BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c17997_g1_i1 len=1909 path=[1:0-188 190:189-1252 1254:1253-1908]

Length=1909
                                                                      Score     E

ref|XP_009793978.1|  PREDICTED: cytokinin dehydrogenase 3               739   0.0      
ref|XP_009610079.1|  PREDICTED: cytokinin dehydrogenase 3               731   0.0      
dbj|BAK52672.1|  cytokinin oxidase                                      721   0.0      
emb|CDP03155.1|  unnamed protein product                                718   0.0      
ref|XP_004251670.1|  PREDICTED: cytokinin dehydrogenase 3               716   0.0      
ref|NP_001275401.1|  cytokinin oxidase/dehydrogenase 2                  701   0.0      
ref|XP_006353538.1|  PREDICTED: cytokinin dehydrogenase 3               700   0.0      
ref|XP_009799177.1|  PREDICTED: cytokinin dehydrogenase 3-like          683   0.0      
ref|XP_009602355.1|  PREDICTED: cytokinin dehydrogenase 3-like          672   0.0      
ref|XP_007012819.1|  Cytokinin oxidase                                  653   0.0      
ref|XP_002264445.1|  PREDICTED: cytokinin dehydrogenase 3               650   0.0      Vitis vinifera
ref|XP_002279519.1|  PREDICTED: cytokinin dehydrogenase 3               650   0.0      Vitis vinifera
ref|XP_002263646.1|  PREDICTED: cytokinin dehydrogenase 3               647   0.0      Vitis vinifera
emb|CAN80714.1|  hypothetical protein VITISV_042932                     647   0.0      Vitis vinifera
ref|XP_011077990.1|  PREDICTED: cytokinin dehydrogenase 3-like is...    646   0.0      
emb|CAN77185.1|  hypothetical protein VITISV_039458                     646   0.0      Vitis vinifera
ref|XP_011093737.1|  PREDICTED: cytokinin dehydrogenase 3               645   0.0      
ref|XP_011009888.1|  PREDICTED: cytokinin dehydrogenase 3               644   0.0      
ref|XP_010090055.1|  Cytokinin dehydrogenase 3                          639   0.0      
ref|XP_002308300.2|  Cytokinin dehydrogenase 3 precursor family p...    639   0.0      Populus trichocarpa [western balsam poplar]
gb|KDO49370.1|  hypothetical protein CISIN_1g009793mg                   636   0.0      
ref|XP_006475463.1|  PREDICTED: cytokinin dehydrogenase 3-like          636   0.0      
ref|XP_006451484.1|  hypothetical protein CICLE_v10007992mg             635   0.0      
ref|XP_010262099.1|  PREDICTED: cytokinin dehydrogenase 3-like          624   0.0      
gb|EYU37164.1|  hypothetical protein MIMGU_mgv1a004294mg                620   0.0      
ref|XP_010242231.1|  PREDICTED: cytokinin dehydrogenase 3 isoform X1    619   0.0      
ref|XP_007154651.1|  hypothetical protein PHAVU_003G136400g             614   0.0      
gb|AGW52152.1|  CKX3                                                    613   0.0      
gb|ACM79256.1|  cytokinin oxidase/dehydrogenase                         613   0.0      Gossypium hirsutum [American cotton]
ref|XP_007138720.1|  hypothetical protein PHAVU_009G231700g             613   0.0      
gb|KDP33841.1|  hypothetical protein JCGZ_07412                         612   0.0      
dbj|BAM74651.1|  cytokinin oxidase/dehydrogenase                        612   0.0      
ref|XP_003547474.1|  PREDICTED: cytokinin dehydrogenase 3-like          610   0.0      
ref|XP_010696503.1|  PREDICTED: cytokinin dehydrogenase 3               610   0.0      
ref|NP_001243813.1|  cytokinin dehydrogenase 3-like                     609   0.0      
ref|XP_002514119.1|  gulonolactone oxidase, putative                    608   0.0      Ricinus communis
ref|XP_003534923.1|  PREDICTED: cytokinin dehydrogenase 3-like          609   0.0      
ref|XP_003542331.1|  PREDICTED: cytokinin dehydrogenase 3-like          608   0.0      
ref|XP_004288952.1|  PREDICTED: cytokinin dehydrogenase 3-like          606   0.0      
ref|XP_010242232.1|  PREDICTED: cytokinin dehydrogenase 3 isoform X2    606   0.0      
gb|KHN35852.1|  Cytokinin dehydrogenase 3                               604   0.0      
ref|XP_004508239.1|  PREDICTED: cytokinin dehydrogenase 3-like          605   0.0      
gb|KEH32513.1|  cytokinin oxidase/dehydrogenase-like protein            603   0.0      
ref|XP_010040366.1|  PREDICTED: cytokinin dehydrogenase 3-like          602   0.0      
ref|XP_010024059.1|  PREDICTED: cytokinin dehydrogenase 3-like          602   0.0      
gb|KCW60469.1|  hypothetical protein EUGRSUZ_H03195                     602   0.0      
ref|XP_011077992.1|  PREDICTED: cytokinin dehydrogenase 3-like is...    599   0.0      
ref|XP_008459369.1|  PREDICTED: cytokinin dehydrogenase 3-like          599   0.0      
ref|XP_008450862.1|  PREDICTED: cytokinin dehydrogenase 3-like          598   0.0      
emb|CAN61742.1|  hypothetical protein VITISV_038638                     596   0.0      Vitis vinifera
ref|XP_004158449.1|  PREDICTED: LOW QUALITY PROTEIN: cytokinin de...    595   0.0      
ref|XP_010024208.1|  PREDICTED: cytokinin dehydrogenase 3-like          595   0.0      
ref|XP_010026881.1|  PREDICTED: cytokinin dehydrogenase 3-like          593   0.0      
emb|CBI27904.3|  unnamed protein product                                592   0.0      
ref|XP_008797779.1|  PREDICTED: cytokinin dehydrogenase 6-like          593   0.0      
ref|XP_009352666.1|  PREDICTED: cytokinin dehydrogenase 3-like          590   0.0      
ref|XP_004144003.1|  PREDICTED: cytokinin dehydrogenase 3-like          588   0.0      
gb|KCW79507.1|  hypothetical protein EUGRSUZ_C00881                     588   0.0      
ref|XP_010047562.1|  PREDICTED: cytokinin dehydrogenase 3-like          588   0.0      
ref|XP_008805777.1|  PREDICTED: cytokinin dehydrogenase 6-like          588   0.0      
ref|XP_010915226.1|  PREDICTED: cytokinin dehydrogenase 6-like          585   0.0      
ref|XP_009408848.1|  PREDICTED: cytokinin dehydrogenase 6-like          584   0.0      
ref|XP_008242354.1|  PREDICTED: cytokinin dehydrogenase 3-like          583   0.0      
ref|XP_008367923.1|  PREDICTED: cytokinin dehydrogenase 3-like          583   0.0      
ref|XP_004488057.1|  PREDICTED: cytokinin dehydrogenase 3-like          583   0.0      
ref|XP_010912967.1|  PREDICTED: cytokinin dehydrogenase 6               583   0.0      
ref|XP_007203595.1|  hypothetical protein PRUPE_ppb021417mg             581   0.0      
gb|KCW60471.1|  hypothetical protein EUGRSUZ_H03198                     580   0.0      
ref|XP_008242393.1|  PREDICTED: cytokinin dehydrogenase 4-like          578   0.0      
ref|XP_010047563.1|  PREDICTED: cytokinin dehydrogenase 3-like          577   0.0      
ref|XP_003595184.1|  Cytokinin dehydrogenase                            574   0.0      
ref|XP_011077993.1|  PREDICTED: cytokinin dehydrogenase 4-like          570   0.0      
ref|XP_010026880.1|  PREDICTED: cytokinin dehydrogenase 3-like          570   0.0      
ref|XP_007203856.1|  hypothetical protein PRUPE_ppa021859mg             568   0.0      
emb|CBI37291.3|  unnamed protein product                                566   0.0      
emb|CBI37295.3|  unnamed protein product                                572   0.0      
ref|XP_004173096.1|  PREDICTED: LOW QUALITY PROTEIN: cytokinin de...    566   0.0      
ref|XP_009393975.1|  PREDICTED: cytokinin dehydrogenase 6-like          565   0.0      
gb|KCW60470.1|  hypothetical protein EUGRSUZ_H03197                     559   0.0      
ref|XP_009352704.1|  PREDICTED: cytokinin dehydrogenase 2-like          560   0.0      
ref|XP_003635659.1|  PREDICTED: cytokinin dehydrogenase 3-like          555   0.0      
ref|XP_010443356.1|  PREDICTED: cytokinin dehydrogenase 3               558   0.0      
ref|XP_009361720.1|  PREDICTED: cytokinin dehydrogenase 4-like          554   0.0      
ref|XP_010026879.1|  PREDICTED: cytokinin dehydrogenase 3-like          551   0.0      
ref|XP_010451656.1|  PREDICTED: cytokinin dehydrogenase 3-like is...    551   0.0      
ref|XP_011094005.1|  PREDICTED: cytokinin dehydrogenase 3-like          550   0.0      
ref|XP_010026877.1|  PREDICTED: cytokinin dehydrogenase 3-like          551   0.0      
ref|XP_006280310.1|  hypothetical protein CARUB_v10026233mg             550   0.0      
ref|XP_008338887.1|  PREDICTED: cytokinin dehydrogenase 4-like          549   0.0      
emb|CBI33301.3|  unnamed protein product                                545   0.0      
ref|XP_010451653.1|  PREDICTED: cytokinin dehydrogenase 3-like is...    549   0.0      
ref|XP_008451152.1|  PREDICTED: cytokinin dehydrogenase 4               549   0.0      
ref|XP_009402032.1|  PREDICTED: cytokinin dehydrogenase 6-like          548   0.0      
ref|XP_009120210.1|  PREDICTED: cytokinin dehydrogenase 3 isoform X2    547   0.0      
ref|NP_200507.1|  cytokinin dehydrogenase 3                             546   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006401261.1|  hypothetical protein EUTSA_v10013271mg             546   0.0      
ref|XP_011094006.1|  PREDICTED: cytokinin dehydrogenase 3-like          545   0.0      
ref|XP_009120209.1|  PREDICTED: cytokinin dehydrogenase 3 isoform X1    544   0.0      
gb|KHN13439.1|  Cytokinin dehydrogenase 3                               540   0.0      
ref|XP_002866175.1|  hypothetical protein ARALYDRAFT_918856             541   0.0      
ref|XP_004288951.1|  PREDICTED: cytokinin dehydrogenase 2-like          539   0.0      
ref|XP_002513399.1|  gulonolactone oxidase, putative                    535   0.0      Ricinus communis
emb|CDY62828.1|  BnaCnng41060D                                          534   2e-180   
ref|XP_006475551.1|  PREDICTED: cytokinin dehydrogenase 3-like          533   4e-180   
ref|XP_008377186.1|  PREDICTED: cytokinin dehydrogenase 5-like          532   2e-179   
ref|XP_010254443.1|  PREDICTED: cytokinin dehydrogenase 3-like          531   2e-179   
ref|XP_009126914.1|  PREDICTED: cytokinin dehydrogenase 3               530   7e-179   
ref|XP_006451487.1|  hypothetical protein CICLE_v10010516mg             530   1e-178   
ref|XP_002307681.1|  hypothetical protein POPTR_0005s25380g             530   1e-178   Populus trichocarpa [western balsam poplar]
ref|XP_004291832.1|  PREDICTED: cytokinin dehydrogenase 5-like          530   1e-178   
ref|XP_006838693.1|  hypothetical protein AMTR_s00002p00248240          530   2e-178   
ref|XP_006475550.1|  PREDICTED: cytokinin dehydrogenase 3-like          530   2e-178   
emb|CDY20702.1|  BnaA02g08420D                                          528   3e-178   
ref|XP_011048828.1|  PREDICTED: cytokinin dehydrogenase 5-like          527   1e-177   
gb|AHL64253.1|  cytokinin dehydrogenase 5                               527   2e-177   
ref|XP_010539134.1|  PREDICTED: LOW QUALITY PROTEIN: cytokinin de...    526   4e-177   
ref|XP_002300742.2|  cytokinin oxidase 6 family protein                 525   8e-177   Populus trichocarpa [western balsam poplar]
gb|EYU32888.1|  hypothetical protein MIMGU_mgv1a004444mg                525   8e-177   
ref|XP_008387997.1|  PREDICTED: cytokinin dehydrogenase 5-like          525   8e-177   
ref|XP_003635626.2|  PREDICTED: cytokinin dehydrogenase 3-like          518   2e-176   
gb|KCW60664.1|  hypothetical protein EUGRSUZ_H03393                     522   2e-176   
gb|KDP38564.1|  hypothetical protein JCGZ_04489                         525   2e-176   
emb|CBI41113.3|  unnamed protein product                                518   2e-176   
ref|XP_009389713.1|  PREDICTED: cytokinin dehydrogenase 6-like          524   3e-176   
gb|KHG00982.1|  Cytokinin dehydrogenase 5 -like protein                 523   5e-176   
ref|XP_002510450.1|  gulonolactone oxidase, putative                    523   6e-176   Ricinus communis
ref|XP_004488074.1|  PREDICTED: cytokinin dehydrogenase 3-like          523   6e-176   
gb|KFK42198.1|  hypothetical protein AALP_AA2G224300                    522   9e-176   
ref|XP_010090054.1|  Cytokinin dehydrogenase 4                          522   1e-175   
gb|KCW45277.1|  hypothetical protein EUGRSUZ_L01060                     518   1e-175   
ref|XP_006451486.1|  hypothetical protein CICLE_v10010713mg             520   3e-175   
ref|XP_007017645.1|  Cytokinin oxidase 5                                521   4e-175   
ref|XP_011015952.1|  PREDICTED: cytokinin dehydrogenase 3-like          520   8e-175   
ref|XP_004144113.1|  PREDICTED: cytokinin dehydrogenase 4-like          520   9e-175   
gb|KDO40371.1|  hypothetical protein CISIN_1g044784mg                   518   9e-175   
ref|XP_009335765.1|  PREDICTED: cytokinin dehydrogenase 5               520   1e-174   
ref|XP_011015519.1|  PREDICTED: cytokinin dehydrogenase 3-like          519   2e-174   
ref|XP_004507936.1|  PREDICTED: cytokinin dehydrogenase 3-like          517   1e-173   
gb|AES65430.2|  cytokinin oxidase/dehydrogenase-like protein            516   1e-173   
emb|CAC17752.1|  cytokinin oxidase                                      517   2e-173   
ref|XP_010275527.1|  PREDICTED: cytokinin dehydrogenase 5-like is...    517   2e-173   
ref|XP_007221789.1|  hypothetical protein PRUPE_ppa003895mg             517   2e-173   
ref|XP_004488073.1|  PREDICTED: cytokinin dehydrogenase 3-like          516   2e-173   
ref|XP_002280797.1|  PREDICTED: cytokinin dehydrogenase 5 isoform X1    516   3e-173   Vitis vinifera
gb|ADB45880.1|  cytokinin oxidase/dehydrogenase                         515   7e-173   Bambusa oldhamii
ref|XP_002310104.2|  hypothetical protein POPTR_0007s08360g             514   8e-173   Populus trichocarpa [western balsam poplar]
emb|CBI19763.3|  unnamed protein product                                516   1e-172   
ref|XP_009398389.1|  PREDICTED: cytokinin dehydrogenase 5               515   1e-172   
ref|XP_009381235.1|  PREDICTED: cytokinin dehydrogenase 6-like          514   1e-172   
ref|XP_006577980.1|  PREDICTED: cytokinin dehydrogenase 5-like          514   1e-172   
ref|XP_008221343.1|  PREDICTED: cytokinin dehydrogenase 5               514   2e-172   
dbj|BAM74648.1|  cytokinin oxidase/dehydrogenase                        514   2e-172   
ref|XP_003632404.1|  PREDICTED: cytokinin dehydrogenase 3-like          511   4e-172   
ref|XP_011028922.1|  PREDICTED: cytokinin dehydrogenase 5-like          513   5e-172   
gb|ADB45878.1|  cytokinin oxidase/dehydrogenase                         513   5e-172   Bambusa oldhamii
ref|XP_006435071.1|  hypothetical protein CICLE_v10000709mg             514   5e-172   
ref|XP_006473567.1|  PREDICTED: cytokinin dehydrogenase 5-like          514   9e-172   
ref|XP_010932835.1|  PREDICTED: cytokinin dehydrogenase 5-like          512   1e-171   
ref|XP_008796604.1|  PREDICTED: cytokinin dehydrogenase 5-like          513   2e-171   
ref|XP_009409596.1|  PREDICTED: cytokinin dehydrogenase 7-like          511   2e-171   
ref|XP_010110013.1|  Cytokinin dehydrogenase 5                          513   2e-171   
ref|XP_010254676.1|  PREDICTED: cytokinin dehydrogenase 5-like          512   2e-171   
gb|KCW60467.1|  hypothetical protein EUGRSUZ_H03190                     508   3e-171   
ref|XP_007138721.1|  hypothetical protein PHAVU_009G231800g             510   4e-171   
ref|NP_001274957.1|  cytokinin oxidase/dehydrogenase precursor          509   1e-170   
ref|XP_008804537.1|  PREDICTED: cytokinin dehydrogenase 5-like          509   2e-170   
ref|XP_003595179.1|  Cytokinin dehydrogenase                            509   2e-170   
ref|NP_194703.1|  cytokinin dehydrogenase 4                             508   3e-170   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011083611.1|  PREDICTED: LOW QUALITY PROTEIN: cytokinin de...    508   3e-170   
gb|KFK29530.1|  hypothetical protein AALP_AA7G146300                    508   4e-170   
gb|AAG30907.1|AF303980_1  cytokinin oxidase                             508   5e-170   Arabidopsis thaliana [mouse-ear cress]
gb|KEH32514.1|  cytokinin oxidase/dehydrogenase-like protein            508   5e-170   
ref|NP_001266251.1|  cytokinin oxidase/dehydrogenase-like precursor     508   6e-170   
ref|XP_006294012.1|  hypothetical protein CARUB_v10023000mg             507   9e-170   
gb|ABN08744.1|  FAD linked oxidase, N-terminal                          507   1e-169   Medicago truncatula
ref|XP_002869416.1|  predicted protein                                  506   1e-169   
gb|AFK79779.1|  cytokinin oxidase/dehydrogenase                         506   2e-169   
gb|EAY85042.1|  hypothetical protein OsI_06399                          505   4e-169   Oryza sativa Indica Group [Indian rice]
ref|XP_010061263.1|  PREDICTED: cytokinin dehydrogenase 5               506   4e-169   
gb|ABN05767.1|  FAD linked oxidase, N-terminal                          504   5e-169   Medicago truncatula
ref|XP_006595335.1|  PREDICTED: cytokinin dehydrogenase 3-like          505   5e-169   
ref|XP_003571719.1|  PREDICTED: cytokinin dehydrogenase 7-like          505   5e-169   
ref|XP_006412813.1|  hypothetical protein EUTSA_v10024918mg             504   7e-169   
gb|AEV76973.1|  cytokinin oxidase/dehydrogenase 8                       504   1e-168   
gb|ABM98099.2|  cytokinin oxidase                                       503   3e-168   Dendrobium huoshanense
ref|XP_003527677.1|  PREDICTED: cytokinin dehydrogenase 5-like          504   4e-168   
ref|XP_009761052.1|  PREDICTED: cytokinin dehydrogenase 5               502   7e-168   
ref|XP_003550630.1|  PREDICTED: cytokinin dehydrogenase 3-like          503   7e-168   
ref|XP_007136628.1|  hypothetical protein PHAVU_009G060200g             502   2e-167   
ref|XP_009124316.1|  PREDICTED: cytokinin dehydrogenase 2-like          500   2e-167   
gb|AEV76972.1|  cytokinin oxidase/dehydrogenase 7                       501   3e-167   
ref|XP_010438272.1|  PREDICTED: cytokinin dehydrogenase 4-like          501   3e-167   
sp|Q6YW50.1|CKX7_ORYSJ  RecName: Full=Cytokinin dehydrogenase 7; ...    500   4e-167   Oryza sativa Japonica Group [Japonica rice]
ref|NP_565455.1|  cytokinin oxidase 2                                   499   5e-167   Arabidopsis thaliana [mouse-ear cress]
gb|ADB45879.1|  cytokinin oxidase/dehydrogenase                         500   5e-167   Bambusa oldhamii
ref|XP_009609662.1|  PREDICTED: cytokinin dehydrogenase 5               499   2e-166   
gb|KDP25108.1|  hypothetical protein JCGZ_22643                         498   2e-166   
ref|XP_010907734.1|  PREDICTED: cytokinin dehydrogenase 5-like          499   2e-166   
ref|XP_010433070.1|  PREDICTED: cytokinin dehydrogenase 4               498   3e-166   
ref|XP_002889026.1|  hypothetical protein ARALYDRAFT_476695             498   3e-166   
ref|XP_010447814.1|  PREDICTED: cytokinin dehydrogenase 4-like          498   3e-166   
ref|XP_009137860.1|  PREDICTED: cytokinin dehydrogenase 4               498   3e-166   
sp|Q5Z620.1|CKX10_ORYSJ  RecName: Full=Cytokinin dehydrogenase 10...    499   4e-166   Oryza sativa Japonica Group [Japonica rice]
ref|NP_177678.2|  cytokinin dehydrogenase 5                             498   4e-166   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004951450.1|  PREDICTED: cytokinin dehydrogenase 7-like          498   5e-166   
gb|AAG30905.1|AF303978_1  cytokinin oxidase                             496   7e-166   Arabidopsis thaliana [mouse-ear cress]
emb|CDY30204.1|  BnaA03g49660D                                          496   1e-165   
ref|NP_001185809.1|  cytokinin dehydrogenase 8 precursor                497   2e-165   
ref|XP_004141168.1|  PREDICTED: uncharacterized protein LOC101212791    508   2e-165   
gb|AAG30909.1|AF303982_1  cytokinin oxidase                             496   2e-165   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006390301.1|  hypothetical protein EUTSA_v10018378mg             496   3e-165   
ref|XP_002453544.1|  hypothetical protein SORBIDRAFT_04g007730          496   4e-165   Sorghum bicolor [broomcorn]
ref|XP_002451780.1|  hypothetical protein SORBIDRAFT_04g007740          495   5e-165   Sorghum bicolor [broomcorn]
emb|CDY47521.1|  BnaAnng09190D                                          495   7e-165   
ref|XP_006409043.1|  hypothetical protein EUTSA_v10023158mg             493   8e-165   
ref|XP_006297443.1|  hypothetical protein CARUB_v10013466mg             494   9e-165   
ref|XP_009106198.1|  PREDICTED: cytokinin dehydrogenase 5               494   9e-165   
sp|Q6YW51.1|CKX6_ORYSJ  RecName: Full=Cytokinin dehydrogenase 6; ...    494   1e-164   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010533263.1|  PREDICTED: cytokinin dehydrogenase 5               494   1e-164   
ref|XP_002883987.1|  hypothetical protein ARALYDRAFT_480522             493   1e-164   
ref|NP_001185402.1|  cytokinin dehydrogenase 5                          494   2e-164   
ref|XP_008679837.1|  PREDICTED: cytokinin dehydrogenase 7-like          493   6e-164   
gb|KHN06618.1|  Cytokinin dehydrogenase 3                               489   6e-164   
ref|XP_010415434.1|  PREDICTED: cytokinin dehydrogenase 2               491   6e-164   
gb|AIU94750.1|  cytokinin oxidase                                       491   8e-164   
emb|CDY54283.1|  BnaC07g50850D                                          491   9e-164   
ref|XP_009112608.1|  PREDICTED: cytokinin dehydrogenase 2               489   3e-163   
gb|EEC80843.1|  hypothetical protein OsI_23446                          489   4e-163   Oryza sativa Indica Group [Indian rice]
emb|CDP07468.1|  unnamed protein product                                490   4e-163   
emb|CDX73174.1|  BnaC06g36220D                                          490   4e-163   
ref|XP_010467897.1|  PREDICTED: cytokinin dehydrogenase 2-like          489   7e-163   
gb|KHN17673.1|  Cytokinin dehydrogenase 3                               483   9e-163   
gb|EEC72755.1|  hypothetical protein OsI_06398                          489   1e-162   Oryza sativa Indica Group [Indian rice]
gb|KFK41981.1|  hypothetical protein AALP_AA2G196900                    489   1e-162   
gb|EMT16465.1|  Cytokinin dehydrogenase 1                               489   1e-162   
ref|XP_009408782.1|  PREDICTED: cytokinin dehydrogenase 5-like          488   2e-162   
gb|AFK48435.1|  unknown                                                 487   7e-162   
ref|XP_004968471.1|  PREDICTED: cytokinin dehydrogenase 1-like          486   8e-162   
emb|CDY51023.1|  BnaC09g33450D                                          483   3e-161   
pdb|2QKN|A  Chain A, Crystal Structure Of Maize Cytokinin Oxidase...    485   3e-161   
ref|NP_001105591.1|  cytokinin dehydrogenase 1 precursor                485   5e-161   Zea mays [maize]
emb|CDM81697.1|  unnamed protein product                                484   1e-160   
gb|KFK40311.1|  hypothetical protein AALP_AA3G358400                    483   1e-160   
pdb|2QPM|A  Chain A, Leu492ala Mutant Of Maize Cytokinin OxidaseD...    483   1e-160   
pdb|1W1O|A  Chain A, Native Cytokinin Dehydrogenase                     484   1e-160   
pdb|3S1D|A  Chain A, Glu381ser Mutant Of Maize Cytokinin OxidaseD...    483   2e-160   
pdb|3S1F|A  Chain A, Asp169glu Mutant Of Maize Cytokinin OxidaseD...    483   2e-160   
emb|CDY50467.1|  BnaA10g28940D                                          480   5e-160   
sp|Q9T0N8.2|CKX1_MAIZE  RecName: Full=Cytokinin dehydrogenase 1; ...    482   8e-160   Zea mays [maize]
pdb|3S1E|A  Chain A, Pro427gln Mutant Of Maize Cytokinin OxidaseD...    481   8e-160   
ref|XP_010227585.1|  PREDICTED: cytokinin dehydrogenase 10-like         480   5e-159   
ref|XP_010236336.1|  PREDICTED: cytokinin dehydrogenase 7-like          479   5e-159   
gb|KEH36208.1|  cytokinin oxidase/dehydrogenase-like protein            479   1e-158   
ref|XP_008672378.1|  PREDICTED: cytokinin dehydrogenase 4 isoform X1    479   1e-158   
gb|ADP38079.1|  cytokinin dehydrogenase 4                               479   1e-158   
emb|CAN81010.1|  hypothetical protein VITISV_017949                     478   1e-158   Vitis vinifera
ref|XP_006657073.1|  PREDICTED: LOW QUALITY PROTEIN: cytokinin de...    479   1e-158   
gb|AFW84922.1|  hypothetical protein ZEAMMB73_083779                    479   1e-158   
ref|XP_004970152.1|  PREDICTED: cytokinin dehydrogenase 5-like          479   2e-158   
ref|XP_008660924.1|  PREDICTED: cytokinin dehydrogenase 10-like         479   2e-158   
gb|EYU29892.1|  hypothetical protein MIMGU_mgv1a007407mg                473   3e-158   
gb|EPS70139.1|  hypothetical protein M569_04624                         475   5e-158   
gb|AFW87013.1|  hypothetical protein ZEAMMB73_853322                    478   5e-158   
emb|CDY67088.1|  BnaA09g52930D                                          475   6e-158   
ref|XP_002455033.1|  hypothetical protein SORBIDRAFT_03g003280          477   7e-158   Sorghum bicolor [broomcorn]
ref|XP_008444755.1|  PREDICTED: cytokinin dehydrogenase 5               477   1e-157   
ref|XP_004967225.1|  PREDICTED: cytokinin dehydrogenase 10-like         476   2e-157   
ref|XP_010672675.1|  PREDICTED: cytokinin dehydrogenase 5               475   3e-157   
gb|KHN06617.1|  Cytokinin dehydrogenase 3                               474   5e-157   
ref|XP_010428567.1|  PREDICTED: cytokinin dehydrogenase 5 isoform X1    474   9e-157   
ref|XP_004500976.1|  PREDICTED: cytokinin dehydrogenase 5-like is...    472   3e-156   
gb|KGN66247.1|  hypothetical protein Csa_1G588560                       468   5e-156   
ref|NP_001185960.1|  cytokinin dehydrogenase 4b precursor               472   7e-156   
gb|KDO84681.1|  hypothetical protein CISIN_1g042782mg                   471   1e-155   
ref|XP_010471656.1|  PREDICTED: cytokinin dehydrogenase 5-like is...    471   2e-155   
ref|XP_010416431.1|  PREDICTED: cytokinin dehydrogenase 5-like is...    471   2e-155   
ref|XP_006302113.1|  hypothetical protein CARUB_v10020114mg             471   2e-155   
dbj|BAM09008.1|  cytokinin oxidase/dehydrogenase-like                   463   2e-155   
ref|XP_011048092.1|  PREDICTED: cytokinin dehydrogenase 1               471   2e-155   
gb|AEV76971.1|  cytokinin oxidase/dehydrogenase 2                       471   3e-155   
ref|XP_003534915.2|  PREDICTED: cytokinin dehydrogenase 3-like          469   6e-155   
ref|XP_002438603.1|  hypothetical protein SORBIDRAFT_10g022590          469   1e-154   
ref|XP_002308930.2|  hypothetical protein POPTR_0006s04650g             466   9e-154   
ref|XP_002988125.1|  hypothetical protein SELMODRAFT_127173             465   3e-153   
ref|XP_002972678.1|  hypothetical protein SELMODRAFT_98722              464   6e-153   
ref|XP_002534458.1|  gulonolactone oxidase, putative                    464   6e-153   
ref|XP_004971745.1|  PREDICTED: cytokinin dehydrogenase 2-like          464   8e-153   
ref|XP_002458582.1|  hypothetical protein SORBIDRAFT_03g036160          464   1e-152   
dbj|BAG16379.1|  cytokinin oxidase family protein                       463   1e-152   
gb|KFK36997.1|  hypothetical protein AALP_AA4G199000                    464   1e-152   
ref|XP_009142753.1|  PREDICTED: cytokinin dehydrogenase 1-like          463   2e-152   
emb|CDX79932.1|  BnaA05g02240D                                          462   2e-152   
ref|XP_009141995.1|  PREDICTED: cytokinin dehydrogenase 1-like          462   2e-152   
ref|XP_008445865.1|  PREDICTED: cytokinin dehydrogenase 6               462   5e-152   
gb|AEV76970.1|  cytokinin oxidase/dehydrogenase 1                       461   5e-152   
ref|XP_004143695.1|  PREDICTED: cytokinin dehydrogenase 6-like          462   7e-152   
ref|XP_006411418.1|  hypothetical protein EUTSA_v10016470mg             462   8e-152   
ref|NP_001044409.1|  Os01g0775400                                       460   2e-151   
dbj|BAG16373.1|  cytokinin oxidase family protein                       460   2e-151   
gb|ABH07114.1|  cytokinin oxidase/dehydrogenase 1                       459   3e-151   
ref|XP_004295395.1|  PREDICTED: cytokinin dehydrogenase 6-like          458   4e-151   
emb|CDM84390.1|  unnamed protein product                                459   5e-151   
emb|CDY23844.1|  BnaC04g01930D                                          461   8e-151   
ref|XP_006482960.1|  PREDICTED: cytokinin dehydrogenase 6-like          458   1e-150   
gb|ADG57788.1|  cytokinin oxidase 2                                     459   1e-150   
gb|KDO83251.1|  hypothetical protein CISIN_1g008291mg                   459   2e-150   
gb|AFK79773.1|  cytokinin oxidase/dehydrogenase                         458   2e-150   
gb|AEC33261.1|  cytokinin oxidase/dehydrogenase                         458   3e-150   
ref|NP_181682.1|  cytokinin dehydrogenase 1                             459   3e-150   
ref|XP_004305707.1|  PREDICTED: cytokinin dehydrogenase 1-like          457   4e-150   
ref|XP_006438909.1|  hypothetical protein CICLE_v10031210mg             456   5e-150   
gb|AAG13068.1|AC023754_6  Similar to cytokinin oxidase                  456   5e-150   
dbj|BAK01307.1|  predicted protein                                      456   6e-150   
gb|AFK79784.1|  cytokinin oxidase/dehydrogenase                         457   6e-150   
ref|XP_006843486.1|  hypothetical protein AMTR_s00053p00208790          455   9e-150   
ref|XP_010505935.1|  PREDICTED: cytokinin dehydrogenase 1               457   9e-150   
emb|CDY14777.1|  BnaC04g47740D                                          456   1e-149   
ref|XP_010670377.1|  PREDICTED: cytokinin dehydrogenase 6-like          456   1e-149   
gb|ADG57789.1|  cytokinin oxidase 2                                     456   1e-149   
ref|XP_006293839.1|  hypothetical protein CARUB_v10022823mg             459   1e-149   
ref|XP_002879935.1|  ATCKX1/CKX1                                        456   1e-149   
gb|EAZ22265.1|  hypothetical protein OsJ_05920                          454   2e-149   
gb|AEK84310.1|  cytokinin oxidase/dehydrogenase                         455   2e-149   
ref|XP_010523651.1|  PREDICTED: cytokinin dehydrogenase 1               456   2e-149   
gb|KHN45882.1|  Cytokinin dehydrogenase 5                               451   3e-149   
gb|ADG57787.1|  cytokinin oxidase 2                                     455   4e-149   
ref|XP_004514814.1|  PREDICTED: cytokinin dehydrogenase 6-like          454   6e-149   
ref|XP_007131444.1|  hypothetical protein PHAVU_011G014000g             454   8e-149   
gb|KHN11723.1|  Cytokinin dehydrogenase 6                               453   2e-148   
ref|XP_003599606.1|  Cytokinin dehydrogenase                            452   3e-148   
gb|AFM10539.1|  cytokinin oxidase                                       452   4e-148   
ref|XP_008464594.1|  PREDICTED: cytokinin dehydrogenase 1 isoform X1    452   5e-148   
dbj|BAM74647.1|  cytokinin oxidase/dehydrogenase                        451   6e-148   
ref|XP_011088157.1|  PREDICTED: cytokinin dehydrogenase 6-like          451   6e-148   
ref|XP_010279585.1|  PREDICTED: cytokinin dehydrogenase 9-like          452   6e-148   
gb|KHN39533.1|  Cytokinin dehydrogenase 6                               451   7e-148   
ref|XP_004303072.1|  PREDICTED: cytokinin dehydrogenase 6-like          451   8e-148   
ref|XP_003538221.1|  PREDICTED: cytokinin dehydrogenase 6               452   8e-148   
gb|ACV04939.1|  cytokinin oxidase/dehydrogenase                         451   1e-147   
emb|CDY35410.1|  BnaA03g19500D                                          451   1e-147   
ref|XP_010517646.1|  PREDICTED: cytokinin dehydrogenase 1-like          452   1e-147   
ref|XP_003534375.1|  PREDICTED: cytokinin dehydrogenase 6-like          450   2e-147   
ref|XP_009767664.1|  PREDICTED: cytokinin dehydrogenase 1-like          450   3e-147   
ref|XP_003569936.1|  PREDICTED: cytokinin dehydrogenase 5               450   3e-147   
ref|XP_010938664.1|  PREDICTED: cytokinin dehydrogenase 4 isoform X1    449   4e-147   
ref|XP_002284560.2|  PREDICTED: cytokinin dehydrogenase 1-like          450   4e-147   
ref|XP_004142714.1|  PREDICTED: cytokinin dehydrogenase 1-like          449   5e-147   
ref|XP_006654329.1|  PREDICTED: cytokinin dehydrogenase 9-like          449   5e-147   
ref|XP_009336587.1|  PREDICTED: cytokinin dehydrogenase 1-like          450   5e-147   
sp|Q0JQ12.2|CKX1_ORYSJ  RecName: Full=Cytokinin dehydrogenase 1; ...    449   6e-147   
ref|XP_003605865.1|  Cytokinin oxidase                                  448   6e-147   
ref|XP_007154653.1|  hypothetical protein PHAVU_003G1365000g            446   8e-147   
ref|XP_009609443.1|  PREDICTED: cytokinin dehydrogenase 1-like          449   9e-147   
ref|XP_009391556.1|  PREDICTED: cytokinin dehydrogenase 4-like is...    447   1e-146   
gb|EPS70157.1|  hypothetical protein M569_04602                         447   1e-146   
ref|XP_006421171.1|  hypothetical protein CICLE_v10006491mg             448   1e-146   
ref|XP_008392337.1|  PREDICTED: cytokinin dehydrogenase 1-like          448   1e-146   
gb|KDP40485.1|  hypothetical protein JCGZ_24484                         446   2e-146   
ref|XP_010508710.1|  PREDICTED: cytokinin dehydrogenase 1-like          449   2e-146   
ref|XP_009133497.1|  PREDICTED: cytokinin dehydrogenase 1-like          448   2e-146   
ref|XP_008796239.1|  PREDICTED: cytokinin dehydrogenase 9-like          447   3e-146   
ref|XP_002304773.1|  FAD-binding domain-containing family protein       446   4e-146   
dbj|BAK52671.1|  cytokinin oxidase                                      447   4e-146   
ref|XP_002270841.2|  PREDICTED: cytokinin dehydrogenase 9               447   4e-146   
ref|XP_009417944.1|  PREDICTED: cytokinin dehydrogenase 4-like          446   4e-146   
gb|AFW83998.1|  cytokinin oxidase 3, mRNA                               445   6e-146   
gb|AFW83999.1|  LOW QUALITY PROTEIN: cytokinin oxidase 3                446   7e-146   
ref|XP_003565050.1|  PREDICTED: cytokinin dehydrogenase 4               446   8e-146   
dbj|BAL04493.1|  cytokinin oxidase                                      446   8e-146   
gb|ADK56162.1|  cytokinin oxidase/dehydrogenase                         446   9e-146   
ref|XP_009363232.1|  PREDICTED: cytokinin dehydrogenase 1-like          446   1e-145   
ref|XP_003539919.1|  PREDICTED: cytokinin dehydrogenase 6-like          446   1e-145   
ref|XP_002513118.1|  Cytokinin dehydrogenase, putative                  445   1e-145   
emb|CBI28611.3|  unnamed protein product                                448   1e-145   
ref|XP_011033192.1|  PREDICTED: cytokinin dehydrogenase 1-like          445   2e-145   
ref|XP_008360505.1|  PREDICTED: cytokinin dehydrogenase 1-like          446   2e-145   
emb|CAE55201.1|  cytokinin oxidase 3                                    444   2e-145   
ref|XP_007028626.1|  Cytokinin oxidase/dehydrogenase 1 isoform 1        445   2e-145   
ref|XP_004513273.1|  PREDICTED: cytokinin dehydrogenase 6-like          449   3e-145   
ref|XP_004971217.1|  PREDICTED: cytokinin dehydrogenase 4-like          444   3e-145   
ref|XP_010269658.1|  PREDICTED: cytokinin dehydrogenase 1-like          444   4e-145   
ref|NP_001105163.1|  cytokinin oxidase 3 precursor                      444   4e-145   
ref|XP_010106427.1|  Cytokinin dehydrogenase 1                          444   4e-145   
ref|NP_001105526.1|  cytokinin oxidase 2 precursor                      443   5e-145   
ref|XP_003564990.2|  PREDICTED: cytokinin dehydrogenase 2-like          444   5e-145   
gb|EAY72836.1|  hypothetical protein OsI_00707                          444   5e-145   
ref|XP_010090224.1|  Cytokinin dehydrogenase 1                          444   7e-145   
ref|XP_006491496.1|  PREDICTED: cytokinin dehydrogenase 1-like          444   9e-145   
ref|XP_004493454.1|  PREDICTED: cytokinin dehydrogenase 1-like          443   1e-144   
ref|XP_011042115.1|  PREDICTED: cytokinin dehydrogenase 6-like          442   1e-144   
ref|XP_007149023.1|  hypothetical protein PHAVU_005G034000g             443   1e-144   
gb|EEE56570.1|  hypothetical protein OsJ_05919                          442   1e-144   
ref|XP_010938665.1|  PREDICTED: cytokinin dehydrogenase 4 isoform X2    443   1e-144   
gb|AFK79770.1|  cytokinin oxidase/dehydrogenase                         444   1e-144   
ref|XP_006368582.1|  FAD-binding domain-containing family protein       442   1e-144   
ref|XP_007162153.1|  hypothetical protein PHAVU_001G128800g             444   2e-144   
ref|XP_002439706.1|  hypothetical protein SORBIDRAFT_09g018640          442   2e-144   
ref|XP_011037797.1|  PREDICTED: cytokinin dehydrogenase 6-like          442   2e-144   
ref|XP_002323274.1|  hypothetical protein POPTR_0016s04340g             442   2e-144   
gb|AII20187.1|  cytokinin oxidase/dehydrogenase-like 7                  443   2e-144   
ref|XP_003625100.1|  Cytokinin oxidase                                  442   2e-144   
ref|NP_001244907.1|  cytokinin oxidase/dehydrogenase-like 5 precu...    442   2e-144   
ref|XP_009784170.1|  PREDICTED: cytokinin dehydrogenase 6-like is...    442   3e-144   
ref|XP_003553393.1|  PREDICTED: cytokinin dehydrogenase 1-like is...    442   3e-144   
ref|XP_009590336.1|  PREDICTED: cytokinin dehydrogenase 6-like          441   4e-144   
ref|XP_006292397.1|  hypothetical protein CARUB_v10018610mg             442   4e-144   
dbj|BAK05047.1|  predicted protein                                      442   4e-144   
ref|NP_001275006.1|  cytokinin oxidase/dehydrogenase                    441   4e-144   
dbj|BAH47540.1|  cytokinin oxidase                                      441   4e-144   
ref|XP_002456917.1|  hypothetical protein SORBIDRAFT_03g045410          441   5e-144   
gb|EEC70112.1|  hypothetical protein OsI_00771                          442   5e-144   
ref|XP_004152677.1|  PREDICTED: cytokinin dehydrogenase 5-like          441   6e-144   
gb|AEK84309.1|  cytokinin oxidase/dehydrogenase                         442   6e-144   
ref|XP_007008757.1|  Cytokinin oxidase/dehydrogenase 6 isoform 1        441   8e-144   
ref|XP_008349298.1|  PREDICTED: cytokinin dehydrogenase 6-like          441   8e-144   
ref|XP_009368087.1|  PREDICTED: cytokinin dehydrogenase 6-like          440   9e-144   
ref|NP_001055371.2|  Os05g0374200                                       440   1e-143   
gb|KHN14944.1|  Cytokinin dehydrogenase 1                               441   1e-143   
gb|EAY97807.1|  hypothetical protein OsI_19727                          440   1e-143   
ref|XP_010067774.1|  PREDICTED: cytokinin dehydrogenase 6-like          441   2e-143   
ref|XP_006645310.1|  PREDICTED: cytokinin dehydrogenase 4-like          439   2e-143   
ref|XP_011078924.1|  PREDICTED: cytokinin dehydrogenase 1-like          440   2e-143   
ref|NP_001244909.1|  cytokinin oxidase/dehydrogenase-like 2             439   3e-143   
gb|AAN16383.1|  cytokinin dehydrogenase 2                               439   3e-143   
dbj|BAM74650.1|  cytokinin oxidase/dehydrogenase                        440   3e-143   
ref|NP_191903.3|  cytokinin oxidase/dehydrogenase 6                     439   4e-143   
ref|XP_002876723.1|  predicted protein                                  439   4e-143   
ref|XP_010418548.1|  PREDICTED: cytokinin dehydrogenase 6               439   4e-143   
ref|XP_004962256.1|  PREDICTED: cytokinin dehydrogenase 9-like          438   5e-143   
ref|XP_011075363.1|  PREDICTED: cytokinin dehydrogenase 1               439   5e-143   
ref|XP_007219000.1|  hypothetical protein PRUPE_ppa004120mg             438   5e-143   
ref|XP_008244287.1|  PREDICTED: cytokinin dehydrogenase 1               439   6e-143   
ref|XP_010547318.1|  PREDICTED: cytokinin dehydrogenase 6-like          437   8e-143   
emb|CDY22528.1|  BnaC03g23380D                                          438   9e-143   
ref|XP_003565448.1|  PREDICTED: cytokinin dehydrogenase 1-like          437   1e-142   
ref|XP_006598397.1|  PREDICTED: LOW QUALITY PROTEIN: cytokinin de...    435   1e-142   
ref|XP_007203158.1|  hypothetical protein PRUPE_ppa024442mg             438   1e-142   
ref|XP_008375236.1|  PREDICTED: cytokinin dehydrogenase 6-like          437   2e-142   
ref|XP_009784168.1|  PREDICTED: cytokinin dehydrogenase 6-like is...    437   2e-142   
dbj|BAF00384.1|  cytokinin oxidase -like protein                        436   3e-142   
gb|AAM08400.2|AF490591_1  cytokinin dehydrogenase 2                     436   3e-142   
ref|XP_001777489.1|  predicted protein                                  435   3e-142   
ref|XP_007008758.1|  Cytokinin oxidase/dehydrogenase 6 isoform 2        436   4e-142   
gb|EMT30248.1|  Cytokinin dehydrogenase 1                               436   4e-142   
ref|XP_010231472.1|  PREDICTED: cytokinin dehydrogenase 9               436   5e-142   
ref|XP_009782890.1|  PREDICTED: cytokinin dehydrogenase 1-like          436   6e-142   
gb|KHN32384.1|  Cytokinin dehydrogenase 6                               436   7e-142   
emb|CDY60734.1|  BnaA07g35940D                                          443   7e-142   
ref|NP_001045353.1|  Os01g0940000                                       436   8e-142   
ref|XP_009354403.1|  PREDICTED: cytokinin dehydrogenase 6-like          435   8e-142   
gb|EAY77168.1|  hypothetical protein OsI_05138                          435   8e-142   
ref|XP_004159659.1|  PREDICTED: cytokinin dehydrogenase 1-like          435   2e-141   
ref|XP_010468848.1|  PREDICTED: cytokinin dehydrogenase 6-like          434   2e-141   
ref|XP_008443336.1|  PREDICTED: cytokinin dehydrogenase 1-like          436   3e-141   
ref|XP_004136791.1|  PREDICTED: cytokinin dehydrogenase 1-like          435   3e-141   
ref|XP_006402274.1|  hypothetical protein EUTSA_v10005878mg             434   4e-141   
ref|XP_008811766.1|  PREDICTED: cytokinin dehydrogenase 4-like          433   6e-141   
gb|AFK79768.1|  cytokinin oxidase/dehydrogenase                         434   7e-141   
ref|NP_001244908.1|  cytokinin oxidase/dehydrogenase-like 7 precu...    433   9e-141   
ref|NP_001244203.1|  cytokinin dehydrogenase 1-like                     433   1e-140   
ref|XP_006604338.1|  PREDICTED: cytokinin dehydrogenase 1-like is...    433   1e-140   
dbj|BAB56095.1|  putative cytokinin oxidase                             432   5e-140   
gb|EYU20769.1|  hypothetical protein MIMGU_mgv1a022053mg                431   6e-140   
ref|XP_010672924.1|  PREDICTED: cytokinin dehydrogenase 1-like          431   8e-140   
ref|XP_010921880.1|  PREDICTED: cytokinin dehydrogenase 9-like          430   9e-140   
gb|AFK79785.1|  cytokinin oxidase/dehydrogenase                         431   1e-139   
ref|XP_009391555.1|  PREDICTED: cytokinin dehydrogenase 4-like is...    431   1e-139   
sp|Q4ADV8.1|CKX2_ORYSJ  RecName: Full=Cytokinin dehydrogenase 2; ...    431   1e-139   
ref|XP_011081605.1|  PREDICTED: cytokinin dehydrogenase 7               427   6e-139   
ref|XP_006351290.1|  PREDICTED: cytokinin dehydrogenase 1-like          428   7e-139   
gb|EYU27005.1|  hypothetical protein MIMGU_mgv1a004144mg                428   9e-139   
ref|XP_010036308.1|  PREDICTED: cytokinin dehydrogenase 1-like is...    428   1e-138   
gb|EMS64767.1|  Cytokinin dehydrogenase 9                               429   1e-138   
ref|XP_008452781.1|  PREDICTED: LOW QUALITY PROTEIN: cytokinin de...    427   1e-138   
ref|XP_010098364.1|  Cytokinin dehydrogenase 7                          426   1e-138   
ref|XP_009630800.1|  PREDICTED: cytokinin dehydrogenase 1-like is...    427   2e-138   
ref|XP_010523657.1|  PREDICTED: cytokinin dehydrogenase 6               426   2e-138   
gb|AAO50082.1|  cytokinin dehydrogenase 3                               426   4e-138   
emb|CDP13849.1|  unnamed protein product                                422   5e-138   
gb|AFW80325.1|  hypothetical protein ZEAMMB73_057649                    427   5e-138   
ref|NP_001185958.1|  cytokinin dehydrogenase 5 precursor                427   5e-138   
emb|CDX76698.1|  BnaC08g32840D                                          425   1e-137   
ref|XP_006451485.1|  hypothetical protein CICLE_v10010210mg             422   1e-137   
ref|XP_009116997.1|  PREDICTED: cytokinin dehydrogenase 6               425   2e-137   
ref|XP_009781977.1|  PREDICTED: cytokinin dehydrogenase 7               425   3e-137   
ref|XP_006576244.1|  PREDICTED: cytokinin dehydrogenase 1-like is...    424   3e-137   
ref|XP_009593487.1|  PREDICTED: cytokinin dehydrogenase 7               424   4e-137   
emb|CDP13465.1|  unnamed protein product                                423   4e-137   
ref|XP_004141436.1|  PREDICTED: cytokinin dehydrogenase 7-like          422   7e-137   
gb|KGN55376.1|  hypothetical protein Csa_4G647490                       423   2e-136   
gb|EPS64605.1|  cytokinin oxidase                                       420   3e-136   
ref|NP_001275030.1|  cytokinin oxidase/dehydrogenase 1 precursor        421   5e-136   
ref|XP_002455003.1|  hypothetical protein SORBIDRAFT_03g002810          422   6e-136   
gb|EYU29893.1|  hypothetical protein MIMGU_mgv1a023414mg                415   2e-135   
ref|XP_001786014.1|  predicted protein                                  417   3e-135   
emb|CDP14175.1|  unnamed protein product                                414   7e-135   
ref|XP_007222863.1|  hypothetical protein PRUPE_ppa004276mg             416   1e-134   
gb|EMS58043.1|  Cytokinin dehydrogenase 5                               417   2e-134   
gb|KHG27003.1|  Cytokinin dehydrogenase 5 -like protein                 412   3e-134   
gb|KHN22222.1|  Cytokinin dehydrogenase 5                               411   5e-134   



>ref|XP_009793978.1| PREDICTED: cytokinin dehydrogenase 3 [Nicotiana sylvestris]
Length=533

 Score =   739 bits (1909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/516 (69%), Positives = 425/516 (82%), Gaps = 19/516 (4%)
 Frame = -1

Query  1807  MSILGKLKPWNS-SLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVD  1631
             MSI+GKLKPWN+ S+PYEILS+DIA +   +S + +  STDFG IVQE PA VLYPSS+ 
Sbjct  21    MSIIGKLKPWNNPSIPYEILSLDIASKLSTNSDSISETSTDFGKIVQEIPAAVLYPSSII  80

Query  1630  DIINLVRFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGALR--------------G  1493
             DI+ L++FSY    PF +AARGHGHS+RGQA A++GVVVEM +L               G
Sbjct  81    DIVELIKFSYGLSIPFHIAARGHGHSIRGQAMAQNGVVVEMNSLNNNNNNNNNINNNKNG  140

Query  1492  GGKIRVSWSESLGYFADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISG  1313
                IRVSW  SLG++ADVGG +LW+DVL A L HG+SP SWTDYL+LTVGGTLSNAGISG
Sbjct  141   SCGIRVSWDSSLGFYADVGGEQLWIDVLRATLEHGLSPVSWTDYLYLTVGGTLSNAGISG  200

Query  1312  QMFRCGPQISNVLELDVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAP  1133
             Q FR GPQISNV E+DVITGKGEF+TCSK  NSELFFAVLGGLGQFGIITRARIVL+KAP
Sbjct  201   QTFRHGPQISNVHEMDVITGKGEFVTCSKHKNSELFFAVLGGLGQFGIITRARIVLDKAP  260

Query  1132  TRVKWVRMLYDDFSKFTRDQEHLISINGLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIA  953
             TRVKWVRMLY DFSKFT+DQEHLISI+GL+Y+EGSLMM  +S NNWRSSFFS S+Q+KIA
Sbjct  261   TRVKWVRMLYADFSKFTKDQEHLISIDGLDYVEGSLMMEQSSLNNWRSSFFSPSNQTKIA  320

Query  952   SLLTQQGLLYCLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRG  773
             SLL+Q G++YCLE+VK+YDDQT +TVD+ELK L+K L+F+PG  FKKD ++ +FLNRVR 
Sbjct  321   SLLSQNGIIYCLEMVKYYDDQTANTVDEELKKLVKGLNFLPGFIFKKDVTFVDFLNRVRS  380

Query  772   EELEPQENGLWEATHPWLNLFVPKSRILDFNSAVFQNILLK-HKTSGPMLVYPTTTKMWD  596
              ELE Q  G W+  HPWLNLFVPKS I+DFN+ VF +I+L+ +KT+GP+LVYPT+ K WD
Sbjct  381   GELELQSKGQWDVPHPWLNLFVPKSNIMDFNAGVFVDIILRQNKTTGPILVYPTSRKKWD  440

Query  595   ERMSAVIPEEDTFYCVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRS  416
             ER+SAVIPEE+TFYCVGLL+S G N WK LD+ N+EIL++C   D+ G KIKQYLPHY++
Sbjct  441   ERISAVIPEEETFYCVGLLHSSGFNDWKNLDDQNEEILNYC---DKAGLKIKQYLPHYKT  497

Query  415   REDWMKHFGKKWNTFQENKAKFDPKMILSPGQTIFN  308
             +EDW+KHFGKKWN FQ+ K++FDPKMILSPGQ IFN
Sbjct  498   KEDWIKHFGKKWNIFQQRKSQFDPKMILSPGQRIFN  533



>ref|XP_009610079.1| PREDICTED: cytokinin dehydrogenase 3 [Nicotiana tomentosiformis]
Length=534

 Score =   731 bits (1887),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/517 (67%), Positives = 421/517 (81%), Gaps = 20/517 (4%)
 Frame = -1

Query  1807  MSILGKLKPWNS-SLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVD  1631
             +SI+GKLKPWN+ S+P EILS+DIA +   +S +    STDFG IVQE PA VLYPSS++
Sbjct  21    VSIIGKLKPWNNPSIPCEILSLDIASKLSTNSDSIRETSTDFGKIVQENPAAVLYPSSIN  80

Query  1630  DIINLVRFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGALRGGGK-----------  1484
             DI+ L++FSY    PF +AARGHGHS+RGQA  ++GVVVEM +L                
Sbjct  81    DIVELIKFSYGLSIPFHIAARGHGHSIRGQAMTQNGVVVEMNSLNNNNNNNNNNNNNNNN  140

Query  1483  ----IRVSWSESLGYFADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGIS  1316
                 IRVSW  SLG++ADVGG +LW+DVL A L HG+SP +WTDYL+LTVGGTLSNAGIS
Sbjct  141   GNGGIRVSWDSSLGFYADVGGEQLWIDVLRATLEHGLSPVTWTDYLYLTVGGTLSNAGIS  200

Query  1315  GQMFRCGPQISNVLELDVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKA  1136
             GQ FR GPQISNV E+D+ITGKGEF+TCSK  NSELFFAVLGGLGQFGIITRARIVL+KA
Sbjct  201   GQTFRHGPQISNVHEMDIITGKGEFVTCSKHKNSELFFAVLGGLGQFGIITRARIVLDKA  260

Query  1135  PTRVKWVRMLYDDFSKFTRDQEHLISINGLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKI  956
             PTRVKWVRMLY DFSKFT+DQEHLISI+GL+Y+EGSLMM   S NNWRSSFFS S+Q+KI
Sbjct  261   PTRVKWVRMLYADFSKFTKDQEHLISIDGLDYVEGSLMMEQRSLNNWRSSFFSPSNQTKI  320

Query  955   ASLLTQQGLLYCLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVR  776
             ASLL+Q G++YCLE+VK+YDDQT STVD+ELK L+K L+F+PG  FKKD ++ +FLNRVR
Sbjct  321   ASLLSQNGIIYCLEMVKYYDDQTASTVDEELKKLVKGLNFLPGFIFKKDVTFVDFLNRVR  380

Query  775   GEELEPQENGLWEATHPWLNLFVPKSRILDFNSAVFQNILLK-HKTSGPMLVYPTTTKMW  599
               ELE +  G W+  HPWLNLFVPKS I+DFN+ VF +I+L+ +KT+GP+LVYPT+ K W
Sbjct  381   RGELELKSKGQWDVPHPWLNLFVPKSNIMDFNAGVFVDIILRQNKTTGPILVYPTSRKKW  440

Query  598   DERMSAVIPEEDTFYCVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYR  419
             D+RMSAVIPEE+TFYCVGLL+S G N WK LD+ N+EIL++C   D+ G KIKQYLPHY+
Sbjct  441   DDRMSAVIPEEETFYCVGLLHSSGFNDWKSLDDQNEEILNYC---DKAGLKIKQYLPHYK  497

Query  418   SREDWMKHFGKKWNTFQENKAKFDPKMILSPGQTIFN  308
             ++EDW+KHFGKKWN FQ+ K++FDPKMILSPGQ IFN
Sbjct  498   TKEDWIKHFGKKWNIFQQRKSQFDPKMILSPGQRIFN  534



>dbj|BAK52672.1| cytokinin oxidase [Petunia x hybrida]
Length=535

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/518 (67%), Positives = 418/518 (81%), Gaps = 21/518 (4%)
 Frame = -1

Query  1807  MSILGKLKPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDD  1628
             MSI+GKL+PWN S+PYEILS+D+A R   +S +T   STDFG IVQE PA VLYP S +D
Sbjct  21    MSIIGKLRPWNPSIPYEILSLDLASRLSANSDSTREVSTDFGKIVQEIPAAVLYPKSTND  80

Query  1627  IINLVRFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGALRGG--------------  1490
             I+ L++FSY+   PF +AARGHGHS+RGQA A+DGVVVEM +L+                
Sbjct  81    IVELIKFSYDLSVPFHIAARGHGHSIRGQAMAQDGVVVEMNSLKNNNNNNNNNNNNNNKN  140

Query  1489  ---GKIRVSWSESLGYFADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGI  1319
                  IRVSW  SLGY+ADVGG +LW+DVL A L HG++P SWTDYL+LTVGGTLSNAGI
Sbjct  141   GIYNGIRVSWDSSLGYYADVGGEQLWIDVLRATLEHGLAPVSWTDYLYLTVGGTLSNAGI  200

Query  1318  SGQMFRCGPQISNVLELDVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEK  1139
             SGQ F+ GPQISNV E+DVITGKGE +TCSK MNSELFFAVLGGLGQFGIITRARIVL+K
Sbjct  201   SGQTFKHGPQISNVHEMDVITGKGELVTCSKHMNSELFFAVLGGLGQFGIITRARIVLDK  260

Query  1138  APTRVKWVRMLYDDFSKFTRDQEHLISINGLNYLEGSLMMNHTSPNNWRSSFFSLSDQSK  959
             APTRVKWVR+LY DFSKFT+DQEHLISI+GL+Y+EGSLMM  +  NNWRSSFFS S+Q+K
Sbjct  261   APTRVKWVRILYADFSKFTKDQEHLISIDGLDYVEGSLMMKQSPLNNWRSSFFSPSNQTK  320

Query  958   IASLLTQQGLLYCLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRV  779
             IASLL++ G++YCLE+VK+YDDQ+ +T+D+ELK LLK L+ +PG  FKKDA+Y +FLNRV
Sbjct  321   IASLLSENGIIYCLEMVKYYDDQSSNTIDKELKKLLKGLNNLPGFIFKKDATYVDFLNRV  380

Query  778   RGEELEPQENGLWEATHPWLNLFVPKSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKM  602
             R  ELE Q  GLW+  HPWLNLFVPKS I+DFN+ VF +I+LK   T+GP+LVYPT+ K 
Sbjct  381   RSGELELQSKGLWDVPHPWLNLFVPKSSIMDFNAGVFVDIILKQNMTAGPILVYPTSRKK  440

Query  601   WDERMSAVIPEEDTFYCVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHY  422
             WD+RMSAVIPEE+TFYCVGLL+S G N W+ LDE N+EIL +C   D+ G KIKQYLPHY
Sbjct  441   WDDRMSAVIPEEETFYCVGLLHSSGFNDWQTLDEQNEEILKYC---DKAGLKIKQYLPHY  497

Query  421   RSREDWMKHFGKKWNTFQENKAKFDPKMILSPGQTIFN  308
             + +EDW+KHF KKWN FQ+ K +FDPKM+LSPGQ IFN
Sbjct  498   KRKEDWIKHFSKKWNIFQQRKTQFDPKMLLSPGQRIFN  535



>emb|CDP03155.1| unnamed protein product [Coffea canephora]
Length=527

 Score =   718 bits (1854),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/507 (68%), Positives = 420/507 (83%), Gaps = 10/507 (2%)
 Frame = -1

Query  1807  MSILGKLKPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDD  1628
             +SI+GK +PW +SLP ++L +DIA + R D  A   AS+DFG +VQE P+ V +PSSV D
Sbjct  22    ISIIGKFRPWPNSLPRQVLFLDIATKLRFDPDAINTASSDFGKLVQEIPSAVFHPSSVAD  81

Query  1627  IINLVRFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGALR----GGGKIRVSWSES  1460
             II ++  SYNS  PF +AARGHGHS+RGQA A +GVV+EM +L      G KI+VSWS S
Sbjct  82    IIRVINVSYNSSVPFGIAARGHGHSIRGQAMAPNGVVIEMSSLSDYTSNGTKIKVSWSPS  141

Query  1459  LGYFADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISN  1280
             LGY+ADVGG +LW+DVL   L +G++P SWTDYL+LTVGGTLSNAGISGQ FR GPQISN
Sbjct  142   LGYYADVGGEQLWIDVLRTTLDYGLAPVSWTDYLYLTVGGTLSNAGISGQTFRHGPQISN  201

Query  1279  VLELDVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYD  1100
             V ELDVITGKGEFITCSK MNSEL++AVLGGLGQFGIITRARIVL+KAPTRVKW+R++YD
Sbjct  202   VHELDVITGKGEFITCSKHMNSELYYAVLGGLGQFGIITRARIVLDKAPTRVKWLRIMYD  261

Query  1099  DFSKFTRDQEHLISI--NGLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLL  926
             DFS FTRDQE+LISI  NGL+Y+EGSL++  +SPNNWRSSFFS S QSKI+SLLT++G+L
Sbjct  262   DFSSFTRDQEYLISINDNGLDYVEGSLILQQSSPNNWRSSFFSASHQSKISSLLTERGIL  321

Query  925   YCLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENG  746
             YC+EVVK+YDD T +TVDQEL+ LL+ L ++PG  FKKD S+  FLNRVR  ELE Q  G
Sbjct  322   YCMEVVKYYDDNTAATVDQELELLLEGLHYIPGFLFKKDDSFVGFLNRVRSGELELQSKG  381

Query  745   LWEATHPWLNLFVPKSRILDFNSAVFQNILLK-HKTSGPMLVYPTTTKMWDERMSAVIPE  569
             LW+  HPWLNLFVPKSRI+DFN+ VF +ILLK +K +GP+LVYPT+ KMWDERMSAV+P+
Sbjct  382   LWDVPHPWLNLFVPKSRIMDFNAGVFVDILLKQNKATGPILVYPTSKKMWDERMSAVVPD  441

Query  568   EDTFYCVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFG  389
             EDTFYCVGLL+SG ++ WK LD+ N E+L FC+K+   G +IKQYLPHY++R+DWM HFG
Sbjct  442   EDTFYCVGLLHSGTLDDWKNLDDQNNELLEFCDKN---GIEIKQYLPHYKTRQDWMNHFG  498

Query  388   KKWNTFQENKAKFDPKMILSPGQTIFN  308
              KW+TFQE KA+FDPK+ILSPGQ IFN
Sbjct  499   SKWSTFQERKARFDPKVILSPGQKIFN  525



>ref|XP_004251670.1| PREDICTED: cytokinin dehydrogenase 3 [Solanum lycopersicum]
Length=527

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/509 (67%), Positives = 417/509 (82%), Gaps = 12/509 (2%)
 Frame = -1

Query  1807  MSILGKLKPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQET-PAGVLYPSSVD  1631
             MSILGKLKPWN S+PYEILS++I+ +   +S A   +S DFG I+QE  PA VLYPS V+
Sbjct  22    MSILGKLKPWNPSIPYEILSLNISSKLSTNSHAIKESSKDFGKIIQEILPAAVLYPSCVN  81

Query  1630  DIINLVRFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGALRGGGK----IRVSWSE  1463
             DII+L++FSY+   PF VAA+GHGHS+RGQA AK+GV+VEM +L         +RVSW  
Sbjct  82    DIIDLIQFSYDLSVPFHVAAKGHGHSIRGQAMAKNGVIVEMSSLNNNNNENCGVRVSWDS  141

Query  1462  SLGYFADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQIS  1283
              LG++ADVGG +LW+DVLH  L +G++P SWTDYL+LTVGGTLSNAGISGQ FR GPQIS
Sbjct  142   DLGFYADVGGEQLWIDVLHNTLEYGLAPVSWTDYLYLTVGGTLSNAGISGQTFRYGPQIS  201

Query  1282  NVLELDVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLY  1103
             NV E+DVITGKGE +TCSKDMNSELFF VLGGLGQFGIITRARIVL+KAPTRVKWVRMLY
Sbjct  202   NVHEMDVITGKGELMTCSKDMNSELFFGVLGGLGQFGIITRARIVLDKAPTRVKWVRMLY  261

Query  1102  DDFSKFTRDQEHLISI--NGLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGL  929
             DDFSKFT+DQEHLISI  NGL+Y+EGSLMM  +S NNWRSSF+S S+Q+KIASLL++  +
Sbjct  262   DDFSKFTKDQEHLISIHNNGLDYVEGSLMMEQSSLNNWRSSFYSPSNQTKIASLLSKNKI  321

Query  928   LYCLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQEN  749
             +YCLE+VK+YDDQ  +T+D+ELK L+K L +V G  FKKD S+ EFLNRVR  ELE Q  
Sbjct  322   MYCLEIVKYYDDQNANTIDKELKKLVKGLKYVGGFMFKKDVSFVEFLNRVRSGELELQSK  381

Query  748   GLWEATHPWLNLFVPKSRILDFNSAVFQNILLK-HKTSGPMLVYPTTTKMWDERMSAVIP  572
             G+W+  HPWLNLFVPKS I+ FN+AVF +I+L+ +KT+GP+LVYPT+ K WD+RMSA+IP
Sbjct  382   GMWDVPHPWLNLFVPKSSIMHFNAAVFVDIILRQNKTNGPILVYPTSRKRWDDRMSAIIP  441

Query  571   EEDTFYCVGLLY-SGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKH  395
             EE+TFYCVGLL+ S G N  K+LD  N+EIL++C   D+ G  IKQYLPHY+++EDW+KH
Sbjct  442   EEETFYCVGLLHSSSGYNECKILDNQNEEILNYC---DKVGLNIKQYLPHYKTKEDWIKH  498

Query  394   FGKKWNTFQENKAKFDPKMILSPGQTIFN  308
             FGKKWN FQ+ K  FDPKMILSPGQ IFN
Sbjct  499   FGKKWNIFQQRKDLFDPKMILSPGQRIFN  527



>ref|NP_001275401.1| cytokinin oxidase/dehydrogenase 2 [Solanum tuberosum]
 gb|ACN65409.1| cytokinin oxidase/dehydrogenase 2 [Solanum tuberosum]
Length=527

 Score =   701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/509 (66%), Positives = 413/509 (81%), Gaps = 12/509 (2%)
 Frame = -1

Query  1807  MSILGKLKPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQET-PAGVLYPSSVD  1631
             MSILGKL PWN S+PYEILS++I+ +   +S A   +S DFG I+QE  PA VLYPS V+
Sbjct  22    MSILGKLNPWNPSIPYEILSLNISSKLSTNSHAIKESSKDFGKIIQEILPAAVLYPSCVN  81

