BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18035_g1_i2 len=957 path=[995:0-580 1576:581-624 1620:625-956]

Length=957
                                                                      Score     E

emb|CDP14033.1|  unnamed protein product                                237   2e-74   
ref|XP_010534588.1|  PREDICTED: protein yippee-like isoform X4          233   9e-73   
ref|XP_002526899.1|  fad NAD binding oxidoreductases, putative          232   2e-72   Ricinus communis
ref|XP_009600804.1|  PREDICTED: protein yippee-like                     231   2e-72   
ref|XP_009781999.1|  PREDICTED: protein yippee-like isoform X1          229   1e-71   
ref|XP_004235245.1|  PREDICTED: protein yippee-like                     229   1e-71   
ref|XP_006362988.1|  PREDICTED: protein yippee-like                     229   2e-71   
ref|XP_007009014.1|  Yippee family zinc-binding protein, putative...    228   4e-71   
ref|XP_006435717.1|  hypothetical protein CICLE_v10033070mg             228   5e-71   
ref|NP_001274831.1|  protein yippee-like                                228   6e-71   
ref|XP_007163531.1|  hypothetical protein PHAVU_001G242000g             227   1e-70   
ref|XP_002273272.1|  PREDICTED: protein yippee-like                     227   1e-70   Vitis vinifera
ref|XP_008233742.1|  PREDICTED: protein yippee-like                     226   2e-70   
ref|XP_004500681.1|  PREDICTED: protein yippee-like isoform X4          226   4e-70   
ref|NP_001236973.1|  uncharacterized protein LOC100305552               225   5e-70   
gb|KDP44782.1|  hypothetical protein JCGZ_01282                         224   9e-70   
gb|KHG08088.1|  yippee-like protein                                     224   1e-69   
ref|XP_004500680.1|  PREDICTED: protein yippee-like isoform X3          224   1e-69   
ref|XP_010689802.1|  PREDICTED: protein yippee-like                     224   1e-69   
gb|KHG19185.1|  yippee-like protein                                     223   3e-69   
gb|EYU22342.1|  hypothetical protein MIMGU_mgv1a016254mg                223   4e-69   
ref|XP_007220477.1|  hypothetical protein PRUPE_ppa013317mg             223   5e-69   
ref|XP_006356456.1|  PREDICTED: protein yippee-like isoform X1          222   1e-68   
gb|AFK44986.1|  unknown                                                 222   1e-68   
gb|AFK42344.1|  unknown                                                 220   4e-68   
ref|XP_003538458.1|  PREDICTED: protein yippee-like isoform X1          219   9e-68   
ref|XP_002312152.1|  Yippee-like family protein                         219   1e-67   Populus trichocarpa [western balsam poplar]
ref|XP_011084918.1|  PREDICTED: protein yippee-like                     218   2e-67   
ref|XP_009141864.1|  PREDICTED: protein yippee-like                     218   2e-67   
ref|XP_004490983.1|  PREDICTED: protein yippee-like isoform X3          218   2e-67   
ref|XP_010095099.1|  hypothetical protein L484_026408                   218   3e-67   
ref|XP_006650439.1|  PREDICTED: protein yippee-like                     218   3e-67   
ref|NP_181540.1|  Yippee family putative zinc-binding protein           218   5e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010558081.1|  PREDICTED: protein yippee-like At3g11230           217   5e-67   
ref|XP_004307635.1|  PREDICTED: protein yippee-like isoform 1           217   1e-66   
ref|XP_006411259.1|  hypothetical protein EUTSA_v10017415mg             217   1e-66   
ref|XP_002879844.1|  yippee family protein                              216   1e-66   
ref|XP_003519391.1|  PREDICTED: protein yippee-like isoform 1           216   1e-66   
ref|NP_001050981.1|  Os03g0698500                                       216   2e-66   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004235254.1|  PREDICTED: protein yippee-like isoform X2          216   2e-66   
ref|XP_011043728.1|  PREDICTED: protein yippee-like isoform X2          215   4e-66   
ref|XP_009412576.1|  PREDICTED: protein yippee-like                     215   4e-66   
emb|CDY61708.1|  BnaC04g56710D                                          223   4e-66   
ref|XP_004235253.1|  PREDICTED: protein yippee-like                     214   8e-66   
ref|XP_009344741.1|  PREDICTED: protein yippee-like                     214   8e-66   
ref|XP_010923051.1|  PREDICTED: protein yippee-like isoform X1          214   8e-66   
ref|XP_008776663.1|  PREDICTED: protein yippee-like                     214   1e-65   
ref|XP_010505717.1|  PREDICTED: protein yippee-like                     214   1e-65   
ref|XP_002315161.1|  Yippee-like family protein                         214   1e-65   Populus trichocarpa [western balsam poplar]
ref|XP_003600874.1|  Protein yippee-like protein                        214   3e-65   
gb|ACU23549.1|  unknown                                                 213   3e-65   Glycine max [soybeans]
ref|XP_010508914.1|  PREDICTED: protein yippee-like                     213   4e-65   
gb|AFK39854.1|  unknown                                                 213   4e-65   
gb|EYU20019.1|  hypothetical protein MIMGU_mgv1a016206mg                213   5e-65   
ref|XP_008343615.1|  PREDICTED: protein yippee-like                     212   6e-65   
ref|XP_007141774.1|  hypothetical protein PHAVU_008G224700g             212   6e-65   
ref|XP_003560972.1|  PREDICTED: protein yippee-like                     211   1e-64   
ref|XP_008369243.1|  PREDICTED: protein yippee-like                     211   1e-64   
ref|NP_001238047.1|  uncharacterized protein LOC100500435               211   1e-64   
ref|XP_009419732.1|  PREDICTED: protein yippee-like isoform X1          211   2e-64   
ref|XP_011035968.1|  PREDICTED: protein yippee-like                     211   2e-64   
ref|XP_006298725.1|  hypothetical protein CARUB_v10014821mg             212   2e-64   
ref|NP_001150917.1|  protein yippee-like                                211   3e-64   Zea mays [maize]
ref|XP_010908535.1|  PREDICTED: protein yippee-like isoform X2          210   4e-64   
ref|XP_009369154.1|  PREDICTED: protein yippee-like                     209   8e-64   
ref|XP_004138427.1|  PREDICTED: protein yippee-like At3g11230-lik...    209   1e-63   
gb|KGN50647.1|  hypothetical protein Csa_5G201320                       212   1e-63   
ref|XP_010543736.1|  PREDICTED: protein yippee-like At3g11230 iso...    208   3e-63   
ref|XP_007026733.1|  Yippee family zinc-binding protein, putative...    208   3e-63   
ref|NP_001078135.1|  Yippee family putative zinc-binding protein        209   4e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002466620.1|  hypothetical protein SORBIDRAFT_01g011160          207   4e-63   Sorghum bicolor [broomcorn]
ref|XP_004982093.1|  PREDICTED: protein yippee-like isoform X1          207   5e-63   
ref|XP_010031234.1|  PREDICTED: protein yippee-like                     207   6e-63   
ref|XP_008441452.1|  PREDICTED: protein yippee-like                     207   6e-63   
ref|NP_566389.1|  Yippee family putative zinc-binding protein           206   2e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008676448.1|  PREDICTED: protein yippee-like isoform X1          206   2e-62   
ref|XP_010487129.1|  PREDICTED: protein yippee-like At3g11230           206   2e-62   
ref|XP_004149238.1|  PREDICTED: protein yippee-like                     206   2e-62   
ref|XP_008243868.1|  PREDICTED: protein yippee-like                     206   2e-62   
gb|AAM67003.1|  yippee-like protein                                     206   2e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003616622.1|  Yippee-like protein                                206   3e-62   
ref|NP_001148915.1|  protein yippee-like                                205   5e-62   Zea mays [maize]
ref|XP_010464823.1|  PREDICTED: protein yippee-like At3g11230           204   6e-62   
ref|XP_011077567.1|  PREDICTED: protein yippee-like                     204   1e-61   
ref|XP_002882719.1|  yippee family protein                              203   3e-61   
ref|XP_008463228.1|  PREDICTED: protein yippee-like                     202   4e-61   
ref|XP_006481018.1|  PREDICTED: protein yippee-like                     202   5e-61   
ref|XP_006366350.1|  PREDICTED: protein yippee-like isoform X1          201   1e-60   
gb|KFK38513.1|  hypothetical protein AALP_AA3G122900                    201   2e-60   
ref|XP_007140356.1|  hypothetical protein PHAVU_008G105100g             201   2e-60   
ref|XP_006407463.1|  hypothetical protein EUTSA_v10021761mg             201   2e-60   
ref|XP_007207494.1|  hypothetical protein PRUPE_ppa013324mg             199   6e-60   
gb|KDP24463.1|  hypothetical protein JCGZ_25027                         198   1e-59   
ref|XP_004246327.1|  PREDICTED: protein yippee-like                     198   3e-59   
emb|CDY08541.1|  BnaA05g27770D                                          200   4e-59   
ref|XP_003530278.1|  PREDICTED: protein yippee-like isoform X1          197   4e-59   
ref|XP_009377785.1|  PREDICTED: protein yippee-like                     197   6e-59   
ref|XP_008370079.1|  PREDICTED: protein yippee-like                     197   6e-59   
gb|EPS69006.1|  hypothetical protein M569_05769                         196   1e-58   
ref|XP_008449254.1|  PREDICTED: LOW QUALITY PROTEIN: protein yipp...    196   1e-58   
ref|XP_009135158.1|  PREDICTED: protein yippee-like At3g11230           196   2e-58   
emb|CDY01005.1|  BnaC05g41950D                                          195   3e-58   
ref|XP_009146743.1|  PREDICTED: protein yippee-like At3g11230           195   3e-58   
dbj|BAJ85601.1|  predicted protein                                      195   3e-58   
ref|XP_008388207.1|  PREDICTED: protein yippee-like                     195   4e-58   
ref|XP_004305129.1|  PREDICTED: protein yippee-like                     195   4e-58   
ref|XP_006848191.1|  hypothetical protein AMTR_s00029p00239230          194   5e-58   
ref|XP_010543218.1|  PREDICTED: protein yippee-like At3g08990           194   6e-58   
emb|CDY00730.1|  BnaC03g37140D                                          194   8e-58   
ref|XP_002528110.1|  fad NAD binding oxidoreductases, putative          193   2e-57   Ricinus communis
ref|XP_004147886.1|  PREDICTED: protein yippee-like                     192   3e-57   
ref|XP_010464526.1|  PREDICTED: protein yippee-like At3g08990 iso...    192   7e-57   
ref|XP_002526887.1|  fad NAD binding oxidoreductases, putative          191   1e-56   Ricinus communis
ref|XP_002882596.1|  yippee family protein                              190   2e-56   
ref|XP_010552875.1|  PREDICTED: protein yippee-like At3g11230 iso...    189   8e-56   
ref|XP_010534586.1|  PREDICTED: protein yippee-like isoform X2          189   1e-55   
ref|XP_010552876.1|  PREDICTED: protein yippee-like At3g11230 iso...    188   1e-55   
ref|XP_010534594.1|  PREDICTED: protein yippee-like isoform X3          188   1e-55   
ref|XP_009588560.1|  PREDICTED: protein yippee-like                     188   2e-55   
ref|XP_010534585.1|  PREDICTED: protein yippee-like At3g55890 iso...    189   2e-55   
ref|XP_010534587.1|  PREDICTED: protein yippee-like At3g55890 iso...    188   3e-55   
ref|XP_004249078.1|  PREDICTED: protein yippee-like                     187   4e-55   
ref|XP_010467712.1|  PREDICTED: protein yippee-like At3g08990           187   5e-55   
ref|XP_009760319.1|  PREDICTED: protein yippee-like isoform X1          187   6e-55   
ref|XP_009758232.1|  PREDICTED: protein yippee-like                     186   1e-54   
emb|CAN76144.1|  hypothetical protein VITISV_024928                     185   2e-54   Vitis vinifera
ref|XP_009612245.1|  PREDICTED: protein yippee-like                     185   2e-54   
ref|XP_007009018.1|  Yippee family zinc-binding protein, putative...    185   3e-54   
ref|XP_006349458.1|  PREDICTED: protein yippee-like isoform X1          186   3e-54   
ref|XP_007026732.1|  Yippee family zinc-binding protein, putative...    186   3e-54   
emb|CDP12662.1|  unnamed protein product                                184   3e-54   
ref|XP_002271449.1|  PREDICTED: protein yippee-like isoform X2          184   4e-54   Vitis vinifera
ref|XP_002279771.1|  PREDICTED: protein yippee-like                     184   4e-54   Vitis vinifera
ref|XP_006349459.1|  PREDICTED: protein yippee-like isoform X2          184   5e-54   
ref|XP_009760320.1|  PREDICTED: protein yippee-like isoform X2          184   7e-54   
ref|XP_010543737.1|  PREDICTED: protein yippee-like At3g11230 iso...    183   8e-54   
emb|CDY36308.1|  BnaA01g31100D                                          183   1e-53   
ref|XP_009344714.1|  PREDICTED: protein yippee-like                     182   2e-53   
ref|NP_187511.2|  yippee family putative zinc-binding protein           182   3e-53   Arabidopsis thaliana [mouse-ear cress]
ref|NP_973645.1|  Yippee family putative zinc-binding protein           181   4e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009122309.1|  PREDICTED: protein yippee-like At3g11230           181   5e-53   
gb|EYU26657.1|  hypothetical protein MIMGU_mgv1a016231mg                181   1e-52   
ref|XP_009146961.1|  PREDICTED: protein yippee-like At3g08990           179   3e-52   
ref|XP_003552239.1|  PREDICTED: protein yippee-like isoform X1          179   3e-52   
ref|XP_010688132.1|  PREDICTED: protein yippee-like At3g08990           179   7e-52   
ref|XP_003623290.1|  Protein yippee-like protein                        178   1e-51   
ref|XP_004492429.1|  PREDICTED: protein yippee-like At3g08990-lik...    176   4e-51   
emb|CDY36324.1|  BnaA01g30940D                                          177   4e-51   
gb|AES71126.2|  yippee family zinc-binding protein, putative            175   1e-50   
emb|CDY44673.1|  BnaA05g29330D                                          175   2e-50   
ref|XP_004490981.1|  PREDICTED: protein yippee-like isoform X1          175   4e-50   
ref|XP_010427390.1|  PREDICTED: protein yippee-like At3g55890           173   6e-50   
ref|XP_006292054.1|  hypothetical protein CARUB_v10018247mg             173   9e-50   
emb|CDY53089.1|  BnaCnng24190D                                          177   2e-49   
ref|XP_009782005.1|  PREDICTED: protein yippee-like isoform X2          172   2e-49   
ref|XP_009116284.1|  PREDICTED: protein yippee-like At3g55890           172   2e-49   
ref|XP_006300037.1|  hypothetical protein CARUB_v10016261mg             172   5e-49   
ref|XP_010504461.1|  PREDICTED: protein yippee-like At3g55890           171   5e-49   
gb|KCW50499.1|  hypothetical protein EUGRSUZ_J00225                     171   5e-49   
gb|EPS67581.1|  hypothetical protein M569_07194                         171   5e-49   
ref|XP_010516179.1|  PREDICTED: protein yippee-like At3g55890           170   8e-49   
ref|NP_191148.1|  yippee family putative zinc-binding protein           170   1e-48   Arabidopsis thaliana [mouse-ear cress]
emb|CDX72191.1|  BnaC08g26830D                                          169   3e-48   
ref|XP_006362996.1|  PREDICTED: protein yippee-like                     168   3e-48   
gb|ADE77469.1|  unknown                                                 169   4e-48   
ref|XP_003577629.1|  PREDICTED: protein yippee-like                     169   4e-48   
dbj|BAK03540.1|  predicted protein                                      168   9e-48   
ref|XP_006403402.1|  hypothetical protein EUTSA_v10010822mg             168   9e-48   
ref|XP_008802789.1|  PREDICTED: protein yippee-like                     166   3e-47   
ref|XP_010318253.1|  PREDICTED: protein yippee-like isoform X1          167   4e-47   
gb|AAD56315.1|AC009326_2  Yippee-like protein                           165   5e-47   Arabidopsis thaliana [mouse-ear cress]
gb|ACO87677.1|  yippee-like protein                                     166   7e-47   Brachypodium sylvaticum
ref|XP_010318254.1|  PREDICTED: protein yippee-like isoform X3          164   2e-46   
ref|XP_010256558.1|  PREDICTED: protein yippee-like                     163   4e-46   
gb|EMS65691.1|  hypothetical protein TRIUR3_29370                       164   5e-46   
ref|XP_011043653.1|  PREDICTED: protein yippee-like isoform X1          164   5e-46   
ref|XP_011098279.1|  PREDICTED: protein yippee-like At5g53940           162   9e-46   
ref|XP_008363614.1|  PREDICTED: protein yippee-like At5g53940           161   3e-45   
ref|XP_009760920.1|  PREDICTED: protein yippee-like At5g53940           160   6e-45   
ref|XP_009586618.1|  PREDICTED: protein yippee-like At5g53940           160   6e-45   
ref|XP_009419733.1|  PREDICTED: protein yippee-like isoform X2          160   8e-45   
gb|KFK34830.1|  hypothetical protein AALP_AA5G198700                    160   8e-45   
ref|XP_001774860.1|  predicted protein                                  160   9e-45   
ref|XP_009795869.1|  PREDICTED: protein yippee-like At5g53940           160   1e-44   
ref|XP_001756273.1|  predicted protein                                  159   1e-44   
ref|XP_009103975.1|  PREDICTED: protein yippee-like At3g55890           159   2e-44   
ref|XP_002282618.2|  PREDICTED: protein yippee-like At5g53940           159   2e-44   Vitis vinifera
ref|XP_001761099.1|  predicted protein                                  159   3e-44   
gb|EYU44969.1|  hypothetical protein MIMGU_mgv1a016305mg                158   4e-44   
ref|XP_010555759.1|  PREDICTED: protein yippee-like At5g53940           158   5e-44   
ref|XP_010272366.1|  PREDICTED: protein yippee-like At5g53940 iso...    158   7e-44   
gb|ADE75788.1|  unknown                                                 157   7e-44   
ref|XP_004251867.1|  PREDICTED: protein yippee-like At5g53940           157   8e-44   
ref|XP_001777844.1|  predicted protein                                  157   9e-44   
ref|XP_006358970.1|  PREDICTED: protein yippee-like At5g53940-like      157   1e-43   
ref|XP_006451783.1|  hypothetical protein CICLE_v10009870mg             157   1e-43   
ref|XP_006451784.1|  hypothetical protein CICLE_v10009870mg             157   1e-43   
ref|XP_003628551.1|  Protein yippee-like protein                        157   2e-43   
gb|KDP45867.1|  hypothetical protein JCGZ_15311                         156   2e-43   
ref|XP_002876341.1|  yippee family protein                              156   3e-43   
ref|XP_007133235.1|  hypothetical protein PHAVU_011G163000g             156   3e-43   
ref|XP_009596207.1|  PREDICTED: protein yippee-like At5g53940 iso...    155   5e-43   
gb|EPS57708.1|  hypothetical protein M569_17109                         154   7e-43   
ref|XP_009356776.1|  PREDICTED: protein yippee-like At5g53940           155   7e-43   
ref|XP_003543228.1|  PREDICTED: protein yippee-like At5g53940-like      155   9e-43   
ref|NP_001237190.1|  uncharacterized protein LOC100305822               155   9e-43   
ref|XP_007021557.1|  Yippee family zinc-binding protein, putative...    155   1e-42   
ref|XP_011029524.1|  PREDICTED: protein yippee-like At5g53940           154   1e-42   
ref|XP_004244248.1|  PREDICTED: protein yippee-like At5g53940           154   1e-42   
ref|XP_006348269.1|  PREDICTED: protein yippee-like At5g53940-lik...    154   2e-42   
ref|XP_006348268.1|  PREDICTED: protein yippee-like At5g53940-lik...    154   2e-42   
ref|XP_008226492.1|  PREDICTED: protein yippee-like At5g53940           154   2e-42   
ref|XP_007212220.1|  hypothetical protein PRUPE_ppa013293mg             154   3e-42   
gb|KDO49240.1|  hypothetical protein CISIN_1g030967mg                   155   3e-42   
gb|KEH38682.1|  yippee family zinc-binding protein, putative            153   4e-42   
ref|XP_010928868.1|  PREDICTED: protein yippee-like At5g53940 iso...    153   5e-42   
emb|CDP05948.1|  unnamed protein product                                152   7e-42   
ref|XP_006826504.1|  hypothetical protein AMTR_s00004p00261790          152   8e-42   
ref|XP_010686417.1|  PREDICTED: protein yippee-like At5g53940           152   1e-41   
ref|XP_002984164.1|  hypothetical protein SELMODRAFT_268836             152   1e-41   
ref|NP_001150808.1|  protein yippee-like                                152   2e-41   Zea mays [maize]
ref|XP_010318372.1|  PREDICTED: protein yippee-like                     152   2e-41   
ref|XP_010675478.1|  PREDICTED: protein yippee-like At5g53940 iso...    151   3e-41   
emb|CDY46517.1|  BnaC06g15680D                                          151   3e-41   
tpg|DAA50816.1|  TPA: protein yippee-like protein                       151   3e-41   
ref|XP_002972250.1|  hypothetical protein SELMODRAFT_148358             151   3e-41   
gb|ABK25918.1|  unknown                                                 151   3e-41   Picea sitchensis
ref|XP_010111189.1|  hypothetical protein L484_015073                   150   5e-41   
ref|XP_006367369.1|  PREDICTED: protein yippee-like                     149   5e-41   
ref|XP_010060617.1|  PREDICTED: protein yippee-like At5g53940           150   6e-41   
ref|XP_004510026.1|  PREDICTED: protein yippee-like At5g53940-lik...    150   7e-41   
gb|AFK35590.1|  unknown                                                 150   7e-41   
ref|NP_001237913.1|  uncharacterized protein LOC100306635               150   8e-41   
ref|XP_008463693.1|  PREDICTED: protein yippee-like At5g53940           149   1e-40   
ref|NP_001151841.1|  protein yippee-like                                149   2e-40   Zea mays [maize]
gb|KFK27010.1|  hypothetical protein AALP_AA8G322700                    149   2e-40   
ref|XP_009596205.1|  PREDICTED: protein yippee-like At5g53940 iso...    149   2e-40   
ref|XP_006348270.1|  PREDICTED: protein yippee-like At5g53940-like      149   3e-40   
ref|XP_004146051.1|  PREDICTED: protein yippee-like At5g53940-like      148   3e-40   
ref|XP_009119933.1|  PREDICTED: protein yippee-like At5g53940           148   3e-40   
ref|XP_011047446.1|  PREDICTED: protein yippee-like At3g11230           149   4e-40   
ref|XP_009127128.1|  PREDICTED: protein yippee-like At5g53940           147   6e-40   
ref|XP_006401642.1|  hypothetical protein EUTSA_v10015019mg             147   8e-40   
ref|XP_006435716.1|  hypothetical protein CICLE_v10033070mg             146   9e-40   
ref|XP_010272365.1|  PREDICTED: protein yippee-like At5g53940 iso...    147   1e-39   
ref|XP_002509443.1|  fad NAD binding oxidoreductases, putative          147   1e-39   Ricinus communis
ref|XP_009342807.1|  PREDICTED: protein yippee-like At5g53940 iso...    147   1e-39   
ref|XP_004982092.1|  PREDICTED: protein yippee-like At3g08990-like      146   1e-39   
ref|XP_010446313.1|  PREDICTED: protein yippee-like At5g53940           147   1e-39   
ref|XP_002866007.1|  yippee family protein                              146   1e-39   
ref|XP_010442968.1|  PREDICTED: protein yippee-like At5g53940           146   2e-39   
ref|XP_006281269.1|  hypothetical protein CARUB_v10027317mg             147   2e-39   
ref|XP_004500678.1|  PREDICTED: protein yippee-like isoform X1          146   3e-39   
ref|XP_002323573.1|  Yippee-like family protein                         146   3e-39   Populus trichocarpa [western balsam poplar]
ref|NP_200205.1|  yippee-like zinc-binding protein                      145   4e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004293858.1|  PREDICTED: protein yippee-like At5g53940-like      145   6e-39   
emb|CDY28806.1|  BnaA02g09980D                                          147   1e-38   
gb|KCW67396.1|  hypothetical protein EUGRSUZ_F01163                     144   1e-38   
ref|XP_010052288.1|  PREDICTED: protein yippee-like At5g53940 iso...    144   2e-38   
ref|XP_002442626.1|  hypothetical protein SORBIDRAFT_08g023220          144   3e-38   Sorghum bicolor [broomcorn]
ref|XP_008371402.1|  PREDICTED: protein yippee-like At5g53940 iso...    142   4e-38   
ref|XP_010549584.1|  PREDICTED: protein yippee-like isoform X3          141   5e-38   
gb|EPS63678.1|  hypothetical protein M569_11105                         142   6e-38   
tpg|DAA47725.1|  TPA: protein yippee-like protein                       142   1e-37   
ref|NP_001150387.1|  LOC100284017                                       142   1e-37   Zea mays [maize]
ref|XP_002969467.1|  hypothetical protein SELMODRAFT_91634              140   2e-37   
ref|XP_004368245.1|  Protein yippeelike 1, putative                     140   2e-37   
ref|XP_008789830.1|  PREDICTED: protein yippee-like At5g53940           138   8e-37   
ref|XP_009397202.1|  PREDICTED: protein yippee-like At5g53940           139   8e-37   
ref|XP_004162926.1|  PREDICTED: protein yippee-like At5g53940-like      139   1e-36   
ref|XP_008225133.1|  PREDICTED: protein yippee-like At5g53940           139   1e-36   
ref|XP_007159353.1|  hypothetical protein PHAVU_002G230900g             139   2e-36   
ref|XP_008442812.1|  PREDICTED: protein yippee-like At5g53940           138   3e-36   
ref|XP_007212229.1|  hypothetical protein PRUPE_ppa013364mg             138   3e-36   
ref|XP_004146613.1|  PREDICTED: protein yippee-like At5g53940-like      137   4e-36   
ref|XP_010658289.1|  PREDICTED: protein yippee-like isoform X3          136   4e-36   
ref|XP_010658287.1|  PREDICTED: protein yippee-like isoform X1          137   6e-36   
ref|XP_006844294.1|  hypothetical protein AMTR_s00145p00105880          137   8e-36   
ref|XP_002507146.1|  yippee zinc-binding-like protein                   135   1e-35   Micromonas commoda
ref|XP_010923056.1|  PREDICTED: protein yippee-like isoform X3          135   1e-35   
ref|XP_009352872.1|  PREDICTED: protein yippee-like At5g53940           136   1e-35   
gb|KDO77663.1|  hypothetical protein CISIN_1g032714mg                   135   2e-35   
ref|XP_010908536.1|  PREDICTED: protein yippee-like isoform X3          135   2e-35   
ref|XP_010908534.1|  PREDICTED: protein yippee-like isoform X1          135   2e-35   
dbj|BAD43904.1|  zinc-binding protein-like                              135   2e-35   
gb|KHN34730.1|  Protein yippee-like                                     134   2e-35   
ref|XP_008358677.1|  PREDICTED: protein yippee-like At5g53940           135   2e-35   
gb|EYU20020.1|  hypothetical protein MIMGU_mgv1a016206mg                134   2e-35   
ref|XP_004963346.1|  PREDICTED: protein yippee-like At3g08990-like      136   3e-35   
ref|XP_006449388.1|  hypothetical protein CICLE_v10017171mg             135   3e-35   
gb|AFK48494.1|  unknown                                                 134   3e-35   
ref|NP_001238206.1|  uncharacterized protein LOC100499933               135   4e-35   
ref|XP_010318250.1|  PREDICTED: protein yippee-like                     133   6e-35   
ref|XP_003542735.1|  PREDICTED: uncharacterized LOC100305833            134   7e-35   
gb|AFK37305.1|  unknown                                                 134   8e-35   
ref|XP_004505081.1|  PREDICTED: protein yippee-like At5g53940-like      134   1e-34   
gb|EUC61756.1|  yippee zinc-binding/DNA-binding/Mis18, centromere...    133   1e-34   
ref|XP_002961237.1|  hypothetical protein SELMODRAFT_74962              132   2e-34   
ref|XP_001694372.1|  predicted protein                                  132   2e-34   
ref|XP_002973986.1|  hypothetical protein SELMODRAFT_100523             132   4e-34   
ref|XP_005847110.1|  hypothetical protein CHLNCDRAFT_134827             130   9e-34   
ref|XP_005704545.1|  hypothetical protein Gasu_45230                    130   2e-33   
ref|XP_004338414.1|  Yippee putative zincbinding protein                130   2e-33   
ref|XP_001702057.1|  predicted protein                                  130   2e-33   
ref|XP_006677792.1|  hypothetical protein BATDEDRAFT_16398              129   3e-33   
ref|XP_005651784.1|  yippee-like protein                                129   4e-33   
ref|XP_002952928.1|  hypothetical protein VOLCADRAFT_82034              129   5e-33   
ref|XP_006429354.1|  hypothetical protein CICLE_v100131022mg            127   9e-33   
ref|XP_004244247.1|  PREDICTED: protein yippee-like At5g53940 iso...    129   1e-32   
gb|EPS57426.1|  yippee family protein                                   127   2e-32   
ref|XP_009407959.1|  PREDICTED: protein yippee-like At4g27745           127   2e-32   
ref|XP_005536449.1|  hypothetical protein, conserved                    127   2e-32   
ref|XP_002956953.1|  hypothetical protein VOLCADRAFT_77361              127   2e-32   
ref|XP_004958144.1|  PREDICTED: putative yippee-like protein Os10...    127   3e-32   
ref|XP_005834852.1|  hypothetical protein GUITHDRAFT_106421             127   3e-32   
ref|XP_010318371.1|  PREDICTED: protein yippee-like                     126   3e-32   
gb|ESA09300.1|  hypothetical protein GLOINDRAFT_30705                   126   4e-32   
ref|XP_010318245.1|  PREDICTED: protein yippee-like isoform X1          125   4e-32   
ref|XP_005832130.1|  hypothetical protein GUITHDRAFT_71470              126   6e-32   
gb|EMS23546.1|  Yippee-like protein                                     125   8e-32   
gb|EMS62799.1|  hypothetical protein TRIUR3_07444                       128   2e-31   
ref|XP_007021558.1|  Yippee family zinc-binding protein, putative...    125   2e-31   
ref|XP_002267218.1|  PREDICTED: protein yippee-like At4g27745           124   2e-31   
ref|NP_001060117.1|  Os07g0584000                                       124   3e-31   
gb|EWM24716.1|  yippee-like protein                                     124   3e-31   
ref|XP_006657890.1|  PREDICTED: putative yippee-like protein Os10...    124   4e-31   
ref|XP_003351573.1|  hypothetical protein SMAC_00114                    127   4e-31   
ref|XP_004145943.1|  PREDICTED: protein yippee-like At4g27745-like      123   6e-31   
ref|XP_002518891.1|  fad NAD binding oxidoreductases, putative          123   8e-31   
ref|XP_003616623.1|  Yippee-like protein                                122   8e-31   
ref|XP_007860277.1|  yippee-like protein                                123   8e-31   
ref|XP_003195493.1|  hypothetical protein CGB_G1670C                    123   1e-30   
gb|EPB88278.1|  hypothetical protein HMPREF1544_04862                   123   1e-30   
emb|CCA74243.1|  related to Yippee protein                              122   1e-30   
ref|XP_002280984.1|  PREDICTED: protein yippee-like At4g27745           122   1e-30   
ref|XP_003562816.1|  PREDICTED: putative yippee-like protein Os10...    122   1e-30   
ref|XP_010055998.1|  PREDICTED: protein yippee-like At4g27745           122   1e-30   
ref|XP_009773717.1|  PREDICTED: protein yippee-like At4g27745           122   1e-30   
ref|XP_003283514.1|  hypothetical protein DICPUDRAFT_96394              123   1e-30   
gb|KCW72565.1|  hypothetical protein EUGRSUZ_E01033                     125   2e-30   
dbj|BAJ86474.1|  predicted protein                                      122   2e-30   
gb|EPS99128.1|  hypothetical protein FOMPIDRAFT_1024349                 122   2e-30   
ref|XP_001352126.1|  zinc-binding protein (Yippee), putative            122   2e-30   
ref|XP_001614789.1|  hypothetical protein                               122   2e-30   
gb|EJU00990.1|  yippee-like protein                                     121   2e-30   
ref|XP_002275406.1|  PREDICTED: protein yippee-like At4g27745           121   2e-30   
ref|XP_002268209.3|  PREDICTED: putative yippee-like protein Os10...    121   3e-30   
ref|XP_002258526.1|  zinc binding protein                               122   3e-30   
ref|XP_009383201.1|  PREDICTED: protein yippee-like At4g27745 iso...    121   3e-30   
ref|XP_572071.1|  yippee-like                                           122   3e-30   
ref|XP_774490.1|  hypothetical protein CNBG1360                         122   3e-30   
gb|KIK49614.1|  hypothetical protein CY34DRAFT_69453                    121   3e-30   
gb|KDQ54739.1|  hypothetical protein JAAARDRAFT_347172                  121   3e-30   
dbj|GAA94455.1|  hypothetical protein E5Q_01107                         122   3e-30   
gb|KDQ12786.1|  hypothetical protein BOTBODRAFT_112427                  121   4e-30   
ref|XP_003333014.1|  peptidylprolyl isomerase                           121   4e-30   
gb|KIK26617.1|  hypothetical protein PISMIDRAFT_28499                   121   4e-30   
ref|XP_008806946.1|  PREDICTED: protein yippee-like At4g27745           120   5e-30   
gb|KIM28983.1|  hypothetical protein M408DRAFT_329027                   121   5e-30   
ref|XP_011026804.1|  PREDICTED: protein yippee-like At4g27745           120   5e-30   
ref|XP_009599570.1|  PREDICTED: protein yippee-like At4g27745           120   5e-30   
ref|XP_004828581.1|  yippee zinc binding protein family member pr...    121   5e-30   
ref|XP_957011.1|  hypothetical protein NCU00024                         124   6e-30   
gb|AFR96459.1|  hypothetical protein CNAG_03233                         121   6e-30   
gb|KIK05603.1|  hypothetical protein K443DRAFT_91057                    120   6e-30   
ref|XP_007312191.1|  hypothetical protein SERLADRAFT_454647             120   6e-30   
ref|XP_002318443.1|  Yippee-like family protein                         120   6e-30   
gb|AFR96455.2|  hypothetical protein CNAG_03230                         121   6e-30   
gb|KDP25234.1|  hypothetical protein JCGZ_20390                         120   6e-30   
ref|XP_009850812.1|  hypothetical protein NEUTE1DRAFT_62849             124   7e-30   
ref|XP_009603481.1|  PREDICTED: protein yippee-like At5g53940           120   8e-30   
ref|XP_003577466.1|  PREDICTED: protein yippee-like At4g27745           120   8e-30   
ref|XP_007413936.1|  hypothetical protein MELLADRAFT_49731              120   9e-30   
gb|KIM48403.1|  hypothetical protein M413DRAFT_230726                   120   9e-30   
ref|XP_572028.1|  yippee-like                                           121   9e-30   
ref|XP_011101002.1|  PREDICTED: protein yippee-like At4g27745           120   9e-30   
ref|XP_009358682.1|  PREDICTED: protein yippee-like At4g27745           120   9e-30   
gb|KIJ68643.1|  hypothetical protein HYDPIDRAFT_82501                   120   9e-30   
gb|KDR84790.1|  hypothetical protein GALMADRAFT_217852                  120   1e-29   
gb|EMD41727.1|  hypothetical protein CERSUDRAFT_79364                   120   1e-29   
emb|CCI45053.1|  unnamed protein product                                120   1e-29   
gb|KGB76521.1|  hypothetical protein CNBG_2359                          120   1e-29   
ref|XP_010091865.1|  hypothetical protein L484_009477                   119   1e-29   
ref|XP_010252677.1|  PREDICTED: protein yippee-like At4g27745           119   1e-29   
ref|XP_008351275.1|  PREDICTED: protein yippee-like At4g27745           119   1e-29   
ref|XP_003536177.1|  PREDICTED: protein yippee-like At4g27745-like      119   1e-29   
ref|XP_002450944.1|  hypothetical protein SORBIDRAFT_05g021470          119   1e-29   
ref|XP_007842395.1|  yippee zinc-binding protein                        119   1e-29   
gb|EPS61765.1|  hypothetical protein M569_13029                         119   1e-29   
gb|KDE02804.1|  hypothetical protein MVLG_06663                         119   1e-29   
ref|XP_004979456.1|  PREDICTED: protein yippee-like At4g27745-lik...    119   2e-29   
ref|NP_001068080.1|  Os11g0551800                                       119   2e-29   
ref|XP_006454773.1|  hypothetical protein AGABI2DRAFT_190009            119   2e-29   
gb|KFH66488.1|  peptidylprolyl isomerase                                119   2e-29   
ref|XP_001874277.1|  predicted protein                                  119   2e-29   
ref|XP_010094688.1|  hypothetical protein L484_004265                   119   2e-29   
ref|XP_010928877.1|  PREDICTED: protein yippee-like At5g53940 iso...    119   2e-29   
ref|XP_009358676.1|  PREDICTED: protein yippee-like At4g27745           119   2e-29   
gb|KFO78512.1|  Protein yippee-like 4                                   119   2e-29   
ref|XP_008343795.1|  PREDICTED: protein yippee-like At4g27745           119   2e-29   
ref|XP_009785819.1|  PREDICTED: protein yippee-like At4g27745           119   2e-29   
ref|XP_008031882.1|  yippee-like protein                                119   2e-29   
ref|XP_002297955.1|  Yippee-like family protein                         119   2e-29   
ref|XP_009625123.1|  PREDICTED: protein yippee-like At4g27745           119   2e-29   
ref|XP_002321386.1|  Yippee-like family protein                         119   2e-29   
ref|XP_005046637.1|  PREDICTED: protein yippee-like 4                   121   2e-29   
ref|XP_009608027.1|  PREDICTED: protein yippee-like At4g27745           119   2e-29   
emb|CCM02181.1|  predicted protein                                      119   2e-29   
ref|XP_007265935.1|  yippee-like protein                                119   2e-29   
ref|XP_003206393.2|  PREDICTED: protein yippee-like 4                   119   2e-29   
gb|KDQ30542.1|  hypothetical protein PLEOSDRAFT_1095966                 119   2e-29   
gb|KGB76519.1|  hypothetical protein CNBG_2357                          120   2e-29   
ref|XP_005408058.1|  PREDICTED: protein yippee-like 4 isoform X1        119   2e-29   
ref|XP_002515651.1|  fad NAD binding oxidoreductases, putative          119   3e-29   
gb|KFO97725.1|  Protein yippee-like 4                                   119   3e-29   
ref|XP_009398714.1|  PREDICTED: protein yippee-like At4g27745           119   3e-29   
ref|XP_007212252.1|  hypothetical protein PRUPE_ppa013649mg             119   3e-29   
gb|KIJ21537.1|  hypothetical protein PAXINDRAFT_63280                   119   3e-29   
ref|XP_006663543.1|  PREDICTED: protein yippee-like At4g27745-like      120   3e-29   
ref|XP_006439252.1|  hypothetical protein CICLE_v10022980mg             119   3e-29   
ref|XP_008227458.1|  PREDICTED: putative yippee-like protein Os10...    119   3e-29   
ref|XP_006441167.1|  hypothetical protein CICLE_v10022976mg             119   3e-29   
ref|XP_003641379.1|  PREDICTED: protein yippee-like 4                   120   3e-29   
ref|XP_647468.2|  yippee-like protein                                   119   3e-29   
ref|NP_001066778.1|  Os12g0484700                                       119   3e-29   
ref|XP_008234695.1|  PREDICTED: protein yippee-like At4g27745           119   3e-29   
ref|XP_010267494.1|  PREDICTED: protein yippee-like At4g27745           118   3e-29   
ref|XP_005529052.1|  PREDICTED: protein yippee-like 4                   119   3e-29   
emb|CDI97675.1|  yippee protein                                         120   3e-29   
gb|EYU45283.1|  hypothetical protein MIMGU_mgv1a016794mg                118   3e-29   
ref|XP_007026290.1|  Yippee family zinc-binding protein, putative       119   3e-29   
gb|KIM67087.1|  hypothetical protein SCLCIDRAFT_14215                   118   4e-29   
emb|CDS24029.1|  yippee protein                                         120   4e-29   
ref|XP_008356553.1|  PREDICTED: protein yippee-like At4g27745           118   4e-29   
emb|CDS32299.1|  yippee protein                                         120   4e-29   
ref|XP_008504256.1|  PREDICTED: protein yippee-like 4                   119   4e-29   
ref|XP_007003123.1|  hypothetical protein TREMEDRAFT_73283              119   4e-29   
ref|XP_007039121.1|  Yippee family zinc-binding protein, putative...    118   4e-29   
ref|XP_011044686.1|  PREDICTED: protein yippee-like At4g27745           118   4e-29   
ref|NP_001237730.1|  uncharacterized protein LOC100527552               118   4e-29   
emb|CCA22058.1|  conserved hypothetical protein                         118   4e-29   
gb|EAR94563.2|  yippee zinc-binding protein, putative                   118   4e-29   
ref|XP_004234994.1|  PREDICTED: protein yippee-like At4g27745           118   4e-29   
ref|XP_006580965.1|  PREDICTED: uncharacterized protein LOC100527...    118   4e-29   
gb|KII93662.1|  hypothetical protein PLICRDRAFT_49685                   118   5e-29   
ref|XP_006491966.1|  PREDICTED: protein yippee-like At4g27745-lik...    118   5e-29   
ref|XP_010909030.1|  PREDICTED: putative yippee-like protein Os10...    118   5e-29   
ref|XP_010919302.1|  PREDICTED: protein yippee-like At4g27745           118   5e-29   
gb|KDP27468.1|  hypothetical protein JCGZ_20124                         118   5e-29   
ref|XP_010566359.1|  PREDICTED: protein yippee-like 4                   119   5e-29   
gb|KIK98497.1|  hypothetical protein PAXRUDRAFT_134060                  118   5e-29   
ref|XP_007360043.1|  yippee-like protein                                118   6e-29   
ref|XP_002523301.1|  fad NAD binding oxidoreductases, putative          118   6e-29   
gb|ESZ97606.1|  putative proteim yippee-like 3                          118   6e-29   
ref|XP_008815516.1|  hypothetical protein C922_01691                    118   6e-29   
ref|XP_010686664.1|  PREDICTED: putative yippee-like protein Os10...    118   6e-29   
ref|XP_007378518.1|  yippee-like protein                                118   6e-29   
ref|XP_008384160.1|  PREDICTED: putative yippee-like protein Os10...    118   6e-29   
ref|XP_001777098.1|  predicted protein                                  118   6e-29   
emb|CCG83203.1|  Putative uncharacterized protein                       118   6e-29   
ref|XP_007220482.1|  hypothetical protein PRUPE_ppa013726mg             117   6e-29   
ref|XP_009415723.1|  PREDICTED: putative yippee-like protein Os10...    118   7e-29   
ref|XP_004962673.1|  PREDICTED: protein yippee-like At4g27745-like      117   7e-29   
gb|EPQ65798.1|  hypothetical protein BGT96224_3711                      117   7e-29   
ref|XP_001775580.1|  predicted protein                                  118   7e-29   
ref|XP_006449886.1|  hypothetical protein CICLE_v10016709mg             120   7e-29   
ref|XP_003055737.1|  predicted protein                                  118   7e-29   
ref|NP_001235124.1|  uncharacterized protein LOC100306443               117   7e-29   
ref|XP_006664021.1|  PREDICTED: protein yippee-like At4g27745-like      117   8e-29   
ref|XP_010606692.1|  PREDICTED: protein yippee-like 4                   119   8e-29   
ref|XP_010676876.1|  PREDICTED: protein yippee-like At4g27745 iso...    119   9e-29   
gb|AAF07828.1|AC010871_4  yippee-like protein                           117   9e-29   
ref|XP_006033479.1|  PREDICTED: protein yippee-like 4                   118   9e-29   
dbj|GAA53838.1|  hypothetical protein CLF_111277                        119   9e-29   
ref|XP_010324376.1|  PREDICTED: uncharacterized protein LOC101259...    122   9e-29   
emb|CCD76216.1|  unnamed protein product                                119   9e-29   
ref|XP_009351959.1|  PREDICTED: protein yippee-like At4g27745           117   1e-28   
ref|XP_003215010.1|  PREDICTED: protein yippee-like 4                   118   1e-28   
gb|EMT14612.1|  hypothetical protein F775_29848                         118   1e-28   
ref|XP_001511683.1|  PREDICTED: protein yippee-like 4                   118   1e-28   
ref|XP_009562373.1|  PREDICTED: protein yippee-like 4                   119   1e-28   
ref|XP_004240076.1|  PREDICTED: protein yippee-like At4g27745           117   1e-28   
gb|ETB60171.1|  hypothetical protein YYC_02510                          118   1e-28   
ref|XP_009166924.1|  hypothetical protein T265_13391                    119   1e-28   
gb|ABA98518.1|  Yippee-like protein At4g27740, putative                 117   1e-28   
ref|XP_010908585.1|  PREDICTED: putative yippee-like protein Os10...    117   1e-28   
ref|XP_009374880.1|  PREDICTED: putative yippee-like protein Os10...    117   1e-28   
ref|XP_002304574.2|  Yippee-like family protein                         117   1e-28   
ref|XP_004645827.1|  PREDICTED: protein yippee-like 4                   117   1e-28   
ref|XP_003576376.1|  PREDICTED: protein yippee-like At4g27745           117   1e-28   
ref|XP_007423131.1|  PREDICTED: protein yippee-like 4                   117   1e-28   
gb|EMF16227.1|  yippee-like protein                                     117   1e-28   
ref|XP_010324374.1|  PREDICTED: uncharacterized protein LOC101259...    122   1e-28   
ref|XP_680052.1|  hypothetical protein                                  117   1e-28   
ref|XP_010324375.1|  PREDICTED: uncharacterized protein LOC101259...    122   1e-28   
ref|XP_008800641.1|  PREDICTED: putative yippee-like protein Os10...    117   1e-28   
ref|XP_006214124.1|  PREDICTED: protein yippee-like 4                   117   1e-28   
ref|XP_005891201.1|  PREDICTED: protein yippee-like 4                   117   1e-28   
ref|XP_010676877.1|  PREDICTED: protein yippee-like At4g27745 iso...    117   1e-28   
ref|XP_005295010.1|  PREDICTED: protein yippee-like 4                   117   1e-28   



