PREDICTED: extensin-like [Oryza brachyantha]
Length=767

 Score =   105 bits (262),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 84/120 (70%), Gaps = 4/120 (3%)
 Frame = -3

Query  404  FDPNSPPFPCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRT  225
            FDPN+ PFPCT+W +HP +IWG+ G+    +R +FG        F   + + EAL+N RT
Sbjct  648  FDPNTAPFPCTYWLSHPNVIWGLFGFWCPLVR-LFGPTAAAP--FGHDLTVTEALANKRT  704

Query  224  DGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGra-alssnqaaaaqarLFKLANEGH  48
            DG G LYREGTA++LNSM+   F ++TQQV+D+F  A +   ++AAAAQA+LFK ANEGH
Sbjct  705  DGVGELYREGTASLLNSMVNSKFAFSTQQVKDAFSAALSSGDDRAAAAQAQLFKKANEGH  764



>gb|EMS52214.1| hypothetical protein TRIUR3_33602 [Triticum urartu]
Length=529

 Score =   102 bits (255),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 89/122 (73%), Gaps = 7/122 (6%)
 Frame = -3

Query  404  FDPNSPPF---PCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSN  234
            FDPN+PPF   P  +W +HP +IWG+ G+    +R +FG +   +P F   + + EAL+N
Sbjct  407  FDPNTPPFSTGPYGYWMSHPGVIWGLFGYWCPLVR-LFGPSAA-VP-FGHDLTVPEALAN  463

Query  233  TRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGra-alssnqaaaaqarLFKLAN  57
            TR DG GALYREGTA++LNSM++  FP+TT QV+D+FG A +   ++AAAAQA+LFK+AN
Sbjct  464  TRADGVGALYREGTASLLNSMVSSGFPFTTAQVKDAFGAALSSGDDRAAAAQAQLFKMAN  523

Query  56   EG  51
            EG
Sbjct  524  EG  525



>emb|CDM84206.1| unnamed protein product [Triticum aestivum]
Length=586

 Score =   102 bits (255),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 89/122 (73%), Gaps = 7/122 (6%)
 Frame = -3

Query  404  FDPNSPPF---PCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSN  234
            FDPN+PPF   P  +W +HP +IWG+ G+    +R +FG +   +P F   + + EAL+N
Sbjct  464  FDPNTPPFSTGPYGYWMSHPGVIWGLFGYWCPLVR-LFGPSAA-VP-FGHDLTVPEALAN  520

Query  233  TRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGra-alssnqaaaaqarLFKLAN  57
            TR DG GALYREGTA++LNSM++  FP+TT QV+D+FG A +   ++AAAAQA+LFK+AN
Sbjct  521  TRADGVGALYREGTASLLNSMVSSGFPFTTAQVKDAFGAALSSGDDRAAAAQAQLFKMAN  580

Query  56   EG  51
            EG
Sbjct  581  EG  582



>ref|XP_003567069.2| PREDICTED: protodermal factor 1-like [Brachypodium distachyon]
Length=453

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 88/124 (71%), Gaps = 8/124 (6%)
 Frame = -3

Query  404  FDPNSPPF---PCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSN  234
            FDPN+PPF   P ++W +HP +IWG+ G+    +R +FG  +  +P F   + + EAL+N
Sbjct  330  FDPNTPPFSTGPYSYWMSHPGVIWGLFGFWCPLVR-LFG-PSAAVP-FGHDLTVPEALAN  386

Query  233  TRTDGYGALYREGTAAMLNSMMTK-NFPYTTQQVRDSFGra-alssnqaaaaqarLFKLA  60
            TR DG GALYREGTA++LNSM++   FP+TTQQV+D FG A      +AAAAQA+LFK+A
Sbjct  387  TRADGVGALYREGTASLLNSMVSAGGFPFTTQQVKDGFGAALGSGDERAAAAQAQLFKMA  446

Query  59   NEGH  48
            NEG 
Sbjct  447  NEGQ  450



>dbj|BAJ92021.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=579

 Score =   100 bits (248),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 88/123 (72%), Gaps = 7/123 (6%)
 Frame = -3

Query  404  FDPNSPPF---PCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSN  234
            FDPN+PPF   P  +W +HP +IWG+ G+    +R +FG +   +P F   + + EAL+N
Sbjct  457  FDPNTPPFSTGPYGYWMSHPGVIWGLFGYWCPLVR-LFGPSAA-VP-FGHDLTVPEALAN  513

Query  233  TRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGra-alssnqaaaaqarLFKLAN  57
            TR DG GALYREGTA++LNSM+   FP TT QV+D+FG A +   ++AAAAQA+LFK+AN
Sbjct  514  TRADGVGALYREGTASLLNSMVNSEFPLTTTQVKDAFGAALSSGDDRAAAAQAQLFKMAN  573

Query  56   EGH  48
            EG+
Sbjct  574  EGN  576



>ref|XP_010924678.1| PREDICTED: protodermal factor 1-like [Elaeis guineensis]
Length=264

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 80/110 (73%), Gaps = 4/110 (4%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTDGYGALYRE  198
            C +W+ HP  I+G+ G+  N I  +FG+   +  G   +++L EAL+NTR+DG+GAL RE
Sbjct  155  CDYWRTHPAAIFGLFGYWCN-IGQLFGLPATSALG--SNLSLPEALANTRSDGFGALLRE  211

Query  197  GTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEGH  48
            GTA++LNSM+ + FP TTQQVRD+F   A  SN+ AAAQA++FK ANEGH
Sbjct  212  GTASLLNSMVNQRFPLTTQQVRDAFA-DASVSNRDAAAQAQVFKKANEGH  260



>ref|XP_010667972.1| PREDICTED: protodermal factor 1 [Beta vulgaris subsp. vulgaris]
Length=339

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 82/108 (76%), Gaps = 4/108 (4%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTDGYGALYRE  198
            CT+W +HP LI+G++GW   T+  +FG+    +PG + + +L E L+N R DGYG+LYRE
Sbjct  224  CTYWGSHPGLIFGVLGWWA-TVGGIFGVTT--LPGLNSATSLEEMLNNPRNDGYGSLYRE  280

Query  197  GTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANE  54
            GTA+ LNSM TK F  +T+QV+D+F  A+L+S++ AAAQA+LFKLANE
Sbjct  281  GTASFLNSMATKEFSLSTKQVKDAF-LASLTSDRIAAAQAKLFKLANE  327



>ref|NP_001151862.1| DNA-directed RNA polymerase II largest subunit precursor [Zea 
mays]
 gb|ACG44652.1| DNA-directed RNA polymerase II largest subunit [Zea mays]
Length=566

 Score = 96.3 bits (238),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 80/112 (71%), Gaps = 4/112 (4%)
 Frame = -3

Query  380  PCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTDGYGALYR  201
            PCT+W  HP +IWG+ G+    +R +FG  +  +P F   + + EAL+NTR DG GALYR
Sbjct  453  PCTYWMMHPGVIWGLFGFWCPLVR-LFG-PSAAVP-FGHDLTVPEALANTREDGVGALYR  509

Query  200  EGTAAMLNSMMTKNFPYTTQQVRDSFGraa-lssnqaaaaqarLFKLANEGH  48
            EGTA++LNSM+   FP+TTQ+V+D+FG A     + AAAAQARLFK ANEGH
Sbjct  510  EGTASLLNSMVNNRFPFTTQEVKDAFGAALNSGDDGAAAAQARLFKKANEGH  561