Query  1630  DIINLVRFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGALRGGGK----IRVSWSE  1463
             DII+L++FS++   PF VAA+GHGHS+RGQA AK+GV+VEM +L         +RVSW  
Sbjct  82    DIIDLIQFSHDHSVPFHVAAKGHGHSIRGQAMAKNGVIVEMSSLNNNNNENCGVRVSWDL  141

Query  1462  SLGYFADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQIS  1283
              LG++ADVGG +LW+DVL + + +G++P SWTDYL+LTVGGTLSNAGISGQ FR GPQIS
Sbjct  142   GLGFYADVGGEQLWIDVLRSTIEYGLAPVSWTDYLYLTVGGTLSNAGISGQTFRYGPQIS  201

Query  1282  NVLELDVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLY  1103
             NV E+DVITGKGE +TCSKDMNSELFF VLGGLGQFGIITRARIVL+KAPTRVKWVRMLY
Sbjct  202   NVHEMDVITGKGELVTCSKDMNSELFFGVLGGLGQFGIITRARIVLDKAPTRVKWVRMLY  261

Query  1102  DDFSKFTRDQEHLISI--NGLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGL  929
             DDFSKFT+DQEHLISI  NGL+Y+EGSLMM  +S NNWRSSFFS S+Q++IASLL++  +
Sbjct  262   DDFSKFTKDQEHLISIHHNGLDYVEGSLMMEQSSLNNWRSSFFSPSNQTEIASLLSKNKI  321

Query  928   LYCLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQEN  749
             +YCLE+VK+YDDQ  +T+D+ELK L+K L ++ G  FKKD S+ EFLNRVR  ELE Q  
Sbjct  322   MYCLEIVKYYDDQNANTIDEELKQLVKGLKYLGGFMFKKDVSFVEFLNRVRSGELELQSK  381

Query  748   GLWEATHPWLNLFVPKSRILDFNSAVFQNILLK-HKTSGPMLVYPTTTKMWDERMSAVIP  572
             G W+  HPWLNLFVPKS I+ F++AVF +I+L+ +KT+GP+LVYPT+ K WD+RMS VIP
Sbjct  382   GKWDVPHPWLNLFVPKSSIMHFHAAVFVDIILRQNKTTGPILVYPTSRKRWDDRMSTVIP  441

Query  571   EEDTFYCVGLLY-SGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKH  395
             EE+TFYCVGLL+ S G    K+LD  N+EIL++C   D+ G  IKQYLPHY+++EDW+KH
Sbjct  442   EEETFYCVGLLHSSSGYKECKILDNQNEEILNYC---DKVGLNIKQYLPHYKTKEDWIKH  498

Query  394   FGKKWNTFQENKAKFDPKMILSPGQTIFN  308
             FGKKWN FQ+ K  FDPKMILSPGQ IFN
Sbjct  499   FGKKWNIFQQRKDLFDPKMILSPGQRIFN  527



>ref|XP_006353538.1| PREDICTED: cytokinin dehydrogenase 3 [Solanum tuberosum]
Length=527

 Score =   700 bits (1807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/509 (66%), Positives = 412/509 (81%), Gaps = 12/509 (2%)
 Frame = -1

Query  1807  MSILGKLKPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQET-PAGVLYPSSVD  1631
             MSILGKL PWN S+PYEILS++I+ +   +S     +S DFG I+QE  PA VLYPS V+
Sbjct  22    MSILGKLNPWNPSIPYEILSLNISSKLSTNSHDIKESSKDFGKIIQEILPAAVLYPSCVN  81

Query  1630  DIINLVRFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGALRGGGK----IRVSWSE  1463
             DII+L++FS++   PF VAA+GHGHS+RGQA AK+GV+VEM +L         +RVSW  
Sbjct  82    DIIDLIQFSHDLSVPFHVAAKGHGHSIRGQAMAKNGVIVEMSSLNNNNNENCGVRVSWDS  141

Query  1462  SLGYFADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQIS  1283
              LG++ADVGG +LW+DVL + L +G++P SWTDYL+LTVGGTLSNAGISGQ FR GPQIS
Sbjct  142   GLGFYADVGGEQLWIDVLRSTLEYGLAPVSWTDYLYLTVGGTLSNAGISGQTFRYGPQIS  201

Query  1282  NVLELDVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLY  1103
             NV E+DVITGKGE +TCSKDMNSELFF VLGGLGQFGIITRARIVL+KAPTRVKWVRMLY
Sbjct  202   NVHEMDVITGKGELVTCSKDMNSELFFGVLGGLGQFGIITRARIVLDKAPTRVKWVRMLY  261

Query  1102  DDFSKFTRDQEHLISI--NGLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGL  929
             DDFSKFT+DQEHLISI  NGL+Y+EGSLMM  +S NNWRSSFFS S+Q+KIASLL++  +
Sbjct  262   DDFSKFTKDQEHLISIHHNGLDYVEGSLMMEQSSLNNWRSSFFSPSNQTKIASLLSKNKI  321

Query  928   LYCLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQEN  749
             +YCLE+VK+YDDQ  +T+D+ELK L+K L ++ G  FKKD S+ EFLNRVR  ELE Q  
Sbjct  322   MYCLEIVKYYDDQNANTIDEELKKLVKGLKYLGGFMFKKDVSFVEFLNRVRSGELELQSK  381

Query  748   GLWEATHPWLNLFVPKSRILDFNSAVFQNILLK-HKTSGPMLVYPTTTKMWDERMSAVIP  572
             G W+  HPWLNLFVPKS I+ F++AVF +I+L+ +KT+GP+LVYPT+ K WD+RMS +IP
Sbjct  382   GKWDVPHPWLNLFVPKSSIMHFHAAVFVDIILRQNKTTGPILVYPTSRKRWDDRMSTMIP  441

Query  571   EEDTFYCVGLLY-SGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKH  395
             EE+TFYCVGLL+ S G    K+LD  N+EIL++C   D+ G  IKQYLPHY+++EDW+KH
Sbjct  442   EEETFYCVGLLHSSSGYKECKILDNQNEEILNYC---DKVGLNIKQYLPHYKTKEDWIKH  498

Query  394   FGKKWNTFQENKAKFDPKMILSPGQTIFN  308
             FGKKWN FQ+ K  FDPKMILSPGQ IFN
Sbjct  499   FGKKWNIFQQRKDLFDPKMILSPGQRIFN  527



>ref|XP_009799177.1| PREDICTED: cytokinin dehydrogenase 3-like [Nicotiana sylvestris]
Length=520

 Score =   683 bits (1763),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/508 (66%), Positives = 405/508 (80%), Gaps = 17/508 (3%)
 Frame = -1

Query  1807  MSILGKLKPWNSSLPYEIL-SVDIAGRFRVD-SRATTAASTDFGGIVQETPAGVLYPSSV  1634
             +SI+GK      S+PYE+L  +DIA R  V+ S AT A STDFG +VQ+ PA VLYPSS+
Sbjct  20    VSIIGK-----PSIPYEVLFHLDIATRLSVNISDATIATSTDFGKLVQKIPAAVLYPSSI  74

Query  1633  DDIINLVRFSYNSP--SPFSVAARGHGHSVRGQATAKDGVVVEMGALRGG--GKIRVSWS  1466
              DII L+ +S N     PF VAARGHGHSVRGQA + +GVVV M +L+    GKIRV W 
Sbjct  75    HDIIKLINYSNNGAISVPFGVAARGHGHSVRGQAMSPNGVVVVMSSLKNNNNGKIRVFWE  134

Query  1465  ESLG-YFADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQ  1289
               LG Y+ADVGG +LW+DVLHA L HG++P SWTDYL+L+VGGTLSNAGISGQ F+ GPQ
Sbjct  135   SFLGFYYADVGGEQLWIDVLHATLEHGLAPVSWTDYLYLSVGGTLSNAGISGQTFKYGPQ  194

Query  1288  ISNVLELDVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRM  1109
             ISNVLE+DVITGKG+ +TCSK  NSELFFAVLGGLGQFGIITRARIV+EKAPTRVKWVR+
Sbjct  195   ISNVLEMDVITGKGQLVTCSKQTNSELFFAVLGGLGQFGIITRARIVVEKAPTRVKWVRV  254

Query  1108  LYDDFSKFTRDQEHLISI-NGLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQG  932
              Y DFSKFT+DQE LISI NG++Y+EGSLMMN + PNNWRSSFFS S+QSKI SL+++ G
Sbjct  255   FYSDFSKFTKDQEKLISINNGMDYVEGSLMMNQSPPNNWRSSFFSTSNQSKIISLISKYG  314

Query  931   LLYCLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQE  752
             ++YCLE+VK+YDDQ  +TVD+EL+ +++ L+F+ G  FKKD ++  FLNRVR  EL  Q 
Sbjct  315   IIYCLEMVKYYDDQCANTVDKELQKMMRGLNFLSGHIFKKDTTFVHFLNRVRSGELRLQS  374

Query  751   NGLWEATHPWLNLFVPKSRILDFNSAVFQNILLK-HKTSGPMLVYPTTTKMWDERMSAVI  575
              G+W+  HPWLNLFVPKS I+DFN  VF +I+L+ +KT+GP+LVYPTT K WD+RMS VI
Sbjct  375   KGMWDVPHPWLNLFVPKSSIMDFNVGVFLDIILRQNKTTGPILVYPTTRKKWDDRMSVVI  434

Query  574   PEEDTFYCVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKH  395
             PEEDTFYCVGLL+S G N W+VLD  N+EI+++C K    G  IKQYLPHY+S+E WM H
Sbjct  435   PEEDTFYCVGLLHSSGFNDWEVLDGQNEEIINYCEK---AGLNIKQYLPHYKSKEAWMNH  491

Query  394   FGKKWNTFQENKAKFDPKMILSPGQTIF  311
             FGKKW  FQ+ K++FDPKMILSPGQ IF
Sbjct  492   FGKKWKIFQQRKSQFDPKMILSPGQKIF  519



>ref|XP_009602355.1| PREDICTED: cytokinin dehydrogenase 3-like [Nicotiana tomentosiformis]
Length=525

 Score =   672 bits (1733),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/513 (65%), Positives = 402/513 (78%), Gaps = 22/513 (4%)
 Frame = -1

Query  1807  MSILGKLKPWNSSLPYEILS-VDIAGRFRVD-SRATTAASTDFGGIVQETPAGVLYPSSV  1634
             +SI+GK      S+  E+LS +DIA R  V+ S AT A STDFG +VQE PA VLYPSS+
Sbjct  20    VSIIGK-----PSITNEVLSHLDIATRLSVNISDATIATSTDFGKLVQEIPAAVLYPSSI  74

Query  1633  DDIINLVRFSYNSP--SPFSVAARGHGHSVRGQATAKDGVVVEMGALRGG-------GKI  1481
              DI+ L+ +S N    +P  VAARGHGHSVRGQA + +GVVV M +L          GKI
Sbjct  75    HDIVKLINYSNNGAISAPIGVAARGHGHSVRGQAMSPNGVVVVMSSLNNNNNNNNNNGKI  134

Query  1480  RVSWSESLG-YFADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMF  1304
             RV W  SLG Y+ADVGG +LW+DVLHA L HG++P SWTDYL+L+VGGTLSNAGISGQ F
Sbjct  135   RVFWESSLGFYYADVGGEQLWIDVLHATLEHGLAPVSWTDYLYLSVGGTLSNAGISGQTF  194

Query  1303  RCGPQISNVLELDVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRV  1124
             + GPQISNVLE+DVITGKGE +TCSK  NSELFFAVLG LGQFGII RARIVLEKAPTRV
Sbjct  195   KYGPQISNVLEMDVITGKGELVTCSKRTNSELFFAVLGSLGQFGIIIRARIVLEKAPTRV  254

Query  1123  KWVRMLYDDFSKFTRDQEHLISIN-GLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASL  947
             KWVR+LY DFSKFTRDQE LISIN G++Y+EGSLMMN + PNNWRSSFFS S+QSKI SL
Sbjct  255   KWVRVLYSDFSKFTRDQEKLISINDGMDYVEGSLMMNQSPPNNWRSSFFSTSNQSKILSL  314

Query  946   LTQQGLLYCLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEE  767
             +++ G++YCLE+VK+YDDQT +TVD+EL+ +++ L+FV G  FKKD ++  FLNRVR  E
Sbjct  315   ISKYGIIYCLEMVKYYDDQTANTVDKELQKMMRGLNFVFGHIFKKDTAFVHFLNRVRSGE  374

Query  766   LEPQENGLWEATHPWLNLFVPKSRILDFNSAVFQNILLK-HKTSGPMLVYPTTTKMWDER  590
             L  Q  G+W+  HPWLNLFVPKS I+DFN  VF +I+L+ +K++GP+LVYPTT K WD+R
Sbjct  375   LMLQSKGMWDVPHPWLNLFVPKSSIMDFNVGVFLDIILRQNKSTGPILVYPTTRKRWDDR  434

Query  589   MSAVIPEEDTFYCVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSRE  410
             MS VIPEEDTFYCVGLL+S   N W+VLD  N+EI++ C K    G  +KQYLPHY+++E
Sbjct  435   MSVVIPEEDTFYCVGLLHSSRFNDWEVLDGQNEEIINCCEK---AGLNVKQYLPHYKTKE  491

Query  409   DWMKHFGKKWNTFQENKAKFDPKMILSPGQTIF  311
              WM HFGKKW  FQ+ K++FDPKMILSPGQ IF
Sbjct  492   AWMNHFGKKWKIFQQRKSQFDPKMILSPGQKIF  524



>ref|XP_007012819.1| Cytokinin oxidase [Theobroma cacao]
 gb|EOY30438.1| Cytokinin oxidase [Theobroma cacao]
Length=524

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/510 (62%), Positives = 392/510 (77%), Gaps = 18/510 (4%)
 Frame = -1

Query  1807  MSILGKLKPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDD  1628
             MSI+G  KPWN S  +  L+++IAG+  VD  A  +AS DFG IV+  P  VLYPSS +D
Sbjct  21    MSIIGISKPWNISPKF--LTLEIAGKLSVDPSAIESASQDFGHIVKAIPEAVLYPSSAED  78

Query  1627  IINLVRFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGAL---RGGGKIRVSWSESL  1457
             I  LV+ SYNS  PFS+AA+GHGHSVRGQA A +GVVV+M ++   R G  IR+S   S 
Sbjct  79    IATLVKLSYNSLVPFSIAAKGHGHSVRGQAMANNGVVVDMASMKKHRNGSGIRIS---SD  135

Query  1456  GYFADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNV  1277
             G +AD+GG +LW+DVL+A L  G++P SWTDYL+LTVGGTLSNAGISGQ FR GPQISNV
Sbjct  136   GCYADIGGEQLWIDVLNATLERGLAPVSWTDYLYLTVGGTLSNAGISGQTFRYGPQISNV  195

Query  1276  LELDVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDD  1097
              E+DVITG  +F TCS + NSELF+AVLGGLGQFGIITRARI LE AP RVKWVRMLY+D
Sbjct  196   YEMDVITGTADFHTCSPEKNSELFYAVLGGLGQFGIITRARIPLEPAPKRVKWVRMLYND  255

Query  1096  FSKFTRDQEHLISING------LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQ  935
             FS FTRDQE LISING      L+YLEGSLMM+  SP+NWRSSFF  +D  KI SL+T+ 
Sbjct  256   FSAFTRDQELLISINGRKDNNALDYLEGSLMMDQGSPDNWRSSFFPPADHPKIMSLITEH  315

Query  934   GLLYCLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQ  755
              ++YCLEVVKHYDDQT STVD+EL+ LLK LS+ PG+ F+KD  Y EFLNRVR  EL+ +
Sbjct  316   RIIYCLEVVKHYDDQTKSTVDKELQQLLKGLSYTPGLMFEKDVLYAEFLNRVRSGELKLK  375

Query  754   ENGLWEATHPWLNLFVPKSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAV  578
               GLW+  HPWLNLF+PKS+I DFN  VF+ I+L+   T+GP+L+YP   K WD+RMSAV
Sbjct  376   SQGLWDVPHPWLNLFIPKSQIADFNDGVFKGIVLERSITTGPVLLYPMNRKKWDDRMSAV  435

Query  577   IPEEDTFYCVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMK  398
             IP+E+ FY VG+L+S G + W+  D+ N+EI+ FC   D+ G  +KQYLPHY ++E+W++
Sbjct  436   IPDEEIFYTVGILHSSGFDDWEAFDDQNKEIMQFC---DKAGIGVKQYLPHYTAKEEWIQ  492

Query  397   HFGKKWNTFQENKAKFDPKMILSPGQTIFN  308
             HFG KW TFQ++K +FDPKMILSPGQ IFN
Sbjct  493   HFGSKWKTFQQSKHQFDPKMILSPGQRIFN  522



>ref|XP_002264445.1| PREDICTED: cytokinin dehydrogenase 3 [Vitis vinifera]
Length=522

 Score =   650 bits (1678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/500 (64%), Positives = 387/500 (77%), Gaps = 11/500 (2%)
 Frame = -1

Query  1789  LKPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQE-TPAGVLYPSSVDDIINLV  1613
             L+PW   LP E+ S+DIA R RVD  AT  AS DFG +V    PA VLYPSS++DI +LV
Sbjct  26    LRPWPDVLPNELQSLDIASRLRVDPDATRMASRDFGKLVHPPNPAAVLYPSSIEDIASLV  85

Query  1612  RFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGAL----RGGGKIRVSWSESLGYFA  1445
             +FSYN   PFS+AARG GHS+RGQA A  GVVVEM +L    RG G IRV+ +   G +A
Sbjct  86    KFSYNRSFPFSIAARGQGHSLRGQAMAPHGVVVEMRSLNNCSRGSG-IRVTKNPISGSYA  144

Query  1444  DVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELD  1265
             D GG +LW+DVL A L HG++P SWTDYL+LT+GGTLSNAGISGQ FR GPQISNV E+D
Sbjct  145   DAGGEQLWIDVLQATLKHGLAPVSWTDYLYLTIGGTLSNAGISGQTFRHGPQISNVYEMD  204

Query  1264  VITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKF  1085
             V+TGKGE +TCSKD NSELFFAVLGGLGQFGII RARI L+ AP RVKW++MLYDDFS F
Sbjct  205   VLTGKGELVTCSKDTNSELFFAVLGGLGQFGIIIRARIALKPAPKRVKWIQMLYDDFSTF  264

Query  1084  TRDQEHLISINGLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVK  905
             +RDQEHLISINGL+YLEGSL+M ++SPNNWRSS FS S+  +I+SL+++ G++YCLEVVK
Sbjct  265   SRDQEHLISINGLDYLEGSLLMQNSSPNNWRSS-FSPSEYPRISSLISKNGIIYCLEVVK  323

Query  904   HYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHP  725
             +YD+ T  TVD+EL++LLK L+F+PG  F KD S  +FLNRV  EEL  Q  GLW+  HP
Sbjct  324   YYDELTSHTVDEELQELLKGLNFLPGFVFTKDVSLVDFLNRVHSEELNLQAKGLWDVPHP  383

Query  724   WLNLFVPKSRILDFNSAVFQNILLK-HKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCV  548
             WLNLFVP SRI DFNS VF++IL K ++T+G  LVYP     WD+R SAVIP+ED FY V
Sbjct  384   WLNLFVPGSRISDFNSGVFRDILPKINQTTGTFLVYPVIRNKWDDRTSAVIPDEDIFYTV  443

Query  547   GLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQ  368
             GLL+S G + W+ L+  N+EIL FC   D+ G KIK+YL  Y ++EDWM HFG KW TF+
Sbjct  444   GLLHSSGADDWEPLENQNKEILQFC---DKAGIKIKRYLSRYTTKEDWMNHFGPKWRTFE  500

Query  367   ENKAKFDPKMILSPGQTIFN  308
             + KA+FDPK+ILSPGQ IFN
Sbjct  501   DRKAQFDPKLILSPGQQIFN  520



>ref|XP_002279519.1| PREDICTED: cytokinin dehydrogenase 3 [Vitis vinifera]
Length=521

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/495 (62%), Positives = 383/495 (77%), Gaps = 7/495 (1%)
 Frame = -1

Query  1780  WNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSY  1601
             W   LP+++ ++ IA R RVD  AT  A+ DFG +VQ+TPA VLYPSS++DI++LV+FSY
Sbjct  28    WADVLPHQLHTLTIATRLRVDLDATAKAARDFGKLVQQTPAAVLYPSSIEDIVSLVKFSY  87

Query  1600  NSPSPFSVAARGHGHSVRGQATAKDGVVVEMGALRGGGK---IRVSWSESLGYFADVGGH  1430
             N PSPF++AARG GHS+ GQA A +GVVV+M +L+  G    I+V+ +   G +ADVGGH
Sbjct  88    NQPSPFTIAARGRGHSLGGQAMAPNGVVVDMTSLKNSGAGIGIKVTKNPVSGSYADVGGH  147

Query  1429  ELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGK  1250
             +LW+DVL A L HG++P SWTDYL+LTVGGTLSNAG SGQ FR GPQISNV E+D+ITGK
Sbjct  148   QLWIDVLQATLEHGLAPVSWTDYLYLTVGGTLSNAGGSGQTFRHGPQISNVHEMDIITGK  207

Query  1249  GEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQE  1070
             GE +TCSK+ NS+LF+AVLGGLGQFGIITRARI LE AP RVKWVRMLYDDFS F+ DQE
Sbjct  208   GELVTCSKETNSDLFYAVLGGLGQFGIITRARIPLEPAPKRVKWVRMLYDDFSTFSEDQE  267

Query  1069  HLISINGLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQ  890
             HLISINGL+YLEGSL+   + PNNWRSSFFS S    I+SLLT+ G++Y +EVVK+YDD 
Sbjct  268   HLISINGLDYLEGSLITKQSPPNNWRSSFFSKSQYPIISSLLTKNGIIYSIEVVKYYDDL  327

Query  889   TGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLF  710
             T  TVD+EL++L K L F+PG+ F KD +  +FL+RV   EL+ Q  GLW+  HPWLNLF
Sbjct  328   TSHTVDEELQELFKGLRFLPGLVFTKDVTLVDFLDRVHNGELQLQAKGLWDVPHPWLNLF  387

Query  709   VPKSRILDFNSAVFQNILLK-HKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYS  533
             VPKSRI DFNS VF++I+LK ++T GP+LVYP     WD  MSA IP+ED FY +GLL+S
Sbjct  388   VPKSRISDFNSGVFRDIILKTNQTVGPLLVYPMIRNKWDNGMSAAIPDEDIFYSIGLLHS  447

Query  532   GGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAK  353
              G + W+ L+  N+EIL FC   D+ G KIKQYLP Y ++ DWM HFG KW  F++ KA+
Sbjct  448   SGADDWEPLENQNKEILKFC---DKAGIKIKQYLPRYTTKADWMNHFGPKWKIFEDRKAQ  504

Query  352   FDPKMILSPGQTIFN  308
             FDPK ILSPGQ IFN
Sbjct  505   FDPKNILSPGQRIFN  519



>ref|XP_002263646.1| PREDICTED: cytokinin dehydrogenase 3 [Vitis vinifera]
Length=522

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/499 (64%), Positives = 384/499 (77%), Gaps = 9/499 (2%)
 Frame = -1

Query  1789  LKPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQE-TPAGVLYPSSVDDIINLV  1613
             L+ W   LPYE+ S+DIA R RVD  AT  AS DFG +V    PA VLYPSS++DI +LV
Sbjct  26    LRRWPDVLPYELQSLDIASRLRVDPDATRMASRDFGRLVHPPNPAAVLYPSSIEDIASLV  85

Query  1612  RFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGALRG---GGKIRVSWSESLGYFAD  1442
             +FSYN  SPFS+AARG GHS+RGQA A  GVVVEM +L     G  IRV+ +   G +AD
Sbjct  86    KFSYNRSSPFSIAARGQGHSLRGQAMASHGVVVEMRSLNNCSCGSGIRVTKNPIWGSYAD  145

Query  1441  VGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDV  1262
             VGG + W+DVL A L HG++P SWTDYL+LT+GGTLSNAGISGQ FR GPQISNV E+DV
Sbjct  146   VGGEQQWIDVLQATLKHGLAPVSWTDYLYLTIGGTLSNAGISGQTFRHGPQISNVYEMDV  205

Query  1261  ITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFT  1082
             +TGKGE +TCSKD NSELFFAVLGGLGQFGIITRARI LE AP RVKW++MLYDDFS F+
Sbjct  206   LTGKGELVTCSKDTNSELFFAVLGGLGQFGIITRARIALEPAPERVKWIQMLYDDFSTFS  265

Query  1081  RDQEHLISINGLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKH  902
             RDQEHLISINGL+YLEGSL M ++ PNNWRSS FS S+  +I+SL+++ G++YCLEVVK+
Sbjct  266   RDQEHLISINGLDYLEGSLSMQNSPPNNWRSS-FSPSEYPRISSLISKNGIIYCLEVVKY  324

Query  901   YDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPW  722
             YD+ T  TVD+EL+ LLK L+F+PG  F KD S  +FLNRV   EL  +  GLW+  HPW
Sbjct  325   YDELTSHTVDEELQVLLKGLNFLPGFVFTKDVSLVDFLNRVHSGELNLRAKGLWDVPHPW  384

Query  721   LNLFVPKSRILDFNSAVFQNILLK-HKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVG  545
             LNLFVP+S I DFNS VF++IL K ++T+GP LVYP     WD+R SAVIP+ED FY VG
Sbjct  385   LNLFVPRSSISDFNSGVFRDILPKINQTTGPFLVYPMIRNKWDDRTSAVIPDEDIFYTVG  444

Query  544   LLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQE  365
             +L+S G + W+ L+  N+EIL FC   D+ G KIK+YL  Y ++EDWM HFG KW TF++
Sbjct  445   VLHSSGADDWEPLENQNKEILKFC---DKAGIKIKRYLSRYTTKEDWMNHFGPKWRTFED  501

Query  364   NKAKFDPKMILSPGQTIFN  308
              KA+FDPKMILSPGQ IFN
Sbjct  502   RKAQFDPKMILSPGQQIFN  520



>emb|CAN80714.1| hypothetical protein VITISV_042932 [Vitis vinifera]
Length=522

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/499 (63%), Positives = 384/499 (77%), Gaps = 9/499 (2%)
 Frame = -1

Query  1789  LKPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQE-TPAGVLYPSSVDDIINLV  1613
             L+PW   LP E+ S+DIA R RVD  AT  AS DFG +V    PA VLYPSS++DI +LV
Sbjct  26    LRPWPDVLPNELQSLDIASRLRVDPBATRMASRDFGKLVHPPNPAAVLYPSSIEDIASLV  85

Query  1612  RFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGALRG---GGKIRVSWSESLGYFAD  1442
             +F YN   PFS+AARG GHS+RGQA A  GVVVEM +L     G  IRV+ +   G +AD
Sbjct  86    KFXYNRSXPFSIAARGQGHSLRGQAMAXHGVVVEMRSLNNCSXGSGIRVTKNPIWGSYAD  145

Query  1441  VGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDV  1262
             VGG + W+DVL A L HG++P SWTDYL+LT+GGTLSNAGISGQ FR GPQISNV E+DV
Sbjct  146   VGGEQQWIDVLQATLKHGLAPVSWTDYLYLTIGGTLSNAGISGQTFRHGPQISNVYEMDV  205

Query  1261  ITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFT  1082
             +TGKGE +TCSKD NSELFFAVLGGLGQFGII RARI L+ AP RVKW++MLYDDFS F+
Sbjct  206   LTGKGELVTCSKDTNSELFFAVLGGLGQFGIIIRARIALKPAPKRVKWIQMLYDDFSTFS  265

Query  1081  RDQEHLISINGLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKH  902
             RDQEHLISINGL+YLEGSL+M ++SPNNWRSS FS S+  +I+SL+++ G++YCLEVVK+
Sbjct  266   RDQEHLISINGLDYLEGSLLMQNSSPNNWRSS-FSPSEYPRISSLISKNGIIYCLEVVKY  324

Query  901   YDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPW  722
             YD+ T  TVD+EL++LLK L+F+PG  F KD S  +FLNRV  EEL  +  GLW+  HPW
Sbjct  325   YDELTSHTVDEELQELLKGLNFLPGFVFTKDVSLVDFLNRVHSEELNLRAKGLWDVPHPW  384

Query  721   LNLFVPKSRILDFNSAVFQNILLK-HKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVG  545
             LNLFVP SRI DFNS VF++IL K ++T+G  LVYP     WD+R SAVIP+ED FY VG
Sbjct  385   LNLFVPGSRISDFNSGVFRDILPKINQTTGTFLVYPVIRNKWDDRTSAVIPDEDIFYTVG  444

Query  544   LLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQE  365
             LL+S G + W+ L+  N+EIL FC   D+ G KIK+YL  Y +++DWM HFG KW TF++
Sbjct  445   LLHSSGADDWEPLENQNKEILKFC---DKAGIKIKRYLSRYTTKKDWMNHFGPKWRTFED  501

Query  364   NKAKFDPKMILSPGQTIFN  308
              KA+FDPKMILSPGQ IFN
Sbjct  502   RKAQFDPKMILSPGQQIFN  520



>ref|XP_011077990.1| PREDICTED: cytokinin dehydrogenase 3-like isoform X1 [Sesamum 
indicum]
Length=528

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/500 (65%), Positives = 385/500 (77%), Gaps = 17/500 (3%)
 Frame = -1

Query  1783  PWNSS-LPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRF  1607
             PW SS LP    S D+  R R D  A TAAS D+G +V E PA VLYPSS+ +I++L++ 
Sbjct  28    PWTSSALP----SCDLPIRLRTDPDAVTAASNDYGNLVHEAPAAVLYPSSIQEIVDLIKL  83

Query  1606  SYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGAL-RGGGKIRVSWSESLGYFADVGGH  1430
             S N  +PF+VAARG GHSVRGQA A  GVVVEM AL R GG IRVSWS SLGY+ADVGG 
Sbjct  84    SNNCSTPFTVAARGRGHSVRGQAMAGGGVVVEMAALSRNGGGIRVSWSPSLGYYADVGGE  143

Query  1429  ELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGK  1250
             E+W DVL   L HG++P SWTDYL+LTVGGTLSNAGISGQ FR GPQISNVLELDVITGK
Sbjct  144   EMWADVLRVGLEHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRHGPQISNVLELDVITGK  203

Query  1249  GEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQE  1070
             G+F+TCSKDMNS+LFFAVLGGLGQFGIITRARIVL+KAPTR KWVR++Y+DF+ FTRDQE
Sbjct  204   GDFLTCSKDMNSDLFFAVLGGLGQFGIITRARIVLQKAPTRAKWVRLIYNDFTMFTRDQE  263

Query  1069  HLIS--INGLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLL-TQQGLLYCLEVVKHY  899
             HLIS  ING NY+EGSL+ + + PNNWRSSF+S SDQSKI SLL ++QGLLY +EVVK+Y
Sbjct  264   HLISTNINGPNYVEGSLITDQSPPNNWRSSFYSPSDQSKILSLLRSKQGLLYSIEVVKYY  323

Query  898   DDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRV---RGEELEPQENGLWEATH  728
              D    T+DQE+K L+KDL+F+PG  F KD S  +FL RV   R +E E   +   E TH
Sbjct  324   HDTNIDTIDQEVKLLVKDLNFIPGFVFNKDVSLVDFLTRVGSGRDKEEEKSSDRELE-TH  382

Query  727   PWLNLFVPKSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIPEEDTFYC  551
             PWLNLF+PKS I+DFN AVF N++ +H  TSGP+L YP   + WD+RMSAV P+ED FY 
Sbjct  383   PWLNLFLPKSSIMDFNDAVFVNVIRRHNHTSGPILFYPFNRQKWDDRMSAVTPDEDIFYT  442

Query  550   VGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTF  371
             +GLL++   +   V D LN EIL  C K D +   +KQYLPHY S+EDWMKHFG KW+TF
Sbjct  443   LGLLHTSRPHQSDVYDNLNSEILDCCEKADID---VKQYLPHYISKEDWMKHFGPKWDTF  499

Query  370   QENKAKFDPKMILSPGQTIF  311
             QE K KFDP+MILSPGQ IF
Sbjct  500   QERKTKFDPRMILSPGQRIF  519



>emb|CAN77185.1| hypothetical protein VITISV_039458 [Vitis vinifera]
Length=522

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/499 (64%), Positives = 383/499 (77%), Gaps = 9/499 (2%)
 Frame = -1

Query  1789  LKPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQE-TPAGVLYPSSVDDIINLV  1613
             L+ W   LPYE+ S+DIA R RVD  AT  AS DFG +V    PA VLYPSS++DI +LV
Sbjct  26    LRRWPDVLPYELQSLDIASRLRVDPDATRMASXDFGRLVHPPNPAAVLYPSSIEDIASLV  85

Query  1612  RFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGALRG---GGKIRVSWSESLGYFAD  1442
             +FSYN  SPFS+AARG GHS+RGQA A  GVVVEM +L     G  IRV+ +   G +AD
Sbjct  86    KFSYNRSSPFSIAARGQGHSLRGQAMASHGVVVEMRSLNNCSCGSGIRVTKNPIWGSYAD  145

Query  1441  VGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDV  1262
             VGG + W+DVL A L HG++P SWTDYL+LT+GGTLSNAGISGQ FR GPQISNV E+DV
Sbjct  146   VGGEQQWIDVLQATLKHGLAPVSWTDYLYLTIGGTLSNAGISGQTFRHGPQISNVYEMDV  205

Query  1261  ITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFT  1082
             +TGKGE +TCSKD NSELFFAVLGGLGQFGIITRARI LE AP RVKW++MLYDDFS F+
Sbjct  206   LTGKGELVTCSKDTNSELFFAVLGGLGQFGIITRARIALEPAPERVKWIQMLYDDFSTFS  265

Query  1081  RDQEHLISINGLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKH  902
             RDQEHLISINGL+YLEGSL M ++ PNNWRSS FS S+  +I+SL+++ G++YCLEVVK+
Sbjct  266   RDQEHLISINGLDYLEGSLXMQNSXPNNWRSS-FSPSEYPRISSLISKNGIIYCLEVVKY  324

Query  901   YDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPW  722
             YD+ T  TVD+EL++LLK L+F+PG  F KD S  +FLNRV  EEL  +  GLW+  HPW
Sbjct  325   YDELTSHTVDEELQELLKGLNFLPGFVFTKDVSLVDFLNRVHSEELNLRAKGLWDVPHPW  384

Query  721   LNLFVPKSRILDFNSAVFQNILLK-HKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVG  545
             LNLFVP SRI DFNS VF++IL K ++T+G  LVYP     WD+R SAVIP+ED FY VG
Sbjct  385   LNLFVPGSRISDFNSGVFRDILPKINQTTGTFLVYPVIRNKWDDRTSAVIPDEDIFYTVG  444

Query  544   LLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQE  365
              L+S G + W+ L+  N+EIL FC   D+ G KIK+YL  Y ++ DWM HFG KW TF++
Sbjct  445   XLHSSGADDWEPLENQNKEILKFC---DKAGIKIKRYLSRYTTKXDWMNHFGPKWXTFED  501

Query  364   NKAKFDPKMILSPGQTIFN  308
              KA+FDPKMILSPGQ IFN
Sbjct  502   RKAQFDPKMILSPGQQIFN  520



>ref|XP_011093737.1| PREDICTED: cytokinin dehydrogenase 3 [Sesamum indicum]
Length=529

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/506 (64%), Positives = 389/506 (77%), Gaps = 15/506 (3%)
 Frame = -1

Query  1807  MSILGKLKPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDD  1628
             M  LGK   + S LP +I+S+D+A R R D  +   AS D+G +V E+P+ VLYPSS+DD
Sbjct  23    MCSLGK---FTSPLPNDIVSLDLATRLRNDPHSINIASNDYGNLVHESPSAVLYPSSIDD  79

Query  1627  IINLVRFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGAL-RGGGKIRVSWSESLGY  1451
             I+NL++FS N  +PF ++ARG GHSVRGQA A+ GVVV+M +L + G  +RVSW  SLGY
Sbjct  80    IVNLIKFSNNCSTPFGISARGRGHSVRGQAMARSGVVVDMPSLSQNGIGVRVSWDPSLGY  139

Query  1450  FADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLE  1271
             +ADVGG ++W+DVL A L HG++P SWTDYL+L+VGGTLSNAGISGQ F  GPQISNVLE
Sbjct  140   YADVGGEQMWIDVLRAGLEHGLAPVSWTDYLYLSVGGTLSNAGISGQSFLHGPQISNVLE  199

Query  1270  LDVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFS  1091
             LDVITGKG+ +TCS+ MNSELFFAVLGGLGQFGIITRARIVL+KAPTR KWVR+LY DFS
Sbjct  200   LDVITGKGDLVTCSQQMNSELFFAVLGGLGQFGIITRARIVLDKAPTRAKWVRLLYSDFS  259

Query  1090  KFTRDQEHLISINGLN----YLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLL-TQQGLL  926
              FTRDQEHLIS    N    Y+EGSL+ + + PNNWRSSF++ SD+SKIASLL +++GLL
Sbjct  260   IFTRDQEHLISSTVDNPSPDYVEGSLITHQSPPNNWRSSFYTPSDRSKIASLLKSKKGLL  319

Query  925   YCLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENG  746
             Y +E+VK+YDDQT   +DQEL+ LLKDL+F+PG  FKKD +  +FL RV G      EN 
Sbjct  320   YSIELVKYYDDQTADYIDQELEVLLKDLNFIPGFVFKKDVALIDFLGRV-GRSAASDENN  378

Query  745   LWEATHPWLNLFVPKSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIPE  569
               EA HPWLNLFVPKSRILDFN+ VF +I+ +H  TSGP+L YP   K WDERMSAV P+
Sbjct  379   HLEA-HPWLNLFVPKSRILDFNAGVFVDIIGRHNSTSGPILFYPLNRKKWDERMSAVTPD  437

Query  568   EDTFYCVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFG  389
             ED FY +GLL S G       D+LN EI+ FC KD   G KIKQYLPHY+S EDWM+H+G
Sbjct  438   EDVFYTLGLLQSSGAEEPGEYDKLNNEIIEFCEKD---GIKIKQYLPHYKSEEDWMEHYG  494

Query  388   KKWNTFQENKAKFDPKMILSPGQTIF  311
              KWNTF E K KFDP+MILSPGQ IF
Sbjct  495   PKWNTFLERKNKFDPRMILSPGQRIF  520



>ref|XP_011009888.1| PREDICTED: cytokinin dehydrogenase 3 [Populus euphratica]
Length=529

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/509 (61%), Positives = 378/509 (74%), Gaps = 13/509 (3%)
 Frame = -1

Query  1804  SILGKLKPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDI  1625
             S LGK KPW   LP +I ++D A    V+     + S+D+G IV E PA VLYPSS++DI
Sbjct  22    STLGKSKPWTGFLPPQIQTLDFARHLHVEPDTIKSVSSDYGNIVHEKPAAVLYPSSIEDI  81

Query  1624  INLVRFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGALRG---GGKIRVSWSESLG  1454
             ++L++FSYN+ +PF+VAARGHGHSV GQA A +GVVV+M +LR    G  I VS   SLG
Sbjct  82    MSLIKFSYNNYTPFTVAARGHGHSVGGQAMASNGVVVDMMSLRNHKNGTGITVSKCPSLG  141

Query  1453  YFADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVL  1274
             ++ADVGG +LW+DVLH+ + HG +P SWTDYL+L+VGGTLSNAGISG  F+ GPQISNV 
Sbjct  142   FYADVGGEQLWIDVLHSTMEHGFAPVSWTDYLYLSVGGTLSNAGISGTTFQYGPQISNVY  201

Query  1273  ELDVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDF  1094
             E+DV+TGKGE +TCS   NSELF+AVLGGLGQFGIITRARI LE AP RVKWVRMLY DF
Sbjct  202   EMDVVTGKGELVTCSSHTNSELFYAVLGGLGQFGIITRARIALEPAPKRVKWVRMLYSDF  261

Query  1093  SKFTRDQEHLISING------LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQG  932
             S FTRDQE LISING      L+YLEGSL+M    PNNWRSSFF  SD  KI SL+TQ  
Sbjct  262   SAFTRDQELLISINGWKQKNALDYLEGSLLMAQGPPNNWRSSFFPSSDIPKIMSLVTQHA  321

Query  931   LLYCLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQE  752
             ++YCLEV K+YDD T  TVD++L+ L K LSFV G  F+KD S+ +FLNRVR  E +   
Sbjct  322   IIYCLEVAKYYDDGTRHTVDKDLQQLFKGLSFVAGFKFEKDVSFVDFLNRVRSGEQKLHS  381

Query  751   NGLWEATHPWLNLFVPKSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVI  575
              GLW+  HPWLNLF+PKSRILDFN  VF +++LK   T+G +L YP   K WD++MSAVI
Sbjct  382   QGLWDVPHPWLNLFLPKSRILDFNKGVFHDLVLKRNITTGVVLFYPMNRKKWDDKMSAVI  441

Query  574   PEEDTFYCVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKH  395
             PEED FY VG L+S G N W+  D  N++IL FC   D  G +IKQYLPHY S ++W+ H
Sbjct  442   PEEDIFYTVGFLHSSGFNDWQAYDHQNKDILKFC---DRNGIEIKQYLPHYNSNKEWINH  498

Query  394   FGKKWNTFQENKAKFDPKMILSPGQTIFN  308
             FG KW  F+E KA+FDPKM+LSPGQ IFN
Sbjct  499   FGSKWRNFRERKAQFDPKMMLSPGQRIFN  527



>ref|XP_010090055.1| Cytokinin dehydrogenase 3 [Morus notabilis]
 gb|EXB38852.1| Cytokinin dehydrogenase 3 [Morus notabilis]
Length=529

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/509 (62%), Positives = 378/509 (74%), Gaps = 15/509 (3%)
 Frame = -1

Query  1798  LGKLKPWNSSLPYEILSVDIAG--RFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDI  1625
             LGK KPW SS+   ILS    G  + R D  A   ASTDFG IV+E P  VL PSS +DI
Sbjct  24    LGKSKPWISSVIPPILSTKDIGLHKLRGDPEAIKLASTDFGHIVREIPLAVLDPSSTNDI  83

Query  1624  INLVRFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGAL---RGGGKIRVSWSESLG  1454
             + L++ + +   PF +AARGHGHSV GQA A++GVVV M AL   R G  I VS   SLG
Sbjct  84    VGLIKSANDLSVPFKIAARGHGHSVHGQAMAQNGVVVNMAALKTYRSGTGIVVSGDPSLG  143

Query  1453  YFADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVL  1274
             Y+ADVGG +LW+DVLHA L HG +P SWTDYL+LTVGGTLSNAGISGQ FR GPQISNV 
Sbjct  144   YYADVGGEQLWIDVLHATLEHGFAPVSWTDYLYLTVGGTLSNAGISGQTFRYGPQISNVY  203

Query  1273  ELDVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDF  1094
             ELDVITGKGEF+TCS   NSELF+A LGGLGQFGII RARI LE AP RVKWVRMLY DF
Sbjct  204   ELDVITGKGEFVTCSVHKNSELFYAALGGLGQFGIIVRARIALEPAPKRVKWVRMLYSDF  263

Query  1093  SKFTRDQEHLISING------LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQG  932
             S F+RDQE LI ING      L+YLEGSL+MN  SPNNWRSSFF  SD S+I S +T+  
Sbjct  264   SAFSRDQERLIKINGRKDKNALDYLEGSLLMNQGSPNNWRSSFFPRSDHSRIISKVTEHK  323

Query  931   LLYCLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQE  752
             ++YCLEV K YDD++ +TVD+ L+ LL+ LSF PG  F+KD +Y +F++RVRG EL+ Q 
Sbjct  324   IIYCLEVAKLYDDRSKTTVDKVLQVLLQGLSFEPGFMFEKDVAYVDFVDRVRGGELKLQS  383

Query  751   NGLWEATHPWLNLFVPKSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVI  575
              GLWE  HPWLNLF+PKSR+ DFN+ VF+ I+LK   T+GP+L+YP     WD+R SAVI
Sbjct  384   QGLWEVPHPWLNLFIPKSRVSDFNAGVFREIVLKRNITTGPVLLYPMNRNKWDDRTSAVI  443

Query  574   PEEDTFYCVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKH  395
             P+ED FY VG L+S G + W+  D+ N++IL FC   ++ G ++KQYLPHY+++EDWMKH
Sbjct  444   PDEDVFYTVGFLHSSGFDDWESFDQQNKDILQFC---EDVGIEVKQYLPHYKTQEDWMKH  500

Query  394   FGKKWNTFQENKAKFDPKMILSPGQTIFN  308
             FG KW TF E K+ FDPK ILSPGQ IFN
Sbjct  501   FGSKWRTFNERKSMFDPKKILSPGQRIFN  529



>ref|XP_002308300.2| Cytokinin dehydrogenase 3 precursor family protein [Populus trichocarpa]
 gb|EEE91823.2| Cytokinin dehydrogenase 3 precursor family protein [Populus trichocarpa]
Length=529

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/509 (61%), Positives = 377/509 (74%), Gaps = 13/509 (3%)
 Frame = -1

Query  1804  SILGKLKPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDI  1625
             S LGK K W   LP +I ++D A    V+  A  + S+D+G IV E PA VLYPSS++DI
Sbjct  22    STLGKSKSWTGLLPPQIQTLDFARHLHVEPDAIKSVSSDYGNIVHENPAAVLYPSSIEDI  81

Query  1624  INLVRFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGALRG---GGKIRVSWSESLG  1454
              +L++FSYN+ +PF+VAARGHGHSV GQA A +GVVV+M +LR    G  I VS   SLG
Sbjct  82    TSLIKFSYNNYTPFTVAARGHGHSVGGQAMASNGVVVDMTSLRNHKNGTGITVSKCPSLG  141

Query  1453  YFADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVL  1274
             ++ADVGG +LW+DVLH+ + HG +P SWTDYL+L+VGGTLSNAGISG  FR GPQISNV 
Sbjct  142   FYADVGGEQLWIDVLHSTMEHGFAPVSWTDYLYLSVGGTLSNAGISGTTFRYGPQISNVY  201

Query  1273  ELDVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDF  1094
             E+DV+TGKGE +TCS   NSELF+AVLGGLGQFGIITRARI LE AP RVKWVR+LY DF
Sbjct  202   EMDVVTGKGELVTCSSHTNSELFYAVLGGLGQFGIITRARIALEPAPKRVKWVRILYSDF  261

Query  1093  SKFTRDQEHLISING------LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQG  932
             S FTRDQE LISING      L+YLEGSL+M    PNNWRSSFF  SD  KI SL+TQ  
Sbjct  262   SAFTRDQERLISINGRKQKNALDYLEGSLLMAQGPPNNWRSSFFPSSDIPKIMSLVTQHA  321

Query  931   LLYCLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQE  752
             ++YCLEV K+YDD T   VD++L+ LLK LSFV G  F+KD S+ +FLNRVR  E +   
Sbjct  322   IIYCLEVAKYYDDGTRHIVDKDLQQLLKGLSFVAGFMFEKDVSFVDFLNRVRSGEQKLHS  381

Query  751   NGLWEATHPWLNLFVPKSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVI  575
              GLW+  HPWLNLF+PKSRIL+FN  VF +++LK   T+G +L YP   K WD++MSAVI
Sbjct  382   QGLWDVPHPWLNLFLPKSRILEFNKGVFHDLVLKRNITTGVVLFYPMNRKKWDDKMSAVI  441

Query  574   PEEDTFYCVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKH  395
             PEED FY VG L+S G N W+  D  N++IL FC   D+ G +IKQYLP Y S ++W+ H
Sbjct  442   PEEDIFYTVGFLHSSGFNDWQAYDHQNKDILKFC---DKAGIEIKQYLPLYNSNKEWINH  498

Query  394   FGKKWNTFQENKAKFDPKMILSPGQTIFN  308
             FG KW  F+E KA+FDPKM+LSPGQ IFN
Sbjct  499   FGSKWRNFRERKAQFDPKMMLSPGQRIFN  527



>gb|KDO49370.1| hypothetical protein CISIN_1g009793mg [Citrus sinensis]
Length=525

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/507 (61%), Positives = 379/507 (75%), Gaps = 17/507 (3%)
 Frame = -1

Query  1798  LGKLKPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIIN  1619
             +G  KP N  +P+++L++DI  R  +D  A  +AS+D+G I +E P  VLYPSS +DI+ 
Sbjct  24    IGNSKPSNILVPHKLLTLDIGARLHLDPAAIKSASSDYGNIFKENPVAVLYPSSTEDIVA  83

Query  1618  LVRFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGAL---RGGGKIRVSWSESLGYF  1448
             LV+ +YNS  PF +AA+G GHSVRGQA A  GVVVEM AL   R G  I V      G++
Sbjct  84    LVKAAYNSSVPFKIAAKGRGHSVRGQAMADGGVVVEMMALKNYRNGNGITVG----SGFY  139

Query  1447  ADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLEL  1268
             ADV G +LW+DVL+A L HG++PASWTDYL+LTVGGTLSNAGISGQ FR GPQISNV EL
Sbjct  140   ADVAGEQLWIDVLNATLEHGLAPASWTDYLYLTVGGTLSNAGISGQTFRYGPQISNVYEL  199

Query  1267  DVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSK  1088
             DV+TGKGE +TCS   NSELF+A LGGLGQFGIITRARI LE AP RVKWVRMLY DFS 
Sbjct  200   DVVTGKGELMTCSALKNSELFYAALGGLGQFGIITRARIALEPAPKRVKWVRMLYSDFSS  259

Query  1087  FTRDQEHLISING------LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLL  926
             F+RDQE+LIS+NG      L+YLEG+L+M+  S +NWRSSFF  SD  KI S +    ++
Sbjct  260   FSRDQEYLISMNGRRQKQALDYLEGTLIMDQGSLDNWRSSFFPPSDHPKIISQVKTHAII  319

Query  925   YCLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENG  746
             YCLEV K+YDD T ST+ +EL+ L K LS++PG  F+KD SY EFLNRVR  EL+ +  G
Sbjct  320   YCLEVAKYYDDHTQSTLHKELQTLFKGLSYLPGFMFEKDVSYVEFLNRVRSGELKLESQG  379

Query  745   LWEATHPWLNLFVPKSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIPE  569
             LWE  HPWLNLF+PKSRI DFN  VF++I+LK   T+GP+LVYP     WD+RMSAVIP+
Sbjct  380   LWEVPHPWLNLFLPKSRISDFNKGVFRDIVLKRNITTGPVLVYPMNRNKWDDRMSAVIPD  439

Query  568   EDTFYCVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFG  389
             ED FY VG L+S G + W+  D+ N+EIL FC   +  G K+KQYLP++R++E+W+KHFG
Sbjct  440   EDVFYTVGFLHSSGFDEWEAFDDQNKEILKFC---ENAGIKVKQYLPYHRNKEEWIKHFG  496

Query  388   KKWNTFQENKAKFDPKMILSPGQTIFN  308
              KWNTF + KA FDPKMILSPGQ IFN
Sbjct  497   SKWNTFAQRKAHFDPKMILSPGQRIFN  523



>ref|XP_006475463.1| PREDICTED: cytokinin dehydrogenase 3-like [Citrus sinensis]
Length=525

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/507 (61%), Positives = 379/507 (75%), Gaps = 17/507 (3%)
 Frame = -1

Query  1798  LGKLKPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIIN  1619
             +G  KP N  +P+++L++DI  R  +D  A  +AS+D+G I +E P  VLYP+S +DI+ 
Sbjct  24    IGNSKPSNILVPHKLLTLDIGARLHLDPAAIKSASSDYGNIFKENPVAVLYPTSTEDIVA  83

Query  1618  LVRFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGAL---RGGGKIRVSWSESLGYF  1448
             LV+ +YNS  PF +AA+G GHSVRGQA A  GVVVEM AL   R G  I V      G++
Sbjct  84    LVKAAYNSSVPFKIAAKGRGHSVRGQAMADGGVVVEMMALKNYRNGNGITVG----SGFY  139

Query  1447  ADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLEL  1268
             ADV G +LW+DVL+A L HG++PASWTDYL+LTVGGTLSNAGISGQ FR GPQISNV EL
Sbjct  140   ADVAGEQLWIDVLNATLEHGLAPASWTDYLYLTVGGTLSNAGISGQTFRYGPQISNVYEL  199

Query  1267  DVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSK  1088
             DVITGKGE +TCS   NSELF+A LGGLGQFGIITRARI LE AP RVKWVRMLY DFS 
Sbjct  200   DVITGKGELMTCSALKNSELFYAALGGLGQFGIITRARIALEPAPKRVKWVRMLYSDFSS  259

Query  1087  FTRDQEHLISING------LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLL  926
             F+RDQE+LIS+NG      L+YLEG+L+M+  S +NWRSSFF  SD  KI S +    ++
Sbjct  260   FSRDQEYLISMNGRRQKQALDYLEGTLIMDQGSLDNWRSSFFPPSDHPKIISQVKTHAII  319

Query  925   YCLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENG  746
             YCLEV K+YDD T ST+ +EL+ L K LS++PG  F+KD SY EFLNRVR  EL+ +  G
Sbjct  320   YCLEVAKYYDDHTQSTLHKELQTLFKGLSYLPGFMFEKDVSYVEFLNRVRSGELKLESQG  379

Query  745   LWEATHPWLNLFVPKSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIPE  569
             LWE  HPWLNLF+PKSRI DFN  VF++I+LK   T+GP+LVYP     WD+RMSAVIP+
Sbjct  380   LWEVPHPWLNLFLPKSRISDFNKGVFRDIVLKRNITTGPVLVYPMNRNKWDDRMSAVIPD  439

Query  568   EDTFYCVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFG  389
             ED FY VG L+S G + W+  D+ N+EIL FC   +  G K+KQYLP++R++E+W+KHFG
Sbjct  440   EDVFYTVGFLHSSGFDEWEAFDDQNKEILKFC---ENAGIKVKQYLPYHRNKEEWIKHFG  496

Query  388   KKWNTFQENKAKFDPKMILSPGQTIFN  308
              KWNTF + KA FDPKMILSPGQ IFN
Sbjct  497   SKWNTFAQRKAHFDPKMILSPGQRIFN  523



>ref|XP_006451484.1| hypothetical protein CICLE_v10007992mg [Citrus clementina]
 gb|ESR64724.1| hypothetical protein CICLE_v10007992mg [Citrus clementina]
Length=525

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/507 (61%), Positives = 379/507 (75%), Gaps = 17/507 (3%)
 Frame = -1

Query  1798  LGKLKPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIIN  1619
             +G  KP N  +P+++L++DI  R  +D  A  +AS+D+G I +E P  VLYP+S +DI+ 
Sbjct  24    IGNSKPSNILVPHKLLTLDIGARLHLDPAAIKSASSDYGNIFKENPVAVLYPTSTEDIVA  83

Query  1618  LVRFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGAL---RGGGKIRVSWSESLGYF  1448
             LV+ +YNS  PF +AA+G GHSVRGQA A  GVVVEM AL   R G  I V      G++
Sbjct  84    LVKAAYNSSVPFKIAAKGRGHSVRGQAMADGGVVVEMMALKNYRNGNGITVG----SGFY  139

Query  1447  ADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLEL  1268
             ADV G +LW+DVL+A L HG++PASWTDYL+LTVGGTLSNAGISGQ FR GPQISNV EL
Sbjct  140   ADVAGEQLWIDVLNATLEHGLAPASWTDYLYLTVGGTLSNAGISGQTFRYGPQISNVYEL  199

Query  1267  DVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSK  1088
             DVI+GKGE +TCS   NSELF+A LGGLGQFGIITRARI LE AP RVKWVRMLY DFS 
Sbjct  200   DVISGKGELMTCSALKNSELFYAALGGLGQFGIITRARIALEPAPKRVKWVRMLYSDFSS  259

Query  1087  FTRDQEHLISING------LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLL  926
             F+RDQE+LIS+NG      L+YLEG+L+M+  S +NWRSSFF  SD  KI S +    ++
Sbjct  260   FSRDQEYLISMNGRRQKQALDYLEGTLIMDQGSLDNWRSSFFPPSDHPKIISQVKTHAII  319

Query  925   YCLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENG  746
             YCLEV K+YDD T ST+ +EL+ L K LS++PG  F+KD SY EFLNRVR  EL+ +  G
Sbjct  320   YCLEVAKYYDDHTQSTLHKELQTLFKGLSYLPGFMFEKDVSYVEFLNRVRSGELKLESQG  379

Query  745   LWEATHPWLNLFVPKSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIPE  569
             LWE  HPWLNLF+PKSRI DFN  VF++I+LK   T+GP+LVYP     WD+RMSAVIP+
Sbjct  380   LWEVPHPWLNLFLPKSRISDFNKGVFRDIVLKRNITTGPVLVYPMNRNKWDDRMSAVIPD  439

Query  568   EDTFYCVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFG  389
             ED FY VG L+S G + W+  D+ N+EIL FC   +  G K+KQYLP++R++E+W+KHFG
Sbjct  440   EDVFYTVGFLHSSGFDEWEAFDDQNKEILKFC---ENAGIKVKQYLPYHRNKEEWIKHFG  496

Query  388   KKWNTFQENKAKFDPKMILSPGQTIFN  308
              KWNTF + KA FDPKMILSPGQ IFN
Sbjct  497   SKWNTFAQRKAHFDPKMILSPGQRIFN  523



>ref|XP_010262099.1| PREDICTED: cytokinin dehydrogenase 3-like [Nelumbo nucifera]
Length=529

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/509 (64%), Positives = 390/509 (77%), Gaps = 13/509 (3%)
 Frame = -1

Query  1807  MSILGKLKPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDD  1628
             MSI+GK +PW S LP E+LS+D+A R  +D  A + ASTDFG + +  PA VLYP S DD
Sbjct  22    MSIIGKRRPWTSLLPPELLSLDLATRLHIDPAAISLASTDFGKLTRVIPAAVLYPLSPDD  81

Query  1627  IINLVRFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGALRG---GGKIRVSWSESL  1457
             I+ L+RFS++S  PFS+AARG GHSVRGQA A +GVVV+M +L     G +I V+ S SL
Sbjct  82    IVALIRFSFSSSVPFSIAARGRGHSVRGQAMAHNGVVVDMRSLNNDSNGNRINVARSSSL  141

Query  1456  GYFADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNV  1277
             G++ADVGG +LW+DVL A L HG++P SWTDYL+LTVGGTLSNAGISGQ FR GPQISNV
Sbjct  142   GWYADVGGEQLWIDVLLATLEHGLAPRSWTDYLYLTVGGTLSNAGISGQSFRHGPQISNV  201

Query  1276  LELDVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDD  1097
              E+DVITG+GE + CS++ NSELF+AVLGGLGQFGIITRARI LE APT+V+WVRMLY D
Sbjct  202   FEMDVITGRGELVRCSRNTNSELFYAVLGGLGQFGIITRARIALELAPTKVRWVRMLYHD  261

Query  1096  FSKFTRDQEHLISIN----GLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGL  929
             FS FTRDQEHLISI+    GL+Y+EGSL+M  +  NNWRSSFFS +D S+IASL  Q G+
Sbjct  262   FSAFTRDQEHLISIHGGIKGLDYVEGSLVMPQSPANNWRSSFFSSADHSRIASLANQYGI  321

Query  928   LYCLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQEN  749
             LY LEV K+YDD T   VD EL+ LLK LSF+PG+ F KD SY +FLNRVR  EL+ Q  
Sbjct  322   LYSLEVAKYYDDLTADGVDGELESLLKGLSFIPGLIFAKDVSYVDFLNRVRSGELKLQSQ  381

Query  748   GLWEATHPWLNLFVPKSRILDFNSAVFQNILLK-HKTSGPMLVYPTTTKMWDERMSAVIP  572
             GLW+  HPWLNLFVP+SRI DF+S VF+ IL K +KTSGP+LVYP     WD+RMSAVIP
Sbjct  382   GLWDVPHPWLNLFVPRSRIFDFDSGVFRGILKKQNKTSGPILVYPMNRSKWDDRMSAVIP  441

Query  571   E--EDTFYCVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMK  398
             +  +D FY VGLL S GM+ W+ L+  N+EIL FC K    G K+KQYLPHYRS+ +W+ 
Sbjct  442   DDVDDIFYSVGLLQSSGMHDWEYLENQNKEILMFCEK---AGIKVKQYLPHYRSKAEWVN  498

Query  397   HFGKKWNTFQENKAKFDPKMILSPGQTIF  311
             H G KW TF+  K KFDPK ILSPGQ IF
Sbjct  499   HLGPKWETFKAWKNKFDPKAILSPGQRIF  527



>gb|EYU37164.1| hypothetical protein MIMGU_mgv1a004294mg [Erythranthe guttata]
Length=534

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/499 (62%), Positives = 383/499 (77%), Gaps = 18/499 (4%)
 Frame = -1

Query  1771  SLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSP  1592
             ++P EI+S   + + R D  + T AS D+G +VQE P  VLYPSSVDD+INLV+FS N  
Sbjct  34    TIPNEIIS---SSKLRKDPASITTASNDYGNLVQEPPPLVLYPSSVDDVINLVKFSNNIS  90

Query  1591  SPFSVAARGHGHSVRGQATAKDGVVVEMGALRGGGK-----IRVSWSESLG-YFADVGGH  1430
             +PF+VAARG GHSVRGQATA  GVVVEM +L  G +     IRVSW  SLG Y+ADVGG 
Sbjct  91    APFTVAARGRGHSVRGQATAAGGVVVEMSSLSSGDQVSNDGIRVSWDSSLGCYYADVGGE  150

Query  1429  ELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGK  1250
             ++W DVL A L +G++P SWTDYL+LTVGGTLSN GISGQ F  GPQISNVLELDVITGK
Sbjct  151   KMWADVLRAGLEYGLAPVSWTDYLYLTVGGTLSNGGISGQSFLHGPQISNVLELDVITGK  210

Query  1249  GEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQE  1070
             G+F+TCSKD+N ELFFAVLGGLGQFGIITRARIVLEKAPTRVKW+R++Y DF+ FTRDQE
Sbjct  211   GDFVTCSKDVNPELFFAVLGGLGQFGIITRARIVLEKAPTRVKWLRLIYSDFTIFTRDQE  270

Query  1069  HLISINGLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLL-TQQGLLYCLEVVKHYDD  893
             HLIS +  +Y+EGSL+ + + PNNWRSSF+S S  SKI SLL T+QGLLY +EVVK+YD+
Sbjct  271   HLISSSVPDYVEGSLITDKSPPNNWRSSFYSPSHYSKIISLLNTKQGLLYSIEVVKYYDE  330

Query  892   QTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEE---LEPQENGLWEAT-HP  725
             QT  +VDQE++ L+ +LS+  G  FKKD    +FL RV   +   +  + +    A+ HP
Sbjct  331   QTADSVDQEIEVLMNELSYTRGFIFKKDVGLIDFLGRVENTDNNNIHQKSSAKAAASVHP  390

Query  724   WLNLFVPKSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIPEEDTFYCV  548
             WLNLFVPKSRILDFN+ VF +I+ +H  +SGP+L YP     WDERMSAVIP+E+ FY +
Sbjct  391   WLNLFVPKSRILDFNAGVFVDIIARHNHSSGPILFYPFHRIKWDERMSAVIPDEEIFYTL  450

Query  547   GLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQ  368
             GLL+S G +   + +ELN+EI+ FC   +E    IKQYLPHY+S+EDWMKHFG+KWNTFQ
Sbjct  451   GLLHSCGAHEAGIYEELNKEIIRFC---EENEINIKQYLPHYKSKEDWMKHFGRKWNTFQ  507

Query  367   ENKAKFDPKMILSPGQTIF  311
             E K KFDP++ILSPGQ IF
Sbjct  508   ELKTKFDPRLILSPGQRIF  526



>ref|XP_010242231.1| PREDICTED: cytokinin dehydrogenase 3 isoform X1 [Nelumbo nucifera]
Length=529

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/514 (62%), Positives = 382/514 (74%), Gaps = 22/514 (4%)
 Frame = -1

Query  1807  MSILGKLKPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDD  1628
             MSI+GKL+PW S LP E+LS+D+A R  +D   T+ ASTDFG +V+  PA VLYP S+DD
Sbjct  21    MSIIGKLRPWTSLLPPELLSLDLATRLHIDPEITSLASTDFGKLVRVIPAAVLYPLSLDD  80

Query  1627  IINLVRFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGAL----RGGGKIRVSWSES  1460
             I+ L+RFS+ S  PF +AARG GHSVRGQATA  GVVV+M +L      G +I V  S  
Sbjct  81    IVALIRFSFRSSVPFGIAARGRGHSVRGQATAHKGVVVDMRSLDNDHNNGSRIIVDRSSP  140

Query  1459  L--GYFADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQI  1286
                 ++ADVG  +LWVDVLHA L HG++P SWTDYL+LTVGGTLSNAGISGQ FR GPQI
Sbjct  141   SVNNWYADVGCEQLWVDVLHATLEHGLAPRSWTDYLYLTVGGTLSNAGISGQSFRHGPQI  200

Query  1285  SNVLELDVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRML  1106
             SNV E+DV+TG+GE +TCS   NSELF+AVLGGLGQFGIITRARI LE APT+V+WVR+L
Sbjct  201   SNVYEMDVVTGRGELVTCSPQTNSELFYAVLGGLGQFGIITRARIALEPAPTKVRWVRLL  260

Query  1105  YDDFSKFTRDQEHLISIN-------GLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASL  947
             Y DF  FTRDQEHLIS N       GL+Y+EGSL+MN +  NNWRSSFFS  D S+I SL
Sbjct  261   YHDFIAFTRDQEHLISFNNGSEGIKGLDYVEGSLVMNQSPANNWRSSFFSPDDHSRIISL  320

Query  946   LTQQGLLYCLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEE  767
               + G+LY LEV K+YDD+    VD EL+ LLK LSF+P + F KD SY +FLNRVR  E
Sbjct  321   ANEHGILYSLEVAKYYDDE----VDGELEALLKGLSFIPDLIFAKDVSYIDFLNRVRSGE  376

Query  766   LEPQENGLWEATHPWLNLFVPKSRILDFNSAVFQNILLK-HKTSGPMLVYPTTTKMWDER  590
             LE Q  GLW+  HPWLNLFVPKSRILDF+S  F+ IL + +K SGP+LVYP     WD+R
Sbjct  377   LELQSQGLWDVPHPWLNLFVPKSRILDFDSGAFKGILRQNNKISGPILVYPMNRNKWDDR  436

Query  589   MSAVIPEEDTFYCVGLLY-SGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSR  413
             MSAVIPEED FY +GLL  S G + W+ L+E N EIL FC K    G KIKQYLP Y+++
Sbjct  437   MSAVIPEEDIFYSIGLLLQSSGTHDWEHLEEQNTEILRFCEK---AGIKIKQYLPRYQTK  493

Query  412   EDWMKHFGKKWNTFQENKAKFDPKMILSPGQTIF  311
              +W+ HFG KW+TF++ K KFDPK ILSPGQ +F
Sbjct  494   AEWVNHFGPKWDTFKQRKTKFDPKAILSPGQGVF  527



>ref|XP_007154651.1| hypothetical protein PHAVU_003G136400g [Phaseolus vulgaris]
 gb|ESW26645.1| hypothetical protein PHAVU_003G136400g [Phaseolus vulgaris]
Length=535

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/506 (59%), Positives = 367/506 (73%), Gaps = 13/506 (3%)
 Frame = -1

Query  1795  GKLKPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINL  1616
             GK + W   +  ++   +I  +   D      AS+D+G IV E PA V +PSS++DI  L
Sbjct  26    GKTEQWKGLILPDLDFENIFHKLHDDPETIQMASSDYGHIVHELPAAVFHPSSIEDIATL  85

Query  1615  VRFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGALR---GGGKIRVSWSESLGYFA  1445
             ++ SYNS +PF +AARG GHS  GQA A+DGVVV+M  LR    G  I VS    +G++A
Sbjct  86    IKSSYNSLAPFHIAARGQGHSHHGQAMARDGVVVDMATLRKQRNGVSISVSKDPLIGHYA  145

Query  1444  DVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELD  1265
             DVGG +LW+DVLHA L HG++P SWTDYL+LTVGGTLSNAGISGQ FR GPQISNV E+D
Sbjct  146   DVGGEQLWIDVLHASLEHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQISNVHEMD  205

Query  1264  VITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKF  1085
             VITGKGEF+TCS   N ELF AVLGG GQFG+I RARI LE AP RVKWVR+LY DFS F
Sbjct  206   VITGKGEFVTCSTQKNLELFNAVLGGFGQFGVIARARIALETAPKRVKWVRLLYSDFSAF  265