>emb|CDP14033.1| unnamed protein product [Coffea canephora]
Length=129

 Score =   237 bits (604),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 108/129 (84%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFVV+LEGK+Y CKHCGTHLA+ EDI+SK+FQCRHGKAYLFNKV NVT+G+ E+RMM
Sbjct  1    MGRLFVVSLEGKIYCCKHCGTHLALWEDIVSKSFQCRHGKAYLFNKVANVTAGEKEERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TGLHTVADIFCVRCGSIVGWKYETA+EK QKYKEG+SVLERFKISGPDG+NYW +HEA 
Sbjct  61   MTGLHTVADIFCVRCGSIVGWKYETAHEKGQKYKEGKSVLERFKISGPDGSNYWTSHEAY  120

Query  361  VAGSDADDV  335
            V GSDADDV
Sbjct  121  VGGSDADDV  129



>ref|XP_010534588.1| PREDICTED: protein yippee-like isoform X4 [Tarenaya hassleriana]
 ref|XP_010534589.1| PREDICTED: protein yippee-like isoform X4 [Tarenaya hassleriana]
 ref|XP_010534593.1| PREDICTED: protein yippee-like isoform X2 [Tarenaya hassleriana]
Length=139

 Score =   233 bits (593),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -3

Query  727  KEMGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDR  548
            ++MGRLFVVNLEGK+YSCKHC THLAV EDI+SK+F CRHGKAYLFNKVVNV+ G+NEDR
Sbjct  9    RKMGRLFVVNLEGKIYSCKHCKTHLAVYEDIISKSFHCRHGKAYLFNKVVNVSMGENEDR  68

Query  547  MMTTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHE  368
            MM TGLHTVADIFCV CGSIVGW+YE A+EK QKYKEG+SVLERFKISGPDG+NYWI+H 
Sbjct  69   MMMTGLHTVADIFCVGCGSIVGWRYEMAHEKSQKYKEGKSVLERFKISGPDGSNYWISHG  128

Query  367  ARVAGSDADD  338
              V GSDADD
Sbjct  129  THVGGSDADD  138



>ref|XP_002526899.1| fad NAD binding oxidoreductases, putative [Ricinus communis]
 gb|EEF35530.1| fad NAD binding oxidoreductases, putative [Ricinus communis]
Length=129

 Score =   232 bits (591),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/128 (84%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFVVNLEGK+YSCKHC THLAV EDI+SK+F  RHGKAYLFNKVVNV+ G NE+RMM
Sbjct  1    MGRLFVVNLEGKIYSCKHCRTHLAVYEDIVSKSFTSRHGKAYLFNKVVNVSVGVNEERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TGLHTVADIFCV CGSIVGWKYETA+EK QKYKEG+SVLERFK+SGPDG++YWINHEA 
Sbjct  61   LTGLHTVADIFCVGCGSIVGWKYETAHEKSQKYKEGKSVLERFKVSGPDGSSYWINHEAH  120

Query  361  VAGSDADD  338
            V GSDADD
Sbjct  121  VGGSDADD  128



>ref|XP_009600804.1| PREDICTED: protein yippee-like [Nicotiana tomentosiformis]
Length=129

 Score =   231 bits (589),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 105/129 (81%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFV+ LEGK+YSCKHCGTHLA+SE I+SK+F CRHGKAYLF+KVVNVTSG+ E+RMM
Sbjct  1    MGRLFVLTLEGKIYSCKHCGTHLALSESIVSKSFHCRHGKAYLFSKVVNVTSGEIENRMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG+HTVADIFCV CGSIVGWKYETA+EK QKYKEG+SVLERFKISGPDG++YW +HE  
Sbjct  61   MTGMHTVADIFCVCCGSIVGWKYETAHEKSQKYKEGKSVLERFKISGPDGSHYWASHETH  120

Query  361  VAGSDADDV  335
            VAGSDADDV
Sbjct  121  VAGSDADDV  129



>ref|XP_009781999.1| PREDICTED: protein yippee-like isoform X1 [Nicotiana sylvestris]
Length=129

 Score =   229 bits (585),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFV+ LEGK+YSCKHCGTHLA+SE I+SK+F CRHGKAYLF+KVVNVTSG+ E+R+M
Sbjct  1    MGRLFVLTLEGKIYSCKHCGTHLALSESIVSKSFHCRHGKAYLFSKVVNVTSGEIENRIM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG+HTVADIFCV CGSIVGWKYETA+EK QKYKEG+SVLERFKISGPDG++YW +HE  
Sbjct  61   MTGMHTVADIFCVCCGSIVGWKYETAHEKSQKYKEGKSVLERFKISGPDGSHYWASHETH  120

Query  361  VAGSDADDV  335
            VAGSDADDV
Sbjct  121  VAGSDADDV  129



>ref|XP_004235245.1| PREDICTED: protein yippee-like [Solanum lycopersicum]
Length=129

 Score =   229 bits (584),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 104/128 (81%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFV+ LEGK+YSCKHCGTHLA+SE+I+SK+F CRHGKAYLF+KVVNVTSG+ E+RMM
Sbjct  1    MGRLFVLTLEGKMYSCKHCGTHLALSENIVSKSFHCRHGKAYLFSKVVNVTSGEVENRMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG+HTVADIFCV CGSIVGWKYETA+EK QKYKEG+SVLERFKISGPDG++YW +HE  
Sbjct  61   MTGMHTVADIFCVCCGSIVGWKYETAHEKSQKYKEGKSVLERFKISGPDGSHYWASHETH  120

Query  361  VAGSDADD  338
            VAGSDADD
Sbjct  121  VAGSDADD  128



>ref|XP_006362988.1| PREDICTED: protein yippee-like [Solanum tuberosum]
Length=129

 Score =   229 bits (583),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFV+ LEGK+YSCKHCGTHLA+SE+I+SK+F CRHGKAYLF+KVVNVTSG+ E+RMM
Sbjct  1    MGRLFVLTLEGKIYSCKHCGTHLALSENIVSKSFHCRHGKAYLFSKVVNVTSGEIENRMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG+HTVADIFCV CGSIVGWKYETA+EK QKYKEG+SVLERFKI+GPDG++YW +H+  
Sbjct  61   MTGMHTVADIFCVCCGSIVGWKYETAHEKSQKYKEGKSVLERFKITGPDGSHYWASHDTH  120

Query  361  VAGSDADDV  335
            VAGSDADDV
Sbjct  121  VAGSDADDV  129



>ref|XP_007009014.1| Yippee family zinc-binding protein, putative isoform 1 [Theobroma 
cacao]
 ref|XP_007009015.1| Yippee family zinc-binding protein, putative isoform 1 [Theobroma 
cacao]
 ref|XP_007009016.1| Yippee family zinc-binding protein, putative isoform 1 [Theobroma 
cacao]
 ref|XP_007009017.1| Yippee family zinc-binding protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY17824.1| Yippee family zinc-binding protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY17825.1| Yippee family zinc-binding protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY17826.1| Yippee family zinc-binding protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY17827.1| Yippee family zinc-binding protein, putative isoform 1 [Theobroma 
cacao]
Length=129

 Score =   228 bits (581),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFVVNLEGKVYSCKHC THLA+ EDI+SK+F CRHGKAYLF+KVVNV+SG+ EDR M
Sbjct  1    MGRLFVVNLEGKVYSCKHCKTHLALCEDIVSKSFHCRHGKAYLFSKVVNVSSGEKEDRHM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TGLHTVADIFCV CGSIVGWKYETA++K+QKYKEG+SVLERFK+SGPDG++YW++H A 
Sbjct  61   MTGLHTVADIFCVGCGSIVGWKYETAHDKNQKYKEGKSVLERFKVSGPDGSHYWVSHGAH  120

Query  361  VAGSDADDV  335
            V GSDADDV
Sbjct  121  VGGSDADDV  129



>ref|XP_006435717.1| hypothetical protein CICLE_v10033070mg [Citrus clementina]
 ref|XP_006435718.1| hypothetical protein CICLE_v10033070mg [Citrus clementina]
 ref|XP_006435719.1| hypothetical protein CICLE_v10033070mg [Citrus clementina]
 ref|XP_006486330.1| PREDICTED: protein yippee-like [Citrus sinensis]
 gb|ESR48957.1| hypothetical protein CICLE_v10033070mg [Citrus clementina]
 gb|ESR48958.1| hypothetical protein CICLE_v10033070mg [Citrus clementina]
 gb|ESR48959.1| hypothetical protein CICLE_v10033070mg [Citrus clementina]
 gb|KDO69015.1| hypothetical protein CISIN_1g032990mg [Citrus sinensis]
 gb|KDO69016.1| hypothetical protein CISIN_1g032990mg [Citrus sinensis]
Length=129

 Score =   228 bits (581),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 101/128 (79%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFVVNLEGK+YSCKHC THLA+ ED++SK+F CRHGKAYLF+KVVNV+ G+ E+R+M
Sbjct  1    MGRLFVVNLEGKIYSCKHCRTHLALCEDVVSKSFHCRHGKAYLFSKVVNVSVGEKEERLM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG+HTVADIFCV CGSIVGWKYETA+EK QKYKEG+SVLERFK+SGPDG+NYW++HEA 
Sbjct  61   MTGMHTVADIFCVGCGSIVGWKYETAHEKSQKYKEGKSVLERFKVSGPDGSNYWVSHEAH  120

Query  361  VAGSDADD  338
            V GSDADD
Sbjct  121  VGGSDADD  128



>ref|NP_001274831.1| protein yippee-like [Solanum tuberosum]
 sp|P59234.1|YIPL_SOLTU RecName: Full=Protein yippee-like [Solanum tuberosum]
 dbj|BAC23053.1| yippee-like protein [Solanum tuberosum]
 gb|ABX72226.1| yippee-like protein [Solanum tuberosum]
Length=129

 Score =   228 bits (580),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 102/129 (79%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFV+ LEGK+YSCKHCGTHLA+SE+I+SK+F C+HGKAYLF+KVVNVTSG+ E+RMM
Sbjct  1    MGRLFVLTLEGKIYSCKHCGTHLALSENIVSKSFHCKHGKAYLFSKVVNVTSGEIENRMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG+HTVADIFCV CGSIVGWKYETA+EK QKYKEG+SVLERFKI+GPDG++YW +H+  
Sbjct  61   MTGMHTVADIFCVCCGSIVGWKYETAHEKSQKYKEGKSVLERFKITGPDGSHYWASHDTH  120

Query  361  VAGSDADDV  335
            VAGSDADDV
Sbjct  121  VAGSDADDV  129



>ref|XP_007163531.1| hypothetical protein PHAVU_001G242000g [Phaseolus vulgaris]
 gb|ESW35525.1| hypothetical protein PHAVU_001G242000g [Phaseolus vulgaris]
Length=129

 Score =   227 bits (578),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 103/128 (80%), Positives = 114/128 (89%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFVVNLEGK+YSCKHC THLA+ +DI SK F CRHGKAYLFNKVVNV+ G+ EDR M
Sbjct  1    MGRLFVVNLEGKIYSCKHCHTHLALYDDIYSKTFHCRHGKAYLFNKVVNVSIGEMEDRQM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TGLHTVADIFCV CGSIVGW+YETAYEK QKYKEG+SVLER+K+SGPDG+NYWI+HE  
Sbjct  61   MTGLHTVADIFCVGCGSIVGWQYETAYEKSQKYKEGKSVLERYKVSGPDGSNYWISHEPH  120

Query  361  VAGSDADD  338
            V GSDADD
Sbjct  121  VGGSDADD  128



>ref|XP_002273272.1| PREDICTED: protein yippee-like [Vitis vinifera]
 emb|CBI25496.3| unnamed protein product [Vitis vinifera]
Length=129

 Score =   227 bits (578),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 103/128 (80%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFVV+LEGK+YSCKHC THLA+SEDI+SK+F CRHGKAYLFNKVVNV+ G +E+RMM
Sbjct  1    MGRLFVVSLEGKIYSCKHCRTHLALSEDIVSKSFHCRHGKAYLFNKVVNVSVGVHEERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG+HTVADIFCV CGSIVGW+YETA+EK QKYKEG+SVLERFK+SGPDG+NYWI  EA 
Sbjct  61   MTGMHTVADIFCVGCGSIVGWRYETAHEKAQKYKEGKSVLERFKVSGPDGSNYWITPEAH  120

Query  361  VAGSDADD  338
            V GSDADD
Sbjct  121  VGGSDADD  128



>ref|XP_008233742.1| PREDICTED: protein yippee-like [Prunus mume]
 ref|XP_008233743.1| PREDICTED: protein yippee-like [Prunus mume]
Length=129

 Score =   226 bits (577),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 102/129 (79%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFV +LEGK+YSCKHC THLA+ EDI+SK+F CRHGKAYLF+KVVNVTSG+ E+RMM
Sbjct  1    MGRLFVQSLEGKIYSCKHCRTHLALCEDIVSKSFHCRHGKAYLFSKVVNVTSGEKEERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TGLHTVADIFCV CGSIVGWKYETA+EK Q+YKEG+SVLER K+SGPDG+NYW++HEA+
Sbjct  61   MTGLHTVADIFCVGCGSIVGWKYETAHEKSQRYKEGKSVLERVKMSGPDGSNYWVSHEAQ  120

Query  361  VAGSDADDV  335
            V  SDADDV
Sbjct  121  VGSSDADDV  129



>ref|XP_004500681.1| PREDICTED: protein yippee-like isoform X4 [Cicer arietinum]
 ref|XP_004500682.1| PREDICTED: protein yippee-like isoform X5 [Cicer arietinum]
Length=129

 Score =   226 bits (575),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFV+NLEGK+Y+CK+C THLA+ EDI+SK F CRHGKAYLFNKV+NV+ G+ E+R+M
Sbjct  1    MGRLFVINLEGKIYTCKYCRTHLALYEDIVSKTFHCRHGKAYLFNKVMNVSLGETEERLM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TGLHTVADIFCV CGSIVGWKYETA+EK QKYKEG+SVLER+K+SGPDG+NYWIN+EA 
Sbjct  61   MTGLHTVADIFCVGCGSIVGWKYETAHEKGQKYKEGKSVLERYKVSGPDGSNYWINNEAH  120

Query  361  VAGSDADDV  335
            V+GSDADDV
Sbjct  121  VSGSDADDV  129



>ref|NP_001236973.1| uncharacterized protein LOC100305552 [Glycine max]
 ref|XP_006601729.1| PREDICTED: uncharacterized protein LOC100305552 isoform X1 [Glycine 
max]
 gb|ACU13287.1| unknown [Glycine max]
 gb|KHN36384.1| Protein yippee-like [Glycine soja]
Length=129

 Score =   225 bits (574),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 103/128 (80%), Positives = 116/128 (91%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFVVNLEGK+YSCKHC THLA+ +DI S+ F CRHGKAYLFNKVVNV+ G+ EDR M
Sbjct  1    MGRLFVVNLEGKIYSCKHCHTHLALYDDIYSRTFHCRHGKAYLFNKVVNVSIGEMEDRPM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TGLHTVADIFCV CGSIVGWKYETAYEK+QKYKEG+SVLER+K+SGPDG+NYWI++EA 
Sbjct  61   MTGLHTVADIFCVGCGSIVGWKYETAYEKNQKYKEGKSVLERYKVSGPDGSNYWISNEAH  120

Query  361  VAGSDADD  338
            V GSDADD
Sbjct  121  VGGSDADD  128



>gb|KDP44782.1| hypothetical protein JCGZ_01282 [Jatropha curcas]
Length=129

 Score =   224 bits (572),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 114/129 (88%), Gaps = 0/129 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFVVNLEGK+YSCKHC THLA+ EDI+SK+F  RHGKAYLFNKVVNV+ G  EDRMM
Sbjct  1    MGRLFVVNLEGKIYSCKHCKTHLALYEDIVSKSFHSRHGKAYLFNKVVNVSMGVKEDRMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG+HTV DIFCV CGSIVGWKYE A+EK QKYKEG+SVLERFK+SGPDG++YW+NHE  
Sbjct  61   MTGIHTVVDIFCVGCGSIVGWKYEIAHEKSQKYKEGKSVLERFKVSGPDGSSYWMNHEVH  120

Query  361  VAGSDADDV  335
            + GSDADDV
Sbjct  121  IGGSDADDV  129



>gb|KHG08088.1| yippee-like protein [Gossypium arboreum]
Length=130

 Score =   224 bits (572),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 117/130 (90%), Gaps = 1/130 (1%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSK-AFQCRHGKAYLFNKVVNVTSGKNEDRM  545
            MGRLFVVNLEGKVYSCKHC THLA+ EDI+SK +F CRHGKAYLF+KVVNVT+G+ EDR+
Sbjct  1    MGRLFVVNLEGKVYSCKHCKTHLALCEDIVSKVSFHCRHGKAYLFSKVVNVTTGEKEDRL  60

Query  544  MTTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEA  365
            M TGLHTVADIFCV CGSIVGWKYE A+EK QKYKEG+SVLERFK+SGPDG+NYWI+H  
Sbjct  61   MMTGLHTVADIFCVGCGSIVGWKYEMAHEKSQKYKEGKSVLERFKVSGPDGSNYWISHGR  120

Query  364  RVAGSDADDV  335
             V GSDADDV
Sbjct  121  HVGGSDADDV  130



>ref|XP_004500680.1| PREDICTED: protein yippee-like isoform X3 [Cicer arietinum]
Length=130

 Score =   224 bits (571),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 100/128 (78%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFV+NLEGK+Y+CK+C THLA+ EDI+SK F CRHGKAYLFNKV+NV+ G+ E+R+M
Sbjct  1    MGRLFVINLEGKIYTCKYCRTHLALYEDIVSKTFHCRHGKAYLFNKVMNVSLGETEERLM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TGLHTVADIFCV CGSIVGWKYETA+EK QKYKEG+SVLER+K+SGPDG+NYWIN+EA 
Sbjct  61   MTGLHTVADIFCVGCGSIVGWKYETAHEKGQKYKEGKSVLERYKVSGPDGSNYWINNEAH  120

Query  361  VAGSDADD  338
            V+GSDADD
Sbjct  121  VSGSDADD  128



>ref|XP_010689802.1| PREDICTED: protein yippee-like [Beta vulgaris subsp. vulgaris]
 ref|XP_010689804.1| PREDICTED: protein yippee-like [Beta vulgaris subsp. vulgaris]
Length=129

 Score =   224 bits (571),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFVV+LEGK+YSCKHC THLAVSEDI+SK+F  RHGKAYLFN+VVNVT G+ EDR+M
Sbjct  1    MGRLFVVHLEGKIYSCKHCRTHLAVSEDIVSKSFHSRHGKAYLFNRVVNVTLGEKEDRLM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG+H+VADIFCV CGSIVGWKYETA+EK QKYKEG+SVLER+K+ GPDG+NYW+ HEA 
Sbjct  61   MTGMHSVADIFCVGCGSIVGWKYETAHEKSQKYKEGKSVLERYKVFGPDGSNYWVTHEAH  120

Query  361  VAGSDADDV  335
            V  SDADDV
Sbjct  121  VGSSDADDV  129



>gb|KHG19185.1| yippee-like protein [Gossypium arboreum]
Length=129

 Score =   223 bits (569),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFVVNLEGKVYSCKHC  HLA+ +DILSK+FQ RHGKAYLF+KVVNV+ G+ EDR+M
Sbjct  1    MGRLFVVNLEGKVYSCKHCKIHLALVDDILSKSFQSRHGKAYLFSKVVNVSVGEKEDRLM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TGLHTVADIFC+ CGSIVGWKYE A+EK QKYKEG+SVLERFK+SGPDG++YW++HE  
Sbjct  61   ITGLHTVADIFCIGCGSIVGWKYEFAHEKSQKYKEGKSVLERFKVSGPDGSHYWVSHETH  120

Query  361  VAGSDADDV  335
            V GSDADDV
Sbjct  121  VGGSDADDV  129



>gb|EYU22342.1| hypothetical protein MIMGU_mgv1a016254mg [Erythranthe guttata]
Length=129

 Score =   223 bits (568),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 101/128 (79%), Positives = 116/128 (91%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+F V+LEGK+YSCK+C THLA+SEDI+SK+FQCRHGKAYLFNKVVNVT G+ E+RMM
Sbjct  1    MGRVFTVSLEGKIYSCKYCATHLALSEDIVSKSFQCRHGKAYLFNKVVNVTLGEKEERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG H VADIFCV+CGS VGWKYETA EK+QKYKEG+SVLERFKISGPDG+NYW++H A 
Sbjct  61   MTGSHVVADIFCVKCGSNVGWKYETANEKNQKYKEGKSVLERFKISGPDGSNYWVSHGAH  120

Query  361  VAGSDADD  338
            V GSDADD
Sbjct  121  VGGSDADD  128



>ref|XP_007220477.1| hypothetical protein PRUPE_ppa013317mg [Prunus persica]
 gb|EMJ21676.1| hypothetical protein PRUPE_ppa013317mg [Prunus persica]
Length=129

 Score =   223 bits (567),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFV +LEGK+YSCKHC THLA+ +DI+SK+F  RHGKAYLF+KVVNVTSG+ E+RMM
Sbjct  1    MGRLFVQSLEGKIYSCKHCRTHLALCQDIVSKSFHSRHGKAYLFSKVVNVTSGEREERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TGLHTVADIFCV CGSIVGWKYETA+EK QKYKEG+SVLER K+SGPDG+NYW++HEA+
Sbjct  61   MTGLHTVADIFCVGCGSIVGWKYETAHEKSQKYKEGKSVLERVKMSGPDGSNYWVSHEAQ  120

Query  361  VAGSDADDV  335
            V  SDADDV
Sbjct  121  VGSSDADDV  129



>ref|XP_006356456.1| PREDICTED: protein yippee-like isoform X1 [Solanum tuberosum]
 ref|XP_006356457.1| PREDICTED: protein yippee-like isoform X2 [Solanum tuberosum]
Length=129

 Score =   222 bits (565),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFV+ LEGK+YSCKHCGTHLA+SE+I+SK+F CRHGKAYLF+KV NVTSG+ E+RMM
Sbjct  1    MGRLFVLTLEGKIYSCKHCGTHLALSENIVSKSFHCRHGKAYLFSKVANVTSGEIENRMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG+HTVADIFCV CGSIVGWKYETA+EK QKYKEG+SVLERFKI GPDG++YW +H+  
Sbjct  61   MTGMHTVADIFCVCCGSIVGWKYETAHEKSQKYKEGKSVLERFKICGPDGSHYWASHDTH  120

Query  361  VAGSDADDV  335
            VAGSDA+ V
Sbjct  121  VAGSDAEGV  129



>gb|AFK44986.1| unknown [Lotus japonicus]
Length=129

 Score =   222 bits (565),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFVVNLEG++YSCKHC THLA+ EDI+SK F  R+GKAYLFNKVVN++ G+ EDRMM
Sbjct  1    MGRLFVVNLEGRIYSCKHCRTHLALYEDIISKTFHSRNGKAYLFNKVVNISLGEKEDRMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TGLHTVADIFCV CGS+VGWKYETA++K QKYKEG+SVLER+K+SGPDG+NYWI+HEA 
Sbjct  61   MTGLHTVADIFCVGCGSMVGWKYETAHDKGQKYKEGKSVLERYKMSGPDGSNYWISHEAN  120