>ref|XP_008673135.1| PREDICTED: uncharacterized protein LOC100382457 isoform X1 [Zea 
mays]
Length=564

 Score = 95.9 bits (237),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 80/112 (71%), Gaps = 4/112 (4%)
 Frame = -3

Query  380  PCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTDGYGALYR  201
            PCT+W  HP +IWG+ G+    +R +FG  +  +P F   + + EAL+NTR DG GALYR
Sbjct  451  PCTYWMMHPGVIWGLFGFWCPLVR-LFG-PSAAVP-FGHDLTVPEALANTREDGMGALYR  507

Query  200  EGTAAMLNSMMTKNFPYTTQQVRDSFGraa-lssnqaaaaqarLFKLANEGH  48
            EGTA++LNSM+   FP+TTQ+V+D+FG A     + AAAAQARLFK ANEGH
Sbjct  508  EGTASLLNSMVNNRFPFTTQEVKDAFGAALNSGDDGAAAAQARLFKKANEGH  559



>ref|XP_009392539.1| PREDICTED: protodermal factor 1-like [Musa acuminata subsp. malaccensis]
Length=205

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 84/128 (66%), Gaps = 6/128 (5%)
 Frame = -3

Query  422  GTPPTGFDPNSPPFPCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEA  243
            GTP T  D N  PF C +W+ HP  I  + G+   T+  + G       G + SV  LEA
Sbjct  82   GTPIT--DSNPSPFTCDYWRTHPEAILALFGF-WCTLGQLLGTPAAYALGRNPSV--LEA  136

Query  242  LSNTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKL  63
            LSNTR DG GALYREGTA+ LNS+++++F +T +QVRD+F  AA+ SN AAAAQA LFK 
Sbjct  137  LSNTRADGIGALYREGTASFLNSLVSRSFVFTARQVRDAF-NAAVVSNSAAAAQAELFKR  195

Query  62   ANEGHRPK  39
            ANEGH  K
Sbjct  196  ANEGHLVK  203



>ref|NP_001148678.1| meiosis 5 precursor [Zea mays]
 gb|ACG32503.1| meiosis 5 [Zea mays]
Length=201

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 75/110 (68%), Gaps = 3/110 (3%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTDGYGALYRE  198
            C +WK+HP +I  +VG  GN I   FG   + + G     NL EALSNTRTDG GAL RE
Sbjct  94   CDYWKSHPDMIIAVVGSLGN-IGKTFGAACSLLVG-KKLENLHEALSNTRTDGVGALLRE  151

Query  197  GTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEGH  48
            G+AA LNS++ K FP+TTQQV+D     +++S+ AA+AQA +FK ANE H
Sbjct  152  GSAAFLNSIVNKKFPFTTQQVKDCIA-VSVTSDDAASAQAGIFKKANEYH  200



>ref|XP_002456277.1| hypothetical protein SORBIDRAFT_03g033390 [Sorghum bicolor]
 gb|EES01397.1| hypothetical protein SORBIDRAFT_03g033390 [Sorghum bicolor]
Length=525

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 81/112 (72%), Gaps = 4/112 (4%)
 Frame = -3

Query  380  PCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTDGYGALYR  201
            PCT+W  HP ++WG+ G+    +R +FG  +  +P F   + + EAL+NTR DG GAL+R
Sbjct  413  PCTYWIMHPGVVWGLFGFWCPLVR-LFG-PSAAVP-FGHDLTVPEALANTRQDGVGALFR  469

Query  200  EGTAAMLNSMMTKNFPYTTQQVRDSFGraals-snqaaaaqarLFKLANEGH  48
            EGTA++LNSM+   FP+TTQ+V+D+FG A  S  + AAAAQA+LFK ANEGH
Sbjct  470  EGTASLLNSMVNSGFPFTTQEVKDAFGAALSSGDDGAAAAQAQLFKKANEGH  521



>gb|EMT14417.1| hypothetical protein F775_04470 [Aegilops tauschii]
Length=277

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 82/113 (73%), Gaps = 4/113 (4%)
 Frame = -3

Query  386  PFPCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTDGYGAL  207
            P+   +W +HP +IWG+ G+    +R +FG  +  +P F   + + EAL+NTR DG GAL
Sbjct  164  PYYACYWMSHPGVIWGLFGYWCPLVR-LFG-PSAAVP-FGYDLTVPEALANTRADGVGAL  220

Query  206  YREGTAAMLNSMMTKNFPYTTQQVRDSFGraals-snqaaaaqarLFKLANEG  51
            YREGTA++LNSM++  FP+TT QV+D+FG A  S  ++AAAAQA+LFK+ANEG
Sbjct  221  YREGTASLLNSMVSSGFPFTTAQVKDAFGAALSSGDDRAAAAQAQLFKMANEG  273



>ref|XP_006859008.1| hypothetical protein AMTR_s00068p00158450 [Amborella trichopoda]
 gb|ERN20475.1| hypothetical protein AMTR_s00068p00158450 [Amborella trichopoda]
Length=267

 Score = 91.3 bits (225),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 80/116 (69%), Gaps = 6/116 (5%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPG-FSGSVNLLEALSNTRTDGYGALYR  201
            C FW+ HP  +WGM G+   T+   FG     IPG F   +NL +AL+N R DG+G+LYR
Sbjct  156  CDFWRTHPAAVWGMFGYF-VTVAGAFGCIG--IPGGFGQGLNLHQALNNNRKDGFGSLYR  212

Query  200  EGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEG-HRPKA  36
            EGTA++LNSM+ KNF +T  QV+ SF   AL+S++ AAAQA +FK ANEG  +P+A
Sbjct  213  EGTASLLNSMVNKNFAFTPDQVKSSF-NTALASDKIAAAQADVFKKANEGLLKPRA  267



>gb|AFW71223.1| meiosis 5 [Zea mays]
Length=201

 Score = 89.7 bits (221),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 75/110 (68%), Gaps = 3/110 (3%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTDGYGALYRE  198
            C +WK+HP +I  +VG  GN I   FG   + + G     NL +ALSNTRTDG GAL RE
Sbjct  94   CDYWKSHPDMIIAVVGSLGN-IGKTFGAACSLLVG-KKLENLHDALSNTRTDGVGALLRE  151

Query  197  GTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEGH  48
            G+AA LNS++ K FP+TTQQV+D     +++S+ AA+AQA +FK ANE H
Sbjct  152  GSAAFLNSIVNKKFPFTTQQVKDCIA-VSVTSDNAASAQAGIFKKANEYH  200



>ref|XP_004951386.1| PREDICTED: protodermal factor 1-like [Setaria italica]
Length=202

 Score = 89.4 bits (220),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 74/110 (67%), Gaps = 3/110 (3%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTDGYGALYRE  198
            C +WK+HP +I  +VG  GN I   FG   + I G     NL +ALSNTRTDG GAL RE
Sbjct  95   CDYWKSHPDMIVAVVGSLGN-IGKTFGTACSLIVGKKLE-NLHDALSNTRTDGVGALIRE  152

Query  197  GTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEGH  48
            G AA LNS++ K FP+TTQQV+D     A++S+ AA+AQA +FK ANE H
Sbjct  153  GAAAYLNSIVNKKFPFTTQQVKDCI-IVAVTSDGAASAQAGIFKKANEYH  201