Query  1084  TRDQEHLISING------LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLY  923
             T+DQE LISING      L++LEG L+MN    NNWRSSFF LSD  +IASL+T+ G+LY
Sbjct  266   TKDQERLISINGRKQKNALDFLEGMLLMNQGPINNWRSSFFPLSDHPRIASLITEHGILY  325

Query  922   CLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGL  743
             CLEV K+YDDQT   VD+E+  LL+ L+++PG  ++K+ SY EFLNRVR  EL+ Q  GL
Sbjct  326   CLEVAKYYDDQTEKNVDKEIHVLLQGLAYIPGFYYEKNVSYVEFLNRVRSGELKLQSQGL  385

Query  742   WEATHPWLNLFVPKSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIPEE  566
             WE  HPWLNLF+PKS+ILDFNS VF +I+LK   +SGP+LVYP     WD+RMSA IP+E
Sbjct  386   WEVPHPWLNLFLPKSQILDFNSGVFMDIILKRNISSGPVLVYPMNRNKWDDRMSASIPDE  445

Query  565   DTFYCVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGK  386
             D FY VG L+S G + WK  D  N+EIL FC    + G K+KQYLP++ ++EDW  HFG 
Sbjct  446   DVFYTVGFLHSSGFDSWKAHDAQNREILEFCR---DAGIKVKQYLPNHSTQEDWTNHFGT  502

Query  385   KWNTFQENKAKFDPKMILSPGQTIFN  308
             KW  F E K +FDP+MILSPGQ IF+
Sbjct  503   KWLKFLERKHQFDPRMILSPGQKIFH  528



>gb|AGW52152.1| CKX3 [Populus tomentosa]
Length=529

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/509 (60%), Positives = 367/509 (72%), Gaps = 13/509 (3%)
 Frame = -1

Query  1804  SILGKLKPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDI  1625
             S LGK K W   LP +I ++D A    V+  A  + S+D+G IV E PA VLYPSS++DI
Sbjct  22    STLGKSKSWTGLLPPQIQTLDFARHLHVEPDAIKSVSSDYGIIVHENPAAVLYPSSIEDI  81

Query  1624  INLVRFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGALRG---GGKIRVSWSESLG  1454
              +L++F YN+ +PF+VAAR HGHSV GQA A +GVVV+M +LR    G  I VS   SLG
Sbjct  82    TSLIKFWYNNYTPFTVAARRHGHSVGGQAMASNGVVVDMTSLRNHKNGTGITVSKCPSLG  141

Query  1453  YFADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVL  1274
             ++ADVGG  LW+DVLH+ + HG +P SWTD L+L+VGGTLSNAGISG  FR GPQISNV 
Sbjct  142   FYADVGGELLWIDVLHSTMEHGFAPVSWTDCLYLSVGGTLSNAGISGTTFRYGPQISNVY  201

Query  1273  ELDVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDF  1094
             E+DV+TGKGE +T S   NSELF+AVLGGLGQFGIITRARI LE AP RVKWVR+LY DF
Sbjct  202   EMDVVTGKGELVTYSSHTNSELFYAVLGGLGQFGIITRARIALEPAPNRVKWVRILYSDF  261

Query  1093  SKFTRDQEHLISING------LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQG  932
             S F RDQE LISING      L YLEGSL+M    PNNWRSSFF  SD  KI SL+TQ  
Sbjct  262   SAFRRDQERLISINGRKQKNALAYLEGSLLMAQGPPNNWRSSFFPSSDIPKIMSLVTQHA  321

Query  931   LLYCLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQE  752
             ++YCLEV K+YDD T   VDQ+L+ LLK LSFV G  F+KD S+ +FLNRVR  E +   
Sbjct  322   IIYCLEVAKYYDDGTRHIVDQDLQQLLKGLSFVAGFMFEKDVSFVDFLNRVRSGEQKLHS  381

Query  751   NGLWEATHPWLNLFVPKSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVI  575
              GLW+  HPWLNLF+PKSRIL+FN  VF +++LK   T+G +L YP   K WD++MSAVI
Sbjct  382   QGLWDVPHPWLNLFLPKSRILEFNKGVFHDLVLKRNITTGVVLFYPMNRKKWDDKMSAVI  441

Query  574   PEEDTFYCVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKH  395
             PEE  FY VG L+S G N W+     N++IL FC   D  G +IKQYLP Y S ++W+ H
Sbjct  442   PEEHIFYTVGFLHSSGFNDWQAYGHQNKDILKFC---DTAGIEIKQYLPLYNSNKEWINH  498

Query  394   FGKKWNTFQENKAKFDPKMILSPGQTIFN  308
             FG KW  F+E KA+FDPKM+LSPGQ IFN
Sbjct  499   FGSKWRNFRERKAQFDPKMMLSPGQRIFN  527



>gb|ACM79256.1| cytokinin oxidase/dehydrogenase [Gossypium hirsutum]
 gb|ACT21088.1| cytokinin oxidase/dehydrogenase [Gossypium hirsutum]
Length=526

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/511 (58%), Positives = 382/511 (75%), Gaps = 18/511 (4%)
 Frame = -1

Query  1807  MSILGKLKPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDD  1628
             MSI+   KP +     +I +VD+A +  VD  A  +AS DFGGIV+  P  VL+PS+  D
Sbjct  21    MSIMKISKPLDVHHK-DIRAVDLATKLSVDPSAIESASRDFGGIVKAEPEAVLHPSAPQD  79

Query  1627  IINLVRFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGAL----RGGGKIRVSWSES  1460
             I  L++FSY+S  PF +AA+GHGHS RGQA A++GVVV+M ++    R G  IRVS    
Sbjct  80    IAALIKFSYSSSVPFGIAAKGHGHSARGQAMAENGVVVDMRSMANNRRNGTGIRVSIDR-  138

Query  1459  LGYFADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISN  1280
                +ADVGG +LW+DVL+A L +G++P SWTDYL+LTVGGTLSNAGISGQ FR GPQISN
Sbjct  139   --LYADVGGEQLWIDVLNATLEYGLAPVSWTDYLYLTVGGTLSNAGISGQTFRYGPQISN  196

Query  1279  VLELDVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYD  1100
             VLE+DVITGK +F+TCS  MNSELF+AVLGGLGQFGIITRARI L+ AP  VKWVR+LYD
Sbjct  197   VLEMDVITGKADFLTCSPRMNSELFYAVLGGLGQFGIITRARIPLQPAPKGVKWVRLLYD  256

Query  1099  DFSKFTRDQEHLISING------LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQ  938
             DFS FT+DQE LIS NG      L+YLEGSL+M+  SP+NWRSSFF   D  KI SL+T+
Sbjct  257   DFSSFTKDQELLISKNGRKDKSALDYLEGSLLMDQGSPDNWRSSFFPHKDHPKIISLITK  316

Query  937   QGLLYCLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEP  758
              G++YCLE+VKHYDD+T  TVD+E+K +L+ L+++PG  F KD  Y EFLNRVR  EL+ 
Sbjct  317   HGIIYCLEIVKHYDDRTKHTVDKEMKQVLQGLNYMPGFMFGKDVGYEEFLNRVRSGELKL  376

Query  757   QENGLWEATHPWLNLFVPKSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSA  581
             +  GLW+  HPWLNLF+PKS+I DFN+ VF++I+L+   T+GP+LVYP   +  D+RMSA
Sbjct  377   KSQGLWDVPHPWLNLFIPKSQISDFNNGVFRDIVLERNITTGPVLVYPMNRQKRDDRMSA  436

Query  580   VIPEEDTFYCVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWM  401
             VIP+E+ FY VG L+S G + W+  ++ N++I+ FCNK    G  +KQYLPHY ++E+W+
Sbjct  437   VIPDEEIFYTVGFLHSSGFDTWEAFEDQNKDIMRFCNK---TGILVKQYLPHYSTKEEWV  493

Query  400   KHFGKKWNTFQENKAKFDPKMILSPGQTIFN  308
              HFG KW  FQ  K +FDP+M+LSPGQ IFN
Sbjct  494   HHFGSKWKVFQHRKYQFDPRMLLSPGQRIFN  524



>ref|XP_007138720.1| hypothetical protein PHAVU_009G231700g [Phaseolus vulgaris]
 gb|ESW10714.1| hypothetical protein PHAVU_009G231700g [Phaseolus vulgaris]
Length=539

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/517 (58%), Positives = 372/517 (72%), Gaps = 20/517 (4%)
 Frame = -1

Query  1807  MSILGKLKPWNSSLPYEILSVD--IAGRFRVDSRATTA-ASTDFGGIVQETPAGVLYPSS  1637
             +S +GK   W + LP E+ +VD  +  + R DS A     S D+G + +E P  V +P+S
Sbjct  23    ISTVGKTSQWKAVLPAELAAVDQDVFDKLRGDSEALQGRVSKDYGNMAREVPLAVFHPAS  82

Query  1636  VDDIINLVRFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGALRGGG-----KIRVS  1472
              +DI  L++ SY    PF VAARG GHS RGQA A+ GVVV+M   R  G     K+  +
Sbjct  83    ANDIARLIKASYKGAVPFKVAARGQGHSTRGQAMARGGVVVDMAGFRERGSGVGIKVSNT  142

Query  1471  WSESLGYF--ADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRC  1298
                S+GYF  ADVGG +LW+DVLHA L HG++P SWTDYL+LTVGGTLSNAGISGQ FR 
Sbjct  143   VDPSVGYFHYADVGGEQLWIDVLHATLQHGLAPLSWTDYLYLTVGGTLSNAGISGQTFRY  202

Query  1297  GPQISNVLELDVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKW  1118
             GPQIS V E+DVITGKGE +TCS   NSELF  VLGGLGQFGIITRARI L  AP RVKW
Sbjct  203   GPQISTVREMDVITGKGETVTCSPQTNSELFHGVLGGLGQFGIITRARIALAPAPKRVKW  262

Query  1117  VRMLYDDFSKFTRDQEHLISIN------GLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKI  956
             +R+LY DFS FT+DQE LIS+N      G++Y+EGSL+M+    NNWRSSFF L+D ++I
Sbjct  263   IRLLYKDFSSFTKDQEQLISMNGRKQNIGVDYVEGSLLMHQGPINNWRSSFFPLADHARI  322

Query  955   ASLLTQQGLLYCLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVR  776
              SL+T+  +LYCLEV K+YD Q+ + VD+EL+ LL+ LS++PG  ++KD SY EFLNRVR
Sbjct  323   ISLVTKHSVLYCLEVAKYYDGQSENNVDKELQVLLQGLSYIPGFYYEKDVSYVEFLNRVR  382

Query  775   GEELEPQENGLWEATHPWLNLFVPKSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMW  599
               EL+ Q  GLW+  HPWLNLF+PKS+I+DF+S VF++I+LK   T+GP+LVYP     W
Sbjct  383   SGELKLQSQGLWDVPHPWLNLFIPKSQIMDFDSGVFKDIILKRNITTGPVLVYPMNRNKW  442

Query  598   DERMSAVIPEEDTFYCVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYR  419
             D RMSA IP+ED FY VG L+S G + WK  D  N+EIL FCN   + G KIKQYLPHYR
Sbjct  443   DNRMSASIPDEDIFYTVGFLHSSGFDNWKAYDTQNKEILQFCN---DAGMKIKQYLPHYR  499

Query  418   SREDWMKHFGKKWNTFQENKAKFDPKMILSPGQTIFN  308
             ++EDW  HFG KW +F E K +FDP+MILSPGQ IFN
Sbjct  500   TQEDWTNHFGPKWRSFVERKQQFDPRMILSPGQRIFN  536



>gb|KDP33841.1| hypothetical protein JCGZ_07412 [Jatropha curcas]
Length=531

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/514 (58%), Positives = 376/514 (73%), Gaps = 17/514 (3%)
 Frame = -1

Query  1807  MSILGKLKPWNSSLPYEI-LSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVD  1631
             +S  GK KPW + LP ++ L+VD A R   D  A  +ASTD+G I+ + PA VLYPSSV 
Sbjct  21    ISTAGKSKPWTTFLPPKLFLNVDFAERIHTDPLAIKSASTDYGNIIHQKPAAVLYPSSVQ  80

Query  1630  DIINLVRFSYN-SPSPFSVAARGHGHSVRGQATAKDGVVVEMGALRG---GGKIRVSWSE  1463
             DI++L+ ++YN S  PF+++ARG  HSV GQA A +GVVV+M  LR       + +  S 
Sbjct  81    DILSLITYAYNFSTPPFTISARGRSHSVSGQAMAPNGVVVDMMRLRSYTEKNGVEIFKSP  140

Query  1462  SLGYFADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQIS  1283
             S G++ADVGG +LW+DVL A + HG++P SWTDYL+LTVGGTLSNAGISGQ FR GPQIS
Sbjct  141   SSGFYADVGGEQLWIDVLKATIEHGLAPTSWTDYLYLTVGGTLSNAGISGQTFRYGPQIS  200

Query  1282  NVLELDVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLY  1103
             NV E+DVITG+GE +TCS   NSELFFAVLGGLGQFGIITRARI +E AP RVKWVRMLY
Sbjct  201   NVYEMDVITGRGELVTCSAQKNSELFFAVLGGLGQFGIITRARIAIEPAPKRVKWVRMLY  260

Query  1102  DDFSKFTRDQEHLISING------LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLT  941
              DFS FT+DQEHLIS NG      ++Y+EGSL+M+   PNNWRSSFF  SD  +I SL  
Sbjct  261   SDFSAFTKDQEHLISKNGRKQSNAVDYVEGSLLMDQGPPNNWRSSFFPSSDIPRIMSLFI  320

Query  940   QQGLLYCLEVVKHY--DDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEE  767
             Q  ++YCLE+ K+Y  D  T  +  +EL+ +  +LSF+ G   +KD  Y EFL+RVR  E
Sbjct  321   QHRIIYCLEIAKYYYDDATTQHSAAKELEQMYGELSFIAGFKTEKDVGYVEFLDRVRNGE  380

Query  766   LEPQENGLWEATHPWLNLFVPKSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDER  590
             L+ Q  GLWE  HPWLNLF+PKS I DFNS VF++I+LK   T+GP+LVYP     WD+R
Sbjct  381   LKLQSEGLWEVPHPWLNLFLPKSSISDFNSGVFRDIVLKRNITTGPVLVYPMNRNKWDDR  440

Query  589   MSAVIPEEDTFYCVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSRE  410
              SAVIP+E+ FY VG L+S G + W+  D+ N+EILSFC   D+ G K+KQY P+Y+++E
Sbjct  441   TSAVIPDEEVFYTVGFLHSSGFDDWQRYDDQNKEILSFC---DKAGIKVKQYFPYYKTKE  497

Query  409   DWMKHFGKKWNTFQENKAKFDPKMILSPGQTIFN  308
             +W+KHFG KW +F+E KA FDPKM+LSPGQ IFN
Sbjct  498   EWIKHFGSKWRSFRERKALFDPKMMLSPGQRIFN  531



>dbj|BAM74651.1| cytokinin oxidase/dehydrogenase [Torenia fournieri]
Length=545

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/508 (60%), Positives = 378/508 (74%), Gaps = 25/508 (5%)
 Frame = -1

Query  1768  LPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPS  1589
             LP +I S DIA + + D  + T ASTD G ++ + P+ VLYPSS+DDI+ LV+ S N  S
Sbjct  32    LPNKIQSFDIASKLKNDLESITKASTDHGNLIHDKPSSVLYPSSIDDIVALVKLSNNCSS  91

Query  1588  PFSVAARGHGHSVRGQATAKDGVVVEMGALRGGGK----------------IRVSWSESL  1457
             PF+V+A+G GHSVRGQA ++ GVV++M +L                     IRVSWS SL
Sbjct  92    PFTVSAKGCGHSVRGQAMSRSGVVIDMTSLNKHDHKNNMNNDAKNENYDSGIRVSWSSSL  151

Query  1456  GYFADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNV  1277
             GY+ADVGG +LW+DVL A + HG++P SWTDYL+LTVGGTLSN GISGQ F  GPQISNV
Sbjct  152   GYYADVGGEQLWIDVLRATIEHGLAPLSWTDYLYLTVGGTLSNGGISGQSFLHGPQISNV  211

Query  1276  LELDVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDD  1097
             LELDV+TGKG F+TCS+ +NSELFFAVLGGLGQFGIITRARIVL+KAPTR KW+R+LY+D
Sbjct  212   LELDVVTGKGAFVTCSEHINSELFFAVLGGLGQFGIITRARIVLDKAPTRAKWIRLLYED  271

Query  1096  FSKFTRDQEHLISI--NGLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLL-TQQGLL  926
             F+ FT DQE LIS   NG +Y+EGSL+ +H+ PNNWRSSF+S + QSKI SLL   QGLL
Sbjct  272   FTMFTSDQETLISTVNNGPDYVEGSLITDHSPPNNWRSSFYSHAHQSKIHSLLKNNQGLL  331

Query  925   YCLEVVKHY-DDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQEN  749
             Y +E+VK+Y DDQ+ ST+D+E+  LLKDL+F+PG  FKKD +  EFL RV   + E + +
Sbjct  332   YSIELVKYYHDDQSVSTIDEEIHSLLKDLNFIPGFIFKKDVTITEFLTRVARTDNE-KGS  390

Query  748   GLWEATHPWLNLFVPKSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIP  572
              +    HPWLNLFVPKSRI DFN+ V  +I+ +HK TSGP+L YP   K WD+RMSAV+P
Sbjct  391   SVQSQAHPWLNLFVPKSRIHDFNAGVLVHIIARHKQTSGPILFYPLNRKKWDDRMSAVVP  450

Query  571   EEDTFYCVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHF  392
             +ED FY +GLL+S  ++  +  D LN +I+ FC K    G +IKQYLPHY+S+EDW KHF
Sbjct  451   DEDIFYTLGLLHSCRVDESEDFDRLNNKIMEFCEK---AGIRIKQYLPHYKSKEDWAKHF  507

Query  391   GKKWNTFQENKAKFDPKMILSPGQTIFN  308
             G KW  FQE K KFDP+MILSPGQ IFN
Sbjct  508   GDKWKIFQERKLKFDPEMILSPGQKIFN  535



>ref|XP_003547474.1| PREDICTED: cytokinin dehydrogenase 3-like [Glycine max]
Length=543

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/523 (58%), Positives = 371/523 (71%), Gaps = 26/523 (5%)
 Frame = -1

Query  1807  MSILGKLKPWNS--SLPYEILSVD----IAGRFRVDSRATTA-ASTDFGGIVQETPAGVL  1649
             +S +GK   W    SL  E+ SV     I  + R D  A    AS D+G +V+E P  V 
Sbjct  23    ISTVGKTSQWTKALSLTPELASVSLDDTIFCKLRDDPEALQGRASRDYGNLVREVPLAVF  82

Query  1648  YPSSVDDIINLVRFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGALRGGGK---IR  1478
             +P+S  DI  L++ SYN   PF +AARG GHS RGQA A++GVVV+M   R  G    IR
Sbjct  83    HPASASDIARLIKLSYNGSVPFKIAARGQGHSTRGQAMAREGVVVDMAGFRERGNGVGIR  142

Query  1477  VSWS------ESLGYFADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGIS  1316
             V  S          Y+ADVGG +LW+DVLHA L HG++P SWTDYL+LT+GGTLSNAGIS
Sbjct  143   VVSSVDPNNKNGYYYYADVGGEQLWIDVLHATLEHGLAPMSWTDYLYLTLGGTLSNAGIS  202

Query  1315  GQMFRCGPQISNVLELDVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKA  1136
             GQ FR GPQI+ V E+DVITGKGEF+TCS+  NSELF AVLGGLGQFGIITRARI L  A
Sbjct  203   GQTFRYGPQITTVREMDVITGKGEFVTCSQQTNSELFHAVLGGLGQFGIITRARIALAPA  262

Query  1135  PTRVKWVRMLYDDFSKFTRDQEHLISING------LNYLEGSLMMNHTSPNNWRSSFFSL  974
             P RVKWVR+LY+DFS FT+DQE LIS+ G      L+YLEG L+M+    NNWRSSFF L
Sbjct  263   PKRVKWVRLLYNDFSAFTKDQEQLISVTGRKQNVSLDYLEGLLLMHQGPINNWRSSFFPL  322

Query  973   SDQSKIASLLTQQGLLYCLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFE  794
             +D ++I SL+T+  +LYCLEV K+YD Q  + VD+EL+ LL+ LS++PG  ++KD SYFE
Sbjct  323   ADHARIISLVTKHSVLYCLEVAKYYDGQNENNVDKELQVLLQGLSYIPGFYYEKDVSYFE  382

Query  793   FLNRVRGEELEPQENGLWEATHPWLNLFVPKSRILDFNSAVFQNILLKHK-TSGPMLVYP  617
             FLNRVR  EL+ Q  GLW+  HPWLNLF+PKS+I++F+S VF+NI+LK   T+GP+LVYP
Sbjct  383   FLNRVRSGELKLQSQGLWDVPHPWLNLFIPKSQIMEFDSGVFKNIILKRNITTGPVLVYP  442

Query  616   TTTKMWDERMSAVIPEEDTFYCVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQ  437
                  WD RMSA IP+ED FY VG L+S G + WK  D  N+EIL FCN     G K+KQ
Sbjct  443   MNRNKWDNRMSASIPDEDIFYTVGFLHSSGFDNWKAYDAQNKEILQFCNV---AGIKVKQ  499

Query  436   YLPHYRSREDWMKHFGKKWNTFQENKAKFDPKMILSPGQTIFN  308
             YLPHYR++EDW  HFG KW TF E K +FDP+MILSPGQ IFN
Sbjct  500   YLPHYRTQEDWANHFGPKWRTFVERKHQFDPRMILSPGQRIFN  542



>ref|XP_010696503.1| PREDICTED: cytokinin dehydrogenase 3 [Beta vulgaris subsp. vulgaris]
Length=551

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/533 (56%), Positives = 380/533 (71%), Gaps = 38/533 (7%)
 Frame = -1

Query  1807  MSILG-KLKPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVD  1631
             MSI+  K +PW   LP E+ S+DIA +  ++  +   ASTDFG +V  TPA VLYPSS++
Sbjct  22    MSIISVKHRPWTDLLPCELFSLDIASKLSLNKSSLAIASTDFGNLVHVTPAAVLYPSSIE  81

Query  1630  DIINLVRFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGALR---------------  1496
             DII++V+FSYN   PF VAARG GHS RGQA  ++GVV++M +L                
Sbjct  82    DIISIVKFSYNHSLPFKVAARGRGHSCRGQAMVENGVVIDMTSLNRFKLKNISYNNNYHQ  141

Query  1495  --GGGKIRVSWSESLGYFADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAG  1322
                  +IRVS+   LG++ADVGG +LW+DVLHA L HGV+P SWTDYL+LTVGGTLSNAG
Sbjct  142   YYDNSRIRVSYDALLGFYADVGGEQLWIDVLHATLDHGVAPVSWTDYLYLTVGGTLSNAG  201

Query  1321  ISGQMFRCGPQISNVLELDVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLE  1142
             ISGQ FR GPQI+NV ELDV+TGKGE ITCSK +NSELF AVLGGLGQFGIITRARI L+
Sbjct  202   ISGQSFRYGPQITNVHELDVVTGKGELITCSKKINSELFNAVLGGLGQFGIITRARIKLK  261

Query  1141  KAPTRVKWVRMLYDDFSKFTRDQEHLISI-----------NGLNYLEGSLMMNHTSPNNW  995
              AP RVKWVRMLYD++S FTRDQEHLIS+           +GL+Y+EGSL+M++  PNNW
Sbjct  262   AAPKRVKWVRMLYDNYSTFTRDQEHLISLYGNYQDLIDVNDGLDYVEGSLIMHNVDPNNW  321

Query  994   RSSFFSLSDQSKIASLLTQQGLLYCLEVVKHY---DDQTGSTVDQELKDLLKDLSFVPGM  824
             RSSFF+ +DQ +IASL +  G+LY LEV K+Y   DD   + +D+E++  LK L+F+PG 
Sbjct  322   RSSFFTPNDQDRIASLNSPNGILYFLEVAKYYYHDDDANDTNIDKEVEKQLKGLNFIPGY  381

Query  823   TFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKSRILDFNSAVFQNILLKHK  644
              F ++ S+ EFLNRVR  ELE +  GLW+  HPWLN+F+P+S+I DF   VF NI+ K  
Sbjct  382   IFTQEVSFVEFLNRVRKGELELESKGLWDVPHPWLNMFIPRSQIDDF-QYVFANIIAKDS  440

Query  643   T--SGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSGGMNGWKVLDELNQEILSFCN  470
                 GP+L YP     WD++MSAV PEED FY +GLL+S G++ W VL+  N+EI+++CN
Sbjct  441   KGLEGPILFYPFNRNKWDDKMSAVTPEEDVFYTLGLLHSSGLDDWDVLEHKNEEIINYCN  500

Query  469   KDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFDPKMILSPGQTIF  311
                E G +IKQYLP Y + E+W  HFG KW  FQ  K  FDPK+ILSPGQ IF
Sbjct  501   ---ENGIQIKQYLPRYTTTEEWKTHFGSKWRIFQHRKNLFDPKLILSPGQNIF  550



>ref|NP_001243813.1| cytokinin dehydrogenase 3-like [Glycine max]
 gb|AFB18642.1| cytokinin dehydrogenase 3 [Glycine max]
Length=535

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/507 (58%), Positives = 369/507 (73%), Gaps = 13/507 (3%)
 Frame = -1

Query  1798  LGKLKPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIIN  1619
             +GK + W + +  E+   +I+ +   D      AS D+G +  E P  V  PSS+DDI+ 
Sbjct  25    VGKTEQWKAPILPELDIDNISHKLHDDPETIQMASRDYGHLTHEFPLAVFRPSSIDDIVT  84

Query  1618  LVRFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGALR---GGGKIRVSWSESLGYF  1448
             L++ SYNS +PF +AARG GHS  GQA A+DG+VV+M +LR    G  I VS    +G++
Sbjct  85    LIKSSYNSFAPFDIAARGQGHSTHGQAMARDGIVVDMASLRKQRNGVAISVSKDPLMGHY  144

Query  1447  ADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLEL  1268
             ADVGG +LW+DVLHA L +G++P SWTDYL+LTVGGTLSNAGISGQ FR GPQISNV E+
Sbjct  145   ADVGGEQLWIDVLHATLEYGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQISNVHEM  204

Query  1267  DVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSK  1088
             DVITGKGEF+TCS   N ELF AVLGGLGQFG+I RARI LE AP RVKWVR+LY DFS 
Sbjct  205   DVITGKGEFVTCSSQKNLELFHAVLGGLGQFGVIARARIALEPAPKRVKWVRLLYSDFSA  264

Query  1087  FTRDQEHLISING------LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLL  926
             FT+DQE LISING      L++LEG L+MN    NNWRSSFF LSD  +IASL+T+  +L
Sbjct  265   FTKDQERLISINGRKQKNALDFLEGMLLMNQGPINNWRSSFFPLSDHPRIASLITEHSIL  324

Query  925   YCLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENG  746
             YCLEV K+YD+QT   VD+E++ LL+ L+++PG  ++K+ SY EFLNRVR  EL+ Q  G
Sbjct  325   YCLEVAKYYDEQTELNVDKEIEVLLQGLAYIPGFNYEKNVSYVEFLNRVRSGELKLQSQG  384

Query  745   LWEATHPWLNLFVPKSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIPE  569
             LWE  HPWLNLF+PKS+ILDFNS VF++I+LK   +SGP+LVYP     WD+RMSA IP+
Sbjct  385   LWEVPHPWLNLFIPKSQILDFNSGVFKDIVLKRNISSGPVLVYPMNRNKWDDRMSASIPD  444

Query  568   EDTFYCVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFG  389
             ED FY VG L+S G + WK  D  N+EIL FC    + G  +KQYLP++ ++EDW  HFG
Sbjct  445   EDVFYTVGFLHSSGFDTWKAYDAQNREILEFCR---DAGIMVKQYLPNHSTQEDWTNHFG  501

Query  388   KKWNTFQENKAKFDPKMILSPGQTIFN  308
              KW  F E K +FDP+MILSPGQ IF+
Sbjct  502   AKWMKFLERKHQFDPRMILSPGQKIFH  528



>ref|XP_002514119.1| gulonolactone oxidase, putative [Ricinus communis]
 gb|EEF48073.1| gulonolactone oxidase, putative [Ricinus communis]
Length=529

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/512 (58%), Positives = 379/512 (74%), Gaps = 15/512 (3%)
 Frame = -1

Query  1807  MSILGKLKPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDD  1628
             +S +GK+KP  + LP ++L++D A R   D  +  +AS+D+G +V + PA VLYPSSV D
Sbjct  21    VSTVGKVKPLTTLLPPKLLTLDFAERIHTDPSSIKSASSDYGNLVHKKPAAVLYPSSVQD  80

Query  1627  IINLVRFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGALRG-----GGKIRVSWSE  1463
             I++L+ F+YN  +P +V+ARG  HS+ GQA A DGVVV+M  LR       G + VS   
Sbjct  81    IVSLINFAYNYSAPLTVSARGRSHSINGQAMAPDGVVVDMMHLRSIIEKTNGGVTVSKDP  140

Query  1462  SLGYFADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQIS  1283
              LG++ADVGG +LW+DVL+A + HG++P SWTDYL+LTVGGTLSNAGISGQ FR GPQIS
Sbjct  141   LLGFYADVGGEQLWIDVLNATIEHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIS  200

Query  1282  NVLELDVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLY  1103
             NV E+DV+TG+GE +TCS   NS+LF+AVLGGLGQFGIITRARI LE AP +VKWVRMLY
Sbjct  201   NVYEMDVVTGRGELVTCSGHRNSDLFYAVLGGLGQFGIITRARIALEPAPKKVKWVRMLY  260

Query  1102  DDFSKFTRDQEHLISING------LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLT  941
              DFS+FT+DQE LISING      L+Y+EGSL+MN   PNNWRSSFF  SD  +I SL+T
Sbjct  261   SDFSEFTKDQERLISINGRKQSNALDYVEGSLLMNQGPPNNWRSSFFPSSDIPRIMSLVT  320

Query  940   QQGLLYCLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELE  761
             Q G++YCLEV K+YDD T  ++  EL+ + K LSF  G  F+KD  Y +FL+RVR  E++
Sbjct  321   QHGIIYCLEVAKYYDDATQHSMSMELQLMFKGLSFADGFMFEKDVPYVDFLDRVRSGEIK  380

Query  760   PQENGLWEATHPWLNLFVPKSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMS  584
              Q  GLW+  HPWLNLF+PKS I DFNS VF++I+LK   T+GP+LVYP     WD+R S
Sbjct  381   LQSQGLWDVPHPWLNLFLPKSSISDFNSGVFRDIVLKRNVTTGPVLVYPMNRNKWDDRTS  440

Query  583   AVIPEEDTFYCVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDW  404
             AVIP+ED FY VG L+S G + W+  D+ N+++L++C   D+ G K+KQY PHY ++E+W
Sbjct  441   AVIPDEDVFYTVGFLHSSGFDDWQTYDDQNKDLLNYC---DKAGIKVKQYFPHYTTKEEW  497

Query  403   MKHFGKKWNTFQENKAKFDPKMILSPGQTIFN  308
               HFG KW TF E KAKFDPK +LSPGQ IFN
Sbjct  498   TDHFGSKWRTFVERKAKFDPKRMLSPGQRIFN  529



>ref|XP_003534923.1| PREDICTED: cytokinin dehydrogenase 3-like [Glycine max]
Length=546

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/526 (58%), Positives = 372/526 (71%), Gaps = 29/526 (6%)
 Frame = -1

Query  1807  MSILGKLKPWNSSL--PYEILSVD----IAGRFRVDSRATTA-ASTDFGGIVQETPAGVL  1649
             +S +GK   W  +L  P E+ SV     I  + R D  A    AS D+G +V+E P+ V 
Sbjct  23    ISTVGKTSQWMKALTPPPELASVSLDDTIFSKLRNDPEALQGRASRDYGNLVREVPSAVF  82

Query  1648  YPSSVDDIINLVRFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGALR---GGGKIR  1478
             +P+S  DI  L++ SYN   PF +AARG GHS RGQA  +DGVVV+M   R    G  IR
Sbjct  83    HPTSSSDIARLIKLSYNGSVPFKIAARGQGHSTRGQAMVRDGVVVDMAGFRERGNGEGIR  142

Query  1477  VSWSESLG---------YFADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNA  1325
             V  S  +          Y+ADVGG +LW+DVL+A L HG++P SWTDYL+LTVGGTLSNA
Sbjct  143   VVMSVVVDPNNKNGYGYYYADVGGEQLWIDVLNATLEHGLAPMSWTDYLYLTVGGTLSNA  202

Query  1324  GISGQMFRCGPQISNVLELDVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVL  1145
             GISGQ FR GPQI+ V ++DVITGKGEF+TCS+  NSELF AVLGGLGQFGIITRARI L
Sbjct  203   GISGQTFRYGPQITTVRQMDVITGKGEFVTCSQQTNSELFHAVLGGLGQFGIITRARIAL  262

Query  1144  EKAPTRVKWVRMLYDDFSKFTRDQEHLISIN------GLNYLEGSLMMNHTSPNNWRSSF  983
               AP RVKWVR+LY+DFS FT+DQE LISI        L+YLEG L+M+    NNWRSSF
Sbjct  263   APAPKRVKWVRLLYNDFSAFTKDQEQLISITRRKQNIALDYLEGLLLMHQGPINNWRSSF  322

Query  982   FSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDAS  803
             F L+D ++I SL+T+  +LYCLEV K+YD Q  + VD+ELK LL+ LS++PG  ++KD S
Sbjct  323   FPLADHARIISLVTKHSVLYCLEVAKYYDGQNENNVDKELKVLLQGLSYIPGFYYEKDVS  382

Query  802   YFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKSRILDFNSAVFQNILLKHK-TSGPML  626
             Y EFLNRVR  EL+ Q  GLW+  HPWLNLF+PKS+I++F+S VF+NI+LK   T+GP+L
Sbjct  383   YVEFLNRVRSGELKLQSQGLWDVPHPWLNLFIPKSQIMEFDSGVFKNIILKRNITTGPVL  442

Query  625   VYPTTTKMWDERMSAVIPEEDTFYCVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSK  446
             VYP     WD RMSA IP+ED FY VG L+S G + WK  D  N+EIL FCN   + G K
Sbjct  443   VYPMNRNKWDNRMSASIPDEDIFYTVGFLHSSGFDNWKAYDAQNKEILQFCN---DSGIK  499

Query  445   IKQYLPHYRSREDWMKHFGKKWNTFQENKAKFDPKMILSPGQTIFN  308
             +KQYLPHYR++EDW  HFG KW TF E K +FDPKMILSPGQ IFN
Sbjct  500   VKQYLPHYRTQEDWTNHFGPKWRTFVERKHQFDPKMILSPGQRIFN  545



>ref|XP_003542331.1| PREDICTED: cytokinin dehydrogenase 3-like [Glycine max]
Length=535

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/507 (58%), Positives = 367/507 (72%), Gaps = 13/507 (3%)
 Frame = -1

Query  1798  LGKLKPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIIN  1619
             +GK + W + +  E+   +I+ +   D      AS D+G IV E P  V  PSS+DDI  
Sbjct  25    VGKTEQWKAPILTELDINNISHKLHDDPEIIQMASRDYGHIVHEFPLAVFRPSSIDDIAT  84

Query  1618  LVRFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGALR---GGGKIRVSWSESLGYF  1448
             L++ SYNS +PF +AARG GHS  GQA A+DGVVV+M  LR    G  I VS    +G++
Sbjct  85    LIKSSYNSFAPFGIAARGQGHSTHGQAMARDGVVVDMANLRKQRNGVAISVSKDPLMGHY  144

Query  1447  ADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLEL  1268
             ADVGG +LW+DVLH  L HG++P SWTDYL+LTVGGTLSNAGISGQ FR GPQISNV E+
Sbjct  145   ADVGGEQLWIDVLHTTLKHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQISNVHEM  204

Query  1267  DVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSK  1088
             DVITGKGEF+TCS   N ELF AVLGGLGQFG+I RARI LE AP RVKWVR+LY DF  
Sbjct  205   DVITGKGEFVTCSSQKNLELFHAVLGGLGQFGVIARARIALEPAPKRVKWVRLLYSDFFA  264

Query  1087  FTRDQEHLISING------LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLL  926
             FT+DQE LISING      L++LEG L+MN    NNWRSSFF LSD  +I+SL+T+  +L
Sbjct  265   FTKDQERLISINGRKQKNALDFLEGMLLMNQGPINNWRSSFFPLSDHPRISSLITEHSIL  324

Query  925   YCLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENG  746
             YCLEV K+YD+QT   VD+E++ LL+ L+++PG  ++K+ SY EFLNRVR  EL+ Q  G
Sbjct  325   YCLEVAKYYDEQTEINVDKEIQVLLQGLAYIPGFYYEKNVSYVEFLNRVRSGELKLQSQG  384

Query  745   LWEATHPWLNLFVPKSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIPE  569
             LW+  HPWLNLF+PKS+ILDFNS VF++I+LK   +SGP+LVYPT    WD+RMSA IP+
Sbjct  385   LWDVPHPWLNLFIPKSQILDFNSRVFKDIVLKRNISSGPVLVYPTNRNKWDDRMSASIPD  444

Query  568   EDTFYCVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFG  389
             E+ FY VG L+S G + WK  D  N EIL FC    + G K+KQYLP++ ++EDW  HFG
Sbjct  445   EEVFYTVGFLHSSGFDTWKAYDAQNSEILEFCR---DAGIKVKQYLPNHSTQEDWTNHFG  501

Query  388   KKWNTFQENKAKFDPKMILSPGQTIFN  308
              KW  F E K +FDP+MILSPGQ IF+
Sbjct  502   AKWIKFLERKHQFDPRMILSPGQKIFH  528



>ref|XP_004288952.1| PREDICTED: cytokinin dehydrogenase 3-like [Fragaria vesca subsp. 
vesca]
Length=517

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/492 (60%), Positives = 364/492 (74%), Gaps = 18/492 (4%)
 Frame = -1

Query  1741  IAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSPFSVAARGH  1562
             +  R R D  A   ASTD+G I  E PA VLYPSS+ DI +L++F+ N   PF VAA+G 
Sbjct  25    VGYRLRDDHEAIRLASTDYGHIHSENPAAVLYPSSIHDISSLIKFANNVSVPFGVAAKGQ  84

Query  1561  GHSVRGQATAKDGVVVEMGALR---GGGKIRV----SWSESLGYFADVGGHELWVDVLHA  1403
             GHS RGQA A++GVVVEM +LR   G   I V    S  +   Y+ADVGG +LWVDVLHA
Sbjct  85    GHSTRGQAMARNGVVVEMSSLRNQHGSSGIEVVSTTSKDDVTVYYADVGGEQLWVDVLHA  144

Query  1402  CLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKD  1223
              L HG+SP +WTDYL+LTVGGTLSNAGI GQ FR GPQISNV E+DV+TG+G+F+TCS +
Sbjct  145   TLEHGLSPVTWTDYLYLTVGGTLSNAGIGGQTFRFGPQISNVYEMDVVTGEGDFVTCSPN  204

Query  1222  MNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISING--  1049
              N+ELF+ VLGGLGQFG+I+RARI LE APTRVKWVRMLY DFS F+RDQE LISING  
Sbjct  205   NNAELFYGVLGGLGQFGVISRARIALEPAPTRVKWVRMLYSDFSAFSRDQERLISINGRQ  264

Query  1048  ----LNYLEGSLMMNHTSPNNWR-SSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTG  884
                 L+Y+EGSL++N   PNNWR SSFF  S   KI S + + G++YCLEVVK+YD QT 
Sbjct  265   QSNALDYIEGSLLINQGPPNNWRASSFFPQSSHKKIISRVNKHGIIYCLEVVKYYDHQTE  324

Query  883   STVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVP  704
             STVD+E+++LL  L+++PG  F+ DASY EFLNRVR  EL+ Q  G W+  HPWLNLF+P
Sbjct  325   STVDKEVQNLLNGLNYLPGFKFENDASYVEFLNRVRSGELKLQSEGQWDVPHPWLNLFIP  384

Query  703   KSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSGG  527
             KSRI DF+  VF++I+LK   T+GP+LVYP     W+E+MSAV+PEED FY +G L++ G
Sbjct  385   KSRIADFDQGVFRDIVLKRNITTGPVLVYPMNRSKWNEKMSAVVPEEDVFYTIGFLHATG  444

Query  526   MNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFD  347
              + WK  DE N+EIL FC K    G  +KQYLP +++++ WMKHFG KW TF++ KA FD
Sbjct  445   FDEWKAFDEQNKEILEFCVK---AGIDVKQYLPDHKTQQGWMKHFGSKWKTFEKRKALFD  501

Query  346   PKMILSPGQTIF  311
             PK ILSPGQ IF
Sbjct  502   PKRILSPGQRIF  513



>ref|XP_010242232.1| PREDICTED: cytokinin dehydrogenase 3 isoform X2 [Nelumbo nucifera]
Length=525

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/514 (61%), Positives = 380/514 (74%), Gaps = 26/514 (5%)
 Frame = -1

Query  1807  MSILGKLKPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDD  1628
             MSI+GKL+PW S LP E+LS+D+A R  +D   T+ ASTDFG +V+  PA VLYP S+DD
Sbjct  21    MSIIGKLRPWTSLLPPELLSLDLATRLHIDPEITSLASTDFGKLVRVIPAAVLYPLSLDD  80

Query  1627  IINLVRFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGAL----RGGGKIRVSWSES  1460
             I+ L+RFS+ S  PF +AARG GHSVRGQATA  GVVV+M +L      G +I V  S  
Sbjct  81    IVALIRFSFRSSVPFGIAARGRGHSVRGQATAHKGVVVDMRSLDNDHNNGSRIIVDRSSP  140

Query  1459  L--GYFADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQI  1286
                 ++ADVG  +LWVDVLHA L HG++P SWTDYL+LTVGGTLSNAGISGQ FR GPQI
Sbjct  141   SVNNWYADVGCEQLWVDVLHATLEHGLAPRSWTDYLYLTVGGTLSNAGISGQSFRHGPQI  200

Query  1285  SNVLELDVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRML  1106
             SNV E+DV+TG+GE +TCS   NSELF+AVLGGLGQFGIITRARI LE APT+V+WVR+L
Sbjct  201   SNVYEMDVVTGRGELVTCSPQTNSELFYAVLGGLGQFGIITRARIALEPAPTKVRWVRLL  260

Query  1105  YDDFSKFTRDQEHLISIN-------GLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASL  947
             Y DF  FTRDQEHLIS N       GL+Y+EGSL+MN +  NNWRSSFFS  D S+I SL
Sbjct  261   YHDFIAFTRDQEHLISFNNGSEGIKGLDYVEGSLVMNQSPANNWRSSFFSPDDHSRIISL  320

Query  946   LTQQGLLYCLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEE  767
               + G+LY LEV K+YDD+    VD EL+ LLK LSF+P + F KD SY +FLNRVR  E
Sbjct  321   ANEHGILYSLEVAKYYDDE----VDGELEALLKGLSFIPDLIFAKDVSYIDFLNRVRSGE  376

Query  766   LEPQENGLWEATHPWLNLFVPKSRILDFNSAVFQNILLK-HKTSGPMLVYPTTTKMWDER  590
             LE Q  GLW+  HPWLNLFVPKSRILDF+S  F+ IL + +K SGP+LVYP    M   +
Sbjct  377   LELQSQGLWDVPHPWLNLFVPKSRILDFDSGAFKGILRQNNKISGPILVYP----MNRNK  432

Query  589   MSAVIPEEDTFYCVGLLY-SGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSR  413
             MSAVIPEED FY +GLL  S G + W+ L+E N EIL FC K    G KIKQYLP Y+++
Sbjct  433   MSAVIPEEDIFYSIGLLLQSSGTHDWEHLEEQNTEILRFCEK---AGIKIKQYLPRYQTK  489

Query  412   EDWMKHFGKKWNTFQENKAKFDPKMILSPGQTIF  311
              +W+ HFG KW+TF++ K KFDPK ILSPGQ +F
Sbjct  490   AEWVNHFGPKWDTFKQRKTKFDPKAILSPGQGVF  523



>gb|KHN35852.1| Cytokinin dehydrogenase 3 [Glycine soja]
Length=514

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/510 (58%), Positives = 364/510 (71%), Gaps = 27/510 (5%)
 Frame = -1

Query  1765  PYEILSVD----IAGRFRVDSRATTA-ASTDFGGIVQETPAGVLYPSSVDDIINLVRFSY  1601
             P E+ SV     I  + R D  A    AS D+G +V+E P+ V +P+S  DI  L++ SY
Sbjct  7     PPELASVSLDDTIFSKLRNDPEALQGRASRDYGNLVREVPSAVFHPTSSSDIARLIKLSY  66

Query  1600  NSPSPFSVAARGHGHSVRGQATAKDGVVVEMGALR---GGGKIRVSWSESLG--------  1454
             N   PF +AARG GHS RGQA  +DGVVV+M   R    G  IRV  S  +         
Sbjct  67    NGSVPFKIAARGQGHSTRGQAMVRDGVVVDMAGFRERGNGEGIRVVMSVVVDPNNKNGYG  126

Query  1453  -YFADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNV  1277
              Y+ADVGG +LW+DVL+A L HG++P SWTDYL+LTVGGTLSNAGISGQ FR GPQI+ V
Sbjct  127   YYYADVGGEQLWIDVLNATLEHGLAPMSWTDYLYLTVGGTLSNAGISGQTFRYGPQITTV  186

Query  1276  LELDVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDD  1097
              ++DVITGKGEF+TCS+  NSELF AVLGGLGQFGIITRARI L  AP RVKWVR+LY+D
Sbjct  187   RQMDVITGKGEFVTCSQQTNSELFHAVLGGLGQFGIITRARIALAPAPKRVKWVRLLYND  246

Query  1096  FSKFTRDQEHLISIN------GLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQ  935
             FS FT+DQE LISI        L+YLEG L+M+    NNWRSSFF L+D ++I SL+T+ 
Sbjct  247   FSAFTKDQEQLISITRRKQNIALDYLEGLLLMHQGPINNWRSSFFPLADHARIISLVTKH  306

Query  934   GLLYCLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQ  755
              +LYCLEV K+YD Q  + VD+ELK LL+ LS++PG  ++KD SY EFLNRVR  EL+ Q
Sbjct  307   SVLYCLEVAKYYDGQNENNVDKELKVLLQGLSYIPGFYYEKDVSYVEFLNRVRSGELKLQ  366

Query  754   ENGLWEATHPWLNLFVPKSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAV  578
               GLW+  HPWLNLF+PKS+I++F+S VF+NI+LK   T+GP+LVYP     WD RMSA 
Sbjct  367   SQGLWDVPHPWLNLFIPKSQIMEFDSGVFKNIILKRNITTGPVLVYPMNRNKWDNRMSAS  426

Query  577   IPEEDTFYCVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMK  398
             IP+ED FY VG L+S G + WK  D  N+EIL FCN   + G K+KQYLPHYR++EDW  
Sbjct  427   IPDEDIFYTVGFLHSSGFDNWKAYDAQNKEILQFCN---DSGIKVKQYLPHYRTQEDWTN  483

Query  397   HFGKKWNTFQENKAKFDPKMILSPGQTIFN  308
             HFG KW TF E K +FDPKMILSPGQ IFN
Sbjct  484   HFGPKWRTFVERKHQFDPKMILSPGQRIFN  513



>ref|XP_004508239.1| PREDICTED: cytokinin dehydrogenase 3-like [Cicer arietinum]
Length=543

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/512 (57%), Positives = 366/512 (71%), Gaps = 16/512 (3%)
 Frame = -1

Query  1804  SILGKLKPWNSSLPYE---ILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSV  1634
             S LGK++ W + +P E   I++  I+ +F  D +    AS D+G I+ E P  V +PS +
Sbjct  23    STLGKIEKWKTVVPREHTIIVNTTISNKFHNDLKTIQVASNDYGNIIHELPLAVFHPSCI  82

Query  1633  DDIINLVRFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGALR---GGGKIRVSWSE  1463
              DI  L++ SYNS  PF++AARG GHS  GQA A+DGVVV+M + R    GG I VS   
Sbjct  83    QDIATLIKISYNSSVPFTIAARGQGHSTSGQAMARDGVVVDMASYRKQRNGGAISVSEDP  142

Query  1462  SLGYFADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQIS  1283
              +GY+ DVGG +LW+DVL+    H ++P SWTDYL+LTVGGTLSNAGISGQ FR GPQI+
Sbjct  143   LIGYYVDVGGEQLWIDVLYETFEHRLAPVSWTDYLYLTVGGTLSNAGISGQTFRYGPQIT  202

Query  1282  NVLELDVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLY  1103
             NV E+DVITGKG+ +TCS   NSELF A+LGGLGQFG+ITRARI LE APT VKWVR+LY
Sbjct  203   NVHEMDVITGKGDLVTCSSKKNSELFHALLGGLGQFGVITRARISLEPAPTWVKWVRVLY  262

Query  1102  DDFSKFTRDQEHLISING------LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLT  941
              DFS FT+DQE LISI+G      L++LEG L+M   S NNWRSSFF LS  S+I+SL+T
Sbjct  263   SDFSDFTKDQERLISIDGSTKNIELDFLEGMLLMQQGSINNWRSSFFPLSHHSRISSLIT  322

Query  940   QQGLLYCLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELE  761
             +  +LYCLE+ K+YD Q+   VD+E++ LL+ L+++PG+ ++K+ SY EFLNRVR  EL+
Sbjct  323   KHNILYCLELAKYYDHQSEKMVDKEIQVLLQGLAYIPGLHYEKNVSYVEFLNRVRSGELK  382

Query  760   PQENGLWEATHPWLNLFVPKSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMS  584
              Q  GLW   HPWLNLFVPKS+ILDFNS VF +I+LK   TSG +L+YP     WD+RMS
Sbjct  383   LQSQGLWHVPHPWLNLFVPKSQILDFNSGVFNDIILKRNITSGIVLIYPMNKSKWDDRMS  442

Query  583   AVIPEEDTFYCVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDW  404
              + P+ED FY VG L+S   N WK  D  N+EIL FCN   + G K+KQYLP++ + E W
Sbjct  443   TITPDEDVFYAVGFLHSSAFNNWKAYDAQNKEILKFCN---DVGIKVKQYLPNHSTEEHW  499

Query  403   MKHFGKKWNTFQENKAKFDPKMILSPGQTIFN  308
               HFG KW TF E K  FDP+MILSPGQ IFN
Sbjct  500   KNHFGTKWRTFLETKLLFDPRMILSPGQKIFN  531



>gb|KEH32513.1| cytokinin oxidase/dehydrogenase-like protein [Medicago truncatula]
Length=527

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/507 (57%), Positives = 370/507 (73%), Gaps = 11/507 (2%)
 Frame = -1

Query  1804  SILGKLKPWNSSLPYEILSVD-IAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDD  1628
             + +GK     + LP E+ +++ I+ +   D +    AS+D+G I+ E P  V +PSS+ D
Sbjct  23    TTVGKTDQCKTLLPPELANINTISTKLHNDPKTIKIASSDYGNIIHEFPIAVFHPSSIQD  82

Query  1627  IINLVRFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGALRG---GGKIRVSWSESL  1457
             II L++ SYNS  PF++AARG GHS  GQA   DG+VV+M + R    G  I V     +
Sbjct  83    IITLIKISYNSYVPFTIAARGQGHSTNGQAMTHDGIVVDMASFRKQRKGVAISVFEDPLI  142

Query  1456  GYFADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNV  1277
             GY+ DVGG +LW+DVL+A L HG++P SWTDYL+LTVGGTLSNAGISGQ F  GPQI+NV
Sbjct  143   GYYVDVGGEQLWIDVLYATLEHGLAPVSWTDYLYLTVGGTLSNAGISGQTFLYGPQITNV  202

Query  1276  LELDVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDD  1097
              E DVITGKG+F+TCS + NSEL+ AVLGGLGQFG+ITRARI L+ APT VKW+R+LY D
Sbjct  203   HEFDVITGKGDFVTCSSEKNSELYHAVLGGLGQFGVITRARISLKPAPTTVKWIRLLYSD  262

Query  1096  FSKFTRDQEHLISING--LNYLEGSLMMNHTSPNNWRSS-FFSLSDQSKIASLLTQQGLL  926
             FS FT+DQE LISING  LN+LEG L+M   S NNWRSS FF LSDQ +IASL+T+  ++
Sbjct  263   FSAFTKDQERLISINGRKLNFLEGMLLMQQGSINNWRSSNFFPLSDQHRIASLITKHSII  322

Query  925   YCLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENG  746
             YCLE  K+YD Q+   VD+E++ LL+ L+++PG+ ++K  SY EFLNRVR  EL+ Q  G
Sbjct  323   YCLEFAKYYDHQSEKMVDKEIEILLQGLAYIPGLHYEKKVSYVEFLNRVRSGELKLQSQG  382

Query  745   LWEATHPWLNLFVPKSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIPE  569
             LWE  HPWLNLF+PKS+ILDFNS VF++I+ K   TSG +LVYP     WD++MSA+IP 
Sbjct  383   LWEVPHPWLNLFIPKSQILDFNSGVFKDIIFKRNITSGTVLVYPMHKSKWDDKMSAMIPN  442

Query  568   EDTFYCVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFG  389
             ED FY VG L+S G + WK  +  N+EIL FC    + G K+KQYLP+Y  +EDW KHFG
Sbjct  443   EDVFYTVGFLHSSGFDNWKAYESQNKEILKFCT---DAGIKVKQYLPNYSIQEDWKKHFG  499

Query  388   KKWNTFQENKAKFDPKMILSPGQTIFN  308
              KW +F E+K KFDP+MILSPGQ IFN
Sbjct  500   TKWKSFLESKHKFDPRMILSPGQKIFN  526



>ref|XP_010040366.1| PREDICTED: cytokinin dehydrogenase 3-like [Eucalyptus grandis]
Length=528

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/502 (60%), Positives = 374/502 (75%), Gaps = 14/502 (3%)
 Frame = -1

Query  1786  KPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRF  1607
             KP   SL +++LS+ IA    VDS +T AAS DFG IV+E PA VL PS   DI+ LV F
Sbjct  30    KPLTDSLYHKLLSLPIADILHVDSESTRAASVDFGLIVREIPAAVLRPSCPKDIVTLVAF  89

Query  1606  SYNSPS-PFSVAARGHGHSVRGQATAKDGVVVEMGALRGGGK-IRVSWSESLGYFADVGG  1433
             +YN  S PF+++ARG  HS++GQA A DGVVV+M +L    +   V WS SLG++ADVGG
Sbjct  90    AYNESSLPFTISARGCSHSIQGQAMAPDGVVVDMMSLENKRRGTTVLWSWSLGHYADVGG  149

Query  1432  HELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITG  1253
              +LW+DVL   L HGV+P SWTDYL+LTVGGTLSNAGISG+ FR GPQISNV E+DVITG
Sbjct  150   QQLWIDVLEETLKHGVAPVSWTDYLYLTVGGTLSNAGISGETFRYGPQISNVYEMDVITG  209

Query  1252  KGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQ  1073
              G+F+TCS D N ELF++VLGGLGQFGIITRARI L +AP RVKWVRMLY DFS FT DQ
Sbjct  210   TGDFLTCSPDKNPELFYSVLGGLGQFGIITRARIALGQAPKRVKWVRMLYSDFSDFTIDQ  269

Query  1072  EHLISING------LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEV  911
             E LIS +G      L+Y+EGSL+M H + ++W +SFFSLSD+ ++ SL+T+  LLYC+EV
Sbjct  270   ESLISHHGRDQDEALDYVEGSLLM-HRNSDSW-TSFFSLSDRQRLMSLVTEHELLYCIEV  327

Query  910   VKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEAT  731
              K YD +T +TVD+ L+ +LKDLS VP   F+KD +Y +FLNRVR EEL+ +  GLW   
Sbjct  328   AKFYDGRTQTTVDKALEIILKDLSHVPEFMFEKDVAYVDFLNRVRVEELKLRRQGLWNVP  387

Query  730   HPWLNLFVPKSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIPEEDTFY  554
             HPWLNLFVPKSRI DFN+ VF NI+LK   T+G +L+YP     WD+RMSAVIP+ED FY
Sbjct  388   HPWLNLFVPKSRIADFNTGVFNNIVLKKNITTGLVLIYPMNNDKWDDRMSAVIPDEDVFY  447

Query  553   CVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNT  374
              VG L+S G   W+  D  N+E+L FC  +   G K+KQYLP+Y +  +WM+HFG KW T
Sbjct  448   TVGFLHSSGFEDWQEFDLQNKEVLLFCENN---GIKVKQYLPNYNTEREWMEHFGSKWRT  504

Query  373   FQENKAKFDPKMILSPGQTIFN  308
             FQE+KA+FDPKM+LSPGQ IFN
Sbjct  505   FQESKAQFDPKMLLSPGQRIFN  526



>ref|XP_010024059.1| PREDICTED: cytokinin dehydrogenase 3-like [Eucalyptus grandis]
Length=528

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/504 (60%), Positives = 376/504 (75%), Gaps = 18/504 (4%)
 Frame = -1

Query  1786  KPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRF  1607
             KP   SL +++LS+ IA    VDS +T AAS DFG IV+E PA VL PS   DI+ LV F
Sbjct  30    KPLTDSLYHKLLSLPIADILHVDSESTHAASVDFGLIVREIPAAVLRPSCPKDIVTLVAF  89

Query  1606  SYNSPS-PFSVAARGHGHSVRGQATAKDGVVVEMGALRGGGKIR---VSWSESLGYFADV  1439
             +YN  S PF+++ARG  HS++GQA A DGVVV+M +L  G K R   V WS SLG++ADV
Sbjct  90    AYNESSLPFTISARGCSHSIQGQAMAPDGVVVDMMSL--GNKRRGTTVLWSWSLGHYADV  147

Query  1438  GGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVI  1259
             GG +LW+DVL   L HGV+P SWTDYL+LTVGGTLSNAGISG+ FR GPQISNV E+DVI
Sbjct  148   GGQQLWIDVLEETLKHGVAPVSWTDYLYLTVGGTLSNAGISGETFRYGPQISNVYEMDVI  207

Query  1258  TGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTR  1079
             TG G+F+TCS D N ELF++VLGGLGQFGIITRARI L +AP RVKWVRMLY DFS FT 
Sbjct  208   TGTGDFLTCSPDKNPELFYSVLGGLGQFGIITRARIALGQAPKRVKWVRMLYSDFSDFTI  267

Query  1078  DQEHLISING------LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCL  917
             DQE LIS +G      L+Y+EGSL+M H + ++W +SFFSLSD+ ++ SL+T+  LLYC+
Sbjct  268   DQESLISHHGRDQDEALDYVEGSLLM-HRNSDSW-TSFFSLSDRQRLMSLVTEHELLYCI  325

Query  916   EVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWE  737
             EV K YD +T +TVD+ L+ +LKDLS VP   F+KD +Y +FLNRVR EEL+ +  GLW 
Sbjct  326   EVAKFYDGRTQTTVDKALEIILKDLSHVPEFMFEKDVAYVDFLNRVRVEELKLRRQGLWN  385

Query  736   ATHPWLNLFVPKSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIPEEDT  560
               HPWLNLFVPKSRI DFN+ VF NI+LK   T+G +L+YP     WD+RMSAVIP+ED 
Sbjct  386   VPHPWLNLFVPKSRIADFNTGVFNNIVLKKNITTGLVLIYPMNNDKWDDRMSAVIPDEDV  445

Query  559   FYCVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKW  380
             FY VG L+S G   W+  D  N+E+L FC  +   G K+KQYLP+Y +  +WM+HFG KW
Sbjct  446   FYTVGFLHSSGFEDWQEFDLQNKEVLLFCENN---GIKVKQYLPNYNTEREWMEHFGSKW  502

Query  379   NTFQENKAKFDPKMILSPGQTIFN  308
              TFQE+KA+FDPKM+LSPGQ IFN
Sbjct  503   RTFQESKAQFDPKMLLSPGQRIFN  526



>gb|KCW60469.1| hypothetical protein EUGRSUZ_H03195 [Eucalyptus grandis]
Length=522

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/504 (60%), Positives = 376/504 (75%), Gaps = 18/504 (4%)
 Frame = -1

Query  1786  KPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRF  1607
             KP   SL +++LS+ IA    VDS +T AAS DFG IV+E PA VL PS   DI+ LV F
Sbjct  24    KPLTDSLYHKLLSLPIADILHVDSESTHAASVDFGLIVREIPAAVLRPSCPKDIVTLVAF  83

Query  1606  SYNSPS-PFSVAARGHGHSVRGQATAKDGVVVEMGALRGGGKIR---VSWSESLGYFADV  1439
             +YN  S PF+++ARG  HS++GQA A DGVVV+M +L  G K R   V WS SLG++ADV
Sbjct  84    AYNESSLPFTISARGCSHSIQGQAMAPDGVVVDMMSL--GNKRRGTTVLWSWSLGHYADV  141

Query  1438  GGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVI  1259
             GG +LW+DVL   L HGV+P SWTDYL+LTVGGTLSNAGISG+ FR GPQISNV E+DVI
Sbjct  142   GGQQLWIDVLEETLKHGVAPVSWTDYLYLTVGGTLSNAGISGETFRYGPQISNVYEMDVI  201

Query  1258  TGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTR  1079
             TG G+F+TCS D N ELF++VLGGLGQFGIITRARI L +AP RVKWVRMLY DFS FT 
Sbjct  202   TGTGDFLTCSPDKNPELFYSVLGGLGQFGIITRARIALGQAPKRVKWVRMLYSDFSDFTI  261

Query  1078  DQEHLISING------LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCL  917
             DQE LIS +G      L+Y+EGSL+M H + ++W +SFFSLSD+ ++ SL+T+  LLYC+
Sbjct  262   DQESLISHHGRDQDEALDYVEGSLLM-HRNSDSW-TSFFSLSDRQRLMSLVTEHELLYCI  319

Query  916   EVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWE  737
             EV K YD +T +TVD+ L+ +LKDLS VP   F+KD +Y +FLNRVR EEL+ +  GLW 
Sbjct  320   EVAKFYDGRTQTTVDKALEIILKDLSHVPEFMFEKDVAYVDFLNRVRVEELKLRRQGLWN  379

Query  736   ATHPWLNLFVPKSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIPEEDT  560
               HPWLNLFVPKSRI DFN+ VF NI+LK   T+G +L+YP     WD+RMSAVIP+ED 
Sbjct  380   VPHPWLNLFVPKSRIADFNTGVFNNIVLKKNITTGLVLIYPMNNDKWDDRMSAVIPDEDV  439

Query  559   FYCVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKW  380
             FY VG L+S G   W+  D  N+E+L FC  +   G K+KQYLP+Y +  +WM+HFG KW
Sbjct  440   FYTVGFLHSSGFEDWQEFDLQNKEVLLFCENN---GIKVKQYLPNYNTEREWMEHFGSKW  496

Query  379   NTFQENKAKFDPKMILSPGQTIFN  308
              TFQE+KA+FDPKM+LSPGQ IFN
Sbjct  497   RTFQESKAQFDPKMLLSPGQRIFN  520



>ref|XP_011077992.1| PREDICTED: cytokinin dehydrogenase 3-like isoform X2 [Sesamum 
indicum]
Length=509

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/500 (62%), Positives = 366/500 (73%), Gaps = 36/500 (7%)
 Frame = -1

Query  1783  PWNSS-LPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRF  1607
             PW SS LP    S D+  R R D  A TAAS D+G +V E PA VLYPSS+ +I++L++ 
Sbjct  28    PWTSSALP----SCDLPIRLRTDPDAVTAASNDYGNLVHEAPAAVLYPSSIQEIVDLIKL  83

Query  1606  SYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGAL-RGGGKIRVSWSESLGYFADVGGH  1430
             S N  +PF+VAARG GHSVRGQA A  GVVVEM AL R GG IRVSWS SLGY+ADVGG 
Sbjct  84    SNNCSTPFTVAARGRGHSVRGQAMAGGGVVVEMAALSRNGGGIRVSWSPSLGYYADVGGE  143

Query  1429  ELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGK  1250
             E+W DVL   L HG++P SWTDYL+LTVGGTLSNAGISGQ FR GPQISNVLELDVIT  
Sbjct  144   EMWADVLRVGLEHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRHGPQISNVLELDVIT--  201

Query  1249  GEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQE  1070
                              VLGGLGQFGIITRARIVL+KAPTR KWVR++Y+DF+ FTRDQE
Sbjct  202   -----------------VLGGLGQFGIITRARIVLQKAPTRAKWVRLIYNDFTMFTRDQE  244

Query  1069  HLIS--INGLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLL-TQQGLLYCLEVVKHY  899
             HLIS  ING NY+EGSL+ + + PNNWRSSF+S SDQSKI SLL ++QGLLY +EVVK+Y
Sbjct  245   HLISTNINGPNYVEGSLITDQSPPNNWRSSFYSPSDQSKILSLLRSKQGLLYSIEVVKYY  304

Query  898   DDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRV---RGEELEPQENGLWEATH  728
              D    T+DQE+K L+KDL+F+PG  F KD S  +FL RV   R +E E   +   E TH
Sbjct  305   HDTNIDTIDQEVKLLVKDLNFIPGFVFNKDVSLVDFLTRVGSGRDKEEEKSSDRELE-TH  363

Query  727   PWLNLFVPKSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIPEEDTFYC  551
             PWLNLF+PKS I+DFN AVF N++ +H  TSGP+L YP   + WD+RMSAV P+ED FY 
Sbjct  364   PWLNLFLPKSSIMDFNDAVFVNVIRRHNHTSGPILFYPFNRQKWDDRMSAVTPDEDIFYT  423

Query  550   VGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTF  371
             +GLL++   +   V D LN EIL  C K D +   +KQYLPHY S+EDWMKHFG KW+TF
Sbjct  424   LGLLHTSRPHQSDVYDNLNSEILDCCEKADID---VKQYLPHYISKEDWMKHFGPKWDTF  480

Query  370   QENKAKFDPKMILSPGQTIF  311
             QE K KFDP+MILSPGQ IF
Sbjct  481   QERKTKFDPRMILSPGQRIF  500



>ref|XP_008459369.1| PREDICTED: cytokinin dehydrogenase 3-like [Cucumis melo]
Length=524

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/515 (57%), Positives = 372/515 (72%), Gaps = 29/515 (6%)
 Frame = -1

Query  1804  SILGKLKPWNSSL---PYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSV  1634
             S + K K W ++L   P  +L+         D    T AS+D+G +V+ETPA VL PSS+
Sbjct  22    SSINKSKAWTTTLNQRPNNLLN---------DPETLTLASSDYGNMVKETPAAVLQPSSI  72

Query  1633  DDIINLVRFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGALRGGGK---IRVS---  1472
             +DI+ L+ ++YN+P PF +AARG GHSVRGQA AK+GVV++M ALR   K   I VS   
Sbjct  73    NDIVQLISYAYNNPIPFQIAARGQGHSVRGQAMAKNGVVIDMSALRRNRKTPGIVVSCRR  132

Query  1471  WSESLGYFADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGP  1292
             W+    ++ DVGG +LW+DVL+  L +G++P SWTDYL++TVGGTLSNAGISGQ FR GP
Sbjct  133   WTTG-EFYVDVGGEQLWIDVLNETLGYGMTPVSWTDYLYITVGGTLSNAGISGQSFRYGP  191

Query  1291  QISNVLELDVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVR  1112
             Q+SNV+E+DV+TGKG  +TCS   N ELF AVLGGLGQFGII RARI LE AP RVKWVR
Sbjct  192   QVSNVVEMDVVTGKGNMMTCSPKKNCELFHAVLGGLGQFGIIARARIALEPAPIRVKWVR  251

Query  1111  MLYDDFSKFTRDQEHLISING------LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIAS  950
             MLY +F+ FT+DQEHLIS+NG      L+YLEG ++++H  P+NWRSSFF  SD S+I S
Sbjct  252   MLYTNFAAFTKDQEHLISLNGRKQMNALDYLEGLVLLHHNKPDNWRSSFFPPSDHSRIIS  311

Query  949   LLTQQGLLYCLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGE  770
             L  Q  ++YCLEVVK+YD  T STVD++L+ LL+ L +  G  F+KD +Y EFLNRVR  
Sbjct  312   LANQNSIIYCLEVVKYYDHHTQSTVDKDLEVLLQGLDYESGFKFEKDVTYVEFLNRVRTG  371