Query  361  VAGSDADDV  335
            + GSDADD 
Sbjct  121  IGGSDADDA  129



>gb|AFK42344.1| unknown [Lotus japonicus]
Length=129

 Score =   220 bits (561),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 115/129 (89%), Gaps = 0/129 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFV NLEG++YSCKHC THLA+ EDI+SK F  R+GKAYLFNKVVN++ G+ EDRMM
Sbjct  1    MGRLFVANLEGRIYSCKHCRTHLALYEDIISKTFHSRNGKAYLFNKVVNISLGEKEDRMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TGLHTVADIFCV CGS+VGWKYETA++K QKYKEG+SVLER+K+SGPDG+NYWI+HEA 
Sbjct  61   MTGLHTVADIFCVGCGSMVGWKYETAHDKGQKYKEGKSVLERYKMSGPDGSNYWISHEAN  120

Query  361  VAGSDADDV  335
            + GSDADD 
Sbjct  121  IGGSDADDA  129



>ref|XP_003538458.1| PREDICTED: protein yippee-like isoform X1 [Glycine max]
 ref|XP_006591383.1| PREDICTED: protein yippee-like isoform X2 [Glycine max]
Length=129

 Score =   219 bits (559),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 101/128 (79%), Positives = 114/128 (89%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFVVNLEGK+YSCKHC THLA+ +DI S+ F CRHGKAYLFN VVNV+ G+ EDR M
Sbjct  1    MGRLFVVNLEGKIYSCKHCHTHLALYDDIYSRTFHCRHGKAYLFNNVVNVSVGEMEDRPM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TGLHTVADIFCV CGSIVGWKYETAYEK+QKYKEG+SVLER+K+SGPDG+NY I++EA 
Sbjct  61   MTGLHTVADIFCVGCGSIVGWKYETAYEKNQKYKEGKSVLERYKVSGPDGSNYLISNEAH  120

Query  361  VAGSDADD  338
            V GSDADD
Sbjct  121  VGGSDADD  128



>ref|XP_002312152.1| Yippee-like family protein [Populus trichocarpa]
 gb|EEE89519.1| Yippee-like family protein [Populus trichocarpa]
Length=130

 Score =   219 bits (558),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 100/130 (77%), Positives = 116/130 (89%), Gaps = 1/130 (1%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFVV+LEGK+YSCKHC THLA+ +DI+SK+F CRHGKAYLFNKV NV  G+ E+RMM
Sbjct  1    MGRLFVVDLEGKIYSCKHCRTHLALYDDIVSKSFHCRHGKAYLFNKVANVFLGEKEERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHE-A  365
             TGLHTVADIFCV CGSIVGWKYETA+E+ QKYKEG+SVLERFK+SGPDG++YW+NHE  
Sbjct  61   ITGLHTVADIFCVGCGSIVGWKYETAHERSQKYKEGKSVLERFKVSGPDGSHYWVNHEHH  120

Query  364  RVAGSDADDV  335
             + GSDADDV
Sbjct  121  HIGGSDADDV  130



>ref|XP_011084918.1| PREDICTED: protein yippee-like [Sesamum indicum]
 ref|XP_011084919.1| PREDICTED: protein yippee-like [Sesamum indicum]
Length=129

 Score =   218 bits (556),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 115/128 (90%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+F V LEGK+YSC+HCGTHLA++E+I+SK+F  RHGKAYLFNKVVNVT G+ E+R+M
Sbjct  1    MGRVFEVTLEGKIYSCRHCGTHLALAEEIVSKSFHSRHGKAYLFNKVVNVTLGEKEERLM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG H V+DIFCVRCGSIVGWKYETA+EK QKYKEG+SVLERFKISGPDG++YW++H A 
Sbjct  61   MTGSHIVSDIFCVRCGSIVGWKYETAHEKSQKYKEGKSVLERFKISGPDGSHYWVSHGAH  120

Query  361  VAGSDADD  338
            V GSDADD
Sbjct  121  VGGSDADD  128



>ref|XP_009141864.1| PREDICTED: protein yippee-like [Brassica rapa]
 emb|CDY07054.1| BnaA04g22610D [Brassica napus]
Length=130

 Score =   218 bits (556),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 114/129 (88%), Gaps = 1/129 (1%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFVV+LEGK+YSCKHC THLA+ EDI+SK+F C+HGKAYLFNKV NVT G+ EDRMM
Sbjct  1    MGRLFVVHLEGKIYSCKHCKTHLALYEDIISKSFHCKHGKAYLFNKVSNVTIGETEDRMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG HTVADIFCV CGSIVGW+YETA+EK QKYKEG+SVLERFKISGPDG+NYW++   R
Sbjct  61   MTGKHTVADIFCVSCGSIVGWRYETAHEKSQKYKEGKSVLERFKISGPDGSNYWVSSHGR  120

Query  361  -VAGSDADD  338
             + GSDADD
Sbjct  121  HIGGSDADD  129



>ref|XP_004490983.1| PREDICTED: protein yippee-like isoform X3 [Cicer arietinum]
 ref|XP_004490984.1| PREDICTED: protein yippee-like isoform X4 [Cicer arietinum]
Length=129

 Score =   218 bits (556),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 99/128 (77%), Positives = 114/128 (89%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFVV+LEGK+YSCKHC T LA+SEDI+SK+F  RHGKAYLF+KVVNV+ G+ EDR M
Sbjct  1    MGRLFVVHLEGKIYSCKHCRTPLALSEDIVSKSFHSRHGKAYLFSKVVNVSVGEKEDRPM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG+HTVADIFCV CGSIVGW YETA+EK QKYKEG+SVLERFK+SGPDG+NYW++HE  
Sbjct  61   LTGMHTVADIFCVGCGSIVGWTYETAHEKSQKYKEGKSVLERFKVSGPDGSNYWVSHETH  120

Query  361  VAGSDADD  338
            V GSDADD
Sbjct  121  VGGSDADD  128



>ref|XP_010095099.1| hypothetical protein L484_026408 [Morus notabilis]
 gb|EXB58205.1| hypothetical protein L484_026408 [Morus notabilis]
Length=129

 Score =   218 bits (556),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 116/128 (91%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFVV+LEGK+YSC+HC THLA+ +DI+SK+F  RHGKAYLF+KVVNV+ G+ E+R+M
Sbjct  1    MGRLFVVSLEGKIYSCRHCRTHLALCDDIVSKSFHSRHGKAYLFSKVVNVSLGEKEERLM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TGLHTVADIFCV CGSIVGWKYETA+EK QKYKEG+SVLER K+SGPDGNN+W++HE +
Sbjct  61   MTGLHTVADIFCVGCGSIVGWKYETAHEKSQKYKEGKSVLERVKVSGPDGNNFWVSHETQ  120

Query  361  VAGSDADD  338
            V GSDADD
Sbjct  121  VGGSDADD  128



>ref|XP_006650439.1| PREDICTED: protein yippee-like [Oryza brachyantha]
Length=129

 Score =   218 bits (555),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 114/129 (88%), Gaps = 0/129 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFV++LEGKVYSCKHC THL ++ DI+SK+F C+HGKAYLFNKVVNVTSG  EDRMM
Sbjct  1    MGRLFVMHLEGKVYSCKHCHTHLGLTTDIISKSFHCKHGKAYLFNKVVNVTSGVKEDRMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG+HTV+DIFCV CGSIVGWKYE A+EK Q+YKEG+ +LER+K+SGPDG++YW+ H+A 
Sbjct  61   ITGMHTVSDIFCVGCGSIVGWKYEAAHEKSQRYKEGKFILERYKVSGPDGSHYWVTHDAH  120

Query  361  VAGSDADDV  335
            V GSD DDV
Sbjct  121  VGGSDVDDV  129



>ref|NP_181540.1| Yippee family putative zinc-binding protein [Arabidopsis thaliana]
 gb|AAM62838.1| Yippee-like protein [Arabidopsis thaliana]
 gb|AAN71946.1| unknown protein [Arabidopsis thaliana]
 dbj|BAH20057.1| AT2G40110 [Arabidopsis thaliana]
 gb|AEC09780.1| Yippee family putative zinc-binding protein [Arabidopsis thaliana]
Length=130

 Score =   218 bits (554),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 114/130 (88%), Gaps = 1/130 (1%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFVVNLEGK+YSCKHC THLA  EDI+SK+F C+HGKAYLFNKV NV+ G+ E+R+M
Sbjct  1    MGRLFVVNLEGKIYSCKHCKTHLATYEDIISKSFHCKHGKAYLFNKVANVSIGETEERLM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG HTVADIFCV CGSIVGWKYETA+EK+QKYKEG+SVLERFKISGPDG+NYW++   R
Sbjct  61   MTGKHTVADIFCVSCGSIVGWKYETAHEKNQKYKEGKSVLERFKISGPDGSNYWVSSHGR  120

Query  361  -VAGSDADDV  335
             + GSDADD 
Sbjct  121  HIGGSDADDA  130



>ref|XP_010558081.1| PREDICTED: protein yippee-like At3g11230 [Tarenaya hassleriana]
 ref|XP_010558082.1| PREDICTED: protein yippee-like At3g11230 [Tarenaya hassleriana]
Length=126

 Score =   217 bits (553),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 115/128 (90%), Gaps = 3/128 (2%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLF++NLEGK+YSCKHC THLA+ ED++SK+FQC+HGKAYLFNKVVNV +G+ EDRMM
Sbjct  1    MGRLFLLNLEGKIYSCKHCKTHLALCEDVISKSFQCKHGKAYLFNKVVNVYAGETEDRMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TGLHTV+DI+C++CGS VGWKYE AYEK+QKYKEG+SVLERFK+SGP+GNNYW+   A+
Sbjct  61   MTGLHTVSDIYCIKCGSYVGWKYEVAYEKNQKYKEGKSVLERFKVSGPEGNNYWV---AQ  117

Query  361  VAGSDADD  338
               SDADD
Sbjct  118  AGASDADD  125



>ref|XP_004307635.1| PREDICTED: protein yippee-like isoform 1 [Fragaria vesca subsp. 
vesca]
 ref|XP_004307636.1| PREDICTED: protein yippee-like isoform 2 [Fragaria vesca subsp. 
vesca]
Length=129

 Score =   217 bits (552),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 113/128 (88%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFV++LEGK+YSCKHC THLA+SEDI+SK+FQ RHGKAYLF KVVNVT G+ E+R M
Sbjct  1    MGRLFVLSLEGKIYSCKHCRTHLALSEDIVSKSFQSRHGKAYLFGKVVNVTCGETEERAM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TGLHTVADIFCV CGSIVGWKYETA++K QKYKEG+SVLER KISGP+GNNYW++H   
Sbjct  61   MTGLHTVADIFCVGCGSIVGWKYETAHDKSQKYKEGKSVLERVKISGPEGNNYWVSHGGH  120

Query  361  VAGSDADD  338
            +  SDADD
Sbjct  121  IGSSDADD  128



>ref|XP_006411259.1| hypothetical protein EUTSA_v10017415mg [Eutrema salsugineum]
 gb|ESQ52712.1| hypothetical protein EUTSA_v10017415mg [Eutrema salsugineum]
Length=130

 Score =   217 bits (552),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 114/129 (88%), Gaps = 1/129 (1%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFVVNLEGK+YSCKHC THLA+ EDI+SK+F C+HGKAYLFNKV NV++G  E+RMM
Sbjct  1    MGRLFVVNLEGKIYSCKHCKTHLALYEDIISKSFHCKHGKAYLFNKVANVSTGVTEERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG HTVADIFCV CGSIVGW+YETA+EK QKYKEG+SVLERFKISGPDG+NYW++   R
Sbjct  61   MTGKHTVADIFCVSCGSIVGWRYETAHEKSQKYKEGKSVLERFKISGPDGSNYWVSSHGR  120

Query  361  -VAGSDADD  338
             + GSDAD+
Sbjct  121  HIGGSDADE  129



>ref|XP_002879844.1| yippee family protein [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006295229.1| hypothetical protein CARUB_v10024314mg [Capsella rubella]
 gb|EFH56103.1| yippee family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EOA28127.1| hypothetical protein CARUB_v10024314mg [Capsella rubella]
Length=130

 Score =   216 bits (551),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 114/130 (88%), Gaps = 1/130 (1%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFVVNLEGK+YSCKHC THLA  EDI+SK+F C+HGKAYLFNKV NV+ G+ E+R+M
Sbjct  1    MGRLFVVNLEGKIYSCKHCKTHLATYEDIISKSFHCKHGKAYLFNKVANVSIGETEERLM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG HTVADIFCV CGSIVGW+YETA+EK+QKYKEG+SVLERFKISGPDG+NYW++   R
Sbjct  61   MTGKHTVADIFCVSCGSIVGWRYETAHEKNQKYKEGKSVLERFKISGPDGSNYWVSSHGR  120

Query  361  -VAGSDADDV  335
             + GSDADD 
Sbjct  121  HIGGSDADDA  130



>ref|XP_003519391.1| PREDICTED: protein yippee-like isoform 1 [Glycine max]
 ref|XP_003519392.1| PREDICTED: protein yippee-like isoform 2 [Glycine max]
 gb|KHN48561.1| Protein yippee-like [Glycine soja]
Length=132

 Score =   216 bits (551),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 115/131 (88%), Gaps = 3/131 (2%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFV +LEG++YSCKHC THLA+ EDI+SK+F  RHG+AYLF+KVVNVT G NEDR M
Sbjct  1    MGRLFVTHLEGQIYSCKHCRTHLALYEDIVSKSFHSRHGRAYLFSKVVNVTVGVNEDRQM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDG---NNYWINH  371
             TG+HTVADIFCV CGSIVGW+YETA+EK QKYKEG+SVLER+K+SGPDG   NNYW++H
Sbjct  61   LTGMHTVADIFCVGCGSIVGWRYETAHEKSQKYKEGKSVLERYKVSGPDGNNNNNYWVSH  120

Query  370  EARVAGSDADD  338
            EA V GSDADD
Sbjct  121  EAHVGGSDADD  131



>ref|NP_001050981.1| Os03g0698500 [Oryza sativa Japonica Group]
 gb|AAO38447.1| putative zinc binding protein [Oryza sativa Japonica Group]
 gb|ABF98370.1| Yippee, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF12895.1| Os03g0698500 [Oryza sativa Japonica Group]
 dbj|BAG98778.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC76006.1| hypothetical protein OsI_13146 [Oryza sativa Indica Group]
 gb|EEE59751.1| hypothetical protein OsJ_12219 [Oryza sativa Japonica Group]
Length=129

 Score =   216 bits (550),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 114/129 (88%), Gaps = 0/129 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFV++LEGKVYSCKHC THL +S DI+SK+F C+HGKAYLFNKVVNVTSG  EDRMM
Sbjct  1    MGRLFVMHLEGKVYSCKHCHTHLGLSSDIISKSFHCKHGKAYLFNKVVNVTSGVKEDRMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG+HTV+DIFCV CGSIVGWKYE A+EK Q+YKEG+ +LER+K+SGPDG++Y++ H+A 
Sbjct  61   ITGMHTVSDIFCVGCGSIVGWKYEAAHEKSQRYKEGKFILERYKVSGPDGSHYFVTHDAH  120

Query  361  VAGSDADDV  335
            V GSD DDV
Sbjct  121  VGGSDVDDV  129



>ref|XP_004235254.1| PREDICTED: protein yippee-like isoform X2 [Solanum lycopersicum]
Length=129

 Score =   216 bits (550),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 115/129 (89%), Gaps = 0/129 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFV+ LEGK+YSCKHCGTHLA+SE+I+SK+F CRHGKAYLF+KVVNVTSG+ E R+M
Sbjct  1    MGRLFVLTLEGKIYSCKHCGTHLALSENIVSKSFHCRHGKAYLFSKVVNVTSGEMEGRVM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TGLHTVADIFCV CGSI GWKYETA+E  QKYKEG+SVLERFKI GPDG++Y  +H+  
Sbjct  61   MTGLHTVADIFCVCCGSIFGWKYETAHEMSQKYKEGKSVLERFKICGPDGSHYSGSHDTH  120

Query  361  VAGSDADDV  335
            VAGSDADDV
Sbjct  121  VAGSDADDV  129



>ref|XP_011043728.1| PREDICTED: protein yippee-like isoform X2 [Populus euphratica]
 ref|XP_011043807.1| PREDICTED: protein yippee-like isoform X2 [Populus euphratica]
 ref|XP_011043878.1| PREDICTED: protein yippee-like isoform X2 [Populus euphratica]
Length=130

 Score =   215 bits (548),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 117/130 (90%), Gaps = 1/130 (1%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFVV+LEGK+YSCKHC THLA+ +DI+S++F CRHGKAYLFNKV NV  G+ E+RMM
Sbjct  1    MGRLFVVDLEGKIYSCKHCRTHLALYDDIVSRSFHCRHGKAYLFNKVANVFVGEKEERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHE-A  365
             TGLHTVADIFCV CGSIVGWKYETA+E+ QKYKEG+SVLERFK+SGPDG++YW+N+E  
Sbjct  61   ITGLHTVADIFCVGCGSIVGWKYETAHERSQKYKEGKSVLERFKVSGPDGSHYWVNNEHH  120

Query  364  RVAGSDADDV  335
             ++GSDADDV
Sbjct  121  HISGSDADDV  130



>ref|XP_009412576.1| PREDICTED: protein yippee-like [Musa acuminata subsp. malaccensis]
Length=129

 Score =   215 bits (548),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 113/128 (88%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLF+V+LEGK+YSCKHC  HLA+ +DI+S++F CRHGKAYLFNKVVNVT+G  EDRMM
Sbjct  1    MGRLFLVSLEGKIYSCKHCQAHLALVDDIVSRSFHCRHGKAYLFNKVVNVTAGIKEDRMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TGLHTV+DIFCV CG+IVGWKYE A+EK QKYKEG+ VLERFK++GPDG+ YW+ H+A 
Sbjct  61   MTGLHTVSDIFCVGCGAIVGWKYEAAHEKAQKYKEGKIVLERFKLTGPDGSRYWVTHDAH  120

Query  361  VAGSDADD  338
            + GSDADD
Sbjct  121  MGGSDADD  128



>emb|CDY61708.1| BnaC04g56710D [Brassica napus]
Length=350

 Score =   223 bits (567),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 115/130 (88%), Gaps = 1/130 (1%)
 Frame = -3

Query  724  EMGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRM  545
            EMGRLFVV+LEGK+YSCKHC THLA+ EDI+SK+F C+HGKAYLFNKV NVT G+ EDRM
Sbjct  220  EMGRLFVVHLEGKIYSCKHCKTHLALYEDIISKSFHCKHGKAYLFNKVSNVTIGETEDRM  279

Query  544  MTTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEA  365
            M TG HTVADIFCV CGSIVGW+YETA+EK QKYKEG+SVLERFKISGPDG+NYW++   
Sbjct  280  MMTGKHTVADIFCVSCGSIVGWRYETAHEKSQKYKEGKSVLERFKISGPDGSNYWVSSHG  339

Query  364  R-VAGSDADD  338
            R + GSDADD
Sbjct  340  RHIGGSDADD  349



>ref|XP_004235253.1| PREDICTED: protein yippee-like [Solanum lycopersicum]
Length=129

 Score =   214 bits (546),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFV+ LEG  YSCKHCGTHLA+SE+I+SK+F+CRHGKAYLF+KVVNVTSG+ EDR+M
Sbjct  1    MGRLFVLTLEGNFYSCKHCGTHLALSENIVSKSFRCRHGKAYLFSKVVNVTSGEMEDRVM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG+HTVADIFCV CGSIVGWKYETA+E  QKYKEG+SVLERFKI+GPDG++Y  +H+  
Sbjct  61   MTGVHTVADIFCVCCGSIVGWKYETAHEMSQKYKEGKSVLERFKITGPDGSHYSASHDTH  120

Query  361  VAGSDADDV  335
            VAGSDA DV
Sbjct  121  VAGSDAYDV  129



>ref|XP_009344741.1| PREDICTED: protein yippee-like [Pyrus x bretschneideri]
 ref|XP_009344748.1| PREDICTED: protein yippee-like [Pyrus x bretschneideri]
 ref|XP_009344754.1| PREDICTED: protein yippee-like [Pyrus x bretschneideri]
 ref|XP_009344761.1| PREDICTED: protein yippee-like [Pyrus x bretschneideri]
 ref|XP_009344770.1| PREDICTED: protein yippee-like [Pyrus x bretschneideri]
Length=129

 Score =   214 bits (546),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 114/128 (89%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFVV+LEGK+YSC+HC THLA+ EDI+S++F CRHGKAYLF KVVNV SG+ EDR M
Sbjct  1    MGRLFVVSLEGKIYSCRHCRTHLALCEDIVSRSFHCRHGKAYLFKKVVNVFSGECEDRSM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TGLHTVADIFCV CGSIVGWKYETA+++ QKYKEG+SVLER K+ GPDGN+YW++HEA+
Sbjct  61   ITGLHTVADIFCVGCGSIVGWKYETAHDETQKYKEGKSVLERVKVLGPDGNDYWVSHEAQ  120

Query  361  VAGSDADD  338
            V  SDADD
Sbjct  121  VGSSDADD  128



>ref|XP_010923051.1| PREDICTED: protein yippee-like isoform X1 [Elaeis guineensis]
 ref|XP_010923052.1| PREDICTED: protein yippee-like isoform X1 [Elaeis guineensis]
 ref|XP_010923053.1| PREDICTED: protein yippee-like isoform X1 [Elaeis guineensis]
 ref|XP_010923054.1| PREDICTED: protein yippee-like isoform X2 [Elaeis guineensis]
 ref|XP_010923055.1| PREDICTED: protein yippee-like isoform X2 [Elaeis guineensis]
Length=129

 Score =   214 bits (546),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 114/128 (89%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLF+++LEGK+YSCKHC THLA+  DI+SK+F CRHGKAYLF+KVVNVT G  EDRMM
Sbjct  1    MGRLFLIHLEGKIYSCKHCQTHLALYTDIMSKSFHCRHGKAYLFHKVVNVTVGLKEDRMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TGLHTV+DIFCV CGSIVGWKY+ A++K+QKYKEG+ +LERFK+SGPDG++YW++H+  
Sbjct  61   MTGLHTVSDIFCVGCGSIVGWKYDAAHDKNQKYKEGKFILERFKVSGPDGSHYWVSHDPH  120

Query  361  VAGSDADD  338
            V GSDADD
Sbjct  121  VGGSDADD  128



>ref|XP_008776663.1| PREDICTED: protein yippee-like [Phoenix dactylifera]
 ref|XP_008776664.1| PREDICTED: protein yippee-like [Phoenix dactylifera]
 ref|XP_008776665.1| PREDICTED: protein yippee-like [Phoenix dactylifera]
Length=129

 Score =   214 bits (545),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 113/128 (88%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MG LF+++LEGK+YSCKHC THLA+S+DI+SK+F CRHGKAYLFNKVVNVT G  EDR M
Sbjct  1    MGLLFLIHLEGKIYSCKHCQTHLAISDDIISKSFHCRHGKAYLFNKVVNVTVGLKEDRAM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG+HTV+DIFCV CGSIVGWKYE A++K Q+YKEG+ +LERFKISGPDG++YW++H+  
Sbjct  61   MTGMHTVSDIFCVGCGSIVGWKYEAAHDKSQRYKEGKFILERFKISGPDGSHYWVSHDPH  120

Query  361  VAGSDADD  338
            V GSDADD
Sbjct  121  VGGSDADD  128



>ref|XP_010505717.1| PREDICTED: protein yippee-like [Camelina sativa]
 ref|XP_010517409.1| PREDICTED: protein yippee-like [Camelina sativa]
Length=130

 Score =   214 bits (545),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 114/130 (88%), Gaps = 1/130 (1%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFVVNLEGK+YSCKHC THLA  EDI+SK+F C++GKAYLFNKV NV+ G+ E+R+M
Sbjct  1    MGRLFVVNLEGKIYSCKHCKTHLATYEDIISKSFHCKNGKAYLFNKVANVSMGETEERLM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG HTVADIFCV CGSIVGW+YETA+EK+QKYKEG+SVLERFKISGPDG+NYW++   R
Sbjct  61   MTGKHTVADIFCVSCGSIVGWRYETAHEKNQKYKEGKSVLERFKISGPDGSNYWVSSHGR  120

Query  361  -VAGSDADDV  335
             + GSDADD 
Sbjct  121  HIGGSDADDA  130



>ref|XP_002315161.1| Yippee-like family protein [Populus trichocarpa]
 ref|XP_006378667.1| hypothetical protein POPTR_0010s19730g [Populus trichocarpa]
 gb|ABK92856.1| unknown [Populus trichocarpa]
 gb|EEF01332.1| Yippee-like family protein [Populus trichocarpa]
 gb|ERP56464.1| hypothetical protein POPTR_0010s19730g [Populus trichocarpa]
Length=130

 Score =   214 bits (544),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 115/130 (88%), Gaps = 1/130 (1%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFV +LEG++YSCKHC THLA+ +DI+SK+F CRHGKAYLF KVVNV  G+ E+R+M
Sbjct  1    MGRLFVESLEGRIYSCKHCRTHLALYDDIVSKSFHCRHGKAYLFKKVVNVFVGEKEERIM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHE-A  365
             TGLHTVADIFCV CGSIVGWKYETA+EK QKYKEG+SVLERFK+SGPDG++YW+NHE  
Sbjct  61   ITGLHTVADIFCVGCGSIVGWKYETAHEKSQKYKEGKSVLERFKVSGPDGSHYWVNHEHH  120

Query  364  RVAGSDADDV  335
             + GSDADDV
Sbjct  121  HIGGSDADDV  130



>ref|XP_003600874.1| Protein yippee-like protein [Medicago truncatula]
 gb|AES71125.1| yippee family zinc-binding protein, putative [Medicago truncatula]
Length=152

 Score =   214 bits (545),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 114/129 (88%), Gaps = 0/129 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFV+NLEGK+YSC++C THLA+ EDI+SK F  RHGKAYLFNKVVNV+ G+ E+R M
Sbjct  24   MGRLFVINLEGKIYSCRYCRTHLALYEDIVSKTFHSRHGKAYLFNKVVNVSLGETEERPM  83

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TGLHTVADIFCV CGSIVGWKYE A+EKDQKYKEG+SVLER+K+SGPDG+NY IN+ A 
Sbjct  84   MTGLHTVADIFCVGCGSIVGWKYEIAHEKDQKYKEGKSVLERYKVSGPDGSNYRINNGAH  143

Query  361  VAGSDADDV  335
            V GSDADD+
Sbjct  144  VGGSDADDL  152



>gb|ACU23549.1| unknown [Glycine max]
Length=132

 Score =   213 bits (543),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 114/131 (87%), Gaps = 3/131 (2%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFV +LEG++YSCKHC THLA+ EDI+SK+F  RHG+AYLF+KVVNVT G NEDR M
Sbjct  1    MGRLFVTHLEGQIYSCKHCRTHLALYEDIVSKSFHSRHGRAYLFSKVVNVTVGVNEDRQM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDG---NNYWINH  371
             T +HTVADIFCV CGSIVGW+YETA+EK QKYKEG+SVLER+K+SGPDG   NNYW++H
Sbjct  61   LTRMHTVADIFCVGCGSIVGWRYETAHEKSQKYKEGKSVLERYKVSGPDGNNNNNYWVSH  120

Query  370  EARVAGSDADD  338
            EA V GSDADD
Sbjct  121  EAHVGGSDADD  131



>ref|XP_010508914.1| PREDICTED: protein yippee-like [Camelina sativa]
Length=130

 Score =   213 bits (542),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 114/130 (88%), Gaps = 1/130 (1%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFVVNLEGK+YSCKHC THLA  EDI+SK+F C++GKAYLFNKV NV+ G+ E+R+M
Sbjct  1    MGRLFVVNLEGKIYSCKHCKTHLATYEDIISKSFHCKNGKAYLFNKVANVSMGETEERLM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG HTVADI+CV CGSIVGW+YETA+EK+QKYKEG+SVLERFKISGPDG+NYW++   R
Sbjct  61   ITGKHTVADIYCVSCGSIVGWRYETAHEKNQKYKEGKSVLERFKISGPDGSNYWVSSHGR  120

Query  361  -VAGSDADDV  335
             + GSDADD 
Sbjct  121  HIGGSDADDA  130



>gb|AFK39854.1| unknown [Medicago truncatula]
Length=129

 Score =   213 bits (541),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 114/129 (88%), Gaps = 0/129 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFV+NLEGK+YSC++C THLA+ EDI+SK F  RHGKAYLFNKVVNV+ G+ E+R M
Sbjct  1    MGRLFVINLEGKIYSCRYCRTHLALYEDIVSKTFHSRHGKAYLFNKVVNVSLGETEERPM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TGLHTVADIFCV CGSIVGWKYE A+EKDQKYKEG+SVLER+K+SGPDG+NY IN+ A 
Sbjct  61   MTGLHTVADIFCVGCGSIVGWKYEIAHEKDQKYKEGKSVLERYKVSGPDGSNYRINNGAH  120

Query  361  VAGSDADDV  335
            V GSDADD+
Sbjct  121  VGGSDADDL  129



>gb|EYU20019.1| hypothetical protein MIMGU_mgv1a016206mg [Erythranthe guttata]
 gb|EYU20021.1| hypothetical protein MIMGU_mgv1a016206mg [Erythranthe guttata]
Length=130

 Score =   213 bits (541),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 113/129 (88%), Gaps = 1/129 (1%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+FV+ LEGK+YSCKHC THLA+S+D++SK+F CRHGKAYLF KVVNVT G  E+RMM
Sbjct  1    MGRVFVLALEGKIYSCKHCQTHLALSDDVVSKSFLCRHGKAYLFKKVVNVTLGDKEERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINH-EA  365
             TG HTVADIFCV+CGS+VGWKYETA+EK QKYKEG+SVLER KISGPDG NYW+N+ EA
Sbjct  61   MTGSHTVADIFCVKCGSMVGWKYETAHEKSQKYKEGKSVLERVKISGPDGINYWMNNEEA  120

Query  364  RVAGSDADD  338
             V GSD DD
Sbjct  121  HVGGSDTDD  129



>ref|XP_008343615.1| PREDICTED: protein yippee-like [Malus domestica]
 ref|XP_008343617.1| PREDICTED: protein yippee-like [Malus domestica]
 ref|XP_008343618.1| PREDICTED: protein yippee-like [Malus domestica]
Length=129

 Score =   212 bits (540),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 113/128 (88%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFVV+LEGK+YSC+HC THLA+ EDI+S++F  RHGKAYLF KVVNV SG+ EDR M
Sbjct  1    MGRLFVVSLEGKIYSCRHCRTHLALCEDIVSRSFHSRHGKAYLFKKVVNVFSGECEDRSM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TGLHTVADIFCV CGSIVGWKYETA+E+ QKYKEG+SVLER K+ GPDGNNYW++HEA+
Sbjct  61   ITGLHTVADIFCVGCGSIVGWKYETAHEEAQKYKEGKSVLERVKVLGPDGNNYWVSHEAQ  120

Query  361  VAGSDADD  338
            V  SDAD+
Sbjct  121  VGSSDADE  128



>ref|XP_007141774.1| hypothetical protein PHAVU_008G224700g [Phaseolus vulgaris]
 ref|XP_007141775.1| hypothetical protein PHAVU_008G224700g [Phaseolus vulgaris]
 gb|ESW13768.1| hypothetical protein PHAVU_008G224700g [Phaseolus vulgaris]
 gb|ESW13769.1| hypothetical protein PHAVU_008G224700g [Phaseolus vulgaris]
Length=128

 Score =   212 bits (540),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 114/128 (89%), Gaps = 1/128 (1%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFVV+LEGKVYSCKHC THLA+ EDI+SK+F  RHGKAYLF+KVVNV++G+NEDR M
Sbjct  1    MGRLFVVHLEGKVYSCKHCRTHLALYEDIVSKSFHSRHGKAYLFSKVVNVSAGENEDRQM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG+HTVADIFCV CGSIVGWKYETA+E+ QKYKEG+SVLER+K+SGPD  NYW+ HEA 
Sbjct  61   LTGMHTVADIFCVGCGSIVGWKYETAHEESQKYKEGKSVLERYKVSGPDNCNYWVGHEAH  120

Query  361  VAGSDADD  338
              GS+ADD
Sbjct  121  -GGSEADD  127



>ref|XP_003560972.1| PREDICTED: protein yippee-like [Brachypodium distachyon]
Length=129

 Score =   211 bits (538),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLF+++L+G VYSCKHC THL ++ DI+SKAF  +HGKAYLFNKVVNVT+G  EDR+M
Sbjct  1    MGRLFLMHLDGNVYSCKHCDTHLGLASDIISKAFHSKHGKAYLFNKVVNVTTGVKEDRVM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TGLHTV+DIFCV CGSIVGWKYE A+EK Q+YKEG+ +LERFK+SGPDG++YW+ H+A 
Sbjct  61   MTGLHTVSDIFCVGCGSIVGWKYEAAHEKSQRYKEGKFILERFKVSGPDGSHYWVTHDAH  120

Query  361  VAGSDADDV  335
            V GSDADD+
Sbjct  121  VGGSDADDL  129



>ref|XP_008369243.1| PREDICTED: protein yippee-like [Malus domestica]
 ref|XP_008369244.1| PREDICTED: protein yippee-like [Malus domestica]
Length=129

 Score =   211 bits (538),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 113/128 (88%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFVV+LEGK+YSCKHC THLA+ +D++SK+F CRHGKAYLF+KVVNV SG+ EDR M
Sbjct  1    MGRLFVVSLEGKIYSCKHCRTHLALCDDVVSKSFYCRHGKAYLFSKVVNVYSGECEDRAM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TGLHTVADIFCV CGSIVGWKYETA+EK QKYKEG+SVLER K+SGP+G  +W +HEA+
Sbjct  61   MTGLHTVADIFCVGCGSIVGWKYETAHEKGQKYKEGKSVLERIKVSGPEGRTFWASHEAQ  120

Query  361  VAGSDADD  338
            V  SDAD+
Sbjct  121  VGSSDADE  128



>ref|NP_001238047.1| uncharacterized protein LOC100500435 [Glycine max]
 ref|XP_006595517.1| PREDICTED: uncharacterized protein LOC100500435 isoform X1 [Glycine 
max]
 gb|ACU15523.1| unknown [Glycine max]
 gb|KHN20851.1| Protein yippee-like [Glycine soja]
Length=132

 Score =   211 bits (538),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 116/131 (89%), Gaps = 3/131 (2%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFV +LEG++Y+CKHC THLA+ EDI+SKAF  RHG+AYLF+KVVNVT+G+NEDR M
Sbjct  1    MGRLFVTHLEGQIYTCKHCRTHLALYEDIVSKAFHSRHGRAYLFSKVVNVTTGENEDRQM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDG---NNYWINH  371
             TG+HTVADIFCV CGSIVGWKYETA+EK QKYKEG+SV+ER+K+SGPDG   NNYW+ +
Sbjct  61   ATGMHTVADIFCVGCGSIVGWKYETAHEKSQKYKEGKSVIERYKVSGPDGNNNNNYWVGN  120