>ref|XP_006576119.1| PREDICTED: protodermal factor 1-like [Glycine max]
 gb|KHN38376.1| hypothetical protein glysoja_004041 [Glycine soja]
Length=154

 Score = 88.2 bits (217),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 84/128 (66%), Gaps = 11/128 (9%)
 Frame = -3

Query  413  PTGFDPNSPPFPCT----FWKAHPTLIWGMVGWNGNTIRSMFGM--NNNNIPGFSGSVNL  252
            P    P S P P T    +W ++P  I  ++GW G TI S FG+  +NN IP    +V+L
Sbjct  29   PVTCTPTSSPTPFTGTSYYWSSNPGRIKEVLGWVG-TIGSAFGVGSSNNKIPS---NVSL  84

Query  251  LEALSNTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarL  72
            + ALSNT +DG GAL REGTA+ LNS++   FPYTT QVRD+F   +L S+ AAAAQA L
Sbjct  85   VHALSNTTSDGLGALCREGTASFLNSLVNNKFPYTTPQVRDTF-VGSLVSDIAAAAQANL  143

Query  71   FKLANEGH  48
            FK+ANEG 
Sbjct  144  FKMANEGR  151



>ref|XP_009381201.1| PREDICTED: protodermal factor 1-like [Musa acuminata subsp. malaccensis]
Length=257

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 78/120 (65%), Gaps = 7/120 (6%)
 Frame = -3

Query  401  DPNSPPF---PCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNT  231
            DP+ PPF    C FW +HP  I  ++G  G TI  +FG     I  F  + +L +AL+NT
Sbjct  138  DPHIPPFFTGTCRFWGSHPDAIAAIIGSLG-TIGDLFGHGCAAI--FGSNPSLTDALTNT  194

Query  230  RTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEG  51
            RTDGYGAL REGTAA LNSM    +P+TT+QV+ +F   A++S+  AA QA +F+ ANEG
Sbjct  195  RTDGYGALIREGTAAFLNSMANSRYPFTTRQVKTAF-AGAITSDGIAATQAEIFEQANEG  253



>ref|XP_008791849.1| PREDICTED: protodermal factor 1 [Phoenix dactylifera]
Length=485

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 85/128 (66%), Gaps = 9/128 (7%)
 Frame = -3

Query  419  TPPTGF--DPNSPPF---PCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVN  255
            TPP+    DPNS P     C +W+ HP  I  ++G+ GN I  +FG        F   ++
Sbjct  358  TPPSPLIPDPNSHPSFTGTCNYWRTHPEAILTVLGYLGN-ISQLFGAACGLA--FGRDLS  414

Query  254  LLEALSNTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqar  75
            L EAL+NTR DG GALYREGTA++LNS+  + FP+TTQQV D+F  AA++S++AAA QA 
Sbjct  415  LPEALANTRADGIGALYREGTASLLNSLADRRFPFTTQQVTDAF-AAAVTSDEAAATQAE  473

Query  74   LFKLANEG  51
            LFK ANEG
Sbjct  474  LFKQANEG  481



>ref|XP_008792281.1| PREDICTED: protodermal factor 1-like [Phoenix dactylifera]
Length=258

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 80/110 (73%), Gaps = 4/110 (4%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTDGYGALYRE  198
            C FW+ HP  IWG+ G+    +   FG+ + ++  F  +++L EAL+NTR DG+GAL RE
Sbjct  149  CDFWRTHPAAIWGLFGY-WVPVGQFFGLPSTSM--FGRNLSLPEALANTRKDGFGALLRE  205

Query  197  GTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEGH  48
            GTA++LNSM+ + FP TTQQV D+   AA +SN+AAAAQA+LFK ANEGH
Sbjct  206  GTASLLNSMVNRRFPLTTQQVTDA-FAAAAASNKAAAAQAQLFKKANEGH  254



>ref|XP_002451823.1| hypothetical protein SORBIDRAFT_04g008270 [Sorghum bicolor]
 gb|EES04799.1| hypothetical protein SORBIDRAFT_04g008270 [Sorghum bicolor]
Length=213

 Score = 86.7 bits (213),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 73/110 (66%), Gaps = 3/110 (3%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTDGYGALYRE  198
            C +WK+HP +I  + G  GN I   FG   + I G     NL +ALSNTRTDG G+L RE
Sbjct  106  CDYWKSHPDMIIAVAGSLGN-IGKTFGAACSLIVGKKLE-NLHDALSNTRTDGVGSLLRE  163

Query  197  GTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEGH  48
            G AA LNS++ K FP+TTQQV+D     A++S+ AA+AQA +FK ANE H
Sbjct  164  GAAAYLNSIVNKKFPFTTQQVKDCI-VVAVTSDGAASAQAGIFKKANEYH  212



>ref|XP_004969811.1| PREDICTED: sialidase-like [Setaria italica]
Length=617

 Score = 90.5 bits (223),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 79/112 (71%), Gaps = 4/112 (4%)
 Frame = -3

Query  380  PCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTDGYGALYR  201
            PCT+W  HP ++WG+ G+    +R +FG  +  +P F   + + EAL+NTR DG GAL+R
Sbjct  507  PCTYWMTHPGVVWGLFGFWCPLVR-LFG-PSAAVP-FGHDLTVPEALANTRQDGVGALFR  563

Query  200  EGTAAMLNSMMTKNFPYTTQQVRDSFGraalssn-qaaaaqarLFKLANEGH  48
            EGTA++LNSM+   F +TTQ+V+D+FG A  S +  AAAAQA+LFK ANEG 
Sbjct  564  EGTASLLNSMVDNRFAFTTQEVKDAFGAALSSGDNGAAAAQAQLFKKANEGR  615



>ref|XP_003571819.1| PREDICTED: protodermal factor 1-like [Brachypodium distachyon]
Length=220

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 70/110 (64%), Gaps = 3/110 (3%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTDGYGALYRE  198
            C +WK HP  I   +G  GN I   FG+  + I G     NL +ALSNTRTDG GAL RE
Sbjct  113  CDYWKKHPDAIVAAIGSVGN-IGKTFGVACSLIVG-KKIENLHDALSNTRTDGIGALIRE  170

Query  197  GTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEGH  48
            G AA LNS++   FP+TTQQV+D     A +S+ AA+AQA +FK ANE H
Sbjct  171  GAAAYLNSIVNHKFPFTTQQVKDCI-IVAATSDGAASAQAGVFKKANESH  219



>ref|XP_010915432.1| PREDICTED: leucine-rich repeat extensin-like protein 5 [Elaeis 
guineensis]
Length=517

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 86/128 (67%), Gaps = 9/128 (7%)
 Frame = -3

Query  419  TPPTGF--DPNSPPF---PCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVN  255
            TPP+    +PNS P+    C +W+ HP  I  ++G+ GN I  +FG        F   ++
Sbjct  390  TPPSPLIPNPNSHPYFTGTCNYWRTHPEAIMAILGYLGN-ISQLFGPAYGLA--FGRDLS  446

Query  254  LLEALSNTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqar  75
            L EAL+NTR DG GALYREGTA++LNS +   FP+TTQQV+++F  AA++S++AAA +A 
Sbjct  447  LPEALANTRNDGIGALYREGTASLLNSFVDSRFPFTTQQVKNAF-AAAVTSDKAAATRAE  505