Query  769   ELEPQENGLWEATHPWLNLFVPKSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDE  593
             EL+ Q  GLW+  HPWLNLFVP+SRI+DFNS VF++I+L+   T GP+L+YP     WDE
Sbjct  372   ELKLQSKGLWDVPHPWLNLFVPRSRIMDFNSGVFKDIVLRRNITKGPILIYPMNRSKWDE  431

Query  592   RMSAVIPEEDTFYCVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSR  413
             R S VIP+E+ FY +G L S G + WK  +E N+EIL +C K    G +IKQYLPHY+++
Sbjct  432   RNSTVIPDEEVFYTIGFLNSSGFDDWKKFEEQNEEILEYCGK---SGIEIKQYLPHYKTQ  488

Query  412   EDWMKHFGKKWNTFQENKAKFDPKMILSPGQTIFN  308
               W++HFG KW  FQ NK KFDPK ILSPGQ IFN
Sbjct  489   TQWIQHFGSKWTNFQHNKFKFDPKNILSPGQKIFN  523



>ref|XP_008450862.1| PREDICTED: cytokinin dehydrogenase 3-like [Cucumis melo]
Length=515

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/507 (57%), Positives = 373/507 (74%), Gaps = 13/507 (3%)
 Frame = -1

Query  1807  MSILGKLKPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDD  1628
             M  + +LK   S L     S  +    R DS A ++A+TDFG IV   PA VL+P+S++D
Sbjct  14    MVFINRLK---SFLTKSFFSHHLPTHLRHDSAALSSAATDFGHIVTNPPAAVLFPTSIND  70

Query  1627  IINLVRFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGALRGG-GKIRVSWSESLGY  1451
             ++ L++ + +   PF+VAA+G GHSV GQA A++GVVVEM +L     +I +S S   G+
Sbjct  71    LVTLLKLANSRSIPFNVAAKGCGHSVHGQAMAQNGVVVEMTSLNNNPTRISISGSADAGF  130

Query  1450  FADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLE  1271
             FADVGG ++W+DVL+A L HG++P SWTDYL+LTVGGTLSNAGISGQ FR GPQI NV+E
Sbjct  131   FADVGGEQMWIDVLNATLKHGLAPPSWTDYLYLTVGGTLSNAGISGQTFRYGPQICNVVE  190

Query  1270  LDVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFS  1091
             LDV+TGKG+ ++CS + N+ELF +VLGGLGQFGII RARI L  AP RVKWVRMLY++F 
Sbjct  191   LDVVTGKGDIVSCSAEKNNELFNSVLGGLGQFGIIVRARIPLFPAPNRVKWVRMLYNNFD  250

Query  1090  KFTRDQEHLISIN-----GLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLL  926
             +F +DQE+LIS+N     GL+YLEG L+M+   P+NWRSSFF  S  S I SL+ Q  ++
Sbjct  251   EFVKDQENLISMNSNDDGGLDYLEGLLLMHDGPPDNWRSSFFPPSHHSTIISLVNQHSII  310

Query  925   YCLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENG  746
             YCLEV K+YDD +  T++QEL D L+ L+F+PG  F+KD SY EFLNRVRG EL  +  G
Sbjct  311   YCLEVAKYYDDHSRHTINQELDDSLEGLNFLPGYKFEKDVSYVEFLNRVRGGELSLRSQG  370

Query  745   LWEATHPWLNLFVPKSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIPE  569
             LW+  HPWLNLFVPKSRI +F+  VF++I+LK K  SGP+L+YP     WDE+MSA+IPE
Sbjct  371   LWDVPHPWLNLFVPKSRIAEFDLGVFKDIILKRKIASGPILIYPMNRNKWDEKMSAIIPE  430

Query  568   EDTFYCVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFG  389
             E+ FY +G L S G + W+ ++E N+EILSFC+  D    KIKQYLPHY ++EDW KHFG
Sbjct  431   EEVFYTIGFLNSSGYDNWEAIEEQNKEILSFCDSVD---MKIKQYLPHYNTKEDWEKHFG  487

Query  388   KKWNTFQENKAKFDPKMILSPGQTIFN  308
              KW  FQ+ K +FDPKMILSPGQ IFN
Sbjct  488   NKWKIFQDRKNQFDPKMILSPGQKIFN  514



>emb|CAN61742.1| hypothetical protein VITISV_038638 [Vitis vinifera]
Length=496

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/498 (60%), Positives = 363/498 (73%), Gaps = 35/498 (7%)
 Frame = -1

Query  1789  LKPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQE-TPAGVLYPSSVDDIINLV  1613
             L+PW   LP E+ S+DIA R  VD  AT  AS DFG +V    PA VLYPSS++DI +LV
Sbjct  26    LRPWPDVLPNELQSLDIASRLXVDPXATRMASRDFGKLVHPPNPAAVLYPSSIEDIASLV  85

Query  1612  RFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGALRG---GGKIRVSWSESLGYFAD  1442
             +FSYN  SPFS+AARG GHS+RGQA A  GVVVEM +L     G  IRV+ +        
Sbjct  86    KFSYNRSSPFSIAARGQGHSLRGQAMAXHGVVVEMRSLNNCSXGSGIRVTKNPIX-----  140

Query  1441  VGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDV  1262
                                   SWTDYL+LT+GGTLSNAGISGQ FR GPQISNV E+DV
Sbjct  141   ---------------------VSWTDYLYLTIGGTLSNAGISGQTFRHGPQISNVYEMDV  179

Query  1261  ITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFT  1082
             +TGKGE +TCSKD NSELFFAVLGGLGQFGII RARI L+ AP RVKW++MLYDDFS F+
Sbjct  180   LTGKGELVTCSKDTNSELFFAVLGGLGQFGIIIRARIALKPAPKRVKWIQMLYDDFSTFS  239

Query  1081  RDQEHLISINGLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKH  902
             RDQEHLISINGL+YLEGSL+M ++SPNNWRSS FS S+  +I+SL+++ G +YCLEVVK+
Sbjct  240   RDQEHLISINGLDYLEGSLLMQNSSPNNWRSS-FSPSEYPRISSLISKNGXIYCLEVVKY  298

Query  901   YDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPW  722
             YD+ T  TVD+EL++LLK L+F+PG  F KD S  +FLNRV  EEL  +  GLW+  HPW
Sbjct  299   YDELTSHTVDEELQELLKGLNFLPGFVFTKDVSLVDFLNRVHSEELNLRAKGLWDVPHPW  358

Query  721   LNLFVPKSRILDFNSAVFQNILLK-HKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVG  545
             LNLFVP SRI DFNS VF++IL K ++T+G  LVYP     WD+R SAVIP+ED FY VG
Sbjct  359   LNLFVPGSRISDFNSGVFRDILPKINQTTGTFLVYPVIRNKWDDRTSAVIPDEDIFYTVG  418

Query  544   LLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQE  365
             LL+S G + W+ L+  N+EIL FC   D+ G KIK+YL  Y +++DWM HFG KW TF++
Sbjct  419   LLHSSGADDWEPLENQNKEILKFC---DKAGIKIKRYLSRYTTKKDWMNHFGPKWRTFED  475

Query  364   NKAKFDPKMILSPGQTIF  311
              KA+FDPKMILSPGQ IF
Sbjct  476   RKAQFDPKMILSPGQQIF  493



>ref|XP_004158449.1| PREDICTED: LOW QUALITY PROTEIN: cytokinin dehydrogenase 3-like 
[Cucumis sativus]
Length=516

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/496 (58%), Positives = 366/496 (74%), Gaps = 10/496 (2%)
 Frame = -1

Query  1774  SSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNS  1595
             S L     S  +    R DS A ++A+TDFG +V  TPA VL+P+S++D++ L++ + + 
Sbjct  23    SFLTESFFSDHLPTHLRHDSTALSSAATDFGHLVTSTPAAVLFPTSINDLVTLLKLANSR  82

Query  1594  PSPFSVAARGHGHSVRGQATAKDGVVVEMGALRGG-GKIRVSWSESLGYFADVGGHELWV  1418
               PF+VAA+G GHSV GQA A++GVVVEM +L     +I +S S   G+FADVGG ++W+
Sbjct  83    SVPFNVAAKGCGHSVHGQAMAENGVVVEMTSLNNNPSRISISGSADAGFFADVGGEQMWI  142

Query  1417  DVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFI  1238
             DVL A L HG++P SWTDYL+LTVGGTLSNAGISGQ FR GPQI NVLELDV+TGKG+ +
Sbjct  143   DVLTATLKHGLAPPSWTDYLYLTVGGTLSNAGISGQTFRYGPQICNVLELDVVTGKGDIV  202

Query  1237  TCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLIS  1058
             +CS + N+ELF +VLGGLGQFGII RARI L  AP RVKWVRMLY++F +F +DQE LI 
Sbjct  203   SCSAEXNNELFNSVLGGLGQFGIIVRARIPLFPAPNRVKWVRMLYNNFDEFVKDQEKLIL  262

Query  1057  IN-----GLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDD  893
              N     GLNYLEG L+M+   P+NWRSSFF  S  S I SL+ Q  ++YCLEV K+YDD
Sbjct  263   KNSNDDGGLNYLEGLLLMHDGPPDNWRSSFFPPSHHSTIISLVNQHSIIYCLEVAKYYDD  322

Query  892   QTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNL  713
             ++  T+D+EL +LLK L+F+PG  F+KD SY EFLNRVRG EL  +  GLW+  HPWLNL
Sbjct  323   RSRHTIDKELDNLLKGLNFLPGYKFEKDVSYVEFLNRVRGGELSLRSQGLWDVPHPWLNL  382

Query  712   FVPKSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLY  536
             FVPKSRI +FNS VF++I+LK K  +GP+L+YP     WD++MSAVIPEE+ FY +G L 
Sbjct  383   FVPKSRIAEFNSGVFKDIILKRKIANGPILIYPMNRNKWDDKMSAVIPEEEVFYTIGFLN  442

Query  535   SGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKA  356
             S G + W+ ++E N++IL FC+  D    KIKQYLPHY ++EDW KHFG KW   Q+ K 
Sbjct  443   SSGYDNWEAVEEQNKDILRFCDSVD---MKIKQYLPHYNTKEDWEKHFGNKWKIIQDRKN  499

Query  355   KFDPKMILSPGQTIFN  308
             +FDPKMILSPGQ IFN
Sbjct  500   QFDPKMILSPGQKIFN  515



>ref|XP_010024208.1| PREDICTED: cytokinin dehydrogenase 3-like [Eucalyptus grandis]
Length=522

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/507 (59%), Positives = 372/507 (73%), Gaps = 15/507 (3%)
 Frame = -1

Query  1804  SILGKLKPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDI  1625
             +++ + K  N  L  E+LS+ IA    +D  +   AS DFG IV++ PA VL PS  +DI
Sbjct  21    TLVCQSKLLNDPLYRELLSLPIASDLHIDPESIAEASVDFGLIVRKIPAVVLRPSHPEDI  80

Query  1624  INLVRFSYNSPS-PFSVAARGHGHSVRGQATAKDGVVVEMGALRGGGKIRVSWSESLGYF  1448
               LV F+ +  S PF+++ARG GHSVRGQA A+DGVVV+M +L  G K  VSWS+SLG++
Sbjct  81    AVLVAFANSKSSIPFTISARGCGHSVRGQAMARDGVVVDMTSL--GNKTAVSWSQSLGHY  138

Query  1447  ADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLEL  1268
             ADVGG +LW++VL   L HGV+P SWTDYL+LTVGGTLSNAGISG+ FR GPQISNV E+
Sbjct  139   ADVGGQQLWINVLEETLKHGVTPVSWTDYLYLTVGGTLSNAGISGETFRYGPQISNVYEM  198

Query  1267  DVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSK  1088
             DVITG G F TCS   N ELF++VLGGLGQFGIITRARI L +AP R  WVRMLY DFS 
Sbjct  199   DVITGTGHFFTCSPHKNPELFYSVLGGLGQFGIITRARIALGQAPNRAIWVRMLYSDFSA  258

Query  1087  FTRDQEHLISING------LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLL  926
             FT DQE LIS++G      L+Y+EG L M   S ++W  SFFSLSD+ ++ SLLT+  LL
Sbjct  259   FTTDQERLISLHGRDQDEALDYVEGQLFMRRNS-DSW-ISFFSLSDRPRLMSLLTEHELL  316

Query  925   YCLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENG  746
             YC+EV K YD++T STVD++LK +LKDLS VP   F+KD  Y +FLNRVR EEL  +E G
Sbjct  317   YCIEVAKFYDERTRSTVDKDLKTILKDLSHVPEFLFQKDVGYVDFLNRVRAEELTLRELG  376

Query  745   LWEATHPWLNLFVPKSRILDFNSAVFQNILL-KHKTSGPMLVYPTTTKMWDERMSAVIPE  569
             LW   HPWLNLFVPKSRI DFN+ VF+NI+L K+ T+GP+L+YP     WD+RMSAVIP+
Sbjct  377   LWNVPHPWLNLFVPKSRIADFNTGVFKNIVLRKNITTGPVLIYPMNNDKWDDRMSAVIPD  436

Query  568   EDTFYCVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFG  389
             ED FY VG L S G   W+  D  N+E+L FC   ++ G K+KQYLP+Y +  +WM+HFG
Sbjct  437   EDVFYTVGFLLSSGFKDWQEFDLQNKEVLLFC---EDNGIKVKQYLPNYSTEREWMQHFG  493

Query  388   KKWNTFQENKAKFDPKMILSPGQTIFN  308
              KW  FQE+KA+FDPKM+LSPGQ IFN
Sbjct  494   PKWRAFQESKAQFDPKMLLSPGQRIFN  520



>ref|XP_010026881.1| PREDICTED: cytokinin dehydrogenase 3-like [Eucalyptus grandis]
Length=512

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/497 (60%), Positives = 368/497 (74%), Gaps = 15/497 (3%)
 Frame = -1

Query  1774  SSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNS  1595
             +SL +++LS+ IA +  VD  +   AS DFG IV+E PA VL PS  +DI  LV F+Y+ 
Sbjct  21    NSLYHKLLSLPIADKLHVDPESIGEASVDFGLIVREIPAAVLRPSHPEDIAILVAFAYSK  80

Query  1594  PS-PFSVAARGHGHSVRGQATAKDGVVVEMGALRGGGKIRVSWSESLGYFADVGGHELWV  1418
              S PF+++ARG GHSVRGQA A+DGVVV+M +L  G K  VSWS+SLG++ADVGG +LW+
Sbjct  81    SSIPFTISARGCGHSVRGQAMARDGVVVDMTSL--GNKTTVSWSQSLGHYADVGGQQLWI  138

Query  1417  DVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFI  1238
             DVL   L HGV+P SWTDYL+LTVGGTLSNAGISG+ FR GPQISN  E+DVITG G F+
Sbjct  139   DVLEETLKHGVAPVSWTDYLYLTVGGTLSNAGISGETFRYGPQISNAYEMDVITGTGHFL  198

Query  1237  TCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLIS  1058
             TCS   N ELF +VLGGLGQF IITRARI L  AP R KWVRMLY DFS FT DQE LIS
Sbjct  199   TCSPHENPELFHSVLGGLGQFVIITRARIALGPAPKRAKWVRMLYSDFSAFTMDQERLIS  258

Query  1057  ING------LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYD  896
             ++G      L+Y+EG L +   S ++W  SFFSLSD  ++ SLLT+  LLYC+EV K YD
Sbjct  259   VHGRDQDEALDYVEGQLFIRGNS-DSW-ISFFSLSDHPRLMSLLTEHELLYCIEVAKFYD  316

Query  895   DQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLN  716
             ++T STVD++LK +LKDLS VP   F+KD  Y +FLNRVR EE+  ++ GLW   HPWLN
Sbjct  317   ERTRSTVDKDLKMILKDLSHVPEFLFQKDVGYVDFLNRVRAEEMTLRKLGLWNVPHPWLN  376

Query  715   LFVPKSRILDFNSAVFQNILL-KHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLL  539
             LFVPKSRI DFN+ VF+NI+L K+ T+GP+L+YP     WD+RMSAVIP+ED FY VG L
Sbjct  377   LFVPKSRIADFNTGVFKNIVLRKNITTGPVLIYPMNNDKWDDRMSAVIPDEDVFYTVGFL  436

Query  538   YSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENK  359
              S G   W+  D  N+E+L FC   ++ G K+KQYLP+Y +  +WM+HFG KW  FQE+K
Sbjct  437   LSSGFKDWQEFDLQNKEVLLFC---EDNGIKVKQYLPNYSTEREWMQHFGPKWRAFQESK  493

Query  358   AKFDPKMILSPGQTIFN  308
             A+FDPKM+LSPGQ IFN
Sbjct  494   AQFDPKMLLSPGQRIFN  510



>emb|CBI27904.3| unnamed protein product [Vitis vinifera]
Length=494

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/495 (59%), Positives = 358/495 (72%), Gaps = 34/495 (7%)
 Frame = -1

Query  1780  WNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSY  1601
             W   LP+++ ++ IA R RVD  AT  A+ DFG +                         
Sbjct  28    WADVLPHQLHTLTIATRLRVDLDATAKAARDFGKL-------------------------  62

Query  1600  NSPSPFSVAARGHGHSVRGQATAKDGVVVEMGALRGGGK---IRVSWSESLGYFADVGGH  1430
               PSPF++AARG GHS+ GQA A +GVVV+M +L+  G    I+V+ +   G +ADVGGH
Sbjct  63    --PSPFTIAARGRGHSLGGQAMAPNGVVVDMTSLKNSGAGIGIKVTKNPVSGSYADVGGH  120

Query  1429  ELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGK  1250
             +LW+DVL A L HG++P SWTDYL+LTVGGTLSNAG SGQ FR GPQISNV E+D+ITGK
Sbjct  121   QLWIDVLQATLEHGLAPVSWTDYLYLTVGGTLSNAGGSGQTFRHGPQISNVHEMDIITGK  180

Query  1249  GEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQE  1070
             GE +TCSK+ NS+LF+AVLGGLGQFGIITRARI LE AP RVKWVRMLYDDFS F+ DQE
Sbjct  181   GELVTCSKETNSDLFYAVLGGLGQFGIITRARIPLEPAPKRVKWVRMLYDDFSTFSEDQE  240

Query  1069  HLISINGLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQ  890
             HLISINGL+YLEGSL+   + PNNWRSSFFS S    I+SLLT+ G++Y +EVVK+YDD 
Sbjct  241   HLISINGLDYLEGSLITKQSPPNNWRSSFFSKSQYPIISSLLTKNGIIYSIEVVKYYDDL  300

Query  889   TGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLF  710
             T  TVD+EL++L K L F+PG+ F KD +  +FL+RV   EL+ Q  GLW+  HPWLNLF
Sbjct  301   TSHTVDEELQELFKGLRFLPGLVFTKDVTLVDFLDRVHNGELQLQAKGLWDVPHPWLNLF  360

Query  709   VPKSRILDFNSAVFQNILLK-HKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYS  533
             VPKSRI DFNS VF++I+LK ++T GP+LVYP     WD  MSA IP+ED FY +GLL+S
Sbjct  361   VPKSRISDFNSGVFRDIILKTNQTVGPLLVYPMIRNKWDNGMSAAIPDEDIFYSIGLLHS  420

Query  532   GGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAK  353
              G + W+ L+  N+EIL FC   D+ G KIKQYLP Y ++ DWM HFG KW  F++ KA+
Sbjct  421   SGADDWEPLENQNKEILKFC---DKAGIKIKQYLPRYTTKADWMNHFGPKWKIFEDRKAQ  477

Query  352   FDPKMILSPGQTIFN  308
             FDPK ILSPGQ IFN
Sbjct  478   FDPKNILSPGQRIFN  492



>ref|XP_008797779.1| PREDICTED: cytokinin dehydrogenase 6-like [Phoenix dactylifera]
Length=543

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/505 (57%), Positives = 361/505 (71%), Gaps = 16/505 (3%)
 Frame = -1

Query  1786  KPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRF  1607
             +PW   LP E+ ++ I  R R+D  ATT ASTDFG + Q  PA VLYPSSV DI+ LVRF
Sbjct  31    RPWPEELPEELQALGIGPRTRIDHHATTRASTDFGRLTQALPAAVLYPSSVHDIMTLVRF  90

Query  1606  SYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGALRGGG--------KIRVSWSESLGY  1451
             SY+SP PF++A RGHGHSVRGQA A  GVV+EM ++R GG        +IRVS + S+  
Sbjct  91    SYSSPKPFTIAPRGHGHSVRGQALAPHGVVIEMTSMRRGGGGDGDGEPRIRVSPAGSVSG  150

Query  1450  FADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLE  1271
             + D GG + W+DVL   L +G++P SWTDYL+LTVGGTLSNAG+SGQ F  GPQISNV E
Sbjct  151   YVDAGGEQFWIDVLRETLKYGLAPMSWTDYLYLTVGGTLSNAGVSGQAFLHGPQISNVYE  210

Query  1270  LDVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFS  1091
             LDVITGKGE +TCS+D   +LFFAVLGGLGQFGIITRARI LE AP  V+WVR++Y +F 
Sbjct  211   LDVITGKGEMVTCSEDHEPDLFFAVLGGLGQFGIITRARIALEPAPQMVRWVRLIYTNFE  270

Query  1090  KFTRDQEHLISIN----GLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLY  923
              F RDQE LIS++    G NY+EGS++M+H   NNWRSSFFS  D  +I+SL  Q G +Y
Sbjct  271   AFARDQEKLISLDDGNKGFNYVEGSILMDHHVGNNWRSSFFSERDLERISSLAAQYGAVY  330

Query  922   CLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGL  743
             CLE  ++YD      VDQEL+ LL+ LSF+PG  F  D +Y  FLNRVR  EL+ +  GL
Sbjct  331   CLEGARYYDKAMVHMVDQELEWLLEGLSFMPGFAFTNDVTYIRFLNRVRDGELKLRSQGL  390

Query  742   WEATHPWLNLFVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEED  563
             W   HPWLN+FVP+SRI+DF+  VF++IL    ++GP+L+YP     WD RMSAVIP+E+
Sbjct  391   WNVPHPWLNIFVPRSRIIDFDRGVFKSILRHDNSTGPILIYPMDRNKWDRRMSAVIPDEE  450

Query  562   TFYCVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKK  383
              FY +GLL S G++ W+ L+  N+EIL FCN   + G   KQYLPHY ++ DWM+HFG K
Sbjct  451   IFYSIGLLRS-GVHAWERLENQNKEILHFCN---QAGISHKQYLPHYTTQADWMEHFGSK  506

Query  382   WNTFQENKAKFDPKMILSPGQTIFN  308
             W T  E K ++DPK +LSPGQ IF 
Sbjct  507   WETIVERKRRYDPKSLLSPGQQIFT  531



>ref|XP_009352666.1| PREDICTED: cytokinin dehydrogenase 3-like [Pyrus x bretschneideri]
Length=517

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/493 (58%), Positives = 360/493 (73%), Gaps = 21/493 (4%)
 Frame = -1

Query  1732  RFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSPFSVAARGHGHS  1553
             + R D  A   AS+DFG   +  PA VLYP+S++DI +L++FS    +PFS+AARGHGHS
Sbjct  27    KLRDDPEAIKLASSDFGHFHRYNPAAVLYPASINDISSLIKFSNKVSTPFSIAARGHGHS  86

Query  1552  VRGQATAKDGVVVEMGALRGG----GKIRVSWSESLGY-------FADVGGHELWVDVLH  1406
              RGQA A +GVVV+M +L+        I V+ S++ G        +ADVGG +LW+DVLH
Sbjct  87    TRGQAMAPNGVVVDMTSLKNYRPHVSGISVNSSKNSGININNNDNYADVGGGQLWIDVLH  146

Query  1405  ACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSK  1226
             A L HG++P SWTDYL+LTVGGTLSNAGISG  FR GPQI+NV E+DV+TG+G+F+TCS 
Sbjct  147   ATLEHGLTPVSWTDYLYLTVGGTLSNAGISGSAFRFGPQITNVYEMDVVTGQGDFVTCSP  206

Query  1225  DMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISING-  1049
               NSELFF VLGGLGQFGIITRARI LE AP RVKWVRMLY DFS F RDQE LIS+NG 
Sbjct  207   QKNSELFFGVLGGLGQFGIITRARISLEPAPKRVKWVRMLYSDFSTFARDQERLISLNGR  266

Query  1048  -----LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTG  884
                  L+YLEGSLM+N   P+NWRSSFF  S  S+I SL+T++G++YCLEV K+YD+ T 
Sbjct  267   KQRNALDYLEGSLMLNQGPPDNWRSSFFPQSSHSRIVSLVTKRGIIYCLEVSKYYDEHTE  326

Query  883   STVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVP  704
             +TV +EL+ L K LSF+PG  F+KD SY +FLNRVR  E +    G W+  HPWLNLF+P
Sbjct  327   TTVKKELELLFKGLSFLPGFLFEKDVSYVDFLNRVRSGEEKLHSQGQWDVPHPWLNLFIP  386

Query  703   KSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSGG  527
             KS I DF++ VF++I+L+   T+GP+LVYP     WD+RMSAVIP+ED FY VG LYS G
Sbjct  387   KSSISDFDAGVFKDIVLRRNITTGPVLVYPMNRTKWDDRMSAVIPQEDVFYTVGFLYSSG  446

Query  526   MNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFD  347
              + W+  +E N+EIL FC   D  G ++KQYLPH ++++ W+ HFG KW  F + KA FD
Sbjct  447   FDDWEAFEEQNEEILGFC---DRAGLEVKQYLPHIKTQQGWINHFGSKWKAFLKKKALFD  503

Query  346   PKMILSPGQTIFN  308
             PK ILSPGQ IFN
Sbjct  504   PKRILSPGQRIFN  516



>ref|XP_004144003.1| PREDICTED: cytokinin dehydrogenase 3-like [Cucumis sativus]
Length=522

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/502 (57%), Positives = 366/502 (73%), Gaps = 16/502 (3%)
 Frame = -1

Query  1774  SSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNS  1595
             S L     S  +    R DS A ++A+TDFG +V  TPA VL+P+S++D++ L++ + + 
Sbjct  23    SFLTESFFSDHLPTHLRHDSTALSSAATDFGHLVTSTPAAVLFPTSINDLVTLLKLANSR  82

Query  1594  PSPFSVAARGHGHSVRGQATAKDGVVVEMGALRGG-GKIRVSWSESLGYFADVGGHELWV  1418
               PF+VAA+G GHSV GQA A++GVVVEM +L     +I +S S   G+FADVGG ++W+
Sbjct  83    SVPFNVAAKGCGHSVHGQAMAENGVVVEMTSLNNNPSRISISGSADAGFFADVGGEQMWI  142

Query  1417  DVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFI  1238
             DVL A L HG++P SWTDYL+LTVGGTLSNAGISGQ FR GPQI NVLELDV+TGKG+ +
Sbjct  143   DVLTATLKHGLAPPSWTDYLYLTVGGTLSNAGISGQTFRYGPQICNVLELDVVTGKGDIV  202

Query  1237  TCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLIS  1058
             +CS + N+ELF +VLGGLGQFGII RARI L  AP RVKWVRMLY++F +F +DQE LI 
Sbjct  203   SCSAEKNNELFNSVLGGLGQFGIIVRARIPLFPAPNRVKWVRMLYNNFDEFVKDQEKLIL  262

Query  1057  IN-----GLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDD  893
              N     GLNYLEG L+M+   P+NWRSSFF  S  S I SL+ Q  ++YCLEV K+YDD
Sbjct  263   KNSNDDGGLNYLEGLLLMHDGPPDNWRSSFFPPSHHSTIISLVNQHSIIYCLEVAKYYDD  322

Query  892   QTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNL  713
             ++  T+D+EL +LLK L+F+PG  F+KD SY EFLNRVRG EL  +  GLW+  HPWLNL
Sbjct  323   RSRHTIDKELDNLLKGLNFLPGYKFEKDVSYVEFLNRVRGGELSLRSQGLWDVPHPWLNL  382

Query  712   FVPKSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLY  536
             FVPKSRI +FNS VF++I+LK K  +GP+L+YP     WD++MSAVIPEE+ FY +G L 
Sbjct  383   FVPKSRIAEFNSGVFKDIILKRKIANGPILIYPMNRNKWDDKMSAVIPEEEVFYTIGFLN  442

Query  535   SGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKK------WNT  374
             S G + W+ ++E N++IL FC+  D    KIKQYLPHY ++EDW KHFG K      W  
Sbjct  443   SSGYDNWEAVEEQNKDILRFCDSVD---MKIKQYLPHYNTKEDWEKHFGNKWKIIQDWKI  499

Query  373   FQENKAKFDPKMILSPGQTIFN  308
              Q+ K +FDPKMILSPGQ IFN
Sbjct  500   IQDRKNQFDPKMILSPGQKIFN  521



>gb|KCW79507.1| hypothetical protein EUGRSUZ_C00881 [Eucalyptus grandis]
Length=520

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/503 (58%), Positives = 363/503 (72%), Gaps = 17/503 (3%)
 Frame = -1

Query  1774  SSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNS  1595
             +  P   L   +  + R D  + +AAS DFG IV+ETP  VL+PS   DI  LVR +Y+ 
Sbjct  16    AKFPAHSLPDKLTEKLRTDPESISAASVDFGNIVRETPLAVLHPSCPKDIAALVRSAYHG  75

Query  1594  P-SPFSVAARGHGHSVRGQATAKDGVVVEMGAL---RGGG---KIRVSWSESLGYFADVG  1436
               S F++AARG GHSVRGQA A  GVVV+M +L   RGGG    I VSWS SLGY+ADVG
Sbjct  76    DGSSFAIAARGRGHSVRGQAMAPGGVVVDMTSLARHRGGGGGSAISVSWSRSLGYYADVG  135

Query  1435  GHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVIT  1256
             G +LW DVL   L HG+SP SW DYL+LTVGGTLSNAGISGQ FR GPQISNV E+DVIT
Sbjct  136   GGQLWRDVLEETLWHGLSPVSWPDYLYLTVGGTLSNAGISGQTFRYGPQISNVYEMDVIT  195

Query  1255  GKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRD  1076
             G GE  TCS D N ELF++VLGGLGQFGIITRAR+ L++APTRVKW RMLY DFS FTRD
Sbjct  196   GTGELTTCSPDKNPELFYSVLGGLGQFGIITRARVALDRAPTRVKWARMLYSDFSDFTRD  255

Query  1075  QEHLISING------LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLE  914
             QE+LIS NG      L+Y+EG L+M    P++WRSSFF LSD  +I SLL Q  ++YCLE
Sbjct  256   QEYLISKNGRYQDNALDYVEGMLLMPQGPPDSWRSSFFPLSDHPRIISLLKQHKIVYCLE  315

Query  913   VVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEA  734
             V K+YDD T +TV+++L+ L + L+ +P   F+KD +Y +FL+RVR  EL+    GLW+ 
Sbjct  316   VAKYYDDLTQNTVNKDLEKLFEGLNHIPEFEFQKDVAYVDFLDRVREGELKLTAQGLWDV  375

Query  733   THPWLNLFVPKSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIPEEDTF  557
              HPWLNLFVPKSRI DFN  VF+NI+LK   T+GP+L+YP     WD++MSAV+P+ED F
Sbjct  376   PHPWLNLFVPKSRIADFNDGVFKNIILKRNITTGPVLIYPMNRNKWDDQMSAVVPDEDVF  435

Query  556   YCVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWN  377
             Y VG L+S G + W+     N+E+LSFC   ++ G ++K YLP + + ++WM+HFG KW 
Sbjct  436   YTVGFLHSSGFDDWQQFYLQNKELLSFC---EDTGIELKHYLPSFGNEQEWMRHFGSKWR  492

Query  376   TFQENKAKFDPKMILSPGQTIFN  308
              F++ KA+FDPKMI SPGQ IFN
Sbjct  493   RFRQRKARFDPKMIFSPGQKIFN  515



>ref|XP_010047562.1| PREDICTED: cytokinin dehydrogenase 3-like [Eucalyptus grandis]
Length=531

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/503 (58%), Positives = 363/503 (72%), Gaps = 17/503 (3%)
 Frame = -1

Query  1774  SSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNS  1595
             +  P   L   +  + R D  + +AAS DFG IV+ETP  VL+PS   DI  LVR +Y+ 
Sbjct  27    AKFPAHSLPDKLTEKLRTDPESISAASVDFGNIVRETPLAVLHPSCPKDIAALVRSAYHG  86

Query  1594  P-SPFSVAARGHGHSVRGQATAKDGVVVEMGAL---RGGG---KIRVSWSESLGYFADVG  1436
               S F++AARG GHSVRGQA A  GVVV+M +L   RGGG    I VSWS SLGY+ADVG
Sbjct  87    DGSSFAIAARGRGHSVRGQAMAPGGVVVDMTSLARHRGGGGGSAISVSWSRSLGYYADVG  146

Query  1435  GHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVIT  1256
             G +LW DVL   L HG+SP SW DYL+LTVGGTLSNAGISGQ FR GPQISNV E+DVIT
Sbjct  147   GGQLWRDVLEETLWHGLSPVSWPDYLYLTVGGTLSNAGISGQTFRYGPQISNVYEMDVIT  206

Query  1255  GKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRD  1076
             G GE  TCS D N ELF++VLGGLGQFGIITRAR+ L++APTRVKW RMLY DFS FTRD
Sbjct  207   GTGELTTCSPDKNPELFYSVLGGLGQFGIITRARVALDRAPTRVKWARMLYSDFSDFTRD  266

Query  1075  QEHLISING------LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLE  914
             QE+LIS NG      L+Y+EG L+M    P++WRSSFF LSD  +I SLL Q  ++YCLE
Sbjct  267   QEYLISKNGRYQDNALDYVEGMLLMPQGPPDSWRSSFFPLSDHPRIISLLKQHKIVYCLE  326

Query  913   VVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEA  734
             V K+YDD T +TV+++L+ L + L+ +P   F+KD +Y +FL+RVR  EL+    GLW+ 
Sbjct  327   VAKYYDDLTQNTVNKDLEKLFEGLNHIPEFEFQKDVAYVDFLDRVREGELKLTAQGLWDV  386

Query  733   THPWLNLFVPKSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIPEEDTF  557
              HPWLNLFVPKSRI DFN  VF+NI+LK   T+GP+L+YP     WD++MSAV+P+ED F
Sbjct  387   PHPWLNLFVPKSRIADFNDGVFKNIILKRNITTGPVLIYPMNRNKWDDQMSAVVPDEDVF  446

Query  556   YCVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWN  377
             Y VG L+S G + W+     N+E+LSFC   ++ G ++K YLP + + ++WM+HFG KW 
Sbjct  447   YTVGFLHSSGFDDWQQFYLQNKELLSFC---EDTGIELKHYLPSFGNEQEWMRHFGSKWR  503

Query  376   TFQENKAKFDPKMILSPGQTIFN  308
              F++ KA+FDPKMI SPGQ IFN
Sbjct  504   RFRQRKARFDPKMIFSPGQKIFN  526



>ref|XP_008805777.1| PREDICTED: cytokinin dehydrogenase 6-like [Phoenix dactylifera]
Length=546

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/517 (57%), Positives = 373/517 (72%), Gaps = 20/517 (4%)
 Frame = -1

Query  1807  MSILGKLKPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDD  1628
             MSI+ ++ PW  +LP +++++D+A + R+DS AT   STDFGG+ Q  PA V YPSS  D
Sbjct  24    MSIVSQIGPWPGALPQDLVAIDLAAKLRLDSHATALVSTDFGGLTQVAPAAVFYPSSPHD  83

Query  1627  IINLVRFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGALRGG--GKIRVSWSESLG  1454
             I  LV+FSY+S  PF+VA RGHGHS+RGQA A DGVV++M +L  G   +I V   +S  
Sbjct  84    IAVLVQFSYSSSRPFTVAPRGHGHSIRGQAFAPDGVVIDMPSLGRGRADRIIVHSDDSSF  143

Query  1453  YFADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVL  1274
              + D GG +LW+DVLHA L HG+SP SWTDYL+LTVGGTLSNAG+SGQ FR GPQISNV 
Sbjct  144   RYVDAGGEQLWIDVLHAALEHGLSPPSWTDYLYLTVGGTLSNAGVSGQAFRHGPQISNVY  203

Query  1273  ELDVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDF  1094
             ELDVITGKGE +TCS+D NSELF+AVLGGLGQFGIITRARI LE AP RV+WVR++YDDF
Sbjct  204   ELDVITGKGEMVTCSRDYNSELFYAVLGGLGQFGIITRARIALEPAPQRVRWVRLIYDDF  263

Query  1093  SKFTRDQEHLISIN----------GLNYLEGSLMMNHTSP-NNWRSSFFSLSDQSKIASL  947
               FTRDQE LI+I+          G +Y+EGS++    SP  +WRSS F+  D  +IA L
Sbjct  264   GAFTRDQERLIAISASWESKKKGGGFDYVEGSVLAADGSPIGSWRSSSFAGWDAERIARL  323

Query  946   LTQQGLLYCLEVVKHYDDQTGS----TVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRV  779
               Q G++YCLE   +YD    S     VD+EL+ LL++LSFVPG  F  D SY  FL+RV
Sbjct  324   GAQHGVIYCLEGAMYYDSVRASRSWVVVDEELELLLEELSFVPGFAFTNDVSYERFLDRV  383

Query  778   RGEELEPQENGLWEATHPWLNLFVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMW  599
                EL+ +  GLW+  HPWLN+F+PKS I DFNS VF+ IL  ++++GP+L YP     W
Sbjct  384   HDGELKLRSMGLWDVPHPWLNIFLPKSGIQDFNSGVFKKILKHNESTGPILFYPLNKNKW  443

Query  598   DERMSAVIPEEDTFYCVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYR  419
             DERMS+VIP+E+ FY +GLL+S  M+ W+ L+ LN EI+ FC   D++G K KQYLPHY 
Sbjct  444   DERMSSVIPDEEIFYSIGLLWSAIMDDWEYLENLNMEIIQFC---DQKGIKYKQYLPHYL  500

Query  418   SREDWMKHFGKKWNTFQENKAKFDPKMILSPGQTIFN  308
             S+EDWMKHFG +W+ F E K K+DPK +LSPGQ IF 
Sbjct  501   SQEDWMKHFGPRWDKFVEMKRKYDPKALLSPGQKIFT  537



>ref|XP_010915226.1| PREDICTED: cytokinin dehydrogenase 6-like [Elaeis guineensis]
Length=546

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/518 (57%), Positives = 374/518 (72%), Gaps = 21/518 (4%)
 Frame = -1

Query  1807  MSILGKLKPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDD  1628
             MSI+ ++ PW  +LP ++L++DIA +  +DS AT+  STDFGG+ Q +PA V YPSS  D
Sbjct  23    MSIVSQIGPWPGALPQDLLAIDIAAKLHMDSHATSLVSTDFGGLTQASPAAVFYPSSPHD  82

Query  1627  IINLVRFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGALRGG--GKIRVSWSESLG  1454
             I  LV+FSY+S  PF+VA RGHGHS+RGQA A DGVV++M +L  G   +I V   +S  
Sbjct  83    IAVLVQFSYSSSRPFTVAPRGHGHSIRGQAFAPDGVVIDMASLGHGRNDRIIVHSDDSQF  142

Query  1453  YFADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVL  1274
              + D GG +LW+DVLHA L HG++P SWTDYLHLTVGGTLSNAG+SGQ FR GPQISNV 
Sbjct  143   RYVDAGGEQLWIDVLHAALEHGLAPPSWTDYLHLTVGGTLSNAGVSGQAFRHGPQISNVY  202

Query  1273  ELDVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDF  1094
             ELDV+TGKGE +TCS+D NSELF+AVLGGLGQ GIITRARI LE AP RV+WVR++YDDF
Sbjct  203   ELDVVTGKGEMVTCSRDDNSELFYAVLGGLGQLGIITRARIGLEPAPQRVRWVRLIYDDF  262

Query  1093  SKFTRDQEHLISI------------NGLNYLEGSLMMNHTS-PNNWRSSFFSLSDQSKIA  953
              +FTRDQE LI++             G +Y+EGS+++   S   +WRSS F+  D  +IA
Sbjct  263   GEFTRDQERLITMISASKEMKKKKGGGFDYVEGSVLVADGSLIGSWRSSSFAGWDAERIA  322

Query  952   SLLTQQGLLYCLEVVKHYDDQTGS---TVDQELKDLLKDLSFVPGMTFKKDASYFEFLNR  782
              L  + G++YCLE   +YD  T S    VDQEL+ LL++LSFVPG  F  D SY  FL+R
Sbjct  323   RLGAEHGVIYCLEGAMYYDWVTASRSWVVDQELELLLEELSFVPGFAFTNDVSYERFLDR  382

Query  781   VRGEELEPQENGLWEATHPWLNLFVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKM  602
             V   EL+ +  GLW+  HPWLN+FVPKSRI DFN+ +F+ IL  +K++GP+L YP     
Sbjct  383   VHEGELKLRSKGLWDVPHPWLNIFVPKSRIQDFNTGIFKRILKHNKSTGPILFYPMNRDK  442

Query  601   WDERMSAVIPEEDTFYCVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHY  422
             WD+RMS+VIP+E+ FY +G L+S  +N W+ L+ LN EIL FC   D+EG K KQYLPHY
Sbjct  443   WDKRMSSVIPDEEIFYSIGFLWSAIINDWEYLENLNLEILRFC---DQEGIKYKQYLPHY  499

Query  421   RSREDWMKHFGKKWNTFQENKAKFDPKMILSPGQTIFN  308
              S+EDWMKHFG +W+ F E K K+DPK +LSPGQ IF 
Sbjct  500   LSQEDWMKHFGSRWDKFFEMKRKYDPKALLSPGQKIFT  537



>ref|XP_009408848.1| PREDICTED: cytokinin dehydrogenase 6-like [Musa acuminata subsp. 
malaccensis]
Length=533

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/506 (56%), Positives = 361/506 (71%), Gaps = 9/506 (2%)
 Frame = -1

Query  1807  MSILGKLKPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDD  1628
             +SI+G+L+PW  +LP  +L++DIAG   +D  AT   STDFG + +  PA VL PS+ DD
Sbjct  24    ISIVGQLRPWPPTLPQGLLTLDIAGEVLLDPDATAGFSTDFGCLARAAPAAVLRPSAPDD  83

Query  1627  IINLVRFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGALRGGGKIRVSWS---ESL  1457
             I  LVRFSY+SP PF++AARGHGHS+RGQA A  GVVV+M +L  G   R+S S     L
Sbjct  84    IAALVRFSYSSPQPFAIAARGHGHSIRGQALAPGGVVVDMASLGHGRADRISVSFDNAPL  143

Query  1456  GYFADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNV  1277
              ++ D GG +LW+DVLH  L HG++P SWTDYL+LTVGGTLSNAG+SGQ FR GPQISNV
Sbjct  144   VWYVDAGGEQLWIDVLHETLKHGLAPRSWTDYLYLTVGGTLSNAGVSGQAFRHGPQISNV  203

Query  1276  LELDVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDD  1097
              ELDVITGKGE ITCS +  S+LF+ VLGGLGQFGIITRARI LE AP RV+WVR++Y  
Sbjct  204   YELDVITGKGEMITCSHENKSDLFYGVLGGLGQFGIITRARIALEPAPQRVRWVRLIYTH  263

Query  1096  FSKFTRDQEHLISI--NGLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLY  923
             F  F+RDQE LIS+   G +Y+EGSL+M+HT   NWRSSFFS ++  KI  L  + G +Y
Sbjct  264   FVSFSRDQELLISMMDQGFDYVEGSLLMDHTLITNWRSSFFSKTNSEKIRGLAAEFGAIY  323

Query  922   CLE-VVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENG  746
             CLE  V +++    S VDQ+L  LL+ LSFVPG  F  D SY  FL+RV   E++ +  G
Sbjct  324   CLEGAVYYHELAMASRVDQKLHLLLQRLSFVPGFAFTNDVSYVGFLDRVHDGEVKLRSMG  383

Query  745   LWEATHPWLNLFVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEE  566
             LWE  HPWLN+FVPKSRI DF   VF+ IL+ + ++GP+L+YP     W + MSAV P+E
Sbjct  384   LWEVPHPWLNIFVPKSRIQDFEVGVFKGILMPNNSTGPVLIYPMIKNKWHDEMSAVTPDE  443

Query  565   DTFYCVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGK  386
             + FY +GLL S   + W+ LD  N +IL FC++   EG + KQYLPHY S+ DW  HFG+
Sbjct  444   EVFYSIGLLRSAITDDWQDLDNQNDDILGFCHR---EGIQFKQYLPHYASQRDWKNHFGR  500

Query  385   KWNTFQENKAKFDPKMILSPGQTIFN  308
             KW+TF E K ++DPK +LSPGQ IF 
Sbjct  501   KWDTFVEMKRRYDPKALLSPGQRIFT  526



>ref|XP_008242354.1| PREDICTED: cytokinin dehydrogenase 3-like [Prunus mume]
Length=516

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/494 (59%), Positives = 367/494 (74%), Gaps = 19/494 (4%)
 Frame = -1

Query  1741  IAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSPFSVAARGH  1562
             I    R D  +   AS+D+G I++E PA VLYP+S+D+I +L++FS    +PFS+AARGH
Sbjct  25    IGYSLRDDPESIRLASSDYGHILRENPAAVLYPTSIDEISSLIKFSNLISTPFSIAARGH  84

Query  1561  GHSVRGQATAKDGVVVEMGALR------GGGKIRVSWSESLG---YFADVGGHELWVDVL  1409
             GHS  GQA A +GVVV+M +L+        G I  +++ S+    Y+ADVGG +LW+DVL
Sbjct  85    GHSTMGQAMAPNGVVVDMMSLKNHHPSHASGIIVNTFNLSVNNNNYYADVGGGQLWIDVL  144

Query  1408  HACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCS  1229
             HA L HG++P +WTDYL+LTVGGTLSNAGISG  FR GPQISNV E+DV+TG+G+F+TCS
Sbjct  145   HATLEHGLAPVAWTDYLYLTVGGTLSNAGISGSAFRFGPQISNVYEMDVVTGQGDFVTCS  204

Query  1228  KDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISING  1049
                NS+LFF VLGGLGQFGIITRARI LE AP RVKWVRMLY+DFS + RDQE LIS+NG
Sbjct  205   PQNNSDLFFGVLGGLGQFGIITRARIALEPAPKRVKWVRMLYNDFSAYARDQERLISVNG  264

Query  1048  ------LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQT  887
                   L+YLEGSL++N  SPNNWRSSFF  S  S+I SL+T+ G++Y LEV K+YD  T
Sbjct  265   RKQSNALDYLEGSLLINQGSPNNWRSSFFPQSTYSRIISLVTKHGIIYSLEVAKYYDQHT  324

Query  886   GSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFV  707
              +TVD+EL+ LLK LSF+PG  F+KD +Y EFLNRV+  E + Q  G W+  HPWLNLFV
Sbjct  325   ETTVDKELELLLKGLSFLPGFVFEKDVAYVEFLNRVKSGEEKLQSQGQWDVPHPWLNLFV  384

Query  706   PKSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSG  530
             PKSRI DF++ V + I+LK   T+ P+L+YP     WD+RMSAV+PEE+ FY VG L+S 
Sbjct  385   PKSRISDFDAGVLKGIVLKRNITTAPVLLYPMNRTKWDDRMSAVVPEEEVFYTVGFLHSS  444

Query  529   GMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKF  350
             G + W+ L+E N+EIL FC      G +IKQYLP+Y++++ WM HFG KWNTFQ+ KA F
Sbjct  445   GFDEWEALEEQNKEILKFCAG---VGIEIKQYLPYYKTQQGWMNHFGSKWNTFQKRKALF  501

Query  349   DPKMILSPGQTIFN  308
             DPK ILSPGQ IFN
Sbjct  502   DPKKILSPGQRIFN  515



>ref|XP_008367923.1| PREDICTED: cytokinin dehydrogenase 3-like [Malus domestica]
Length=519

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/500 (57%), Positives = 356/500 (71%), Gaps = 21/500 (4%)
 Frame = -1

Query  1753  LSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSPFSVA  1574
             L+  +  + R D  A   AS+DFG I +  PA VLYP+S++DI +L++FS N  +PFS+A
Sbjct  22    LTFTMCYKLRDDPEAIKLASSDFGHIHRYNPAAVLYPASINDISSLIKFSNNVSTPFSIA  81

Query  1573  ARGHGHSVRGQATAKDGVVVEMGALRG-----------GGKIRVSWSESLGYFADVGGHE  1427
             ARGHGHS RGQA A +GVVV+M +L                       +   +ADVGG +
Sbjct  82    ARGHGHSTRGQAMAPNGVVVDMTSLTNYRPHVSGISVNSSNNSGININNNDNYADVGGGQ  141

Query  1426  LWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKG  1247
             LW+DVLHA L HG++P SWTDYL+LTVGGTLSNAGISG  FR GPQI+NV E+DV+TG+G
Sbjct  142   LWIDVLHATLEHGLTPVSWTDYLYLTVGGTLSNAGISGSAFRFGPQITNVYEMDVVTGQG  201

Query  1246  EFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEH  1067
              F+TCS   NSELFF VLGGLGQFGIITRARI LE AP RVKWVRMLY DFS F RDQE 
Sbjct  202   GFVTCSPQKNSELFFGVLGGLGQFGIITRARIALEPAPKRVKWVRMLYSDFSTFARDQER  261

Query  1066  LISING------LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVK  905
             LIS+NG      L+YLEGSLM+N   P+NWRS FF  S  S+I SL+T++G++YCLEV K
Sbjct  262   LISLNGRKQSNALDYLEGSLMLNRGPPDNWRSXFFPQSSHSRIISLVTKRGIIYCLEVSK  321

Query  904   HYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHP  725
             +YD+ T +TV +EL+ L K LSF+PG  F+KD SY +FLNRVR  E +    G W+  HP
Sbjct  322   YYDEHTETTVKKELELLFKGLSFLPGFLFEKDVSYVDFLNRVRSGEEKLHSQGQWDVPHP  381

Query  724   WLNLFVPKSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIPEEDTFYCV  548
             WLNLF+PKS I DF++ VF++I+L+   T+GP+LVYP     WD+RMSAVIP+ED FY V
Sbjct  382   WLNLFIPKSSISDFDAGVFKDIVLRRNITTGPVLVYPMNRTKWDDRMSAVIPQEDVFYTV  441

Query  547   GLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQ  368
             G L+S G + W+  +E N+EIL FC   D  G ++KQYLPH ++++ W+ HFG KW  F 
Sbjct  442   GFLHSSGFDDWEAFEEQNEEILGFC---DRAGLEVKQYLPHIKTQQGWINHFGSKWKAFL  498

Query  367   ENKAKFDPKMILSPGQTIFN  308
             + KA FDPK ILSPGQ IFN
Sbjct  499   KKKALFDPKRILSPGQRIFN  518



>ref|XP_004488057.1| PREDICTED: cytokinin dehydrogenase 3-like [Cicer arietinum]
Length=533

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/513 (56%), Positives = 366/513 (71%), Gaps = 16/513 (3%)
 Frame = -1

Query  1807  MSILGKLKPWNSSLPYEILSVD--IAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSV  1634
             +S +GK + W SSLP E+   +  +      D +    AS+D+G +V E PA V  P++V
Sbjct  22    ISTVGKTEQWKSSLPIELSKPNNILFKNVINDPKTIEIASSDYGNLVHEFPAAVFRPTTV  81

Query  1633  DDIINLVRFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGALRGGGKIRVSWSESL-  1457
             +DI++LV+ S+NS  PF +AARG GHS  GQA A+DGVVV+M  LR       +    + 
Sbjct  82    NDIVSLVKLSFNSSVPFRIAARGQGHSTCGQAMARDGVVVDMKGLREINNNNNNVGIKVF  141

Query  1456  --GYFADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQIS  1283
               G + DVGG +LW+DVL+  L +G++P SWTDYL+LTVGGTLSNAGISGQ FR GPQI+
Sbjct  142   KEGNYVDVGGEQLWIDVLYGTLEYGLAPVSWTDYLYLTVGGTLSNAGISGQTFRYGPQIT  201

Query  1282  NVLELDVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLY  1103
             +V ++DV+TGKGEF+TCSK  NSELF  VLGGLGQFGIITRARI LE AP RVKWVR+LY
Sbjct  202   SVHQMDVVTGKGEFVTCSKQKNSELFHGVLGGLGQFGIITRARIALEPAPKRVKWVRLLY  261

Query  1102  DDFSKFTRDQEHLISING-----LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQ  938
              DFS FT+DQE LIS+ G     L+YLEG L+M+    NNWRSSFF L+D  +I SL+TQ
Sbjct  262   SDFSIFTKDQERLISMKGSKNSSLDYLEGMLLMHQGPINNWRSSFFPLADHQRIISLVTQ  321

Query  937   QGLLYCLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEP  758
               +LYCLE+ K+YDDQ+   V++E++ LL+ L+ +PG  ++K+ S+ EFLNRVR  EL+ 
Sbjct  322   HRVLYCLEIAKYYDDQSEINVNKEIQVLLQGLNHIPGFYYEKNVSFVEFLNRVRSGELKL  381

Query  757   QENGLWEATHPWLNLFVPKSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSA  581
             Q  GLW+  HPWLNLF+PKSRILDFNS VF+ I+ K   T+GP+LVYP     WD +MSA
Sbjct  382   QSQGLWDVPHPWLNLFIPKSRILDFNSGVFKKIIYKRNITTGPVLVYPMNRNKWDNKMSA  441

Query  580   VIP--EEDTFYCVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSRED  407
              IP  E++ FY VG L+S G + WK  D  N+EIL FCN   + G K K YLPHYR++ED
Sbjct  442   RIPDEEDEIFYAVGFLHSSGFDNWKEFDAQNREILQFCN---DVGIKYKLYLPHYRTQED  498

Query  406   WMKHFGKKWNTFQENKAKFDPKMILSPGQTIFN  308
             W  HFG KW TF + K +FDP+MILSPGQ IFN
Sbjct  499   WTNHFGPKWTTFLQRKFQFDPRMILSPGQRIFN  531



>ref|XP_010912967.1| PREDICTED: cytokinin dehydrogenase 6 [Elaeis guineensis]
Length=536

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/500 (56%), Positives = 359/500 (72%), Gaps = 12/500 (2%)
 Frame = -1

Query  1786  KPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRF  1607
             +PW   LP E+ ++DI  R R+D   TT +STDFG ++   PA VLYPSSV DI+ LV+F
Sbjct  31    RPWPEELPEELQALDIGPRTRIDPDVTTRSSTDFGRLMHALPAAVLYPSSVHDIMTLVQF  90

Query  1606  SYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGALRGGG---KIRVSWSESLGYFADVG  1436
             SY+S  PF++A RGHGHS+RGQA A  GVV+EM ++R GG   + R+S S   G + D G
Sbjct  91    SYSSSKPFTIAPRGHGHSLRGQALAPHGVVIEMTSMRNGGCDGEPRLSVSPE-GSYVDAG  149

Query  1435  GHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVIT  1256
             G + W+DVL   L +G++P SWTDYL+LTVGGTLSNAG+SGQ F  GPQIS+V ELDVIT
Sbjct  150   GEQFWIDVLQETLKYGLAPRSWTDYLYLTVGGTLSNAGVSGQAFLHGPQISSVYELDVIT  209

Query  1255  GKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRD  1076
             GKGE +TCS+D   +LFFAVLGGLGQFGIITRARI LE AP  V+WVR++Y +F  F RD
Sbjct  210   GKGEMVTCSEDQEPDLFFAVLGGLGQFGIITRARIALEPAPQMVRWVRLIYMNFEAFARD  269

Query  1075  QEHLISIN----GLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVV  908
             QE LIS++    G NY+EGS++M+H   NNWRSSFF   D  +I+SL  Q G +YCLE  
Sbjct  270   QEKLISLDDGKKGFNYVEGSILMHHNVGNNWRSSFFPERDLGRISSLAAQHGAVYCLEGA  329

Query  907   KHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATH  728
             ++YD      VD+EL+ LL+ LSF+PG  FK D +Y  FLNRVR  EL+ +  GLW   H
Sbjct  330   RYYDKAMVHMVDKELESLLEALSFMPGFAFKNDVTYTRFLNRVRDGELKLRSQGLWNVPH  389

Query  727   PWLNLFVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCV  548
             PWLN+FVP+SRI+DF+  +F++IL    + GP+L+YP     WD R SAVIP+E+ FY +
Sbjct  390   PWLNIFVPRSRIIDFDRGIFKSILRHDNSMGPILIYPMNRNKWDRRTSAVIPDEEIFYSI  449

Query  547   GLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQ  368
             GLL+S G++ W+ L++ N+EIL FCN   + G   KQYLPHY ++ DWMKHFG KW+ F 
Sbjct  450   GLLWS-GVHAWEWLEDQNKEILHFCN---QAGINHKQYLPHYTTQADWMKHFGSKWDIFV  505

Query  367   ENKAKFDPKMILSPGQTIFN  308
             E K ++DPK +LSPGQ IF 
Sbjct  506   ERKRRYDPKALLSPGQQIFT  525



>ref|XP_007203595.1| hypothetical protein PRUPE_ppb021417mg [Prunus persica]
 gb|EMJ04794.1| hypothetical protein PRUPE_ppb021417mg [Prunus persica]
Length=516

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/494 (58%), Positives = 365/494 (74%), Gaps = 19/494 (4%)
 Frame = -1

Query  1741  IAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSPFSVAARGH  1562
             I    R D  +   AS+D+G I++E PA VLYP+S+D+I +L++FS    +PFS+AARGH
Sbjct  25    IGYSLRDDPESIRLASSDYGHILRENPAAVLYPTSIDEISSLIKFSNLISTPFSIAARGH  84

Query  1561  GHSVRGQATAKDGVVVEMGALR------GGGKIRVSWSESLG---YFADVGGHELWVDVL  1409
             GHS  GQA A +GVVV+M +L+        G I  +++ S+    Y+ADVGG +LW+DVL
Sbjct  85    GHSTMGQAMAPNGVVVDMMSLKNHLPSHASGIIVNTFNSSVNNNYYYADVGGGQLWIDVL  144

Query  1408  HACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCS  1229
             HA L HG++P +WTDYL+LTVGGTLSNAGISG  FR GPQISNV E+DV+TG+G+F+TCS
Sbjct  145   HASLEHGLAPVAWTDYLYLTVGGTLSNAGISGSAFRFGPQISNVYEMDVVTGQGDFVTCS  204

Query  1228  KDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISING  1049
                NS+LFF VLGGLGQFGIITRARI LE AP RVKWVRMLY+DFS + RDQE LIS+NG
Sbjct  205   PQNNSDLFFGVLGGLGQFGIITRARIALEPAPKRVKWVRMLYNDFSAYARDQERLISVNG  264

Query  1048  ------LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQT  887
                   L+YLEGSL++N  SPNNWRSSFF  S  S+I SL+T+ G++Y LEV K+YD  T
Sbjct  265   RKQSNALDYLEGSLLINQGSPNNWRSSFFPQSTYSRIISLVTKHGIIYSLEVAKYYDQHT  324

Query  886   GSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFV  707
              + VD+EL+ LLK LSF+PG  F+KD +Y EFLNRV+  E + Q  G W+  HPWLNLFV
Sbjct  325   ETAVDKELELLLKGLSFLPGFVFEKDVAYVEFLNRVKSGEEKLQSQGQWDVPHPWLNLFV  384

Query  706   PKSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSG  530
             PKSRI DF++ V + I+LK   T+ P+L+YP     WD+RMSAV+PEE+ FY VG L+S 
Sbjct  385   PKSRISDFDAGVLKGIVLKRNITTAPVLLYPMNRTKWDDRMSAVVPEEEVFYTVGFLHSS  444

Query  529   GMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKF  350
             G + W+ L+E N+EIL FC      G +IKQYLP+Y++++ WM HFG KW TFQ+ KA F
Sbjct  445   GFDEWEALEEQNKEILKFC---ASVGIEIKQYLPYYKTQQGWMNHFGSKWKTFQKRKALF  501

Query  349   DPKMILSPGQTIFN  308
             DPK ILSPGQ IFN
Sbjct  502   DPKKILSPGQRIFN  515



>gb|KCW60471.1| hypothetical protein EUGRSUZ_H03198, partial [Eucalyptus grandis]
Length=545

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/496 (59%), Positives = 360/496 (73%), Gaps = 23/496 (5%)
 Frame = -1

Query  1774  SSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNS  1595
             +SL +++LS+ IA +  VD  +   AS DFG IV+E PA VL PS  +DI  LV F+Y  
Sbjct  64    NSLYHKLLSLPIADKLHVDPESIGEASVDFGLIVREIPAAVLRPSHPEDIAILVAFAY--  121

Query  1594  PSPFSVAARGHGHSVRGQATAKDGVVVEMGALRGGGKIRVSWSESLGYFADVGGHELWVD  1415
                     RG GHSVRGQA A+DGVVV+M +L  G K  VSWS+SLG++ADVGG +LW+D
Sbjct  122   -------TRGCGHSVRGQAMARDGVVVDMTSL--GNKTTVSWSQSLGHYADVGGQQLWID  172

Query  1414  VLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFIT  1235
             VL   L HGV+P SWTDYL+LTVGGTLSNAGISG+ FR GPQISN  E+DVITG G F+T
Sbjct  173   VLEETLKHGVAPVSWTDYLYLTVGGTLSNAGISGETFRYGPQISNAYEMDVITGTGHFLT  232

Query  1234  CSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISI  1055
             CS   N ELF +VLGGLGQF IITRARI L  AP R KWVRMLY DFS FT DQE LIS+
Sbjct  233   CSPHENPELFHSVLGGLGQFVIITRARIALGPAPKRAKWVRMLYSDFSAFTMDQERLISV  292

Query  1054  NG------LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDD  893
             +G      L+Y+EG L +   S ++W  SFFSLSD  ++ SLLT+  LLYC+EV K YD+
Sbjct  293   HGRDQDEALDYVEGQLFIRGNS-DSW-ISFFSLSDHPRLMSLLTEHELLYCIEVAKFYDE  350

Query  892   QTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNL  713
             +T STVD++LK +LKDLS VP   F+KD  Y +FLNRVR EE+  ++ GLW   HPWLNL
Sbjct  351   RTRSTVDKDLKMILKDLSHVPEFLFQKDVGYVDFLNRVRAEEMTLRKLGLWNVPHPWLNL  410

Query  712   FVPKSRILDFNSAVFQNILL-KHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLY  536
             FVPKSRI DFN+ VF+NI+L K+ T+GP+L+YP     WD+RMSAVIP+ED FY VG L 
Sbjct  411   FVPKSRIADFNTGVFKNIVLRKNITTGPVLIYPMNNDKWDDRMSAVIPDEDVFYTVGFLL  470

Query  535   SGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKA  356
             S G   W+  D  N+E+L FC   ++ G K+KQYLP+Y +  +WM+HFG KW  FQE+KA
Sbjct  471   SSGFKDWQEFDLQNKEVLLFC---EDNGIKVKQYLPNYSTEREWMQHFGPKWRAFQESKA  527

Query  355   KFDPKMILSPGQTIFN  308
             +FDPKM+LSPGQ IFN
Sbjct  528   QFDPKMLLSPGQRIFN  543



>ref|XP_008242393.1| PREDICTED: cytokinin dehydrogenase 4-like [Prunus mume]
Length=520

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/487 (58%), Positives = 354/487 (73%), Gaps = 14/487 (3%)
 Frame = -1

Query  1744  DIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYN-SPSPFSVAAR  1568
             DIAG  R D+ +  + STD+G IVQE PA V  P+S +DI +L+ FS N S +PF VAAR
Sbjct  37    DIAGMLRNDTESINSTSTDYGHIVQEFPAAVFNPTSPNDIASLILFSNNNSEAPFGVAAR  96

Query  1567  GHGHSVRGQATAKDGVVVEMGALRGGGKIRVSWSESLGYFADVGGHELWVDVLHACLAHG  1388
             G GHSVRGQ  A DGVV+ M AL  G +I VS S SLG +ADVGG +LW+DVLHA L HG
Sbjct  97    GQGHSVRGQDLAHDGVVINMTALSNGSRIVVSESPSLGSYADVGGEQLWIDVLHATLYHG  156

Query  1387  VSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDMNSEL  1208
             ++P SWTDYL+L+VGGTLSNAGISGQ FR GPQISNV ELDV+TGKG+FITCS     +L
Sbjct  157   LTPVSWTDYLYLSVGGTLSNAGISGQTFRFGPQISNVYELDVVTGKGDFITCSSTKKPKL  216

Query  1207  FFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISI------NGL  1046
             F+AVLGGLGQFGIITRARI L+ AP R KW+R+LY +FS F+ DQE LIS       +G 
Sbjct  217   FYAVLGGLGQFGIITRARIALQPAPNRAKWLRLLYSNFSAFSSDQELLISTSGKMERDGF  276

Query  1045  NYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGSTVDQE  866
             +Y+EG L+M     +    SF+ ++DQ +IASL+ + G++Y +EVVK+YDD T  TVD+ 
Sbjct  277   DYVEGLLLMQQGPLD---LSFYPVADQPRIASLVNKYGVVYTIEVVKYYDDSTRDTVDKV  333

Query  865   LKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKSRILD  686
             +++L K LSFVPG  F++D SY EFL+RVR EE   +  GLW+  HPW+NLFVPKSRI D
Sbjct  334   VENLTKRLSFVPGFMFEQDVSYEEFLDRVRNEEKMLKSLGLWDIAHPWMNLFVPKSRISD  393

Query  685   FNSAVFQNILLKHKTSGPM-LVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSGGMNGWKV  509
             FNS VF++ILLK K    + L+YP     WD RMSAVIP+ED FY VGLL+S G N W+ 
Sbjct  394   FNSGVFKDILLKQKVPAALTLIYPMNRNKWDGRMSAVIPDEDVFYVVGLLHSSGFNEWQA  453

Query  508   LDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFDPKMILS  329
              DE+N+++L FC   ++ G  +KQYLPHY ++EDW  HFG  W +FQE K K DP  IL+
Sbjct  454   FDEVNKQLLQFC---EDAGIMVKQYLPHYETQEDWKNHFGSNWQSFQEMKTKSDPNKILA  510

Query  328   PGQTIFN  308
             PGQ IFN
Sbjct  511   PGQRIFN  517



>ref|XP_010047563.1| PREDICTED: cytokinin dehydrogenase 3-like [Eucalyptus grandis]
 gb|KCW79508.1| hypothetical protein EUGRSUZ_C00883 [Eucalyptus grandis]
Length=531

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/517 (55%), Positives = 371/517 (72%), Gaps = 25/517 (5%)
 Frame = -1

Query  1807  MSILGKLKPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDD  1628
             +S +GK KP   SL  +++S     +   D  + + ASTDFG IV ETP GVL PS  ++
Sbjct  21    LSTVGKSKPRTQSLIPKLIS-----KLCTDPESISMASTDFGNIVWETPQGVLQPSCHEE  75

Query  1627  IINLVRFSY---NSPSPFSVAARGHGHSVRGQATAKDGVVVEM-------GALRGGGKIR  1478
             I++LVR +Y   N  +PF +AARG GHSVRGQA A  G+VV+M       G   GG  + 
Sbjct  76    IVDLVRNAYSDDNPSAPFPIAARGCGHSVRGQALAPGGIVVDMTSLASHQGGTGGGPAVA  135

Query  1477  VSWSESLGYFADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRC  1298
             VSWS SLG++ADV G ++W DVL   L HG++P SWTDYL++TVGGTLSN GISGQ FR 
Sbjct  136   VSWSRSLGHYADVSGGQIWRDVLEETLRHGLAPVSWTDYLYVTVGGTLSNGGISGQTFRY  195

Query  1297  GPQISNVLELDVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKW  1118
             GPQISNV E+D+ITG  E +TCS D N ELF++VLGGLGQFGIITRARI L++AP RVKW
Sbjct  196   GPQISNVYEMDIITGTEELMTCSPDKNPELFYSVLGGLGQFGIITRARIALDRAPKRVKW  255

Query  1117  VRMLYDDFSKFTRDQEHLISING------LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKI  956
             VRMLY DFS FTRDQEHLIS +G      L+Y+EG L+M+   P++WRSSFF   D  +I
Sbjct  256   VRMLYSDFSAFTRDQEHLISKSGRDQDDALDYVEGLLLMHQGPPDSWRSSFFPEPDHPRI  315

Query  955   ASLLTQQGLLYCLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVR  776
             ASL+ +  L+YCLEV K+YDD T +TV+++L++L ++LS +P   F+KD +Y +FL+RVR
Sbjct  316   ASLMDRHELIYCLEVAKYYDDLTENTVNRDLENLFQELSHIPEFLFQKDVTYIDFLDRVR  375