Query  370  EARVAGSDADD  338
            EA V GSDADD
Sbjct  121  EAHVGGSDADD  131



>ref|XP_009419732.1| PREDICTED: protein yippee-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=129

 Score =   211 bits (537),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 112/128 (88%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLF+++LEGK+YSCKHC  HLAVS+DI+SKAF C+HG+AYLFNK VNVT G  E+R+M
Sbjct  1    MGRLFLISLEGKIYSCKHCQAHLAVSDDIVSKAFHCKHGRAYLFNKAVNVTVGIKEERLM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG+HTV+DIFCV CGSIVGWKY+ A+EK QKYKEG+ VLERFK++GPDG+ YW+ H+A 
Sbjct  61   ITGMHTVSDIFCVGCGSIVGWKYDAAHEKAQKYKEGKIVLERFKLTGPDGSRYWVTHDAH  120

Query  361  VAGSDADD  338
            + GSDADD
Sbjct  121  MGGSDADD  128



>ref|XP_011035968.1| PREDICTED: protein yippee-like [Populus euphratica]
 ref|XP_011035969.1| PREDICTED: protein yippee-like [Populus euphratica]
Length=130

 Score =   211 bits (537),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 115/130 (88%), Gaps = 1/130 (1%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFV +LEG++YSCKHC THLA+ +DI+SK+F  RHGKAYLF KVVNV +G+ E+R+M
Sbjct  1    MGRLFVESLEGRIYSCKHCRTHLALYDDIVSKSFHSRHGKAYLFKKVVNVFAGEKEERIM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHE-A  365
             TGLHTVADIFCV CGSIVGWKYETA+EK QKYKEG+SV+ERFK+SGPDG++YW+NHE  
Sbjct  61   ITGLHTVADIFCVGCGSIVGWKYETAHEKSQKYKEGKSVIERFKVSGPDGSHYWVNHEHH  120

Query  364  RVAGSDADDV  335
             + GSDADDV
Sbjct  121  HIGGSDADDV  130



>ref|XP_006298725.1| hypothetical protein CARUB_v10014821mg, partial [Capsella rubella]
 gb|EOA31623.1| hypothetical protein CARUB_v10014821mg, partial [Capsella rubella]
Length=156

 Score =   212 bits (539),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = -3

Query  766  RISPALFAVQERQKEMGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFN  587
            ++ P++     R++EMGRLF+VNLEGK YSCKHC T+L + +D++SK+FQ RHGKAYLF+
Sbjct  13   KLQPSILLEIVREREMGRLFLVNLEGKSYSCKHCKTNLGLYDDVVSKSFQSRHGKAYLFS  72

Query  586  KVVNVTSGKNEDRMMTTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKI  407
            KVVNV +GK EDRMM TG+HTV DI+CV+CGS VGW+YE A+EK+QKYKEG+SVLER+K+
Sbjct  73   KVVNVYAGKKEDRMMMTGMHTVVDIYCVKCGSYVGWRYEFAFEKNQKYKEGKSVLERYKV  132

Query  406  SGPDGNNYWINHEARVAGSDADD  338
             GPDGNNYW+  E     S++DD
Sbjct  133  WGPDGNNYWVAQEVEAGESESDD  155



>ref|NP_001150917.1| protein yippee-like [Zea mays]
 gb|ACG40937.1| protein yippee-like [Zea mays]
 gb|AFW67910.1| protein yippee-like protein [Zea mays]
Length=129

 Score =   211 bits (536),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLF+++L+G VYSCKHC THL V+ DI+SKAFQC+HGKAYLF+KVVNVTSG  EDRMM
Sbjct  1    MGRLFLMHLDGNVYSCKHCKTHLGVASDIISKAFQCKHGKAYLFHKVVNVTSGVKEDRMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG+HTV+DIFCV CGSIVGWKY+ A+EK Q+YKEG+ +LER+K+SGPDG+ YW+  +A 
Sbjct  61   ITGMHTVSDIFCVGCGSIVGWKYDAAHEKGQRYKEGKFILERYKVSGPDGSQYWVPQDAH  120

Query  361  VAGSDADDV  335
            + GSDADD+
Sbjct  121  LGGSDADDI  129



>ref|XP_010908535.1| PREDICTED: protein yippee-like isoform X2 [Elaeis guineensis]
Length=129

 Score =   210 bits (535),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 112/128 (88%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MG  F+++LEGK+YSCKHC THL +S+DI+S++F CRHGKAYLF+K+VNVT G  E+RMM
Sbjct  1    MGLPFLIHLEGKIYSCKHCQTHLGISDDIMSRSFHCRHGKAYLFSKIVNVTVGLKEERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TGLHTV+DIFCV CGSIVGWKYE A+EK QKYKEG+ +LERFK+SGPDG++YW++H+  
Sbjct  61   MTGLHTVSDIFCVGCGSIVGWKYEAAHEKSQKYKEGKFILERFKVSGPDGSHYWVSHDPH  120

Query  361  VAGSDADD  338
            V GSDADD
Sbjct  121  VGGSDADD  128



>ref|XP_009369154.1| PREDICTED: protein yippee-like [Pyrus x bretschneideri]
Length=129

 Score =   209 bits (533),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 112/128 (88%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFVV+LEGK+YSCKHC THLA+ ED++SK+F  RHGKAYLF+KVVNV SG+ EDR M
Sbjct  1    MGRLFVVSLEGKIYSCKHCRTHLALCEDVVSKSFYSRHGKAYLFSKVVNVFSGECEDRAM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TGLHTVADIFCV CGSIVGWKYETA++K QKYKEG+SVLER K+SGP+G  YW +HEA+
Sbjct  61   MTGLHTVADIFCVGCGSIVGWKYETAHDKSQKYKEGKSVLERVKVSGPEGRTYWASHEAQ  120

Query  361  VAGSDADD  338
            V  SDAD+
Sbjct  121  VGSSDADE  128



>ref|XP_004138427.1| PREDICTED: protein yippee-like At3g11230-like isoform 1 [Cucumis 
sativus]
 ref|XP_004138428.1| PREDICTED: protein yippee-like At3g11230-like isoform 2 [Cucumis 
sativus]
 ref|XP_004170483.1| PREDICTED: protein yippee-like At3g11230-like isoform 1 [Cucumis 
sativus]
 ref|XP_004170484.1| PREDICTED: protein yippee-like At3g11230-like isoform 2 [Cucumis 
sativus]
 gb|KGN45782.1| hypothetical protein Csa_6G011570 [Cucumis sativus]
Length=134

 Score =   209 bits (533),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 112/133 (84%), Gaps = 5/133 (4%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFVVNLEG++YSCKHC THLA+ EDI+SK+FQ RHGKAYLFNKVVNV+ G  E RMM
Sbjct  1    MGRLFVVNLEGRIYSCKHCRTHLALYEDIVSKSFQSRHGKAYLFNKVVNVSVGVKETRMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINH---  371
             TG+HTVADIFCV CGSIVGW YETA+EK+QKYKEG+SVLERFK+SGP G +YW++H   
Sbjct  61   MTGMHTVADIFCVGCGSIVGWTYETAFEKNQKYKEGKSVLERFKVSGPGGTSYWVSHTHS  120

Query  370  --EARVAGSDADD  338
               A   GSDAD+
Sbjct  121  HETAHGGGSDADE  133



>gb|KGN50647.1| hypothetical protein Csa_5G201320 [Cucumis sativus]
Length=202

 Score =   212 bits (539),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -3

Query  751  LFAVQERQKEMGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNV  572
            LF    R K MGRLFVVNLEG++YSCK C THLA+ +DI+SK+F  RHGKAYLFNKVVNV
Sbjct  64   LFVGSLRFKAMGRLFVVNLEGQIYSCKFCRTHLALYDDIISKSFHSRHGKAYLFNKVVNV  123

Query  571  TSGKNEDRMMTTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDG  392
              GK E+R+M TG+HTVADIFCV CGS+VGWKYETA+EK+QKYKEG+SVLERFK+ GPD 
Sbjct  124  CLGKIEERLMMTGMHTVADIFCVGCGSMVGWKYETAHEKNQKYKEGKSVLERFKVLGPDE  183

Query  391  NNYWINHEARVAGSDADDV  335
            +++W++HEA   GS+ DDV
Sbjct  184  SSHWVSHEADTGGSEGDDV  202



>ref|XP_010543736.1| PREDICTED: protein yippee-like At3g11230 isoform X1 [Tarenaya 
hassleriana]
Length=128

 Score =   208 bits (529),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 111/129 (86%), Gaps = 3/129 (2%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLF++NLEGK+Y CKHC THLAV ED++SK+FQCRHGKAYLFNKVVNV  G+ EDRMM
Sbjct  1    MGRLFLLNLEGKIYCCKHCKTHLAVCEDVVSKSFQCRHGKAYLFNKVVNVCPGEKEDRMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDG-NNYWINHEA  365
             TGLHTVADI+C++CGS +GWKYE AYEK QKYKEG+SVLERFK+SGP+G NN W+ HEA
Sbjct  61   MTGLHTVADIYCIKCGSYLGWKYEVAYEKSQKYKEGKSVLERFKVSGPEGSNNNWVAHEA  120

Query  364  RVAGSDADD  338
                SD +D
Sbjct  121  --GASDPED  127



>ref|XP_007026733.1| Yippee family zinc-binding protein, putative isoform 2 [Theobroma 
cacao]
 ref|XP_007026734.1| Yippee family zinc-binding protein, putative isoform 2 [Theobroma 
cacao]
 ref|XP_007026735.1| Yippee family zinc-binding protein, putative isoform 2 [Theobroma 
cacao]
 gb|EOY07235.1| Yippee family zinc-binding protein, putative isoform 2 [Theobroma 
cacao]
 gb|EOY07236.1| Yippee family zinc-binding protein, putative isoform 2 [Theobroma 
cacao]
 gb|EOY07237.1| Yippee family zinc-binding protein, putative isoform 2 [Theobroma 
cacao]
Length=129

 Score =   208 bits (529),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 109/128 (85%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFV+ LEG VYSCKHC THLA+  DI+SK+F CRHG+AYLF+KVVN+T G+ E+RMM
Sbjct  1    MGRLFVITLEGSVYSCKHCQTHLALLADIISKSFHCRHGRAYLFDKVVNITVGEKEERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG+HTV DIFCV CGSIVGWKYE A+EK QKYKEG+ +LERFK+ GPDG+NY ++ EA 
Sbjct  61   MTGMHTVVDIFCVGCGSIVGWKYEAAHEKLQKYKEGKFILERFKVLGPDGSNYLVSQEAM  120

Query  361  VAGSDADD  338
            V GSDADD
Sbjct  121  VGGSDADD  128



>ref|NP_001078135.1| Yippee family putative zinc-binding protein [Arabidopsis thaliana]
 gb|AEE75018.1| Yippee family putative zinc-binding protein [Arabidopsis thaliana]
Length=162

 Score =   209 bits (531),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = -3

Query  724  EMGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRM  545
            EMGRLF+VNLEGK YSCKHC T+LA+ +D++SK+FQ RHGKAYLF+KVVNV +GK EDRM
Sbjct  33   EMGRLFLVNLEGKSYSCKHCKTNLALCDDVVSKSFQSRHGKAYLFSKVVNVYAGKKEDRM  92

Query  544  MTTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEA  365
            M TG+HTV DI+CV+CGS VGWKYE A+EK+QKYKEG+SVLER+K+ GPDGNNYW+  E 
Sbjct  93   MMTGMHTVVDIYCVKCGSYVGWKYEFAFEKNQKYKEGKSVLERYKVWGPDGNNYWVAQEV  152

Query  364  RVAGSDADD  338
                SD DD
Sbjct  153  EAGDSDTDD  161



>ref|XP_002466620.1| hypothetical protein SORBIDRAFT_01g011160 [Sorghum bicolor]
 gb|EER93618.1| hypothetical protein SORBIDRAFT_01g011160 [Sorghum bicolor]
Length=129

 Score =   207 bits (528),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLF+++L+G VYSCKHC THL V+ DI+SKAF C+HGKAYLF+KVVNVTSG  EDRMM
Sbjct  1    MGRLFLMHLDGNVYSCKHCKTHLGVAGDIISKAFHCKHGKAYLFHKVVNVTSGVKEDRMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG+HTV+DIFCV CGSIVGWKYE A+EK Q+YKEG+ +LER+K+SGPDG+ YWI  +  
Sbjct  61   ITGMHTVSDIFCVGCGSIVGWKYEAAHEKSQRYKEGKFILERYKVSGPDGSQYWIAPDVN  120

Query  361  VAGSDADDV  335
            + GSDADDV
Sbjct  121  LGGSDADDV  129



>ref|XP_004982093.1| PREDICTED: protein yippee-like isoform X1 [Setaria italica]
Length=129

 Score =   207 bits (527),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLF+++L+G VYSCKHC THL ++ DI+SKAF C+HGKAYLF+KVVNVT G  EDR+M
Sbjct  1    MGRLFLMHLDGNVYSCKHCKTHLGLAGDIISKAFHCKHGKAYLFHKVVNVTPGVKEDRLM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG+HTV+DIFCV CGSIVGWKYE A+EK Q+YKEG+ +LERFK+SGPDG+ YWI  +A 
Sbjct  61   MTGMHTVSDIFCVGCGSIVGWKYEAAHEKSQRYKEGKYILERFKVSGPDGSQYWIAPDAH  120

Query  361  VAGSDADDV  335
            + GSDADDV
Sbjct  121  LVGSDADDV  129



>ref|XP_010031234.1| PREDICTED: protein yippee-like [Eucalyptus grandis]
 ref|XP_010031235.1| PREDICTED: protein yippee-like [Eucalyptus grandis]
 gb|KCW50498.1| hypothetical protein EUGRSUZ_J00225 [Eucalyptus grandis]
Length=130

 Score =   207 bits (527),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 113/130 (87%), Gaps = 1/130 (1%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+F V LEGK+Y+C+HC THLA++E I+SK+F CRHG+AYLF+KV NV+ G+ E+RMM
Sbjct  1    MGRVFAVTLEGKIYTCRHCKTHLAIAEHIVSKSFHCRHGRAYLFSKVANVSIGEREERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG+HTVADIFCV CG+IVGWKYETA+EK QKYKEG+SVLER K+ GPDG+NYW +HEA 
Sbjct  61   MTGMHTVADIFCVGCGAIVGWKYETAHEKAQKYKEGKSVLERNKLVGPDGSNYWASHEAH  120

Query  361  -VAGSDADDV  335
             + GSDADDV
Sbjct  121  IIGGSDADDV  130



>ref|XP_008441452.1| PREDICTED: protein yippee-like [Cucumis melo]
Length=134

 Score =   207 bits (527),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 110/133 (83%), Gaps = 5/133 (4%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFVVNLEG++YSCKHC THLA+ EDI+SK FQ RHGKAYLFNKVVNV+ G  E RMM
Sbjct  1    MGRLFVVNLEGRIYSCKHCRTHLALYEDIVSKTFQSRHGKAYLFNKVVNVSVGVKETRMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINH---  371
             TG+HTVADIFCV CGSIVGW YETA+EK+QKYKEG+SVLERFK+SGP G +YW++H   
Sbjct  61   MTGMHTVADIFCVGCGSIVGWTYETAFEKNQKYKEGKSVLERFKVSGPGGTSYWVSHTHS  120

Query  370  --EARVAGSDADD  338
                   GSDAD+
Sbjct  121  HETGHGGGSDADE  133



>ref|NP_566389.1| Yippee family putative zinc-binding protein [Arabidopsis thaliana]
 sp|Q9C777.1|YIPL3_ARATH RecName: Full=Protein yippee-like At3g11230 [Arabidopsis thaliana]
 gb|AAG50966.1|AC073395_8 unknown protein; 53948-55359 [Arabidopsis thaliana]
 gb|AAP21201.1| At3g11230 [Arabidopsis thaliana]
 dbj|BAE99710.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE75017.1| Yippee family putative zinc-binding protein [Arabidopsis thaliana]
Length=129

 Score =   206 bits (524),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 109/128 (85%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLF+VNLEGK YSCKHC T+LA+ +D++SK+FQ RHGKAYLF+KVVNV +GK EDRMM
Sbjct  1    MGRLFLVNLEGKSYSCKHCKTNLALCDDVVSKSFQSRHGKAYLFSKVVNVYAGKKEDRMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG+HTV DI+CV+CGS VGWKYE A+EK+QKYKEG+SVLER+K+ GPDGNNYW+  E  
Sbjct  61   MTGMHTVVDIYCVKCGSYVGWKYEFAFEKNQKYKEGKSVLERYKVWGPDGNNYWVAQEVE  120

Query  361  VAGSDADD  338
               SD DD
Sbjct  121  AGDSDTDD  128



>ref|XP_008676448.1| PREDICTED: protein yippee-like isoform X1 [Zea mays]
 tpg|DAA50814.1| TPA: protein yippee-like protein [Zea mays]
Length=129

 Score =   206 bits (524),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLF+++L+G VYSCKHC T L V+ DI+SKAF CRHGKAYLF+KV NVTSG  EDRMM
Sbjct  1    MGRLFLMHLDGNVYSCKHCRTQLGVASDIISKAFHCRHGKAYLFHKVANVTSGVKEDRMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG+HTV+DIFCV CGSIVGWKYE A+EK Q+YKEG+ +LER+K+SGPDG+ YWI  +  
Sbjct  61   MTGMHTVSDIFCVGCGSIVGWKYEAAHEKSQRYKEGKFILERYKVSGPDGSQYWIPQDPH  120

Query  361  VAGSDADDV  335
            + GSDADD+
Sbjct  121  LGGSDADDI  129



>ref|XP_010487129.1| PREDICTED: protein yippee-like At3g11230 [Camelina sativa]
 ref|XP_010486769.1| PREDICTED: protein yippee-like At3g11230 [Camelina sativa]
 ref|XP_010486770.1| PREDICTED: protein yippee-like At3g11230 [Camelina sativa]
Length=129

 Score =   206 bits (524),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 109/128 (85%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLF+VNLEGK YSCKHC T+LA+ +D++SK+FQ RHGKAYLF+KVVNV +GK EDRMM
Sbjct  1    MGRLFLVNLEGKSYSCKHCKTNLALYDDVVSKSFQSRHGKAYLFSKVVNVYAGKEEDRMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TGLHTV DI+CV+CGS VGW+YE A+EK+QKYKEG+SVLER+K+ GPDGNNYW+  E  
Sbjct  61   MTGLHTVVDIYCVKCGSYVGWRYEFAFEKNQKYKEGKSVLERYKVWGPDGNNYWVAQEVE  120

Query  361  VAGSDADD  338
               SD DD
Sbjct  121  AGESDTDD  128



>ref|XP_004149238.1| PREDICTED: protein yippee-like [Cucumis sativus]
 ref|XP_004162773.1| PREDICTED: protein yippee-like [Cucumis sativus]
Length=129

 Score =   206 bits (523),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFVVNLEG++YSCK C THLA+ +DI+SK+F  RHGKAYLFNKVVNV  GK E+R+M
Sbjct  1    MGRLFVVNLEGQIYSCKFCRTHLALYDDIISKSFHSRHGKAYLFNKVVNVCLGKIEERLM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG+HTVADIFCV CGS+VGWKYETA+EK+QKYKEG+SVLERFK+ GPD +++W++HEA 
Sbjct  61   MTGMHTVADIFCVGCGSMVGWKYETAHEKNQKYKEGKSVLERFKVLGPDESSHWVSHEAD  120

Query  361  VAGSDADDV  335
              GS+ DDV
Sbjct  121  TGGSEGDDV  129



>ref|XP_008243868.1| PREDICTED: protein yippee-like [Prunus mume]
Length=129

 Score =   206 bits (523),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 110/128 (86%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLF ++LEGK+YSCKHC THLA+ +DILSK+F CRHGKAYLF+ VVNVT G+ E+R+M
Sbjct  1    MGRLFAISLEGKIYSCKHCKTHLALVDDILSKSFHCRHGKAYLFHNVVNVTLGEKEERIM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TGLHTVADIFCV CGS+VGW+YE A EK QKYKEG+ +LERF+I GPDG+NY I  EA+
Sbjct  61   ITGLHTVADIFCVSCGSMVGWRYEAAQEKSQKYKEGKFILERFQILGPDGSNYSIALEAQ  120

Query  361  VAGSDADD  338
            + GSDADD
Sbjct  121  IGGSDADD  128



>gb|AAM67003.1| yippee-like protein [Arabidopsis thaliana]
Length=129

 Score =   206 bits (523),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 108/128 (84%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLF+VNLEGK YSCKHC T+LA+ +D+ SK+FQ RHGKAYLF+KVVNV +GK EDRMM
Sbjct  1    MGRLFLVNLEGKSYSCKHCKTNLALCDDVFSKSFQSRHGKAYLFSKVVNVYAGKKEDRMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG+HTV DI+CV+CGS VGWKYE A+EK+QKYKEG+SVLER+K+ GPDGNNYW+  E  
Sbjct  61   MTGMHTVVDIYCVKCGSYVGWKYEFAFEKNQKYKEGKSVLERYKVWGPDGNNYWVAQEVE  120

Query  361  VAGSDADD  338
               SD DD
Sbjct  121  AGDSDTDD  128



>ref|XP_003616622.1| Yippee-like protein [Medicago truncatula]
 gb|AES99580.1| yippee family zinc-binding protein, putative [Medicago truncatula]
 gb|AFK46358.1| unknown [Medicago truncatula]
Length=129

 Score =   206 bits (523),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 109/128 (85%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFVV+LEG++YSCKHC T LA+ ED++SKAF  RHGKAYLF KVVNV+ G+ EDR M
Sbjct  1    MGRLFVVHLEGRMYSCKHCRTPLALCEDVVSKAFHSRHGKAYLFRKVVNVSIGELEDRNM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG+HTVADIFCV CGSI+GW YETA+EK QKYKEG+SVLERFK+SGPDG NYW++H   
Sbjct  61   MTGMHTVADIFCVGCGSILGWTYETAHEKSQKYKEGKSVLERFKVSGPDGGNYWVSHATH  120

Query  361  VAGSDADD  338
              GSDADD
Sbjct  121  GVGSDADD  128



>ref|NP_001148915.1| protein yippee-like [Zea mays]
 gb|ACG33457.1| protein yippee-like [Zea mays]
Length=129

 Score =   205 bits (521),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLF+++L+G VYSCKHC T L V+ DI+SKAF CRHGKAYLF+KV NVTSG  EDRMM
Sbjct  1    MGRLFLMHLDGNVYSCKHCRTQLGVASDIISKAFHCRHGKAYLFHKVANVTSGVKEDRMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG+HTV+DIFCV CGSIVGWKYE A+EK Q+YKEG+ +LE++K+SGPDG+ YWI  +  
Sbjct  61   MTGMHTVSDIFCVGCGSIVGWKYEAAHEKSQRYKEGKFILEKYKVSGPDGSQYWIPQDPH  120

Query  361  VAGSDADDV  335
            + GSDADD+
Sbjct  121  LGGSDADDI  129



>ref|XP_010464823.1| PREDICTED: protein yippee-like At3g11230 [Camelina sativa]
 ref|XP_010464825.1| PREDICTED: protein yippee-like At3g11230 [Camelina sativa]
Length=129

 Score =   204 bits (520),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 109/128 (85%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLF+VNLEGK YSCKHC T+LA+ +D++SK+FQ RHGKAYLF+KVVNV +GK EDRMM
Sbjct  1    MGRLFLVNLEGKSYSCKHCKTNLALYDDVVSKSFQSRHGKAYLFSKVVNVYAGKEEDRMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TGLHTV DI+CV+CGS VGW+YE A+EK+QKYKEG+SVLER+K+ GPDGNNYW+  E  
Sbjct  61   MTGLHTVVDIYCVKCGSYVGWRYEFAFEKNQKYKEGKSVLERYKVWGPDGNNYWVAQEVE  120

Query  361  VAGSDADD  338
               SD D+
Sbjct  121  AGDSDTDE  128



>ref|XP_011077567.1| PREDICTED: protein yippee-like [Sesamum indicum]
Length=129

 Score =   204 bits (518),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLF++ LEG  Y+CKHC THLA+S+DI+SK+F CRHGKAYLF+KVVNVT G+ E+RMM
Sbjct  1    MGRLFLIYLEGNKYTCKHCQTHLALSDDIISKSFHCRHGKAYLFDKVVNVTVGEKEERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG+HTV DIFCV CGSIVGWKYE A+EK QKYK G+ +LERFK+ GPDG+NY I  + +
Sbjct  61   MTGMHTVVDIFCVGCGSIVGWKYEAAHEKSQKYKVGKFILERFKVLGPDGSNYSITQDTQ  120

Query  361  VAGSDADDV  335
            +AGSDADDV
Sbjct  121  MAGSDADDV  129



>ref|XP_002882719.1| yippee family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58978.1| yippee family protein [Arabidopsis lyrata subsp. lyrata]
Length=129

 Score =   203 bits (516),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 108/128 (84%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLF+VNLEGK YSCKHC T+L + +D++SK+FQ RHGKAYLF+KVVNV +GK EDRMM
Sbjct  1    MGRLFLVNLEGKSYSCKHCKTNLGLCDDVVSKSFQSRHGKAYLFSKVVNVYAGKKEDRMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG+HTV DI+CV+CGS VGWKYE A+EK+QKYKEG+SVL+R+K+ GPDGNNYW+  E  
Sbjct  61   MTGMHTVVDIYCVKCGSYVGWKYEFAFEKNQKYKEGKSVLDRYKVWGPDGNNYWVAQEVE  120

Query  361  VAGSDADD  338
               SD DD
Sbjct  121  AGDSDTDD  128



>ref|XP_008463228.1| PREDICTED: protein yippee-like [Cucumis melo]
Length=130

 Score =   202 bits (515),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 113/130 (87%), Gaps = 1/130 (1%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFVVNLEG++YSCK C THLA+ EDI+SK+F  RHGKAYLFNKVVNV  GK E+R+M
Sbjct  1    MGRLFVVNLEGQIYSCKFCRTHLALYEDIISKSFHSRHGKAYLFNKVVNVCLGKIEERLM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYW-INHEA  365
             TG+HTVADIFCV CGS+VGWKYETA+EK+QKYKEG+SVLERFK+ GPD +++W ++HEA
Sbjct  61   MTGMHTVADIFCVGCGSMVGWKYETAHEKNQKYKEGKSVLERFKVLGPDESSHWGVSHEA  120

Query  364  RVAGSDADDV  335
               GS+ DDV
Sbjct  121  DAGGSEGDDV  130



>ref|XP_006481018.1| PREDICTED: protein yippee-like [Citrus sinensis]
Length=129

 Score =   202 bits (514),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 88/128 (69%), Positives = 109/128 (85%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MG LF++ LEG +YSCKHC THL +++DI+SK+F CRHGKAYLFNKVVN+T G+ E+RMM
Sbjct  1    MGMLFLICLEGSIYSCKHCYTHLGLADDIISKSFHCRHGKAYLFNKVVNITVGEKEERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG+HTV DIFCV CGSIVGWKYE A EK QKYKEG+ +LERFK+ GPDG++Y ++ E +
Sbjct  61   MTGMHTVVDIFCVGCGSIVGWKYEAAQEKAQKYKEGKFILERFKVLGPDGSSYLVSQEGQ  120

Query  361  VAGSDADD  338
            V+GSDADD
Sbjct  121  VSGSDADD  128



>ref|XP_006366350.1| PREDICTED: protein yippee-like isoform X1 [Solanum tuberosum]
 ref|XP_006366351.1| PREDICTED: protein yippee-like isoform X2 [Solanum tuberosum]
Length=129

 Score =   201 bits (511),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 108/128 (84%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFV+ LEG +YSCK+C TH  +++ I+SK+FQCRHGKAYLF+KVVNVT G+ E+RMM
Sbjct  1    MGRLFVITLEGNIYSCKYCKTHFGLADHIMSKSFQCRHGKAYLFDKVVNVTLGEKEERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG+HTV DIFCV CGSIVGWKYE A EKDQKYKEGR +LERFKI GPDG+NY I  +A+
Sbjct  61   LTGIHTVVDIFCVGCGSIVGWKYEAAQEKDQKYKEGRFILERFKILGPDGSNYSILQDAQ  120

Query  361  VAGSDADD  338
            + GSD D+
Sbjct  121  LGGSDTDE  128



>gb|KFK38513.1| hypothetical protein AALP_AA3G122900 [Arabis alpina]
Length=128

 Score =   201 bits (511),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 88/128 (69%), Positives = 107/128 (84%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLF+VNLEGK YSC+HC T+LA+ ED++SK+FQ RHGKAYLF+KV NV +G  EDRMM
Sbjct  1    MGRLFLVNLEGKSYSCRHCKTNLALCEDVVSKSFQSRHGKAYLFSKVANVYAGGKEDRMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TGLHTV DI+CV+CGS VGW+YE A+EK+QKYKEG+SVLER+K+ GPDGNNYW+  E  
Sbjct  61   MTGLHTVVDIYCVKCGSYVGWRYEVAFEKNQKYKEGKSVLERYKVWGPDGNNYWVAQEVE  120

Query  361  VAGSDADD  338
               SD D+
Sbjct  121  AGESDTDE  128



>ref|XP_007140356.1| hypothetical protein PHAVU_008G105100g [Phaseolus vulgaris]
 gb|ESW12350.1| hypothetical protein PHAVU_008G105100g [Phaseolus vulgaris]
Length=129

 Score =   201 bits (510),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 106/129 (82%), Gaps = 0/129 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLF++NLEG  YSCKHC TH A+  DI+SK+F CRHGKAYLF+KVVNVT G+ E+RMM
Sbjct  1    MGRLFLINLEGNFYSCKHCQTHFALDGDIISKSFHCRHGKAYLFDKVVNVTIGEKEERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TGLHTV DIFCV CGSIVGWKYE A+EK QKYKEG+ +LER+K+ GPDG+ Y    EAR
Sbjct  61   ITGLHTVVDIFCVVCGSIVGWKYEVAHEKTQKYKEGKFILERYKVLGPDGSLYMAAREAR  120

Query  361  VAGSDADDV  335
             A SDADDV
Sbjct  121  AALSDADDV  129



>ref|XP_006407463.1| hypothetical protein EUTSA_v10021761mg [Eutrema salsugineum]
 gb|ESQ48916.1| hypothetical protein EUTSA_v10021761mg [Eutrema salsugineum]
Length=129

 Score =   201 bits (510),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 88/128 (69%), Positives = 107/128 (84%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLF+VNLEGK YSC+HC T+LA+ ED++SK+FQ RHGKAYLF KV NV +GK EDRMM
Sbjct  1    MGRLFLVNLEGKSYSCRHCKTNLALCEDVVSKSFQSRHGKAYLFRKVANVYAGKKEDRMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG+HTV DI+CV+CGS VGW+YE A+EK+QKYKEG+SVLER+K+ GPDGNNY++  E  
Sbjct  61   MTGMHTVVDIYCVKCGSYVGWRYEVAFEKNQKYKEGKSVLERYKVWGPDGNNYYVAQEVE  120

Query  361  VAGSDADD  338
               SD DD
Sbjct  121  AGESDTDD  128



>ref|XP_007207494.1| hypothetical protein PRUPE_ppa013324mg [Prunus persica]
 gb|EMJ08693.1| hypothetical protein PRUPE_ppa013324mg [Prunus persica]
Length=129

 Score =   199 bits (507),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 108/128 (84%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLF ++LEG +YSCKHC THLA+ + ILSK+F CRHGKAYLF+ VVNVT G+ E+R+M
Sbjct  1    MGRLFAISLEGNIYSCKHCKTHLALVDHILSKSFHCRHGKAYLFHNVVNVTLGEKEERIM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TGLHTVADIFCV CGS+VGW+YE A EK +KYKEG+ +LERF+I GPDG+NY I  EA+
Sbjct  61   ITGLHTVADIFCVSCGSMVGWRYEAAQEKSEKYKEGKFILERFQILGPDGSNYSIALEAQ  120

Query  361  VAGSDADD  338
            + GSDADD
Sbjct  121  IGGSDADD  128



>gb|KDP24463.1| hypothetical protein JCGZ_25027 [Jatropha curcas]
Length=129

 Score =   198 bits (504),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 109/128 (85%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLF+++LEG +YSCKHC THLAV++DI+SK+F CRHGKAYLF+KVVN+T G+ ++RMM
Sbjct  1    MGRLFLISLEGNIYSCKHCHTHLAVADDIISKSFHCRHGKAYLFDKVVNITEGEQDERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG+HTV DI+CV CGSI+GWKYE A+EK+QKYKEG+ +LERFKI  PDG+NY    EA+
Sbjct  61   MTGMHTVVDIYCVGCGSILGWKYEYAHEKNQKYKEGKFILERFKILSPDGSNYTGTQEAQ  120

Query  361  VAGSDADD  338
              GSD DD
Sbjct  121  GVGSDVDD  128



>ref|XP_004246327.1| PREDICTED: protein yippee-like [Solanum lycopersicum]
Length=129

 Score =   198 bits (503),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 88/128 (69%), Positives = 108/128 (84%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFV+ LEG  YSCK+C THL +++ I+SKAFQC+HG+AYLF+KVVNVT G+ E+RMM
Sbjct  1    MGRLFVITLEGNFYSCKYCKTHLVLADHIISKAFQCKHGRAYLFDKVVNVTLGEKEERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG+HTV DIFCV CGSIVGWKYE A E+DQKYKEG+ +LERFKI GPDG+NY I  +A+
Sbjct  61   ITGMHTVVDIFCVGCGSIVGWKYEAAQERDQKYKEGKFILERFKILGPDGSNYSILEDAQ  120

Query  361  VAGSDADD  338
            + GSD D+
Sbjct  121  LGGSDTDE  128



>emb|CDY08541.1| BnaA05g27770D [Brassica napus]
Length=214

 Score =   200 bits (509),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 130/190 (68%), Gaps = 18/190 (9%)
 Frame = -3

Query  859  AFNALTINQTHQKPTCVIRKSSFSSLIFLQFRISPA--------------LFAVQERQKE  722
            +F  +++  T   P  ++  SS  SL    FRI P               L    +++KE
Sbjct  27   SFCKVSLPDTQLPPITLL--SSAISLKKNSFRIFPGHDWASSTRSVPNWILIGFWKKKKE  84

Query  721  -MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRM  545
             MGRLF+VNLEGK YSC+HC T +A+ +D++SK+FQ RHGKAYLF+KV NV +GK EDRM
Sbjct  85   RMGRLFLVNLEGKSYSCRHCKTSIALCDDVVSKSFQSRHGKAYLFSKVANVYAGKKEDRM  144