Query  74   LFKLANEG  51
            LFK ANEG
Sbjct  506  LFKQANEG  513



>gb|KHN38375.1| hypothetical protein glysoja_004040 [Glycine soja]
Length=149

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 66/103 (64%), Gaps = 10/103 (10%)
 Frame = -3

Query  413  PTGFDPNSPPFPCT----FWKAHPTLIWGMVGWNGNTIRSMFGM--NNNNIPGFSGSVNL  252
            P    P S P P T    +W ++P  I  ++GW G TI S FG+  +NN IP    +V+L
Sbjct  29   PVTCTPTSSPTPFTGTSYYWSSNPGRIKEVLGWVG-TIGSAFGVGSSNNKIPS---NVSL  84

Query  251  LEALSNTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSF  123
            + ALSNT +DG GAL REGTA+ LNS++   FPYTT QVRD+F
Sbjct  85   VHALSNTTSDGLGALCREGTASFLNSLVNNKFPYTTPQVRDTF  127



>ref|XP_010053227.1| PREDICTED: protodermal factor 1 [Eucalyptus grandis]
 gb|KCW89701.1| hypothetical protein EUGRSUZ_A01963 [Eucalyptus grandis]
Length=311

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 82/119 (69%), Gaps = 10/119 (8%)
 Frame = -3

Query  380  PCTFWKAHPTLIWGMVGW---NGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTDGYGA  210
            P  ++ ++P +I G+VG+    G   R         +PGF  + NL++AL NT  DG GA
Sbjct  198  PYNYYLSNPGVIIGLVGFVMPMGPAFRV-----TTPVPGFPAAQNLIQALGNTSADGLGA  252

Query  209  LYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEGH-RPKA  36
            LYREGTAA+LNS+ +  FP+TT QVR SF  +ALSSN+AA+AQARLFKLANEG  +P+A
Sbjct  253  LYREGTAALLNSIASNRFPFTTAQVRQSF-VSALSSNEAASAQARLFKLANEGRLKPRA  310



>ref|XP_009409605.1| PREDICTED: protodermal factor 1-like, partial [Musa acuminata 
subsp. malaccensis]
Length=109

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 73/107 (68%), Gaps = 4/107 (4%)
 Frame = -3

Query  371  FWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTDGYGALYREGT  192
            +W +HP  I  ++G  G T+  +FG     I  F  +  L +AL+NTRTDGYGAL+REGT
Sbjct  5    YWGSHPDAIVAVIGSLG-TVGDLFGYGCAAI--FGSNPTLHDALTNTRTDGYGALFREGT  61

Query  191  AAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEG  51
            AA+LNSM    +P+TT+QV+ SF   A++S+ AA AQA +FK ANEG
Sbjct  62   AALLNSMTDSKYPFTTKQVKFSF-AGAITSDGAAEAQADIFKQANEG  107



>emb|CDM81708.1| unnamed protein product [Triticum aestivum]
Length=230

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 71/110 (65%), Gaps = 3/110 (3%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTDGYGALYRE  198
            C +WK HP  I   +G  GN I   FG   + I G     N+ +ALSNTRTDG GAL RE
Sbjct  123  CDYWKNHPDAIVAAIGSLGN-IGKTFGAACSMIGGKKLG-NMHDALSNTRTDGIGALIRE  180

Query  197  GTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEGH  48
            G AA LNS++ K FP+TTQQV++     A++S+ AA+AQA +FK ANE H
Sbjct  181  GAAAYLNSIVNKKFPFTTQQVKNCI-IVAVTSDGAASAQAGVFKKANESH  229



>gb|AAV58857.1| meiosis 5 [Triticum aestivum]
Length=325

 Score = 82.4 bits (202),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 56/85 (66%), Gaps = 1/85 (1%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTDGYGALYRE  198
            C +W+ HP  IW  +G   +++   FG     + G   S+++ +AL+NTRTDG GAL RE
Sbjct  214  CDYWRTHPMQIWSALGSWPSSVSHFFGAAGGAVAGGP-SMSIQDALANTRTDGAGALLRE  272

Query  197  GTAAMLNSMMTKNFPYTTQQVRDSF  123
            GTAA+LNSM    F YTTQQVRD+F
Sbjct  273  GTAALLNSMTRPGFAYTTQQVRDAF  297



>dbj|BAJ91952.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=222

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 69/110 (63%), Gaps = 3/110 (3%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTDGYGALYRE  198
            C FWK HP  I   +G  GN I   FG   + I G     N+ +ALSNTRTDG GAL RE
Sbjct  115  CDFWKNHPDAIIAAIGSLGN-IGKTFGAACSMIGGKKLG-NMHDALSNTRTDGIGALIRE  172

Query  197  GTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEGH  48
            G AA LNS++   FP+TTQQV+D     A +S+ AA+AQA +FK ANE H
Sbjct  173  GAAAYLNSIVNNKFPFTTQQVKDCI-VVAATSDSAASAQAGVFKKANESH  221



>ref|XP_002436628.1| hypothetical protein SORBIDRAFT_10g006190 [Sorghum bicolor]
 gb|EER87995.1| hypothetical protein SORBIDRAFT_10g006190 [Sorghum bicolor]
Length=344

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 61/106 (58%), Gaps = 14/106 (13%)
 Frame = -3

Query  413  PTGFDPNSP------PFPCTFWKAHPTLIWGMVGW-----NGNTIRSMFGMNNNNIPGFS  267
            PT F P  P      P  C +W++HP  IW  +G      + +++   FG   +N     
Sbjct  213  PTPFVPMDPHSFGSLPGSCDYWRSHPMEIWSAIGGRFPSTSPSSMGHFFGAAGSN---GG  269

Query  266  GSVNLLEALSNTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRD  129
              V++ +AL+NTR+DG GAL REG AA+LNSM    FPYTT+QVRD
Sbjct  270  SDVSIQDALANTRSDGTGALLREGAAALLNSMTRAGFPYTTEQVRD  315



>ref|NP_001172867.1| Os02g0230300 [Oryza sativa Japonica Group]
 dbj|BAD26174.1| putative protodermal factor [Oryza sativa Japonica Group]
 gb|EAZ22325.1| hypothetical protein OsJ_05979 [Oryza sativa Japonica Group]
 dbj|BAH91596.1| Os02g0230300 [Oryza sativa Japonica Group]
Length=219

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 59/132 (45%), Positives = 77/132 (58%), Gaps = 11/132 (8%)
 Frame = -3

Query  419  TPPTGFDPNSPPFP--------CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSG  264
            TP T   P+ P  P        C +WK HP +I   +G  G+ I    G   + I G   
Sbjct  90   TPSTPSTPDVPEVPTKHDFCGSCDYWKNHPDVIISAIGSLGD-IGKTLGTACSLITGKKL  148

Query  263  SVNLLEALSNTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaa  84
              NL +ALSNT TDG GAL REG AA LNS++ K FP+TTQQV+D     A++S+ AA++
Sbjct  149  E-NLHDALSNTGTDGTGALLREGAAAYLNSIVNKKFPFTTQQVKDCI-VVAMTSDGAASS  206

Query  83   qarLFKLANEGH  48
            QA +FK AN+ H
Sbjct  207  QAEIFKKANDYH  218



>ref|XP_006647097.1| PREDICTED: protodermal factor 1-like [Oryza brachyantha]
Length=208