Query  775   GEELEPQENGLWEATHPWLNLFVPKSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMW  599
               EL+ +  G W+A HPWLNLFVPKSRI DFN+ VF+NI+LK   T+G +L+YP     W
Sbjct  376   KGELKLRAQGRWDAPHPWLNLFVPKSRISDFNNGVFKNIVLKRNITTGTVLIYPMNRNKW  435

Query  598   DERMSAVIPEEDTFYCVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYR  419
             D+RMS V+P+E+ FY VG L++ G + W+  D  N+E+L FC   ++   ++KQYLPH+ 
Sbjct  436   DDRMSTVVPDENVFYFVGFLHASGFDDWQEFDLQNEELLQFC---EDACIEVKQYLPHFG  492

Query  418   SREDWMKHFGKKWNTFQENKAKFDPKMILSPGQTIFN  308
             S  +WM+HFG KW  F+E KA+FDPKM+ +PGQ IF+
Sbjct  493   SEREWMRHFGSKWRLFRERKAQFDPKMVFAPGQRIFD  529



>ref|XP_003595184.1| Cytokinin dehydrogenase [Medicago truncatula]
 gb|ABN05760.1| FAD linked oxidase, N-terminal [Medicago truncatula]
 gb|AES65435.1| cytokinin oxidase/dehydrogenase-like protein [Medicago truncatula]
Length=540

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/526 (54%), Positives = 366/526 (70%), Gaps = 35/526 (7%)
 Frame = -1

Query  1807  MSILGKLKPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDD  1628
             +S +GK + W     +   + +I+ +   D +A   AS+D+G +V E PA V  PS+V+D
Sbjct  22    ISTVGKTEQWK----FTTKNSNISQKLINDPKAIELASSDYGNLVHEFPAAVFQPSTVND  77

Query  1627  IINLVRFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGALRG---------------  1493
             I++LV+ SYNS  PF +AARG GHS RGQA A+DGVVV+M  LR                
Sbjct  78    IVSLVKLSYNSSVPFLIAARGQGHSTRGQAMARDGVVVDMKGLRRLKNNNKNNEHNNKNV  137

Query  1492  GGKIRVSWSESLGYFADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISG  1313
             G ++        GY+ DVGG +LW+DVL+  L +G++P SWTDYL+LT+GGTLSNAGISG
Sbjct  138   GIEVFEDPKVGFGYYVDVGGEQLWIDVLYETLEYGLAPVSWTDYLYLTIGGTLSNAGISG  197

Query  1312  QMFRCGPQISNVLELDVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAP  1133
             Q FR GPQI++V +LDV+TGKGEF+TCSK  NSELF  VLGGLGQFGIITRARI LE AP
Sbjct  198   QTFRYGPQITSVHQLDVVTGKGEFVTCSKQNNSELFNGVLGGLGQFGIITRARIALEPAP  257

Query  1132  TRVKWVRMLYDDFSKFTRDQEHLISING-----LNYLEGSLMMNHTSPNNWRSSFFSLSD  968
              RVKWVR+LY DFS FT+DQE LIS+ G     L+YLEG ++MN    NNWRSSFF L+D
Sbjct  258   KRVKWVRLLYSDFSVFTKDQERLISMKGNKNSALDYLEGMVLMNQGPINNWRSSFFPLTD  317

Query  967   QSKIASLLTQQGLLYCLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFL  788
               +I SL+TQ  +LYCLE+ K+YD  + + V++E++ LL+ L+++PG  ++K+ S+ EFL
Sbjct  318   HHRILSLVTQHTVLYCLEIAKYYDYHSENNVNKEIQVLLQGLNYIPGFHYEKNVSFVEFL  377

Query  787   NRVRGEELEPQENGLWEATHPWLNLFVPKSRILDFNSAVFQNILLKHK-TSGPMLVYPTT  611
             NRVR  EL+ Q  GLW+  HPWLN+F+PKSRILDFN  VF+ I+ K   T+GP+LVYP  
Sbjct  378   NRVRSGELKLQSQGLWDVPHPWLNMFIPKSRILDFNLGVFKKIIQKRNITTGPVLVYPMN  437

Query  610   TKMWDERMSAVIP--EEDTFYCVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKI--  443
                WD  MSA IP  EED FY VG L+S G + WK  D  N+EIL FCN      +KI  
Sbjct  438   RNKWDNEMSATIPDDEEDIFYAVGFLHSSGFDNWKAFDAQNKEILQFCNH-----AKINY  492

Query  442   KQYLPHYRSREDWMKHFG-KKWNTFQENKAKFDPKMILSPGQTIFN  308
             K YLPHY ++E+W  HFG KKW TF + K +FDP+MILSPGQ IFN
Sbjct  493   KLYLPHYSTQEEWTNHFGPKKWKTFLQRKNEFDPRMILSPGQRIFN  538



>ref|XP_011077993.1| PREDICTED: cytokinin dehydrogenase 4-like [Sesamum indicum]
Length=499

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/490 (59%), Positives = 353/490 (72%), Gaps = 20/490 (4%)
 Frame = -1

Query  1753  LSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSY-NSPSPFSV  1577
             L  DI    R D  A  AAS D+G +V + P+ VLYPSS++DI+ L++ S  N  +PF++
Sbjct  22    LPTDITNGIRTDPDAIRAASNDYGNLVHQVPSAVLYPSSINDIVELIKASCCNYSTPFTI  81

Query  1576  AARGHGHSVRGQATAKDGVVVEMGAL-RGGGKIRVSWSESLGYFADVGGHELWVDVLHAC  1400
             AARG GHSVRGQA A  GVVVEM AL R GG IRVSWS SLGY+ADVGG E+W DVL   
Sbjct  82    AARGRGHSVRGQAMAGGGVVVEMAALSRNGGGIRVSWSRSLGYYADVGGEEMWADVLRVG  141

Query  1399  LAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDM  1220
             L HG++P SWTDYL+LTVGGTLSNAGISGQ FR GPQISNVLELDV+TGKGE ITCS++M
Sbjct  142   LEHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRHGPQISNVLELDVVTGKGELITCSRNM  201

Query  1219  NSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISINGLNY  1040
             NSELFF  LGGLGQFGIITRARIVL+KAP R +W R++Y +FS+FTRDQE LI  N  NY
Sbjct  202   NSELFFGALGGLGQFGIITRARIVLDKAPARARWARLIYSNFSEFTRDQERLILTNASNY  261

Query  1039  LEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGSTVDQELK  860
             +EG L+ N  +   WRSSF S S QS +ASL  +  LLY +E+VK+YD+ T ST+D+E  
Sbjct  262   VEGFLITNERTTKQWRSSFSSPSHQSDVASLWKKHRLLYSIELVKYYDNLTASTIDKEFG  321

Query  859   DLLKDLSFVPGMTFKKDASYFEFLNRVRG-----EELEPQENGLWEATHPWLNLFVPKSR  695
              +L++L+F+PG  F++D    +FLNR        EELE          HPWLNLF+PKSR
Sbjct  322   VILEELNFIPGFIFRRDVPLVDFLNRAGNLDDGREELE---------AHPWLNLFIPKSR  372

Query  694   ILDFNSAVFQNILLK-HKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSGGMNG  518
             I DF   V +N++ K  KT G  + YP  TK WD RMSAV P+ED FY +GLL+SG  N 
Sbjct  373   IHDFYDGVLENMIPKLRKTPGLFIFYPLNTKKWDSRMSAVTPDEDVFYNLGLLHSGRPNE  432

Query  517   WKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFDPKM  338
               V +  N ++L FC K    G K+KQYLP+++SREDW+KHFG KW+ FQ+ K +FDPKM
Sbjct  433   SDVFELFNNQVLGFCEK---AGIKVKQYLPYHKSREDWIKHFGSKWSIFQQRKMEFDPKM  489

Query  337   ILSPGQTIFN  308
             ILSPGQ IFN
Sbjct  490   ILSPGQRIFN  499



>ref|XP_010026880.1| PREDICTED: cytokinin dehydrogenase 3-like [Eucalyptus grandis]
Length=520

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/497 (58%), Positives = 357/497 (72%), Gaps = 17/497 (3%)
 Frame = -1

Query  1774  SSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNS  1595
             +SL +++LS+ IA +  VD  +   AS DFG IV+E P  VL PS  +DI  LV F+YN 
Sbjct  21    NSLYHKLLSLPIADKLHVDPESIGEASVDFGLIVREIPVAVLRPSHPEDIAILVAFAYNK  80

Query  1594  -PSPFSVAARGHGHSVRGQATAKDGVVVEMGALRGGGKIRVSWSESLGYFADVGGHELWV  1418
              P PF+++ARG GHSVRGQA A+DGVVV+M +L  G K  VSWS+SLG++ADVGG +LW+
Sbjct  81    FPIPFTISARGCGHSVRGQAMARDGVVVDMTSL--GNKTTVSWSQSLGHYADVGGQQLWI  138

Query  1417  DVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFI  1238
             DVL   L HGV+P SWTDYL+LTVGGTLSNAGISG  FR GPQISNV E+DVITG G F+
Sbjct  139   DVLEETLKHGVAPVSWTDYLYLTVGGTLSNAGISGGTFRYGPQISNVYEMDVITGTGHFL  198

Query  1237  TCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLIS  1058
             TCS   N ELF +VLGGLGQFGIITRARI L  AP R KWV+MLY DFS FT DQE LIS
Sbjct  199   TCSPHENPELFHSVLGGLGQFGIITRARIALGPAPKRAKWVKMLYSDFSAFTTDQERLIS  258

Query  1057  ING------LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYD  896
              +       L+Y+EG L M   S ++W  SFFS  D  ++ SL+T+  LLYC+EV K YD
Sbjct  259   RHRRDQDEVLDYVEGQLFMRRNS-DSW-ISFFSSLDHPRLMSLVTEHELLYCIEVAKFYD  316

Query  895   DQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLN  716
             + T S VD++L+ +LKDLS  P   ++KD  Y +FLNRVR  E+  +E GLW   HPWLN
Sbjct  317   ECTQSAVDKDLEKILKDLSHGPEFLYQKDVGYVDFLNRVRVGEMVLREQGLWNVPHPWLN  376

Query  715   LFVPKSRILDFNSAVFQNILL-KHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLL  539
             LFVPKSRI DFN+ VF+NI+L K+ T+  +L+YP     WD+RMSAVIP+ED FY VG L
Sbjct  377   LFVPKSRIADFNTGVFKNIVLKKNMTTELVLIYPMNNDKWDDRMSAVIPDEDVFYAVGFL  436

Query  538   YSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENK  359
             +S G   W+  D  N+E+L FC     E + IKQYLP+Y +  DW++HFG KW  F+ENK
Sbjct  437   HSSGFEDWQEFDLQNKEVLHFC-----EDNGIKQYLPNYSTESDWIQHFGPKWRKFEENK  491

Query  358   AKFDPKMILSPGQTIFN  308
             A+FDPKM+LSPGQ IFN
Sbjct  492   AQFDPKMLLSPGQNIFN  508



>ref|XP_007203856.1| hypothetical protein PRUPE_ppa021859mg [Prunus persica]
 gb|EMJ05055.1| hypothetical protein PRUPE_ppa021859mg [Prunus persica]
Length=480

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/482 (58%), Positives = 348/482 (72%), Gaps = 14/482 (3%)
 Frame = -1

Query  1729  FRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYN-SPSPFSVAARGHGHS  1553
              R D+ +  + STD+G IVQE PA V  P+S +DI +L+ FS N S +PF VAARG GHS
Sbjct  2     LRNDTESINSTSTDYGHIVQEFPAAVFNPTSPNDIASLILFSNNNSYAPFGVAARGQGHS  61

Query  1552  VRGQATAKDGVVVEMGALRGGGKIRVSWSESLGYFADVGGHELWVDVLHACLAHGVSPAS  1373
             VRGQ  A DGVV+ M AL  G +I VS S SLG +ADVGG +LW+DVLHA L HG++P S
Sbjct  62    VRGQDLAPDGVVINMTALSNGSRIVVSESPSLGSYADVGGEQLWIDVLHATLDHGLTPVS  121

Query  1372  WTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDMNSELFFAVL  1193
             WTDYL+L+VGGTLSNAGISGQ FR GPQISNV ELDV+TGKG+FITCS     +LF+AVL
Sbjct  122   WTDYLYLSVGGTLSNAGISGQTFRFGPQISNVYELDVVTGKGDFITCSSTKKPKLFYAVL  181

Query  1192  GGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISI------NGLNYLEG  1031
             GGLGQFGIITRARI L+ AP R KWVR+LY +FS F+ DQE LIS       +G +Y+EG
Sbjct  182   GGLGQFGIITRARIALQPAPNRAKWVRLLYSNFSAFSSDQELLISTSGKMERDGFDYVEG  241

Query  1030  SLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGSTVDQELKDLL  851
              L+M     +    SF+ ++DQ +IASL+ Q G++Y +EV+K+YDD T  TVD+ ++ L 
Sbjct  242   LLLMQQGPLD---LSFYPVADQPRIASLVNQYGIVYTIEVIKYYDDSTRDTVDKVVEKLT  298

Query  850   KDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKSRILDFNSAV  671
             K LSFVPG  F++D SY EFL+RVR EE   Q  GLW+  HPW+NLFVPKSRI DF+S V
Sbjct  299   KRLSFVPGFMFEQDVSYEEFLDRVRIEEKILQSLGLWDIAHPWMNLFVPKSRISDFDSGV  358

Query  670   FQNILLKHKTSGPM-LVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSGGMNGWKVLDELN  494
             F++ILLK K    + L+YP     WD RMSAVIP+ED FY VGLL+S G N W   DE+N
Sbjct  359   FKDILLKQKVPAALILIYPMNRNKWDGRMSAVIPDEDVFYVVGLLHSSGFNEWPAFDEVN  418

Query  493   QEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFDPKMILSPGQTI  314
              ++L FC+   + G  +KQYLPHY+++EDW  HFG  W +FQE K K DP  IL+PGQ I
Sbjct  419   TQLLQFCH---DAGIMVKQYLPHYQTQEDWKNHFGSNWQSFQEMKTKSDPNKILAPGQRI  475

Query  313   FN  308
             FN
Sbjct  476   FN  477



>emb|CBI37291.3| unnamed protein product [Vitis vinifera]
Length=467

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/458 (62%), Positives = 345/458 (75%), Gaps = 20/458 (4%)
 Frame = -1

Query  1669  ETPAGVLYPSSVDDIINLVRFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGALRG-  1493
             E P G+L    VD  I+ ++          +AARG GHS+RGQA A  GVVVEM +L   
Sbjct  24    EWPPGIL----VDLFIHQIQLH--------IAARGQGHSLRGQAMASHGVVVEMRSLNNC  71

Query  1492  --GGKIRVSWSESLGYFADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGI  1319
               G  IRV+ +   G +ADVGG + W+DVL A L HG++P SWTDYL+LT+GGTLSNAGI
Sbjct  72    SCGSGIRVTKNPIWGSYADVGGEQQWIDVLQATLKHGLAPVSWTDYLYLTIGGTLSNAGI  131

Query  1318  SGQMFRCGPQISNVLELDVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEK  1139
             SGQ FR GPQISNV E+DV+TGKGE +TCSKD NSELFFAVLGGLGQFGIITRARI LE 
Sbjct  132   SGQTFRHGPQISNVYEMDVLTGKGELVTCSKDTNSELFFAVLGGLGQFGIITRARIALEP  191

Query  1138  APTRVKWVRMLYDDFSKFTRDQEHLISINGLNYLEGSLMMNHTSPNNWRSSFFSLSDQSK  959
             AP RVKW++MLYDDFS F+RDQEHLISINGL+YLEGSL M ++ PNNWRSS FS S+  +
Sbjct  192   APERVKWIQMLYDDFSTFSRDQEHLISINGLDYLEGSLSMQNSPPNNWRSS-FSPSEYPR  250

Query  958   IASLLTQQGLLYCLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRV  779
             I+SL+++ G++YCLEVVK+YD+ T  TVD+EL+ LLK L+F+PG  F KD S  +FLNRV
Sbjct  251   ISSLISKNGIIYCLEVVKYYDELTSHTVDEELQVLLKGLNFLPGFVFTKDVSLVDFLNRV  310

Query  778   RGEELEPQENGLWEATHPWLNLFVPKSRILDFNSAVFQNILLK-HKTSGPMLVYPTTTKM  602
                EL  +  GLW+  HPWLNLFVP+S I DFNS VF++IL K ++T+GP LVYP     
Sbjct  311   HSGELNLRAKGLWDVPHPWLNLFVPRSSISDFNSGVFRDILPKINQTTGPFLVYPMIRNK  370

Query  601   WDERMSAVIPEEDTFYCVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHY  422
             WD+R SAVIP+ED FY VG+L+S G + W+ L+  N+EIL FC   D+ G KIK+YL  Y
Sbjct  371   WDDRTSAVIPDEDIFYTVGVLHSSGADDWEPLENQNKEILKFC---DKAGIKIKRYLSRY  427

Query  421   RSREDWMKHFGKKWNTFQENKAKFDPKMILSPGQTIFN  308
              ++EDWM HFG KW TF++ KA+FDPKMILSPGQ IFN
Sbjct  428   TTKEDWMNHFGPKWRTFEDRKAQFDPKMILSPGQQIFN  465



>emb|CBI37295.3| unnamed protein product [Vitis vinifera]
Length=632

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/428 (64%), Positives = 335/428 (78%), Gaps = 8/428 (2%)
 Frame = -1

Query  1579  VAARGHGHSVRGQATAKDGVVVEMGALRG---GGKIRVSWSESLGYFADVGGHELWVDVL  1409
              AARG GHS+RGQA A  GVVVEM +L     G  IRV+ +   G +ADVGG + W+DVL
Sbjct  207   TAARGQGHSLRGQAMASHGVVVEMRSLNNCSCGSGIRVTKNPIWGSYADVGGEQQWIDVL  266

Query  1408  HACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCS  1229
              A L HG++P SWTDYL+LT+GGTLSNAGISGQ FR GPQISNV E+DV+TGKGE +TCS
Sbjct  267   QATLKHGLAPVSWTDYLYLTIGGTLSNAGISGQTFRHGPQISNVYEMDVLTGKGELVTCS  326

Query  1228  KDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISING  1049
             KD NSELFFAVLGGLGQFGII RARI L+ AP RVKW++MLYDDFS F+RDQEHLISING
Sbjct  327   KDTNSELFFAVLGGLGQFGIIIRARIALKPAPKRVKWIQMLYDDFSTFSRDQEHLISING  386

Query  1048  LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGSTVDQ  869
             L+YLEGSL+M ++SPNNWRSS FS S+  +I+SL+++ G++YCLEVVK+YD+ T  TVD+
Sbjct  387   LDYLEGSLLMQNSSPNNWRSS-FSPSEYPRISSLISKNGIIYCLEVVKYYDELTSHTVDE  445

Query  868   ELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKSRIL  689
             EL++LLK L+F+PG  F KD S  +FLNRV  EEL  Q  GLW+  HPWLNLFVP SRI 
Sbjct  446   ELQELLKGLNFLPGFVFTKDVSLVDFLNRVHSEELNLQAKGLWDVPHPWLNLFVPGSRIS  505

Query  688   DFNSAVFQNILLK-HKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSGGMNGWK  512
             DFNS VF++IL K ++T+G  LVYP     WD+R SAVIP+ED FY VGLL+S G + W+
Sbjct  506   DFNSGVFRDILPKINQTTGTFLVYPVIRNKWDDRTSAVIPDEDIFYTVGLLHSSGADDWE  565

Query  511   VLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFDPKMIL  332
              L+  N+EIL FC   D+ G KIK+YL  Y ++EDWM HFG KW TF++ KA+FDPK+IL
Sbjct  566   PLENQNKEILQFC---DKAGIKIKRYLSRYTTKEDWMNHFGPKWRTFEDRKAQFDPKLIL  622

Query  331   SPGQTIFN  308
             SPGQ IFN
Sbjct  623   SPGQQIFN  630


 Score =   221 bits (564),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 136/184 (74%), Gaps = 6/184 (3%)
 Frame = -1

Query  1789  LKPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQE-TPAGVLYPSSVDDIINLV  1613
             L+PW   LP E+ S+DIA R RVD  AT  AS DFG +V    PA VLYPSS++DI +LV
Sbjct  26    LRPWPDVLPNELQSLDIASRLRVDPDATRMASRDFGKLVHPPNPAAVLYPSSIEDIASLV  85

Query  1612  RFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGAL----RGGGKIRVSWSESLGYFA  1445
             +FSYN   PFS+AARG GHS+RGQA A  GVVVEM +L    RG G IRV+ +   G +A
Sbjct  86    KFSYNRSFPFSIAARGQGHSLRGQAMAPHGVVVEMRSLNNCSRGSG-IRVTKNPISGSYA  144

Query  1444  DVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELD  1265
             D GG +LW+DVL A L HG++P SWTDYL+LT+GGTLSNAGISGQ FR GPQISNV E+D
Sbjct  145   DAGGEQLWIDVLQATLKHGLAPVSWTDYLYLTIGGTLSNAGISGQTFRHGPQISNVYEMD  204

Query  1264  VITG  1253
             V+T 
Sbjct  205   VLTA  208



>ref|XP_004173096.1| PREDICTED: LOW QUALITY PROTEIN: cytokinin dehydrogenase 3-like, 
partial [Cucumis sativus]
Length=508

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/467 (58%), Positives = 347/467 (74%), Gaps = 17/467 (4%)
 Frame = -1

Query  1720  DSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSPFSVAARGHGHSVRGQ  1541
             D    T AS+D+G +V+ETPA VL PSS++D++ L+ ++YN+P PF +AARG GHSVRGQ
Sbjct  46    DPETLTIASSDYGNMVKETPAVVLEPSSINDVVQLISYAYNNPIPFHIAARGQGHSVRGQ  105

Query  1540  ATAKDGVVVEMGALRGGGK---IRVS---WSESLGYFADVGGHELWVDVLHACLAHGVSP  1379
             A AK+GVV++M ALR   K   I VS   W+    ++ DVGG +LW++VL+A L +G++P
Sbjct  106   AMAKNGVVIDMSALRRNRKTPRIVVSCRRWTTG-EFYVDVGGEQLWIEVLNATLGYGMTP  164

Query  1378  ASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDMNSELFFA  1199
              SWTDYL++TVGGT SNAGISGQ FR GPQ+SNV+E+DV+TGKG  +TCS   N ELF A
Sbjct  165   VSWTDYLYITVGGTXSNAGISGQSFRYGPQVSNVVEMDVVTGKGNMMTCSPRKNCELFHA  224

Query  1198  VLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISING------LNYL  1037
             VLGGLGQFGII RARI LE APTRVKWVRMLY +F  FT+DQEHLIS+NG      LNYL
Sbjct  225   VLGGLGQFGIIARARIALEPAPTRVKWVRMLYTNFVAFTKDQEHLISLNGRKQVNALNYL  284

Query  1036  EGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGSTVDQELKD  857
             EG ++++H SP+NWRSSFF LSD S+I SL  Q  ++YCLEVVK+YD  T STVD++L+ 
Sbjct  285   EGLVLLHHGSPDNWRSSFFPLSDHSRIISLANQNSVIYCLEVVKYYDHHTQSTVDKDLEV  344

Query  856   LLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKSRILDFNS  677
             LL+ L +  G  F+KD +Y EFLNRVR  EL+ Q  GLW+  HPWLNLFVP+SRI+DF+S
Sbjct  345   LLEGLDYESGFKFEKDVTYVEFLNRVRSGELKLQSKGLWDVPHPWLNLFVPRSRIIDFDS  404

Query  676   AVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSGGMNGWKVLDE  500
              VF++I+++   T GP+L+YP     WD+R S VIP+E+ FY VG L S G + WK  +E
Sbjct  405   GVFKDIIVRRNITKGPILIYPMNRSKWDDRNSTVIPDEEVFYTVGFLNSSGFDDWKKFEE  464

Query  499   LNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENK  359
              N+EIL +C K    G +IKQYLPHY+++  W+ H G KW TFQ NK
Sbjct  465   QNEEILEYCEK---SGIEIKQYLPHYKTQTQWIHHXGSKWTTFQHNK  508



>ref|XP_009393975.1| PREDICTED: cytokinin dehydrogenase 6-like [Musa acuminata subsp. 
malaccensis]
Length=534

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/505 (55%), Positives = 351/505 (70%), Gaps = 10/505 (2%)
 Frame = -1

Query  1804  SILGKLKPWNS-SLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDD  1628
             SI+G+ KP  + SL  EI S+ +     VD  A   ASTDFG I +  PA V  PSS  D
Sbjct  25    SIVGQHKPGPAVSLLQEIHSLKLNSTVCVDPEAVDRASTDFGLITRAVPAAVFRPSSDSD  84

Query  1627  IINLVRFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGALRGGG--KIRVSWSESLG  1454
             I  LV FSY S  PF +A RG GHSVRGQA A+DGVVV+MGALRG G  +IRV       
Sbjct  85    IAALVGFSYASARPFGIAPRGRGHSVRGQALARDGVVVDMGALRGDGQGRIRVCGEGCRP  144

Query  1453  YFADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVL  1274
              + D GG +LW+DVL   + HG++P SWTDYL+LTVGGTLSNAGISGQ F  GPQISNV 
Sbjct  145   SYVDAGGEQLWIDVLRETMKHGLAPRSWTDYLYLTVGGTLSNAGISGQTFLYGPQISNVY  204

Query  1273  ELDVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDF  1094
             ELDVITGKGE +TCS+   ++LFFAVLGGL QFGIITRARI +E APT V+WVR++Y DF
Sbjct  205   ELDVITGKGETVTCSEQHEADLFFAVLGGLAQFGIITRARIAIEPAPTMVRWVRLIYKDF  264

Query  1093  SKFTRDQEHLISI---NGLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLY  923
             + FT DQE LIS+    G NY+EGS++M  +  +NWRSSF+   D ++I+ L  Q G +Y
Sbjct  265   AAFTSDQERLISLEKKKGFNYVEGSVIMADSLTDNWRSSFYVEEDITRISRLAAQYGAVY  324

Query  922   CLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGL  743
             CLE  K+YD  T S++DQEL+ ++ DL ++PG  F+ D SY  FLNRVR  E + Q  GL
Sbjct  325   CLEGAKYYDHATASSIDQELRSVVDDLRYLPGFEFRNDVSYMHFLNRVREGETKLQSRGL  384

Query  742   WEATHPWLNLFVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEED  563
             W   HPWLN+ +P+SRIL+F+  VF++IL  + + GP+L+       WD+R SAV+P+E+
Sbjct  385   WNVPHPWLNMLIPRSRILEFDRGVFKSILKHNNSVGPILICAMNRNKWDQRTSAVVPDEE  444

Query  562   TFYCVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKK  383
              FY +GLL S GM+GWK L+E N+EIL FC   D+ G   +QYLPHY S  DW KHFG K
Sbjct  445   VFYAIGLLRS-GMDGWKNLEEQNEEILRFC---DDAGISYRQYLPHYTSLADWRKHFGAK  500

Query  382   WNTFQENKAKFDPKMILSPGQTIFN  308
             W+ F E K ++DP+ +LSPGQ IF 
Sbjct  501   WDVFVERKMRYDPRALLSPGQRIFT  525



>gb|KCW60470.1| hypothetical protein EUGRSUZ_H03197, partial [Eucalyptus grandis]
Length=487

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/483 (59%), Positives = 346/483 (72%), Gaps = 17/483 (4%)
 Frame = -1

Query  1732  RFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNS-PSPFSVAARGHGH  1556
             +  VD  +   AS DFG IV+E P  VL PS  +DI  LV F+YN  P PF+++ARG GH
Sbjct  2     KLHVDPESIGEASVDFGLIVREIPVAVLRPSHPEDIAILVAFAYNKFPIPFTISARGCGH  61

Query  1555  SVRGQATAKDGVVVEMGALRGGGKIRVSWSESLGYFADVGGHELWVDVLHACLAHGVSPA  1376
             SVRGQA A+DGVVV+M +L  G K  VSWS+SLG++ADVGG +LW+DVL   L HGV+P 
Sbjct  62    SVRGQAMARDGVVVDMTSL--GNKTTVSWSQSLGHYADVGGQQLWIDVLEETLKHGVAPV  119

Query  1375  SWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDMNSELFFAV  1196
             SWTDYL+LTVGGTLSNAGISG  FR GPQISNV E+DVITG G F+TCS   N ELF +V
Sbjct  120   SWTDYLYLTVGGTLSNAGISGGTFRYGPQISNVYEMDVITGTGHFLTCSPHENPELFHSV  179

Query  1195  LGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISING------LNYLE  1034
             LGGLGQFGIITRARI L  AP R KWV+MLY DFS FT DQE LIS +       L+Y+E
Sbjct  180   LGGLGQFGIITRARIALGPAPKRAKWVKMLYSDFSAFTTDQERLISRHRRDQDEVLDYVE  239

Query  1033  GSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGSTVDQELKDL  854
             G L M   S ++W  SFFS  D  ++ SL+T+  LLYC+EV K YD+ T S VD++L+ +
Sbjct  240   GQLFMRRNS-DSW-ISFFSSLDHPRLMSLVTEHELLYCIEVAKFYDECTQSAVDKDLEKI  297

Query  853   LKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKSRILDFNSA  674
             LKDLS  P   ++KD  Y +FLNRVR  E+  +E GLW   HPWLNLFVPKSRI DFN+ 
Sbjct  298   LKDLSHGPEFLYQKDVGYVDFLNRVRVGEMVLREQGLWNVPHPWLNLFVPKSRIADFNTG  357

Query  673   VFQNILL-KHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSGGMNGWKVLDEL  497
             VF+NI+L K+ T+  +L+YP     WD+RMSAVIP+ED FY VG L+S G   W+  D  
Sbjct  358   VFKNIVLKKNMTTELVLIYPMNNDKWDDRMSAVIPDEDVFYAVGFLHSSGFEDWQEFDLQ  417

Query  496   NQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFDPKMILSPGQT  317
             N+E+L FC     E + IKQYLP+Y +  DW++HFG KW  F+ENKA+FDPKM+LSPGQ 
Sbjct  418   NKEVLHFC-----EDNGIKQYLPNYSTESDWIQHFGPKWRKFEENKAQFDPKMLLSPGQN  472

Query  316   IFN  308
             IFN
Sbjct  473   IFN  475



>ref|XP_009352704.1| PREDICTED: cytokinin dehydrogenase 2-like [Pyrus x bretschneideri]
Length=513

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/481 (56%), Positives = 347/481 (72%), Gaps = 8/481 (2%)
 Frame = -1

Query  1744  DIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSPFSVAARG  1565
             DI+G  R D+ +  + STD+G IV +  + VL P+S +DI +L+  + N+ +PFSVAARG
Sbjct  37    DISGSLRNDTESINSTSTDYGHIVYQYASAVLNPTSPNDIASLILSANNNSAPFSVAARG  96

Query  1564  HGHSVRGQATAKDGVVVEMGAL-RGGGKIRVSWSESLGYFADVGGHELWVDVLHACLAHG  1388
              GHSVRGQA   DGVV+ M AL   G +I VS S SLG +ADVGG + W+DVLHA L  G
Sbjct  97    QGHSVRGQALTSDGVVINMTALISNGSRIVVSESPSLGSYADVGGEQRWIDVLHATLDRG  156

Query  1387  VSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDMNSEL  1208
             ++P SWTDYL+L+VGGTLSNAGISGQ FR GPQI+NV ELDV+TGKGE +TCS +    L
Sbjct  157   LTPVSWTDYLYLSVGGTLSNAGISGQTFRYGPQINNVYELDVVTGKGELVTCSSNKVPGL  216

Query  1207  FFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISINGLNYLEGS  1028
             F+AVLGGLGQFGIITRARI LE AP R KWVRM+Y +FS F++DQE L++ NG +YLEG 
Sbjct  217   FYAVLGGLGQFGIITRARIPLEPAPKRAKWVRMMYSNFSAFSKDQERLMANNGFDYLEGF  276

Query  1027  LMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGSTVDQELKDLLK  848
             L+M     +    SF+ L DQ +I +L+ Q G++Y +E  K+YDD T +TVD+ ++ L+ 
Sbjct  277   LLMKQGPLD---LSFYPLLDQPRITALINQYGIIYYIEAAKYYDDSTRTTVDKVVEKLIN  333

Query  847   DLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKSRILDFNSAVF  668
              LSFVPG  F +D  Y +FL+RV  EE + +  GLW+  HPWLN+FVPKSRILD +S VF
Sbjct  334   GLSFVPGFLFDQDVLYIDFLDRVHTEEEKLRSLGLWDIAHPWLNVFVPKSRILDIDSGVF  393

Query  667   QNILLKHKT-SGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSGGMNGWKVLDELNQ  491
             +NILLK    +   L+YP   K WD RMSAVIP+ED FY VGLL++ G N W+  DE+N+
Sbjct  394   RNILLKQNVPTAVTLIYPMNRKKWDGRMSAVIPDEDVFYVVGLLHASGFNDWQAFDEVNR  453

Query  490   EILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFDPKMILSPGQTIF  311
             +IL FCN   + G  +KQYLPHY ++EDW  HFG KW +FQ+ K +FDP  IL+PGQ IF
Sbjct  454   QILQFCN---DAGILVKQYLPHYETQEDWKNHFGTKWQSFQDRKVRFDPNKILAPGQRIF  510

Query  310   N  308
             +
Sbjct  511   S  511



>ref|XP_003635659.1| PREDICTED: cytokinin dehydrogenase 3-like, partial [Vitis vinifera]
Length=418

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/421 (64%), Positives = 331/421 (79%), Gaps = 10/421 (2%)
 Frame = -1

Query  1555  SVRGQATAKDGVVVEMGAL----RGGGKIRVSWSESLGYFADVGGHELWVDVLHACLAHG  1388
             S+RGQA A  GVVVEM +L    RG G IRV+ +   G +AD GG +LW+DVL A L HG
Sbjct  1     SLRGQAMAPHGVVVEMRSLNNCSRGSG-IRVTKNPISGSYADAGGEQLWIDVLQATLKHG  59

Query  1387  VSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDMNSEL  1208
             ++P SWTDYL+LT+GGTLSNAGISGQ FR GPQISNV E+DV+TGKGE +TCSKD NSEL
Sbjct  60    LAPVSWTDYLYLTIGGTLSNAGISGQTFRHGPQISNVYEMDVLTGKGELVTCSKDTNSEL  119

Query  1207  FFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISINGLNYLEGS  1028
             FFAVLGGLGQFGII RARI L+ AP RVKW++MLYDDFS F+RDQEHLISINGL+YLEGS
Sbjct  120   FFAVLGGLGQFGIIIRARIALKPAPKRVKWIQMLYDDFSTFSRDQEHLISINGLDYLEGS  179

Query  1027  LMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGSTVDQELKDLLK  848
             L+M ++SPNNWRSS FS S+  +I+SL+++ G++YCLEVVK+YD+ T  TVD+EL++LLK
Sbjct  180   LLMQNSSPNNWRSS-FSPSEYPRISSLISKNGIIYCLEVVKYYDELTSHTVDEELQELLK  238

Query  847   DLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKSRILDFNSAVF  668
              L+F+PG  F KD S  +FLNRV  EEL  +  GLW+  HPWLNLFVP SRI DFNS VF
Sbjct  239   GLNFLPGFVFTKDVSLVDFLNRVHSEELNLRAKGLWDVPHPWLNLFVPGSRISDFNSGVF  298

Query  667   QNILLK-HKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSGGMNGWKVLDELNQ  491
             ++IL K ++T+G  LVYP     WD+R SAVIP+ED FY VGLL+S G + W+ L+  N+
Sbjct  299   RDILPKINQTTGTFLVYPVIRNKWDDRTSAVIPDEDIFYTVGLLHSSGADDWEPLENQNK  358

Query  490   EILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFDPKMILSPGQTIF  311
             EIL FC   D+ G KIK+YL  Y +++DWM HFG KW TF++ KA+FDPKMILSPGQ IF
Sbjct  359   EILKFC---DKAGIKIKRYLSRYTTKKDWMNHFGPKWRTFEDRKAQFDPKMILSPGQQIF  415

Query  310   N  308
             N
Sbjct  416   N  416



>ref|XP_010443356.1| PREDICTED: cytokinin dehydrogenase 3 [Camelina sativa]
Length=519

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/492 (56%), Positives = 359/492 (73%), Gaps = 10/492 (2%)
 Frame = -1

Query  1774  SSLPYEILS-VDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYN  1598
             S  P+ ILS  D AG+    S +  +A+TDFG + +  P+ VL PSSV+DI +LV+ SY+
Sbjct  33    SPQPWNILSHNDFAGKLTTASSSIESAATDFGHVTKIFPSAVLNPSSVEDITDLVKLSYD  92

Query  1597  SPSPFSVAARGHGHSVRGQATAKDGVVVEMGALRGGGK-IRVSWSESLGYFADVGGHELW  1421
             S   F++AARGHGHS RGQA+AKDGVVV M ++    + I+VS     G +ADV    LW
Sbjct  93    SQPSFTLAARGHGHSHRGQASAKDGVVVNMRSMVNRDRGIKVS---RTGLYADVDAAWLW  149

Query  1420  VDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEF  1241
             ++VL+  L  G++P SWTDYL+LTVGGTLSNAGISGQ FR GPQI+NV E+DVITGKGE 
Sbjct  150   IEVLNKTLELGLTPVSWTDYLYLTVGGTLSNAGISGQTFRYGPQITNVQEMDVITGKGEI  209

Query  1240  ITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLI  1061
              TCSKDMNS+LFFA LGG GQFGIITRARI LE AP R KW R LY DFS+FTRDQE LI
Sbjct  210   ATCSKDMNSDLFFAALGGFGQFGIITRARIKLEVAPKRAKWFRFLYIDFSEFTRDQERLI  269

Query  1060  S-INGLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTG  884
             S  +G+++LEGS+M++H  P+NWRS+++  SD  +I S++ +  ++YCLEVVK+YD+ + 
Sbjct  270   SETDGVDFLEGSVMLDHGPPDNWRSTYYPPSDHLRIVSMVKRHRVIYCLEVVKYYDETSQ  329

Query  883   STVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVP  704
               V++E++DL + L+FV G  ++KD +Y +FLNRVR  EL  +  G W+  HPWLNLFVP
Sbjct  330   YAVNEEMEDLGESLNFVKGFMYEKDVTYMDFLNRVRTGELSLKSKGQWDVPHPWLNLFVP  389

Query  703   KSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSGG  527
             KS+I  F+++VF+ I+L++  TSGP+LVYP     W+ERMSA IPEED FY VG L S  
Sbjct  390   KSQISKFDNSVFKGIILRNNITSGPVLVYPMNRNKWNERMSAAIPEEDVFYAVGFLRSAD  449

Query  526   MNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFD  347
              + W+  D+ N EIL FC   ++   +I QYLP++ S+E W++HFG +WN F E K K+D
Sbjct  450   FDDWEAYDKENMEILKFC---EDANMRIIQYLPYHSSQEGWVRHFGPRWNIFLERKYKYD  506

Query  346   PKMILSPGQTIF  311
             PKMILSPGQ IF
Sbjct  507   PKMILSPGQNIF  518



>ref|XP_009361720.1| PREDICTED: cytokinin dehydrogenase 4-like [Pyrus x bretschneideri]
Length=513

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/473 (57%), Positives = 339/473 (72%), Gaps = 8/473 (2%)
 Frame = -1

Query  1720  DSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSPFSVAARGHGHSVRGQ  1541
             D+ +  + STD+G IV E PA VL P+S +DI +L+  S N+ +PFSVAARG GHSVRGQ
Sbjct  45    DTGSINSTSTDYGHIVYEFPAAVLNPTSPNDIASLILSSNNNSAPFSVAARGQGHSVRGQ  104

Query  1540  ATAKDGVVVEMGAL-RGGGKIRVSWSESLGYFADVGGHELWVDVLHACLAHGVSPASWTD  1364
             A    GVV+ M AL R G +I VS S SLG +ADVGG + W+DVL A L  G++P SWTD
Sbjct  105   ALTSGGVVINMTALIRNGSRIVVSESPSLGSYADVGGEQRWIDVLRATLERGLTPVSWTD  164

Query  1363  YLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDMNSELFFAVLGGL  1184
             YL+L+VGGTLSNAGISGQ F  GPQI+NV ELDV+TGKGE +TCS     ELF+AVLGGL
Sbjct  165   YLYLSVGGTLSNAGISGQTFLYGPQINNVYELDVVTGKGELVTCSSKKVPELFYAVLGGL  224

Query  1183  GQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISINGLNYLEGSLMMNHTSP  1004
             GQFG+ITRARI L  AP R KWVRM+Y +FS F+RDQEHL++ NG +YLEG L+M     
Sbjct  225   GQFGVITRARIPLAPAPKRAKWVRMMYSNFSAFSRDQEHLMAPNGFDYLEGFLLMKQGPV  284

Query  1003  NNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGM  824
             +    SF+ L DQ +IA+L+ Q G++Y +E  K+YDD T  TVD+ +   +K LSFVP  
Sbjct  285   D---LSFYPLLDQPRIAALINQYGIIYYIEAAKYYDDSTRKTVDKVVDKTIKGLSFVPEF  341

Query  823   TFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKSRILDFNSAVFQNILLKHK  644
              F++D SY +FL+RV  EE   +  GLWE  HPWLN+FVPKSRI D +S VF+NILLK  
Sbjct  342   LFEQDVSYIDFLDRVHTEEENLRSLGLWEIAHPWLNIFVPKSRISDIDSGVFRNILLKQN  401

Query  643   TSGPM-LVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSGGMNGWKVLDELNQEILSFCNK  467
                 + L+YP   K WD RMSAVIP+ED FY VGLL++ G N W+  DE+N+++L FC  
Sbjct  402   VPTAVSLIYPVNRKKWDGRMSAVIPDEDVFYVVGLLHASGFNDWQAFDEVNRQLLQFCKD  461

Query  466   DDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFDPKMILSPGQTIFN  308
              D    ++KQYLPHY +REDW  HFG+KW +FQ+ K +FDP  IL+PGQ IF+
Sbjct  462   AD---IRVKQYLPHYETREDWKNHFGRKWQSFQDMKVRFDPNKILAPGQRIFS  511



>ref|XP_010026879.1| PREDICTED: cytokinin dehydrogenase 3-like [Eucalyptus grandis]
Length=507

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/501 (54%), Positives = 363/501 (72%), Gaps = 14/501 (3%)
 Frame = -1

Query  1783  PWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFS  1604
             P  +SL +++LS+ IA +   D  + +AAS D+G  VQE PA VL PS ++DI+ LV F 
Sbjct  10    PSTNSLHHKLLSLPIADKLHFDPESISAASVDYGFFVQEIPAAVLRPSCLEDIMTLVAFR  69

Query  1603  YNSPS-PFSVAARGHGHSVRGQATAKDGVVVEMGAL-RGGGKIRVSWSESLGYFADVGGH  1430
              N  S PF+++ARG GHSVRGQA A+DGVVV+M +L   G +  VS+S+SLG++ADVGGH
Sbjct  70    NNESSIPFTISARGRGHSVRGQAMARDGVVVDMTSLGNKGHETTVSYSQSLGHYADVGGH  129

Query  1429  ELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGK  1250
             E+W +VL   L HG++P + TDY + TVGGTLSNAGI G+ FR GPQI+NV E+DVITG 
Sbjct  130   EIWFNVLEHTLKHGLAPVTLTDYQYATVGGTLSNAGIGGEAFRNGPQITNVHEMDVITGT  189

Query  1249  GEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQE  1070
             G+F+TCS   N +LF++VLGGLGQFGIITRARI L  AP R KWVR+LY DFS FT DQE
Sbjct  190   GDFLTCSPHKNPDLFYSVLGGLGQFGIITRARIALRPAPKRAKWVRLLYSDFSAFTTDQE  249

Query  1069  HLISIN------GLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVV  908
              LIS +       L+++EG L+M H + + W  SFF LSD+ ++ SLLT+  LLYC++  
Sbjct  250   RLISRHQRDQDEALDFVEGCLLM-HRNMDTW-VSFFPLSDRPRVMSLLTEHKLLYCIKAA  307

Query  907   KHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATH  728
             K+YD+QT STV+++L+ +LKDL+ VP   F+KD ++ +FLNR+R  EL  +E GLW   H
Sbjct  308   KYYDEQTESTVEKDLEIILKDLNHVPEFKFEKDVAFIDFLNRIRVAELRLREQGLWNIPH  367

Query  727   PWLNLFVPKSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIPEEDTFYC  551
             PWL+LFVPKSR+ D N+ +F++I LK+  T+G +L+YP     WD+RMSAV P+ED FY 
Sbjct  368   PWLDLFVPKSRMADINTGIFKDIALKNNITTGCVLIYPMNKNKWDDRMSAVTPDEDIFYT  427

Query  550   VGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTF  371
             V  L++ G   W+  +  N+E+LSF     + G K K+YLP+YR+  +WM+HFG KW TF
Sbjct  428   VEFLHTSGFGDWQECELQNKEMLSFLK---DNGIKFKRYLPNYRTEREWMEHFGPKWRTF  484

Query  370   QENKAKFDPKMILSPGQTIFN  308
             Q +KAKFDPK++LSPGQ IFN
Sbjct  485   QGSKAKFDPKLLLSPGQRIFN  505



>ref|XP_010451656.1| PREDICTED: cytokinin dehydrogenase 3-like isoform X2 [Camelina 
sativa]
Length=519

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/492 (55%), Positives = 358/492 (73%), Gaps = 10/492 (2%)
 Frame = -1

Query  1774  SSLPYEILSVD-IAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYN  1598
             S  P+ ILS D  AG+    S +  +A+TDFG + +  P+ VL PSSV+DI +L++ SY+
Sbjct  33    SPQPWNILSHDDFAGKLTTASSSIESAATDFGHVTKIFPSAVLNPSSVEDITDLLKLSYD  92

Query  1597  SPSPFSVAARGHGHSVRGQATAKDGVVVEMGALRGGGK-IRVSWSESLGYFADVGGHELW  1421
             S   F++AARGHGHS RGQA+AKDGVVV M ++    + I+VS     G +ADV    LW
Sbjct  93    SQPSFTLAARGHGHSHRGQASAKDGVVVNMRSMVNRDRGIKVS---RTGLYADVDAAWLW  149

Query  1420  VDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEF  1241
             ++VL+  L  G++P SWTDYL+LTVGGTLSNAGISGQ FR GPQI+NV E+DVITGKGE 
Sbjct  150   IEVLNKTLELGLTPVSWTDYLYLTVGGTLSNAGISGQTFRYGPQITNVQEMDVITGKGES  209

Query  1240  ITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLI  1061
              TCSKDMNS+LFFA LGGLGQFGIITRARI LE AP R KW R LY DFS+FTRDQE LI
Sbjct  210   ATCSKDMNSDLFFAALGGLGQFGIITRARIKLEVAPKRAKWFRFLYIDFSEFTRDQERLI  269

Query  1060  S-INGLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTG  884
             S  +GL++LEGS+M++   P+NWRS+++  SD  +I S++ ++ ++YCLEVVK+YD+ + 
Sbjct  270   SETDGLDFLEGSVMLDRGPPDNWRSTYYPPSDHLRIVSMVKRRRVIYCLEVVKYYDETSQ  329

Query  883   STVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVP  704
              TV++E+++L + L+FV G  ++KD +Y +FLNRVR  EL  +  G W+  HPWLNLFVP
Sbjct  330   YTVNEEMEELGESLNFVKGFMYEKDVTYMDFLNRVRTGELSLKSKGQWDVPHPWLNLFVP  389

Query  703   KSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSGG  527
             KS+I  F+  VF+ I+L++  TSGP+LVYP     W++RMSA IPEED FY VG L S  
Sbjct  390   KSQISKFDHGVFKGIILRNNITSGPVLVYPMNRNKWNDRMSAAIPEEDVFYAVGFLRSAD  449

Query  526   MNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFD  347
              + W+  D  N EIL FC   ++   ++ QYLP++ S+E W++HFG +WN F E K K+D
Sbjct  450   FDDWEAYDRENMEILKFC---EDANMRVIQYLPYHSSQEGWVRHFGPRWNIFLERKYKYD  506

Query  346   PKMILSPGQTIF  311
             PKMILSPGQ IF
Sbjct  507   PKMILSPGQNIF  518



>ref|XP_011094005.1| PREDICTED: cytokinin dehydrogenase 3-like [Sesamum indicum]
Length=501

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/475 (58%), Positives = 354/475 (75%), Gaps = 8/475 (2%)
 Frame = -1

Query  1729  FRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSPFSVAARGHGHSV  1550
              R DS +   AS D+G IV E P+ VL+PSSV +I  LVR S     PF+VAARG GHSV
Sbjct  32    LRNDSDSIKKASNDYGNIVHEIPSAVLFPSSVKEISCLVRSSNERSPPFTVAARGRGHSV  91

Query  1549  RGQATAKDGVVVEMGAL-RGGGKIRVSWSESLGYFADVGGHELWVDVLHACLAHGVSPAS  1373
             RGQA A+ GVVV+M AL +   +IRVS  ES G++ADVG  +LW+DVL A L  G++P S
Sbjct  92    RGQAMARGGVVVDMTALNKTRSRIRVSGKESSGFYADVGAEQLWIDVLRATLKRGLAPVS  151

Query  1372  WTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDMNSELFFAVL  1193
             WT+YL+L+VGGTLSNAGISGQ F+ GPQI+NVLELDVITGKGEFITCS++  ++LFFAVL
Sbjct  152   WTNYLYLSVGGTLSNAGISGQTFQRGPQINNVLELDVITGKGEFITCSRERKAKLFFAVL  211

Query  1192  GGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISINGLNYLEGSLMMNH  1013
             GGLGQFGIITRARI+LEKAPTRVKWVR++Y +FS FT DQEHLIS N  +Y+ G L+++ 
Sbjct  212   GGLGQFGIITRARIILEKAPTRVKWVRLIYSNFSIFTTDQEHLISSNSPDYVLGFLIIDE  271

Query  1012  TSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGSTVDQELKDLLKDLSFV  833
              + N WRSSF S S QS I +LL +QG+LY +E+VK+YD++T ST+D++ + LLK+L++ 
Sbjct  272   NTTNQWRSSFSSPSRQSDIDALLKKQGILYSIELVKYYDNRTTSTIDKDFETLLKELNYN  331

Query  832   PGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKSRILDFNSAVFQNILL  653
             P   F+ D S F+FL+R+   +L+     L   +HPWLNLF+PKSRI DFN+ V   +L 
Sbjct  332   PEFIFRTDTSLFDFLHRI--GDLDSPTGPL--DSHPWLNLFIPKSRISDFNAGVLATLLP  387

Query  652   KHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSGGMNGWKVLDELNQEILSFC  473
             K   S  +L YP   K WD+RMSAVIPEED FY +GLL+S   N +++ DE N ++L FC
Sbjct  388   KLNESSTILFYPFNRKKWDDRMSAVIPEEDVFYTLGLLHSSSPNAYQIYDEFNSQVLGFC  447

Query  472   NKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFDPKMILSPGQTIFN  308
              +    G K+KQYLP+Y+S+ DW++HFG KW TF++ KA FDPK ILSPGQ IFN
Sbjct  448   KR---AGIKVKQYLPNYKSQGDWIQHFGPKWPTFRQRKATFDPKFILSPGQGIFN  499



>ref|XP_010026877.1| PREDICTED: cytokinin dehydrogenase 3-like [Eucalyptus grandis]
Length=507

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/501 (54%), Positives = 362/501 (72%), Gaps = 14/501 (3%)
 Frame = -1

Query  1783  PWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFS  1604
             P  +SL +++LS+ IA +   D  + +AAS D+G IVQE PA VL PS ++DI  LV F 
Sbjct  10    PSTNSLHHKLLSLPIADKLHFDPESISAASVDYGFIVQEIPAAVLRPSCLEDITILVAFR  69

Query  1603  YNSPS-PFSVAARGHGHSVRGQATAKDGVVVEMGALRGGGK-IRVSWSESLGYFADVGGH  1430
             YN  S PF+++ARG GHSVRGQA A+DGVVV+M +L   G    VS+S+SLG++ADVGGH
Sbjct  70    YNESSIPFTISARGRGHSVRGQAMARDGVVVDMTSLGNKGHGTTVSYSQSLGHYADVGGH  129

Query  1429  ELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGK  1250
             ++W +VL   L HG++P + TDY + TVGGTLSNAGI G+ FR GPQI+NV E+DVITG 
Sbjct  130   QIWFNVLEHTLKHGLAPVTLTDYQYATVGGTLSNAGIGGEAFRNGPQITNVHEMDVITGT  189

Query  1249  GEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQE  1070
             G+F+TCS   N +LF++VLGGLGQFGIITRARI L  AP R KWVRMLY DFS FT D E
Sbjct  190   GDFLTCSPHKNPDLFYSVLGGLGQFGIITRARIALRPAPKRAKWVRMLYSDFSAFTTDHE  249

Query  1069  HLISIN------GLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVV  908
              LIS +       L+++EG L+M H + ++W SS F LSD  ++ SLLT+  LLYC++  
Sbjct  250   RLISRHQRDQDEALDFVEGCLLM-HRNMDSWISS-FPLSDHPRLMSLLTEHKLLYCIKAA  307

Query  907   KHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATH  728
             K+YD+QT STV+++L+ +LKDL+ VP   F+KD ++ +FLNR+R  EL+ +E GLW   H
Sbjct  308   KYYDEQTESTVEKDLEIILKDLNHVPEFKFEKDVAFIDFLNRMRVAELQLREQGLWNIPH  367

Query  727   PWLNLFVPKSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIPEEDTFYC  551
             PWLNLFVPKS + D N+ +F++I LK+  T+G +L+YP     WD+RMSAV P+ED FY 
Sbjct  368   PWLNLFVPKSHMADINTGIFKDIALKNNITTGYVLIYPMNKNKWDDRMSAVTPDEDIFYT  427

Query  550   VGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTF  371
             V   ++ G   W+  +  N+E+LSF   +   G K K+YLP+YR+  +WM+HFG KW TF
Sbjct  428   VEFFHASGFGDWQECELQNKEMLSFLKVN---GIKFKRYLPNYRTEREWMEHFGPKWRTF  484

Query  370   QENKAKFDPKMILSPGQTIFN  308
             QE+KAKFDPK++LSPGQ IFN
Sbjct  485   QESKAKFDPKLLLSPGQRIFN  505



>ref|XP_006280310.1| hypothetical protein CARUB_v10026233mg [Capsella rubella]
 gb|EOA13208.1| hypothetical protein CARUB_v10026233mg [Capsella rubella]
Length=517

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/495 (56%), Positives = 358/495 (72%), Gaps = 11/495 (2%)
 Frame = -1

Query  1780  WNSSLPYEILS-VDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFS  1604
             + S  P+ ILS  D AG+    S +  AA+TDFG + +  P+ VL PSSV+DI +LV+ S
Sbjct  28    YTSPQPWNILSHNDFAGKLTTASSSIDAAATDFGHVTKIFPSAVLNPSSVEDITDLVKLS  87

Query  1603  YNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGAL--RGGGKIRVSWSESLGYFADVGGH  1430
             YNS S F++AARGHGHS RGQA+A+DGVVV M ++  R  G I+VS     G +ADV   
Sbjct  88    YNSQSSFTLAARGHGHSHRGQASARDGVVVNMRSMVNRDRGSIKVS---RTGLYADVDAG  144

Query  1429  ELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGK  1250
              LW++VL+  L  G++P SWTDYL+LTVGGTLSN G SGQ FR GPQI+NV ELDVITGK
Sbjct  145   CLWIEVLNKTLELGLTPVSWTDYLYLTVGGTLSNGGFSGQTFRYGPQITNVQELDVITGK  204

Query  1249  GEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQE  1070
             GE  TCSKDMNS+LFFA LGGLGQFGIITRARI L+ AP R KW R LY DFS+FTRDQE
Sbjct  205   GEIATCSKDMNSDLFFAALGGLGQFGIITRARIKLDVAPKRAKWFRFLYIDFSEFTRDQE  264

Query  1069  HLIS-INGLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDD  893
              LIS  +G+++LEGS+M++H  P+NWRS+++  SD  +I S++ +  ++YCLEVVK+YD+
Sbjct  265   RLISETDGVDFLEGSVMLDHGPPDNWRSTYYPPSDHLRIVSMVKRHRVIYCLEVVKYYDE  324

Query  892   QTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNL  713
              +  TV++E+++L + L++V G  ++KD +Y +FLNRVR  EL  +  G W+  HPWLNL
Sbjct  325   TSQYTVNEEMEELSESLNYVKGFMYEKDVTYIDFLNRVRTGELSLKSKGQWDVPHPWLNL  384

Query  712   FVPKSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLY  536
             FVPKS+I  F+  VF+ I+L++  TSGP+LVYP     WD+RMSA IPEED FY VG L 
Sbjct  385   FVPKSQISKFDHGVFKGIVLRNNITSGPVLVYPMNRNKWDDRMSAAIPEEDVFYAVGFLR  444

Query  535   SGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKA  356
             S   + W+  D  N EIL FC   ++   K  QYLP++ S+E W++HFG +WN F E K 
Sbjct  445   SADFDNWEAYDRENMEILKFC---EDANMKAIQYLPYHSSQEGWVRHFGPRWNVFVERKD  501

Query  355   KFDPKMILSPGQTIF  311
             K+DPKMILSPGQ IF
Sbjct  502   KYDPKMILSPGQNIF  516



>ref|XP_008338887.1| PREDICTED: cytokinin dehydrogenase 4-like [Malus domestica]
Length=513

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/481 (56%), Positives = 342/481 (71%), Gaps = 8/481 (2%)
 Frame = -1

Query  1744  DIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSPFSVAARG  1565
             DI      D+ +  + STD+G IV E  A VL P+S +DI++L+  + N+ +P SVAARG
Sbjct  37    DIESLLLNDTGSINSTSTDYGHIVYEFAAAVLNPTSPNDIVSLILSANNNSAPVSVAARG  96

Query  1564  HGHSVRGQATAKDGVVVEMGAL-RGGGKIRVSWSESLGYFADVGGHELWVDVLHACLAHG  1388
              GHSVRGQA    GVV+ M AL R G +I VS S SLG +ADVGG + W+DVL A L  G
Sbjct  97    QGHSVRGQALTSGGVVINMTALIRNGSRIVVSESPSLGSYADVGGEQRWIDVLRATLERG  156

Query  1387  VSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDMNSEL  1208
             ++P SWTDYL+L+VGGTLSNAGISGQ F  GPQI+NV ELDV+TGKGE +TCS     EL
Sbjct  157   LTPVSWTDYLYLSVGGTLSNAGISGQTFLYGPQINNVYELDVVTGKGELVTCSSKKVPEL  216

Query  1207  FFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISINGLNYLEGS  1028
             F+AVLGGLGQFGIITRARI L  AP R KWVRM+Y +FS F+RDQEHL++ NG +YLEG 
Sbjct  217   FYAVLGGLGQFGIITRARIPLAPAPKRAKWVRMMYSNFSAFSRDQEHLMAPNGFDYLEGF  276

Query  1027  LMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGSTVDQELKDLLK  848
             L+M     +    SF+ L DQ +IA+L+ + G++Y +E  K+YDD T  TVD+ ++  +K
Sbjct  277   LLMKQGPLD---LSFYPLLDQPRIAALINRYGIIYYIEAAKYYDDSTTKTVDKVVEKTIK  333

Query  847   DLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKSRILDFNSAVF  668
              LSFVP   F++D SY +FL+RV  EE   +  GLWE  HPWLN+FVPKSRI D +S VF
Sbjct  334   GLSFVPEFLFEQDVSYIDFLDRVHTEEENLRSLGLWEIAHPWLNIFVPKSRISDIDSGVF  393

Query  667   QNILLKHKT-SGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSGGMNGWKVLDELNQ  491
             +NILLK    +    +YP   K WD RMSAVIP+ED FY VGLL++ G N W+  DE+N+
Sbjct  394   RNILLKQNVPTAVSXIYPMNRKRWDGRMSAVIPDEDVFYVVGLLHASGFNDWQAFDEVNR  453

Query  490   EILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFDPKMILSPGQTIF  311
             ++L FC    + G ++KQYLPHY++REDW  HFG+KW +FQ+ K +FDP  IL+PGQ IF
Sbjct  454   QLLQFCT---DAGIRVKQYLPHYKTREDWKNHFGRKWQSFQDMKVRFDPNKILAPGQRIF  510

Query  310   N  308
             +
Sbjct  511   S  511



>emb|CBI33301.3| unnamed protein product [Vitis vinifera]
Length=412

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/414 (64%), Positives = 325/414 (79%), Gaps = 10/414 (2%)
 Frame = -1

Query  1534  AKDGVVVEMGAL----RGGGKIRVSWSESLGYFADVGGHELWVDVLHACLAHGVSPASWT  1367
             A  GVVVEM +L    RG G IRV+ +   G +AD GG +LW+DVL A L HG++P SWT
Sbjct  2     APHGVVVEMRSLNNCSRGSG-IRVTKNPISGSYADAGGEQLWIDVLQATLKHGLAPVSWT  60

Query  1366  DYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDMNSELFFAVLGG  1187
             DYL+LT+GGTLSNAGISGQ FR GPQISNV E+DV+TGKGE +TCSKD NSELFFAVLGG
Sbjct  61    DYLYLTIGGTLSNAGISGQTFRHGPQISNVYEMDVLTGKGELVTCSKDTNSELFFAVLGG  120

Query  1186  LGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISINGLNYLEGSLMMNHTS  1007
             LGQFGII RARI L+ AP RVKW++MLYDDFS F+RDQEHLISINGL+YLEGSL+M ++S
Sbjct  121   LGQFGIIIRARIALKPAPKRVKWIQMLYDDFSTFSRDQEHLISINGLDYLEGSLLMQNSS  180

Query  1006  PNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGSTVDQELKDLLKDLSFVPG  827
             PNNWRSS FS S+  +I+SL+++ G++YCLEVVK+YD+ T  TVD+EL++LLK L+F+PG
Sbjct  181   PNNWRSS-FSPSEYPRISSLISKNGIIYCLEVVKYYDELTSHTVDEELQELLKGLNFLPG  239

Query  826   MTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKSRILDFNSAVFQNILLK-  650
               F KD S  +FLNRV  EEL  +  GLW+  HPWLNLFVP SRI DFNS VF++IL K 
Sbjct  240   FVFTKDVSLVDFLNRVHSEELNLRAKGLWDVPHPWLNLFVPGSRISDFNSGVFRDILPKI  299

Query  649   HKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSGGMNGWKVLDELNQEILSFCN  470
             ++T+G  LVYP     WD+R SAVIP+ED FY VGLL+S G + W+ L+  N+EIL FC 
Sbjct  300   NQTTGTFLVYPVIRNKWDDRTSAVIPDEDIFYTVGLLHSSGADDWEPLENQNKEILKFC-  358

Query  469   KDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFDPKMILSPGQTIFN  308
               D+ G KIK+YL  Y +++DWM HFG KW TF++ KA+FDPKMILSPGQ IFN
Sbjct  359   --DKAGIKIKRYLSRYTTKKDWMNHFGPKWRTFEDRKAQFDPKMILSPGQQIFN  410



>ref|XP_010451653.1| PREDICTED: cytokinin dehydrogenase 3-like isoform X1 [Camelina 
sativa]
Length=519

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/492 (55%), Positives = 357/492 (73%), Gaps = 10/492 (2%)
 Frame = -1

Query  1774  SSLPYEILSVD-IAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYN  1598
             S  P+ ILS D  AG+    S +  +A+TDFG + +  P+ VL PSSV+DI +L++ SY+
Sbjct  33    SPQPWNILSHDDFAGKLTTASSSIESAATDFGHVTKIFPSAVLNPSSVEDITDLLKLSYD  92

Query  1597  SPSPFSVAARGHGHSVRGQATAKDGVVVEMGALRGGGK-IRVSWSESLGYFADVGGHELW  1421
             S   F++AARGHGHS RGQA+AKDGVVV M ++    + I+VS     G +ADV    LW
Sbjct  93    SQPSFTLAARGHGHSHRGQASAKDGVVVNMRSMVNRDRGIKVS---RTGLYADVDAAWLW  149

Query  1420  VDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEF  1241
             ++VL+  L  G++P SWTDYL+LTVGGTLSNAGISGQ FR GPQI+NV E+DVITGKGE 
Sbjct  150   IEVLNKTLELGLTPVSWTDYLYLTVGGTLSNAGISGQTFRYGPQITNVQEMDVITGKGEI  209

Query  1240  ITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLI  1061
              TCSK MNS+LFFA LGGLGQFGIITRARI LE AP R KW R LY DFS+FTRDQE LI
Sbjct  210   ATCSKYMNSDLFFAALGGLGQFGIITRARIKLEVAPKRAKWFRFLYIDFSEFTRDQERLI  269

Query  1060  S-INGLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTG  884
             S  +GL++LEGS+M++   P+NWRS+++  SD  +I S++ ++ ++YCLEVVK+YD+ + 
Sbjct  270   SETDGLDFLEGSVMLDRGPPDNWRSTYYPPSDHLRIVSMVKRRRVIYCLEVVKYYDETSQ  329

Query  883   STVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVP  704
              TV++E+++L + L+FV G  ++KD +Y +FLNRVR  EL  +  G W+  HPWLNLFVP
Sbjct  330   YTVNEEMEELGESLNFVKGFMYEKDVTYMDFLNRVRTGELSLKSKGQWDVPHPWLNLFVP  389

Query  703   KSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSGG  527
             KS+I  F+  VF+ I+L++  TSGP+LVYP     W++RMSA IPEED FY VG L S  
Sbjct  390   KSQISKFDHGVFKGIILRNNITSGPVLVYPMNRNKWNDRMSAAIPEEDVFYAVGFLRSAD  449

Query  526   MNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFD  347
              + W+  D  N EIL FC   ++   ++ QYLP++ S+E W++HFG +WN F E K K+D
Sbjct  450   FDDWEAYDRENMEILKFC---EDANMRVIQYLPYHSSQEGWVRHFGPRWNIFLERKYKYD  506

Query  346   PKMILSPGQTIF  311
             PKMILSPGQ IF
Sbjct  507   PKMILSPGQNIF  518



>ref|XP_008451152.1| PREDICTED: cytokinin dehydrogenase 4 [Cucumis melo]
Length=516

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/483 (55%), Positives = 344/483 (71%), Gaps = 13/483 (3%)
 Frame = -1

Query  1732  RFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSPFSVAARGHGHS  1553
             + + D    + AS D+G +VQE P+GV +P +  D++ L+RF Y SP P  +AARG GH 
Sbjct  39    KLKNDPLTISLASKDYGLMVQENPSGVFFPLTGHDVVGLIRFMYTSPVPLHIAARGQGHC  98

Query  1552  VRGQATAKDGVVVEMGALRG----GGKIRVSWSESLGYFADVGGHELWVDVLHACLAHGV  1385
             VRGQA  ++G+VV M +L G      +I VS +  LG +ADVG  +LW+DVLHA    G+
Sbjct  99    VRGQALVENGLVVNMTSLGGFRQKTSRIVVSTTSPLGPYADVGAEQLWIDVLHATTQKGL  158

Query  1384  SPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDMNSELF  1205
             SP SWTDYLH+TVGGTLSNAGISGQ FR GPQI+NV ELDVITG+GE +TCS   N ELF
Sbjct  159   SPVSWTDYLHITVGGTLSNAGISGQTFRFGPQINNVHELDVITGRGELLTCSPTNNPELF  218

Query  1204  FAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLIS---INGLNYLE  1034
             ++VLGGLGQFGIITRARI L   PTRVKWVRMLY +F+ FT DQE LIS    N  +YLE
Sbjct  219   YSVLGGLGQFGIITRARIALAPTPTRVKWVRMLYTNFASFTSDQETLISRDKSNAPDYLE  278

Query  1033  GSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGSTVDQELKDL  854
             G LM+   + ++  SSF+ L DQ KI+SL++Q G++Y LE+VK+YD  T S+VDQE+++L
Sbjct  279   GLLMLQFNANDD--SSFYPLPDQPKISSLVSQYGIVYVLEIVKYYDQTTSSSVDQEVENL  336

Query  853   LKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKSRILDFNSA  674
             +  L F  GM F KD SY +FL+RV  +E+  +  GLWE  HPW+NLFVPKSRI DF+S 
Sbjct  337   VAGLKFEAGMKFIKDVSYEQFLDRVHTDEVALRALGLWEVPHPWINLFVPKSRIADFDSG  396