Query  544  MTTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWI-NHE  368
            M TG+HTV DI+CV+CGS VGW+YE A+EK+QKYKEG+SVLER+K+ GPDGNNYW+   E
Sbjct  145  MMTGMHTVVDIYCVKCGSYVGWRYEFAFEKNQKYKEGKSVLERYKVCGPDGNNYWVAAQE  204

Query  367  ARVAGSDADD  338
                 SD D+
Sbjct  205  VEAGDSDTDE  214



>ref|XP_003530278.1| PREDICTED: protein yippee-like isoform X1 [Glycine max]
 ref|XP_006583647.1| PREDICTED: protein yippee-like isoform X2 [Glycine max]
 ref|XP_006583648.1| PREDICTED: protein yippee-like isoform X3 [Glycine max]
Length=125

 Score =   197 bits (501),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 107/128 (84%), Gaps = 3/128 (2%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLF++NLEG  YSCKHC TH A+ +DI+SK+FQCRHGKA+LF+KVVNVT G+ E+RMM
Sbjct  1    MGRLFLINLEGNFYSCKHCQTHFALEDDIISKSFQCRHGKAFLFDKVVNVTVGEKEERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TGLHTV DIFCV CGSIVGW+YE A+EK QKYKEG+ +LERFK+ GPDG+ Y     A+
Sbjct  61   ITGLHTVVDIFCVVCGSIVGWRYEAAHEKTQKYKEGKFILERFKVLGPDGSLYL---AAQ  117

Query  361  VAGSDADD  338
             AGSDADD
Sbjct  118  AAGSDADD  125



>ref|XP_009377785.1| PREDICTED: protein yippee-like [Pyrus x bretschneideri]
Length=128

 Score =   197 bits (500),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 106/128 (83%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFV  LE  +YSCKHC THL + +D++SK+F CRHGKAYLF+KVVNVT G+ E+R+M
Sbjct  1    MGRLFVTTLEENMYSCKHCRTHLGLVDDVISKSFHCRHGKAYLFDKVVNVTLGEQEERIM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TGLHTVADIFCV CGS VGWKYE A+EK QKYKEG+ +LERF+I GPDG+NY I  EA+
Sbjct  61   ITGLHTVADIFCVSCGSNVGWKYEAAHEKSQKYKEGKFILERFQILGPDGSNYSIALEAQ  120

Query  361  VAGSDADD  338
            + GSD DD
Sbjct  121  IGGSDGDD  128



>ref|XP_008370079.1| PREDICTED: protein yippee-like [Malus domestica]
Length=128

 Score =   197 bits (500),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 106/128 (83%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFV  LE  +YSCKHC THL + +D++SK+F CRHGKAYLF+KVVNVT G+ E+R+M
Sbjct  1    MGRLFVTTLEENMYSCKHCRTHLGLVDDVISKSFHCRHGKAYLFDKVVNVTLGEQEERIM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TGLHTVADIFCV CGS VGWKYE A+EK QKYKEG+ +LERF+I GPDG+NY I  EA+
Sbjct  61   ITGLHTVADIFCVSCGSNVGWKYEAAHEKSQKYKEGKFILERFQILGPDGSNYSIALEAQ  120

Query  361  VAGSDADD  338
            + GSD DD
Sbjct  121  IGGSDVDD  128



>gb|EPS69006.1| hypothetical protein M569_05769, partial [Genlisea aurea]
Length=123

 Score =   196 bits (498),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 109/128 (85%), Gaps = 5/128 (4%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+F ++LEGK+YSCKHCGTHLA+++DI+SK F  RHGKAYLFN+VVNV+ G+ E+R+M
Sbjct  1    MGRVFAISLEGKIYSCKHCGTHLALTDDIISKNFHSRHGKAYLFNRVVNVSLGEKEERVM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG H VADIFCV+CGS+VGWKYETA EK QKYKEG+SVLERFK+ GPDG+  WINH   
Sbjct  61   MTGSHVVADIFCVKCGSVVGWKYETAQEKAQKYKEGKSVLERFKLCGPDGS--WINH---  115

Query  361  VAGSDADD  338
            + GSD DD
Sbjct  116  IVGSDGDD  123



>ref|XP_008449254.1| PREDICTED: LOW QUALITY PROTEIN: protein yippee-like [Cucumis 
melo]
Length=129

 Score =   196 bits (498),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 85/128 (66%), Positives = 104/128 (81%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLF++ LEG  YSCKHC THLA+S+DI+S+ F CRHG+AYLFN VVNV+ G+ E+RMM
Sbjct  1    MGRLFLLXLEGNFYSCKHCKTHLALSKDIISRTFYCRHGRAYLFNDVVNVSVGEQEERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TGLHTV DIFCV CGSI+GWKYE AY+K QKYKEG+ +LE FK+ GPDG  Y  +H+ +
Sbjct  61   ITGLHTVVDIFCVGCGSIIGWKYEVAYDKSQKYKEGKYILEMFKVLGPDGTGYLASHDPQ  120

Query  361  VAGSDADD  338
            + GSD DD
Sbjct  121  LVGSDGDD  128



>ref|XP_009135158.1| PREDICTED: protein yippee-like At3g11230 [Brassica rapa]
 emb|CDX73883.1| BnaA03g31640D [Brassica napus]
Length=128

 Score =   196 bits (497),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 85/128 (66%), Positives = 104/128 (81%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLF+V LEGK Y C+HC T +A+ +D++SK+FQ RHGKAYLF+KV NV +GK EDRMM
Sbjct  1    MGRLFLVELEGKSYCCRHCKTDIALCDDVVSKSFQSRHGKAYLFSKVANVYAGKKEDRMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG+HTV DI+CV+CGS VGW+YE A+EK QKYKEG+SVLER+K+ GPDGNNYW+  E  
Sbjct  61   MTGMHTVVDIYCVKCGSYVGWRYEFAFEKSQKYKEGKSVLERYKVWGPDGNNYWVAQEVE  120

Query  361  VAGSDADD  338
               SD DD
Sbjct  121  AGDSDTDD  128



>emb|CDY01005.1| BnaC05g41950D [Brassica napus]
Length=129

 Score =   195 bits (496),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 109/129 (84%), Gaps = 1/129 (1%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLF+VNLEGK YSC+HC T +A+ +D++SK+FQ RHGKAYLF+KV NV +GK EDRMM
Sbjct  1    MGRLFLVNLEGKSYSCRHCKTSIALCDDVVSKSFQSRHGKAYLFSKVANVYAGKKEDRMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG+HTV DI+CV+CGS VGW+YE A+EK+QKYKEG+SVLER+K+ GPDGNNYW+  +  
Sbjct  61   MTGMHTVVDIYCVKCGSYVGWRYEFAFEKNQKYKEGKSVLERYKVCGPDGNNYWVAAQEV  120

Query  361  VAG-SDADD  338
             AG SD D+
Sbjct  121  EAGESDTDE  129



>ref|XP_009146743.1| PREDICTED: protein yippee-like At3g11230 [Brassica rapa]
Length=129

 Score =   195 bits (495),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 107/129 (83%), Gaps = 1/129 (1%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLF+VNLEGK YSC+HC T +A+ +D++SK+FQ RHGKAYLF+KV NV +GK EDRMM
Sbjct  1    MGRLFLVNLEGKSYSCRHCKTSIALCDDVVSKSFQSRHGKAYLFSKVANVYAGKKEDRMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWI-NHEA  365
             TG+HTV DI+CV+CGS VGW+YE A+EK+QKYKEG+SVLER+K+ GPDGNNYW+   E 
Sbjct  61   MTGMHTVVDIYCVKCGSYVGWRYEFAFEKNQKYKEGKSVLERYKVCGPDGNNYWVAAQEV  120

Query  364  RVAGSDADD  338
                SD D+
Sbjct  121  EAGDSDTDE  129



>dbj|BAJ85601.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=131

 Score =   195 bits (495),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 109/131 (83%), Gaps = 2/131 (2%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLF+++LEG  YSCK C  HL ++ DI+SK FQ +HGKAYLFN+VVNVTSG NEDRMM
Sbjct  1    MGRLFLMHLEGNAYSCKFCRAHLGLAADIISKNFQSKHGKAYLFNRVVNVTSGINEDRMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYW-INHEA  365
             TGLHTV+DIFCV CGSIVGWKYE A+EK Q+YKEG+ +LERFK+SGPDG++YW + H+A
Sbjct  61   MTGLHTVSDIFCVGCGSIVGWKYEAAHEKSQRYKEGKFILERFKVSGPDGSHYWGVTHDA  120

Query  364  -RVAGSDADDV  335
                GSD DD+
Sbjct  121  HHGGGSDTDDL  131



>ref|XP_008388207.1| PREDICTED: protein yippee-like [Malus domestica]
 ref|XP_008359787.1| PREDICTED: protein yippee-like [Malus domestica]
Length=129

 Score =   195 bits (495),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 88/128 (69%), Positives = 107/128 (84%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFV+ LE  +YSCKHC THLA+ +D++SK+F  RHGKAYLF+KVVNVT G+ E+R+M
Sbjct  1    MGRLFVITLEENMYSCKHCRTHLALVDDVISKSFHSRHGKAYLFDKVVNVTLGEKEERIM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TGLHTVADIFCV CGS VGWKYE A+EK QKYKEG+ +LERF+I GPDG+NY I  EA+
Sbjct  61   ITGLHTVADIFCVSCGSNVGWKYEAAHEKSQKYKEGKCILERFQILGPDGSNYSIALEAQ  120

Query  361  VAGSDADD  338
            + GSD D+
Sbjct  121  IGGSDGDE  128



>ref|XP_004305129.1| PREDICTED: protein yippee-like [Fragaria vesca subsp. vesca]
Length=136

 Score =   195 bits (496),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 108/135 (80%), Gaps = 7/135 (5%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFV+ LEG VYSCK+C THLA+++DILS +F CRHGKAYLF+ VVNVT G+ E+R+M
Sbjct  1    MGRLFVLTLEGHVYSCKYCKTHLALADDILSTSFHCRHGKAYLFDNVVNVTDGEKEERIM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNN-------Y  383
             TGLHTV DIFCV CGS+VGWKYE+AY++ QKYKEG+ +LERFKI GPDG+N       Y
Sbjct  61   ITGLHTVVDIFCVSCGSVVGWKYESAYDEGQKYKEGKFILERFKILGPDGSNYPRAHEDY  120

Query  382  WINHEARVAGSDADD  338
             I  EA + GSD DD
Sbjct  121  SIAQEAEIGGSDVDD  135



>ref|XP_006848191.1| hypothetical protein AMTR_s00029p00239230 [Amborella trichopoda]
 gb|ERN09772.1| hypothetical protein AMTR_s00029p00239230 [Amborella trichopoda]
Length=129

 Score =   194 bits (494),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 109/128 (85%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRL++++L+G++Y+CKHC THLA+ EDI SK+F CRHGKAYLF KVVNV  G  EDRMM
Sbjct  1    MGRLYLIHLDGRIYACKHCRTHLALCEDIESKSFHCRHGKAYLFKKVVNVFVGPKEDRMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
            T+G+HTV+DIFCV CGSIVGWKY  A+EK QK+KEG+ +LER K+   DG+N+W++HEA+
Sbjct  61   TSGMHTVSDIFCVGCGSIVGWKYLVAHEKGQKHKEGKFILERPKVEDFDGSNFWVSHEAQ  120

Query  361  VAGSDADD  338
            V GSDADD
Sbjct  121  VGGSDADD  128



>ref|XP_010543218.1| PREDICTED: protein yippee-like At3g08990 [Tarenaya hassleriana]
 ref|XP_010543219.1| PREDICTED: protein yippee-like At3g08990 [Tarenaya hassleriana]
Length=127

 Score =   194 bits (493),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLF+VNLEG +YSCKHC TH AV++DI+SK+F CRHGKAYLF++VVNVT G+ EDR+M
Sbjct  1    MGRLFLVNLEGSIYSCKHCRTHFAVADDIISKSFHCRHGKAYLFDRVVNVTVGEEEDRVM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG HTV DIFCV CG++VGWKYE AYEK QKYKEG+ +LERF + GPDG  Y +N E +
Sbjct  61   MTGWHTVVDIFCVGCGNLVGWKYEAAYEKSQKYKEGKFILERFMVLGPDGGGYHMNVEEQ  120

Query  361  VAGSDAD  341
            + GSD +
Sbjct  121  ILGSDEE  127



>emb|CDY00730.1| BnaC03g37140D [Brassica napus]
Length=128

 Score =   194 bits (493),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 85/128 (66%), Positives = 104/128 (81%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLF+V LEGK Y C+HC T +A+ +D++SK+FQ RHGKAYLF+KV NV +GK EDRMM
Sbjct  1    MGRLFLVELEGKSYCCRHCKTDIALCDDVVSKSFQSRHGKAYLFSKVANVYTGKKEDRMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG+HTV DI+CV+CGS VGW+YE A+EK QKYKEG+SVLER+K+ GPDGNNYW+  E  
Sbjct  61   MTGVHTVFDIYCVKCGSYVGWRYEFAFEKSQKYKEGKSVLERYKVWGPDGNNYWVAQEVE  120

Query  361  VAGSDADD  338
               SD DD
Sbjct  121  AGDSDTDD  128



>ref|XP_002528110.1| fad NAD binding oxidoreductases, putative [Ricinus communis]
 gb|EEF34289.1| fad NAD binding oxidoreductases, putative [Ricinus communis]
Length=129

 Score =   193 bits (490),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 101/128 (79%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLF +NLEG  Y CKHC TH A+  DILSK+F C+HGKAYLFN VVN+T G+ EDRMM
Sbjct  1    MGRLFFINLEGNFYCCKHCKTHFALVRDILSKSFHCKHGKAYLFNNVVNITEGEPEDRMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG+HTVADIFCV CGSIVGWKY  A+EK QKYKEG+ +LERFK+ GPDG+NY I+ EA+
Sbjct  61   MTGMHTVADIFCVDCGSIVGWKYLYAHEKSQKYKEGKFILERFKVLGPDGSNYVISQEAQ  120

Query  361  VAGSDADD  338
                  DD
Sbjct  121  AVEESDDD  128



>ref|XP_004147886.1| PREDICTED: protein yippee-like [Cucumis sativus]
 ref|XP_004165108.1| PREDICTED: protein yippee-like [Cucumis sativus]
 gb|KGN54366.1| hypothetical protein Csa_4G308560 [Cucumis sativus]
Length=131

 Score =   192 bits (489),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 102/127 (80%), Gaps = 0/127 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLF++ L+G  YSCKHC THLA+S+DI+S+ F CRHG+AYLFN VVNVT G+ E+RMM
Sbjct  1    MGRLFLITLDGNFYSCKHCKTHLALSKDIISRTFYCRHGRAYLFNNVVNVTVGEQEERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TGLHTV DIFCV CGSI+GWKYE AY+K QKYKEG+ +LE FK+  PDG  Y  +H+ +
Sbjct  61   ITGLHTVVDIFCVGCGSIIGWKYEVAYDKSQKYKEGKYILEMFKVLAPDGTGYLASHDPQ  120

Query  361  VAGSDAD  341
            + GSD D
Sbjct  121  LVGSDGD  127



>ref|XP_010464526.1| PREDICTED: protein yippee-like At3g08990 isoform X1 [Camelina 
sativa]
Length=156

 Score =   192 bits (489),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 114/154 (74%), Gaps = 2/154 (1%)
 Frame = -3

Query  802  KSSFSSLIFLQFRISPALFAVQERQKEMGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKA  623
            K S  SL    +R S   F V+    EMGRLFV+NLEG VYSCKHC TH A++ D++SK+
Sbjct  5    KPSLCSLSLSVWRFSS--FGVRWVCYEMGRLFVINLEGLVYSCKHCQTHFALTNDLISKS  62

Query  622  FQCRHGKAYLFNKVVNVTSGKNEDRMMTTGLHTVADIFCVRCGSIVGWKYETAYEKDQKY  443
            F C+HG+AYLF+ VVNVT G+ E R+M TG HTVADIFCV CGS+VGWKYE AYEK QKY
Sbjct  63   FHCKHGRAYLFDNVVNVTVGEKEHRVMMTGWHTVADIFCVSCGSLVGWKYEIAYEKSQKY  122

Query  442  KEGRSVLERFKISGPDGNNYWINHEARVAGSDAD  341
            KEG+ ++ERFK+ GPDG  Y ++ +  + GSD +
Sbjct  123  KEGKFIIERFKVLGPDGGGYDVDEDEPMIGSDEE  156



>ref|XP_002526887.1| fad NAD binding oxidoreductases, putative [Ricinus communis]
 gb|EEF35518.1| fad NAD binding oxidoreductases, putative [Ricinus communis]
Length=129

 Score =   191 bits (485),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 100/128 (78%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLF +NLEG  Y CKHC TH A+  DILSK+F C+HGKAYLFN VVN+T G+ EDRMM
Sbjct  1    MGRLFFINLEGNFYCCKHCRTHFALVRDILSKSFHCKHGKAYLFNNVVNITEGEPEDRMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG+HTVADIFCV CGSIVGWKY   +EK QKYKEG+ +L+RFK+ GPDGNNY I+ EA+
Sbjct  61   MTGMHTVADIFCVDCGSIVGWKYLYTHEKSQKYKEGKFILKRFKVLGPDGNNYVISQEAQ  120

Query  361  VAGSDADD  338
                  DD
Sbjct  121  AVEESDDD  128



>ref|XP_002882596.1| yippee family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58855.1| yippee family protein [Arabidopsis lyrata subsp. lyrata]
Length=127

 Score =   190 bits (483),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFV++LEG VYSCKHC TH AV+ DI+SK+F C+HG+AYLF+ VVNVT G+ E R+M
Sbjct  1    MGRLFVIDLEGLVYSCKHCQTHFAVTNDIISKSFHCKHGRAYLFDNVVNVTVGEKEHRVM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG HTVADIFCV CGS+VGWKYE AY+K QKYKEG+ ++ERFK+ GPDG  Y +NH+  
Sbjct  61   LTGWHTVADIFCVSCGSLVGWKYEIAYDKSQKYKEGKFIIERFKVLGPDGGGYDMNHDEP  120

Query  361  VAGSDAD  341
            + GSD +
Sbjct  121  MTGSDEE  127



>ref|XP_010552875.1| PREDICTED: protein yippee-like At3g11230 isoform X2 [Tarenaya 
hassleriana]
Length=138

 Score =   189 bits (480),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 108/133 (81%), Gaps = 4/133 (3%)
 Frame = -3

Query  724  EMGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRM  545
            +MGRLF+  LEGKVYSCK C THLA+ E+I+SK+FQC HGKAYLFNKVVNVT+G+ EDRM
Sbjct  5    QMGRLFLQRLEGKVYSCKICNTHLALYEEIVSKSFQCSHGKAYLFNKVVNVTAGEKEDRM  64

Query  544  MTTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEA  365
            M TGLHTVADI+CV+CGS +GWKYE AYE++QKYKEG+SVLERFK+S P+   YW   EA
Sbjct  65   MITGLHTVADIYCVKCGSYLGWKYEVAYEENQKYKEGKSVLERFKVSVPEVMGYWAAREA  124

Query  364  RV----AGSDADD  338
            +     A  D DD
Sbjct  125  QEARAGASDDEDD  137



>ref|XP_010534586.1| PREDICTED: protein yippee-like isoform X2 [Tarenaya hassleriana]
 ref|XP_010534592.1| PREDICTED: protein yippee-like isoform X1 [Tarenaya hassleriana]
Length=145

 Score =   189 bits (480),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = -3

Query  727  KEMGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDR  548
            ++MGRLFVVNLEGK+YSCKHC THLAV EDI+SK+F CRHGKAYLFNKVVNV+ G+NEDR
Sbjct  9    RKMGRLFVVNLEGKIYSCKHCKTHLAVYEDIISKSFHCRHGKAYLFNKVVNVSMGENEDR  68

Query  547  MMTTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLER  416
            MM TGLHTVADIFCV CGSIVGW+YE A+EK QKYKEG+SVLER
Sbjct  69   MMMTGLHTVADIFCVGCGSIVGWRYEMAHEKSQKYKEGKSVLER  112



>ref|XP_010552876.1| PREDICTED: protein yippee-like At3g11230 isoform X3 [Tarenaya 
hassleriana]
Length=133

 Score =   188 bits (478),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 107/132 (81%), Gaps = 4/132 (3%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLF+  LEGKVYSCK C THLA+ E+I+SK+FQC HGKAYLFNKVVNVT+G+ EDRMM
Sbjct  1    MGRLFLQRLEGKVYSCKICNTHLALYEEIVSKSFQCSHGKAYLFNKVVNVTAGEKEDRMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TGLHTVADI+CV+CGS +GWKYE AYE++QKYKEG+SVLERFK+S P+   YW   EA+
Sbjct  61   ITGLHTVADIYCVKCGSYLGWKYEVAYEENQKYKEGKSVLERFKVSVPEVMGYWAAREAQ  120

Query  361  V----AGSDADD  338
                 A  D DD
Sbjct  121  EARAGASDDEDD  132



>ref|XP_010534594.1| PREDICTED: protein yippee-like isoform X3 [Tarenaya hassleriana]
Length=135

 Score =   188 bits (478),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFVVNLEGK+YSCKHC THLAV EDI+SK+F CRHGKAYLFNKVVNV+ G+NEDRMM
Sbjct  1    MGRLFVVNLEGKIYSCKHCKTHLAVYEDIISKSFHCRHGKAYLFNKVVNVSMGENEDRMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLER  416
             TGLHTVADIFCV CGSIVGW+YE A+EK QKYKEG+SVLER
Sbjct  61   MTGLHTVADIFCVGCGSIVGWRYEMAHEKSQKYKEGKSVLER  102



>ref|XP_009588560.1| PREDICTED: protein yippee-like [Nicotiana tomentosiformis]
 ref|XP_009588561.1| PREDICTED: protein yippee-like [Nicotiana tomentosiformis]
Length=129

 Score =   188 bits (477),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 107/128 (84%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFV++LEG +Y CKHC TH A+ + ++S++FQC+HGKAYLF++VVNVT G+ E+R M
Sbjct  1    MGRLFVISLEGNIYRCKHCHTHFALLDHLISRSFQCKHGKAYLFDRVVNVTLGEKEERAM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG+HTV DIFCV CGSIVGWKYE A +K QKYKEG+ +LERFK+ GPDG++Y ++ +A+
Sbjct  61   LTGMHTVVDIFCVGCGSIVGWKYEAAEQKSQKYKEGKFILERFKVLGPDGSSYSLSQDAQ  120

Query  361  VAGSDADD  338
            + GSD D+
Sbjct  121  LGGSDTDE  128



>ref|XP_010534585.1| PREDICTED: protein yippee-like At3g55890 isoform X1 [Tarenaya 
hassleriana]
Length=171

 Score =   189 bits (480),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = -3

Query  727  KEMGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDR  548
            ++MGRLFVVNLEGK+YSCKHC THLAV EDI+SK+F CRHGKAYLFNKVVNV+ G+NEDR
Sbjct  9    RKMGRLFVVNLEGKIYSCKHCKTHLAVYEDIISKSFHCRHGKAYLFNKVVNVSMGENEDR  68

Query  547  MMTTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLER  416
            MM TGLHTVADIFCV CGSIVGW+YE A+EK QKYKEG+SVLER
Sbjct  69   MMMTGLHTVADIFCVGCGSIVGWRYEMAHEKSQKYKEGKSVLER  112



>ref|XP_010534587.1| PREDICTED: protein yippee-like At3g55890 isoform X3 [Tarenaya 
hassleriana]
Length=161

 Score =   188 bits (478),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFVVNLEGK+YSCKHC THLAV EDI+SK+F CRHGKAYLFNKVVNV+ G+NEDRMM
Sbjct  1    MGRLFVVNLEGKIYSCKHCKTHLAVYEDIISKSFHCRHGKAYLFNKVVNVSMGENEDRMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLER  416
             TGLHTVADIFCV CGSIVGW+YE A+EK QKYKEG+SVLER
Sbjct  61   MTGLHTVADIFCVGCGSIVGWRYEMAHEKSQKYKEGKSVLER  102



>ref|XP_004249078.1| PREDICTED: protein yippee-like [Solanum lycopersicum]
Length=127

 Score =   187 bits (475),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFV+ LEG++Y CKHC TH A+++ I+SK+F C HG+AYLF+KVVNVT G  EDRMM
Sbjct  1    MGRLFVLTLEGRIYKCKHCQTHFALADHIISKSFHCSHGRAYLFDKVVNVTVGAKEDRMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG+HTV DIFCV CGSIVGWKYE A++K QKYKEG+ +LERFK++GPDG+ Y ++H+  
Sbjct  61   MTGMHTVVDIFCVGCGSIVGWKYEAAHDKTQKYKEGKFILERFKVAGPDGSLYTVSHDDE  120

Query  361  VAGSD  347
            +   D
Sbjct  121  LGSDD  125



>ref|XP_010467712.1| PREDICTED: protein yippee-like At3g08990 [Camelina sativa]
 ref|XP_010467777.1| PREDICTED: protein yippee-like At3g08990 [Camelina sativa]
 ref|XP_010464527.1| PREDICTED: protein yippee-like At3g08990 isoform X2 [Camelina 
sativa]
 ref|XP_010464529.1| PREDICTED: protein yippee-like At3g08990 isoform X2 [Camelina 
sativa]
 ref|XP_010486452.1| PREDICTED: protein yippee-like At3g08990 [Camelina sativa]
 ref|XP_010486453.1| PREDICTED: protein yippee-like At3g08990 [Camelina sativa]
Length=127

 Score =   187 bits (474),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFV+NLEG VYSCKHC TH A++ D++SK+F C+HG+AYLF+ VVNVT G+ E R+M
Sbjct  1    MGRLFVINLEGLVYSCKHCQTHFALTNDLISKSFHCKHGRAYLFDNVVNVTVGEKEHRVM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG HTVADIFCV CGS+VGWKYE AYEK QKYKEG+ ++ERFK+ GPDG  Y ++ +  
Sbjct  61   MTGWHTVADIFCVSCGSLVGWKYEIAYEKSQKYKEGKFIIERFKVLGPDGGGYDVDEDEP  120

Query  361  VAGSDAD  341
            + GSD +
Sbjct  121  MIGSDEE  127



>ref|XP_009760319.1| PREDICTED: protein yippee-like isoform X1 [Nicotiana sylvestris]
Length=155

 Score =   187 bits (476),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -3

Query  769  FRISPALFAVQERQKEMGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLF  590
            F  S  L       K+MGRLFV++LEG +Y CKHC TH A+ + ++S++FQC++GKAYLF
Sbjct  11   FSTSKTLLQKGYNLKKMGRLFVISLEGNIYRCKHCHTHFALLDHLISRSFQCKYGKAYLF  70

Query  589  NKVVNVTSGKNEDRMMTTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFK  410
            ++VVNVT G+ E+R M TG+HTV DIFCV CGSIVGWKYE A +K QKYKEG+ ++ERFK
Sbjct  71   DRVVNVTLGEKEERAMLTGMHTVVDIFCVGCGSIVGWKYEAAEQKRQKYKEGKFIIERFK  130

Query  409  ISGPDGNNYWINHEARVAGSDADD  338
            + GPDG++Y ++ +A++ GSD D+
Sbjct  131  VLGPDGSSYSLSQDAQLGGSDTDE  154



>ref|XP_009758232.1| PREDICTED: protein yippee-like [Nicotiana sylvestris]
 ref|XP_009758233.1| PREDICTED: protein yippee-like [Nicotiana sylvestris]
 ref|XP_009758234.1| PREDICTED: protein yippee-like [Nicotiana sylvestris]
Length=128

 Score =   186 bits (471),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 106/128 (83%), Gaps = 1/128 (1%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLF+++LEG  Y CKHC THLA+++ I+SK+F C HGKAYLF+ VVNVT G+ EDRMM
Sbjct  1    MGRLFLISLEGNSYKCKHCRTHLALADHIISKSFHCSHGKAYLFDNVVNVTVGEKEDRMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG+HTV DIFCV CGSIVGWKYE A++K+QKYKEG+ +LERFKI  PDG  Y ++ +++
Sbjct  61   MTGMHTVVDIFCVGCGSIVGWKYEAAHDKNQKYKEGKFILERFKIENPDGTLYALSQDSQ  120

Query  361  VAGSDADD  338
            + GSDAD+
Sbjct  121  I-GSDADE  127



>emb|CAN76144.1| hypothetical protein VITISV_024928 [Vitis vinifera]
Length=129

 Score =   185 bits (470),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFVV+LEGK+YSCKHC THLA+SEDI+SK+F CRHGKAYLFNKVVNV+ G +E+RMM
Sbjct  1    MGRLFVVSLEGKIYSCKHCRTHLALSEDIVSKSFHCRHGKAYLFNKVVNVSVGVHEERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFK  410
             TG+HTVADIFCV CGSIVGW+YETA+EK QKYKEG+SVLER +
Sbjct  61   MTGMHTVADIFCVGCGSIVGWRYETAHEKAQKYKEGKSVLERLR  104



>ref|XP_009612245.1| PREDICTED: protein yippee-like [Nicotiana tomentosiformis]
 ref|XP_009612246.1| PREDICTED: protein yippee-like [Nicotiana tomentosiformis]
 ref|XP_009612247.1| PREDICTED: protein yippee-like [Nicotiana tomentosiformis]
 ref|XP_009612248.1| PREDICTED: protein yippee-like [Nicotiana tomentosiformis]
Length=128

 Score =   185 bits (470),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 106/128 (83%), Gaps = 1/128 (1%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLF+++LEG  Y CKHC  HLA+++ I+SK+F C HGKAYLF+ VVNVT G+ EDRMM
Sbjct  1    MGRLFLISLEGNSYKCKHCRAHLALADHIISKSFHCSHGKAYLFDNVVNVTVGEKEDRMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG+HTV DIFCV CGSIVGWKYE A++K+QKYKEG+ +LERFK+ GPDG  Y ++ +++
Sbjct  61   MTGMHTVVDIFCVGCGSIVGWKYEAAHDKNQKYKEGKFILERFKVEGPDGTLYTVSQDSQ  120

Query  361  VAGSDADD  338
            + GSDAD+
Sbjct  121  L-GSDADE  127



>ref|XP_007009018.1| Yippee family zinc-binding protein, putative isoform 5 [Theobroma 
cacao]
 gb|EOY17828.1| Yippee family zinc-binding protein, putative isoform 5 [Theobroma 
cacao]
Length=128

 Score =   185 bits (469),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFVVNLEGKVYSCKHC THLA+ EDI+SK+F CRHGKAYLF+KVVNV+SG+ EDR M
Sbjct  1    MGRLFVVNLEGKVYSCKHCKTHLALCEDIVSKSFHCRHGKAYLFSKVVNVSSGEKEDRHM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLER  416
             TGLHTVADIFCV CGSIVGWKYETA++K+QKYKEG+SVLER
Sbjct  61   MTGLHTVADIFCVGCGSIVGWKYETAHDKNQKYKEGKSVLER  102



>ref|XP_006349458.1| PREDICTED: protein yippee-like isoform X1 [Solanum tuberosum]
Length=151

 Score =   186 bits (471),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = -3

Query  727  KEMGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDR  548
            ++MGRLFV+ LEG +Y CKHC TH ++++ I+SK+F C HG+AYLF+KVVNVT G  E+R
Sbjct  23   EKMGRLFVITLEGSIYKCKHCQTHFSLADHIISKSFHCSHGRAYLFDKVVNVTVGAKEER  82

Query  547  MMTTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHE  368
            MM TG+HTV DIFCV CGSIVGWKYE A++K QKYKEG+ +LERFK++GPDG+ Y ++H+
Sbjct  83   MMMTGMHTVVDIFCVGCGSIVGWKYEAAHDKSQKYKEGKFILERFKVAGPDGSLYTVSHD  142

Query  367  ARVAGSD  347
              +   D
Sbjct  143  DELGSDD  149



>ref|XP_007026732.1| Yippee family zinc-binding protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY07234.1| Yippee family zinc-binding protein, putative isoform 1 [Theobroma 
cacao]
Length=169

 Score =   186 bits (472),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 109/168 (65%), Gaps = 40/168 (24%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSK----------------------------  626
            MGRLFV+ LEG VYSCKHC THLA+  DI+SK                            
Sbjct  1    MGRLFVITLEGSVYSCKHCQTHLALLADIISKNFDGWSHCDGRKPKEGHVCLNDGIVQQH  60

Query  625  ------------AFQCRHGKAYLFNKVVNVTSGKNEDRMMTTGLHTVADIFCVRCGSIVG  482
                        +F CRHG+AYLF+KVVN+T G+ E+RMM TG+HTV DIFCV CGSIVG
Sbjct  61   RDILTQPLPVFQSFHCRHGRAYLFDKVVNITVGEKEERMMMTGMHTVVDIFCVGCGSIVG  120

Query  481  WKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEARVAGSDADD  338
            WKYE A+EK QKYKEG+ +LERFK+ GPDG+NY ++ EA V GSDADD
Sbjct  121  WKYEAAHEKLQKYKEGKFILERFKVLGPDGSNYLVSQEAMVGGSDADD  168



>emb|CDP12662.1| unnamed protein product [Coffea canephora]
Length=129

 Score =   184 bits (468),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 103/128 (80%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLF+ NLEG  YSCKHC  HLA+++D++S++F  +HGKAYLF+K VNVT G+ E+RMM
Sbjct  1    MGRLFLTNLEGNHYSCKHCHAHLALTDDLISRSFHSKHGKAYLFDKAVNVTIGEKEERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG+HTV DIFCV CGS+VGWKYE+A+EK QKYKEG+ +LERFK+ GPDG+ Y  + + +
Sbjct  61   MTGMHTVVDIFCVGCGSLVGWKYESAFEKSQKYKEGKYILERFKVLGPDGSPYVFSQDGQ  120

Query  361  VAGSDADD  338
               SD DD
Sbjct  121  FLESDTDD  128



>ref|XP_002271449.1| PREDICTED: protein yippee-like isoform X2 [Vitis vinifera]
 ref|XP_010658288.1| PREDICTED: protein yippee-like isoform X2 [Vitis vinifera]
 emb|CBI25495.3| unnamed protein product [Vitis vinifera]
Length=118

 Score =   184 bits (467),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 104/123 (85%), Gaps = 9/123 (7%)
 Frame = -3

Query  706  VVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMMTTGLH  527
            VVNLEGK+YSCKHC THLA+SEDI+SK+F   +GKAYLFNKVVN++ G +E++MM TG++
Sbjct  4    VVNLEGKIYSCKHCRTHLALSEDIISKSFHTVNGKAYLFNKVVNISVGVHEEKMMMTGMY  63

Query  526  TVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEARVAGSD  347
            TVADIFCV CGSIVGW+YETA+EK QKYKEG+SVL+R KISGPDG+NY         GSD
Sbjct  64   TVADIFCVGCGSIVGWRYETAHEKAQKYKEGKSVLQRIKISGPDGSNY---------GSD  114