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 71/110 (65%), Gaps = 3/110 (3%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTDGYGALYRE  198
            C +WK+HP +I   +G  G+ I    G   N I G     NL +ALSNTR+DG GAL RE
Sbjct  99   CDYWKSHPDVIIAAIGSLGD-IGKTLGDACNLIVG-KKLENLHDALSNTRSDGTGALLRE  156

Query  197  GTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEGH  48
            G AA LNS++   FP++TQQV+D     A++S+ AA++QA +FK AN+ H
Sbjct  157  GAAAYLNSIVNNKFPFSTQQVKDCI-VVAMTSDGAASSQAEIFKKANDYH  205



>gb|AEJ07953.1| meiosis 5-like protein [Sorghum propinquum]
Length=354

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 59/103 (57%), Gaps = 8/103 (8%)
 Frame = -3

Query  413  PTGFDPNSP------PFPCTFWKAHPTLIWGMVGWN-GNTIRSMFGMNNNNIPGFSGS-V  258
            PT F P  P      P  C +W++HP  IW  +G    +T  S  G          GS V
Sbjct  223  PTPFVPMDPHSFDSLPGSCDYWRSHPMEIWSAIGGRFPSTSPSSMGHFFGAAGSIGGSDV  282

Query  257  NLLEALSNTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRD  129
            ++ +AL+NTR+DG GAL REG AA+LNSM    FPYTT+QVRD
Sbjct  283  SIQDALANTRSDGTGALLREGAAALLNSMTRAGFPYTTEQVRD  325



>gb|EAY85105.1| hypothetical protein OsI_06457 [Oryza sativa Indica Group]
Length=219

 Score = 78.6 bits (192),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 77/132 (58%), Gaps = 11/132 (8%)
 Frame = -3

Query  419  TPPTGFDPNSPPFP--------CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSG  264
            TP T   P+ P  P        C +WK HP +I   +G  G+ I    G   + I G   
Sbjct  90   TPSTPSTPDVPEVPTKHDFCGSCDYWKNHPDVIISAIGSLGD-IGKTLGTACSLITGKKL  148

Query  263  SVNLLEALSNTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaa  84
              NL +ALSNT TDG GAL REG AA LNS++ K FP++TQQV+D     A++S+ AA++
Sbjct  149  E-NLHDALSNTGTDGTGALLREGAAAYLNSIVNKKFPFSTQQVKDCI-VVAMTSDGAASS  206

Query  83   qarLFKLANEGH  48
            QA +FK AN+ H
Sbjct  207  QAEIFKKANDYH  218



>dbj|BAJ89562.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=197

 Score = 77.8 bits (190),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 59/96 (61%), Gaps = 2/96 (2%)
 Frame = -3

Query  419  TPPTGFDPNSPPFPCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEAL  240
            TP    DPNS    C +W+ HP  IW  +G   +++   FG     + G   SV++ +AL
Sbjct  73   TPLIPVDPNSL-GTCDYWRTHPMQIWSALGSWPSSVSHFFGAAGGAVAGGP-SVSIQDAL  130

Query  239  SNTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVR  132
            +NTRTDG GAL REGTAA+LNSM    F YTTQQVR
Sbjct  131  ANTRTDGAGALLREGTAALLNSMTRPGFAYTTQQVR  166



>dbj|BAJ86629.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=348

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 53/82 (65%), Gaps = 1/82 (1%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTDGYGALYRE  198
            C +W+ HP  IW  +G   +++   FG     + G   SV++ +AL+NTRTDG GAL RE
Sbjct  237  CDYWRTHPMQIWSALGSWPSSVSHFFGAAGGAVAGGP-SVSIQDALANTRTDGAGALLRE  295

Query  197  GTAAMLNSMMTKNFPYTTQQVR  132
            GTAA+LNSM    F YTTQQVR
Sbjct  296  GTAALLNSMTRPGFAYTTQQVR  317



>gb|EMT07136.1| hypothetical protein F775_31687 [Aegilops tauschii]
Length=201

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 70/108 (65%), Gaps = 3/108 (3%)
 Frame = -3

Query  371  FWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTDGYGALYREGT  192
            +WK HP  I   +G  GN I   FG   + I G     N+ +ALSNTRTDG GAL REG 
Sbjct  96   YWKNHPDAIVAAIGSLGN-IGKTFGAACSMIGGKKLG-NMHDALSNTRTDGIGALIREGA  153

Query  191  AAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLANEGH  48
            AA LNS++ K FP+TTQQV+D     A++S+ AA+AQA +FK ANE H
Sbjct  154  AAYLNSIVNKKFPFTTQQVKDCI-VVAVTSDGAASAQAGVFKKANEFH  200



>gb|EMT03246.1| hypothetical protein F775_31546 [Aegilops tauschii]
Length=322

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 53/82 (65%), Gaps = 1/82 (1%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTDGYGALYRE  198
            C +W+ HP  IW  +G   +++   FG     + G   S+++ +AL+NTRTDG GAL RE
Sbjct  212  CDYWRTHPMQIWSALGSWPSSVSHFFGAAGGAVAGGP-SMSIQDALANTRTDGAGALLRE  270

Query  197  GTAAMLNSMMTKNFPYTTQQVR  132
            GTAA+LNSM    F YTTQQVR
Sbjct  271  GTAALLNSMTRPGFAYTTQQVR  292



>gb|AAT71304.1| proline- and threonine-rich protein [Oryza sativa]
Length=219

 Score = 75.5 bits (184),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 77/138 (56%), Gaps = 17/138 (12%)
 Frame = -3

Query  419  TPPTGFDPNSPPFP--------------CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNN  282
            TP  G  P+SP  P              C +WK HP +I   +G  G+ I        + 
Sbjct  84   TPSYGTTPSSPSTPDVPEVPTKHDFCGSCDYWKNHPDVIISAIGSLGD-IGMTLDTACSL  142

Query  281  IPGFSGSVNLLEALSNTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalss  102
            I G     NL +ALSNT TDG GAL REG AA LNS++ K FP+TTQQV+D     A++S
Sbjct  143  ITGKKLE-NLHDALSNTGTDGTGALLREGAAAYLNSIVNKKFPFTTQQVKDCI-VVAMTS  200

Query  101  nqaaaaqarLFKLANEGH  48
            + AA++QA +FK AN+ H
Sbjct  201  DGAASSQAEIFKKANDYH  218



>ref|XP_004965593.1| PREDICTED: keratin-3, type I cytoskeletal 51 kDa-like [Setaria 
italica]
Length=197

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 50/87 (57%), Gaps = 6/87 (7%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGS--VNLLEALSNTRTDGYGALY  204
            C +WK+HP  I   +G    ++ S+ G   +    F GS    L +AL NTRTD YG L 
Sbjct  88   CDYWKSHPDAIISCIG----SLGSILGSFGDVCSAFFGSKLQTLQDALCNTRTDCYGDLL  143

Query  203  REGTAAMLNSMMTKNFPYTTQQVRDSF  123
            REG AA LNS+  K + Y+TQQV+D  
Sbjct  144  REGAAAYLNSIAAKKYAYSTQQVKDCI  170



>emb|CDM82145.1| unnamed protein product [Triticum aestivum]
Length=324

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 53/82 (65%), Gaps = 1/82 (1%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTDGYGALYRE  198
            C +W+ HP  IW  +G   +++   FG     + G   S+++ +AL+NTRTDG GAL RE
Sbjct  213  CDYWRTHPMQIWSALGSWPSSVSHFFGAAGGAVAGGP-SMSIQDALANTRTDGAGALLRE  271