Query  673   VFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSGGMNGWKVLDEL  497
             VF+ I+ K   TSG  L YP     WDER SAV+P+ED FY  G L+S G   W+ +D  
Sbjct  397   VFRGIIQKRNLTSGVFLFYPMFKNKWDERTSAVVPDEDVFYAAGFLFSSGFKDWETVDGH  456

Query  496   NQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFDPKMILSPGQT  317
             N++IL FC   +E G ++KQYLPH+ +++DW+ HFG+KW+ F++ KA FDPK +LSPGQ 
Sbjct  457   NRDILKFC---EEAGIEVKQYLPHFETQKDWINHFGRKWSVFRQRKAMFDPKKLLSPGQK  513

Query  316   IFN  308
             IFN
Sbjct  514   IFN  516



>ref|XP_009402032.1| PREDICTED: cytokinin dehydrogenase 6-like [Musa acuminata subsp. 
malaccensis]
Length=524

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/494 (57%), Positives = 350/494 (71%), Gaps = 9/494 (2%)
 Frame = -1

Query  1771  SLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSP  1592
             +LP  +L +DIA R  VD   TT  STDFG + +  P+ VLYPSS DDI  LVRFSY S 
Sbjct  16    TLPQGLLELDIADRIYVDPDTTTRFSTDFGRLTRAPPSAVLYPSSPDDIAALVRFSYFSL  75

Query  1591  SPFSVAARGHGHSVRGQATAKDGVVVEMGALRGGGKIRVSWSESLG---YFADVGGHELW  1421
              PF+VAARG GHSVRGQA A  GVVV+M +L  G   R++ S   G   ++ DVGG +LW
Sbjct  76    HPFTVAARGCGHSVRGQALAPGGVVVDMPSLGRGRDDRINVSRGDGSSFWYVDVGGEQLW  135

Query  1420  VDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEF  1241
             +DVLH  L HG++P SWTDYLHLTVGGTLSNAG+SGQ FR GPQISNV EL+V+TGKGE 
Sbjct  136   IDVLHETLKHGLAPRSWTDYLHLTVGGTLSNAGVSGQAFRHGPQISNVYELEVVTGKGEM  195

Query  1240  ITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLI  1061
             + CS + N  LF+ VLGGLGQ GIITRARI +E AP RV+W R++Y DF  FTRDQE LI
Sbjct  196   MICSHNENPALFYGVLGGLGQLGIITRARIAVEPAPERVRWARLIYTDFVSFTRDQELLI  255

Query  1060  SIN--GLNYLEGSL-MMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQ  890
             S++  G +Y+EGSL MM+H+   NWRSSFFS  D  K+  L +Q G +YCLE   +Y+  
Sbjct  256   SMSEEGFDYVEGSLLMMDHSLIGNWRSSFFSDRDWEKVKLLASQFGAIYCLEGAVYYELA  315

Query  889   TGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLF  710
             T S+VDQ+L   LK LSFVPG  F KD SY  FL+RV   E++ +  GLW+  HPWLN+F
Sbjct  316   TASSVDQKLDSFLKQLSFVPGFAFAKDVSYMAFLDRVHDGEMKLRSMGLWDVPHPWLNIF  375

Query  709   VPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSG  530
             VPKSRI DF   VF+ IL  + + GP+L+YP     WDE+MSAVIP+E+ FY +GLL S 
Sbjct  376   VPKSRIRDFEIGVFKGILKPNNSMGPVLIYPLKKNKWDEKMSAVIPDEEIFYSIGLLRSA  435

Query  529   GMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKF  350
              M  W+ LD+ N EIL FC++   EG + KQYLPHY ++ DWMKHFG KWN F + K ++
Sbjct  436   IMGDWEHLDDQNDEILRFCHR---EGIEYKQYLPHYTAQTDWMKHFGLKWNVFVDLKRRY  492

Query  349   DPKMILSPGQTIFN  308
             DPK++LSPG  IF 
Sbjct  493   DPKLVLSPGHRIFT  506



>ref|XP_009120210.1| PREDICTED: cytokinin dehydrogenase 3 isoform X2 [Brassica rapa]
Length=519

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/492 (54%), Positives = 356/492 (72%), Gaps = 10/492 (2%)
 Frame = -1

Query  1774  SSLPYEILSVD-IAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYN  1598
             SSLP+ ILS D  AG+    S +  +A+TDFG I +  P+ VL PSSV DI +L++ S++
Sbjct  33    SSLPWNILSNDNFAGKLTTASSSVESAATDFGHITKIFPSAVLNPSSVQDITDLIKLSFD  92

Query  1597  SPSPFSVAARGHGHSVRGQATAKDGVVVEMGALRGGGK-IRVSWSESLGYFADVGGHELW  1421
             S S F +AARGHGHS RGQA AKDGVVV M ++    + I+VS +   G +ADV    LW
Sbjct  93    SQSSFPLAARGHGHSHRGQAAAKDGVVVNMRSMVNRDRGIKVSRT---GLYADVDSAWLW  149

Query  1420  VDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEF  1241
             ++VL+  L  G++P SWTDYL+LTVGGTLSN GISGQ FR GPQISNVLE+DVITGKGE 
Sbjct  150   IEVLNKTLELGLTPVSWTDYLYLTVGGTLSNGGISGQTFRYGPQISNVLEMDVITGKGEI  209

Query  1240  ITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLI  1061
              TCSKDMNS+LF+A LGGLGQFGIITRARI LE AP + KW+R LY DFS+FTRDQE LI
Sbjct  210   ATCSKDMNSDLFYAALGGLGQFGIITRARIKLELAPKKAKWLRFLYTDFSEFTRDQERLI  269

Query  1060  S-INGLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTG  884
             S  NG ++LEGS+M++H  P+NWRS+++  S+  +I S++ Q  ++YCLEVVK+YD+ + 
Sbjct  270   SETNGPHFLEGSVMLDHGPPDNWRSTYYPPSEHMRIVSMVKQHRVIYCLEVVKYYDETSQ  329

Query  883   STVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVP  704
              +V++E+++L   L++  G  ++KD +Y +FLNRVR  EL+ +  G W+  HPWLNLFVP
Sbjct  330   HSVNEEMEELSDSLNYERGFVYEKDVTYMDFLNRVRTGELKLKSKGKWDVPHPWLNLFVP  389

Query  703   KSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSGG  527
             KS+I  F   VF+ I+L++  T+GP+LVYP     W++RMS VIPEED FY VG L S  
Sbjct  390   KSQISRFEYGVFKGIILRNNITTGPLLVYPMNRNKWNDRMSTVIPEEDVFYAVGFLRSAS  449

Query  526   MNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFD  347
              + W   ++ N E+L FC   ++   ++ QYLP+Y S+E W+ HFG +WN F E K ++D
Sbjct  450   FDNWDDYEKENMEVLKFC---EDANMRVIQYLPYYASQEGWVGHFGPRWNIFLERKYRYD  506

Query  346   PKMILSPGQTIF  311
             P+MILSPGQ IF
Sbjct  507   PRMILSPGQNIF  518



>ref|NP_200507.1| cytokinin dehydrogenase 3 [Arabidopsis thaliana]
 sp|Q9LTS3.1|CKX3_ARATH RecName: Full=Cytokinin dehydrogenase 3; AltName: Full=Cytokinin 
oxidase 3; Short=AtCKX3; Short=CKO 3; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG30906.1|AF303979_1 cytokinin oxidase [Arabidopsis thaliana]
 dbj|BAA97027.1| cytokinin oxidase [Arabidopsis thaliana]
 gb|ACE62889.1| At5g56970 [Arabidopsis thaliana]
 gb|AED96828.1| cytokinin dehydrogenase 3 [Arabidopsis thaliana]
Length=523

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/492 (54%), Positives = 358/492 (73%), Gaps = 10/492 (2%)
 Frame = -1

Query  1774  SSLPYEILS-VDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYN  1598
             S  P+ ILS  + AG+    S +  +A+TDFG + +  P+ VL PSSV+DI +L++ S++
Sbjct  32    SPQPWNILSHNEFAGKLTSSSSSVESAATDFGHVTKIFPSAVLIPSSVEDITDLIKLSFD  91

Query  1597  SPSPFSVAARGHGHSVRGQATAKDGVVVEMGALRGGGK-IRVSWSESLGYFADVGGHELW  1421
             S   F +AARGHGHS RGQA+AKDGVVV M ++    + I+VS +     + DV    LW
Sbjct  92    SQLSFPLAARGHGHSHRGQASAKDGVVVNMRSMVNRDRGIKVSRT---CLYVDVDAAWLW  148

Query  1420  VDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEF  1241
             ++VL+  L  G++P SWTDYL+LTVGGTLSN GISGQ FR GPQI+NVLE+DVITGKGE 
Sbjct  149   IEVLNKTLELGLTPVSWTDYLYLTVGGTLSNGGISGQTFRYGPQITNVLEMDVITGKGEI  208

Query  1240  ITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLI  1061
              TCSKDMNS+LFFAVLGGLGQFGIITRARI LE AP R KW+R LY DFS+FTRDQE +I
Sbjct  209   ATCSKDMNSDLFFAVLGGLGQFGIITRARIKLEVAPKRAKWLRFLYIDFSEFTRDQERVI  268

Query  1060  S-INGLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTG  884
             S  +G+++LEGS+M++H  P+NWRS+++  SD  +IAS++ +  ++YCLEVVK+YD+ + 
Sbjct  269   SKTDGVDFLEGSIMVDHGPPDNWRSTYYPPSDHLRIASMVKRHRVIYCLEVVKYYDETSQ  328

Query  883   STVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVP  704
              TV++E+++L   L+ V G  ++KD +Y +FLNRVR  EL  +  G W+  HPWLNLFVP
Sbjct  329   YTVNEEMEELSDSLNHVRGFMYEKDVTYMDFLNRVRTGELNLKSKGQWDVPHPWLNLFVP  388

Query  703   KSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSGG  527
             K++I  F+  VF+ I+L++  TSGP+LVYP     W++RMSA IPEED FY VG L S G
Sbjct  389   KTQISKFDDGVFKGIILRNNITSGPVLVYPMNRNKWNDRMSAAIPEEDVFYAVGFLRSAG  448

Query  526   MNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFD  347
              + W+  D+ N EIL FC   ++    + QYLP++ S+E W++HFG +WN F E K K+D
Sbjct  449   FDNWEAFDQENMEILKFC---EDANMGVIQYLPYHSSQEGWVRHFGPRWNIFVERKYKYD  505

Query  346   PKMILSPGQTIF  311
             PKMILSPGQ IF
Sbjct  506   PKMILSPGQNIF  517



>ref|XP_006401261.1| hypothetical protein EUTSA_v10013271mg [Eutrema salsugineum]
 gb|ESQ42714.1| hypothetical protein EUTSA_v10013271mg [Eutrema salsugineum]
Length=517

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/493 (55%), Positives = 364/493 (74%), Gaps = 10/493 (2%)
 Frame = -1

Query  1777  NSSLPYEILS-VDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSY  1601
             N+S P++ILS  + AG+    S +  +A+TDFG + +  P+ VL PSSV+DI +L++ S+
Sbjct  30    NTSQPWDILSDNNFAGKLTTASSSVESAATDFGHVTKIIPSAVLNPSSVEDITDLIKLSF  89

Query  1600  NSPSPFSVAARGHGHSVRGQATAKDGVVVEMGALRGGGK-IRVSWSESLGYFADVGGHEL  1424
             +S S F +AARGHGHS+RGQA AK+GVVV M ++  G + I+VS     G +ADV    L
Sbjct  90    DSQSSFPLAARGHGHSLRGQAAAKNGVVVNMRSMVNGDRGIKVS---RTGLYADVDSAWL  146

Query  1423  WVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGE  1244
             W++VL+  L  G++P SWTDYL+LTVGGTLSN GISGQ FR GPQISNVLE+DVITGKGE
Sbjct  147   WIEVLNKTLELGLTPVSWTDYLYLTVGGTLSNGGISGQTFRYGPQISNVLEMDVITGKGE  206

Query  1243  FITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHL  1064
               TCSKDMNS++FFA LGGLGQFGIITRARI LE AP RVKW+R LY DFS+FT DQE L
Sbjct  207   IATCSKDMNSDIFFAALGGLGQFGIITRARIKLELAPKRVKWLRFLYTDFSEFTNDQERL  266

Query  1063  IS-INGLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQT  887
             IS  +GL++LEGS+M++H  P+NWRS+++  SD  KI S++ +  ++YCLEVVK+YD+ +
Sbjct  267   ISETDGLDFLEGSVMLDHGPPDNWRSTYYPPSDHLKIVSMVKRHRVIYCLEVVKYYDETS  326

Query  886   GSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFV  707
               TV++E+++L + L +V G  +++D +Y +FLNRVR  EL+ +  G W+  HPWLNLFV
Sbjct  327   QRTVNEEMEELSESLKYVRGFMYERDVTYIDFLNRVRTGELKLKSKGQWDLPHPWLNLFV  386

Query  706   PKSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSG  530
             PKS+I  F+  VF+ I+ ++  T+GP+LVYP     W++RMS VIPEED FY VG L S 
Sbjct  387   PKSQISKFDDGVFKGIIPRNNITTGPLLVYPMNRNKWNDRMSTVIPEEDVFYAVGFLRSA  446

Query  529   GMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKF  350
               N W+  ++ N E+L FC +D + G  + QYLP+Y S+E W++HFG +WN F E K ++
Sbjct  447   DFNNWEDYEKENMEVLKFC-EDAKMG--VIQYLPYYSSQEGWVRHFGPRWNIFVERKYRY  503

Query  349   DPKMILSPGQTIF  311
             DPKMILSPGQ IF
Sbjct  504   DPKMILSPGQNIF  516



>ref|XP_011094006.1| PREDICTED: cytokinin dehydrogenase 3-like [Sesamum indicum]
Length=499

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/475 (58%), Positives = 351/475 (74%), Gaps = 10/475 (2%)
 Frame = -1

Query  1729  FRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSPFSVAARGHGHSV  1550
              R DS +   AS D+G IV E P+ VL+PSSV +I  L+R S     PF+VAARG GHSV
Sbjct  32    LRNDSDSIKKASNDYGNIVHEIPSAVLFPSSVKEISGLIRSSNERSPPFTVAARGRGHSV  91

Query  1549  RGQATAKDGVVVEMGALRGGGKIRVSWSESLGYFADVGGHELWVDVLHACLAHGVSPASW  1370
             RGQA A+ GVVV+M AL    + R++ S   G +ADVG  +LW+DVL A L  G++P SW
Sbjct  92    RGQAMARGGVVVDMTALSKTRR-RITVSRK-GTYADVGAEQLWIDVLRATLKRGLAPVSW  149

Query  1369  TDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDMNSELFFAVLG  1190
             TDYL+L+VGGTLSNAGISGQ F+ GPQI+NVLELDVITGKGEF+TCS++   ELFFAVLG
Sbjct  150   TDYLYLSVGGTLSNAGISGQSFQRGPQINNVLELDVITGKGEFMTCSRERKPELFFAVLG  209

Query  1189  GLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISINGLNYLEGSLMMNHT  1010
             GLGQFGIITRARI+L+KAPTRVKWVR++Y DFS F+RDQEHLIS N  NY+EG L+ +  
Sbjct  210   GLGQFGIITRARIILQKAPTRVKWVRLIYSDFSIFSRDQEHLISSNSPNYVEGFLITDEN  269

Query  1009  SPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGSTVDQELKDLLKDLSFVP  830
               N+WRSSF S S QS IA+LL +QG+LY +E+VK+YD++T ST+D++ + LLK+L++ P
Sbjct  270   ITNDWRSSFSSPSRQSDIAALLKKQGILYSIELVKYYDNRTASTIDKDFETLLKELNYNP  329

Query  829   GMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKSRILDFNSAVFQNILLK  650
                F  D S F+FL+RV   +L+     L   +HPWLNLF+PKSRI DFN+ V   +L K
Sbjct  330   EFIFSADTSLFDFLHRV--GDLDSPTAPL--DSHPWLNLFIPKSRISDFNAGVLATLLPK  385

Query  649   HKTSGPMLV-YPTTTKMWDERMSAVIPEEDTFYCVGLLYSGGMNGWKVLDELNQEILSFC  473
                S P+L+ YP     WD+RMSAVIPEED FY +G+L+S   N +++ DE N +IL FC
Sbjct  386   LNESSPILIFYPLNRNKWDDRMSAVIPEEDVFYTLGVLHSSPPNAYQIYDEFNSQILGFC  445

Query  472   NKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFDPKMILSPGQTIFN  308
              +    G K+KQYLP+Y+S+ +W++HFG KW TF++ KA FDPK ILSPGQ IFN
Sbjct  446   KR---AGIKVKQYLPNYKSQGEWIQHFGSKWPTFRQRKATFDPKFILSPGQRIFN  497



>ref|XP_009120209.1| PREDICTED: cytokinin dehydrogenase 3 isoform X1 [Brassica rapa]
Length=522

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/495 (54%), Positives = 356/495 (72%), Gaps = 13/495 (3%)
 Frame = -1

Query  1774  SSLPYEILSVD-IAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYN  1598
             SSLP+ ILS D  AG+    S +  +A+TDFG I +  P+ VL PSSV DI +L++ S++
Sbjct  33    SSLPWNILSNDNFAGKLTTASSSVESAATDFGHITKIFPSAVLNPSSVQDITDLIKLSFD  92

Query  1597  SPSPFSVAARGHGHSVRGQATAKDGVVVEMGALRGGGK-IRVSWSESLGYFADVGGHELW  1421
             S S F +AARGHGHS RGQA AKDGVVV M ++    + I+VS +   G +ADV    LW
Sbjct  93    SQSSFPLAARGHGHSHRGQAAAKDGVVVNMRSMVNRDRGIKVSRT---GLYADVDSAWLW  149

Query  1420  VDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEF  1241
             ++VL+  L  G++P SWTDYL+LTVGGTLSN GISGQ FR GPQISNVLE+DVITGKGE 
Sbjct  150   IEVLNKTLELGLTPVSWTDYLYLTVGGTLSNGGISGQTFRYGPQISNVLEMDVITGKGEI  209

Query  1240  ITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLI  1061
              TCSKDMNS+LF+A LGGLGQFGIITRARI LE AP + KW+R LY DFS+FTRDQE LI
Sbjct  210   ATCSKDMNSDLFYAALGGLGQFGIITRARIKLELAPKKAKWLRFLYTDFSEFTRDQERLI  269

Query  1060  S-INGLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTG  884
             S  NG ++LEGS+M++H  P+NWRS+++  S+  +I S++ Q  ++YCLEVVK+YD+ + 
Sbjct  270   SETNGPHFLEGSVMLDHGPPDNWRSTYYPPSEHMRIVSMVKQHRVIYCLEVVKYYDETSQ  329

Query  883   STVD---QELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNL  713
              +V+   QE+++L   L++  G  ++KD +Y +FLNRVR  EL+ +  G W+  HPWLNL
Sbjct  330   HSVNETMQEMEELSDSLNYERGFVYEKDVTYMDFLNRVRTGELKLKSKGKWDVPHPWLNL  389

Query  712   FVPKSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLY  536
             FVPKS+I  F   VF+ I+L++  T+GP+LVYP     W++RMS VIPEED FY VG L 
Sbjct  390   FVPKSQISRFEYGVFKGIILRNNITTGPLLVYPMNRNKWNDRMSTVIPEEDVFYAVGFLR  449

Query  535   SGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKA  356
             S   + W   ++ N E+L FC   ++   ++ QYLP+Y S+E W+ HFG +WN F E K 
Sbjct  450   SASFDNWDDYEKENMEVLKFC---EDANMRVIQYLPYYASQEGWVGHFGPRWNIFLERKY  506

Query  355   KFDPKMILSPGQTIF  311
             ++DP+MILSPGQ IF
Sbjct  507   RYDPRMILSPGQNIF  521



>gb|KHN13439.1| Cytokinin dehydrogenase 3 [Glycine soja]
Length=424

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/425 (62%), Positives = 317/425 (75%), Gaps = 19/425 (4%)
 Frame = -1

Query  1534  AKDGVVVEMGALRGGGK---IRVSWS------ESLGYFADVGGHELWVDVLHACLAHGVS  1382
             A++GVVV+M   R  G    IRV  S          Y+ADVGG +LW+DVLHA L HG++
Sbjct  2     AREGVVVDMAGFRERGNGVGIRVVSSVDPNNKNGYYYYADVGGEQLWIDVLHATLEHGLA  61

Query  1381  PASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDMNSELFF  1202
             P SWTDYL+LT+GGTLSNAGISGQ FR GPQI+ V E+DVITGKGEF+TCS+  NSELF 
Sbjct  62    PMSWTDYLYLTLGGTLSNAGISGQTFRYGPQITTVREMDVITGKGEFVTCSQQTNSELFH  121

Query  1201  AVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISING------LNY  1040
             AVLGGLGQFGIITRARI L  AP RVKWVR+LY+DFS FT+DQE LISI G      L+Y
Sbjct  122   AVLGGLGQFGIITRARIALAPAPKRVKWVRLLYNDFSAFTKDQEQLISITGRKQNVSLDY  181

Query  1039  LEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGSTVDQELK  860
             LEG L+M+    NNWRSSFF L+D ++I SL+T+  +LYCLEV K+YD Q  + VD+EL+
Sbjct  182   LEGLLLMHQGPINNWRSSFFPLADHARIISLVTKHSVLYCLEVAKYYDGQNENNVDKELQ  241

Query  859   DLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKSRILDFN  680
              LL+ LS++PG  ++KD SYFEFLNRVR  EL+ Q  GLW+  HPWLNLF+PKS+I++F+
Sbjct  242   VLLQGLSYIPGFYYEKDVSYFEFLNRVRSGELKLQSQGLWDVPHPWLNLFIPKSQIMEFD  301

Query  679   SAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSGGMNGWKVLD  503
             S VF+NI+LK   T+GP+LVYP     WD RMSA IP+ED FY VG L+S G + WK  D
Sbjct  302   SGVFKNIILKRNITTGPVLVYPMNRNKWDNRMSASIPDEDIFYTVGFLHSSGFDNWKAYD  361

Query  502   ELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFDPKMILSPG  323
               N+EIL FCN     G K+KQYLPHYR++EDW  HFG KW TF E K +FDPKMILSPG
Sbjct  362   AQNKEILQFCNV---AGIKVKQYLPHYRTQEDWANHFGPKWRTFVERKHQFDPKMILSPG  418

Query  322   QTIFN  308
             Q IFN
Sbjct  419   QRIFN  423



>ref|XP_002866175.1| hypothetical protein ARALYDRAFT_918856 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42434.1| hypothetical protein ARALYDRAFT_918856 [Arabidopsis lyrata subsp. 
lyrata]
Length=518

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/493 (55%), Positives = 362/493 (73%), Gaps = 12/493 (2%)
 Frame = -1

Query  1774  SSLPYEILSV-DIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYN  1598
             S  P+ ILS  D AG+    S +  +A+ DFG + +  P+ VL PSSV+DI +L++ SY+
Sbjct  32    SPQPWNILSRNDFAGKLTTASSSVESAAIDFGHVTKIFPSAVLNPSSVEDITDLIKLSYD  91

Query  1597  SPSPFSVAARGHGHSVRGQATAKDGVVVEMGALRGGGK-IRVSWSESLGYFADVGGHELW  1421
             S S F +AARGHGHS RGQA+AKDGVVV M ++    + I+VS     G + DV    LW
Sbjct  92    SQSSFPLAARGHGHSHRGQASAKDGVVVNMRSMVNRDRGIKVS---RTGLYVDVDAAWLW  148

Query  1420  VDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEF  1241
             ++VL+  L  G++P SWTDYL+LTVGGTLSN GISGQ FR GPQI+NVLE+DVITGKGE 
Sbjct  149   IEVLNKTLELGLTPVSWTDYLYLTVGGTLSNGGISGQTFRYGPQIANVLEMDVITGKGEI  208

Query  1240  ITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLI  1061
              TCSKD+NS+LFFAVLGGLGQFGI+TRARI LE AP R KW+R LY DFS+FTRDQE LI
Sbjct  209   ATCSKDINSDLFFAVLGGLGQFGILTRARIKLEVAPKRAKWLRFLYIDFSEFTRDQERLI  268

Query  1060  S-INGLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTG  884
             S  +G+++LEGS+M++H  P+NWRS+++  SD  +IAS++ +  ++YCLEVVK+YD+ + 
Sbjct  269   SKTDGVDFLEGSVMVDHGPPDNWRSTYYPPSDHLRIASMVKRHRVIYCLEVVKYYDETSQ  328

Query  883   STVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVP  704
              TV++E+++L + L++V G  ++KD +Y +FLNRVR  EL  +  G W+  HPWLNLFVP
Sbjct  329   YTVNEEMEELSESLNYVRGFMYEKDVTYMDFLNRVRTGELNLKSKGQWDVPHPWLNLFVP  388

Query  703   KSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSGG  527
             KS+I  F+  VF+ I+L++  T+GP+LVYP     W++RMSA IPEED FY VG L S G
Sbjct  389   KSQISKFDDGVFKGIILRNNITTGPVLVYPMNRNKWNDRMSAAIPEEDVFYAVGFLRSAG  448

Query  526   MNGWKVLDELNQEILSFCNKDDEEGSK-IKQYLPHYRSREDWMKHFGKKWNTFQENKAKF  350
              + W+  D+ N EIL FC    E+G+  + QYLP++ S+E W++HFG +W+ F + K K+
Sbjct  449   FDNWEAYDQENMEILKFC----EDGNMGVIQYLPYHSSQEGWVRHFGPRWDIFVKRKYKY  504

Query  349   DPKMILSPGQTIF  311
             DPKMILSPGQ IF
Sbjct  505   DPKMILSPGQNIF  517



>ref|XP_004288951.1| PREDICTED: cytokinin dehydrogenase 2-like [Fragaria vesca subsp. 
vesca]
Length=514

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/495 (53%), Positives = 344/495 (69%), Gaps = 22/495 (4%)
 Frame = -1

Query  1768  LPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPS  1589
             LPY     D+A +   DS++  + ++D+G I  E  A VLYP+S +DI  L++F+ N  +
Sbjct  32    LPY-----DVASKLHNDSQSINSTASDWGHIFHEYAAAVLYPNSTNDIATLLQFANNGST  86

Query  1588  PFSVAARGHGHSVRGQATAKDGVVVEMGALRG-GGKIRVSWSESLGYFADVGGHELWVDV  1412
              F +AARG GHS RGQA AKDG+V+ M  L   G +I VS S   G +ADVGG +LW+DV
Sbjct  87    TFGIAARGQGHSARGQAMAKDGIVINMTTLNNMGSRIVVSQS---GEYADVGGEQLWIDV  143

Query  1411  LHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITC  1232
             L A +  G+SP SWTDYL+L+VGGTLSNAGISGQ FR GPQI+NV ELDV+TGKG+ ITC
Sbjct  144   LRATVDQGLSPVSWTDYLYLSVGGTLSNAGISGQTFRYGPQITNVYELDVVTGKGDVITC  203

Query  1231  SKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISIN  1052
             S    SELF++ LGGLGQ GIITRARI L+ AP R  W+R+ Y DFS F++DQE LI+  
Sbjct  204   SSKQTSELFYSALGGLGQVGIITRARIALQPAPNRAVWIRLFYSDFSAFSKDQELLIASK  263

Query  1051  ------GLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQ  890
                   G +Y+EG ++M     +    SF+S++DQ +I +LL Q G+LY +E+ K+YDD+
Sbjct  264   GKQGSVGFDYVEGFVLMPQGPVD---LSFYSVADQPRITALLEQYGILYTIEIAKYYDDK  320

Query  889   TGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLF  710
                T+ + ++ LLK  S++PG  F++D SY +FLNRV  EE   +  GLWE  HPWLNLF
Sbjct  321   AAKTIAKVVEILLKQFSYIPGFIFQQDVSYIDFLNRVHTEEKFLRTLGLWEVAHPWLNLF  380

Query  709   VPKSRILDFNSAVFQNILLKHKT-SGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYS  533
             VPKS I DF+S VF+ ILLK K  +G ++VYP     WD++M+AVIPEED FY V LL+S
Sbjct  381   VPKSGIADFDSGVFKGILLKQKVPAGLVIVYPMNRNKWDDKMTAVIPEEDVFYVVALLHS  440

Query  532   GGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAK  353
              G+  W++ DE+N +IL FCN   + G +IKQYLPHY  ++DW  HFG KW TFQE K K
Sbjct  441   SGLEEWQLFDEVNAQILQFCN---DTGIEIKQYLPHYEKQQDWTDHFGSKWQTFQEMKVK  497

Query  352   FDPKMILSPGQTIFN  308
             +DP  IL+PGQ +F+
Sbjct  498   YDPNKILAPGQRVFD  512



>ref|XP_002513399.1| gulonolactone oxidase, putative [Ricinus communis]
 gb|EEF48802.1| gulonolactone oxidase, putative [Ricinus communis]
Length=511

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/505 (53%), Positives = 342/505 (68%), Gaps = 28/505 (6%)
 Frame = -1

Query  1792  KLKPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLV  1613
             K +P    +P E+       +  VD  A  +ASTD+G IV + PA VLYPSS  DI +L+
Sbjct  23    KSQPLTCPVPSEL-----TDKLNVDPAAIESASTDYGNIVHDKPAAVLYPSSAQDISSLI  77

Query  1612  RFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGALR---GGGKIRVSWSESLGYFAD  1442
             + S+N  +PF +AARG+GHS RGQ  A +GVV++M  LR    G  I +S       + D
Sbjct  78    QASFNCSTPFGIAARGNGHSTRGQGMAYNGVVIDMNVLRDNRNGTGINISKDP---LYVD  134

Query  1441  VGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDV  1262
             VGG +LWVDVL+A +   V+P SWTD+L LTVGGTLSNAGISGQ FR GPQISNV E+DV
Sbjct  135   VGGEQLWVDVLNATVTEDVAPVSWTDFLGLTVGGTLSNAGISGQTFRFGPQISNVHEMDV  194

Query  1261  ITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFT  1082
             ITGKGEF+TCS + NSELF+AVLGGLGQFGIITRARI L  A  R  W ++LY +FS FT
Sbjct  195   ITGKGEFVTCSANNNSELFYAVLGGLGQFGIITRARISLGPAFKRAVWAQILYSNFSAFT  254

Query  1081  RDQEHLIS------INGLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYC  920
             RDQE  I+       N ++YLEG+L++++ +PN WR+SFF  SD  +I SL+ Q G+LY 
Sbjct  255   RDQERFIAGHAKKEGNAISYLEGALLLDNGTPNTWRTSFFPKSDIPRITSLIKQHGILYS  314

Query  919   LEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLW  740
             LE+   +D+ T   V +E+KD +K LS  P   +  + SY EFLNRV+  + + Q     
Sbjct  315   LEIANSFDELTNKAVQEEMKDFIKALSSKPDYIYHTNVSYLEFLNRVQIPDEQSQ-----  369

Query  739   EATHPWLNLFVPKSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIPEED  563
                HPWLNLF+PKS I DFNS VF++I+L+   T+GP+L YP     WD RMS  IP+ED
Sbjct  370   --AHPWLNLFIPKSNISDFNSGVFRDIVLQRNITTGPVLFYPMMRNKWDNRMSVAIPDED  427

Query  562   TFYCVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKK  383
              FY   LLYS G+N W+V D+ N+EIL FC   D+ G + KQYLP+Y ++E+W K FG  
Sbjct  428   IFYTAALLYSSGLNEWQVYDDQNKEILEFC---DKAGIQGKQYLPNYATKEEWTKQFGSN  484

Query  382   WNTFQENKAKFDPKMILSPGQTIFN  308
             W TF++ KA FDPKMILSPGQ IFN
Sbjct  485   WTTFEQRKALFDPKMILSPGQRIFN  509



>emb|CDY62828.1| BnaCnng41060D [Brassica napus]
Length=518

 Score =   534 bits (1376),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 265/492 (54%), Positives = 353/492 (72%), Gaps = 10/492 (2%)
 Frame = -1

Query  1774  SSLPYEILSVD-IAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYN  1598
             S  P+ ILS D  AG+    S +  AA+ DFG + +  P+ VL PSSV DII+L++ S++
Sbjct  32    SPQPWNILSNDNFAGKLTSASSSVEAAAIDFGHVTKILPSAVLNPSSVQDIIDLIKLSFD  91

Query  1597  SPSPFSVAARGHGHSVRGQATAKDGVVVEMGALRGGGK-IRVSWSESLGYFADVGGHELW  1421
             S S F +AARGHGHS RGQA AKDGVVV M ++    + I+VS +   G +ADV    LW
Sbjct  92    SQSSFPIAARGHGHSFRGQAAAKDGVVVNMRSMVNEDRGIKVSRT---GLYADVDTAWLW  148

Query  1420  VDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEF  1241
             ++VL+  L  G++P SWTDYL+LT+GGTLSN GISGQ  R GPQISNVLELDVITGKGE 
Sbjct  149   IEVLNKTLELGLTPVSWTDYLYLTIGGTLSNGGISGQTSRYGPQISNVLELDVITGKGEI  208

Query  1240  ITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLI  1061
              TCS D NS+LF+A LGGLGQFGIITRARI LE AP R KW+R LY DFS+FTRDQE LI
Sbjct  209   ATCSNDTNSDLFYAALGGLGQFGIITRARIKLELAPKRAKWLRFLYTDFSEFTRDQERLI  268

Query  1060  S-INGLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTG  884
             S  +GL++LEGS+M++H  P+NWRS+++  SD  +I S++ +  ++YCLEV K+YD+ + 
Sbjct  269   SETDGLHFLEGSVMLDHGPPDNWRSTYYPPSDHLRIVSMIKRYRVIYCLEVAKYYDETSQ  328

Query  883   STVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVP  704
              +V++E++ L + L++V G  ++KD +Y +FLNRVR  EL  +  G W+  HPWLNLFVP
Sbjct  329   HSVNEEIEKLSESLNYVRGFVYEKDVTYIDFLNRVRTGELNLKSKGQWDVPHPWLNLFVP  388

Query  703   KSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSGG  527
             KS+I  F+  VF+ I+L++  T+GP+LVYP    MW+++MS  IPEED FY VG L S  
Sbjct  389   KSQISRFDYGVFKGIILRNNITTGPLLVYPMKRIMWNDQMSTAIPEEDVFYAVGFLRSAE  448

Query  526   MNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFD  347
              + W+  D+ N E+L FC   ++    + QYLP++ S+E W++HFG  WNTF E K ++D
Sbjct  449   FDNWEAYDKENMEVLKFC---EDAKMDVIQYLPYHASQEGWVRHFGPMWNTFVERKYRYD  505

Query  346   PKMILSPGQTIF  311
             PKMILSPGQ IF
Sbjct  506   PKMILSPGQNIF  517



>ref|XP_006475551.1| PREDICTED: cytokinin dehydrogenase 3-like [Citrus sinensis]
Length=511

 Score =   533 bits (1373),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 268/491 (55%), Positives = 343/491 (70%), Gaps = 24/491 (5%)
 Frame = -1

Query  1744  DIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSPFSVAARG  1565
             ++      DS A   AS D+G I++E P  VLYPSS+DDI  L+  SY+S  P+++AA+G
Sbjct  32    ELTDNLHTDSGAIKLASIDYGRIIKEKPFAVLYPSSLDDIRTLINLSYSSSFPYTIAAKG  91

Query  1564  HGHSVRGQATAKDGVVVEMGAL---RGGGKIRVSWSESLGYFADVGGHELWVDVLHACLA  1394
               HS  GQA A  GVVV+M +L   R G  I +S   S G++ADVGG +LW+DVL+A LA
Sbjct  92    QAHSTWGQAQANKGVVVQMSSLNSFRNGTGILISGDRSSGFYADVGGEQLWIDVLNATLA  151

Query  1393  HGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDMNS  1214
              G+SP SWTDYL+LT+GGTLSNAGISGQ +R GPQI+NVLELDV+TGKGEF+TC+   ++
Sbjct  152   RGLSPVSWTDYLYLTIGGTLSNAGISGQTYRKGPQITNVLELDVLTGKGEFVTCTSQKDT  211

Query  1213  ELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISING-----  1049
             ELF+AVLGGLGQFGIITRARIVLE A  RVKW+R+LY DFS F+ DQE LIS  G     
Sbjct  212   ELFYAVLGGLGQFGIITRARIVLEPAKERVKWLRILYSDFSSFSTDQETLISTTGPSHKV  271

Query  1048  -LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGSTVD  872
               +YLEG L+M+ +  +     F+  S   KI SL+ Q G++Y +EV  +YD++     D
Sbjct  272   MPDYLEGQLLMSQSPLD-----FYPQSQHQKITSLINQYGIVYLIEVATYYDNKNE---D  323

Query  871   QELKDLLKDLS-FVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKSR  695
             + +K +LK L  FV G  F+KD +Y EFLNRV  EE+  ++ GLW+  HPWLN+F+P+SR
Sbjct  324   KRVKQMLKSLKGFVHGFVFEKDVTYLEFLNRVHDEEIVLRKKGLWDIPHPWLNIFIPRSR  383

Query  694   ILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIP-EEDTFYCVGLLYSGGMN  521
             I DF++  F+NILLK   TS  +LVYP     WDERMSAVIP EED FY VG L     +
Sbjct  384   ITDFDNGAFRNILLKRNFTSSTVLVYPLLRSKWDERMSAVIPDEEDVFYVVGFL-DASAD  442

Query  520   GWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFDPK  341
              W+  D  N++IL FC      G K KQYL H+ ++E+W+ HFG KWNTFQ++KA+FDPK
Sbjct  443   DWETFDNRNKDILQFCVNG---GIKFKQYLGHHATKEEWINHFGSKWNTFQQSKARFDPK  499

Query  340   MILSPGQTIFN  308
             MILSPGQ IFN
Sbjct  500   MILSPGQRIFN  510



>ref|XP_008377186.1| PREDICTED: cytokinin dehydrogenase 5-like [Malus domestica]
Length=538

 Score =   532 bits (1371),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 262/499 (53%), Positives = 348/499 (70%), Gaps = 17/499 (3%)
 Frame = -1

Query  1765  PYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSP  1586
             P E+L + + G+  +D      AS DFG + +  P  VL+P+S  D++ LVR +Y+SP  
Sbjct  26    PTELLRLVVEGQLSLDPSDVNTASKDFGLMSRAEPLAVLHPASAQDVVGLVRTAYSSPHG  85

Query  1585  FSVAARGHGHSVRGQATAKDGVVVEM--GALRGGGKIRVSWSESLGYFADVGGHELWVDV  1412
             F+V+ARGHGHS+ GQA   +GVV++M  G+ R G   + +     G + D  G ELW+DV
Sbjct  86    FTVSARGHGHSINGQAQTNNGVVIQMSGGSSRSGTPGQAARVSEKGMYVDAWGGELWIDV  145

Query  1411  LHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITC  1232
             L + L +G++P SWTDYL+L+VGGTLSNAGISGQ F  GPQISNV ELDV+TGKGE +TC
Sbjct  146   LRSTLEYGLAPKSWTDYLYLSVGGTLSNAGISGQAFNYGPQISNVHELDVVTGKGELLTC  205

Query  1231  SKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISIN  1052
             S++ NSELF AVLGGLGQFGIITRARI LE +P RV+W+R+LY +FS FT+DQE LIS++
Sbjct  206   SEEQNSELFHAVLGGLGQFGIITRARIALEXSPQRVRWIRVLYSNFSAFTKDQEFLISLH  265

Query  1051  G------LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQ  890
             G       +Y+EG ++++    NNWRSSFFS S+  KI S+ ++ G+LYCLE+ K+YD+ 
Sbjct  266   GQPTSQKFDYVEGFVIVDEGLINNWRSSFFSPSNPVKITSINSEGGVLYCLEITKNYDES  325

Query  889   TGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLF  710
             T  T+DQE++DLL+ L FVP   F  D  Y +FL+RV   EL+ +  GLW+  HPWLNLF
Sbjct  326   TAVTIDQEIEDLLEKLDFVPTSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLF  385

Query  709   VPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSG  530
             VPKSRI DF+  VF+ I L +KTSGP+L+YP     WD+  S V P+ED FY V LL S 
Sbjct  386   VPKSRISDFDEGVFKGI-LGNKTSGPILIYPMNKDKWDQSSSVVTPDEDVFYLVALLRSA  444

Query  529   GMNG--WKVLDEL---NQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQE  365
                G   + L+ L   N++IL FC   D+ G ++KQYLPHY +RE+WM HFG KW+ F +
Sbjct  445   LDTGDETRTLEHLTNQNRQILRFC---DDAGIEVKQYLPHYTTREEWMDHFGDKWDRFYQ  501

Query  364   NKAKFDPKMILSPGQTIFN  308
              K KFDP+ IL+ GQ IF+
Sbjct  502   RKMKFDPRRILATGQRIFS  520



>ref|XP_010254443.1| PREDICTED: cytokinin dehydrogenase 3-like [Nelumbo nucifera]
Length=517

 Score =   531 bits (1368),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 278/510 (55%), Positives = 346/510 (68%), Gaps = 28/510 (5%)
 Frame = -1

Query  1795  GKLKPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINL  1616
             G L    S  P ++ S+ I  R R+D++A T+AS D+G I Q  PA VLYP S DDI  L
Sbjct  20    GLLSRTASLFPSDLQSLYIDTRLRLDAKAKTSASIDYGNITQVIPAAVLYPESQDDIAAL  79

Query  1615  VRFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGAL---RGGGKIRVSWSES---LG  1454
             + FS+ SP PF +AA+G GHSV GQA A DGVVV M +L     G +I VS S +   + 
Sbjct  80    ITFSFESPVPFLIAAKGMGHSVNGQAMAPDGVVVNMRSLNNEENGSRINVSRSTTSMAIN  139

Query  1453  YFADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVL  1274
             ++ D GG +LW+DVL A L +G++P SWTD+L+LTVGGTLSNAGISGQ FR GPQISNV 
Sbjct  140   WYVDAGGEQLWIDVLRATLEYGLAPRSWTDFLYLTVGGTLSNAGISGQTFRYGPQISNVY  199

Query  1273  ELDVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDF  1094
             ELDV+TGKGE +TCSK  NS+LF+AVLGGLGQFGIITRARI LEKAP+ VKW+ + Y DF
Sbjct  200   ELDVVTGKGELVTCSKHTNSKLFYAVLGGLGQFGIITRARIALEKAPSTVKWMSLYYVDF  259

Query  1093  SKFTRDQEHLISIN------GLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQG  932
               FTRDQE LIS +        +Y+EG+L+M H +           SD  +I SL  Q G
Sbjct  260   FAFTRDQEILISTHTSHENKTFDYIEGTLVMQHDT-----------SDDPRITSLAKQYG  308

Query  931   LLYCLEVVKHYDDQT--GSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEP  758
             ++Y +EV K+YDD T    TVD+ELK LL+ LSF+PGM    D SY +FLNRVR + L+ 
Sbjct  309   IVYTIEVAKYYDDLTINQDTVDEELKLLLEGLSFIPGMITTTDVSYLDFLNRVRSKALKV  368

Query  757   QENGLWEATHPWLNLFVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAV  578
             Q     +  HPWLNLF+PKSRI DFNS VF+ ILLK   +     YP     W+ RMS+V
Sbjct  369   QSQEQGDVLHPWLNLFIPKSRIFDFNSGVFKGILLKQNKTALNRFYPMNRNKWEGRMSSV  428

Query  577   IPEEDTFYCVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMK  398
             IP+ED FY + LL S G++  +     N+EIL FC   D+ G +IKQYLPH+ S+ +W+K
Sbjct  429   IPDEDIFYHLALLRSSGIHDLEFFQRQNREILEFC---DKAGIEIKQYLPHHESKAEWIK  485

Query  397   HFGKKWNTFQENKAKFDPKMILSPGQTIFN  308
             HFG KWNTF+  KA FDPK ILSPGQ IFN
Sbjct  486   HFGPKWNTFKARKAMFDPKAILSPGQRIFN  515



>ref|XP_009126914.1| PREDICTED: cytokinin dehydrogenase 3 [Brassica rapa]
Length=518

 Score =   530 bits (1365),  Expect = 7e-179, Method: Compositional matrix adjust.
 Identities = 270/492 (55%), Positives = 356/492 (72%), Gaps = 10/492 (2%)
 Frame = -1

Query  1774  SSLPYEILSVD-IAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYN  1598
             S  P+ ILS D  AG+    S +  AAS DFG + +  P+ VL PSSV DII+L++ S++
Sbjct  32    SPQPWNILSNDNFAGKLPSASSSVEAASIDFGHVTKILPSAVLNPSSVQDIIDLIKLSFD  91

Query  1597  SPSPFSVAARGHGHSVRGQATAKDGVVVEMGALRGGGK-IRVSWSESLGYFADVGGHELW  1421
             S S F +AARGHGHS RGQA AKDGVVV M ++    + I+VS     G +ADV    LW
Sbjct  92    SQSSFPIAARGHGHSFRGQAAAKDGVVVNMRSMVNEDRGIKVS---RTGLYADVDTAWLW  148

Query  1420  VDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEF  1241
             ++VL+  L  G++P SWTDYL+LTVGGTLSN GISGQ  R GPQISNVLELD+ITGKGE 
Sbjct  149   IEVLNKTLELGLTPVSWTDYLYLTVGGTLSNGGISGQTSRYGPQISNVLELDIITGKGEI  208

Query  1240  ITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLI  1061
              TCS DMNS+LF+A LGGLGQFGIITRARI LE AP R KW+R LY DFS+FTRDQE LI
Sbjct  209   ATCSNDMNSDLFYAALGGLGQFGIITRARIKLELAPKRAKWLRFLYTDFSEFTRDQERLI  268

Query  1060  S-INGLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTG  884
             S  +GL++LEGS+M++H  P+NWRS+++  SD  +I S++ +  ++YCLEVVK+YD+ + 
Sbjct  269   SEADGLHFLEGSVMLDHGPPDNWRSTYYPPSDHLRIVSMIKRHRVIYCLEVVKYYDEFSQ  328

Query  883   STVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVP  704
              +V++E+++L + L+FV G  ++KD +Y +FLNRVR  EL  +  G W+  HPWLNLFVP
Sbjct  329   HSVNEEMEELSESLNFVRGFVYEKDVTYIDFLNRVRTGELNLKSKGQWDVPHPWLNLFVP  388

Query  703   KSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSGG  527
             KS+I  F+  VF+ I+L++  T+GP+LVYP    MW+++MS  IPEED FY VG L S  
Sbjct  389   KSQISRFDYGVFKGIILRNNITTGPLLVYPMKRIMWNDQMSTAIPEEDVFYAVGFLRSAE  448

Query  526   MNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFD  347
              + W+  D+ N E+L FC   ++    + QYLP++ S+E W++HFG +WNTF E K K+D
Sbjct  449   FDNWEAYDKENMEVLMFC---EDAKMDVIQYLPYHASQEGWVRHFGPRWNTFVERKYKYD  505

Query  346   PKMILSPGQTIF  311
             PKMILSPGQ IF
Sbjct  506   PKMILSPGQNIF  517



>ref|XP_006451487.1| hypothetical protein CICLE_v10010516mg, partial [Citrus clementina]
 gb|ESR64727.1| hypothetical protein CICLE_v10010516mg, partial [Citrus clementina]
Length=527

 Score =   530 bits (1365),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 267/491 (54%), Positives = 342/491 (70%), Gaps = 24/491 (5%)
 Frame = -1

Query  1744  DIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSPFSVAARG  1565
             ++      DS A   AS D+G I++E P  VLYPSS+DDI  L+  SY+S  P+++AA+G
Sbjct  48    ELTDNLHTDSGAIKLASIDYGRIIKEKPFAVLYPSSLDDIRTLINLSYSSSFPYTIAAKG  107

Query  1564  HGHSVRGQATAKDGVVVEMGAL---RGGGKIRVSWSESLGYFADVGGHELWVDVLHACLA  1394
               HS  GQA A  GVVV+M +L   R G  I +S   S G++ADVGG +LW+DVL+A LA
Sbjct  108   QAHSTWGQAQANKGVVVQMSSLNSFRNGTGILISGDRSSGFYADVGGEQLWIDVLNATLA  167

Query  1393  HGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDMNS  1214
              G+SP SWTDYL+LT+GGTLSNAGISGQ +R GPQI+NVLELDV+TGKGEF+TC+   ++
Sbjct  168   RGLSPVSWTDYLYLTIGGTLSNAGISGQTYRKGPQITNVLELDVLTGKGEFVTCTSQKDT  227

Query  1213  ELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISING-----  1049
             ELF+AVLGGLGQFGIITRARIVLE A  RVKW+R+LY DFS F+ DQE LIS  G     
Sbjct  228   ELFYAVLGGLGQFGIITRARIVLEPAKERVKWLRILYSDFSSFSTDQETLISTTGPSHKV  287

Query  1048  -LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGSTVD  872
               +YLEG L+M+ +  +     F+  S   KI SL+ Q G++Y +EV  +YD++     D
Sbjct  288   MPDYLEGQLLMSQSPLD-----FYPQSQHQKITSLINQYGIVYLIEVATYYDNKNE---D  339

Query  871   QELKDLLKDLS-FVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKSR  695
             + +K +LK L  FV G  F+KD +Y EFLNRV  EE+  ++ GLW+  HPWLN+F+P+SR
Sbjct  340   KRVKQMLKSLKGFVHGFVFEKDVTYLEFLNRVHDEEIVLRKKGLWDIPHPWLNIFIPRSR  399

Query  694   ILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIP-EEDTFYCVGLLYSGGMN  521
             I DF++   +NILLK   TS  +LVYP     WDERMSAVIP EED FY VG L     +
Sbjct  400   ITDFDNGALRNILLKRNFTSSTVLVYPLLRSKWDERMSAVIPDEEDVFYVVGFL-DASAD  458

Query  520   GWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFDPK  341
              W+  D  N++IL FC      G K KQYL H+ ++E+W+ HFG KWNTFQ++KA+FDPK
Sbjct  459   DWETFDNRNKDILQFCVNG---GIKFKQYLGHHATKEEWINHFGSKWNTFQQSKARFDPK  515

Query  340   MILSPGQTIFN  308
             MILSPGQ IFN
Sbjct  516   MILSPGQRIFN  526



>ref|XP_002307681.1| hypothetical protein POPTR_0005s25380g [Populus trichocarpa]
 gb|EEE94677.1| hypothetical protein POPTR_0005s25380g [Populus trichocarpa]
Length=534

 Score =   530 bits (1365),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 267/505 (53%), Positives = 345/505 (68%), Gaps = 25/505 (5%)
 Frame = -1

Query  1765  PYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSP  1586
             P E+L + + G+  VD      AS DFG I +  P  VL+P S DDI  LV+ +Y S   
Sbjct  24    PSELLRLGVDGQLSVDPFDVETASLDFGLISRSEPMAVLHPGSADDIARLVQAAYLSSQG  83

Query  1585  FSVAARGHGHSVRGQATAKDGVVVEM-GALRGG-------GKIRVSWSESLGYFADVGGH  1430
             F+V+ARGHGHS+ GQA   +GVV+EM G  RG         K +V+  E      DV G 
Sbjct  84    FTVSARGHGHSINGQAQTSNGVVIEMNGGSRGSRLGLGNLAKPQVAVKE---MHVDVWGG  140

Query  1429  ELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGK  1250
             ELW+DVL + L HG++P SWTDYL+L+VGGTLSN GISGQ F  GPQISNV ELDV+TGK
Sbjct  141   ELWIDVLRSTLEHGLAPKSWTDYLYLSVGGTLSNGGISGQAFNHGPQISNVYELDVVTGK  200

Query  1249  GEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQE  1070
             GE +TCS++ NS+LF AVLGGLGQFGIITRARI LE AP RV+W+R+LY +FS FT DQE
Sbjct  201   GELMTCSEEKNSKLFHAVLGGLGQFGIITRARIALEPAPQRVRWIRVLYSNFSTFTGDQE  260

Query  1069  HLISING------LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVV  908
             +LIS++G       +Y+EG ++++    NNWRSSFFS  +  KI+S+    G+LYCLE+ 
Sbjct  261   YLISMHGKPSTLKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKISSVGANGGVLYCLEIT  320

Query  907   KHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATH  728
             K+YD+ TG T+DQE++ L+K+L+F+P   F  D  Y +FL+RV   EL+ +  GLWE  H
Sbjct  321   KNYDESTGDTIDQEVEALMKNLNFIPSTVFTTDLPYTDFLDRVHRAELKLRAKGLWEVPH  380

Query  727   PWLNLFVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCV  548
             PWLNLFVP+SRI D +  VF+ IL  +KTSGP+L+YP     WD+R S V P+ED FY V
Sbjct  381   PWLNLFVPRSRIADLDRGVFKGILGNNKTSGPILIYPMNKNKWDQRSSVVTPDEDVFYLV  440

Query  547   GLLYSGGMNG-----WKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKK  383
              LL S   NG      + L + N++IL FC   D+ G K+KQYLPHY +RE+WM HFG K
Sbjct  441   ALLRSALDNGEETQSLEYLTDQNRKILRFC---DDAGIKVKQYLPHYTTREEWMDHFGDK  497

Query  382   WNTFQENKAKFDPKMILSPGQTIFN  308
             W+ F + K +FDP+ IL+ GQ IFN
Sbjct  498   WDRFYQRKMEFDPRRILATGQRIFN  522



>ref|XP_004291832.1| PREDICTED: cytokinin dehydrogenase 5-like [Fragaria vesca subsp. 
vesca]
Length=535

 Score =   530 bits (1365),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 264/502 (53%), Positives = 347/502 (69%), Gaps = 20/502 (4%)
 Frame = -1

Query  1765  PYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSP  1586
             P E+L + + G+  +D      AS DFG + +  P  V++P+S +D+  LVR +Y+S   
Sbjct  25    PAELLRLVVDGQLSLDPSDVETASKDFGLMSRAEPLAVMHPASAEDVARLVRAAYSSAKG  84

Query  1585  FSVAARGHGHSVRGQATAKDGVVVEM-GALRGGGKIRVSWS--ESLGYFADVGGHELWVD  1415
             FSV+ARGHGHS+ GQA A++GVV+ M G  R GG+   +       G + D  G ELW++
Sbjct  85    FSVSARGHGHSINGQAQARNGVVIAMSGGNRAGGRRETAAGVVSEKGLYVDAWGGELWIE  144

Query  1414  VLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFIT  1235
             VL A L HG++P SWTDYL+L+VGGTLSNAGISGQ F  GPQISNVLELDV+TGKGE +T
Sbjct  145   VLRATLEHGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVLELDVVTGKGELLT  204

Query  1234  CSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISI  1055
             CS++ N+ELF AVLGGLGQFGIITRARI LE APTRV+W+R+LY +FS FT+DQE+LIS+
Sbjct  205   CSEERNAELFHAVLGGLGQFGIITRARIALEPAPTRVRWIRVLYSNFSAFTKDQEYLISL  264

Query  1054  NG------LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLT--QQGLLYCLEVVKHY  899
             +G       +Y+EG ++++    NNWRSSFFS S+  KI+S+ +    G+LYCLE+ K+Y
Sbjct  265   HGQPSSRKFDYVEGFVIVDEGLINNWRSSFFSPSNPVKISSIDSNGNGGVLYCLEITKNY  324

Query  898   DDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWL  719
             DD T  ++DQE++ LLK+L FVP   F  D  Y +FL+RV   EL+ +  GLW+  HPWL
Sbjct  325   DDSTADSIDQEIEALLKELDFVPTSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWL  384

Query  718   NLFVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLL  539
             NLFVPKSRI DF+  VF+ I L +KTSGP+L+YP     WD+R S V P+ED FY V LL
Sbjct  385   NLFVPKSRISDFDEGVFKGI-LGNKTSGPVLIYPMNKDKWDQRSSVVTPDEDVFYLVALL  443

Query  538   YSGGMNG-----WKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNT  374
              S   +G      + L   N+ I  FC   DE G K+KQYLPHY ++++WM HFG KW  
Sbjct  444   RSALDSGDETHTLEYLTNQNRRIFKFC---DEAGIKVKQYLPHYTTQQEWMDHFGDKWPL  500

Query  373   FQENKAKFDPKMILSPGQTIFN  308
             F + K +FDP+ IL+ GQ IF 
Sbjct  501   FYQRKMEFDPRRILATGQRIFT  522



>ref|XP_006838693.1| hypothetical protein AMTR_s00002p00248240 [Amborella trichopoda]
 gb|ERN01262.1| hypothetical protein AMTR_s00002p00248240 [Amborella trichopoda]
Length=539

 Score =   530 bits (1365),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 273/509 (54%), Positives = 344/509 (68%), Gaps = 35/509 (7%)
 Frame = -1

Query  1741  IAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSPFSVAARGH  1562
             +A     D+  T  AS DFGG+    P GVL PSSV +I NLVR +Y + + F VAA+GH
Sbjct  22    MASNLSFDASRTRLASRDFGGLTGAPPHGVLVPSSVHEIANLVRVAYEADAHFRVAAKGH  81

Query  1561  GHSVRGQATAKDGVVVEMGALRGG----GKI--------------RVSWSESLG---YFA  1445
              HS++GQA A  GVV+EM AL+G     G +              R S     G   Y+A
Sbjct  82    AHSIQGQAQAPGGVVIEMEALKGCLFNVGVLENESCSFSSSYSVERESVERESGGSLYYA  141

Query  1444  DVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELD  1265
             DV G ELW+DVLH  L HG++P SWTDYL+LTVGGTLSNAGISGQ F  GPQISNV ELD
Sbjct  142   DVWGGELWIDVLHETLKHGLAPRSWTDYLYLTVGGTLSNAGISGQAFNHGPQISNVYELD  201

Query  1264  VITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKF  1085
             V+TGKGE +TCSK  NSELF +VLGGLGQFGIITRARI LE AP RV+W+R+LY DF+ F
Sbjct  202   VVTGKGELLTCSKHQNSELFHSVLGGLGQFGIITRARIALEPAPQRVRWIRVLYSDFNTF  261

Query  1084  TRDQEHLISING---LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLL--TQQGLLYC  920
             TRDQEHLIS++G    +Y+EG ++++    NNWRSSFFS  +  K+ S++  ++  +LYC
Sbjct  262   TRDQEHLISLHGRTKFDYVEGFVIVDEGLINNWRSSFFSPRNPIKLQSIVSGSKGTVLYC  321

Query  919   LEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLW  740
             LEV K+YD+ T  TVDQE+  LLK LSF+ G  F  D  Y +FL+RV   EL+ +  GLW
Sbjct  322   LEVTKNYDEATADTVDQEVDSLLKTLSFIQGSVFTTDLPYIDFLDRVHKAELKLRAKGLW  381

Query  739   EATHPWLNLFVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDT  560
             +  HPWLNLF+PKS+I DF++ VF+ IL K KTSGP+L+YP     WDE+ SAV P+ED 
Sbjct  382   DVPHPWLNLFIPKSKIADFDAGVFKGILGK-KTSGPILIYPMNKNRWDEKTSAVTPDEDV  440

Query  559   FYCVGLLYSGGMNG-----WKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKH  395
             FY V  L S   NG      + L + N+ IL FC   +E   ++KQYLPH+  R  W++H
Sbjct  441   FYLVAFLRSALDNGEETQSLRYLQDQNERILRFC---EEANIEMKQYLPHHTKRAQWVQH  497

Query  394   FGKKWNTFQENKAKFDPKMILSPGQTIFN  308
             +G KW  F+E KA FDPK IL+PGQ IF+
Sbjct  498   YGPKWAEFEERKATFDPKNILAPGQRIFS  526



>ref|XP_006475550.1| PREDICTED: cytokinin dehydrogenase 3-like [Citrus sinensis]
Length=561

 Score =   530 bits (1366),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 269/486 (55%), Positives = 343/486 (71%), Gaps = 21/486 (4%)
 Frame = -1

Query  1729  FRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSPFSVAARGHGHSV  1550
              R D  A   AS D+G I++E P  VLYPSSVDDI  L+  SYNS   +++AA+G  HS 
Sbjct  84    LRTDPGAIKLASIDYGHIIKEKPFAVLYPSSVDDIRTLIYLSYNSLFSYTIAAKGQAHST  143

Query  1549  RGQATAKDGVVVEMGAL---RGGGKIRVSWSESLGYFADVGGHELWVDVLHACLAHGVSP  1379
              GQA A DGVVV+M +L   R G  I +S   SLG++ADVGG +LW+DVL+A L  G+SP
Sbjct  144   WGQAQANDGVVVQMNSLNRFRNGTGILISGDRSLGFYADVGGEQLWIDVLNATLTRGLSP  203

Query  1378  ASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDMNSELFFA  1199
              SWTDYL+ TVGGTLSNAGISG  ++ GPQI+NVLELDV+TGKGEF+TCS   +SELF+A
Sbjct  204   VSWTDYLYPTVGGTLSNAGISGHTYQKGPQITNVLELDVLTGKGEFVTCSPQKDSELFYA  263

Query  1198  VLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISING------LNYL  1037
             VLGGLGQFGIITRARIVL  A  RVKW+R+LY DFS F+ DQE LIS  G       ++L
Sbjct  264   VLGGLGQFGIITRARIVLGPAKKRVKWLRILYSDFSSFSTDQETLISTTGPSDKVMPDFL  323

Query  1036  EGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGSTVDQELKD  857
             EG L+MN +  +     F+  S + KI  L+ Q G+LY +EVV +YD++  + V+Q++K 
Sbjct  324   EGHLLMNQSPLD-----FYPQSQRRKITFLVNQYGILYIIEVVTYYDNKNEAKVNQKVKQ  378

Query  856   LLKDLS-FVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKSRILDFN  680
             +LK L  F+PG  F+KD +Y +FLNRV  +E+E ++ GLW+  HPWLN+F+PKSRI DF+
Sbjct  379   MLKSLKGFLPGFVFEKDVTYLQFLNRVHDQEIELRKKGLWDIPHPWLNIFIPKSRITDFD  438

Query  679   SAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVI-PEEDTFYCVGLLYSGGMNGWKVL  506
             + VF+NILLK   TS  +LVYP     WDERMSAVI  EE+ FY VG L +   N W+  
Sbjct  439   NGVFRNILLKRNFTSSTVLVYPLLRSKWDERMSAVIAAEEEVFYFVGFLDASADN-WEAF  497

Query  505   DELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFDPKMILSP  326
             D  N++IL FC      G K KQYL H+ ++E+W+ HFG KWNTFQ+ K +FDP+MILSP
Sbjct  498   DNKNKDILQFCV---NAGIKFKQYLGHHATKEEWIIHFGSKWNTFQQRKTRFDPRMILSP  554

Query  325   GQTIFN  308
             GQ IFN
Sbjct  555   GQRIFN  560



>emb|CDY20702.1| BnaA02g08420D [Brassica napus]
Length=517

 Score =   528 bits (1361),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 270/492 (55%), Positives = 355/492 (72%), Gaps = 10/492 (2%)
 Frame = -1

Query  1774  SSLPYEILSVD-IAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYN  1598
             S  P+ ILS D  AG+    S +  AAS DFG + +  P+ VL PSSV DII+L++ S++
Sbjct  31    SPQPWNILSNDNFAGKLTSASSSVEAASIDFGHVTKILPSAVLNPSSVQDIIDLIKLSFD  90

Query  1597  SPSPFSVAARGHGHSVRGQATAKDGVVVEMGALRGGGK-IRVSWSESLGYFADVGGHELW  1421
             S S F +AARGHGHS RGQA AKDGVVV M ++    + I+VS     G +ADV    LW
Sbjct  91    SQSSFPIAARGHGHSFRGQAAAKDGVVVNMRSMVNEDRGIKVS---RTGLYADVDTAWLW  147

Query  1420  VDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEF  1241
             ++VL+  L  G++P SWTDYL+LTVGGTLSN GISGQ  R GPQISNVLELD+ITGKGE 
Sbjct  148   IEVLNKTLELGLTPVSWTDYLYLTVGGTLSNGGISGQTSRYGPQISNVLELDIITGKGEI  207

Query  1240  ITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLI  1061
              TCS DMNS+LF+A LGGLGQFGIITRARI LE AP R KW+R LY DFS+FTRDQE LI
Sbjct  208   ATCSNDMNSDLFYAALGGLGQFGIITRARIKLELAPKRAKWLRFLYTDFSEFTRDQERLI  267

Query  1060  S-INGLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTG  884
             S   GL++LEGS+M++H  P+NWRS+++  SD  +I S++ +  ++YCLEVVK+YD+ + 
Sbjct  268   SEAGGLHFLEGSVMLDHGPPDNWRSTYYPPSDHLRIVSMIKRHRVIYCLEVVKYYDEFSQ  327

Query  883   STVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVP  704
              +V++E+++L + L+FV G  ++KD +Y +FLNRVR  EL  +  G W+  HPWLNLFVP
Sbjct  328   HSVNEEMEELSESLNFVRGFVYEKDVTYIDFLNRVRTGELNLKSKGQWDVPHPWLNLFVP  387

Query  703   KSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSGG  527
             KS+I  F+  VF+ I+L++  T+GP+LVYP    MW+++MS  IPEED FY VG L S  
Sbjct  388   KSQISRFDYGVFKGIILRNNITTGPLLVYPMKRIMWNDQMSTAIPEEDVFYAVGFLRSAE  447

Query  526   MNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFD  347
              + W+  D+ N E+L FC   ++    + QYLP++ S+E W++HFG +WNTF E K K+D
Sbjct  448   FDNWEAYDKENMEVLMFC---EDAKMDVIQYLPYHASQEGWVRHFGPRWNTFVERKYKYD  504

Query  346   PKMILSPGQTIF  311
             PKMILSPGQ IF
Sbjct  505   PKMILSPGQNIF  516



>ref|XP_011048828.1| PREDICTED: cytokinin dehydrogenase 5-like [Populus euphratica]
Length=534

 Score =   527 bits (1358),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 267/505 (53%), Positives = 343/505 (68%), Gaps = 25/505 (5%)
 Frame = -1

Query  1765  PYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSP  1586
             P E+L + + G+  VD      AS DFG I +  P  VL+P S DDI  LV+ +Y S   
Sbjct  24    PSELLRLGVDGQLSVDPFDIETASLDFGLISRSEPMAVLHPGSADDIARLVQAAYLSSQG  83

Query  1585  FSVAARGHGHSVRGQATAKDGVVVEM-GALRGG-------GKIRVSWSESLGYFADVGGH  1430
             F+V+ARGHGHS+ GQA   +GVV+EM G  RG         K +V+  E      DV G 
Sbjct  84    FTVSARGHGHSINGQAQTNNGVVIEMSGGSRGSRLGLGNLAKQQVAVKE---MHVDVWGG  140

Query  1429  ELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGK  1250
             ELW+DVL   L HG++P SWTDYL+L+VGGTLSN GISGQ F  GPQISNV ELDV+TGK
Sbjct  141   ELWIDVLRRTLEHGLAPKSWTDYLYLSVGGTLSNGGISGQAFNHGPQISNVYELDVVTGK  200

Query  1249  GEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQE  1070
             GE +TCS++ NS+LF AVLGGLGQFGIITRARI LE AP RV+W+R+LY +FS FT DQE
Sbjct  201   GELMTCSEEKNSKLFHAVLGGLGQFGIITRARIALEPAPQRVRWIRVLYSNFSTFTGDQE  260

Query  1069  HLISING------LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVV  908
             +LIS++G       +Y+EG ++++    NNWRSSFFS  +  KI+S+    G+LYCLE+ 
Sbjct  261   YLISMHGKPSTLKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKISSVGANGGVLYCLEIT  320

Query  907   KHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATH  728
             K+YD+ TG T+DQE++ L+K+L+F+P   F  D  Y +FL+RV   EL+ +  GLWE  H
Sbjct  321   KNYDESTGDTIDQEVEALMKNLNFIPSTVFTTDLPYTDFLDRVHRAELKLRAKGLWEVPH  380

Query  727   PWLNLFVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCV  548
             PWLNLFVP+SRI D +  VF+ IL  +KTSGP+L+YP     WD+R S V P+ED FY V
Sbjct  381   PWLNLFVPRSRIADLDRGVFKGILGNNKTSGPILIYPMNKNKWDQRSSVVTPDEDVFYLV  440

Query  547   GLLYSGGMNG-----WKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKK  383
              LL S   NG      + L + N +IL FC   D+ G K+KQYLPHY +RE+WM HFG K
Sbjct  441   ALLRSALDNGEETQSLEYLTDQNGKILRFC---DDAGIKVKQYLPHYTTREEWMDHFGDK  497