Query  346  ADD  338
            ADD
Sbjct  115  ADD  117



>ref|XP_002279771.1| PREDICTED: protein yippee-like [Vitis vinifera]
 ref|XP_010654166.1| PREDICTED: protein yippee-like [Vitis vinifera]
 ref|XP_010654167.1| PREDICTED: protein yippee-like [Vitis vinifera]
 emb|CAN77491.1| hypothetical protein VITISV_010726 [Vitis vinifera]
 emb|CBI30398.3| unnamed protein product [Vitis vinifera]
Length=129

 Score =   184 bits (468),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 104/129 (81%), Gaps = 2/129 (2%)
 Frame = -3

Query  721  MGRLFVVNLEG-KVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRM  545
            MGRLFVV L+G +VYSCKHC TH A +  I+SKAF  +HGKAYLF+KVVNVT G+ EDR+
Sbjct  1    MGRLFVVTLDGGRVYSCKHCKTHFAYANQIISKAFHSKHGKAYLFDKVVNVTVGEKEDRL  60

Query  544  MTTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEA  365
            M TG+HTV DIFCV CGSIVGWKYE A+EK Q+YKEG+ +LERFK+ GPDG+ Y +N + 
Sbjct  61   MMTGMHTVVDIFCVGCGSIVGWKYEAAHEKSQQYKEGKFILERFKVLGPDGSTY-VNQDI  119

Query  364  RVAGSDADD  338
            +  GSD +D
Sbjct  120  QAGGSDVED  128



>ref|XP_006349459.1| PREDICTED: protein yippee-like isoform X2 [Solanum tuberosum]
 ref|XP_006349460.1| PREDICTED: protein yippee-like isoform X3 [Solanum tuberosum]
 ref|XP_006349461.1| PREDICTED: protein yippee-like isoform X4 [Solanum tuberosum]
Length=127

 Score =   184 bits (467),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFV+ LEG +Y CKHC TH ++++ I+SK+F C HG+AYLF+KVVNVT G  E+RMM
Sbjct  1    MGRLFVITLEGSIYKCKHCQTHFSLADHIISKSFHCSHGRAYLFDKVVNVTVGAKEERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG+HTV DIFCV CGSIVGWKYE A++K QKYKEG+ +LERFK++GPDG+ Y ++H+  
Sbjct  61   MTGMHTVVDIFCVGCGSIVGWKYEAAHDKSQKYKEGKFILERFKVAGPDGSLYTVSHDDE  120

Query  361  VAGSD  347
            +   D
Sbjct  121  LGSDD  125



>ref|XP_009760320.1| PREDICTED: protein yippee-like isoform X2 [Nicotiana sylvestris]
 ref|XP_009760321.1| PREDICTED: protein yippee-like isoform X2 [Nicotiana sylvestris]
Length=129

 Score =   184 bits (466),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 107/128 (84%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFV++LEG +Y CKHC TH A+ + ++S++FQC++GKAYLF++VVNVT G+ E+R M
Sbjct  1    MGRLFVISLEGNIYRCKHCHTHFALLDHLISRSFQCKYGKAYLFDRVVNVTLGEKEERAM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG+HTV DIFCV CGSIVGWKYE A +K QKYKEG+ ++ERFK+ GPDG++Y ++ +A+
Sbjct  61   LTGMHTVVDIFCVGCGSIVGWKYEAAEQKRQKYKEGKFIIERFKVLGPDGSSYSLSQDAQ  120

Query  361  VAGSDADD  338
            + GSD D+
Sbjct  121  LGGSDTDE  128



>ref|XP_010543737.1| PREDICTED: protein yippee-like At3g11230 isoform X2 [Tarenaya 
hassleriana]
Length=119

 Score =   183 bits (465),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLF++NLEGK+Y CKHC THLAV ED++SK+FQCRHGKAYLFNKVVNV  G+ EDRMM
Sbjct  1    MGRLFLLNLEGKIYCCKHCKTHLAVCEDVVSKSFQCRHGKAYLFNKVVNVCPGEKEDRMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISG  401
             TGLHTVADI+C++CGS +GWKYE AYEK QKYKEG+SVLER  I G
Sbjct  61   MTGLHTVADIYCIKCGSYLGWKYEVAYEKSQKYKEGKSVLERENICG  107



>emb|CDY36308.1| BnaA01g31100D [Brassica napus]
Length=129

 Score =   183 bits (464),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 103/129 (80%), Gaps = 1/129 (1%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLF+VNLEGK YSC+HC T++A+  D++SK+FQ RHGKAYLF KV NV +G+ EDRMM
Sbjct  1    MGRLFLVNLEGKSYSCRHCNTNIALCSDVVSKSFQSRHGKAYLFRKVANVYAGEKEDRMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYW-INHEA  365
             TG+HTV DI+CV+CGS +GW+YE A+EK QKYKEG+SVLER+K+ GPD NNY  +  E 
Sbjct  61   MTGMHTVVDIYCVKCGSYLGWRYEFAFEKSQKYKEGKSVLERYKVCGPDENNYLVVAQEV  120

Query  364  RVAGSDADD  338
                +D D+
Sbjct  121  EAGETDTDE  129



>ref|XP_009344714.1| PREDICTED: protein yippee-like [Pyrus x bretschneideri]
Length=123

 Score =   182 bits (463),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFV+ LE  +YSCKHC THLA+ +D++SK+F   +GKAYLF+KVVNVT G+ E+R+M
Sbjct  1    MGRLFVITLEENMYSCKHCRTHLALVDDVISKSFYSSYGKAYLFDKVVNVTLGEKEERIM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TGLHTVADIFCV CGS VGWKYE A+EK QKYKEG+ +LERF+I GPDG+NY I  EA+
Sbjct  61   ITGLHTVADIFCVSCGSNVGWKYEAAHEKSQKYKEGKCILERFQILGPDGSNYSIALEAQ  120

Query  361  VAG  353
            + G
Sbjct  121  IGG  123



>ref|NP_187511.2| yippee family putative zinc-binding protein [Arabidopsis thaliana]
 ref|NP_001189843.1| yippee family putative zinc-binding protein [Arabidopsis thaliana]
 sp|Q9SR97.2|YIPL1_ARATH RecName: Full=Protein yippee-like At3g08990 [Arabidopsis thaliana]
 gb|ABF82608.1| At3g08990 [Arabidopsis thaliana]
 gb|AEE74705.1| yippee-like protein [Arabidopsis thaliana]
 gb|AEE74706.1| yippee-like protein [Arabidopsis thaliana]
Length=128

 Score =   182 bits (462),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 102/128 (80%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFV++LEG VYSCK+C TH AV+ DI+SK+F C+HG+AYLF+ VVNVT G+ E R+M
Sbjct  1    MGRLFVIDLEGLVYSCKYCQTHFAVTNDIISKSFHCKHGRAYLFDNVVNVTVGEKEHRVM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG HTVADIFCV CGS+VGWKYE AY+K QKYKEG+ +LERFK+ GP G  Y +N    
Sbjct  61   ITGWHTVADIFCVSCGSLVGWKYEIAYDKSQKYKEGKFILERFKVLGPYGGGYDMNQNEP  120

Query  361  VAGSDADD  338
            + GSD ++
Sbjct  121  MTGSDDEE  128



>ref|NP_973645.1| Yippee family putative zinc-binding protein [Arabidopsis thaliana]
 gb|AEC09781.1| Yippee family putative zinc-binding protein [Arabidopsis thaliana]
Length=110

 Score =   181 bits (460),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 82/103 (80%), Positives = 93/103 (90%), Gaps = 0/103 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFVVNLEGK+YSCKHC THLA  EDI+SK+F C+HGKAYLFNKV NV+ G+ E+R+M
Sbjct  1    MGRLFVVNLEGKIYSCKHCKTHLATYEDIISKSFHCKHGKAYLFNKVANVSIGETEERLM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERF  413
             TG HTVADIFCV CGSIVGWKYETA+EK+QKYKEG+SVLERF
Sbjct  61   MTGKHTVADIFCVSCGSIVGWKYETAHEKNQKYKEGKSVLERF  103



>ref|XP_009122309.1| PREDICTED: protein yippee-like At3g11230 [Brassica rapa]
Length=129

 Score =   181 bits (460),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 103/129 (80%), Gaps = 1/129 (1%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLF+VNLEGK Y+C+HC T++A+  D++SK+FQ RHGKAYLF KV NV +G+ EDRMM
Sbjct  1    MGRLFLVNLEGKSYNCRHCNTNIALCSDVVSKSFQSRHGKAYLFRKVANVYAGEKEDRMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYW-INHEA  365
             TG+HTV DI+CV+CGS +GW+YE A+EK QKYKEG+SVLER+K+ GPD NNY  +  E 
Sbjct  61   MTGMHTVVDIYCVKCGSYLGWRYEFAFEKSQKYKEGKSVLERYKVCGPDENNYLVVAQEV  120

Query  364  RVAGSDADD  338
                +D D+
Sbjct  121  EAGETDTDE  129



>gb|EYU26657.1| hypothetical protein MIMGU_mgv1a016231mg [Erythranthe guttata]
Length=130

 Score =   181 bits (458),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 106/130 (82%), Gaps = 1/130 (1%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLF+++LEG  YSCKHC THLA+ +DI+SK+F CR+GKAYLF+  VNVT G+ E+RMM
Sbjct  1    MGRLFLIHLEGYKYSCKHCKTHLALFDDIISKSFHCRNGKAYLFDNAVNVTVGEKEERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHE-A  365
             TG+H V DIFCV CGSIVGW+YE A+EK QKYK G+ +LERFK+ GPDG++Y    +  
Sbjct  61   MTGMHIVVDIFCVGCGSIVGWRYEAAHEKSQKYKVGKYILERFKVLGPDGSSYSPTLDNP  120

Query  364  RVAGSDADDV  335
            +++GSDADD+
Sbjct  121  QMSGSDADDM  130



>ref|XP_009146961.1| PREDICTED: protein yippee-like At3g08990 [Brassica rapa]
 ref|XP_009146962.1| PREDICTED: protein yippee-like At3g08990 [Brassica rapa]
Length=127

 Score =   179 bits (455),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 102/127 (80%), Gaps = 0/127 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFV++L+G+ YSCKHC T  A+++D++SK+F C+HG+AYLF  VVNVT G+ E R+M
Sbjct  1    MGRLFVIDLQGETYSCKHCHTPFALTDDLISKSFHCKHGRAYLFENVVNVTVGEMEHRIM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG HTVADIFCV CGS+VGWKYE AYEK QKYKEG+ ++ERFK+ GPDG  Y +N +  
Sbjct  61   MTGWHTVADIFCVCCGSLVGWKYEIAYEKSQKYKEGKFIIERFKVLGPDGGGYDMNEDEP  120

Query  361  VAGSDAD  341
            + GSD +
Sbjct  121  MIGSDEE  127



>ref|XP_003552239.1| PREDICTED: protein yippee-like isoform X1 [Glycine max]
 ref|XP_006602657.1| PREDICTED: protein yippee-like isoform X2 [Glycine max]
 ref|XP_006602658.1| PREDICTED: protein yippee-like isoform X3 [Glycine max]
 ref|XP_006602659.1| PREDICTED: protein yippee-like isoform X4 [Glycine max]
 ref|XP_006602660.1| PREDICTED: protein yippee-like isoform X5 [Glycine max]
 ref|XP_006602661.1| PREDICTED: protein yippee-like isoform X6 [Glycine max]
 ref|XP_006602662.1| PREDICTED: protein yippee-like isoform X7 [Glycine max]
Length=128

 Score =   179 bits (455),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 101/128 (79%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLF++NLEG  YSCKHC TH A+ +D++S++F CRHG A+LF+KVVNVT G+ E+RMM
Sbjct  1    MGRLFLINLEGDFYSCKHCRTHFALEDDVISRSFICRHGMAHLFDKVVNVTFGEKEERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             +GL TV DIFCV CGSI+GW+YE  +E++QKYKEG+ +LE FK+ GP  N +    EA 
Sbjct  61   LSGLKTVVDIFCVACGSILGWRYEVVHEQNQKYKEGKFILEMFKVLGPADNLFLAVQEAL  120

Query  361  VAGSDADD  338
             AGSDADD
Sbjct  121  AAGSDADD  128



>ref|XP_010688132.1| PREDICTED: protein yippee-like At3g08990 [Beta vulgaris subsp. 
vulgaris]
Length=131

 Score =   179 bits (453),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 97/121 (80%), Gaps = 0/121 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLF++ L+G++YSC+HC THL +++DI+SK+F CRHG+AYLFN VVN+T G+ EDR+M
Sbjct  1    MGRLFLITLQGRIYSCRHCDTHLGIADDIISKSFHCRHGRAYLFNNVVNITLGEKEDRVM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TGLHTV DIFCV CGS VGWKYE A E  QKYKEG+ +LERFK+ GP GN Y I    +
Sbjct  61   MTGLHTVVDIFCVGCGSNVGWKYEVADEMSQKYKEGKFILERFKVLGPTGNMYTITQALQ  120

Query  361  V  359
            +
Sbjct  121  L  121



>ref|XP_003623290.1| Protein yippee-like protein [Medicago truncatula]
 gb|AES79508.1| yippee family zinc-binding protein, putative [Medicago truncatula]
Length=122

 Score =   178 bits (451),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLF++NLEG  YSCKHC TH A+  DI+SK+F CR+G+AYLF+KVVNVT G+ E+RMM
Sbjct  1    MGRLFLINLEGNFYSCKHCQTHFALVGDIISKSFHCRYGRAYLFDKVVNVTIGEKEERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHE  368
             TG HTV DIFCV CGSIVGWKYE A EK+QKYKEG+ +LER+K+ GPDG+ Y  + E
Sbjct  61   ITGWHTVVDIFCVTCGSIVGWKYEAASEKNQKYKEGKFILERYKVMGPDGSLYSPDQE  118



>ref|XP_004492429.1| PREDICTED: protein yippee-like At3g08990-like isoform X1 [Cicer 
arietinum]
 ref|XP_004492430.1| PREDICTED: protein yippee-like At3g08990-like isoform X2 [Cicer 
arietinum]
Length=124

 Score =   176 bits (447),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLF++NLEG +YSCK C TH A  +DI+SK+F CR+GKAYLF+KVVNV  G+ E+RMM
Sbjct  1    MGRLFLINLEGYIYSCKFCHTHFARVDDIISKSFHCRYGKAYLFDKVVNVIDGEIEERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNY  383
             TGLHTV DIFCV CGSIVGWKY  AYE+ QKYKEG+ +LERFK+ GPDG+ Y
Sbjct  61   ITGLHTVVDIFCVSCGSIVGWKYMFAYERTQKYKEGKFILERFKVLGPDGSLY  113



>emb|CDY36324.1| BnaA01g30940D [Brassica napus]
Length=128

 Score =   177 bits (448),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 102/129 (79%), Gaps = 2/129 (2%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLF+VNLEGK YSC+HC T++A+  D++S +FQ RHGKAYLF KV NV +G+ EDRMM
Sbjct  1    MGRLFLVNLEGKSYSCRHCNTNIALCSDVVS-SFQSRHGKAYLFRKVANVYAGEKEDRMM  59

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYW-INHEA  365
             TG+HTV DI+CV+CGS +GW+YE A+EK QKYKEG+SVLER+K+ GPD NNY  +  E 
Sbjct  60   MTGMHTVVDIYCVKCGSYLGWRYEFAFEKSQKYKEGKSVLERYKVCGPDENNYLVVAQEV  119

Query  364  RVAGSDADD  338
                +D D+
Sbjct  120  EAGETDTDE  128



>gb|AES71126.2| yippee family zinc-binding protein, putative [Medicago truncatula]
Length=130

 Score =   175 bits (444),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFV+NLEGK+YSC++C THLA+ EDI+SK F  RHGKAYLFNKVVNV+ G+ E+R M
Sbjct  24   MGRLFVINLEGKIYSCRYCRTHLALYEDIVSKTFHSRHGKAYLFNKVVNVSLGETEERPM  83

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLER  416
             TGLHTVADIFCV CGSIVGWKYE A+EKDQKYKEG+SVLER
Sbjct  84   MTGLHTVADIFCVGCGSIVGWKYEIAHEKDQKYKEGKSVLER  125



>emb|CDY44673.1| BnaA05g29330D [Brassica napus]
Length=128

 Score =   175 bits (444),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 102/128 (80%), Gaps = 1/128 (1%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFV++L+G+ YSCKHC T  A+++D++SK+F C+HG+AYLF  VVNVT G+ E R+M
Sbjct  1    MGRLFVIDLQGETYSCKHCHTPFALTDDLISKSFHCKHGRAYLFENVVNVTVGEMEHRIM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLE-RFKISGPDGNNYWINHEA  365
             TG HTVADIFCV CGS+VGWKYE AYEK QKYKEG+ ++E RFK+ GPDG  Y +N + 
Sbjct  61   MTGWHTVADIFCVCCGSLVGWKYEIAYEKSQKYKEGKFIIESRFKVLGPDGGGYDMNEDE  120

Query  364  RVAGSDAD  341
             + GSD +
Sbjct  121  PMIGSDEE  128



>ref|XP_004490981.1| PREDICTED: protein yippee-like isoform X1 [Cicer arietinum]
 ref|XP_004490982.1| PREDICTED: protein yippee-like isoform X2 [Cicer arietinum]
Length=167

 Score =   175 bits (444),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 91/103 (88%), Gaps = 0/103 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFVV+LEGK+YSCKHC T LA+SEDI+SK+F  RHGKAYLF+KVVNV+ G+ EDR M
Sbjct  1    MGRLFVVHLEGKIYSCKHCRTPLALSEDIVSKSFHSRHGKAYLFSKVVNVSVGEKEDRPM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERF  413
             TG+HTVADIFCV CGSIVGW YETA+EK QKYKEG+SVLER 
Sbjct  61   LTGMHTVADIFCVGCGSIVGWTYETAHEKSQKYKEGKSVLERL  103



>ref|XP_010427390.1| PREDICTED: protein yippee-like At3g55890 [Camelina sativa]
Length=120

 Score =   173 bits (439),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 98/128 (77%), Gaps = 8/128 (6%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+F+V+LEG +Y CKHC THL+  +DI+SK FQC+HG+AYLFN VVN++ G  EDRMM
Sbjct  1    MGRVFMVDLEGNIYICKHCKTHLSTEQDIISKTFQCKHGRAYLFNNVVNISVGVKEDRMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG+HTV DIFCV CGS VGWKYE A++K QKYKEG+SVLE +KISGP        H++ 
Sbjct  61   ITGMHTVVDIFCVGCGSNVGWKYEFAHDKSQKYKEGKSVLELYKISGP--------HDSN  112

Query  361  VAGSDADD  338
               SD D+
Sbjct  113  DLASDEDE  120



>ref|XP_006292054.1| hypothetical protein CARUB_v10018247mg [Capsella rubella]
 gb|EOA24952.1| hypothetical protein CARUB_v10018247mg [Capsella rubella]
Length=121

 Score =   173 bits (438),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 97/128 (76%), Gaps = 8/128 (6%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+F+V+LEG +Y CKHC THL+  +DI+SK FQC HG+AYLFN VVN++ G  EDRMM
Sbjct  1    MGRVFMVDLEGDIYICKHCKTHLSKDQDIISKTFQCTHGRAYLFNNVVNISVGVKEDRMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG+HTV DIFCV CGS VGWKYE A++K QKYKEG+SVLE FKISGP  +N  I     
Sbjct  61   ITGMHTVVDIFCVGCGSNVGWKYEFAHDKSQKYKEGKSVLELFKISGPHDSNDLI-----  115

Query  361  VAGSDADD  338
               SD DD
Sbjct  116  ---SDGDD  120



>emb|CDY53089.1| BnaCnng24190D [Brassica napus]
Length=287

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/157 (54%), Positives = 113/157 (72%), Gaps = 8/157 (5%)
 Frame = -3

Query  787  SLIFLQFRISPALFAVQERQK-------EMGRLFVVNLEGKVYSCKHCGTHLAVSEDILS  629
             L  ++ R++  ++  Q   K       EMGRLFV++L+G+ YSCKHC T  A+++D++S
Sbjct  131  PLGLIRGRVTGVVWPPQRVSKINRWICLEMGRLFVIDLQGETYSCKHCHTPFALTDDLIS  190

Query  628  KAFQCRHGKAYLFNKVVNVTSGKNEDRMMTTGLHTVADIFCVRCGSIVGWKYETAYEKDQ  449
            K+F C+HG+AYLF  VVNVT G+ E R+M TG HTVADIFCV CGS+VGWKYE AYEK Q
Sbjct  191  KSFHCKHGRAYLFENVVNVTVGEMEHRIMMTGWHTVADIFCVCCGSLVGWKYEIAYEKSQ  250

Query  448  KYKEGRSVLE-RFKISGPDGNNYWINHEARVAGSDAD  341
            KYKEG+ ++E RFK+ GPDG  Y +N +  + GSD +
Sbjct  251  KYKEGKFIIESRFKVLGPDGGGYDMNEDEPMIGSDEE  287



>ref|XP_009782005.1| PREDICTED: protein yippee-like isoform X2 [Nicotiana sylvestris]
Length=108

 Score =   172 bits (435),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = -3

Query  625  AFQCRHGKAYLFNKVVNVTSGKNEDRMMTTGLHTVADIFCVRCGSIVGWKYETAYEKDQK  446
            +F CRHGKAYLF+KVVNVTSG+ E+R+M TG+HTVADIFCV CGSIVGWKYETA+EK QK
Sbjct  12   SFHCRHGKAYLFSKVVNVTSGEIENRIMMTGMHTVADIFCVCCGSIVGWKYETAHEKSQK  71

Query  445  YKEGRSVLERFKISGPDGNNYWINHEARVAGSDADDV  335
            YKEG+SVLERFKISGPDG++YW +HE  VAGSDADDV
Sbjct  72   YKEGKSVLERFKISGPDGSHYWASHETHVAGSDADDV  108



>ref|XP_009116284.1| PREDICTED: protein yippee-like At3g55890 [Brassica rapa]
 emb|CDY27256.1| BnaA09g35460D [Brassica napus]
Length=124

 Score =   172 bits (436),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 98/118 (83%), Gaps = 0/118 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+F+V+LEG++YSCKHC THL   +DI+SK+FQCR+G+AYLFN+VVN+++G  EDRM+
Sbjct  1    MGRVFIVDLEGQIYSCKHCNTHLTKEQDIMSKSFQCRYGQAYLFNEVVNISTGNEEDRML  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHE  368
             TGLHTV DIFCV CGS VGWKY TA++ +QKYKEG+SVLE +KI GP  +N  +  E
Sbjct  61   MTGLHTVTDIFCVGCGSNVGWKYVTAHDINQKYKEGKSVLELYKIVGPYDSNDLVCQE  118



>ref|XP_006300037.1| hypothetical protein CARUB_v10016261mg [Capsella rubella]
 gb|EOA32935.1| hypothetical protein CARUB_v10016261mg [Capsella rubella]
Length=153

 Score =   172 bits (436),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 102/153 (67%), Gaps = 26/153 (17%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFV++LEG VYSCKHC TH AV+ D++SK+F C+HG+AYLF+ VVNVT G+ E R M
Sbjct  1    MGRLFVIDLEGLVYSCKHCQTHFAVTNDLISKSFHCKHGRAYLFDNVVNVTVGEKEHRAM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKY--------------------------ETAYEKDQKYK  440
             TG HTVADIFCV CGS+VGWKY                          E AYEK QKYK
Sbjct  61   MTGWHTVADIFCVSCGSLVGWKYVQDSKLILVNKFRCNSFVANYHFLPQEIAYEKSQKYK  120

Query  439  EGRSVLERFKISGPDGNNYWINHEARVAGSDAD  341
            EG+ ++ERFK+ GPDG  Y ++ +  + GSD +
Sbjct  121  EGKFIIERFKVLGPDGGGYDVDQDEPMIGSDEE  153



>ref|XP_010504461.1| PREDICTED: protein yippee-like At3g55890 [Camelina sativa]
 ref|XP_010504462.1| PREDICTED: protein yippee-like At3g55890 [Camelina sativa]
Length=120

 Score =   171 bits (433),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 98/128 (77%), Gaps = 8/128 (6%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+F+V+L+G +Y CKHC THL+  +DI+SKAFQC+HG+AYLFN VVN++ G  EDRMM
Sbjct  1    MGRVFMVDLQGNIYICKHCKTHLSTEQDIISKAFQCKHGRAYLFNNVVNISVGVKEDRMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG+HTV DIFCV CGS VGWKYE A+ K QKYKEG+SVLE +KISGP        H++ 
Sbjct  61   ITGMHTVVDIFCVGCGSNVGWKYEFAHCKSQKYKEGKSVLELYKISGP--------HDSN  112

Query  361  VAGSDADD  338
               SD D+
Sbjct  113  DLASDGDE  120



>gb|KCW50499.1| hypothetical protein EUGRSUZ_J00225 [Eucalyptus grandis]
Length=120

 Score =   171 bits (433),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+F V LEGK+Y+C+HC THLA++E I+SK+F CRHG+AYLF+KV NV+ G+ E+RMM
Sbjct  1    MGRVFAVTLEGKIYTCRHCKTHLAIAEHIVSKSFHCRHGRAYLFSKVANVSIGEREERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLER  416
             TG+HTVADIFCV CG+IVGWKYETA+EK QKYKEG+SVLER
Sbjct  61   MTGMHTVADIFCVGCGAIVGWKYETAHEKAQKYKEGKSVLER  102



>gb|EPS67581.1| hypothetical protein M569_07194 [Genlisea aurea]
Length=133

 Score =   171 bits (434),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 101/129 (78%), Gaps = 1/129 (1%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+FV  LEG+ YSCK+C THLA ++ +LSK FQC+HG+AYLF+KV+NVT+G  E+RMM
Sbjct  1    MGRVFVTYLEGRKYSCKYCRTHLASADAVLSKGFQCQHGRAYLFDKVMNVTTGTKEERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG+HTV D+FC  CGS+VGWKYETA EK+ +YK GRS+LER K+ GP+GN Y  + E +
Sbjct  61   MTGIHTVVDLFCTGCGSLVGWKYETAPEKNLRYKVGRSILERMKLLGPNGNQYLADEENQ  120

Query  361  V-AGSDADD  338
                SD +D
Sbjct  121  QHIESDGED  129



>ref|XP_010516179.1| PREDICTED: protein yippee-like At3g55890 [Camelina sativa]
Length=120

 Score =   170 bits (431),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+F+V+L G +Y CKHC THL+  +DI+SK FQC+HG+AYLFN VVN++ G+ EDRMM
Sbjct  1    MGRVFMVDLIGNIYICKHCKTHLSTEQDIISKTFQCKHGRAYLFNNVVNISVGEKEDRMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHE  368
             TG+HTV DIFCV CGS VGWKYE A++K QKYKEG+SVLE +KISGP  +N   ++E
Sbjct  61   ITGMHTVVDIFCVGCGSNVGWKYEFAHDKSQKYKEGKSVLELYKISGPHDSNDLASYE  118



>ref|NP_191148.1| yippee family putative zinc-binding protein [Arabidopsis thaliana]
 sp|Q9LY56.1|YIPL4_ARATH RecName: Full=Protein yippee-like At3g55890 [Arabidopsis thaliana]
 emb|CAB87843.1| Yippee-like protein [Arabidopsis thaliana]
 gb|AAK93628.1| putative Yippee protein [Arabidopsis thaliana]
 gb|AAM14382.1| putative Yippee protein [Arabidopsis thaliana]
 dbj|BAF01012.1| Yippee-like protein [Arabidopsis thaliana]
 gb|AEE79454.1| yippee family putative zinc-binding protein [Arabidopsis thaliana]
Length=121

 Score =   170 bits (430),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 98/128 (77%), Gaps = 8/128 (6%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+F+V+LEG +Y CK C THL+  +DI+SK+FQC++G+AYLFN VVNV+ G+ EDRMM
Sbjct  1    MGRVFMVDLEGNIYICKLCKTHLSTDQDIMSKSFQCKNGRAYLFNNVVNVSVGEKEDRMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TGLH V DIFCV CGS VGWKYE A+EK QKYKEG+SVLE +KISGP        H++ 
Sbjct  61   ITGLHNVVDIFCVGCGSNVGWKYEFAHEKSQKYKEGKSVLELYKISGP--------HDSN  112

Query  361  VAGSDADD  338
               SD DD
Sbjct  113  DLVSDGDD  120



>emb|CDX72191.1| BnaC08g26830D [Brassica napus]
Length=124

 Score =   169 bits (428),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR F+V LEG++YSCKHC THL   +DI+SK+FQCR+G+AYLFN+VVN+++G  EDRM+
Sbjct  1    MGRGFIVGLEGQIYSCKHCNTHLTKEQDIMSKSFQCRYGQAYLFNEVVNISTGNEEDRML  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHE  368
             TGLHTV DIFCV CGS VGWKY TA++ +QKYKEG+SVLE +KI GP  +N  +  E
Sbjct  61   MTGLHTVTDIFCVGCGSNVGWKYVTAHDINQKYKEGKSVLELYKIVGPYDSNDLVCQE  118



>ref|XP_006362996.1| PREDICTED: protein yippee-like, partial [Solanum tuberosum]
Length=103

 Score =   168 bits (426),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = -3

Query  637  ILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMMTTGLHTVADIFCVRCGSIVGWKYETAYE  458
            +  ++F CRHGKAYLF+KVVNVTSG+ EDR+M TG+HTVADI CV CGSIVGWKYETA+E
Sbjct  3    VFLQSFHCRHGKAYLFSKVVNVTSGEIEDRVMMTGMHTVADIVCVCCGSIVGWKYETAHE  62

Query  457  KDQKYKEGRSVLERFKISGPDGNNYWINHEARVAGSDADDV  335
            K QKYKEG+SVLERFKI GPDG++YW +H+  VAGSDADDV
Sbjct  63   KSQKYKEGKSVLERFKICGPDGSHYWASHDTHVAGSDADDV  103



>gb|ADE77469.1| unknown [Picea sitchensis]
Length=127

 Score =   169 bits (428),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 102/128 (80%), Gaps = 2/128 (2%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRL+++ L+G +Y+C++CG+HLA  ++++SKAF CR G+AYLFN VVNV+ G  E+RMM
Sbjct  1    MGRLYLIQLDGGIYTCRNCGSHLAHCDELISKAFHCRRGRAYLFNTVVNVSVGPQEERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
            TTG+H VADIFC  CG IVGWKYE A+EK+QKYKEG+ +LER K++  DG N+++  +A 
Sbjct  61   TTGMHMVADIFCNCCGQIVGWKYEAAHEKNQKYKEGKFILERAKMADFDGTNFYL--DAH  118

Query  361  VAGSDADD  338
              GSD DD
Sbjct  119  PVGSDVDD  126



>ref|XP_003577629.1| PREDICTED: protein yippee-like [Brachypodium distachyon]
Length=137

 Score =   169 bits (428),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 102/133 (77%), Gaps = 5/133 (4%)
 Frame = -3

Query  721  MGRLFVVNLE--GKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDR  548
            MGRLF+++L   G +YSCKHC THLA +  I+SK F+C+HGKAYLF+KVVNV  G+ +DR
Sbjct  1    MGRLFLMSLAPTGAIYSCKHCQTHLAYAHHIVSKMFRCKHGKAYLFDKVVNVNDGEKDDR  60

Query  547  MMTTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISG---PDGNNYWI  377
            MMTTGLHTV DIFCV CG+I+GWKY +A+EK Q+YKEG+ +LER KI G    D    W 
Sbjct  61   MMTTGLHTVCDIFCVGCGAILGWKYVSAFEKSQRYKEGKFILERCKIHGGGPTDRIQLWA  120

Query  376  NHEARVAGSDADD  338
             H+AR++ S+ DD
Sbjct  121  EHDARISESEDDD  133



>dbj|BAK03540.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04502.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=141

 Score =   168 bits (426),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 106/137 (77%), Gaps = 9/137 (7%)
 Frame = -3

Query  721  MGRLFVVNLE---GKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNED  551
            MGRLF+ +L    G +Y CKHC +HLA ++ I+SK F+C+HGKAYLF+KVVNV +G++ED
Sbjct  1    MGRLFLTSLAPATGTIYRCKHCDSHLAYAQHIISKMFRCKHGKAYLFDKVVNVVAGESED  60

Query  550  -RMMTTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKI-SG----PDGN  389
             RMMTTGLHTV DIFCV CG+I+GWKY +A+EKDQ+YKEG+ +LER KI SG    PD  
Sbjct  61   DRMMTTGLHTVRDIFCVACGAILGWKYVSAFEKDQRYKEGKFILERCKIHSGGGGPPDRI  120

Query  388  NYWINHEARVAGSDADD  338
              W  H+AR++ S+ DD
Sbjct  121  QLWAEHDARISSSEDDD  137



>ref|XP_006403402.1| hypothetical protein EUTSA_v10010822mg [Eutrema salsugineum]
 gb|ESQ44855.1| hypothetical protein EUTSA_v10010822mg [Eutrema salsugineum]
Length=124

 Score =   168 bits (425),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MG++F+V L G++YSCKHC THL+  +DI+SK+FQC++G+AYLF+KVVN++ GK ED+MM
Sbjct  1    MGKVFMVELVGQIYSCKHCRTHLSTHQDIMSKSFQCKYGQAYLFSKVVNISIGKKEDKMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNN  386
             TGL+T+ DIFCV CGS VGWKYETA+++ QKYKEG+SVLE +KI GP  +N
Sbjct  61   LTGLYTITDIFCVGCGSNVGWKYETAHDQSQKYKEGKSVLELYKILGPHDSN  112



>ref|XP_008802789.1| PREDICTED: protein yippee-like [Phoenix dactylifera]
Length=104

 Score =   166 bits (420),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -3

Query  637  ILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMMTTGLHTVADIFCVRCGSIVGWKYETAYE  458
            ++SK+F CRHGKAYLFNKVVNVT G  E+R M TG+HTV+DIFCV CGSIVGWKYE A+E
Sbjct  4    MISKSFHCRHGKAYLFNKVVNVTVGLKEERAMMTGMHTVSDIFCVGCGSIVGWKYEAAHE  63

Query  457  KDQKYKEGRSVLERFKISGPDGNNYWINHEARVAGSDADD  338
            K QKYKEG+ +LERFK+SGPDG++YW++H+  V GSDADD
Sbjct  64   KSQKYKEGKFILERFKVSGPDGSHYWMSHDPHVGGSDADD  103



>ref|XP_010318253.1| PREDICTED: protein yippee-like isoform X1 [Solanum lycopersicum]
Length=143

 Score =   167 bits (422),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 85/145 (59%), Positives = 103/145 (71%), Gaps = 10/145 (7%)
 Frame = -3

Query  769  FRISPALFAVQERQKEMGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLF  590
            F+ S +L   QE + E  ++ +  L          GT  A    + S++F CRHGKAYLF
Sbjct  9    FQRSKSLSVRQEDKMESRKIMMSQL----------GTSRAHPTALTSRSFHCRHGKAYLF  58