Query  197  GTAAMLNSMMTKNFPYTTQQVR  132
            GTAA+LNSM    F YTTQQVR
Sbjct  272  GTAALLNSMTRPGFAYTTQQVR  293



>gb|AFW86949.1| meiosis 5 [Zea mays]
Length=174

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 50/87 (57%), Gaps = 6/87 (7%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGS--VNLLEALSNTRTDGYGALY  204
            C +WK+HP  I   +G    ++ S+ G   +    F GS    L +AL NTRTD YG L 
Sbjct  66   CDYWKSHPDAIISCIG----SLGSILGSFGDVCSAFFGSKLQTLQDALCNTRTDCYGDLL  121

Query  203  REGTAAMLNSMMTKNFPYTTQQVRDSF  123
            REG AA LNS+  + + Y+TQQV+D  
Sbjct  122  REGAAAYLNSIAAEKYAYSTQQVQDCI  148



>gb|AFW86950.1| hypothetical protein ZEAMMB73_132004 [Zea mays]
Length=178

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 50/87 (57%), Gaps = 6/87 (7%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGS--VNLLEALSNTRTDGYGALY  204
            C +WK+HP  I   +G    ++ S+ G   +    F GS    L +AL NTRTD YG L 
Sbjct  70   CDYWKSHPDAIISCIG----SLGSILGSFGDVCSAFFGSKLQTLQDALCNTRTDCYGDLL  125

Query  203  REGTAAMLNSMMTKNFPYTTQQVRDSF  123
            REG AA LNS+  + + Y+TQQV+D  
Sbjct  126  REGAAAYLNSIAAEKYAYSTQQVQDCI  152



>ref|NP_001148016.1| meiosis 5 precursor [Zea mays]
 gb|ACG29415.1| meiosis 5 [Zea mays]
Length=169

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 50/87 (57%), Gaps = 6/87 (7%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGS--VNLLEALSNTRTDGYGALY  204
            C +WK+HP  I   +G    ++ S+ G   +    F GS    L +AL NTRTD YG L 
Sbjct  61   CDYWKSHPDAIISCIG----SLGSILGSFGDVCSAFFGSKLQTLQDALCNTRTDCYGDLL  116

Query  203  REGTAAMLNSMMTKNFPYTTQQVRDSF  123
            REG AA LNS+  + + Y+TQQV+D  
Sbjct  117  REGAAAYLNSIAAEKYAYSTQQVQDCI  143



>gb|ACG27615.1| meiosis 5 [Zea mays]
Length=168

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 50/87 (57%), Gaps = 6/87 (7%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGS--VNLLEALSNTRTDGYGALY  204
            C +WK+HP  I   +G    ++ S+ G   +    F GS    L +AL NTRTD YG L 
Sbjct  59   CDYWKSHPDAIISCIG----SLGSILGSFGDVCSAFFGSKLQTLQDALCNTRTDCYGDLL  114

Query  203  REGTAAMLNSMMTKNFPYTTQQVRDSF  123
            REG AA LNS+  + + Y+TQQV+D  
Sbjct  115  REGAAAYLNSIAAEKYAYSTQQVQDCI  141



>gb|AFW86951.1| meiosis 5 [Zea mays]
Length=182

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 50/87 (57%), Gaps = 6/87 (7%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGS--VNLLEALSNTRTDGYGALY  204
            C +WK+HP  I   +G    ++ S+ G   +    F GS    L +AL NTRTD YG L 
Sbjct  74   CDYWKSHPDAIISCIG----SLGSILGSFGDVCSAFFGSKLQTLQDALCNTRTDCYGDLL  129

Query  203  REGTAAMLNSMMTKNFPYTTQQVRDSF  123
            REG AA LNS+  + + Y+TQQV+D  
Sbjct  130  REGAAAYLNSIAAEKYAYSTQQVQDCI  156



>ref|NP_001168480.1| uncharacterized protein LOC100382257 precursor [Zea mays]
 gb|ACN28368.1| unknown [Zea mays]
Length=176

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 50/87 (57%), Gaps = 6/87 (7%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGS--VNLLEALSNTRTDGYGALY  204
            C +WK+HP  I   +G    ++ S+ G   +    F GS    L +AL NTRTD YG L 
Sbjct  68   CDYWKSHPDAIISCIG----SLGSILGSFGDVCSAFFGSKLQTLQDALCNTRTDCYGDLL  123

Query  203  REGTAAMLNSMMTKNFPYTTQQVRDSF  123
            REG AA LNS+  + + Y+TQQV+D  
Sbjct  124  REGAAAYLNSIAAEKYAYSTQQVQDCI  150



>gb|ACG28466.1| meiosis 5 [Zea mays]
Length=174

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 50/87 (57%), Gaps = 6/87 (7%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGS--VNLLEALSNTRTDGYGALY  204
            C +WK+HP  I   +G    ++ S+ G   +    F GS    L +AL NTRTD YG L 
Sbjct  65   CDYWKSHPDAIISCIG----SLGSILGSFGDVCSAFFGSKLQTLQDALCNTRTDCYGDLL  120

Query  203  REGTAAMLNSMMTKNFPYTTQQVRDSF  123
            REG AA LNS+  + + Y+TQQV+D  
Sbjct  121  REGAAAYLNSIAAEKYAYSTQQVQDCI  147



>ref|NP_001183948.1| uncharacterized protein LOC100502555 precursor [Zea mays]
 ref|XP_008658578.1| PREDICTED: meiosis 5 isoform X1 [Zea mays]
 gb|ACF85547.1| unknown [Zea mays]
 gb|AFW86952.1| meiosis 5 [Zea mays]
Length=196

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 50/87 (57%), Gaps = 6/87 (7%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGS--VNLLEALSNTRTDGYGALY  204
            C +WK+HP  I   +G    ++ S+ G   +    F GS    L +AL NTRTD YG L 
Sbjct  88   CDYWKSHPDAIISCIG----SLGSILGSFGDVCSAFFGSKLQTLQDALCNTRTDCYGDLL  143

Query  203  REGTAAMLNSMMTKNFPYTTQQVRDSF  123
            REG AA LNS+  + + Y+TQQV+D  
Sbjct  144  REGAAAYLNSIAAEKYAYSTQQVQDCI  170



>ref|NP_001148184.1| meiosis 5 precursor [Zea mays]
 gb|ACG30086.1| meiosis 5 [Zea mays]
 gb|ACG43595.1| meiosis 5 [Zea mays]
Length=194

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 50/87 (57%), Gaps = 6/87 (7%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGS--VNLLEALSNTRTDGYGALY  204
            C +WK+HP  I   +G    ++ S+ G   +    F GS    L +AL NTRTD YG L 
Sbjct  85   CDYWKSHPDAIISCIG----SLGSILGSFGDVCSAFFGSKLQTLQDALCNTRTDCYGDLL  140

Query  203  REGTAAMLNSMMTKNFPYTTQQVRDSF  123
            REG AA LNS+  + + Y+TQQV+D  
Sbjct  141  REGAAAYLNSIAAEKYAYSTQQVQDCI  167



>gb|ADE77644.1| unknown [Picea sitchensis]
Length=349

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 81/127 (64%), Gaps = 5/127 (4%)
 Frame = -3

Query  419  TPPTGFDPNSPPFPCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEAL  240
            +PP   DP S    C FW  HP  +  ++ +  ++I  +FG  ++ I  F G + L EAL
Sbjct  227  SPPVVGDPGSSTGTCDFWGTHPDSLPSILSFF-SSISDLFGSGSSPI--FGGDMTLQEAL  283

Query  239  SNTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFGraalssnqaaaaqarLFKLA  60
            +NTR DGYG+L REG+A++LNS + + F ++ Q+V+  F  AAL+SN AAA QA  FK A
Sbjct  284  TNTRRDGYGSLLREGSASLLNSFVNEKFVFSPQEVKQKF-NAALTSNHAAAVQATKFKSA  342

Query  59   NEGH-RP  42
            NEGH RP
Sbjct  343  NEGHLRP  349



>gb|AFW86948.1| hypothetical protein ZEAMMB73_132004, partial [Zea mays]
Length=186

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 50/88 (57%), Gaps = 6/88 (7%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGS--VNLLEALSNTRTDGYGALY  204
            C +WK+HP  I   +G    ++ S+ G   +    F GS    L +AL NTRTD YG L 
Sbjct  78   CDYWKSHPDAIISCIG----SLGSILGSFGDVCSAFFGSKLQTLQDALCNTRTDCYGDLL  133

Query  203  REGTAAMLNSMMTKNFPYTTQQVRDSFG  120
            REG AA LNS+  + + Y+TQQV+D   
Sbjct  134  REGAAAYLNSIAAEKYAYSTQQVQDCIA  161



>gb|AFV13467.1| meiosis 5-like protein, partial [Coix lacryma-jobi]
Length=359

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 54/93 (58%), Gaps = 9/93 (10%)
 Frame = -3

Query  386  PFPCTFWKAHPTLIWGMVGWN-------GNTIRSMFGMNNNNIPGFSGSVNLLEALSNTR  228
            P  C +W++HP  IW  +G          +++   FG   +   G    +++ +AL++TR
Sbjct  248  PGSCNYWRSHPMEIWSAIGGRFPSTSSSSSSMGHFFGAAGSV--GGPDVMSIQDALASTR  305

Query  227  TDGYGALYREGTAAMLNSMMTKNFPYTTQQVRD  129
            +DG GAL REG AA+LNSM    FPYTT QVRD
Sbjct  306  SDGTGALLREGAAALLNSMTRAGFPYTTDQVRD  338



>ref|XP_004968555.1| PREDICTED: keratin, type I cytoskeletal 9-like [Setaria italica]
Length=369

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 58/105 (55%), Gaps = 11/105 (10%)
 Frame = -3

Query  413  PTGFDPNSP------PFPCTFWKAHPTLIWGMVGWN-----GNTIRSMFGMNNNNIPGFS  267
            PT F P  P      P  C +W++HP  IW  +G       G+      G+      G +
Sbjct  235  PTPFLPVDPHSLGSLPGSCDYWRSHPMEIWSALGGRFPSSMGHFFGGAGGLGGAGGLGGA  294

Query  266  GSVNLLEALSNTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVR  132
              +++ +AL+NTR+DG GAL REG AA+LNSM    FPYTT+QVR
Sbjct  295  ADLSIQDALANTRSDGAGALLREGAAALLNSMTRAGFPYTTEQVR  339



>ref|XP_002438553.1| hypothetical protein SORBIDRAFT_10g021810 [Sorghum bicolor]
 gb|EER89920.1| hypothetical protein SORBIDRAFT_10g021810 [Sorghum bicolor]
Length=199

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 50/89 (56%), Gaps = 8/89 (9%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGS--VNLLEALSNTRTDGYGALY  204
            C +WK+HP  I   +G    ++ S+ G   +    F GS    L +AL NTR+D YG L 
Sbjct  89   CDYWKSHPDAIISCIG----SLGSILGSLGDVCSAFFGSKVQTLQDALCNTRSDCYGDLL  144

Query  203  REGTAAMLNSMMTK--NFPYTTQQVRDSF  123
            REG AA LNS+  K   F Y+TQQV+D  
Sbjct  145  REGAAAYLNSVAAKKQQFAYSTQQVKDCI  173



>ref|NP_001057844.1| Os06g0553200 [Oryza sativa Japonica Group]
 dbj|BAD53672.1| protodermal factor-like [Oryza sativa Japonica Group]
 dbj|BAF19758.1| Os06g0553200 [Oryza sativa Japonica Group]
 gb|EAZ37324.1| hypothetical protein OsJ_21665 [Oryza sativa Japonica Group]
 gb|ACA50498.1| protodermal factor-like protein [Oryza sativa Japonica Group]
 dbj|BAG87602.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96757.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96852.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00603.1| unnamed protein product [Oryza sativa Japonica Group]
Length=186

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/101 (44%), Positives = 56/101 (55%), Gaps = 14/101 (14%)
 Frame = -3

Query  419  TPPTGFDPNSPPFPCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGS--VNLLE  246
            +P TGF  +     C FWK+HP  I   +G  G+ + S FG   +   GF GS    L +
Sbjct  65   SPTTGFTGS-----CDFWKSHPEKIISCIGSLGSIVGS-FG---DVCSGFFGSKLQTLQD  115

Query  245  ALSNTRTDGYGALYREGTAAMLNSMMTK---NFPYTTQQVR  132
            AL +TR D YG L REG AA +NS+  K    F YTTQQV+
Sbjct  116  ALCSTRKDCYGDLLREGAAAYINSVAAKKQAKFAYTTQQVK  156



>gb|EAZ01309.1| hypothetical protein OsI_23340 [Oryza sativa Indica Group]
Length=189

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 44/101 (44%), Positives = 56/101 (55%), Gaps = 14/101 (14%)
 Frame = -3

Query  419  TPPTGFDPNSPPFPCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGS--VNLLE  246
            +P TGF  +     C FWK+HP  I   +G  G+ + S FG   +   GF GS    L +
Sbjct  68   SPTTGFTGS-----CDFWKSHPEKIISCIGSLGSIVGS-FG---DVCSGFFGSKLQTLQD  118

Query  245  ALSNTRTDGYGALYREGTAAMLNSMMTK---NFPYTTQQVR  132
            AL +TR D YG L REG AA +NS+  K    F YTTQQV+
Sbjct  119  ALCSTRKDCYGDLLREGAAAYINSVAAKKQAKFAYTTQQVK  159



>ref|NP_001150305.1| meiosis 5 precursor [Zea mays]
 gb|ACG38591.1| meiosis 5 [Zea mays]
Length=325

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 49/85 (58%), Gaps = 3/85 (4%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFG---MNNNNIPGFSGSVNLLEALSNTRTDGYGAL  207
            C +W++HP  IW  VG    +  S  G          G +  +++ +A+ NTR DG GAL
Sbjct  211  CDYWRSHPMEIWSAVGGRFPSTSSSMGHFFGAAAGNVGGADVMSIQDAVGNTRADGTGAL  270

Query  206  YREGTAAMLNSMMTKNFPYTTQQVR  132
             REG AA+LNSM    FPYTT+QVR
Sbjct  271  LREGAAALLNSMTRAGFPYTTEQVR  295