Query  382   WNTFQENKAKFDPKMILSPGQTIFN  308
             W+ F + K +FDP+ IL+ GQ IFN
Sbjct  498   WDRFYQRKMEFDPRRILATGQRIFN  522



>gb|AHL64253.1| cytokinin dehydrogenase 5 [Rosa canina]
Length=541

 Score =   527 bits (1358),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 266/507 (52%), Positives = 349/507 (69%), Gaps = 26/507 (5%)
 Frame = -1

Query  1765  PYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSP  1586
             P E+L + + G+  +D      AS DFG + +  P  V++P+S +D+  LVR +Y+S   
Sbjct  25    PAELLRLVVDGQLSMDPSDVETASKDFGLMSRAEPLAVMHPASAEDVTRLVRAAYSSAKS  84

Query  1585  FSVAARGHGHSVRGQATAKDGVVVEM--GALRGGGKIRVSWSESLG-------YFADVGG  1433
             FSV+ARGHGHS+ GQA A++GVVVEM  G   G GK     SE++G        + D  G
Sbjct  85    FSVSARGHGHSINGQAQARNGVVVEMSGGNRVGSGKPAAGRSETVGRVVSEKGLYMDAWG  144

Query  1432  HELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITG  1253
              ELW++VL A L +G++P SWTDYL+L+VGGTLSNAGISGQ F  GPQISNVLE+DV+TG
Sbjct  145   GELWIEVLRATLEYGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVLEVDVVTG  204

Query  1252  KGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQ  1073
             KGE +TCS++ NSELF AVLGGLGQFGIITRARI LE AP RV+W+R+LY +FS FT+DQ
Sbjct  205   KGELLTCSEERNSELFHAVLGGLGQFGIITRARIALEPAPKRVRWIRVLYSNFSAFTKDQ  264

Query  1072  EHLISING------LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLT--QQGLLYCL  917
             E+LIS++G       +Y+EG ++++    NNWRSSFFS S+  KI+S+ +    G+LYCL
Sbjct  265   EYLISLHGQPSSQKFDYVEGFVIVDEGLINNWRSSFFSPSNPVKISSIDSNGNGGILYCL  324

Query  916   EVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWE  737
             E+ K+YDD T  T+DQE++ LL+ L FVP   F  D  Y +FL+RV   EL+ +  GLW+
Sbjct  325   EITKNYDDSTADTIDQEIEALLEKLDFVPTSVFTTDLPYVDFLDRVHKAELKLRSKGLWD  384

Query  736   ATHPWLNLFVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTF  557
               HPWLNLFVPKSRI DF+  VF+ I L +KTSGP+L+YP     WD++ S V P+ED F
Sbjct  385   VPHPWLNLFVPKSRIADFDEGVFKGI-LGNKTSGPVLIYPMNNDKWDQQSSVVTPDEDVF  443

Query  556   YCVGLLYSGGMNG-----WKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHF  392
             Y V LL S   +G      + L + N+ I  FC   DE G KIKQYLPHY ++++WM HF
Sbjct  444   YLVALLRSALDSGDETHTLEYLTDQNRRIFKFC---DEAGIKIKQYLPHYTTQQEWMDHF  500

Query  391   GKKWNTFQENKAKFDPKMILSPGQTIF  311
             G KW  F + K +FDP+ IL+ GQ IF
Sbjct  501   GDKWPQFYQRKMEFDPRRILATGQRIF  527



>ref|XP_010539134.1| PREDICTED: LOW QUALITY PROTEIN: cytokinin dehydrogenase 3 [Tarenaya 
hassleriana]
Length=539

 Score =   526 bits (1356),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 270/494 (55%), Positives = 343/494 (69%), Gaps = 20/494 (4%)
 Frame = -1

Query  1765  PYEILSVD-IAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPS  1589
             P+ ILS D +AG+   D+ A  + + DFGG  +  PA VL PSS  DI  LV+ SY+SP 
Sbjct  52    PWNILSGDNLAGKLTTDASAVESVAMDFGGTTKIFPAAVLNPSSAADIAALVKSSYDSPV  111

Query  1588  PFSVAARGHGHSVRGQATAKDGVVVEMGALR------GGGKIRVSWSESLGYFADVGGHE  1427
             PFS+AARG        A A  GVVV M  LR       G  +R+S     G +ADVGG  
Sbjct  112   PFSIAARG-----XNLAAADGGVVVNMRPLRRELRRGDGFHLRIS---PEGSYADVGGEW  163

Query  1426  LWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKG  1247
             LW++VL+A L  G SP SWTDYL+LTVGGTLS+ GISGQ FR GPQISNV+E+DVITGKG
Sbjct  164   LWIEVLNATLEFGWSPVSWTDYLYLTVGGTLSSGGISGQSFRHGPQISNVVEMDVITGKG  223

Query  1246  EFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEH  1067
             E +TCSKD NS+LF+AVLGGLGQFGIITRARI L  AP RVKW+R LY+DFSKFTRDQE 
Sbjct  224   ETVTCSKDRNSDLFYAVLGGLGQFGIITRARIHLRPAPKRVKWLRFLYNDFSKFTRDQES  283

Query  1066  LIS-INGLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQ  890
             LIS  NG ++LEG LM +H SP+NWRS++F  SD S+I S++ +  ++YCLEVVK+YD  
Sbjct  284   LISETNGPDFLEGLLMTHHGSPDNWRSTYFPPSDHSRIISMVKRHRVIYCLEVVKYYDQT  343

Query  889   TGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLF  710
             +  T+D+E+++L + L +V G  ++KD +Y EFLNRVR  EL  +  G W+  HPWLNLF
Sbjct  344   SQHTIDEEIEELTEGLKYVRGYMYEKDVTYTEFLNRVRSGELRLRSEGQWDNPHPWLNLF  403

Query  709   VPKSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYS  533
             VPKS I  F+  VF++I+L++  T+GP+LVYP     W+++MS V+PEED FY +G L+S
Sbjct  404   VPKSHISRFDLRVFRDIVLRNNITTGPVLVYPMNRNKWNDKMSTVVPEEDIFYTIGFLHS  463

Query  532   GGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAK  353
                +     +E N EIL  C  D   G K  QYLPH+ S E W +HFG KW+ F E K +
Sbjct  464   ARDDDLGAYEEQNMEILESCEDD---GIKAIQYLPHHASSEGWSRHFGPKWSVFIERKNR  520

Query  352   FDPKMILSPGQTIF  311
             +DP+MILSPG  IF
Sbjct  521   YDPRMILSPGHNIF  534



>ref|XP_002300742.2| cytokinin oxidase 6 family protein [Populus trichocarpa]
 gb|EEE80015.2| cytokinin oxidase 6 family protein [Populus trichocarpa]
Length=535

 Score =   525 bits (1353),  Expect = 8e-177, Method: Compositional matrix adjust.
 Identities = 266/505 (53%), Positives = 338/505 (67%), Gaps = 25/505 (5%)
 Frame = -1

Query  1765  PYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSP  1586
             P E+L + + G+  VD      AS DFG + +  P  VL+P S DDI  LVR +Y S   
Sbjct  24    PSELLLLGVDGQLSVDQFDVETASLDFGLLTRAEPMAVLHPGSADDIARLVRAAYISSHG  83

Query  1585  FSVAARGHGHSVRGQATAKDGVVVEMGA--------LRGGGKIRVSWSESLGYFADVGGH  1430
             F+V+ARGHGHS+ GQA   +GVV+EM          LR   K +VS  E      DV G 
Sbjct  84    FTVSARGHGHSINGQAQTSNGVVIEMSGGSRGSRFGLRKLDKPQVSIKEK---HVDVWGG  140

Query  1429  ELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGK  1250
             ELW+DVL + L HG++P SWTDYL+L+VGGTLSN GISGQ F  GPQISNV ELDV+TGK
Sbjct  141   ELWIDVLRSTLEHGLAPKSWTDYLYLSVGGTLSNGGISGQAFNHGPQISNVYELDVVTGK  200

Query  1249  GEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQE  1070
             GE  TCS++ NSELF AVLGGLGQFGIITRARI LE AP RV+W+R+LY +FS FT DQE
Sbjct  201   GELSTCSEEKNSELFHAVLGGLGQFGIITRARIALEPAPQRVRWIRVLYSNFSTFTGDQE  260

Query  1069  HLISING------LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVV  908
             +LIS++G       +Y+EG ++++    NNWRSSFFS  +  KI+S+    G+LYCLE+ 
Sbjct  261   YLISLHGNPYSQKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKISSIGANGGVLYCLEIT  320

Query  907   KHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATH  728
             K+YD+ T  T+DQE++ L+K L+F+P   F  D  Y +FL+RV   EL+ +  GLWE  H
Sbjct  321   KNYDEATADTIDQEVEALMKRLNFIPSSVFTTDLPYIDFLDRVHKAELKLRAKGLWEVPH  380

Query  727   PWLNLFVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCV  548
             PWLNLFVPKSR+ D +  VF+ IL  +KTSGP+L+YP     WD+R S V P+ED FY V
Sbjct  381   PWLNLFVPKSRMADLDRGVFKGILGNNKTSGPILIYPMNKSKWDQRSSVVTPDEDVFYLV  440

Query  547   GLLYSGGMNG-----WKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKK  383
              LL S   NG      + L   N +IL FC   D+ G K+KQYLPHY ++E+WM HFG K
Sbjct  441   ALLRSALDNGEETQSLEYLTNQNHKILRFC---DDAGIKVKQYLPHYTTQEEWMDHFGDK  497

Query  382   WNTFQENKAKFDPKMILSPGQTIFN  308
             W+ F   K +FDP+ IL+ GQ IFN
Sbjct  498   WDQFSRRKMEFDPRHILATGQRIFN  522



>gb|EYU32888.1| hypothetical protein MIMGU_mgv1a004444mg [Erythranthe guttata]
Length=526

 Score =   525 bits (1352),  Expect = 8e-177, Method: Compositional matrix adjust.
 Identities = 258/496 (52%), Positives = 342/496 (69%), Gaps = 16/496 (3%)
 Frame = -1

Query  1765  PYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSP  1586
             P E+LS+++ GR  ++     +AS DFGG+    P  VL+P+S +D+  LV+ +Y S   
Sbjct  24    PTELLSLEMEGRLSLEPSDVGSASRDFGGMQSSEPLAVLHPASAEDVARLVKAAYESAQG  83

Query  1585  FSVAARGHGHSVRGQATAKDGVVVEMGALRGGGKIRVS--WSESLGYFADVGGHELWVDV  1412
             F V+ARGHGHS+ GQA A +G+V++M     GG  R+    SE L +  DV G ELW+DV
Sbjct  84    FGVSARGHGHSINGQAMAGNGLVIQMSGSSAGGSRRLGPRVSEELMH-VDVWGGELWIDV  142

Query  1411  LHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITC  1232
             L + L +G++P SWTDYL+L+VGGT+SNAGISGQ F  GPQISNVLELDV+TGKGE +TC
Sbjct  143   LRSTLEYGLAPKSWTDYLYLSVGGTISNAGISGQAFNHGPQISNVLELDVVTGKGELMTC  202

Query  1231  SKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISIN  1052
             SK+ NS+L+ AVLGGLGQFGIITRARI LEK PTRVKW+R+LY DF+ FT+DQE+LIS++
Sbjct  203   SKEHNSKLYHAVLGGLGQFGIITRARIALEKTPTRVKWIRVLYSDFATFTQDQEYLISLH  262

Query  1051  G----LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTG  884
             G     +Y+EG ++++    NNWRSSFFS  +  KI+SL    G+LYCLE+ K+Y +   
Sbjct  263   GQKRKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKISSLNADGGVLYCLEITKNYHESNA  322

Query  883   STVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVP  704
              T+DQE++ L+  L+++P   F  D  Y +FL+RV   EL+ +   LWE  HPWLNLFVP
Sbjct  323   DTIDQEVEALMNKLNYIPASVFTTDLPYVDFLDRVHKAELKLRAKNLWEVPHPWLNLFVP  382

Query  703   KSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSGGM  524
             KSRI DF+  +F+ I L + TSGP+L+YP     WDE+ SAV P ED FY V LL S   
Sbjct  383   KSRIADFDKGIFKGI-LGNNTSGPILIYPMNKNKWDEKSSAVTPNEDVFYLVALLRSALN  441

Query  523   NG-----WKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENK  359
             +G      + L   N++IL FC    EEG  +KQYLPHY + ++W  HFG+KWN F   K
Sbjct  442   DGNETQSLEYLSNQNRKILRFCK---EEGIDVKQYLPHYTTEQEWRNHFGEKWNLFSSRK  498

Query  358   AKFDPKMILSPGQTIF  311
              +FDP+ IL+ GQ IF
Sbjct  499   TEFDPRRILATGQRIF  514



>ref|XP_008387997.1| PREDICTED: cytokinin dehydrogenase 5-like [Malus domestica]
Length=538

 Score =   525 bits (1353),  Expect = 8e-177, Method: Compositional matrix adjust.
 Identities = 259/498 (52%), Positives = 343/498 (69%), Gaps = 17/498 (3%)
 Frame = -1

Query  1765  PYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSP  1586
             P E+L + + G+  VD      AS DFG + +  P  VL+P+S  D+  LVR +Y+SP  
Sbjct  26    PTELLRLVVDGQLSVDPSDVDTASKDFGLMSRAAPLAVLHPASAQDVAGLVRAAYSSPHG  85

Query  1585  FSVAARGHGHSVRGQATAKDGVVVEM--GALRGGGKIRVSWSESLGYFADVGGHELWVDV  1412
             F+V+ARGHGHS+ GQA   +GVV++M  G+LR G   + +     G + D  G ELW+DV
Sbjct  86    FTVSARGHGHSINGQAQTNNGVVIQMSGGSLRSGRPAQAARVSEKGMYVDTWGGELWIDV  145

Query  1411  LHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITC  1232
             L + L +G++P SWTDYL+LTVGGTLSNAGISGQ F  GPQISNV ELDV+TGKG+ +TC
Sbjct  146   LRSTLEYGLAPKSWTDYLYLTVGGTLSNAGISGQAFNYGPQISNVHELDVVTGKGQLLTC  205

Query  1231  SKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISIN  1052
             S++ NSELF AVLGGLGQFGIITRARI LE +P RV+W+R+LY +FS FT+DQE LIS++
Sbjct  206   SEEQNSELFQAVLGGLGQFGIITRARIALEPSPKRVRWIRVLYSNFSAFTKDQEFLISLH  265

Query  1051  G------LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQ  890
             G       +Y+EG ++++    NNWRSSFFS S+  KI S+ ++ G+LYCLE+ K+YD+ 
Sbjct  266   GQPSSQKFDYVEGFVIVDEGLINNWRSSFFSASNPVKITSIDSEGGVLYCLEITKNYDES  325

Query  889   TGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLF  710
             T  T+D+E++DLL+ L FVP   F  D  Y +FL+RV   EL+ +  GLW+  HPWLNLF
Sbjct  326   TADTIDKEIEDLLEKLDFVPTSVFTTDLPYVDFLDRVHKAELKLRAKGLWDVPHPWLNLF  385

Query  709   VPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSG  530
             VPKSRI DFN  VF+ I L +KTSGP+L+YP     WD+  S V P+ED FY V LL + 
Sbjct  386   VPKSRISDFNEGVFKGI-LGNKTSGPILIYPMNKDKWDQSSSVVTPDEDIFYLVALLRTA  444

Query  529   GMNGWKV-----LDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQE  365
                G +      L   N++IL FC    + G ++KQYLPHY ++E+WM HFG KW  F +
Sbjct  445   LDTGDETHTLEHLTNQNRQILRFCV---DAGIEVKQYLPHYTTQEEWMDHFGDKWARFYK  501

Query  364   NKAKFDPKMILSPGQTIF  311
              K +FDP+ IL+ GQ IF
Sbjct  502   RKMEFDPRRILATGQRIF  519



>ref|XP_003635626.2| PREDICTED: cytokinin dehydrogenase 3-like, partial [Vitis vinifera]
Length=372

 Score =   518 bits (1335),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 245/373 (66%), Positives = 300/373 (80%), Gaps = 5/373 (1%)
 Frame = -1

Query  1423  WVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGE  1244
             W+DVL A L HG++P SWTDYL+LT+GGTLSNAGISGQ FR GPQISNV E+DV+TGKGE
Sbjct  2     WIDVLQATLKHGLAPVSWTDYLYLTIGGTLSNAGISGQTFRHGPQISNVYEMDVLTGKGE  61

Query  1243  FITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHL  1064
              +TCSKD NSELFFAVLGGLGQFGII RARI L+ AP RVKW++MLYDDFS F+RDQEHL
Sbjct  62    LVTCSKDTNSELFFAVLGGLGQFGIIIRARIALKPAPKRVKWIQMLYDDFSTFSRDQEHL  121

Query  1063  ISINGLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTG  884
             ISINGL+YLEGSL+M ++SPNNWRSS FS S+  +I+SL+++ G++YCLEVVK+YD+ T 
Sbjct  122   ISINGLDYLEGSLLMQNSSPNNWRSS-FSPSEYPRISSLISKNGIIYCLEVVKYYDELTS  180

Query  883   STVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVP  704
              TVD+EL++LLK L+F+PG  F KD S  +FLNRV  EEL  +  GLW+  HPWLNLFVP
Sbjct  181   HTVDEELQELLKGLNFLPGFVFTKDVSLVDFLNRVHSEELNLRAKGLWDVPHPWLNLFVP  240

Query  703   KSRILDFNSAVFQNILLK-HKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSGG  527
              SRI DFNS VF++IL K ++T+G  L+YP     WD+R SAVIP+ED FY VGLL+S G
Sbjct  241   GSRISDFNSGVFRDILPKINQTTGTFLIYPVIRNKWDDRTSAVIPDEDIFYTVGLLHSSG  300

Query  526   MNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFD  347
              + W+ L+  N+EIL FC   D+ G KIK+YL  Y +++DWM HFG KW TF++ KA+FD
Sbjct  301   ADDWEPLENQNKEILKFC---DKAGIKIKRYLSRYTTKKDWMNHFGPKWRTFEDRKAQFD  357

Query  346   PKMILSPGQTIFN  308
             PKMILSPGQ IFN
Sbjct  358   PKMILSPGQQIFN  370



>gb|KCW60664.1| hypothetical protein EUGRSUZ_H03393, partial [Eucalyptus grandis]
Length=474

 Score =   522 bits (1345),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 266/455 (58%), Positives = 330/455 (73%), Gaps = 12/455 (3%)
 Frame = -1

Query  1804  SILGKLKPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDI  1625
             +++ + K  N  L  E+LS+ IA    +D  +   AS DFG IV++ PA VL PS  +DI
Sbjct  21    TLVCQSKLLNDPLYRELLSLPIASDLHIDPESIAEASVDFGLIVRKIPAVVLRPSHPEDI  80

Query  1624  INLVRFSYNSPS-PFSVAARGHGHSVRGQATAKDGVVVEMGALRGGGKIRVSWSESLGYF  1448
               LV F+ +  S PF+++ARG GHSVRGQA A+DGVVV+M +L  G K  VSWS+SLG++
Sbjct  81    AVLVAFANSKSSIPFTISARGCGHSVRGQAMARDGVVVDMTSL--GNKTAVSWSQSLGHY  138

Query  1447  ADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLEL  1268
             ADVGG +LW++VL   L HGV+P SWTDYL+LTVGGTLSNAGISG+ FR GPQISNV E+
Sbjct  139   ADVGGQQLWINVLEETLKHGVTPVSWTDYLYLTVGGTLSNAGISGETFRYGPQISNVYEM  198

Query  1267  DVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSK  1088
             DVITG G F TCS   N ELF++VLGGLGQFGIITRARI L +AP R  WVRMLY DFS 
Sbjct  199   DVITGTGHFFTCSPHKNPELFYSVLGGLGQFGIITRARIALGQAPNRAIWVRMLYSDFSA  258

Query  1087  FTRDQEHLISING------LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLL  926
             FT DQE LIS++G      L+Y+EG L M   S ++W  SFFSLSD+ ++ SLLT+  LL
Sbjct  259   FTTDQERLISLHGRDQDEALDYVEGQLFMRRNS-DSW-ISFFSLSDRPRLMSLLTEHELL  316

Query  925   YCLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENG  746
             YC+EV K YD++T STVD++LK +LKDLS VP   F+KD  Y +FLNRVR EEL  +E G
Sbjct  317   YCIEVAKFYDERTRSTVDKDLKTILKDLSHVPEFLFQKDVGYVDFLNRVRAEELTLRELG  376

Query  745   LWEATHPWLNLFVPKSRILDFNSAVFQNILL-KHKTSGPMLVYPTTTKMWDERMSAVIPE  569
             LW   HPWLNLFVPKSRI DFN+ VF+NI+L K+ T+GP+L+YP     WD+RMSAVIP+
Sbjct  377   LWNVPHPWLNLFVPKSRIADFNTGVFKNIVLRKNITTGPVLIYPMNNDKWDDRMSAVIPD  436

Query  568   EDTFYCVGLLYSGGMNGWKVLDELNQEILSFCNKD  464
             ED FY VG L S G   W+  D  N+E+L FC  +
Sbjct  437   EDVFYTVGFLLSSGFKDWQEFDLQNKEVLLFCEDN  471



>gb|KDP38564.1| hypothetical protein JCGZ_04489 [Jatropha curcas]
Length=538

 Score =   525 bits (1351),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 266/500 (53%), Positives = 340/500 (68%), Gaps = 19/500 (4%)
 Frame = -1

Query  1765  PYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSP  1586
             P E+L + + G+  VD      AS DFG + +  P  VL+P+S +DI  LVR +YNS   
Sbjct  26    PAELLRLGVDGQLSVDPSDVEIASLDFGLLSRAEPMAVLHPASAEDIARLVRAAYNSARG  85

Query  1585  FSVAARGHGHSVRGQATAKDGVVVEMGALR----GGGKIRVSWSESLGYFADVGGHELWV  1418
             F+V+ARGHGHS+ GQA   +GVVVEM + R    G GK       +     DV G ELW+
Sbjct  86    FTVSARGHGHSINGQAQTSNGVVVEMSSARRSQLGRGKPDPPQVSAKEMHVDVWGGELWI  145

Query  1417  DVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFI  1238
             DVL + L +G++P SWTDYL+L+VGGTLSNAGISGQ F  GPQISNV ELDV+TGKGE +
Sbjct  146   DVLRSTLEYGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGEIL  205

Query  1237  TCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLIS  1058
             TCS++ NSELF AVLGGLGQFGIITRARI L  AP RV+W+R+LY  FS FT DQE+LIS
Sbjct  206   TCSQEQNSELFHAVLGGLGQFGIITRARIALGPAPQRVRWIRVLYSSFSSFTTDQEYLIS  265

Query  1057  ING------LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYD  896
             + G       +Y+EG ++++    NNWRSSFFS  +  KI+S+    G+LYCLE+ K+YD
Sbjct  266   LYGNPSTQKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKISSIDANGGVLYCLEITKNYD  325

Query  895   DQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLN  716
             D T   +DQE++ LLK L+F+P   F  D  Y +FL+RV   EL+ +  GLW+  HPWLN
Sbjct  326   DSTLDNIDQEVESLLKKLNFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLN  385

Query  715   LFVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLY  536
             LFVPKSRI DF++ VF+ I L +KTSGP+L+YP     WD+R S V P+ED FY V LL 
Sbjct  386   LFVPKSRIADFDNGVFKGI-LGNKTSGPILIYPMNRNKWDQRTSVVTPDEDVFYLVALLR  444

Query  535   SGGMNG--WKVLDEL---NQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTF  371
             S   NG   + LD L   N++IL FC   D+ G  +KQYLPHY + +DW+ HFG KW+ F
Sbjct  445   SALDNGEDTQTLDYLSNQNRQILRFC---DDAGINVKQYLPHYTTEKDWVDHFGDKWSQF  501

Query  370   QENKAKFDPKMILSPGQTIF  311
               NK +FDP+ IL+ GQ IF
Sbjct  502   YRNKMEFDPRRILATGQRIF  521



>emb|CBI41113.3| unnamed protein product [Vitis vinifera]
Length=373

 Score =   518 bits (1334),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 245/373 (66%), Positives = 300/373 (80%), Gaps = 5/373 (1%)
 Frame = -1

Query  1423  WVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGE  1244
             W+DVL A L HG++P SWTDYL+LT+GGTLSNAGISGQ FR GPQISNV E+DV+TGKGE
Sbjct  3     WIDVLQATLKHGLAPVSWTDYLYLTIGGTLSNAGISGQTFRHGPQISNVYEMDVLTGKGE  62

Query  1243  FITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHL  1064
              +TCSKD NSELFFAVLGGLGQFGII RARI L+ AP RVKW++MLYDDFS F+RDQEHL
Sbjct  63    LVTCSKDTNSELFFAVLGGLGQFGIIIRARIALKPAPKRVKWIQMLYDDFSTFSRDQEHL  122

Query  1063  ISINGLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTG  884
             ISINGL+YLEGSL+M ++SPNNWRSS FS S+  +I+SL+++ G++YCLEVVK+YD+ T 
Sbjct  123   ISINGLDYLEGSLLMQNSSPNNWRSS-FSPSEYPRISSLISKNGIIYCLEVVKYYDELTS  181

Query  883   STVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVP  704
              TVD+EL++LLK L+F+PG  F KD S  +FLNRV  EEL  +  GLW+  HPWLNLFVP
Sbjct  182   HTVDEELQELLKGLNFLPGFVFTKDVSLVDFLNRVHSEELNLRAKGLWDVPHPWLNLFVP  241

Query  703   KSRILDFNSAVFQNILLK-HKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSGG  527
              SRI DFNS VF++IL K ++T+G  L+YP     WD+R SAVIP+ED FY VGLL+S G
Sbjct  242   GSRISDFNSGVFRDILPKINQTTGTFLIYPVIRNKWDDRTSAVIPDEDIFYTVGLLHSSG  301

Query  526   MNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFD  347
              + W+ L+  N+EIL FC   D+ G KIK+YL  Y +++DWM HFG KW TF++ KA+FD
Sbjct  302   ADDWEPLENQNKEILKFC---DKAGIKIKRYLSRYTTKKDWMNHFGPKWRTFEDRKAQFD  358

Query  346   PKMILSPGQTIFN  308
             PKMILSPGQ IFN
Sbjct  359   PKMILSPGQQIFN  371



>ref|XP_009389713.1| PREDICTED: cytokinin dehydrogenase 6-like [Musa acuminata subsp. 
malaccensis]
Length=531

 Score =   524 bits (1349),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 281/511 (55%), Positives = 354/511 (69%), Gaps = 18/511 (4%)
 Frame = -1

Query  1807  MSILGKLKPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDD  1628
             +S+LG+L+PW ++LP  +LS+DIA        AT   S D+G + +  PA VLYPSS DD
Sbjct  25    LSLLGQLRPWPATLPQGLLSLDIADELHYGPNATARFSIDYGRLTEAAPAAVLYPSSPDD  84

Query  1627  IINLVRFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGALRGGG--------KIRVS  1472
             I +LVRFSY SP PF +AARGHGHS+RGQA A  GVVV+M +L GG         K+ + 
Sbjct  85    IASLVRFSYASPRPFVIAARGHGHSIRGQAFAPGGVVVDMASLGGGRRARRRDRIKVPLD  144

Query  1471  WSESLGYFADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGP  1292
                 L Y  D GG +LW+DVL   L HGV+P SWTDYL+LTVGGTLSNAGISGQ FR GP
Sbjct  145   DVHRLLY-VDAGGEQLWIDVLRETLEHGVAPRSWTDYLYLTVGGTLSNAGISGQAFRHGP  203

Query  1291  QISNVLELDVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVR  1112
             QISNV ELDVITGKG+ +T S+D+NS+LF+ VLGGLGQ GIITRARI +E AP RV+WVR
Sbjct  204   QISNVHELDVITGKGDMVTSSRDVNSDLFYGVLGGLGQLGIITRARIAVEPAPQRVRWVR  263

Query  1111  MLYDDFSKFTRDQEHLISIN--GLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQ  938
              +Y DF  F  DQE LISI+  G +Y+EG L+M + + N   SSFFS  D  KI  L  +
Sbjct  264   FIYTDFGSFINDQELLISISEEGFDYVEGQLLMKNGAAN---SSFFSERDSEKIKVLAAE  320

Query  937   QGLLYCLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEP  758
              G++Y LE   +Y+  T S VDQ+LK LLK LSFVPG  F KD SY  FL+RV  +E++ 
Sbjct  321   FGVIYFLEGAIYYELATASLVDQKLKLLLKKLSFVPGFAFTKDVSYLRFLDRVHHDEIKL  380

Query  757   QENGLWEATHPWLNLFVPKSRILDFNSAVFQNILLKHKTS-GPMLVYPTTTKMWDERMSA  581
             +  GLW+  HPWLNLFVPKSR+ DF + +F+ IL+++ T    +L+ P     WDE+MS 
Sbjct  381   RPMGLWDVPHPWLNLFVPKSRMRDFETGIFRGILIENNTPMATVLISPMNRSKWDEKMSV  440

Query  580   VIPEEDTFYCVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWM  401
              IP+ED FY +G+L S  M+ WK LD+ N EIL FCN   + G + KQYLPHY ++ DW 
Sbjct  441   TIPDEDIFYAIGILRSATMDDWKHLDDQNDEILRFCN---QAGIEFKQYLPHYTTQADWK  497

Query  400   KHFGKKWNTFQENKAKFDPKMILSPGQTIFN  308
             KHFG KW+TF + K ++DPK +LSPGQ IF 
Sbjct  498   KHFGLKWDTFVQLKRRYDPKALLSPGQQIFT  528



>gb|KHG00982.1| Cytokinin dehydrogenase 5 -like protein [Gossypium arboreum]
Length=520

 Score =   523 bits (1346),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 262/495 (53%), Positives = 343/495 (69%), Gaps = 21/495 (4%)
 Frame = -1

Query  1765  PYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSP  1586
             P E+L + +     VD     +AS DFG + +  P  VL PSS +D+  LV+ +Y S   
Sbjct  24    PTELLRLGLT----VDPVDVESASVDFGLMTKVEPLAVLRPSSAEDVAQLVKAAYESSHG  79

Query  1585  FSVAARGHGHSVRGQATAKDGVVVEMGALRGGGKIRVSWSESLGYFADVGGHELWVDVLH  1406
             F+V+ARGHGHS+ GQA    GVVV+M  +R GGK  V W   +  + DV G ELW+DVL 
Sbjct  80    FTVSARGHGHSINGQAQTGTGVVVQMSGVRSGGKPSV-WGGDM--YVDVWGGELWIDVLK  136

Query  1405  ACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSK  1226
             +CL +G++P SWTDYL+L+VGGTLSNAGISGQ F  GPQISNV ELDV+TGKGE +TCSK
Sbjct  137   SCLEYGLAPKSWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVHELDVVTGKGELMTCSK  196

Query  1225  DMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISING-  1049
             + N ELF AVLGGLGQFGIITRARI LE AP RV+W+R+LY +FS FT+DQE+LIS++G 
Sbjct  197   EQNQELFIAVLGGLGQFGIITRARISLEPAPQRVRWIRVLYSNFSAFTKDQEYLISLHGN  256

Query  1048  --LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQ--GLLYCLEVVKHYDDQTGS  881
                +Y+EG ++++    NNWRSSFFS  +  KI+SL +    G+LYCLE+ K+Y + T  
Sbjct  257   QKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKISSLGSNNNGGVLYCLEITKNYHESTAE  316

Query  880   TVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPK  701
             T+DQE++ LLK L+F+P   F  D  Y +FL+RV   EL+ +  G+WE  HPWLNLFVPK
Sbjct  317   TIDQEIEALLKKLNFIPTSVFTTDLPYVDFLDRVHKAELKLRSKGMWEVPHPWLNLFVPK  376

Query  700   SRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSGGMN  521
             S+I DF+  VF+ I L +KTSGP+L+YP     WD++ S V P+ED FY V  L S   N
Sbjct  377   SKIADFDRGVFKGI-LGNKTSGPILIYPMNKNKWDDKSSVVTPDEDVFYLVAFLRSALDN  435

Query  520   G-----WKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKA  356
             G      + L   N++IL FC   DE+G K+KQYLPHY+++ +W +H+G KW+ FQ  K 
Sbjct  436   GEETQSLEYLTNQNRQILKFC---DEDGIKVKQYLPHYKTQSEWKEHYGSKWDRFQRMKM  492

Query  355   KFDPKMILSPGQTIF  311
             KFDP+ IL+ GQ IF
Sbjct  493   KFDPRHILASGQNIF  507



>ref|XP_002510450.1| gulonolactone oxidase, putative [Ricinus communis]
 gb|EEF52637.1| gulonolactone oxidase, putative [Ricinus communis]
Length=540

 Score =   523 bits (1348),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 269/506 (53%), Positives = 339/506 (67%), Gaps = 28/506 (6%)
 Frame = -1

Query  1765  PYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSP  1586
             P E+L + + GR  VD      AS DFG + +  P  V +P+S  DI  LVR +YNS   
Sbjct  25    PAELLRLGVDGRLSVDPSDVEMASLDFGLLSRSQPMAVFHPASAQDIARLVRAAYNSAHG  84

Query  1585  FSVAARGHGHSVRGQATAK-DGVVVEMGA---------LRGGGKIRVSWSESLGYFADVG  1436
             F+V+ARGHGHS+ GQA  + +GVV+EM           LR     +VS  E      DV 
Sbjct  85    FTVSARGHGHSINGQAQTRINGVVIEMSGSDSRRSQLGLRKPASPKVSAKE---MHVDVW  141

Query  1435  GHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVIT  1256
             G ELW+DVL + L +G++P SWTDYL+L+VGGTLSNAGISGQ F  GPQISNV ELDV+T
Sbjct  142   GGELWIDVLKSTLEYGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVT  201

Query  1255  GKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRD  1076
             GKGE +TCS   NSELF AVLGGLGQFGIITRARI LE AP RV+W+R+LY  FS FTRD
Sbjct  202   GKGEILTCSDQQNSELFHAVLGGLGQFGIITRARIALEPAPQRVRWIRVLYSSFSSFTRD  261

Query  1075  QEHLISING------LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLE  914
             QE+LIS+ G       +Y+EG ++++    NNWRSSFFS  +  KI+S+    G+LYCLE
Sbjct  262   QEYLISLQGNSAAQKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKISSIGANGGVLYCLE  321

Query  913   VVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEA  734
             V K+YDD T  T+DQE++ LLK L+F+P   F  D  Y +FL+RV   EL+ +  GLW+ 
Sbjct  322   VTKNYDDSTVDTIDQEIEWLLKKLNFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDV  381

Query  733   THPWLNLFVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFY  554
              HPWLNLFVPKSRI DF+  VF+ I L +KTSGP+L+YP     W++R SAV P+E+ FY
Sbjct  382   PHPWLNLFVPKSRIADFDKGVFKGI-LGNKTSGPILIYPMNRNKWEQRSSAVTPDEEVFY  440

Query  553   CVGLLYSGGMNG-----WKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFG  389
              V LL S   NG      + L   N++IL FC   D+ G K+KQYLPHY S E+W+ HFG
Sbjct  441   LVALLRSALDNGEETQTLEYLSNQNRQILRFC---DDAGIKVKQYLPHYTSEEEWVDHFG  497

Query  388   KKWNTFQENKAKFDPKMILSPGQTIF  311
              KW+ F  NK +FDP+ IL+ GQ IF
Sbjct  498   DKWSKFYHNKMEFDPRRILATGQRIF  523



>ref|XP_004488074.1| PREDICTED: cytokinin dehydrogenase 3-like [Cicer arietinum]
Length=526

 Score =   523 bits (1347),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 262/491 (53%), Positives = 343/491 (70%), Gaps = 20/491 (4%)
 Frame = -1

Query  1741  IAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSPFSVAARGH  1562
             +A +   D +    ASTD+G I+ ++P  VL PSS+DDI NL++FS +  +PF+++ RG 
Sbjct  41    LASKLSRDPQILLEASTDYGHIIHKSPYAVLEPSSIDDIANLIKFSNSLSNPFTISPRGK  100

Query  1561  GHSVRGQATAKDGVVVEMGAL---RGGGKIRVSWSE---SLGYFADVGGHELWVDVLHAC  1400
              HSV GQA A++GVVV M  L   R G  I VS  +    L  + DVGG +LW+DVLHA 
Sbjct  101   AHSVLGQAMAQNGVVVNMTQLNGFRNGSGIVVSNCDVKSPLDCYVDVGGEQLWIDVLHAT  160

Query  1399  LAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDM  1220
                G++P SWTDYL+LTVGGTLSNAGISGQ FR GPQISNVLELDVITG+GEF+TCS++ 
Sbjct  161   TKLGLAPLSWTDYLYLTVGGTLSNAGISGQTFRFGPQISNVLELDVITGQGEFVTCSREK  220

Query  1219  NSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISI-----  1055
             NSELF++VLGGLGQFG+ITRAR+ L  +PTR KW+R++YDDFSKF+ DQEHLIS      
Sbjct  221   NSELFYSVLGGLGQFGVITRARLPLGPSPTRAKWLRLIYDDFSKFSTDQEHLISFNNKND  280

Query  1054  -NGLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGST  878
              N  NY+EG L+ N    +    SF+   DQ +I SL+T+ G+ Y +E+VK+YD  +   
Sbjct  281   TNAANYVEGILLFNKPLLD---LSFYPTPDQPRIKSLVTKSGIAYVIELVKYYDTNSQPR  337

Query  877   VDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKS  698
             VD+E+ +L+K L+FVP   F+KD +Y EFL+RV  EEL  +  GLWE  HPWLN+F+PKS
Sbjct  338   VDEEVDNLIKGLNFVPTFMFQKDVTYEEFLDRVHVEELVLRSKGLWEVPHPWLNMFIPKS  397

Query  697   RILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSG-GM  524
             RI DFN  VF++I+LK   T   +L YP     WD++MSAVIP ED FY +GLL +  G+
Sbjct  398   RISDFNEGVFKDIILKQNLTPVILLFYPMNRNKWDDKMSAVIPNEDVFYTLGLLNAASGL  457

Query  523   NGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFDP  344
             +  K  +   Q+IL FCN   + G +IKQYL   ++ + W++HFG KW  F++ KAKFDP
Sbjct  458   DEVKAFEAQIQQILQFCN---DSGIEIKQYLTRNKTPQQWIQHFGTKWQLFEDRKAKFDP  514

Query  343   KMILSPGQTIF  311
             K ILSPGQ IF
Sbjct  515   KRILSPGQGIF  525



>gb|KFK42198.1| hypothetical protein AALP_AA2G224300 [Arabis alpina]
Length=519

 Score =   522 bits (1345),  Expect = 9e-176, Method: Compositional matrix adjust.
 Identities = 266/503 (53%), Positives = 362/503 (72%), Gaps = 10/503 (2%)
 Frame = -1

Query  1807  MSILGKLKPWNSSLPYEILS-VDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVD  1631
             +++L  +    S  P+ ILS  + AG+    S +  +A+TDFG + +  P+ VL PSSV+
Sbjct  21    ITLLTPITTNTSPQPWNILSNENFAGKLTTTSSSVESAATDFGHVTKIFPSAVLNPSSVE  80

Query  1630  DIINLVRFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGALRGGGK-IRVSWSESLG  1454
             DI +L++ S++S   F +AARGHGHS+RGQA AK GVVV M ++    + I+VS +   G
Sbjct  81    DITDLIKLSFDSQPSFPLAARGHGHSLRGQAAAKGGVVVNMRSMVNRDRGIKVSRT---G  137

Query  1453  YFADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVL  1274
              +ADV G  LW++VL+  L  G++P SWTDYL+LTVGGTLSN GISGQ F  GPQISNVL
Sbjct  138   LYADVEGGCLWIEVLNKTLELGLTPVSWTDYLYLTVGGTLSNGGISGQTFLYGPQISNVL  197

Query  1273  ELDVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDF  1094
             E+DVITGKGE  TCSKD+NS+L+FAVLGGLGQFGII RARI L  AP R KW+R LY DF
Sbjct  198   EMDVITGKGEIATCSKDVNSDLYFAVLGGLGQFGIIARARINLGLAPKRAKWLRFLYIDF  257

Query  1093  SKFTRDQEHLIS-INGLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCL  917
             S+FTRDQE LIS  +GL++LEGS+M++H  P+NWRS+++  SD  +I S++ +  ++YCL
Sbjct  258   SEFTRDQERLISESDGLDFLEGSVMVDHGPPDNWRSTYYPPSDHLRIVSMVKRHRVIYCL  317

Query  916   EVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWE  737
             EVVK+YD  +  TV++E+++L + L++V G  ++KD +Y +FLNRVR  EL  +  G W+
Sbjct  318   EVVKYYDQTSQYTVNEEVEELSESLNYVRGFMYEKDVTYMDFLNRVRTGELNLKSKGQWD  377

Query  736   ATHPWLNLFVPKSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIPEEDT  560
               HPWLNLFVPKS I +F+  VF++I+L++  TSGP+LVYP     W++RMS  IP+ED 
Sbjct  378   VPHPWLNLFVPKSHISNFDYGVFKDIILRNNITSGPVLVYPMNRNKWNDRMSTSIPKEDV  437

Query  559   FYCVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKW  380
             FY VG L S   + W+  ++ N EIL FC +D + G  + QYLP+Y S+E W++HFG +W
Sbjct  438   FYAVGFLRSANFDNWENYEKENMEILKFC-EDAKMG--VIQYLPYYSSQEGWVRHFGPRW  494

Query  379   NTFQENKAKFDPKMILSPGQTIF  311
             N F E K ++DP MILSPGQ IF
Sbjct  495   NIFVERKYRYDPNMILSPGQNIF  517



>ref|XP_010090054.1| Cytokinin dehydrogenase 4 [Morus notabilis]
 gb|EXB38851.1| Cytokinin dehydrogenase 4 [Morus notabilis]
Length=527

 Score =   522 bits (1345),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 264/498 (53%), Positives = 346/498 (69%), Gaps = 26/498 (5%)
 Frame = -1

Query  1741  IAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFS-----YNSPSPF-S  1580
             I+ +F+ D+ +   ASTD+G I  ETP  V  P+S +DI  L++ +     + + SP  S
Sbjct  34    ISDKFQNDTESLELASTDYGHIFNETPDAVFQPTSPNDIKTLIQIANDDKYFGTTSPLAS  93

Query  1579  VAARGHGHSVRGQATAKDGVVVEMGAL-RGG------GKIRVSWSESLGYFADVGGHELW  1421
             +A RG GHSVRGQA A+ G+VV M +L R G      G   V  +  LG + DVGG ++W
Sbjct  94    IAPRGQGHSVRGQAMARRGIVVNMTSLARHGNNNYNIGIKVVKENFHLGPYVDVGGEQIW  153

Query  1420  VDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEF  1241
             +DVL   L H +SP SWTDYL++TVGGTLSNAGISGQ FR GPQIS+V E+DVITGKG+ 
Sbjct  154   IDVLRDTLKHSLSPVSWTDYLYITVGGTLSNAGISGQTFRFGPQISSVHEMDVITGKGDL  213

Query  1240  ITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLI  1061
             +TCS++  SELF+AVLGGLGQFGIITRARI L  APTRVKWVR+ Y+DF  F +DQE LI
Sbjct  214   VTCSRNNASELFYAVLGGLGQFGIITRARIALAPAPTRVKWVRLFYNDFLAFKKDQEKLI  273

Query  1060  S------INGLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHY  899
             S       NG++YLEG L+M     +    SF+  +DQ +I SL+TQ G++Y +E+ K+Y
Sbjct  274   SKNGRKEKNGVDYLEGFLLMRQGPLD---LSFYPTADQLRITSLVTQSGIVYSIELAKYY  330

Query  898   DDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWL  719
             DD T ++VD++L+ LL  LSFVPG  F KD +Y +FLNRV+ EE + +E   WE  HPWL
Sbjct  331   DDSTQNSVDKDLQILLDQLSFVPGFGFVKDVTYEDFLNRVQSEEEKLRELQRWEIPHPWL  390

Query  718   NLFVPKSRILDFNSAVFQNILLKHKTS-GPMLVYPTTTKMWDERMSAVIPEEDTFYCVGL  542
             NLFVP+S++ DFNS VF+ ILL      G  ++YP     WD +MSAVIPEED FY +GL
Sbjct  391   NLFVPESQVSDFNSGVFKGILLNQSVPMGVFIIYPMNRNKWDVKMSAVIPEEDVFYTIGL  450

Query  541   LYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQEN  362
             L+S   + W+ +DE+N++IL FC+   + G + KQYLPHY +++DWM HFG KW  FQ+ 
Sbjct  451   LHSSSYSEWEAIDEVNKQILQFCH---DAGIQAKQYLPHYEAQQDWMDHFGAKWKHFQQM  507

Query  361   KAKFDPKMILSPGQTIFN  308
             K +FDPK ILSPGQ IF+
Sbjct  508   KTQFDPKKILSPGQKIFS  525



>gb|KCW45277.1| hypothetical protein EUGRSUZ_L01060 [Eucalyptus grandis]
Length=415

 Score =   518 bits (1334),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 256/417 (61%), Positives = 316/417 (76%), Gaps = 13/417 (3%)
 Frame = -1

Query  1534  AKDGVVVEMGALRGGGK-IRVSWSESLGYFADVGGHELWVDVLHACLAHGVSPASWTDYL  1358
             A DGVVV+M +L    +   V WS SLG++ADVGG +LW+DVL   L HGV+P SWTDYL
Sbjct  2     APDGVVVDMMSLENKRRGTTVLWSWSLGHYADVGGQQLWIDVLEETLKHGVAPVSWTDYL  61

Query  1357  HLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDMNSELFFAVLGGLGQ  1178
             +LTVGGTLSNAGISG+ FR GPQISNV E+DVITG G+F+TCS D N ELF++VLGGLGQ
Sbjct  62    YLTVGGTLSNAGISGETFRYGPQISNVYEMDVITGTGDFLTCSPDKNPELFYSVLGGLGQ  121

Query  1177  FGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISING------LNYLEGSLMMN  1016
             FGIITRARI L +AP RVKWVRMLY DFS FT DQE LIS +G      L+Y+EGSL+M 
Sbjct  122   FGIITRARIALGQAPKRVKWVRMLYSDFSDFTIDQESLISHHGRDQDEALDYVEGSLLM-  180

Query  1015  HTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGSTVDQELKDLLKDLSF  836
             H + ++W +SFFSLSD+ ++ SL+T+  LLYC+EV K YD +T +TVD+ L+ +LKDLS 
Sbjct  181   HRNSDSW-TSFFSLSDRQRLMSLVTEHELLYCIEVAKFYDGRTQTTVDKALEIILKDLSH  239

Query  835   VPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKSRILDFNSAVFQNIL  656
             VP   F+KD +Y +FLNRVR EEL+ +  GLW   HPWLNLFVPKSRI DFN+ VF NI+
Sbjct  240   VPEFMFEKDVAYVDFLNRVRVEELKLRRQGLWNVPHPWLNLFVPKSRIADFNTGVFNNIV  299

Query  655   LKHK-TSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSGGMNGWKVLDELNQEILS  479
             LK   T+G +L+YP     WD+RMSAVIP+ED FY VG L+S G   W+  D  N+E+L 
Sbjct  300   LKKNITTGLVLIYPMNNDKWDDRMSAVIPDEDVFYTVGFLHSSGFEDWQEFDLQNKEVLL  359

Query  478   FCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFDPKMILSPGQTIFN  308
             FC  +   G K+KQYLP+Y +  +WM+HFG KW TFQE+KA+FDPKM+LSPGQ IFN
Sbjct  360   FCENN---GIKVKQYLPNYNTEREWMEHFGSKWRTFQESKAQFDPKMLLSPGQRIFN  413



>ref|XP_006451486.1| hypothetical protein CICLE_v10010713mg, partial [Citrus clementina]
 gb|ESR64726.1| hypothetical protein CICLE_v10010713mg, partial [Citrus clementina]
Length=482

 Score =   520 bits (1338),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 266/486 (55%), Positives = 341/486 (70%), Gaps = 24/486 (5%)
 Frame = -1

Query  1729  FRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSPFSVAARGHGHSV  1550
              R D  A   AS D+G I++E P  VLYPSSVDDI  L+  SYNS   +++AA+G  HS 
Sbjct  8     LRTDPGAIKLASIDYGHIIKEKPFAVLYPSSVDDIRTLIYLSYNSLFSYTIAAKGQVHST  67

Query  1549  RGQATAKDGVVVEMGAL---RGGGKIRVSWSESLGYFADVGGHELWVDVLHACLAHGVSP  1379
              GQA A DGVVV+M +L   R G  I +S   SLG++ADVGG ++W+DVL+A L  G+SP
Sbjct  68    WGQAQANDGVVVQMNSLNRFRNGTGILISGDRSLGFYADVGGEQMWIDVLNATLTRGLSP  127

Query  1378  ASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDMNSELFFA  1199
              SWTDYL+ TVGGTLSNAGISG  ++ GPQI+NVLELDV+TGKGEF+TCS   +SELF+A
Sbjct  128   VSWTDYLYPTVGGTLSNAGISGHTYQKGPQITNVLELDVLTGKGEFVTCSPQKDSELFYA  187

Query  1198  VLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISING------LNYL  1037
             VLGGLGQFGIITRARIVL  A  RVKW+R+LY DFS F+ DQE LIS  G       ++L
Sbjct  188   VLGGLGQFGIITRARIVLGPAKKRVKWLRILYSDFSSFSTDQETLISTTGPSDKVMPDFL  247

Query  1036  EGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGSTVDQELKD  857
             EG L+MN +  +     F+  S + KI  L+ Q G+LY +EVV +YD++  +   +++K 
Sbjct  248   EGHLLMNQSPLD-----FYPQSQRRKITFLVNQYGILYIIEVVTYYDNKNEA---KKVKQ  299

Query  856   LLKDLS-FVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKSRILDFN  680
             +LK L  F+PG  F+KD +Y +FLNRV  +E+E ++ GLW+  HPWLN+F+PKSRI DF+
Sbjct  300   MLKSLKGFLPGFVFEKDVTYLQFLNRVHDQEIELRKKGLWDIPHPWLNIFIPKSRITDFD  359

Query  679   SAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVI-PEEDTFYCVGLLYSGGMNGWKVL  506
             + VF+NILLK   TS  +LVYP     WDERMSAVI  EE+ FY VG L +   N W+  
Sbjct  360   NGVFRNILLKRNFTSSTVLVYPLLRSKWDERMSAVIAAEEEVFYFVGFLDASADN-WEAF  418

Query  505   DELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFDPKMILSP  326
             D  N++IL FC      G K KQYL H+ ++E+W+ HFG KWNTFQ+ K +FDP+MILSP
Sbjct  419   DNKNKDILQFCV---NAGIKFKQYLGHHATKEEWIIHFGSKWNTFQQRKTRFDPRMILSP  475

Query  325   GQTIFN  308
             GQ IFN
Sbjct  476   GQRIFN  481



>ref|XP_007017645.1| Cytokinin oxidase 5 [Theobroma cacao]
 gb|EOY14870.1| Cytokinin oxidase 5 [Theobroma cacao]
Length=534

 Score =   521 bits (1342),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 262/503 (52%), Positives = 341/503 (68%), Gaps = 26/503 (5%)
 Frame = -1

Query  1765  PYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSP  1586
             P E+L + + G+  VD      AS DFG +++  P  VL+P+S  D+  LV+ +Y S   
Sbjct  24    PAELLRLGVDGQLSVDPSDVETASLDFGLLIRTEPLAVLHPASARDVAKLVKAAYGSNHG  83

Query  1585  FSVAARGHGHSVRGQATAKDGVVVEMGALRGGGKI--------RVSWSESLGYFADVGGH  1430
             F+V+ARGHGHS+ GQA   +GVV++M   RG G++        RV   ES   + DV G 
Sbjct  84    FTVSARGHGHSINGQAQTTNGVVIQMSGSRGSGRMASGKPPQPRVWARES---YVDVWGG  140

Query  1429  ELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGK  1250
             ELW+DVL + L +G++P SWTDYL+L+VGGTLSNAGISGQ F  GPQISNV ELDV+TGK
Sbjct  141   ELWIDVLRSTLGYGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVYELDVVTGK  200

Query  1249  GEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQE  1070
             GE +TCS++ N ELF AVLGGLGQFGIITRARI LE AP RV+W+R+LY +FS FT DQE
Sbjct  201   GELLTCSEEQNPELFQAVLGGLGQFGIITRARISLEPAPQRVRWIRVLYSNFSAFTTDQE  260

Query  1069  HLISING------LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVV  908
             +LIS+ G       +Y+EG ++++    NNWRSSFFS  +  KI+SL    G+LYCLE+ 
Sbjct  261   YLISLQGKPTSQKFDYIEGFVIVDEGLINNWRSSFFSPRNPVKISSLGANGGVLYCLEIT  320

Query  907   KHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATH  728
             K+Y + T  T+DQE++ LLK L+F+P   F  D  Y +FL+RV   EL+ +  GLWE  H
Sbjct  321   KNYHESTADTIDQEVESLLKKLNFIPTSVFTTDLLYVDFLDRVHKAELKLRSKGLWEVPH  380

Query  727   PWLNLFVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCV  548
             PWLNLFVPKS+I DF+  VF+ I L +KTSGP+L+YP     WD R S V P+ED FY V
Sbjct  381   PWLNLFVPKSKIADFDKGVFKGI-LGNKTSGPILIYPMNKNKWDPRSSVVTPDEDVFYLV  439

Query  547   GLLYSGGMNG-----WKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKK  383
              LL S   NG      + L + N+ IL FC   D+ G K+KQYLPHY ++E+WM HFG K
Sbjct  440   ALLRSALDNGEETRSLECLTDQNRRILRFC---DDAGIKVKQYLPHYTTQEEWMDHFGDK  496

Query  382   WNTFQENKAKFDPKMILSPGQTI  314
             W+ F + K +FDP+ IL+ GQ I
Sbjct  497   WDRFHQMKMEFDPRHILATGQQI  519



>ref|XP_011015952.1| PREDICTED: cytokinin dehydrogenase 3-like [Populus euphratica]
Length=512

 Score =   520 bits (1338),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 267/508 (53%), Positives = 344/508 (68%), Gaps = 26/508 (5%)
 Frame = -1

Query  1807  MSILGKLKPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDD  1628
             +  +GK       LP E+     A +  VD  A  +ASTD+G IV   PA VLYPSS++D
Sbjct  21    LCTVGKSNALTCPLPPEL-----ATKLHVDPVAIDSASTDYGNIVHSEPAAVLYPSSIED  75

Query  1627  IINLVRFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGALR---GGGKIRVSWSESL  1457
             I  LV+ SYN P PF ++ RG+GHSV GQ  A+DGVVV+M +LR    G KIRVS +   
Sbjct  76    IQRLVKSSYNCPIPFGISVRGNGHSVNGQDMARDGVVVDMKSLRENKTGIKIRVSRNH--  133

Query  1456  GYFADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNV  1277
               FADVGG +LW+DVLH   A G+SP SWTD+L+L+VGGTLSNAGISGQ F  GPQISNV
Sbjct  134   -LFADVGGEQLWIDVLHTTAAQGLSPVSWTDFLYLSVGGTLSNAGISGQTFLHGPQISNV  192

Query  1276  LELDVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDD  1097
              ELDVITGKGE +TCSK  NS+LF +VLGGLGQFGIITRARI L  APT+V+W R  Y +
Sbjct  193   YELDVITGKGELVTCSKRNNSDLFDSVLGGLGQFGIITRARIALRSAPTKVRWSRAFYSN  252

Query  1096  FSKFTRDQEHLIS---INGLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLL  926
             FS F RDQE ++     +  NYLEGSL++++ +P  W +SFF  +   +I SL+   G++
Sbjct  253   FSDFIRDQERIVRGGHRDVANYLEGSLVLDNGTPTEWITSFFHPTQLPQIMSLVKTYGII  312

Query  925   YCLEVVKHY-DDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQEN  749
             YCLE+ K+Y  +   S +DQ+L+++ K  + VPG    K  S+ EFL RV   E E Q  
Sbjct  313   YCLELTKYYFIEDIESEIDQDLQEVFKQFAHVPGFIDAKFVSHQEFLTRVPNAENESQ--  370

Query  748   GLWEATHPWLNLFVPKSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIP  572
                  THPW NLF+PKSRI DFN  V ++I+LK   T+GP+L YP     WD ++SAVIP
Sbjct  371   -----THPWQNLFIPKSRISDFNVGVLRDIVLKRNITTGPVLFYPLNRHKWDAQLSAVIP  425

Query  571   EEDTFYCVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHF  392
             +ED FY    L++GG++ W+V ++ N+ I+ FC   +E G KI +YL  Y + E+W+KHF
Sbjct  426   DEDIFYTTSFLHTGGIDNWQVYEDQNKAIIKFC---EEAGIKIVKYLADYTTIEEWIKHF  482

Query  391   GKKWNTFQENKAKFDPKMILSPGQTIFN  308
             G KW TF+E KAK+DPK ILSPGQ IFN
Sbjct  483   GSKWTTFRERKAKYDPKNILSPGQKIFN  510



>ref|XP_004144113.1| PREDICTED: cytokinin dehydrogenase 4-like [Cucumis sativus]
 ref|XP_004158467.1| PREDICTED: cytokinin dehydrogenase 4-like [Cucumis sativus]
Length=518

 Score =   520 bits (1338),  Expect = 9e-175, Method: Compositional matrix adjust.
 Identities = 261/485 (54%), Positives = 332/485 (68%), Gaps = 10/485 (2%)
 Frame = -1

Query  1741  IAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSPFSVAARGH  1562
             I+ + + D +  + AS D+G +VQ  P  V +P +  D+  L+RF Y  P P  +AARG 
Sbjct  36    ISDKLKYDLQTISLASKDYGLMVQHNPYAVFFPVTGHDVAGLIRFMYMLPVPLHIAARGQ  95

Query  1561  GHSVRGQATA-KDGVVVEMGALRG----GGKIRVSWSESLGYFADVGGHELWVDVLHACL  1397
             GH VRGQA   ++GVVV M +L G      +I V+ +  LG +ADVG  +LW+DVLHA  
Sbjct  96    GHCVRGQALVDQNGVVVNMTSLGGLRQKTSRIVVTTTSPLGPYADVGAEQLWIDVLHATT  155

Query  1396  AHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDMN  1217
               G+SP SW DYLH+TVGGTLSNAGISGQ FR GPQI+NV ELDVITGKGE +TCS   N
Sbjct  156   QKGLSPVSWVDYLHITVGGTLSNAGISGQTFRFGPQINNVYELDVITGKGESLTCSPTNN  215

Query  1216  SELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISINGLNYL  1037
              ELF+++LGGLGQFGIITRARI L   PTRVKWVRMLY +FS FT DQE LIS +  N  
Sbjct  216   PELFYSLLGGLGQFGIITRARIALAPTPTRVKWVRMLYTNFSSFTSDQESLISRDPSNAP  275

Query  1036  EGSLMMNHTSPNNW-RSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGSTVDQELK  860
             +    +     N   +SSF+ L DQ KI+SL++Q G++Y LE+VK+YD  + S+VDQEL+
Sbjct  276   DYLEGLLLLQLNAGDKSSFYPLPDQPKISSLVSQYGIVYVLELVKYYDQHSSSSVDQELE  335

Query  859   DLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKSRILDFN  680
              LL  L F  GM F KDASY EFL+RV  +E+  +  GLWE  HPW+NLFVPKSRI DF+
Sbjct  336   TLLGGLKFEAGMKFVKDASYEEFLDRVHTDEVALRALGLWEVPHPWINLFVPKSRIADFD  395

Query  679   SAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSGGMNGWKVLD  503
             S VF+ I+ K   TSG  L YP     WDER SAVIP+E+ FY  G L S G   W+ +D
Sbjct  396   SGVFRGIIQKRNLTSGVFLFYPMFKNKWDERTSAVIPDEEVFYAAGFLLSSGFKDWETVD  455

Query  502   ELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFDPKMILSPG  323
                ++IL FC   +E G ++KQYLPH+ + +DW+ HFG+KW+ F++ K+ FDPK +LSPG
Sbjct  456   GHGRDILKFC---EEAGIEVKQYLPHFETEKDWINHFGRKWSVFRQRKSMFDPKHLLSPG  512

Query  322   QTIFN  308
             Q IFN
Sbjct  513   QKIFN  517



>gb|KDO40371.1| hypothetical protein CISIN_1g044784mg, partial [Citrus sinensis]
Length=482

 Score =   518 bits (1334),  Expect = 9e-175, Method: Compositional matrix adjust.
 Identities = 265/486 (55%), Positives = 340/486 (70%), Gaps = 24/486 (5%)
 Frame = -1

Query  1729  FRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSPFSVAARGHGHSV  1550
              R D  A   AS D+G I++E P  VLYP+SVDDI  L+  SYNS   +++AA+G  HS 
Sbjct  8     LRTDPGAIKLASIDYGHIIKEKPFAVLYPTSVDDIRTLIYLSYNSLFSYTIAAKGQAHST  67

Query  1549  RGQATAKDGVVVEMGAL---RGGGKIRVSWSESLGYFADVGGHELWVDVLHACLAHGVSP  1379
              GQA A DGVVV+M +L   R G  I +S   S G++ADVGG +LW+DVL+A L  G+SP
Sbjct  68    WGQAQANDGVVVQMNSLNRFRNGTGILISGDRSSGFYADVGGEQLWIDVLNATLTRGLSP  127

Query  1378  ASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDMNSELFFA  1199
              SWTDYL+ TVGGTLSNAGISG  ++ GPQI+NVLELDV+TGKGEF+TCS   +SELF+A
Sbjct  128   VSWTDYLYPTVGGTLSNAGISGHTYQKGPQITNVLELDVLTGKGEFVTCSPQKDSELFYA  187

Query  1198  VLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISING------LNYL  1037
             VLGGLGQFGIITRARIVL  A  RVKW+R+LY DFS F+ DQE LIS  G       ++L
Sbjct  188   VLGGLGQFGIITRARIVLGPAKKRVKWLRILYSDFSSFSTDQETLISTTGPSDKVMPDFL  247

Query  1036  EGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGSTVDQELKD  857
             EG L+MN +  +     F+  S + KI  L+ Q G+LY +EVV +YD++  +   +++K 
Sbjct  248   EGHLLMNQSPLD-----FYPQSQRRKITFLVNQYGILYIIEVVTYYDNKNEA---KKVKQ  299

Query  856   LLKDLS-FVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKSRILDFN  680
             +LK L  F+PG  F+KD +Y +FLNRV  +E+E ++ GLW+  HPWLN+F+PKSRI DF+
Sbjct  300   MLKSLKGFLPGFVFEKDVTYLQFLNRVHDQEIELRKKGLWDIPHPWLNIFIPKSRITDFD  359

Query  679   SAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVI-PEEDTFYCVGLLYSGGMNGWKVL  506
             + VF+NILLK   TS  +LVYP     WDERMSAVI  EE+ FY VG L +   N W+  
Sbjct  360   NGVFRNILLKRNFTSSTVLVYPLLRSKWDERMSAVIAAEEEVFYFVGFLDASADN-WEAF  418

Query  505   DELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFDPKMILSP  326
             D  N++IL FC      G K KQYL H+ ++E+W+ HFG KWNTFQ+ K +FDP+MILSP
Sbjct  419   DNKNKDILQFCV---NAGIKFKQYLGHHATKEEWIIHFGSKWNTFQQRKTRFDPRMILSP  475

Query  325   GQTIFN  308
             GQ IFN
Sbjct  476   GQRIFN  481



>ref|XP_009335765.1| PREDICTED: cytokinin dehydrogenase 5 [Pyrus x bretschneideri]
Length=538

 Score =   520 bits (1339),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 256/498 (51%), Positives = 342/498 (69%), Gaps = 17/498 (3%)
 Frame = -1

Query  1765  PYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSP  1586
             P E+L + + G+  VD      AS DFG + +  P  VL+P+S  D+  L+R +Y+SP  
Sbjct  26    PTELLRLVVDGQLSVDPSDVDTASKDFGLMSRAAPLAVLHPASPQDVAGLLRAAYSSPHG  85

Query  1585  FSVAARGHGHSVRGQATAKDGVVVEM--GALRGGGKIRVSWSESLGYFADVGGHELWVDV  1412
             F+V+ARGHGHS+ GQA   +G+V++M  G+LR G   + +     G + D  G ELW+DV
Sbjct  86    FTVSARGHGHSINGQAQTNNGIVIQMSGGSLRSGRPGQAARVSEKGMYVDTWGGELWIDV  145

Query  1411  LHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITC  1232
             L + L +G++P SWTDYL+LTVGGTLSNAGISGQ F  GPQISNV ELDV+TGKG+ +TC
Sbjct  146   LRSTLEYGLAPKSWTDYLYLTVGGTLSNAGISGQAFNYGPQISNVHELDVVTGKGQLLTC  205

Query  1231  SKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISIN  1052
             S++ NSELF AVLGGLGQFGIITRARI LE +P RV+W+R+LY +FS FT+DQE LIS++
Sbjct  206   SEEQNSELFHAVLGGLGQFGIITRARIALEPSPQRVRWIRVLYSNFSAFTKDQEFLISLH  265

Query  1051  G------LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQ  890
             G       +Y+EG ++++    NNWRSSFFS S+  KI S+ ++ G+LYCLE+ K+YD+ 
Sbjct  266   GQPSSQKFDYVEGFVIVDEGLINNWRSSFFSPSNPVKITSIDSEGGVLYCLEITKNYDES  325

Query  889   TGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLF  710
             T   +D+E++DLL+ L+FVP   F  D  Y +FL+RV   EL+ +  GLW+  HPWLNLF
Sbjct  326   TADAIDKEIEDLLEKLNFVPTSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLF  385

Query  709   VPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSG  530
             VPKSRI DFN  VF+ I L +KTSGP+L+YP     WD+  S V P+ED FY V LL + 
Sbjct  386   VPKSRISDFNEGVFKGI-LGNKTSGPILIYPMNKDKWDQSNSVVTPDEDIFYLVALLRTA  444

Query  529   GMNGWKV-----LDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQE  365
                G +      L   N+ IL FC    + G ++KQYLPHY ++E+WM HFG KW  F +
Sbjct  445   LDTGDETHTLEHLTNQNRRILRFCG---DAGIEVKQYLPHYTTQEEWMDHFGDKWARFYK  501

Query  364   NKAKFDPKMILSPGQTIF  311
              K +FDP+ IL+ GQ IF
Sbjct  502   RKMEFDPRRILATGQRIF  519



>ref|XP_011015519.1| PREDICTED: cytokinin dehydrogenase 3-like [Populus euphratica]
Length=512

 Score =   519 bits (1336),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 267/508 (53%), Positives = 344/508 (68%), Gaps = 26/508 (5%)
 Frame = -1

Query  1807  MSILGKLKPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDD  1628
             +  +GK       LP E+     A +  VD  A  +ASTD+G IV   PA VLYPSS++D
Sbjct  21    LCTVGKSNALTCPLPPEL-----ATKLHVDPVAIDSASTDYGNIVHSEPAAVLYPSSIED  75

Query  1627  IINLVRFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGALR---GGGKIRVSWSESL  1457
             I  LV+ SYN P PF ++ RG+GHSV GQ  A+DGVVV+M +LR    G KIRVS +   
Sbjct  76    IQRLVKSSYNCPIPFGISVRGNGHSVNGQDMARDGVVVDMKSLRENKTGIKIRVSRNH--  133

Query  1456  GYFADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNV  1277
               FADVGG +LW+DVLH   A G+SP SWTD+L+L+VGGTLSNAGISGQ F  GPQISNV
Sbjct  134   -LFADVGGEQLWIDVLHTTAAQGLSPVSWTDFLYLSVGGTLSNAGISGQTFLHGPQISNV  192

Query  1276  LELDVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDD  1097
              ELDVITGKGE +TCSK  NS+LF +VLGGLGQFGIITRARI L  APT+V+W R  Y +
Sbjct  193   YELDVITGKGELVTCSKRNNSDLFDSVLGGLGQFGIITRARIALRSAPTKVRWSRAFYSN  252

Query  1096  FSKFTRDQEHLIS---INGLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLL  926
             FS F RDQE ++     +  NYLEGSL++++ +P  W +SFF  +   +I SL+   G++
Sbjct  253   FSDFIRDQERIVRGGHRDVANYLEGSLVLDNGTPTEWITSFFHPTQLPQIMSLVKTYGII  312