Query  589  NKVVNVTSGKNEDRMMTTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFK  410
            +KVVNVTSG+ E R+M TGLHTVADIFCV CGSI GWKYETA+E  QKYKEG+SVLERFK
Sbjct  59   SKVVNVTSGEMEGRVMMTGLHTVADIFCVCCGSIFGWKYETAHEMSQKYKEGKSVLERFK  118

Query  409  ISGPDGNNYWINHEARVAGSDADDV  335
            I GPDG++Y  +H+  VAGSDADDV
Sbjct  119  ICGPDGSHYSGSHDTHVAGSDADDV  143



>gb|AAD56315.1|AC009326_2 Yippee-like protein [Arabidopsis thaliana]
Length=108

 Score =   165 bits (418),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFV++LEG VYSCK+C TH AV+ DI+SK+F C+HG+AYLF+ VVNVT G+ E R+M
Sbjct  1    MGRLFVIDLEGLVYSCKYCQTHFAVTNDIISKSFHCKHGRAYLFDNVVNVTVGEKEHRVM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERF  413
             TG HTVADIFCV CGS+VGWKYE AY+K QKYKEG+ +LERF
Sbjct  61   ITGWHTVADIFCVSCGSLVGWKYEIAYDKSQKYKEGKFILERF  103



>gb|ACO87677.1| yippee-like protein [Brachypodium sylvaticum]
Length=137

 Score =   166 bits (420),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 100/133 (75%), Gaps = 5/133 (4%)
 Frame = -3

Query  721  MGRLFVVNLE--GKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDR  548
            MGRLF+++L   G +YSCKHC T LA +  I+SK F+C+HGKAYLF+KVVNV  G+ +DR
Sbjct  1    MGRLFLMSLAPTGAIYSCKHCQTQLAYAHHIVSKMFRCKHGKAYLFDKVVNVNDGEKDDR  60

Query  547  MMTTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISG---PDGNNYWI  377
            MMTTGLHTV DIFCV CGSI+GWKY +A EK Q+YKEG+ +LER KI G    D    W 
Sbjct  61   MMTTGLHTVCDIFCVGCGSILGWKYVSAVEKSQRYKEGKFILERCKIHGGGPTDRIQLWA  120

Query  376  NHEARVAGSDADD  338
             H+AR++ S+ DD
Sbjct  121  EHDARISESEDDD  133



>ref|XP_010318254.1| PREDICTED: protein yippee-like isoform X3 [Solanum lycopersicum]
 ref|XP_010318255.1| PREDICTED: protein yippee-like isoform X3 [Solanum lycopersicum]
Length=121

 Score =   164 bits (416),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -3

Query  664  GTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMMTTGLHTVADIFCVRCGSIV  485
            GT  A    + S++F CRHGKAYLF+KVVNVTSG+ E R+M TGLHTVADIFCV CGSI 
Sbjct  12   GTSRAHPTALTSRSFHCRHGKAYLFSKVVNVTSGEMEGRVMMTGLHTVADIFCVCCGSIF  71

Query  484  GWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEARVAGSDADDV  335
            GWKYETA+E  QKYKEG+SVLERFKI GPDG++Y  +H+  VAGSDADDV
Sbjct  72   GWKYETAHEMSQKYKEGKSVLERFKICGPDGSHYSGSHDTHVAGSDADDV  121



>ref|XP_010256558.1| PREDICTED: protein yippee-like [Nelumbo nucifera]
Length=106

 Score =   163 bits (412),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = -3

Query  628  KAFQCRHGKAYLFNKVVNVTSGKNEDRMMTTGLHTVADIFCVRCGSIVGWKYETAYEKDQ  449
            ++F CRHGKAYLFNKVVN++ G+ EDRMM TG+HTVADIFCV CGSIVGWKYE A+EK Q
Sbjct  9    QSFHCRHGKAYLFNKVVNISVGEKEDRMMMTGMHTVADIFCVGCGSIVGWKYEAAHEKSQ  68

Query  448  KYKEGRSVLERFKISGPDGNNYWINHEARVAGSDADD  338
            +YKEG+ +LERFK+SGPDG++YW   E+ V GSDADD
Sbjct  69   RYKEGKFILERFKVSGPDGSHYWATQESHVVGSDADD  105



>gb|EMS65691.1| hypothetical protein TRIUR3_29370 [Triticum urartu]
Length=143

 Score =   164 bits (415),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 105/139 (76%), Gaps = 11/139 (8%)
 Frame = -3

Query  721  MGRLFVVNLE---GKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNED  551
            MGRLF+ +L    G +Y CKHC +HLA ++ I+SK F+C+HGKAYLF+KVVNV +G++ED
Sbjct  1    MGRLFLTSLAPATGTIYCCKHCDSHLAYAQHIISKMFRCKHGKAYLFDKVVNVVAGESED  60

Query  550  -RMMTTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKI---SG----PD  395
             RMMTTGLHTV DIFCV CG+I+GWKY +A+EKDQ+YKEG+ +LER +    SG    PD
Sbjct  61   DRMMTTGLHTVRDIFCVACGAILGWKYVSAFEKDQRYKEGKFILERRRCKIHSGGGGPPD  120

Query  394  GNNYWINHEARVAGSDADD  338
                W  H+AR++ S+ DD
Sbjct  121  RIQLWAEHDARISSSEDDD  139



>ref|XP_011043653.1| PREDICTED: protein yippee-like isoform X1 [Populus euphratica]
Length=147

 Score =   164 bits (415),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 88/99 (89%), Gaps = 1/99 (1%)
 Frame = -3

Query  628  KAFQCRHGKAYLFNKVVNVTSGKNEDRMMTTGLHTVADIFCVRCGSIVGWKYETAYEKDQ  449
            ++F CRHGKAYLFNKV NV  G+ E+RMM TGLHTVADIFCV CGSIVGWKYETA+E+ Q
Sbjct  49   QSFHCRHGKAYLFNKVANVFVGEKEERMMITGLHTVADIFCVGCGSIVGWKYETAHERSQ  108

Query  448  KYKEGRSVLERFKISGPDGNNYWINHE-ARVAGSDADDV  335
            KYKEG+SVLERFK+SGPDG++YW+N+E   ++GSDADDV
Sbjct  109  KYKEGKSVLERFKVSGPDGSHYWVNNEHHHISGSDADDV  147



>ref|XP_011098279.1| PREDICTED: protein yippee-like At5g53940 [Sesamum indicum]
Length=127

 Score =   162 bits (411),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 100/128 (78%), Gaps = 2/128 (2%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+FVV+LEG+ Y CK C THLA++++++S+AF CR GKAYLFN VVN+T G +E+RMM
Sbjct  1    MGRIFVVDLEGRTYRCKFCKTHLALADELVSRAFHCRRGKAYLFNNVVNITFGPHEERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             +G+HTVADIFC  CG IVGWKYE A+EK QKYKEG+ VLER +I     + ++I+   R
Sbjct  61   LSGVHTVADIFCCCCGQIVGWKYEAAHEKSQKYKEGKFVLERGRIMDGVDSEFYID--TR  118

Query  361  VAGSDADD  338
             + SDA+D
Sbjct  119  PSTSDAED  126



>ref|XP_008363614.1| PREDICTED: protein yippee-like At5g53940 [Malus domestica]
Length=131

 Score =   161 bits (408),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 94/130 (72%), Gaps = 2/130 (2%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+FVV LEG+ Y CK C THLA+  D +S+AF CR GKAYLFN  VN T+G  E+RMM
Sbjct  1    MGRIFVVELEGRCYKCKFCKTHLALFSDCVSRAFHCRRGKAYLFNNAVNTTTGTLEERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPD--GNNYWINHE  368
             +GLHTVADIFC  CG IVGWKYE+A+E  QKYKEG+ VLER +I         Y+++  
Sbjct  61   LSGLHTVADIFCCSCGQIVGWKYESAHENSQKYKEGKFVLERGRIVDEVDFSAEYFVDTR  120

Query  367  ARVAGSDADD  338
              ++GSDADD
Sbjct  121  PSMSGSDADD  130



>ref|XP_009760920.1| PREDICTED: protein yippee-like At5g53940 [Nicotiana sylvestris]
Length=127

 Score =   160 bits (406),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 99/128 (77%), Gaps = 2/128 (2%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+FVV+LEG+ Y CK C THLA+++D++S+ F CR GKAYLFNK VNVT G +E+R+M
Sbjct  1    MGRIFVVDLEGRTYKCKFCKTHLALADDVVSRGFHCRRGKAYLFNKAVNVTVGPHEERVM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             +G+HTVADIFC  CG IVGWKYE+A+E+ QKYKEG+ VLER +I       ++I+   R
Sbjct  61   LSGMHTVADIFCCCCGQIVGWKYESAHEESQKYKEGKFVLERDRIIDGVDTEFYID--TR  118

Query  361  VAGSDADD  338
             + SDA+D
Sbjct  119  PSISDAED  126



>ref|XP_009586618.1| PREDICTED: protein yippee-like At5g53940 [Nicotiana tomentosiformis]
Length=127

 Score =   160 bits (406),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 99/128 (77%), Gaps = 2/128 (2%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+FVV+LEG+ Y CK C THLA+++D++S+ F CR GKAYLFNK VNVT G +E+R+M
Sbjct  1    MGRIFVVDLEGRTYKCKFCKTHLALADDLVSRGFHCRRGKAYLFNKAVNVTVGPHEERVM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             +G+HTVADIFC  CG IVGWKYE+A+E+ QKYKEG+ VLER +I       ++I+   R
Sbjct  61   LSGMHTVADIFCCCCGQIVGWKYESAHEESQKYKEGKFVLERDRIIDGVDTEFYID--TR  118

Query  361  VAGSDADD  338
             + SDA+D
Sbjct  119  PSISDAED  126



>ref|XP_009419733.1| PREDICTED: protein yippee-like isoform X2 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009419734.1| PREDICTED: protein yippee-like isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=114

 Score =   160 bits (404),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = -3

Query  631  SKAFQCRHGKAYLFNKVVNVTSGKNEDRMMTTGLHTVADIFCVRCGSIVGWKYETAYEKD  452
            SKAF C+HG+AYLFNK VNVT G  E+R+M TG+HTV+DIFCV CGSIVGWKY+ A+EK 
Sbjct  16   SKAFHCKHGRAYLFNKAVNVTVGIKEERLMITGMHTVSDIFCVGCGSIVGWKYDAAHEKA  75

Query  451  QKYKEGRSVLERFKISGPDGNNYWINHEARVAGSDADD  338
            QKYKEG+ VLERFK++GPDG+ YW+ H+A + GSDADD
Sbjct  76   QKYKEGKIVLERFKLTGPDGSRYWVTHDAHMGGSDADD  113



>gb|KFK34830.1| hypothetical protein AALP_AA5G198700 [Arabis alpina]
Length=121

 Score =   160 bits (404),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = -3

Query  706  VVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMMTTGLH  527
            +++L GK+YSCKHC THL   +DI+SK FQC+HG+AYLF++VVN++ G  EDRMM TGLH
Sbjct  1    MIDLHGKIYSCKHCKTHLTKDQDIMSKTFQCKHGQAYLFSEVVNISIGNKEDRMMITGLH  60

Query  526  TVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNN  386
            TV DIFCV CGS VGWKYE A++K QKYKEG+SVLE  KI GP  +N
Sbjct  61   TVTDIFCVGCGSNVGWKYEVAHDKSQKYKEGKSVLELCKIFGPHDSN  107



>ref|XP_001774860.1| predicted protein [Physcomitrella patens]
 gb|EDQ60272.1| predicted protein [Physcomitrella patens]
Length=127

 Score =   160 bits (405),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 98/128 (77%), Gaps = 2/128 (2%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRL+++ L+G+VYSC+ C +HLA  ++++SK+F CRHGKAYLFN VVNV+ G  EDR+M
Sbjct  1    MGRLYLIQLDGRVYSCRCCRSHLAQCDELVSKSFHCRHGKAYLFNTVVNVSLGPQEDRLM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
            TTG HTVADI C  C  +VGWKYE+AYEK QKYKEG+ +LER K+   DG N+++  E  
Sbjct  61   TTGKHTVADICCNSCQQVVGWKYESAYEKSQKYKEGKFILERAKMIDGDGGNFFL--ETH  118

Query  361  VAGSDADD  338
               SDA++
Sbjct  119  EVDSDAEN  126



>ref|XP_009795869.1| PREDICTED: protein yippee-like At5g53940 [Nicotiana sylvestris]
Length=127

 Score =   160 bits (404),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 99/128 (77%), Gaps = 2/128 (2%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+FVV+LEG+ Y+CK C T LA+S+D++S+AF CR GKAYLF+  VN+T G +E+RMM
Sbjct  1    MGRIFVVDLEGRTYNCKFCKTQLALSDDLVSRAFHCRSGKAYLFSNAVNITFGPHEERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             +G+HTVADIFC  CG IVGWKYE A+EK QKYKEG+ VLER +I     + ++I+   R
Sbjct  61   LSGMHTVADIFCCCCGQIVGWKYEAAHEKSQKYKEGKYVLERGRIVDGVDSEFYID--TR  118

Query  361  VAGSDADD  338
             + SDA+D
Sbjct  119  PSMSDAED  126



>ref|XP_001756273.1| predicted protein [Physcomitrella patens]
 gb|EDQ79139.1| predicted protein [Physcomitrella patens]
Length=127

 Score =   159 bits (403),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 100/128 (78%), Gaps = 2/128 (2%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRL+++ L+G+VYSC++C +HLA  ++++SK+F CRHGKAYLFN VVNV+ G  EDR+M
Sbjct  1    MGRLYLIQLDGRVYSCRYCRSHLAQCDELVSKSFHCRHGKAYLFNTVVNVSLGPQEDRLM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
            TTG HTVADI C  C  +VGWKYE+A+EK QKYKEG+ +LER K+   DG +++++  A 
Sbjct  61   TTGKHTVADICCNCCQQVVGWKYESAFEKSQKYKEGKFILERAKMIDGDGASFYLD--AH  118

Query  361  VAGSDADD  338
               SDAD+
Sbjct  119  EVDSDADN  126



>ref|XP_009103975.1| PREDICTED: protein yippee-like At3g55890 [Brassica rapa]
 emb|CDX67628.1| BnaA07g16680D [Brassica napus]
Length=125

 Score =   159 bits (403),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+F+V+LEGKVYSC HC T+L   +DI+SK+F+ R G+AYLF++VVNV++G  EDRMM
Sbjct  1    MGRVFIVDLEGKVYSCIHCKTNLTKDQDIMSKSFKSRGGQAYLFSEVVNVSTGNKEDRMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNN  386
             TGLHTV DIFCV CG  VGWKY TA++  QKYKEG+SVLE +KI GP  +N
Sbjct  61   ITGLHTVTDIFCVGCGLNVGWKYVTAHDVSQKYKEGKSVLELYKIVGPHDSN  112



>ref|XP_002282618.2| PREDICTED: protein yippee-like At5g53940 [Vitis vinifera]
 emb|CBI20264.3| unnamed protein product [Vitis vinifera]
Length=127

 Score =   159 bits (402),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 96/128 (75%), Gaps = 2/128 (2%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+FVV LE + Y CK C THLA+++D++S+AF CR GKAYLFN  VN+T G  E+RMM
Sbjct  1    MGRVFVVELEARAYECKFCKTHLALADDLVSRAFHCRRGKAYLFNNAVNITVGAQEERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             +G+HTVADIFC  CG IVGWKYE A++K QKYKEG+ VLER +I     + ++I+  A 
Sbjct  61   ISGMHTVADIFCCCCGQIVGWKYEMAHDKTQKYKEGKFVLERGRIIDGVDSEFYIDTRAN  120

Query  361  VAGSDADD  338
            +  SDA+D
Sbjct  121  M--SDAED  126



>ref|XP_001761099.1| predicted protein [Physcomitrella patens]
 gb|EDQ74166.1| predicted protein [Physcomitrella patens]
Length=122

 Score =   159 bits (401),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRL+++ L+G++YSC+HC +HLA  ++++SK+F CRHGKAYLFN VVNV+ G  EDRMM
Sbjct  1    MGRLYLIQLDGRIYSCRHCRSHLAQCDELVSKSFHCRHGKAYLFNTVVNVSVGPLEDRMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDG  392
            TTG H VADIFC  C  +VGWKYE AYEK QKYKEG+ +LER K+   DG
Sbjct  61   TTGKHAVADIFCNSCQQVVGWKYEVAYEKSQKYKEGKFILERAKMVDGDG  110



>gb|EYU44969.1| hypothetical protein MIMGU_mgv1a016305mg [Erythranthe guttata]
Length=127

 Score =   158 bits (400),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 94/125 (75%), Gaps = 0/125 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+FVV LEG++Y CK C THLA++ +++S+AF CR GKAYLFN VVN+T G +E+RMM
Sbjct  1    MGRIFVVYLEGQIYICKFCKTHLALAHELVSRAFHCRRGKAYLFNNVVNITVGPHEERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             +G+HTVADIFC  CG IVGWKYE A+E  QKYKEG+ VLER +I     + ++I+  A 
Sbjct  61   LSGMHTVADIFCCCCGQIVGWKYEAAHEMSQKYKEGKFVLERARIMDGVDSEFYIDTCAS  120

Query  361  VAGSD  347
               SD
Sbjct  121  AGDSD  125



>ref|XP_010555759.1| PREDICTED: protein yippee-like At5g53940 [Tarenaya hassleriana]
Length=129

 Score =   158 bits (400),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 94/128 (73%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+F V LEG+ Y C+ C THLAV +D++S++F C+ GKAYLFN+ VN++ G  EDRMM
Sbjct  1    MGRIFTVELEGRSYRCRFCKTHLAVPDDLVSRSFHCQRGKAYLFNRAVNISMGPQEDRMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             +GLHTVADIFC  CG IVGWKYE+A EK QKYKEG+ VLER +I      +  +  + R
Sbjct  61   LSGLHTVADIFCCCCGQIVGWKYESAREKTQKYKEGKFVLERGRIVDEIDLSTEVYIDTR  120

Query  361  VAGSDADD  338
             + SDADD
Sbjct  121  GSTSDADD  128



>ref|XP_010272366.1| PREDICTED: protein yippee-like At5g53940 isoform X2 [Nelumbo 
nucifera]
Length=127

 Score =   158 bits (399),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 98/128 (77%), Gaps = 2/128 (2%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+F+V L+G+VY CK CG+HLA+++D++SK+F CR GKAYLFN VVN+  G  E+RMM
Sbjct  1    MGRIFLVELDGRVYKCKFCGSHLALADDLVSKSFHCRRGKAYLFNIVVNIIVGAQEERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             +G+HTVADIFC  CG IVGWKYE A++K QKYKEG+ VLER +I     + ++++   R
Sbjct  61   LSGMHTVADIFCCCCGQIVGWKYEAAHDKSQKYKEGKFVLERGRIVDGAESEFYLD--TR  118

Query  361  VAGSDADD  338
             + SD +D
Sbjct  119  PSMSDNED  126



>gb|ADE75788.1| unknown [Picea sitchensis]
Length=127

 Score =   157 bits (398),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 97/129 (75%), Gaps = 2/129 (2%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRL++V L+G+ YSC+ C +HLA+  +++SK+F C  GKAYLFN VVNV +G  E+R+M
Sbjct  1    MGRLYLVKLDGRTYSCRICDSHLALFGELISKSFHCGKGKAYLFNTVVNVYAGPLEERLM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
            TTGLHTVADIFC  CG IVGWKYE A+EK QKYKEG+ +LER ++   D  N+ I  +  
Sbjct  61   TTGLHTVADIFCNCCGQIVGWKYEAAHEKIQKYKEGKFILERARMRDGDVTNFAI--DTN  118

Query  361  VAGSDADDV  335
              GSDADDV
Sbjct  119  TVGSDADDV  127



>ref|XP_004251867.1| PREDICTED: protein yippee-like At5g53940 [Solanum lycopersicum]
Length=127

 Score =   157 bits (398),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 96/128 (75%), Gaps = 2/128 (2%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+FVV+LEG++Y CK C THLA+++D++S+ F CR GKAYLFNKVVNVT G  E+R M
Sbjct  1    MGRIFVVDLEGRIYKCKFCQTHLALADDLVSRGFHCRRGKAYLFNKVVNVTVGPQEERAM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             +G+HTVADIFC  CG IVGWKYE A+E+ QKYKE + VLER +I       ++I+  +R
Sbjct  61   LSGMHTVADIFCCCCGQIVGWKYEAAHEESQKYKEKKFVLERGRIIDGVDTEFYID--SR  118

Query  361  VAGSDADD  338
               SD +D
Sbjct  119  PTISDTED  126



>ref|XP_001777844.1| predicted protein [Physcomitrella patens]
 gb|EDQ57382.1| predicted protein [Physcomitrella patens]
Length=122

 Score =   157 bits (398),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRL+++ L+G++YSC++C +HLA  ++++SK+F CRHGKAYLFN VVNV+ G  EDRMM
Sbjct  1    MGRLYLIQLDGRIYSCRNCRSHLAQCDELVSKSFHCRHGKAYLFNTVVNVSVGPLEDRMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNN  386
            TTG HTVADIFC  C  +VGWKYE A+EK QKYKEG+ +LER K+   DG++
Sbjct  61   TTGKHTVADIFCNSCQQVVGWKYEVAFEKSQKYKEGKFILERAKMVDGDGSD  112



>ref|XP_006358970.1| PREDICTED: protein yippee-like At5g53940-like [Solanum tuberosum]
Length=127

 Score =   157 bits (398),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 95/128 (74%), Gaps = 2/128 (2%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+FVV+LEG++Y CK C THLA+++D++S+ F CR GKAYLFNKVVNVT G  E+R M
Sbjct  1    MGRIFVVDLEGRIYKCKFCKTHLALADDLVSRGFHCRRGKAYLFNKVVNVTVGPQEERAM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             +G+HTVADIFC  CG IVGWKYE A+E+ QKYKE + VLER +I       ++I+   R
Sbjct  61   LSGMHTVADIFCCCCGQIVGWKYEAAHEESQKYKEKKFVLERGRIVDGVDTEFYID--TR  118

Query  361  VAGSDADD  338
               SD +D
Sbjct  119  PTISDTED  126



>ref|XP_006451783.1| hypothetical protein CICLE_v10009870mg [Citrus clementina]
 ref|XP_006464803.1| PREDICTED: protein yippee-like At5g53940-like isoform X1 [Citrus 
sinensis]
 gb|ESR65023.1| hypothetical protein CICLE_v10009870mg [Citrus clementina]
 gb|KDO49238.1| hypothetical protein CISIN_1g030967mg [Citrus sinensis]
Length=133

 Score =   157 bits (398),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 92/123 (75%), Gaps = 4/123 (3%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+FVV L+G+ Y CK C THLA+ ED++S+AF CR GKAYLFN  VN+T G +E+R+M
Sbjct  1    MGRIFVVELDGRSYRCKFCRTHLALPEDLVSRAFHCRRGKAYLFNSAVNITVGASEERLM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERF----KISGPDGNNYWIN  374
             +G+HTVADIFC  CG IVGWKYE+A EK QKYKEG+ VLERF     I   +   +W++
Sbjct  61   LSGMHTVADIFCCSCGQIVGWKYESAREKSQKYKEGKFVLERFIFLSHIVSSNFCKHWVH  120

Query  373  HEA  365
             E+
Sbjct  121  EES  123



>ref|XP_006451784.1| hypothetical protein CICLE_v10009870mg [Citrus clementina]
 ref|XP_006464804.1| PREDICTED: protein yippee-like At5g53940-like isoform X2 [Citrus 
sinensis]
 gb|ESR65024.1| hypothetical protein CICLE_v10009870mg [Citrus clementina]
 gb|KDO49239.1| hypothetical protein CISIN_1g030967mg [Citrus sinensis]
Length=128

 Score =   157 bits (397),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 95/128 (74%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+FVV L+G+ Y CK C THLA+ ED++S+AF CR GKAYLFN  VN+T G +E+R+M
Sbjct  1    MGRIFVVELDGRSYRCKFCRTHLALPEDLVSRAFHCRRGKAYLFNSAVNITVGASEERLM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             +G+HTVADIFC  CG IVGWKYE+A EK QKYKEG+ VLER +I      +  +  + R
Sbjct  61   LSGMHTVADIFCCSCGQIVGWKYESAREKSQKYKEGKFVLERGRIVDEIDFSTEVYIDTR  120

Query  361  VAGSDADD  338
             + SDA++
Sbjct  121  PSVSDAEE  128



>ref|XP_003628551.1| Protein yippee-like protein [Medicago truncatula]
 gb|AET03027.1| yippee family zinc-binding protein, putative [Medicago truncatula]
 gb|KEH19413.1| yippee family zinc-binding protein, putative [Medicago truncatula]
Length=129

 Score =   157 bits (396),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 92/128 (72%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+F V L+G+VY CK C THLA+S D++S+ F C  GKAYLFN VVN TSG+  +RMM
Sbjct  1    MGRIFAVELDGRVYGCKSCNTHLALSTDLISRGFYCHRGKAYLFNNVVNFTSGEVVERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             +G+HTVADIFC RCG I+GWKYET  EK QKYKEG+ VLER +I    G +     E  
Sbjct  61   LSGMHTVADIFCCRCGQIIGWKYETVQEKSQKYKEGKFVLERGRIVDEIGFSTEFCVEGC  120

Query  361  VAGSDADD  338
            V+ SD +D
Sbjct  121  VSMSDTED  128



>gb|KDP45867.1| hypothetical protein JCGZ_15311 [Jatropha curcas]
Length=129

 Score =   156 bits (395),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 92/128 (72%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+FVV LEG+ Y CK C THLA+  D+ S++F CR GKAYLFNKVVN+T G  E+RMM
Sbjct  1    MGRIFVVELEGRSYRCKFCATHLALPIDLASRSFHCRRGKAYLFNKVVNITVGAMEERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             +G+HTVADIFC  CG IVGWKYE A+EK QKYKEG+ VLER +I      +  +  +  
Sbjct  61   LSGMHTVADIFCCCCGQIVGWKYEAAHEKSQKYKEGKFVLERGRIVDEMDLSSGVFIDTH  120

Query  361  VAGSDADD  338
               SDA+D
Sbjct  121  SGMSDAED  128



>ref|XP_002876341.1| yippee family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52600.1| yippee family protein [Arabidopsis lyrata subsp. lyrata]
Length=121

 Score =   156 bits (394),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 97/128 (76%), Gaps = 8/128 (6%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+F+V+LEG +Y CK C THL+  +DI+SK+FQC+HG AYLFN VVNV+ G  EDRMM
Sbjct  1    MGRVFMVDLEGNIYICKLCKTHLSTDQDIISKSFQCKHGGAYLFNNVVNVSVGVKEDRMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TGLHTV DIFCV CGS VGWKYE A++K QKYKEG+SVLE +KISGP        H++ 
Sbjct  61   ITGLHTVVDIFCVGCGSNVGWKYEFAHDKSQKYKEGKSVLELYKISGP--------HDSN  112

Query  361  VAGSDADD  338
               SD DD
Sbjct  113  DLVSDGDD  120



>ref|XP_007133235.1| hypothetical protein PHAVU_011G163000g [Phaseolus vulgaris]
 gb|ESW05229.1| hypothetical protein PHAVU_011G163000g [Phaseolus vulgaris]
Length=129

 Score =   156 bits (394),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 96/128 (75%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+F V LEG+ Y CK C THLA+++D++S+AF C+ GKAYLFN VVN T G  E+RMM
Sbjct  1    MGRIFTVELEGRSYGCKSCKTHLALADDLISRAFYCQRGKAYLFNNVVNFTIGVLEERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             +GLHTVADIFC  CG IVGWKYE+A+E+ QKYKEG+ VLER +I      +   + E+ 
Sbjct  61   LSGLHTVADIFCCCCGQIVGWKYESAHERSQKYKEGKFVLERGRIVDEIDFSAEFHIESC  120

Query  361  VAGSDADD  338
            V+ SDA+D
Sbjct  121  VSMSDAED  128



>ref|XP_009596207.1| PREDICTED: protein yippee-like At5g53940 isoform X2 [Nicotiana 
tomentosiformis]
Length=127

 Score =   155 bits (393),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 98/128 (77%), Gaps = 2/128 (2%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+FVV+LEG+ Y+CK C T LA+ +D++S+AF C  GKAYLF+  VN+T G +E+RMM
Sbjct  1    MGRIFVVDLEGRTYNCKFCKTQLALCDDLVSRAFHCPRGKAYLFSNAVNITFGPHEERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             +G+HTVADIFC  CG IVGWKYE A+EK+QKYKEG+ VLER +I     + ++I+   R
Sbjct  61   LSGMHTVADIFCCCCGQIVGWKYEAAHEKNQKYKEGKFVLERGRIIDGVDSEFYID--TR  118

Query  361  VAGSDADD  338
             + SDA+D
Sbjct  119  PSMSDAED  126



>gb|EPS57708.1| hypothetical protein M569_17109, partial [Genlisea aurea]
Length=101

 Score =   154 bits (390),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 84/101 (83%), Gaps = 0/101 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+F + LEGK YSC++C THLA+ +D++SK F  RHGKAYLF++VVNVT G  E+R+M
Sbjct  1    MGRVFAITLEGKSYSCRYCRTHLALIDDVVSKNFHSRHGKAYLFSRVVNVTVGDREERLM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLE  419
             TG H VADIFCV+CGSIVGWKYETA E  QKYKEG+SVLE
Sbjct  61   MTGSHVVADIFCVKCGSIVGWKYETAREISQKYKEGKSVLE  101



>ref|XP_009356776.1| PREDICTED: protein yippee-like At5g53940 [Pyrus x bretschneideri]
 ref|XP_009339296.1| PREDICTED: protein yippee-like At5g53940 [Pyrus x bretschneideri]
Length=131

 Score =   155 bits (392),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 93/130 (72%), Gaps = 2/130 (2%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+FVV LEG+ Y CK C THLA+  D +S+AF+C  GKAYLFN  VN  +G +E+RMM
Sbjct  1    MGRIFVVELEGRCYKCKFCKTHLALFSDCVSRAFRCHRGKAYLFNNAVNTIAGTSEERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPD--GNNYWINHE  368
             +GLHTVADIFC  CG IVGWKYE+A+E  QKYKEG+ +LER +I         ++++  
Sbjct  61   LSGLHTVADIFCCSCGQIVGWKYESAHENSQKYKEGKFILERGRIVDEVDFSGEFFVDTR  120

Query  367  ARVAGSDADD  338
              ++GSD DD
Sbjct  121  PSMSGSDGDD  130



>ref|XP_003543228.1| PREDICTED: protein yippee-like At5g53940-like [Glycine max]
Length=129

 Score =   155 bits (391),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+FVV LEG+ Y CK C THLA+++D++S+AF CR GKAYLFN  VN T G  E+RMM
Sbjct  1    MGRIFVVELEGRSYRCKFCRTHLALADDLISRAFHCRRGKAYLFNNAVNFTIGTPEERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKI  407
             +GLHTVADIFC  CG I+GWKYE+A+EK QKYKEG+ VLER +I
Sbjct  61   LSGLHTVADIFCCCCGQIIGWKYESAHEKSQKYKEGKFVLERGRI  105



>ref|NP_001237190.1| uncharacterized protein LOC100305822 [Glycine max]
 gb|ACU13695.1| unknown [Glycine max]
 gb|KHN22530.1| Protein yippee-like [Glycine soja]
Length=129

 Score =   155 bits (391),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 98/128 (77%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+F V LEG+ YSCK C THLA+++D++S++F C+ GKAYLFN VVN T G+ E+R+M
Sbjct  1    MGRIFTVELEGRSYSCKSCKTHLALADDLISRSFYCQRGKAYLFNNVVNFTIGELEERLM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             +GLHTVADIFC  CG IVGWKYE+A+E++QKYKEG+ VLER +I      +     E+ 
Sbjct  61   LSGLHTVADIFCCCCGQIVGWKYESAHERNQKYKEGKFVLERGRIVDEMDFSTEFRIESC  120

Query  361  VAGSDADD  338
            V+ SDA++
Sbjct  121  VSMSDAEN  128



>ref|XP_007021557.1| Yippee family zinc-binding protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY13082.1| Yippee family zinc-binding protein, putative isoform 1 [Theobroma 
cacao]
Length=129

 Score =   155 bits (391),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 93/128 (73%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+FVV L+G+ Y CK C THLA+ ED+ S++F CR GKAYLFN  VN+T G  EDR+M
Sbjct  1    MGRIFVVELDGRSYRCKFCRTHLALPEDLASRSFHCRRGKAYLFNNAVNITVGALEDRVM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             +G+HTVADIFC  CG IVGWKYE A+EK QKYKEG+ VLER +I      +  +  + R
Sbjct  61   ISGMHTVADIFCCCCGQIVGWKYEAAHEKSQKYKEGKFVLERGRIVDEIDFSSEVYIDTR  120

Query  361  VAGSDADD  338
             + SD++D
Sbjct  121  PSMSDSED  128



>ref|XP_011029524.1| PREDICTED: protein yippee-like At5g53940 [Populus euphratica]
Length=122

 Score =   154 bits (390),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+FVV LEG+ Y CK CGTHLA+ + ++SK+F+CR GKAYLFN VVN+T G  E+RMM
Sbjct  1    MGRIFVVELEGRSYRCKFCGTHLALPDQLVSKSFRCRRGKAYLFNNVVNITVGVLEERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISG  401
             +G+HTVADIFC  CG I+GWKYE A+E  QKYKEG+ VLER +I G
Sbjct  61   LSGMHTVADIFCCCCGGIIGWKYEAAHEMSQKYKEGKFVLERGRIVG  107



>ref|XP_004244248.1| PREDICTED: protein yippee-like At5g53940 [Solanum lycopersicum]
Length=129

 Score =   154 bits (390),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 97/130 (75%), Gaps = 3/130 (2%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLF+V+LEGK Y+CK C T L +++D++SKAF CR GKAYLFN VVN+T G++E+R M
Sbjct  1    MGRLFLVDLEGKTYNCKFCKTQLGLADDLVSKAFHCRRGKAYLFNNVVNITFGQSEERTM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFK-ISGPDGNNYWINHEA  365
             +G HTV DIFC  CG I+GWKYE A+EK QKYKEG+ VLER + I G   + ++I+   
Sbjct  61   LSGTHTVNDIFCCCCGQILGWKYERAHEKSQKYKEGKFVLERGRIIDGEVDSEFYID--T  118

Query  364  RVAGSDADDV  335
            R + SD +D 
Sbjct  119  RASTSDGEDT  128



>ref|XP_006348269.1| PREDICTED: protein yippee-like At5g53940-like isoform X2 [Solanum 
tuberosum]
Length=129