>ref|XP_002457165.1| hypothetical protein SORBIDRAFT_03g002540 [Sorghum bicolor]
 gb|EES02285.1| hypothetical protein SORBIDRAFT_03g002540 [Sorghum bicolor]
Length=332

 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 49/89 (55%), Gaps = 6/89 (7%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWN------GNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTDGY  216
            C +W++HP  IW  +G             S F        G +  +++ +AL NTR DG 
Sbjct  215  CDYWRSHPMEIWSAIGGRFPSTSSSMGTMSHFFGAAAGSVGGANMMSIQDALGNTRADGT  274

Query  215  GALYREGTAAMLNSMMTKNFPYTTQQVRD  129
            GAL REG AA+LNSM    FPYTT+QVRD
Sbjct  275  GALLREGAAALLNSMTRAGFPYTTEQVRD  303



>ref|NP_001150889.1| LOC100284522 precursor [Zea mays]
 gb|ACG40802.1| meiosis 5 [Zea mays]
Length=183

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 48/87 (55%), Gaps = 5/87 (6%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLE-ALSNTRTDGYGALYR  201
            C +WK+HP  I   VG  G+ + S+    +     F G +  L+ AL N R DGYG L R
Sbjct  73   CDYWKSHPDAIVSCVGSLGSVLGSL---GDACSAFFGGKLQTLQDALCNARADGYGDLLR  129

Query  200  EGTAAMLNSMMTK-NFPYTTQQVRDSF  123
            EG AA LNS+     + YTTQQV+D  
Sbjct  130  EGAAAYLNSVAAAGKYAYTTQQVKDCI  156



>ref|XP_006656154.1| PREDICTED: protodermal factor 1-like [Oryza brachyantha]
Length=181

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 56/102 (55%), Gaps = 11/102 (11%)
 Frame = -3

Query  419  TPPTGFDPNSPPFPCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLE-A  243
            +P TGF  +     C FWK++P  I   +G  G+ + S FG   ++   F G +  L+ A
Sbjct  62   SPMTGFTGS-----CDFWKSNPDKIISCIGSLGSIVGS-FGDVCSSF--FGGKLQTLQDA  113

Query  242  LSNTRTDGYGALYREGTAAMLNSMMTK--NFPYTTQQVRDSF  123
            L NTR D YG L REG AA +NSM  K   F YTT QV+D  
Sbjct  114  LCNTRKDCYGDLLREGAAAYINSMAAKKAKFAYTTHQVKDCI  155



>ref|XP_003563769.1| PREDICTED: protodermal factor 1-like [Brachypodium distachyon]
Length=192

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 51/90 (57%), Gaps = 8/90 (9%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGS--VNLLEALSNTRTDGYGALY  204
            C +WK+HP  I   VG  G+ + S FG   +    F G+    L +AL +TRTD YG L 
Sbjct  82   CDYWKSHPDKIISCVGSLGSIVGS-FG---DVCSSFYGTKIQTLKDALCSTRTDCYGDLL  137

Query  203  REGTAAMLNSMMTK--NFPYTTQQVRDSFG  120
            REG AA +NS+  K  +F YTT QV+D   
Sbjct  138  REGAAAYINSIAAKKAHFAYTTHQVKDCIA  167



>gb|AFW76536.1| hypothetical protein ZEAMMB73_750604 [Zea mays]
Length=144

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 48/89 (54%), Gaps = 7/89 (8%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLE-ALSNTRTDGYGALYR  201
            C +WK+HP  I   VG  G+ + S+    +     F G +  L+ AL N R DGYG L R
Sbjct  32   CDYWKSHPDAIVSCVGSLGSVLGSL---GDACSAFFGGKLQTLQDALCNARADGYGDLLR  88

Query  200  EGTAAMLNSMMTK---NFPYTTQQVRDSF  123
            EG AA LNS+       + YTTQQV+D  
Sbjct  89   EGAAAYLNSVAAAAAGKYAYTTQQVKDCI  117



>ref|XP_003565471.1| PREDICTED: protodermal factor 1-like [Brachypodium distachyon]
Length=318

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 51/122 (42%), Positives = 64/122 (52%), Gaps = 6/122 (5%)
 Frame = -3

Query  404  FDPNSPPFPCTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRT  225
             DPNSP   C +W++HP  IW  +G    +  S  G       G    V++ +AL NT  
Sbjct  200  VDPNSP-GTCEYWRSHPMQIWSALG---GSWPSSVGHFFGGGSGLGSGVSIQDALGNTGN  255

Query  224  DGYGALYREGTAAMLNSMMTKNFPYTTQQVR--DSFGraalssnqaaaaqarLFKLANEG  51
            D   AL RE TAA+LNSM    FPYTT QVR   +   A  +S+ A   QA  FK ANEG
Sbjct  256  DSSSALLREATAALLNSMTRAGFPYTTSQVRDAFAAAAAPGASDGAKTKQAEAFKKANEG  315

Query  50   HR  45
             +
Sbjct  316  SK  317



>ref|NP_001042324.2| Os01g0201600 [Oryza sativa Japonica Group]
 dbj|BAD73169.1| VsaA -like [Oryza sativa Japonica Group]
 dbj|BAD73213.1| VsaA -like [Oryza sativa Japonica Group]
 gb|EAZ10929.1| hypothetical protein OsJ_00770 [Oryza sativa Japonica Group]
 dbj|BAG93523.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF04238.2| Os01g0201600 [Oryza sativa Japonica Group]
Length=301

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 49/86 (57%), Gaps = 5/86 (6%)
 Frame = -3

Query  386  PFPCTFWKAHPTLIWGMVG-WNGNTIRSMFGMNNNNIPGFSGSVNLLEALSNTRTDGYGA  210
            P  C +W++HP  +W  +G W      S+     +   G    +++ +AL+NTR DG G 
Sbjct  189  PGTCDYWRSHPMEMWSALGRWP----SSVGHFFGSGSGGAGTGMSIQDALANTRGDGAGE  244

Query  209  LYREGTAAMLNSMMTKNFPYTTQQVR  132
            L REG AA+LNSM    FPYT +QVR
Sbjct  245  LMREGAAALLNSMTRSGFPYTAEQVR  270



>gb|ACG27324.1| hypothetical protein [Zea mays]
Length=98

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -3

Query  254  LLEALSNTRTDGYGALYREGTAAMLNSMMTKNFPYTTQQVRDSFG  120
            L +AL NTRTD YG L REG AA LNS+  + + Y+TQQV+D   
Sbjct  28   LQDALCNTRTDCYGDLLREGAAAYLNSIAAEKYAYSTQQVQDCIA  72



>gb|EMS60822.1| hypothetical protein TRIUR3_20400 [Triticum urartu]
Length=233

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 46/89 (52%), Gaps = 8/89 (9%)
 Frame = -3

Query  377  CTFWKAHPTLIWGMVGWNGNTIRSMFGMNNNNIPGFSGSV--NLLEALSNTRTDGYGALY  204
            C +WK HP  I   +G    ++ S+ G        F GS    L +AL NTRTD YG L 
Sbjct  123  CDYWKGHPEKIIDCIG----SLGSILGSLGEVCHAFFGSKIHTLQDALCNTRTDCYGDLL  178

Query  203  REGTAAMLNSMMTK--NFPYTTQQVRDSF  123
            REG AA +N++  K   F YT  QV++  
Sbjct  179  REGAAAYINAIAAKKEKFAYTAYQVKECV  207



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1798677760698