 Score =   154 bits (389),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 96/130 (74%), Gaps = 3/130 (2%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLF+V+LEGK Y+CK C T L  ++D++SKAF CR GKAYLFN VVN+T G++E+R M
Sbjct  1    MGRLFLVDLEGKTYNCKFCKTQLGQADDLVSKAFHCRSGKAYLFNNVVNITFGQSEERTM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFK-ISGPDGNNYWINHEA  365
              G HTV DIFC RCG I+GWKYE ++E+ QKYKEG+ VLER + I G   + ++I+   
Sbjct  61   LPGTHTVTDIFCRRCGQILGWKYEKSHEESQKYKEGKFVLERVRIIDGEFDSEFYID--T  118

Query  364  RVAGSDADDV  335
            R + SD +D 
Sbjct  119  RSSSSDDEDT  128



>ref|XP_006348268.1| PREDICTED: protein yippee-like At5g53940-like isoform X1 [Solanum 
tuberosum]
Length=129

 Score =   154 bits (389),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 95/130 (73%), Gaps = 3/130 (2%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLF+V+LEGK Y+CK C T L  ++D++SKAF CR GKAYLFN VVNVT G++E+R M
Sbjct  1    MGRLFLVDLEGKTYNCKFCKTQLGQADDLVSKAFHCRSGKAYLFNNVVNVTFGQSEERTM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLER-FKISGPDGNNYWINHEA  365
             +G HTV DIFC  CG I+GWKYE A+EK QKYKEG+ VLER   I G   + ++I+   
Sbjct  61   LSGTHTVTDIFCCCCGQILGWKYEKAHEKSQKYKEGKFVLERGMIIDGEVDSEFYID--T  118

Query  364  RVAGSDADDV  335
            R + SD +D 
Sbjct  119  RASTSDGEDT  128



>ref|XP_008226492.1| PREDICTED: protein yippee-like At5g53940 [Prunus mume]
Length=130

 Score =   154 bits (389),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 90/130 (69%), Gaps = 1/130 (1%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFVV LEG+ Y CK C THLA+  D +S+ F CR GKAYLFN  VN T G  E+R+M
Sbjct  1    MGRLFVVELEGRCYKCKFCKTHLALVSDCVSRGFHCRRGKAYLFNNAVNTTIGALEERLM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGP-DGNNYWINHEA  365
             +GLHTVADIFC  CG IVGWKYE+A+EK QKYKEG+ VLER +I    D +  +     
Sbjct  61   LSGLHTVADIFCCCCGQIVGWKYESAHEKSQKYKEGKFVLERGRIVDEVDFSTEFFVDSR  120

Query  364  RVAGSDADDV  335
                SDADDV
Sbjct  121  PSMSSDADDV  130



>ref|XP_007212220.1| hypothetical protein PRUPE_ppa013293mg [Prunus persica]
 gb|EMJ13419.1| hypothetical protein PRUPE_ppa013293mg [Prunus persica]
Length=130

 Score =   154 bits (388),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 91/130 (70%), Gaps = 1/130 (1%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+FVV LEG+ Y CK C THLA+  D +S++F CR GKAYLFN  VN T G  E+R+M
Sbjct  1    MGRIFVVELEGRCYKCKFCKTHLALVSDCVSRSFHCRRGKAYLFNNAVNTTIGALEERLM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGP-DGNNYWINHEA  365
             +GLHTVADIFC  CG IVGWKYE+A+EK QKYKEG+ VLER +I    D +  +     
Sbjct  61   LSGLHTVADIFCCCCGQIVGWKYESAHEKSQKYKEGKFVLERGRIVDEVDFSTEFFVDSR  120

Query  364  RVAGSDADDV  335
                SDADDV
Sbjct  121  PSMSSDADDV  130



>gb|KDO49240.1| hypothetical protein CISIN_1g030967mg [Citrus sinensis]
Length=168

 Score =   155 bits (391),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+FVV L+G+ Y CK C THLA+ ED++S+AF CR GKAYLFN  VN+T G +E+R+M
Sbjct  1    MGRIFVVELDGRSYRCKFCRTHLALPEDLVSRAFHCRRGKAYLFNSAVNITVGASEERLM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERF  413
             +G+HTVADIFC  CG IVGWKYE+A EK QKYKEG+ VLER+
Sbjct  61   LSGMHTVADIFCCSCGQIVGWKYESAREKSQKYKEGKFVLERY  103



>gb|KEH38682.1| yippee family zinc-binding protein, putative [Medicago truncatula]
Length=129

 Score =   153 bits (387),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 94/128 (73%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+FVV LEG+ Y CK C THLA+++D++S+AF CR G AYLF+K VN T+G   +RMM
Sbjct  1    MGRIFVVELEGRSYRCKFCRTHLALADDLISRAFHCRRGNAYLFSKAVNTTTGTPVERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             +GLHTV DIFC  CG IVGWKYE+A+EK QKYKEG+ VLER +I     ++     ++ 
Sbjct  61   LSGLHTVTDIFCCCCGQIVGWKYESAHEKSQKYKEGKFVLERGRIVDDVDSSTEFYIDSH  120

Query  361  VAGSDADD  338
            V+ SD +D
Sbjct  121  VSMSDGED  128



>ref|XP_010928868.1| PREDICTED: protein yippee-like At5g53940 isoform X1 [Elaeis guineensis]
Length=127

 Score =   153 bits (386),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 95/128 (74%), Gaps = 2/128 (2%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+F V L+G++Y C+ C THLA+++D+ S+AF CR GKAYLFN V N++ G  E+RMM
Sbjct  1    MGRVFTVELDGRIYRCRFCHTHLALAQDVASRAFHCRRGKAYLFNSVANISVGDKEERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             +G+HTVAD+FC  CG  VGWKYE A+++ QKYKEG+ VLER K+       ++I+   R
Sbjct  61   LSGMHTVADLFCCFCGQNVGWKYELAHDRSQKYKEGKFVLERGKLVDGFDAEFYID--TR  118

Query  361  VAGSDADD  338
             +GSDAD+
Sbjct  119  PSGSDADE  126



>emb|CDP05948.1| unnamed protein product [Coffea canephora]
Length=127

 Score =   152 bits (385),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 96/128 (75%), Gaps = 2/128 (2%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+FVV+LEG+ Y CK C THLA++++++S+ FQ R GKAYLF+  VN++ G  EDRMM
Sbjct  1    MGRIFVVDLEGRTYKCKFCKTHLALADNLVSRTFQSRRGKAYLFSNAVNISVGPREDRMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             +G+HTVADI+C  CG IVGWKYE A+ K QKYKEG+ VLER +I     + ++I+   R
Sbjct  61   LSGMHTVADIYCCCCGQIVGWKYEAAHVKSQKYKEGKFVLERGRIMDGLDSEFYID--TR  118

Query  361  VAGSDADD  338
             + SDA+D
Sbjct  119  PSMSDAED  126



>ref|XP_006826504.1| hypothetical protein AMTR_s00004p00261790 [Amborella trichopoda]
 gb|ERM93741.1| hypothetical protein AMTR_s00004p00261790 [Amborella trichopoda]
Length=128

 Score =   152 bits (385),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 96/129 (74%), Gaps = 3/129 (2%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR++V+ L+GKVY C++C +HLA+++D+ SK F CR GKAYLF+ VVNV  G  E+R+M
Sbjct  1    MGRVYVLELDGKVYRCRYCKSHLALAKDLASKDFHCRQGKAYLFHNVVNVNIGDLEERLM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKI-SGPDGNNYWINHEA  365
            T+G+HTVADIFC  CG IVGWKYE A+EK QKYKEG+ +LER +I +G D   Y   H  
Sbjct  61   TSGMHTVADIFCSCCGQIVGWKYEAAHEKTQKYKEGKFILERGRIVNGIDSEFYLDTHLG  120

Query  364  RVAGSDADD  338
                SDA+D
Sbjct  121  --GSSDAED  127



>ref|XP_010686417.1| PREDICTED: protein yippee-like At5g53940 [Beta vulgaris subsp. 
vulgaris]
Length=127

 Score =   152 bits (384),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 94/127 (74%), Gaps = 2/127 (2%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+F+V+L+GK Y C+ C + LA++ED+LS++F CR G+AYLF   VNVT G  EDR+M
Sbjct  1    MGRVFLVDLDGKAYRCRFCDSPLALAEDVLSRSFSCRQGRAYLFENAVNVTIGPEEDRLM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             +G+HTVADIFC  CG ++GWKY  A +K+QKYKEG+ VLER++I+      +  N +AR
Sbjct  61   MSGMHTVADIFCCGCGQLLGWKYMVARDKNQKYKEGKVVLERWRITEDSSEEF--NLDAR  118

Query  361  VAGSDAD  341
               SDA+
Sbjct  119  QNSSDAE  125



>ref|XP_002984164.1| hypothetical protein SELMODRAFT_268836 [Selaginella moellendorffii]
 gb|EFJ14674.1| hypothetical protein SELMODRAFT_268836 [Selaginella moellendorffii]
Length=130

 Score =   152 bits (384),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 93/129 (72%), Gaps = 2/129 (2%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRL ++ L+G+ YSC  C THLA  + ++SKAF CRHGKAYLFN VVNV  G  E+RMM
Sbjct  1    MGRLCLIELDGRFYSCHSCRTHLANFDQLMSKAFHCRHGKAYLFNTVVNVFEGPLEERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
            TTG+HTVADI+C  C   VGWKYE A  K QKYKEG+ +LER +I G +  ++++  E +
Sbjct  61   TTGVHTVADIYCKGCQQNVGWKYEFAQHKAQKYKEGKFILERGRIVGCEKGDFYL--ETQ  118

Query  361  VAGSDADDV  335
              GSD DDV
Sbjct  119  AIGSDPDDV  127



>ref|NP_001150808.1| protein yippee-like [Zea mays]
 gb|ACG40506.1| protein yippee-like [Zea mays]
Length=146

 Score =   152 bits (384),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -3

Query  724  EMGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRM  545
            + G L + +++G VYSCK CGT LAV++DI+SK+F C++GKAYLF+ VVNVT G+ EDRM
Sbjct  37   DAGPLKLDDVDGNVYSCKRCGTLLAVADDIVSKSFHCKNGKAYLFDNVVNVTVGEKEDRM  96

Query  544  MTTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPD  395
              TG+++V+DIFCV CG IVGWKYE A+E+ QKYKEG+ VLER+ + GP+
Sbjct  97   TITGMYSVSDIFCVGCGEIVGWKYEAAHERSQKYKEGKFVLERYLLLGPE  146



>ref|XP_010318372.1| PREDICTED: protein yippee-like [Solanum lycopersicum]
Length=165

 Score =   152 bits (385),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = -3

Query  628  KAFQCRHGKAYLFNKVVNVTSGKNEDRMMTTGLHTVADIFCVRCGSIVGWKYETAYEKDQ  449
            ++FQCRHGKAYLF KVVNVTSG+ E+R M TG+HTVADIFCV CGS VGWKYETA+E  Q
Sbjct  68   RSFQCRHGKAYLFRKVVNVTSGEIENRTMMTGMHTVADIFCVCCGSNVGWKYETAHEMSQ  127

Query  448  KYKEGRSVLERFKISGPDGNNYWINHEARVAGSDADDV  335
            KYKEG+SVLE FK  GPDG++Y  +H+  VAGSDADDV
Sbjct  128  KYKEGKSVLELFKNCGPDGSHYSASHDIHVAGSDADDV  165



>ref|XP_010675478.1| PREDICTED: protein yippee-like At5g53940 isoform X1 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010675480.1| PREDICTED: protein yippee-like At5g53940 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=126

 Score =   151 bits (381),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 92/129 (71%), Gaps = 3/129 (2%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLF++ LEG+ Y CK C THLA+ +D++S+A QCR GKAYLF  +VN+  G +E+R M
Sbjct  1    MGRLFLIELEGRAYKCKFCKTHLALVDDLVSRAIQCRKGKAYLFKHMVNMILGASEERFM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             +G+HTVAD++C  CG IVGWKYE A EK QKYKEG+ VLER +I       ++I+    
Sbjct  61   LSGMHTVADVYCCSCGQIVGWKYEAAQEKSQKYKEGKFVLERNRIIDGFSTEFYIDAHPT  120

Query  361  VAGSDADDV  335
               SDA+DV
Sbjct  121  ---SDAEDV  126



>emb|CDY46517.1| BnaC06g15680D [Brassica napus]
Length=125

 Score =   151 bits (381),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+F+V+LEGKVYSC HC T+L   +DI+SK+F+ R G+AYLF +VVNV++G  EDRMM
Sbjct  1    MGRVFIVDLEGKVYSCIHCKTNLTKDQDIMSKSFKIRGGQAYLFREVVNVSTGNKEDRMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNN  386
             TGLHTV DIFCV CG  VGWKY +     QKYKEG+SVLE +KI GP  +N
Sbjct  61   ITGLHTVTDIFCVGCGLNVGWKYVSQTFLYQKYKEGKSVLELYKIVGPHDSN  112



>tpg|DAA50816.1| TPA: protein yippee-like protein [Zea mays]
Length=144

 Score =   151 bits (382),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 91/118 (77%), Gaps = 0/118 (0%)
 Frame = -3

Query  748  FAVQERQKEMGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVT  569
            F V       G L + +++G VYSCK CGT LAV++DI+SK+F C++GKAYLF+ VVNVT
Sbjct  27   FTVNTDAAGAGPLKLDDVDGNVYSCKRCGTLLAVADDIVSKSFHCKNGKAYLFDNVVNVT  86

Query  568  SGKNEDRMMTTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPD  395
             G+ EDRM  TG+++V+DIFCV CG IVGWKYE A+E+ QKYKEG+ VLER+++ G +
Sbjct  87   VGEKEDRMTITGMYSVSDIFCVGCGEIVGWKYEAAHERSQKYKEGKFVLERYQLLGAE  144



>ref|XP_002972250.1| hypothetical protein SELMODRAFT_148358 [Selaginella moellendorffii]
 gb|EFJ26336.1| hypothetical protein SELMODRAFT_148358 [Selaginella moellendorffii]
Length=130

 Score =   151 bits (381),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 94/129 (73%), Gaps = 2/129 (2%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRL ++ L+G+ YSC  C THLA  + ++SKAF CRHGKAYLFN VVNV  G  E+RMM
Sbjct  1    MGRLCLIELDGRFYSCHSCRTHLANFDQLMSKAFHCRHGKAYLFNTVVNVFEGPLEERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
            TTG+HTVADI+C  C   VGWKYE A  K QKYKEG+ +LER ++ G +  +++++ +A 
Sbjct  61   TTGVHTVADIYCKGCQQNVGWKYEFAQHKAQKYKEGKFILERGRVVGCEKGDFYLDTQA-  119

Query  361  VAGSDADDV  335
              GSD DDV
Sbjct  120  -IGSDPDDV  127



>gb|ABK25918.1| unknown [Picea sitchensis]
Length=129

 Score =   151 bits (381),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 93/128 (73%), Gaps = 2/128 (2%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRL++V L G++Y C+ C +HLA  + ILSK F C+HGKAYLFN VVNV++G  E+RMM
Sbjct  1    MGRLYLVQLSGRIYCCRSCHSHLANIDQILSKTFHCKHGKAYLFNTVVNVSAGLLEERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
            TTGLHTVADI C  C + VGWKYE A+EK QKYKEG+ +LER K+   DG++  +     
Sbjct  61   TTGLHTVADIHCNYCYANVGWKYEVAHEKTQKYKEGKFILERSKLIDADGSDMIMG--GN  118

Query  361  VAGSDADD  338
             A SD D+
Sbjct  119  GAASDGDE  126



>ref|XP_010111189.1| hypothetical protein L484_015073 [Morus notabilis]
 gb|EXC30580.1| hypothetical protein L484_015073 [Morus notabilis]
Length=127

 Score =   150 bits (379),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 97/129 (75%), Gaps = 2/129 (2%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+F+V LEG+ Y CK C + LA+++++LS+ F CR G+AYLFN V+NV  G  E+R+M
Sbjct  1    MGRIFLVELEGRAYRCKLCDSPLALADEVLSRTFNCRKGRAYLFNSVINVMMGPQEERLM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             +GLHTV DI+C  CG I+GWKY  A++KDQKYKEG+ VLER++I   D ++  +N +AR
Sbjct  61   LSGLHTVEDIYCCCCGQILGWKYVIAHDKDQKYKEGKFVLERWRID-EDADDE-LNLDAR  118

Query  361  VAGSDADDV  335
               SDA+++
Sbjct  119  PGSSDAENI  127



>ref|XP_006367369.1| PREDICTED: protein yippee-like [Solanum tuberosum]
Length=87

 Score =   149 bits (376),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFV+ LEGK+YSCKHCGTHLA+SE+I+SK+F CRHGKAYLF+KVVNVTSG+ EDR+M
Sbjct  1    MGRLFVLTLEGKIYSCKHCGTHLALSENIVSKSFHCRHGKAYLFSKVVNVTSGEIEDRVM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKY  473
             TG+HTVADI CV CGSIVGWKY
Sbjct  61   MTGMHTVADIVCVCCGSIVGWKY  83



>ref|XP_010060617.1| PREDICTED: protein yippee-like At5g53940 [Eucalyptus grandis]
 gb|KCW67397.1| hypothetical protein EUGRSUZ_F01163 [Eucalyptus grandis]
Length=131

 Score =   150 bits (379),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 92/130 (71%), Gaps = 2/130 (2%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+FVV LEG+ Y C+ C THLA+  D+ SKAF  R GKAYLFNK VNV  G  E+RMM
Sbjct  1    MGRIFVVELEGRSYRCRFCKTHLALVSDVFSKAFHSRRGKAYLFNKAVNVNVGTLEERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKI-SGPD-GNNYWINHE  368
             +GLHTV D++C  CG IVGWKYE A+EK Q+YKEG+ VLER  I   PD  + ++I+  
Sbjct  61   LSGLHTVGDLYCCCCGQIVGWKYEVAHEKSQQYKEGKCVLERVCIVDEPDFCSEFYIDTC  120

Query  367  ARVAGSDADD  338
              V  SD++D
Sbjct  121  PTVTVSDSED  130



>ref|XP_004510026.1| PREDICTED: protein yippee-like At5g53940-like isoform X1 [Cicer 
arietinum]
 ref|XP_004510027.1| PREDICTED: protein yippee-like At5g53940-like isoform X2 [Cicer 
arietinum]
Length=130

 Score =   150 bits (379),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+F V L+G+ Y CK C THLA++ D++S+ F C+ GKAYLFN VVN T G+ E+R+M
Sbjct  1    MGRIFAVELDGRFYGCKSCKTHLALANDLISRGFYCQRGKAYLFNNVVNFTCGEVEERLM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKI  407
             +GLHTV DIFC RCG I+GWKYE+A+EK QKYKEG+ VLER +I
Sbjct  61   LSGLHTVKDIFCCRCGQIIGWKYESAHEKSQKYKEGKFVLERGRI  105



>gb|AFK35590.1| unknown [Lotus japonicus]
Length=129

 Score =   150 bits (378),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 94/128 (73%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+F V LEG+ Y CK C THLA+++D++S+ F C+ GKAYLFN VVN T G+ E+R M
Sbjct  1    MGRIFAVELEGRSYGCKSCKTHLALADDLISRGFYCQRGKAYLFNNVVNFTIGELEERAM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             +GLHTVADIFC  CG I+GWKYE+A+EK QKYKEG+ VLER +I      +     ++ 
Sbjct  61   LSGLHTVADIFCCCCGQIIGWKYESAHEKSQKYKEGKFVLERGRIVDEIDFSTEFRVDSC  120

Query  361  VAGSDADD  338
            ++ SD++D
Sbjct  121  ISMSDSED  128



>ref|NP_001237913.1| uncharacterized protein LOC100306635 [Glycine max]
 gb|ACU14914.1| unknown [Glycine max]
 gb|KHN28081.1| Protein yippee-like [Glycine soja]
Length=129

 Score =   150 bits (378),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 83/105 (79%), Gaps = 0/105 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+F V LEG+ Y CK C THLA++ D++S+AF C  GKAYLFN VVN T G  E+RMM
Sbjct  1    MGRIFAVELEGRSYRCKFCRTHLALANDLISRAFHCLRGKAYLFNNVVNFTIGTPEERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKI  407
             +GLHTVADIFC  CG I+GWKYE+A+EK QKYKEG+ VLER +I
Sbjct  61   LSGLHTVADIFCCCCGEIIGWKYESAHEKCQKYKEGKFVLERGRI  105



>ref|XP_008463693.1| PREDICTED: protein yippee-like At5g53940 [Cucumis melo]
 ref|XP_008463694.1| PREDICTED: protein yippee-like At5g53940 [Cucumis melo]
 ref|XP_008463695.1| PREDICTED: protein yippee-like At5g53940 [Cucumis melo]
Length=129

 Score =   149 bits (377),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+FVV  EG+ Y CK+C T LA+ +D+ S+AF CR GKAYLFN  +N++ G  E+RMM
Sbjct  1    MGRVFVVEREGRSYRCKYCNTQLALFDDLASRAFHCRRGKAYLFNNAINISFGALEERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKI  407
             +GLHTVADIFC  CG IVGWKYE A+EK QKYKEG+ VLER +I
Sbjct  61   LSGLHTVADIFCCTCGQIVGWKYEAAHEKSQKYKEGKYVLERGRI  105



>ref|NP_001151841.1| protein yippee-like [Zea mays]
 gb|ACG44553.1| protein yippee-like [Zea mays]
Length=144

 Score =   149 bits (376),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 90/118 (76%), Gaps = 0/118 (0%)
 Frame = -3

Query  748  FAVQERQKEMGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVT  569
            F V       G L + +++G VYSCK CGT LAV++DI+SK+F C++GKAYLF+ VVNVT
Sbjct  27   FTVNTDAAGAGPLKLDDVDGNVYSCKRCGTLLAVADDIVSKSFHCKNGKAYLFDNVVNVT  86

Query  568  SGKNEDRMMTTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPD  395
             G+ EDRM  TG+++ +DIFCV CG IVGWKYE A+E+ QKYKEG+ VLER+++ G +
Sbjct  87   VGEKEDRMTITGMYSFSDIFCVGCGEIVGWKYEAAHERSQKYKEGKFVLERYQLLGAE  144



>gb|KFK27010.1| hypothetical protein AALP_AA8G322700 [Arabis alpina]
Length=129

 Score =   149 bits (375),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 93/128 (73%), Gaps = 0/128 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+F V LEG+ Y C+ C THLA+ +D++S++F CR GKAYLFN+ VN++ G  E+RMM
Sbjct  1    MGRIFTVELEGRSYRCRFCRTHLALPDDLVSRSFHCRRGKAYLFNRSVNISMGPLEERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             +G+HTVADIFC  CG  VGWKYE+A+EK QKYKEG+ VLER +I      +  +  + R
Sbjct  61   LSGMHTVADIFCCCCGQNVGWKYESAHEKAQKYKEGKFVLERGRIVDEIDLSTEVYIDTR  120

Query  361  VAGSDADD  338
             + SD +D
Sbjct  121  GSTSDTED  128



>ref|XP_009596205.1| PREDICTED: protein yippee-like At5g53940 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009596206.1| PREDICTED: protein yippee-like At5g53940 isoform X1 [Nicotiana 
tomentosiformis]
Length=136

 Score =   149 bits (375),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 84/102 (82%), Gaps = 0/102 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+FVV+LEG+ Y+CK C T LA+ +D++S+AF C  GKAYLF+  VN+T G +E+RMM
Sbjct  1    MGRIFVVDLEGRTYNCKFCKTQLALCDDLVSRAFHCPRGKAYLFSNAVNITFGPHEERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLER  416
             +G+HTVADIFC  CG IVGWKYE A+EK+QKYKEG+ VLER
Sbjct  61   LSGMHTVADIFCCCCGQIVGWKYEAAHEKNQKYKEGKFVLER  102



>ref|XP_006348270.1| PREDICTED: protein yippee-like At5g53940-like [Solanum tuberosum]
Length=129

 Score =   149 bits (375),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 95/130 (73%), Gaps = 3/130 (2%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+F+V+LEGK Y+CK C T LA ++ ++SKAF C  G+AYLFNKVVN+  G+ E+R +
Sbjct  1    MGRVFLVDLEGKTYNCKFCKTQLARADQLISKAFHCSSGRAYLFNKVVNIYFGQTEERTL  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFK-ISGPDGNNYWINHEA  365
             +G HTV DIFC RCG I+GWKYE ++E+ QKYKEG+ VLER + I   D + ++I+   
Sbjct  61   LSGTHTVTDIFCRRCGQILGWKYEKSHEESQKYKEGKFVLERVRIIDDEDDSEFYID--T  118

Query  364  RVAGSDADDV  335
            R + SD +D 
Sbjct  119  RSSTSDDEDT  128



>ref|XP_004146051.1| PREDICTED: protein yippee-like At5g53940-like [Cucumis sativus]
 gb|KGN55108.1| hypothetical protein Csa_4G630520 [Cucumis sativus]
Length=129

 Score =   148 bits (374),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+FVV  EG+ Y CK+C T LA+ +D+ S+AF CR GKAYLFN  +N+  G  E+RMM
Sbjct  1    MGRVFVVEREGRSYRCKYCNTQLALFDDLASRAFHCRRGKAYLFNNAINIYFGALEERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKI  407
             +GLHTVADIFC  CG IVGWKYE A+EK QKYKEG+ VLER +I
Sbjct  61   LSGLHTVADIFCCSCGQIVGWKYEAAHEKSQKYKEGKYVLERGRI  105



>ref|XP_009119933.1| PREDICTED: protein yippee-like At5g53940 [Brassica rapa]
Length=126

 Score =   148 bits (374),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+F V LEG+ Y C+ C THLA+ +D++SK+F CR GKAYLFN+ VN++ G  E+RMM
Sbjct  1    MGRIFTVELEGRSYRCRFCRTHLALPDDLISKSFHCRRGKAYLFNRSVNISMGPLEERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKI  407
             +G+HTVADIFC  CG  VGWKYE+A+EK QKYKEG+ VLER +I
Sbjct  61   LSGMHTVADIFCCCCGQNVGWKYESAHEKAQKYKEGKFVLERGRI  105



>ref|XP_011047446.1| PREDICTED: protein yippee-like At3g11230 [Populus euphratica]
 ref|XP_011047447.1| PREDICTED: protein yippee-like At3g11230 [Populus euphratica]
 ref|XP_011047448.1| PREDICTED: protein yippee-like At3g11230 [Populus euphratica]
 ref|XP_011014740.1| PREDICTED: protein yippee-like At3g11230 [Populus euphratica]
Length=148

 Score =   149 bits (375),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 86/122 (70%), Gaps = 0/122 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLF+V+LEG  YSCKHC T LA+ +DI+SK F  R+ +AYLF  V NVT G  EDRMM
Sbjct  1    MGRLFLVDLEGSSYSCKHCRTPLALKDDIISKYFCSRNSRAYLFYNVENVTFGPKEDRMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             TG HTVADI+CV CGSI+GWKY  AY K  KYKEG  V+ER K+  P G  Y  N E +
Sbjct  61   ITGKHTVADIYCVVCGSILGWKYIYAYVKAHKYKEGWFVIERCKVLNPAGTPYEANQEVQ  120

Query  361  VA  356
            V 
Sbjct  121  VG  122



>ref|XP_009127128.1| PREDICTED: protein yippee-like At5g53940 [Brassica rapa]
Length=124

 Score =   147 bits (372),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 83/105 (79%), Gaps = 0/105 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+F V LEG+ Y C+ C THLA+  D++SK+F CR  KAYLFN+ VN++ G  E+RMM
Sbjct  1    MGRIFTVELEGRSYRCRFCRTHLALPNDLISKSFHCRREKAYLFNRSVNISMGPLEERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKI  407
             +G+HTVADIFC  CG  VGWKYE+A+EKDQKYKEG+ VLER +I
Sbjct  61   LSGMHTVADIFCCCCGQNVGWKYESAHEKDQKYKEGKFVLERGRI  105



>ref|XP_006401642.1| hypothetical protein EUTSA_v10015019mg [Eutrema salsugineum]
 gb|ESQ43095.1| hypothetical protein EUTSA_v10015019mg [Eutrema salsugineum]
Length=126

 Score =   147 bits (371),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+F V LEG+ Y C+ C THLA+ +D++S++F CR GKAYLFN+ VN++ G  E+RMM
Sbjct  1    MGRIFTVELEGRSYRCRFCRTHLALPDDLISRSFHCRRGKAYLFNRSVNISMGPLEERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKI  407
             +G+HTVADIFC  CG  VGWKYE+A+EK QKYKEG+ VLER +I
Sbjct  61   LSGMHTVADIFCCCCGQNVGWKYESAHEKAQKYKEGKFVLERGRI  105



>ref|XP_006435716.1| hypothetical protein CICLE_v10033070mg [Citrus clementina]
 gb|ESR48956.1| hypothetical protein CICLE_v10033070mg [Citrus clementina]
 gb|KDO69017.1| hypothetical protein CISIN_1g032990mg [Citrus sinensis]
Length=94

 Score =   146 bits (368),  Expect = 9e-40, Method: Composition-based stats.
 Identities = 63/81 (78%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = -3

Query  580  VNVTSGKNEDRMMTTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISG  401
            VNV+ G+ E+R+M TG+HTVADIFCV CGSIVGWKYETA+EK QKYKEG+SVLERFK+SG
Sbjct  13   VNVSVGEKEERLMMTGMHTVADIFCVGCGSIVGWKYETAHEKSQKYKEGKSVLERFKVSG  72

Query  400  PDGNNYWINHEARVAGSDADD  338
            PDG+NYW++HEA V GSDADD
Sbjct  73   PDGSNYWVSHEAHVGGSDADD  93



>ref|XP_010272365.1| PREDICTED: protein yippee-like At5g53940 isoform X1 [Nelumbo 
nucifera]
Length=143

 Score =   147 bits (372),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 98/144 (68%), Gaps = 18/144 (13%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+F+V L+G+VY CK CG+HLA+++D++SK+F CR GKAYLFN VVN+  G  E+RMM
Sbjct  1    MGRIFLVELDGRVYKCKFCGSHLALADDLVSKSFHCRRGKAYLFNIVVNIIVGAQEERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKY----------------ETAYEKDQKYKEGRSVLERFK  410
             +G+HTVADIFC  CG IVGWKY                E A++K QKYKEG+ VLER +
Sbjct  61   LSGMHTVADIFCCCCGQIVGWKYLFIMVPGPYLFHYHIQEAAHDKSQKYKEGKFVLERGR  120

Query  409  ISGPDGNNYWINHEARVAGSDADD  338
            I     + ++++   R + SD +D
Sbjct  121  IVDGAESEFYLD--TRPSMSDNED  142



>ref|XP_002509443.1| fad NAD binding oxidoreductases, putative [Ricinus communis]
 gb|EEF50830.1| fad NAD binding oxidoreductases, putative [Ricinus communis]
Length=127

 Score =   147 bits (370),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 94/128 (73%), Gaps = 2/128 (2%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGRLFVV++EG+ YSC+ C T LA+++D+LS+ F CR G+AYLF+ VVN+T G  E+RMM
Sbjct  1    MGRLFVVDVEGRCYSCRFCDTPLALADDVLSRTFNCRKGRAYLFSNVVNITVGPPEERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             +G+HTV DI+C  CG ++GWKY  A++K QKYKEG+ VLER++I       +  N + R
Sbjct  61   LSGMHTVEDIYCCSCGQLLGWKYVAAHDKSQKYKEGKFVLERWRIDDEASGEF--NLDGR  118

Query  361  VAGSDADD  338
             + +D ++
Sbjct  119  PSSNDGEN  126



>ref|XP_009342807.1| PREDICTED: protein yippee-like At5g53940 isoform X1 [Pyrus x 
bretschneideri]
Length=127

 Score =   147 bits (370),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 94/128 (73%), Gaps = 2/128 (2%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+F++ L+G+ Y C+ C T LA+++D+LS++F CR G+AYLF+ VVN+T G  EDR+M
Sbjct  1    MGRIFLIELDGRTYRCRFCDTALALADDVLSRSFNCRQGRAYLFSNVVNITLGPEEDRLM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPDGNNYWINHEAR  362
             +GLHTV DIFC  CG I+GWKY  A+EK+QKYKEG+ VLER+ I       + ++  AR
Sbjct  61   YSGLHTVEDIFCCCCGHILGWKYVIAHEKNQKYKEGKFVLERWTIVEDVAEEFSLD--AR  118

Query  361  VAGSDADD  338
            +  SD ++
Sbjct  119  LGSSDGEN  126



>ref|XP_004982092.1| PREDICTED: protein yippee-like At3g08990-like [Setaria italica]
Length=115

 Score =   146 bits (369),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 86/106 (81%), Gaps = 0/106 (0%)
 Frame = -3

Query  712  LFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMMTTG  533
            L + +  G VY CKHC THLA+++DI+SK F C++GKAYLF+KVVNVT G+ EDRM+ TG
Sbjct  10   LELDDANGNVYRCKHCRTHLALTDDIISKDFYCKNGKAYLFDKVVNVTVGEKEDRMLMTG  69

Query  532  LHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKISGPD  395
            +HT++DIFCVRCG  +GWKY+ A E+ QKYKEG+ +L+R ++ GP+
Sbjct  70   MHTISDIFCVRCGVTLGWKYDAAAERTQKYKEGKFILDRDQLLGPE  115



>ref|XP_010446313.1| PREDICTED: protein yippee-like At5g53940 [Camelina sativa]
 ref|XP_010482804.1| PREDICTED: protein yippee-like At5g53940 [Camelina sativa]
Length=129

 Score =   147 bits (370),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+F V LEG+ Y C+ C THLA+ +D++S++F CR GKAYLFN+ VN++ G  E+RMM
Sbjct  1    MGRIFTVELEGRSYRCRFCRTHLALPDDLVSRSFHCRRGKAYLFNRSVNISMGPLEERMM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKI  407
             +G+HTVADIFC  CG  VGWKYE+A+EK QKYKEG+ VLER +I
Sbjct  61   LSGMHTVADIFCCCCGQNVGWKYESAHEKAQKYKEGKFVLERGRI  105



>ref|XP_002866007.1| yippee family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42266.1| yippee family protein [Arabidopsis lyrata subsp. lyrata]
Length=129

 Score =   146 bits (369),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = -3

Query  721  MGRLFVVNLEGKVYSCKHCGTHLAVSEDILSKAFQCRHGKAYLFNKVVNVTSGKNEDRMM  542
            MGR+F V LEG+ Y C+ C THLA+ +D++S++F CR GKAYLFN+ VN++ G  E+R+M
Sbjct  1    MGRIFTVELEGRSYRCRFCRTHLALPDDLVSRSFHCRRGKAYLFNRSVNISMGPLEERLM  60

Query  541  TTGLHTVADIFCVRCGSIVGWKYETAYEKDQKYKEGRSVLERFKI  407
             +G+HTVADIFC  CG  VGWKYE+A+EK QKYKEG+ VLER +I
Sbjct  61   LSGMHTVADIFCCSCGQNVGWKYESAHEKAQKYKEGKFVLERGRI  105



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2109012510310