Query  925   YCLEVVKHY-DDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQEN  749
             YCLE+ K+Y  +   S +DQ+L+++ K  + VPG    K  S+ EFL RV   E E Q  
Sbjct  313   YCLELTKYYFIEDIESEIDQDLQEVFKHFAHVPGFIDAKFVSHQEFLTRVPNAENESQ--  370

Query  748   GLWEATHPWLNLFVPKSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIP  572
                  THPW NLF+PKSRI DFN  V ++I+LK   T+GP+L YP     WD ++SAVIP
Sbjct  371   -----THPWQNLFIPKSRISDFNVGVLRDIVLKRNITTGPVLFYPLNRHKWDAQLSAVIP  425

Query  571   EEDTFYCVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHF  392
             +ED FY    L++GG++ W+V ++ N+ I+ FC   +E G KI +YL  Y + E+W+KHF
Sbjct  426   DEDIFYTTSFLHTGGIDNWQVYEDQNKAIIKFC---EEAGIKIVKYLADYTTIEEWIKHF  482

Query  391   GKKWNTFQENKAKFDPKMILSPGQTIFN  308
             G KW TF+E KAK+DPK ILSPGQ IFN
Sbjct  483   GSKWTTFRERKAKYDPKNILSPGQKIFN  510



>ref|XP_004507936.1| PREDICTED: cytokinin dehydrogenase 3-like [Cicer arietinum]
Length=516

 Score =   517 bits (1331),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 263/505 (52%), Positives = 340/505 (67%), Gaps = 26/505 (5%)
 Frame = -1

Query  1786  KPWNS-SLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVR  1610
             +PW++ + P +IL + I      D    + ASTDFG IV + P  +  PSS++ I  L++
Sbjct  26    EPWSALNAPKDILQMLIR-----DPVTLSLASTDFGHIVHQNPFAIFAPSSINAISKLIK  80

Query  1609  FSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGALRGGGKIRVSWSES----LGYFAD  1442
             FS + P PF++A RG GHSV GQ+   DGVVV M  L      R   +ES       + D
Sbjct  81    FSNSLPFPFTIAPRGQGHSVNGQSMTNDGVVVNMTQLI---NYRFRSNESGIVVFDEYVD  137

Query  1441  VGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDV  1262
             +GG ++W+DVLHA L  G++P SWTDYL L+VGGTLSNAGISGQ FR GPQISNV ELDV
Sbjct  138   IGGEQIWIDVLHASLERGLTPLSWTDYLFLSVGGTLSNAGISGQTFRFGPQISNVHELDV  197

Query  1261  ITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFT  1082
             +TG G+ +TCS + NSELF+ VLGGLGQFGIITRARI L  AP RVKW+R+LY+DFS F+
Sbjct  198   VTGNGDLVTCSAEKNSELFYGVLGGLGQFGIITRARIALGPAPKRVKWLRLLYNDFSTFS  257

Query  1081  RDQEHLISING------LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYC  920
              DQEHLIS NG       NY+EG L++N    +    SF+   DQ +I SL+TQ G++Y 
Sbjct  258   GDQEHLISFNGRNETNAANYVEGMLLLNQQPLD---LSFYPEIDQPRITSLVTQYGIIYI  314

Query  919   LEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLW  740
             +E+VK+YDD +   +DQE++ L+K+L FVP   F+KD SY EFLNRV  +EL  +  GLW
Sbjct  315   IELVKYYDDNSQDQIDQEIEILVKELRFVPTFMFEKDVSYEEFLNRVHFDELALRAQGLW  374

Query  739   EATHPWLNLFVPKSRILDFNSAVFQNILLKHKTS-GPMLVYPTTTKMWDERMSAVIPEED  563
             +  HPWLN+FVP+SRI DFN  VF+ I+L+   S G ++VYP     WD++MSAV P E+
Sbjct  375   DIPHPWLNIFVPRSRISDFNEGVFKGIILRQNISAGLVIVYPMNRTKWDDKMSAVTPNEE  434

Query  562   TFYCVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKK  383
              FY V LL + G    +     NQ+IL FCN   + G  IKQYLP  ++ EDW+KHFG K
Sbjct  435   IFYIVSLLRTSGFEKLEEFQAQNQQILQFCN---DVGIGIKQYLPLNKTHEDWVKHFGIK  491

Query  382   WNTFQENKAKFDPKMILSPGQTIFN  308
             W  F++ KA+FDP  ILSPGQ IFN
Sbjct  492   WEDFEKRKAQFDPNKILSPGQRIFN  516



>gb|AES65430.2| cytokinin oxidase/dehydrogenase-like protein [Medicago truncatula]
Length=522

 Score =   516 bits (1330),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 256/492 (52%), Positives = 341/492 (69%), Gaps = 20/492 (4%)
 Frame = -1

Query  1744  DIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSPFSVAARG  1565
             D+A +   + +  + ASTD+G I+ E P  VL P+S+ DI NL+ +S + P  F+++ RG
Sbjct  36    DLALKLSRNPQILSQASTDYGHIIHENPFAVLEPTSISDIANLINYSNSLPHSFTISPRG  95

Query  1564  HGHSVRGQATAKDGVVVEMGAL---RGGGKIRVSWSE---SLGYFADVGGHELWVDVLHA  1403
               HSV GQA  ++G+VV M  L   R G  I VS  +    LG + DVGG +LW+DVL+A
Sbjct  96    QAHSVLGQAMTQNGIVVNMTQLNWYRNGSGIVVSDCDVKNPLGCYVDVGGEQLWIDVLNA  155

Query  1402  CLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKD  1223
              L HG++P SWTDYL+L+VGGTLSNAGI GQ FR GPQISNVLELDVITG+G  +TCS++
Sbjct  156   TLKHGLTPLSWTDYLYLSVGGTLSNAGIGGQTFRFGPQISNVLELDVITGQGNIVTCSQE  215

Query  1222  MNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISI----  1055
              NSE+F+AVLGGLGQFG+ITRARI+L  APTRVKW+R++Y+DFS F+ DQEHLIS     
Sbjct  216   KNSEVFYAVLGGLGQFGVITRARILLGPAPTRVKWLRLIYNDFSAFSTDQEHLISFDRRN  275

Query  1054  --NGLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGS  881
               NG +Y+EG L++N         SF+  SD  +I SL+TQ G+ Y LE+VK+YD  + +
Sbjct  276   DSNGADYVEGMLLLNKPP---LILSFYPPSDHPRITSLVTQYGITYVLELVKYYDTNSQA  332

Query  880   TVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPK  701
              + +E+ +L+K L FVP   F+KD +Y EFL+RV  EEL  +  GLW+  HPWLN+F+PK
Sbjct  333   NITEEVDNLVKGLKFVPTFMFQKDVTYEEFLDRVHSEELILRSKGLWDVPHPWLNMFIPK  392

Query  700   SRILDFNSAVFQNILLKHKTS-GPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSGG-  527
             SRI DFN  VF+ I+LK   S G +LVYP     WD+RMSA+ P+ED FY + LL++   
Sbjct  393   SRISDFNEGVFKGIILKQNISAGIVLVYPMNRNKWDDRMSAITPDEDVFYTLALLHAAKE  452

Query  526   MNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFD  347
             M+  K     N +IL FCN   + G K+K+YL   ++ ++W++HFG KW  F+E KAKFD
Sbjct  453   MDEVKTFQAQNHQILQFCN---DAGIKVKEYLSGNKTHQEWVEHFGAKWQQFEERKAKFD  509

Query  346   PKMILSPGQTIF  311
             PK ILSPGQ IF
Sbjct  510   PKRILSPGQGIF  521



>emb|CAC17752.1| cytokinin oxidase [Dendrobium hybrid cultivar]
 emb|CAC17753.1| cytokinin oxidase [Dendrobium hybrid cultivar]
Length=536

 Score =   517 bits (1331),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 265/503 (53%), Positives = 339/503 (67%), Gaps = 23/503 (5%)
 Frame = -1

Query  1774  SSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNS  1595
             +SLP  +L+   +   R DS + +AAS+DFG I+   P+ V  PSS  DI  L+R S+ S
Sbjct  30    NSLPTNLLTHPTSTHLRFDSLSLSAASSDFGDIIHSLPSAVFLPSSPSDIATLLRLSHFS  89

Query  1594  PSPFSVAARGHGHSVRGQATAKDGVVVEMGALRGGGKIRVSWSESLGYFADVGGHELWVD  1415
             P  F+V+ARG GHS RGQA A  G+V+ M +L GG  + +      G F D G  ++W+D
Sbjct  90    PHSFTVSARGLGHSTRGQAQAFGGIVINMPSLDGGITVSID-----GMFVDAGAEQMWID  144

Query  1414  VLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFIT  1235
             VL   L HG++P SWTDYL+LT+GGTLSN GISGQ F  GPQISNV ELD++TGKGE +T
Sbjct  145   VLRETLRHGLTPKSWTDYLYLTLGGTLSNGGISGQAFLHGPQISNVHELDIVTGKGEMVT  204

Query  1234  CSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISI  1055
             CS+  N +LFF+VLGGLGQFGIITRARI LEKAP  V+W+R++Y DF  FT+DQE LISI
Sbjct  205   CSESNNPDLFFSVLGGLGQFGIITRARIALEKAPQSVRWMRLMYTDFELFTKDQELLISI  264

Query  1054  NG------LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLT-QQGLLYCLEVVKHYD  896
                     LNY+EGSL+M H+  +NWRS FFS  D  KI  L +  +G++YCLE   +YD
Sbjct  265   KAEGEGWKLNYVEGSLLMEHSLKSNWRSPFFSEKDLKKIKKLASGNEGVIYCLEASFYYD  324

Query  895   --------DQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLW  740
                         + +DQ++++LL+ LSFV G  F+ D SY  FLNRV   EL+ +  GLW
Sbjct  325   YGHEMNFSRADKAQMDQDIEELLRKLSFVSGFAFRNDVSYMGFLNRVHDGELKLRAMGLW  384

Query  739   EATHPWLNLFVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDT  560
             +  HPWLNLFV KS I+DF+  VF+ I+   K+ GP+LVYPT    WD+RMS  IP+E+ 
Sbjct  385   DVPHPWLNLFVSKSNIMDFHIGVFKGIMKNSKSMGPILVYPTKRSKWDKRMSTSIPDEEV  444

Query  559   FYCVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKW  380
             FY +G+L S  MN  + L+  N EIL FC   D++G   KQYLPHY S EDW KHFGKKW
Sbjct  445   FYSIGILLSSEMNDLEHLESHNAEILKFC---DQQGMNYKQYLPHYTSIEDWKKHFGKKW  501

Query  379   NTFQENKAKFDPKMILSPGQTIF  311
               F E K+++DPK ILSPGQ IF
Sbjct  502   ERFVEMKSRYDPKAILSPGQKIF  524



>ref|XP_010275527.1| PREDICTED: cytokinin dehydrogenase 5-like isoform X1 [Nelumbo 
nucifera]
Length=535

 Score =   517 bits (1331),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 266/504 (53%), Positives = 340/504 (67%), Gaps = 21/504 (4%)
 Frame = -1

Query  1765  PYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSP  1586
             P  +L + +  +   D      AS DFG + Q  P  VL+PSS DDI  L+R +Y SP  
Sbjct  25    PNGLLRLGLYRQLSFDYADVETASLDFGRMTQVKPLAVLHPSSADDIAGLIRTAYESPEG  84

Query  1585  FSVAARGHGHSVRGQATAKDGVVVEMGAL--RGGGKIRVSWSESLGY---FADVGGHELW  1421
             F+V+ARGHGHS+ GQA A +GVV+ M +   +     R S S  LG+   + DV G ELW
Sbjct  85    FTVSARGHGHSISGQAQAANGVVIAMSSSISKRNRLTRPSLSLGLGHKSSYVDVWGGELW  144

Query  1420  VDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEF  1241
             +DVL++ L HG++P SWTDYL+L+VGGTLSNAGISGQ F  GPQISNV ELDV+TGKGE 
Sbjct  145   IDVLNSTLEHGLAPRSWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVYELDVVTGKGEI  204

Query  1240  ITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLI  1061
             +TCS + NS+LF AVLGGLGQFGIITRARI LE AP RVKW+R+LY  FS FT+DQE+LI
Sbjct  205   LTCSNEQNSQLFHAVLGGLGQFGIITRARIALEPAPQRVKWIRVLYSKFSAFTKDQEYLI  264

Query  1060  SING------LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASL--LTQQGLLYCLEVVK  905
             S+NG       +Y+EG ++++    NNWRSSFFS  +  KI+SL      G+LYCLE+ K
Sbjct  265   SLNGHPASERFDYVEGFVIVDEGLINNWRSSFFSPRNPVKISSLGAAANGGVLYCLEITK  324

Query  904   HYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHP  725
             +YD+ +  TVDQE++ LLK L F+P   F  D  Y +FL+RV   EL+ +  GLW+  HP
Sbjct  325   NYDESSSDTVDQEVEALLKKLDFIPTSVFTTDIPYVDFLDRVHKAELKLRAKGLWDVPHP  384

Query  724   WLNLFVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVG  545
             WLNLFVPKSRI DF+  VF+ IL   KTSGP+L+YP     W++R S V P+EDTFY V 
Sbjct  385   WLNLFVPKSRIADFDQGVFKGILGNKKTSGPILIYPMNRNKWNQRSSVVTPDEDTFYLVA  444

Query  544   LLYSGGMNG--WKVLDEL---NQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKW  380
             LL S   +G   + LD L   N++IL FC    E G K+KQYLP+  ++E+W  HFG KW
Sbjct  445   LLRSALDSGEETQTLDYLSNQNRQILRFCK---ETGIKVKQYLPNLSTQEEWKDHFGDKW  501

Query  379   NTFQENKAKFDPKMILSPGQTIFN  308
             +   + K +FDPK IL+ GQ IF 
Sbjct  502   DLIVKRKMEFDPKHILATGQRIFQ  525



>ref|XP_007221789.1| hypothetical protein PRUPE_ppa003895mg [Prunus persica]
 gb|EMJ22988.1| hypothetical protein PRUPE_ppa003895mg [Prunus persica]
Length=542

 Score =   517 bits (1331),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 261/506 (52%), Positives = 339/506 (67%), Gaps = 27/506 (5%)
 Frame = -1

Query  1765  PYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSP  1586
             P E+L + + G+  VD      AS DFG + +  P  VL+P S  D+  LVR +Y+S   
Sbjct  25    PTELLRLVVDGQLSVDPSDVDTASKDFGLMTRAEPLAVLHPGSAQDVARLVRAAYSSAHG  84

Query  1585  FSVAARGHGHSVRGQATAKDGVVVEMGALRGGGKI---------RVSWSESLGYFADVGG  1433
             F+V+ARGHGHS+ GQA   +GVV+EM      G++         RVS     G + D  G
Sbjct  85    FTVSARGHGHSINGQAQTNNGVVIEMNGGGSSGRVMSRVRSGSGRVS---EKGMYVDAWG  141

Query  1432  HELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITG  1253
              ELW+DVL + L +G++P SWTDYL+L+VGGTLSNAGISGQ F  GPQIS+V ELDV+TG
Sbjct  142   GELWIDVLRSTLEYGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISSVDELDVVTG  201

Query  1252  KGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQ  1073
             +GE +TCS++ NSELF AVLGGLGQFGIITRARI LE AP RV+W+R+LY +FS FT+DQ
Sbjct  202   RGELLTCSEEKNSELFHAVLGGLGQFGIITRARIALEPAPQRVRWIRVLYSNFSAFTKDQ  261

Query  1072  EHLISING------LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEV  911
             E LIS++G       +Y+EG ++++    NNWRSSFFS S+  KI S+ +Q G+LYCLE+
Sbjct  262   EFLISLHGQPSTHKFDYVEGFVIVDEGLINNWRSSFFSPSNPVKITSINSQGGVLYCLEI  321

Query  910   VKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEAT  731
              K+Y + T  T+DQE++ LLK L FVP   F  D  Y +FL+RV   EL+ +   LW+  
Sbjct  322   TKNYHESTADTIDQEIEGLLKKLDFVPTSVFTTDLPYVDFLDRVHKAELKLRSKSLWDVP  381

Query  730   HPWLNLFVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYC  551
             HPWLNLFVPKSRI DF+  VF+ I L +KTSGP+L+YP     WD+R S V P+ED FY 
Sbjct  382   HPWLNLFVPKSRISDFDKGVFKGI-LGNKTSGPILIYPMNKDKWDQRSSVVTPDEDIFYL  440

Query  550   VGLLYSGGMNGWKV-----LDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGK  386
             V LL S    G +      L   N++IL FC   D+ G K+KQYLPHY ++E+WM HFG 
Sbjct  441   VALLRSALDTGDETHTLEHLTNQNRQILKFC---DDAGIKVKQYLPHYTTQEEWMDHFGD  497

Query  385   KWNTFQENKAKFDPKMILSPGQTIFN  308
             KW  F + K  FDP+ IL+ GQ IF+
Sbjct  498   KWGQFYQRKMDFDPRRILATGQRIFS  523



>ref|XP_004488073.1| PREDICTED: cytokinin dehydrogenase 3-like [Cicer arietinum]
Length=526

 Score =   516 bits (1329),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 261/491 (53%), Positives = 342/491 (70%), Gaps = 20/491 (4%)
 Frame = -1

Query  1741  IAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSPFSVAARGH  1562
             +A +   D +    ASTD+G I+ ++P  VL PSS+DDI NL++FS +  +PF+++ RG 
Sbjct  41    LASKLSRDPQILLEASTDYGHIIHKSPYAVLEPSSIDDIANLIKFSNSLSNPFTISPRGK  100

Query  1561  GHSVRGQATAKDGVVVEMGAL---RGGGKIRVSWSE---SLGYFADVGGHELWVDVLHAC  1400
              HSV GQA A++GVVV M  L   R G  I VS  +    L  + DVGG +LW+DVLHA 
Sbjct  101   AHSVLGQAMAQNGVVVNMTQLNGFRNGSGIVVSNCDVKSPLDCYVDVGGEQLWIDVLHAT  160

Query  1399  LAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDM  1220
                G++P SWTDYL+LTVGGTLSNAGISGQ FR GPQISNVLELDVITG+GEF+TCS++ 
Sbjct  161   TKLGLAPLSWTDYLYLTVGGTLSNAGISGQTFRFGPQISNVLELDVITGEGEFVTCSREN  220

Query  1219  NSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISINGLN-  1043
             NSELF++VLGGLGQFG+ITRAR+ L  +PTR KW+R++YD+FS F+ DQEHLIS N  N 
Sbjct  221   NSELFYSVLGGLGQFGVITRARLPLGPSPTRAKWLRLIYDNFSIFSADQEHLISFNNKND  280

Query  1042  -----YLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGST  878
                  Y+EG L+ N    +    SF+   DQ +I SL+T+ G+ Y +E+VK+YD  T S 
Sbjct  281   TNAADYVEGILLFNKPLLD---LSFYPTPDQPRIKSLVTKCGIAYVIELVKYYDTNTQSR  337

Query  877   VDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKS  698
             VD+E+ +L+K+L+FVP   F+KD +Y EFL+RV  EEL  +  GLWE  HPWLN+FVPKS
Sbjct  338   VDEEVDNLVKELNFVPTFMFEKDVTYEEFLDRVHVEELVLRSKGLWEVPHPWLNMFVPKS  397

Query  697   RILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSG-GM  524
             RI DFN  VF+ I+LK   T   +L YP     WD++MSAVIP ED FY + LL +  G+
Sbjct  398   RISDFNEGVFKGIILKQNLTPAILLFYPMNQNKWDDKMSAVIPNEDVFYTLSLLNAASGL  457

Query  523   NGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFDP  344
             +  K  +   Q+IL FCN   + G +I+QYL   ++ + W++HFG KW  F++ KAKFDP
Sbjct  458   DEVKAFEAQIQQILQFCN---DSGIEIRQYLIGNKTPQQWIQHFGTKWQLFEDRKAKFDP  514

Query  343   KMILSPGQTIF  311
             K ILSPGQ IF
Sbjct  515   KRILSPGQGIF  525



>ref|XP_002280797.1| PREDICTED: cytokinin dehydrogenase 5 isoform X1 [Vitis vinifera]
Length=524

 Score =   516 bits (1329),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 259/497 (52%), Positives = 334/497 (67%), Gaps = 16/497 (3%)
 Frame = -1

Query  1765  PYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSP  1586
             P ++L +++ G   VD      AS DFG + +  P  VL+PSS +D+  LV  +Y S   
Sbjct  24    PTDLLRLEVDGHLSVDPSDVKTASVDFGMMNRAEPLAVLHPSSAEDVARLVGAAYGSAHG  83

Query  1585  FSVAARGHGHSVRGQATAKDGVVVEMGALRGGGKIRVSWSESLGYFADVGGHELWVDVLH  1406
              SV+ARGHGHS+ GQA    GVV+EM A +G  +  +        + D  G ELW+DVL 
Sbjct  84    LSVSARGHGHSINGQAQTSSGVVIEMSASKGVRQWGLPRVSEQSRYVDAWGGELWIDVLK  143

Query  1405  ACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSK  1226
               L HG++P SWTDYL+L+VGGTLSNAGISGQ F  GPQISNV ELDV+TGKGE +TCS+
Sbjct  144   TTLEHGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVYELDVVTGKGELLTCSE  203

Query  1225  DMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISING-  1049
             + NSELF AVLGGLGQFGIITRARI LE AP RV+W+R+LY +FS FT+DQE+LIS++G 
Sbjct  204   EQNSELFHAVLGGLGQFGIITRARIGLEPAPQRVRWIRVLYSNFSTFTKDQEYLISLHGQ  263

Query  1048  -----LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTG  884
                   +Y+EG ++++    NNWRSSFFS  +  KI+S  T  G+LYCLEV K+Y + T 
Sbjct  264   PPNQKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKISSFGTNGGVLYCLEVTKNYHESTA  323

Query  883   STVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVP  704
              T+DQ+++ LLK L F+P   F  D  Y +FL+RV   EL+ +  GLW+  HPWLNLFVP
Sbjct  324   DTIDQDVEALLKRLDFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVP  383

Query  703   KSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSGGM  524
             +SRI DF+  VF+ I L +KTSGP+L+YP     WD+R S V PEED FY V LL S   
Sbjct  384   RSRIADFDEGVFKGI-LGNKTSGPILIYPMNKNKWDDRTSVVTPEEDVFYLVALLRSALD  442

Query  523   NG-----WKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFG-KKWNTFQEN  362
             +G      + L   N++IL FC   D+ G K+KQYLPHY ++EDW+ HFG  KW  F + 
Sbjct  443   SGDEAQSLEYLSNQNRQILRFC---DDAGIKVKQYLPHYTTQEDWVDHFGDDKWTLFSKR  499

Query  361   KAKFDPKMILSPGQTIF  311
             K  FDP+ IL+ GQ IF
Sbjct  500   KMDFDPRRILATGQRIF  516



>gb|ADB45880.1| cytokinin oxidase/dehydrogenase [Bambusa oldhamii]
Length=522

 Score =   515 bits (1326),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 262/502 (52%), Positives = 339/502 (68%), Gaps = 16/502 (3%)
 Frame = -1

Query  1783  PWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFS  1604
             P++  LP ++ ++  AG+ R D  AT  ASTDFG I    PA VL+P+S  D+  L+R  
Sbjct  27    PFSGQLPGDLAALAAAGKLRTDPNATVPASTDFGNITTALPAAVLFPASPGDVAALLRAV  86

Query  1603  YNSPS-PFSVAARGHGHSVRGQATAKDGVVVEMGALRGGGKIRVSWSESLGYFADVGGHE  1427
             Y++P  PF+V+ RG GHSV GQA A  GVVV M +L    +I VS   + G + D GG +
Sbjct  87    YSTPGWPFTVSFRGRGHSVMGQAFAPGGVVVHMPSLSSAQRINVS---ADGRYVDAGGEQ  143

Query  1426  LWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKG  1247
             LW+DVL A L HGV+P SWTDYLHLTVGGTLSNAG+SGQ FR GPQISNV ELDVITG G
Sbjct  144   LWIDVLRATLEHGVAPLSWTDYLHLTVGGTLSNAGVSGQAFRHGPQISNVYELDVITGYG  203

Query  1246  EFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEH  1067
               +TCSK +NS+LF A+LGGLGQFG+ITRARI L  AP R +WVR++Y DF+ FT DQE 
Sbjct  204   GMVTCSKALNSDLFDAILGGLGQFGVITRARIKLGPAPARARWVRLVYTDFATFTADQER  263

Query  1066  LIS------INGLNYLEGSLMMNHTSPNNWRSS-FFSLSDQSKIASLLTQQG--LLYCLE  914
             L++         ++Y+EGS+ +NH+     +S+ FFS +D ++I +L  ++    +Y +E
Sbjct  264   LVAPRPDGEFGLMSYVEGSVYVNHSLAAGLKSAGFFSDADVARIVALAAERNATAVYSIE  323

Query  913   VVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEA  734
                +YD+ T ++VDQELK +L +LSF     F +DASY EFL+RV GEE+   + GLW  
Sbjct  324   ATLNYDNATAASVDQELKSVLDELSFEKEFAFVRDASYVEFLDRVHGEEVALDKVGLWRV  383

Query  733   THPWLNLFVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFY  554
              HPWLNLFVP+SRI DF+  VF+ IL     +GP++VYP     WD+ MSAV P ED FY
Sbjct  384   PHPWLNLFVPRSRIADFDRGVFRGILQGTDIAGPLIVYPVNKSKWDDGMSAVTPAEDVFY  443

Query  553   CVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNT  374
              V LL+S   N  K L+  N+ IL FC   D  G   K+YLPHY SR DW++HFG KW+ 
Sbjct  444   AVSLLFSSVANDLKRLEAQNRMILRFC---DLAGIGYKEYLPHYTSRGDWVRHFGGKWDR  500

Query  373   FQENKAKFDPKMILSPGQTIFN  308
             F E K K+DPK +LSPGQ IF+
Sbjct  501   FVEMKDKYDPKKLLSPGQDIFS  522



>ref|XP_002310104.2| hypothetical protein POPTR_0007s08360g [Populus trichocarpa]
 gb|EEE90554.2| hypothetical protein POPTR_0007s08360g [Populus trichocarpa]
Length=524

 Score =   514 bits (1325),  Expect = 8e-173, Method: Compositional matrix adjust.
 Identities = 263/504 (52%), Positives = 340/504 (67%), Gaps = 26/504 (5%)
 Frame = -1

Query  1807  MSILGKLKPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDD  1628
             +  +GK       LP E+     A +  VD  A  +ASTD+G IV  TPA VLYPSS++D
Sbjct  21    LCTMGKSNALTCPLPPEL-----ATKLHVDPVAIDSASTDYGNIVHSTPAAVLYPSSIED  75

Query  1627  IINLVRFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGALR---GGGKIRVSWSESL  1457
             I  LV  SYN P PF ++ RG+GHSV GQ  A+DGVVV+M +LR    G KIRVS +   
Sbjct  76    IQILVNSSYNCPIPFGISVRGNGHSVNGQDMARDGVVVDMKSLREDKNGIKIRVSKNH--  133

Query  1456  GYFADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNV  1277
               FADVGG +LW+DVLH   A G+SP SWTD+L+L+VGGTLSNAG+SGQ F  GPQISNV
Sbjct  134   -LFADVGGEQLWIDVLHTTAAQGLSPVSWTDFLYLSVGGTLSNAGVSGQTFLHGPQISNV  192

Query  1276  LELDVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDD  1097
              ELDVITGKGE +TCSK  NS+LF +VLGGLGQFGIITRARI L  APT+V+W R  Y +
Sbjct  193   YELDVITGKGELVTCSKRNNSDLFDSVLGGLGQFGIITRARIALRSAPTKVRWSRAFYSN  252

Query  1096  FSKFTRDQEHLI---SINGLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLL  926
             FS F RDQE ++     +  NYLEGSLM+++ +P  W +SFF  +   +I SL+   G++
Sbjct  253   FSDFIRDQERIVRGGQRDVANYLEGSLMLDNGTPTEWITSFFHPTQLPQIMSLVKTYGII  312

Query  925   YCLEVVKHY-DDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQEN  749
             YCLE+ K+Y  +   S +DQ+L+ + KD S VPG+   K  SY EFL RV   E E Q  
Sbjct  313   YCLELTKYYFIEDIESEIDQDLQQVFKDFSHVPGLINAKFVSYQEFLTRVPNAENESQ--  370

Query  748   GLWEATHPWLNLFVPKSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIP  572
                  THPW NLF+P+SRI DFN  V ++I+LK   T+GP+L YP     WD  +SAVIP
Sbjct  371   -----THPWQNLFIPQSRISDFNVGVLRDIVLKRNITTGPVLFYPLNRHKWDAELSAVIP  425

Query  571   EEDTFYCVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHF  392
             +ED FY    L++ G++ W+V ++ NQ ++ FC   +E G K+ +YL  Y + E+W+KHF
Sbjct  426   DEDIFYTTSFLHTSGIDNWQVYEDQNQAVIKFC---EEAGIKMVKYLADYTTIEEWIKHF  482

Query  391   GKKWNTFQENKAKFDPKMILSPGQ  320
             G KW TF+E KA++DPK ILSPG+
Sbjct  483   GSKWTTFRERKAQYDPKNILSPGK  506



>emb|CBI19763.3| unnamed protein product [Vitis vinifera]
Length=579

 Score =   516 bits (1330),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 259/497 (52%), Positives = 334/497 (67%), Gaps = 16/497 (3%)
 Frame = -1

Query  1765  PYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSP  1586
             P ++L +++ G   VD      AS DFG + +  P  VL+PSS +D+  LV  +Y S   
Sbjct  79    PTDLLRLEVDGHLSVDPSDVKTASVDFGMMNRAEPLAVLHPSSAEDVARLVGAAYGSAHG  138

Query  1585  FSVAARGHGHSVRGQATAKDGVVVEMGALRGGGKIRVSWSESLGYFADVGGHELWVDVLH  1406
              SV+ARGHGHS+ GQA    GVV+EM A +G  +  +        + D  G ELW+DVL 
Sbjct  139   LSVSARGHGHSINGQAQTSSGVVIEMSASKGVRQWGLPRVSEQSRYVDAWGGELWIDVLK  198

Query  1405  ACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSK  1226
               L HG++P SWTDYL+L+VGGTLSNAGISGQ F  GPQISNV ELDV+TGKGE +TCS+
Sbjct  199   TTLEHGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVYELDVVTGKGELLTCSE  258

Query  1225  DMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISING-  1049
             + NSELF AVLGGLGQFGIITRARI LE AP RV+W+R+LY +FS FT+DQE+LIS++G 
Sbjct  259   EQNSELFHAVLGGLGQFGIITRARIGLEPAPQRVRWIRVLYSNFSTFTKDQEYLISLHGQ  318

Query  1048  -----LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTG  884
                   +Y+EG ++++    NNWRSSFFS  +  KI+S  T  G+LYCLEV K+Y + T 
Sbjct  319   PPNQKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKISSFGTNGGVLYCLEVTKNYHESTA  378

Query  883   STVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVP  704
              T+DQ+++ LLK L F+P   F  D  Y +FL+RV   EL+ +  GLW+  HPWLNLFVP
Sbjct  379   DTIDQDVEALLKRLDFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVP  438

Query  703   KSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSGGM  524
             +SRI DF+  VF+ I L +KTSGP+L+YP     WD+R S V PEED FY V LL S   
Sbjct  439   RSRIADFDEGVFKGI-LGNKTSGPILIYPMNKNKWDDRTSVVTPEEDVFYLVALLRSALD  497

Query  523   NG-----WKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFG-KKWNTFQEN  362
             +G      + L   N++IL FC   D+ G K+KQYLPHY ++EDW+ HFG  KW  F + 
Sbjct  498   SGDEAQSLEYLSNQNRQILRFC---DDAGIKVKQYLPHYTTQEDWVDHFGDDKWTLFSKR  554

Query  361   KAKFDPKMILSPGQTIF  311
             K  FDP+ IL+ GQ IF
Sbjct  555   KMDFDPRRILATGQRIF  571



>ref|XP_009398389.1| PREDICTED: cytokinin dehydrogenase 5 [Musa acuminata subsp. malaccensis]
Length=532

 Score =   515 bits (1326),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 262/501 (52%), Positives = 334/501 (67%), Gaps = 19/501 (4%)
 Frame = -1

Query  1765  PYEILS-VDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPS  1589
             P E+L  + + G+  +D     AA  DFGG+ +  P  V+ P S  D+  LVR +Y S  
Sbjct  24    PAELLPRLAVEGQLSLDPAEVAAAGADFGGLARAEPVAVMRPGSAGDVAGLVRAAYGSAR  83

Query  1588  PFSVAARGHGHSVRGQATAKDGVVVEMGALRGGGKIRVSWSESLG-YFADVGGHELWVDV  1412
              F V+ARGHGH   GQA A  GVV+EM   R   + R ++S S G Y+ DV G +LW+DV
Sbjct  84    GFPVSARGHGHCTGGQALAPGGVVIEMSRGRLEPRPRPAYSPSTGEYYVDVWGGDLWIDV  143

Query  1411  LHACLAHG-VSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFIT  1235
             L+  LA+G ++P SWTDYL+L+VGGTLSNAGISGQ F  GPQ SNV ELDV+TGKGE IT
Sbjct  144   LNWTLANGDLAPKSWTDYLYLSVGGTLSNAGISGQAFHHGPQSSNVYELDVVTGKGELIT  203

Query  1234  CSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISI  1055
             CS++ NSELF  VLGGLGQFGIITRARI LE+AP RV+W+R+LY DF  FTRDQEHLIS+
Sbjct  204   CSEEQNSELFHGVLGGLGQFGIITRARIALEQAPQRVRWIRVLYSDFGAFTRDQEHLISL  263

Query  1054  NG------LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDD  893
             +G       +Y+EG ++++    NNWRSSFFS  +  KI+S+ +  G+LYCLE+ K+YDD
Sbjct  264   HGALPSQRFDYVEGFVIVDEGLINNWRSSFFSPKNPVKISSVGSNGGVLYCLEMTKNYDD  323

Query  892   QTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNL  713
              T  T+D+ ++ LL+ LSF+P   F  D  Y +FL+RV   EL  +  GLWE  HPWLNL
Sbjct  324   STADTIDEVVEALLRQLSFIPATVFTTDLPYVDFLDRVHKAELRLRAKGLWEVPHPWLNL  383

Query  712   FVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYS  533
             FVP SRI DF+  VF+ I L ++TSGP+L+YP     WD+R S V P+E+ FY V  L S
Sbjct  384   FVPASRIADFDRGVFRGI-LGNRTSGPILIYPMNKHKWDDRSSVVTPDEEVFYLVAFLRS  442

Query  532   G------GMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTF  371
                         + L + NQ+IL FC   DE G +IKQYLPH+ SR +W +HFG KW  F
Sbjct  443   ALSDSDDPTQSLEYLSQQNQKILEFC---DEVGIEIKQYLPHHPSRTEWARHFGPKWARF  499

Query  370   QENKAKFDPKMILSPGQTIFN  308
                KA+FDPK IL  GQ IF 
Sbjct  500   VRRKAQFDPKFILGTGQGIFQ  520



>ref|XP_009381235.1| PREDICTED: cytokinin dehydrogenase 6-like [Musa acuminata subsp. 
malaccensis]
Length=520

 Score =   514 bits (1324),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 266/496 (54%), Positives = 332/496 (67%), Gaps = 17/496 (3%)
 Frame = -1

Query  1780  WNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSY  1601
             W ++LP  +L++DI  +  VD   T   STD+GG+ Q  PA VLYPSS DDI  LVRF+Y
Sbjct  34    WPAALPEGLLALDIVDKIHVDPDTTARFSTDYGGLSQADPAAVLYPSSPDDIATLVRFAY  93

Query  1600  NSPSPFS-VAARGHGHSVRGQATAKDGVVVEMGALRGGGKIRVSWSESLGYFADVGGHEL  1424
             +S      +AA GHGHS+RGQA    GVVV+M +L  G   R++ S    ++ D GG +L
Sbjct  94    SSSPSSFSIAAHGHGHSIRGQALVPGGVVVDMASLGRGRSDRINVSSD--WYVDAGGEQL  151

Query  1423  WVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGE  1244
             W+DVL   L HG+SP SWTDYL+LTVGGTLSNAGISGQ FR GPQISNV ELDVITGKG+
Sbjct  152   WIDVLRETLKHGLSPRSWTDYLYLTVGGTLSNAGISGQAFRHGPQISNVYELDVITGKGD  211

Query  1243  FITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHL  1064
              ITCS++ NS+LF+ VLGGLGQFGIITRARI LE AP RV+W+R+ Y DFS FT DQE L
Sbjct  212   TITCSREENSDLFYGVLGGLGQFGIITRARIALEPAPQRVRWLRLFYTDFSSFTGDQELL  271

Query  1063  ISING--LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQ  890
             +S+     +Y+EG L+      N   SSFFS +D  K+  L  + G +Y +E   +Y+  
Sbjct  272   VSMTEKVFDYVEGQLLTEKDVGN---SSFFSDTDTEKVKMLAAEYGRIYFVEGGVYYEPA  328

Query  889   TGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQ--ENGLWEATHPWLN  716
             T S VDQ+L+ LLK LSFVPG  F KD +Y  FLNRV+ EE      EN L    HPWLN
Sbjct  329   TASMVDQKLETLLKRLSFVPGFAFTKDVAYISFLNRVQEEETHSTAPENVL----HPWLN  384

Query  715   LFVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLY  536
             +FVPKSRI DF   VF+ IL  +   G +L+YP     WD++MSA IP+E+ FY +GLL 
Sbjct  385   MFVPKSRIRDFEMGVFKGILKNNNPIGLVLIYPFNKNKWDDKMSAAIPDEEVFYTIGLLP  444

Query  535   SGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKA  356
             S  ++ WK LD  N EIL FC    +EG   KQYLPHY ++ DW  HFG KW+ F   K 
Sbjct  445   SATVDDWKYLDSQNDEILRFCQ---QEGIDFKQYLPHYTTQTDWKNHFGLKWDVFVRLKR  501

Query  355   KFDPKMILSPGQTIFN  308
             ++DP+ +LSPGQ IF 
Sbjct  502   RYDPQALLSPGQRIFT  517



>ref|XP_006577980.1| PREDICTED: cytokinin dehydrogenase 5-like [Glycine max]
Length=524

 Score =   514 bits (1325),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 258/495 (52%), Positives = 342/495 (69%), Gaps = 21/495 (4%)
 Frame = -1

Query  1759  EILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSPFS  1580
             E+L V + GR  VD+    AAS DFG + +  P+ V++P++ +D+  +V+ ++ SP  F+
Sbjct  29    ELLDVGLQGRLSVDTLELEAASVDFGRLSRGEPSEVVHPATAEDVARVVKAAFESP--FA  86

Query  1579  VAARGHGHSVRGQATAKD--GVVVEMG---ALRGGGKIRVSWSESLGYFADVGGHELWVD  1415
             V+ARGHGHS+ GQA  K+  GVV+EMG   +   G  IRVS     G + DV G +LW+D
Sbjct  87    VSARGHGHSINGQAMIKEKKGVVIEMGKSDSGEDGSSIRVS---EKGMYVDVWGGKLWID  143

Query  1414  VLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFIT  1235
             VL A L +G++P SWTDYL+L+VGGTLSNAGISGQ F  GPQI+NV ELDV+TGKGE +T
Sbjct  144   VLSATLEYGLAPMSWTDYLYLSVGGTLSNAGISGQTFNHGPQITNVYELDVVTGKGELVT  203

Query  1234  CSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISI  1055
             CS+D NSELF AVLGGLGQFGIITRARI LE AP RV+W+R+LY +F++F +DQE+LIS+
Sbjct  204   CSEDRNSELFHAVLGGLGQFGIITRARIALEPAPHRVRWIRVLYSNFARFCKDQEYLISL  263

Query  1054  NG------LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDD  893
             +G       +Y+EG ++++    NNWRSSFFS S+  KI SL    G+LYCLE+ K+YD 
Sbjct  264   HGKAARERFDYVEGFVIVDEGLINNWRSSFFSASNPVKITSLNADGGVLYCLEITKNYDQ  323

Query  892   QTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNL  713
                 +VD+E++ LLK L+F+P   F  D  Y +FL+RV   EL+ +  GLW+  HPWLNL
Sbjct  324   GNADSVDEEIQALLKKLNFIPTSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNL  383

Query  712   FVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYS  533
             FVPKSRI DF+  VF+ I L +KTSGP+L+YP     WD+R S V PEED FY V  L S
Sbjct  384   FVPKSRIGDFDKGVFKGI-LGNKTSGPILIYPMNKNKWDQRSSVVTPEEDVFYLVAFLRS  442

Query  532   G-GMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKA  356
                    + L   N++IL FC+  +    K+KQYLPHY ++++WM HFG KW  F   K 
Sbjct  443   ALDTETLEYLTNQNRQILKFCHDIE---IKVKQYLPHYTTQQEWMDHFGDKWTQFNARKM  499

Query  355   KFDPKMILSPGQTIF  311
             +FDP+ IL+ GQ IF
Sbjct  500   QFDPRRILATGQQIF  514



>ref|XP_008221343.1| PREDICTED: cytokinin dehydrogenase 5 [Prunus mume]
Length=543

 Score =   514 bits (1325),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 260/505 (51%), Positives = 338/505 (67%), Gaps = 27/505 (5%)
 Frame = -1

Query  1765  PYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSP  1586
             P E+L + + G+  VD      AS DFG + +  P  VL+P S  D+  LVR +Y+S   
Sbjct  25    PTELLRLVVEGQLSVDPSDVDTASKDFGLMTRAEPLAVLHPGSAQDVARLVRAAYSSAHG  84

Query  1585  FSVAARGHGHSVRGQATAKDGVVVEMGALRGGGKI---------RVSWSESLGYFADVGG  1433
             F+V+ARGHGHS+ GQA   +GVV+EM      G++         RVS     G + D  G
Sbjct  85    FTVSARGHGHSINGQAQTNNGVVIEMNGGGSSGRVMSRVRSGSGRVS---EKGMYVDAWG  141

Query  1432  HELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITG  1253
              ELW+DVL + L +G++P SWTDYL+L+VGGTLSNAGISGQ F  GPQIS+V ELDV+TG
Sbjct  142   GELWIDVLMSTLEYGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISSVDELDVVTG  201

Query  1252  KGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQ  1073
             +GE +TCS++ N+ELF AVLGGLGQFGIITRARI LE AP RV+W+R+LY +FS FT+DQ
Sbjct  202   RGELLTCSEEKNAELFHAVLGGLGQFGIITRARIALEPAPQRVRWIRVLYSNFSAFTKDQ  261

Query  1072  EHLISING------LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEV  911
             E LIS++G       +Y+EG ++++    NNWRSSFFS S+  KI S+ +Q G+LYCLE+
Sbjct  262   EFLISLHGQPSTHKFDYVEGFVIVDEGLINNWRSSFFSPSNPVKITSINSQGGVLYCLEI  321

Query  910   VKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEAT  731
              K+Y + T  T+DQE++ LLK L FVP   F  D  Y +FL+RV   EL+ +   LW+  
Sbjct  322   TKNYHESTADTIDQEIECLLKKLDFVPTSVFTTDLPYVDFLDRVHKAELKLRSKSLWDVP  381

Query  730   HPWLNLFVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYC  551
             HPWLNLFVPKSRI DF+  VF+ I L +KTSGP+L+YP     WD+R S V P+ED FY 
Sbjct  382   HPWLNLFVPKSRISDFDEGVFKGI-LGNKTSGPILIYPMNKDKWDQRSSVVTPDEDIFYL  440

Query  550   VGLLYSGGMNGWKV-----LDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGK  386
             V LL S    G +      L   N++IL FC   D+ G K KQYLPHY ++E+WM HFG 
Sbjct  441   VALLRSALDTGDETHTLEHLTNQNRQILKFC---DDAGIKAKQYLPHYTTQEEWMDHFGD  497

Query  385   KWNTFQENKAKFDPKMILSPGQTIF  311
             KW+ F + K  FDP+ IL+ GQ IF
Sbjct  498   KWDQFYQRKVDFDPRRILATGQRIF  522



>dbj|BAM74648.1| cytokinin oxidase/dehydrogenase [Torenia fournieri]
Length=531

 Score =   514 bits (1323),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 264/508 (52%), Positives = 341/508 (67%), Gaps = 23/508 (5%)
 Frame = -1

Query  1789  LKPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVR  1610
             L  + + LP  IL+    G   VD     +AS DFG +    P  VLYP S DD+  LVR
Sbjct  20    LTLYPTELPRSILA---DGHVSVDPSDVASASIDFGRMQSSEPLAVLYPGSADDVARLVR  76

Query  1609  FSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEM--GALRGGGKIRVSWSESLGYFADVG  1436
              +Y SP  F+V+ARGHGHS+ GQA A +G+V++M  G++         W + +  + DV 
Sbjct  77    SAYESPRGFAVSARGHGHSINGQAMASNGIVIQMSGGSVHDHEATTKVWEKLM--YVDVW  134

Query  1435  GHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVIT  1256
             G ELWVDVL + L HG++P SWTDYL+L+VGGTLSNAGISGQ F  GPQISNV ELDV+T
Sbjct  135   GGELWVDVLRSTLRHGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVYELDVVT  194

Query  1255  GKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRD  1076
             GKGE +TCSKD NSEL++AVLGGLGQFGIITRARI LEKAPTRV+W+R+LY +F+ FT D
Sbjct  195   GKGELLTCSKDENSELYYAVLGGLGQFGIITRARIALEKAPTRVRWIRVLYSNFTAFTED  254

Query  1075  QEHLISING----LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLT--QQGLLYCLE  914
             QE+LIS++G     +Y+EG ++++    NNWRSSFFS  +  K++SL +  + G+LYCLE
Sbjct  255   QEYLISLHGQSEMFDYVEGFVIVDEGLINNWRSSFFSPRNPVKVSSLKSDDEGGVLYCLE  314

Query  913   VVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEA  734
             V K+Y +     +DQE+  LLK L+F+P   F  D  Y +FL+RV   EL+ +   LW+ 
Sbjct  315   VTKNYHESNADFIDQEVDALLKKLNFIPSSVFTTDLPYVDFLDRVHKAELKLRAKNLWDV  374

Query  733   THPWLNLFVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFY  554
              HPWLNLFVPKSRI DF+  VF+ IL  +KTSGP+L+YP     WDE+ S V P ED FY
Sbjct  375   PHPWLNLFVPKSRIHDFDKGVFKGILGNNKTSGPILIYPMNKNKWDEKTSVVTPNEDVFY  434

Query  553   CVGLLYSGGMNG---WKVLDEL---NQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHF  392
              V LL S   NG    + LD L   N+ IL FC    ++G   KQYLPHY ++++W  HF
Sbjct  435   LVALLRSALDNGDDEMQTLDYLSNQNRRILGFCQ---DQGIGCKQYLPHYTTQQEWKLHF  491

Query  391   G-KKWNTFQENKAKFDPKMILSPGQTIF  311
             G  KW  F + K +FDP+ IL+ GQ IF
Sbjct  492   GDDKWKQFNKRKTEFDPRHILATGQRIF  519



>ref|XP_003632404.1| PREDICTED: cytokinin dehydrogenase 3-like [Vitis vinifera]
Length=464

 Score =   511 bits (1315),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 271/499 (54%), Positives = 330/499 (66%), Gaps = 67/499 (13%)
 Frame = -1

Query  1789  LKPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQ-ETPAGVLYPSSVDDIINLV  1613
             L+PW  +LP E  S+D A R RVD  A   AS DFG +V    PA VLYP S++DI +LV
Sbjct  26    LRPWADALPLERQSLDNASRLRVDPDAIRMASRDFGKLVHLPNPAAVLYPCSIEDIASLV  85

Query  1612  RFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGAL----RGGGKIRVSWSESLGYFA  1445
             +FSYN  SPFS+AARG GH   GQA A  GVVVEM +L    RG G IRV+ +  LG +A
Sbjct  86    KFSYNLSSPFSIAARGRGHCHSGQAMAPHGVVVEMRSLNDCSRGSG-IRVTKNSILGSYA  144

Query  1444  DVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELD  1265
             DVGG      VL A + HG++P SWTDYL+LTVGG LSN GISGQ FR GP ISNV E+D
Sbjct  145   DVGGEHSSYGVLKATVKHGLAPVSWTDYLYLTVGGVLSNGGISGQTFRRGPPISNVYEMD  204

Query  1264  VITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKF  1085
             V+TGKGE +TCS+D NS+LFFAVLGGLGQFGIITRARIVLE AP RVKW+ MLY DFS F
Sbjct  205   VLTGKGELVTCSEDTNSKLFFAVLGGLGQFGIITRARIVLEPAPKRVKWIHMLYHDFSAF  264

Query  1084  TRDQEHLISINGLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVK  905
             +RDQEHLISINGL+YLEGSL +++  PNNWRSS FS SD  +I+SL++++G++YCLEVVK
Sbjct  265   SRDQEHLISINGLDYLEGSLFLHNCPPNNWRSS-FSPSDYPRISSLISKKGIIYCLEVVK  323

Query  904   HYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHP  725
             +YDD T  TVD E+ D                                   +G++    P
Sbjct  324   YYDDLTSHTVD-EVSDF---------------------------------NSGVFRDILP  349

Query  724   WLNLFVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVG  545
              +N                       +T+GP+ VYP     WD+RMSAV P+ED FY +G
Sbjct  350   NIN-----------------------QTTGPIHVYPMIRNKWDDRMSAVTPDEDIFYAIG  386

Query  544   LLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQE  365
             LL+S G + WK L+  N+EIL FC   D+ G KIK YL  Y ++EDWMKHFG KW TF++
Sbjct  387   LLHSSGADDWKPLENQNKEILQFC---DKAGIKIKLYLSRYTTKEDWMKHFGPKWKTFED  443

Query  364   NKAKFDPKMILSPGQTIFN  308
              KA+FDPK+ILSPGQ IFN
Sbjct  444   RKAQFDPKIILSPGQRIFN  462



>ref|XP_011028922.1| PREDICTED: cytokinin dehydrogenase 5-like [Populus euphratica]
Length=534

 Score =   513 bits (1321),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 263/502 (52%), Positives = 333/502 (66%), Gaps = 27/502 (5%)
 Frame = -1

Query  1756  ILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSPFSV  1577
             +L VD   +  VD      AS DFG + +  P  VL+P S +DI  LVR +Y S   F+V
Sbjct  28    LLGVD--DQLSVDQFDVETASLDFGLLTRAEPMAVLHPGSAEDIARLVRAAYISSPGFTV  85

Query  1576  AARGHGHSVRGQATAKDGVVVEMGA--------LRGGGKIRVSWSESLGYFADVGGHELW  1421
             +ARGHGHS+ GQA   +GVV+EM          LR   K +VS  E      DV G ELW
Sbjct  86    SARGHGHSINGQAQTSNGVVIEMSGGSKGRRLGLRKLDKPQVSIKEK---HVDVWGGELW  142

Query  1420  VDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEF  1241
             +DVL   L HG++P SWTDYL+L+VGGTLSN GISGQ F  GPQISNV ELDV+TGKGE 
Sbjct  143   IDVLRRTLEHGLAPKSWTDYLYLSVGGTLSNGGISGQAFNHGPQISNVYELDVVTGKGEL  202

Query  1240  ITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLI  1061
              TCS++ NSELF AVLGGLGQFGIITRARI LE AP RV+W+R+LY +FS FTRDQE LI
Sbjct  203   WTCSEEENSELFHAVLGGLGQFGIITRARIALEPAPQRVRWIRVLYSNFSTFTRDQEDLI  262

Query  1060  SING------LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHY  899
             S++G       +Y+EG ++++    NNWRSSFFS  +  KI+S+    G+LYCLE+ K+Y
Sbjct  263   SLHGNPYSQKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKISSIGANGGVLYCLEITKNY  322

Query  898   DDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWL  719
             D+ T  T+DQE++ L+K L+F+P   F  D  Y +FL+RV   EL+ +  GLWE  HPWL
Sbjct  323   DEATADTIDQEVEALMKRLNFIPSSVFTTDLPYIDFLDRVHKAELKLRAKGLWEVPHPWL  382

Query  718   NLFVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLL  539
             NLFVPKSR+ D +  VF+ IL  +KTSGP+L+YP     WD+R S V P+ED FY V LL
Sbjct  383   NLFVPKSRMADVDRGVFKGILGNNKTSGPILIYPMNKSKWDQRSSVVTPDEDVFYLVALL  442

Query  538   YSGGMNGWKV-----LDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNT  374
              S   NG +      L   N ++L FC   D+ G K+KQYLPHY ++E+W  HFG KW+ 
Sbjct  443   RSALDNGEETQSLEYLTNQNHKVLRFC---DDAGIKVKQYLPHYTTQEEWRDHFGDKWDQ  499

Query  373   FQENKAKFDPKMILSPGQTIFN  308
             F   K +FDP+ IL+ GQ IFN
Sbjct  500   FSRRKMEFDPRHILATGQRIFN  521



>gb|ADB45878.1| cytokinin oxidase/dehydrogenase [Bambusa oldhamii]
Length=525

 Score =   513 bits (1320),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 260/508 (51%), Positives = 337/508 (66%), Gaps = 16/508 (3%)
 Frame = -1

Query  1795  GKLKPWN--SSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDII  1622
             G   PW   S LP ++ ++ +AG+ R D  AT  AS DFG I    P  VL P+S  D+ 
Sbjct  22    GGGHPWPAPSGLPGDLGALAVAGKLRTDPNATVPASMDFGNITTALPTAVLLPASPGDVA  81

Query  1621  NLVRFSYNSPS-PFSVAARGHGHSVRGQATAKDGVVVEMGALRGGGKIRVSWSESLGYFA  1445
              L+R +Y++P  PF+V+ RG GHSV GQA A  GVVV M +L      R++ S   G + 
Sbjct  82    ALLRAAYSTPGWPFTVSFRGRGHSVMGQAFAPGGVVVHMLSLSSSAARRINVSAD-GRYV  140

Query  1444  DVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELD  1265
             D GG  LW+DVL A L  GV+P SWTDYLHLTVGGTLSNAG+SGQ FR GPQISNV ELD
Sbjct  141   DAGGEHLWIDVLRATLERGVAPRSWTDYLHLTVGGTLSNAGVSGQAFRHGPQISNVYELD  200

Query  1264  VITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKF  1085
             VITG GE +TCSK +NS+LF AVLGGLGQFG+ITRARI LE AP+R +WVR++Y DF+ F
Sbjct  201   VITGYGEMVTCSKALNSDLFDAVLGGLGQFGVITRARIALEPAPSRARWVRLVYTDFAVF  260

Query  1084  TRDQEHLI------SINGLNYLEGSLMMNHTSPNNWRSS-FFSLSDQSKIASLLTQQG--  932
             T DQE LI      S   ++Y+EGS+ +NH+     +S+ FFS +D ++I +   ++   
Sbjct  261   TADQERLIAPRPDGSFEPMSYVEGSVYVNHSLAAGLKSAGFFSDADVARIVAHAAERNAT  320

Query  931   LLYCLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQE  752
              +Y +E   +YD+ T ++VDQEL+ ++ +L F  G  F +DASY EFL+RV G E+  ++
Sbjct  321   AVYSIEATLNYDNATAASVDQELRSVIDELRFEKGFAFVRDASYVEFLDRVYGAEVALEK  380

Query  751   NGLWEATHPWLNLFVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIP  572
              G W   HPWLN+FVP+SRI DF+  VF+ IL     +GP++VYP     W++ MSAV P
Sbjct  381   VGQWRVPHPWLNMFVPRSRIADFDRGVFRGILQGTDIAGPLIVYPVNKSKWNDGMSAVTP  440

Query  571   EEDTFYCVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHF  392
              ED FY V LL+S   N  K L+  N+ IL FC   D  G   K+YLPHY SR DW++HF
Sbjct  441   AEDVFYAVALLFSSVANDLKRLEAQNRRILRFC---DLAGIGYKEYLPHYTSRGDWVRHF  497

Query  391   GKKWNTFQENKAKFDPKMILSPGQTIFN  308
             G KW+ F E K K+DPK +LSPGQ IFN
Sbjct  498   GGKWDRFVEIKNKYDPKKLLSPGQDIFN  525



>ref|XP_006435071.1| hypothetical protein CICLE_v10000709mg [Citrus clementina]
 gb|ESR48311.1| hypothetical protein CICLE_v10000709mg [Citrus clementina]
Length=572

 Score =   514 bits (1325),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 262/505 (52%), Positives = 338/505 (67%), Gaps = 24/505 (5%)
 Frame = -1

Query  1765  PYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSP  1586
             P E+L + + G+  VD      AS DFG + +  P  VL+P+S DDI  +V+ +Y S + 
Sbjct  62    PTELLRLGVYGQLSVDPFDVQTASLDFGMLSRAEPWAVLHPASADDITRVVKAAYESEAH  121

Query  1585  -FSVAARGHGHSVRGQATAKDGVVVEMGALRGG-------GKIRVSWSESLGYFADVGGH  1430
              F+++ARGHGHS+ GQA   +GVV++M   RG          +R    E   Y  DV G 
Sbjct  122   GFTISARGHGHSINGQAQTSNGVVIQMSGSRGRRLGSSTPAALRPHVYEKERY-VDVWGG  180

Query  1429  ELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGK  1250
             ELW+DVL + L HG++P SWTDYL+L+VGGTLSNAGISGQ F  GPQI+NV ELDV+TGK
Sbjct  181   ELWIDVLRSTLEHGLAPKSWTDYLYLSVGGTLSNAGISGQAFHQGPQITNVHELDVVTGK  240

Query  1249  GEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQE  1070
             GE +TCS++ NS LF AVLGGLGQFGIITRARI LE AP RV+W+R+LY DFS FTRDQE
Sbjct  241   GELLTCSEEQNSGLFHAVLGGLGQFGIITRARISLEPAPKRVRWIRVLYSDFSTFTRDQE  300

Query  1069  HLISINGL------NYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVV  908
             +LIS++ L      +Y+EG ++++    NNWRSSFFS  +  KI SL    G+LYCLE+ 
Sbjct  301   YLISLHELPASQKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKITSLGADGGVLYCLEIT  360

Query  907   KHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATH  728
             K+YD+ T  T DQE++ LLK L+F+P   F  D  Y +FL+RV   EL+ +  GLWE  H
Sbjct  361   KNYDESTAETTDQEVESLLKKLNFIPSSVFTTDLLYVDFLDRVHKAELKLRSKGLWEVPH  420

Query  727   PWLNLFVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCV  548
             PWLNLF+PKSRI DF+  VF+ I L +KT GP+L+YP     WD R S V P+ED FY V
Sbjct  421   PWLNLFIPKSRIADFDKGVFKGI-LGNKTGGPILIYPMNKHKWDNRSSVVTPDEDVFYLV  479

Query  547   GLLYSGGMNGWKV-----LDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKK  383
               L S   NG ++     L+  N++IL FC   DE G K KQYLPHY ++E+W+ HFG K
Sbjct  480   AFLRSALDNGEEMQSLEYLNHQNRQILKFC---DEAGIKAKQYLPHYTTQEEWVDHFGDK  536

Query  382   WNTFQENKAKFDPKMILSPGQTIFN  308
             W  F + K +FDP+ IL+ GQ IF 
Sbjct  537   WGQFYQRKMEFDPRHILATGQRIFK  561



>ref|XP_006473567.1| PREDICTED: cytokinin dehydrogenase 5-like [Citrus sinensis]
Length=572

 Score =   514 bits (1323),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 262/504 (52%), Positives = 338/504 (67%), Gaps = 24/504 (5%)
 Frame = -1

Query  1765  PYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSP  1586
             P E+L + + G+  VD      AS DFG + +  P  VL+P+S DDI  +V+ +Y S + 
Sbjct  62    PTELLRLGVYGQLSVDPSDVQTASLDFGMLSRAEPWAVLHPASADDITRVVKAAYESEAH  121

Query  1585  -FSVAARGHGHSVRGQATAKDGVVVEMGALRGG-------GKIRVSWSESLGYFADVGGH  1430
              F+++ARGHGHS+ GQA   +GVV++M   RG          +R    E   Y  DV G 
Sbjct  122   GFTISARGHGHSINGQAQTSNGVVIQMSGSRGRRLGSSTPAALRPHVYEKERY-VDVWGG  180

Query  1429  ELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGK  1250
             ELW+DVL + L HG++P SWTDYL+L+VGGTLSNAGISGQ F  GPQI+NV ELDV+TGK
Sbjct  181   ELWIDVLRSTLEHGLAPKSWTDYLYLSVGGTLSNAGISGQAFHQGPQITNVHELDVVTGK  240

Query  1249  GEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQE  1070
             GE +TCS++ NS LF AVLGGLGQFGIITRARI LE AP RV+W+R+LY DFS FTRDQE
Sbjct  241   GELLTCSEEQNSGLFHAVLGGLGQFGIITRARISLEPAPKRVRWIRVLYSDFSTFTRDQE  300

Query  1069  HLISINGL------NYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVV  908
             +LIS++ L      +Y+EG ++++    NNWRSSFFS  +  KI SL T  G+LYCLE+ 
Sbjct  301   YLISLHELPASQKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKITSLGTDGGVLYCLEIT  360

Query  907   KHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATH  728
             K+YD+ T  T DQE++ LLK L+F+    F  D  Y +FL+RV   EL+ +  GLWE  H
Sbjct  361   KNYDESTADTTDQEVESLLKKLNFIQSSVFTTDLLYVDFLDRVHKAELKLRSKGLWEVPH  420

Query  727   PWLNLFVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCV  548
             PWLNLF+PKSRI DF+  VF+ I L +KT GP+L+YP     WD R S V P+ED FY V
Sbjct  421   PWLNLFIPKSRIADFDKGVFKGI-LGNKTGGPILIYPMNKHKWDNRSSVVTPDEDVFYLV  479

Query  547   GLLYSGGMNGWKV-----LDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKK  383
               L S   NG ++     L+  N++IL FC   DE G K KQYLPHY ++E+W+ HFG K
Sbjct  480   AFLRSALDNGEEMQSLEYLNHQNRQILKFC---DEAGIKAKQYLPHYTTQEEWVDHFGDK  536

Query  382   WNTFQENKAKFDPKMILSPGQTIF  311
             W  F + K +FDP+ IL+ GQ IF
Sbjct  537   WGQFYQRKMEFDPRYILATGQRIF  560



>ref|XP_010932835.1| PREDICTED: cytokinin dehydrogenase 5-like [Elaeis guineensis]
 ref|XP_010932844.1| PREDICTED: cytokinin dehydrogenase 5-like [Elaeis guineensis]
Length=535

 Score =   512 bits (1319),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 262/501 (52%), Positives = 340/501 (68%), Gaps = 21/501 (4%)
 Frame = -1

Query  1765  PYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSP  1586
             P ++L   + G+  ++      AS DFGG+ +  P  V+ P+S  D+ +LVR +Y S   
Sbjct  25    PAQLLQFSMEGQLSLEPSDVDRASVDFGGMTRAEPMAVMRPASAGDVASLVRLAYGSARG  84

Query  1585  FSVAARGHGHSVRGQATAKDGVVVEMGALRGGGKIRVS---WSESLG-YFADVGGHELWV  1418
             F V+ARGHGHS+ GQA A+ GVV+EM   R  G    S   +S SLG Y+ DV G ELW+
Sbjct  85    FPVSARGHGHSINGQARAQGGVVIEMSYDRAVGHRARSHPVYSPSLGEYYVDVWGGELWI  144

Query  1417  DVLHACLAHG-VSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEF  1241
             D+L+  L +G ++P SWTDYL+L+VGGTLSNAGISGQ F  GPQISNV E+DVITGKGE 
Sbjct  145   DILNWTLENGGLAPKSWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVYEVDVITGKGEI  204

Query  1240  ITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLI  1061
             +TCS++ NSELF  VLGGLGQFGIITRAR+ LE AP RV+W+R+LY +F+ FTRDQE LI
Sbjct  205   VTCSEEQNSELFHGVLGGLGQFGIITRARLALEPAPQRVRWIRVLYSNFTTFTRDQELLI  264

Query  1060  SING------LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHY  899
             S++G       +Y+EG ++++    NNWRSSFFS  +   I+S+ T  G+LYCLE+ K+Y
Sbjct  265   SLHGTHRSERFDYVEGFVIVDEGLINNWRSSFFSPRNSVNISSIGTNGGVLYCLEMTKNY  324

Query  898   DDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWL  719
             DD T   VDQE++ LLK L F+P   F  D  Y +FL+RV   EL+ +  GLW+  HPWL
Sbjct  325   DDSTADFVDQEVEALLKRLEFIPASVFTTDLPYVDFLDRVHKAELKLRAKGLWDVPHPWL  384

Query  718   NLFVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLL  539
             NLFVP SRI DF+  VF+ I L +KTSGP+L+YP     WDER SAV P+E+ FY VG L
Sbjct  385   NLFVPASRIADFDHGVFRGI-LGNKTSGPILIYPMNKHKWDERSSAVTPDEEVFYLVGFL  443

Query  538   -----YSG-GMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWN  377
                  YSG      + L + N+ IL+FC   DE G ++KQYLPH+ +R +W +HFG KW+
Sbjct  444   RSALPYSGESTQSLEYLSQQNERILAFC---DEAGIEVKQYLPHHLTRAEWARHFGTKWD  500

Query  376   TFQENKAKFDPKMILSPGQTI  314
              F   KA+FDPK IL  GQ I
Sbjct  501   RFLRLKAEFDPKGILGSGQGI  521



>ref|XP_008796604.1| PREDICTED: cytokinin dehydrogenase 5-like [Phoenix dactylifera]
Length=554

 Score =   513 bits (1320),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 260/503 (52%), Positives = 338/503 (67%), Gaps = 22/503 (4%)
 Frame = -1

Query  1765  PYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSP  1586
             P E+L +D+ G+  +D      AS DFGG+ +  P  V+ P+S  D+ +LVR +Y S   
Sbjct  25    PAELLQLDVEGQVSLDPSDVGRASVDFGGMTRAEPMAVMRPASAGDVASLVRAAYGSAQG  84

Query  1585  FSVAARGHGHSVRGQATAKDGVVVEMGAL-RGGG---KIRVSWSESLG-YFADVGGHELW  1421
             F V+ARGHGHS+ GQA A  GVV+EM    R  G   + R  +S SLG Y+ DV G ELW
Sbjct  85    FPVSARGHGHSIDGQAQAPGGVVIEMSQYGRAAGHRARPRPVYSPSLGEYYVDVWGGELW  144

Query  1420  VDVLHACLAHG-VSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGE  1244
             +D+L+  L +G ++P SWTDYL+L+VGGTLSNAGISGQ F  GPQISNV ELDV+TG GE
Sbjct  145   IDILNWTLENGGLAPKSWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVYELDVVTGMGE  204

Query  1243  FITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHL  1064
              +TCS++ NSELF+ VLGGLGQFGIITRARI LE AP RV+W+R+LY +F+ FTRDQEHL
Sbjct  205   ILTCSEEENSELFYGVLGGLGQFGIITRARIALEPAPRRVRWIRVLYSNFTTFTRDQEHL  264

Query  1063  ISING------LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKH  902
             IS++        +Y+EG ++++    NNWRSSFFS  +  KI+S+    G+LYCLE+ K+
Sbjct  265   ISLHSAHRSERFDYVEGFVIVDEGLINNWRSSFFSPRNPVKISSIGANGGVLYCLEMTKN  324

Query  901   YDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPW  722
             YD+ T   VDQE++ LL  L F+P   F  D  Y +FL+RV   EL+ +  G+W+  HPW
Sbjct  325   YDESTAGLVDQEVEALLTKLEFIPASVFTTDLPYVDFLDRVHKAELKLRAKGMWDVPHPW  384

Query  721   LNLFVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGL  542
             LNLFVP SRI DF+  VF+ I L +KTSGP+L+YP     WDER S V PEE+ FY V  
Sbjct  385   LNLFVPGSRIADFDHGVFRAI-LGNKTSGPILIYPMNKHKWDERSSVVTPEEEVFYLVAF  443

Query  541   LYSG------GMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKW  380
             L S            + L + N+ IL+FC   +E G ++KQYLPH+ +R DW +HFG KW
Sbjct  444   LRSALPDSDESTQSLEYLSQQNERILAFC---EEAGIQVKQYLPHHLTRADWARHFGPKW  500

Query  379   NTFQENKAKFDPKMILSPGQTIF  311
               F+  KA+FDPK IL  GQ IF
Sbjct  501   GRFRRLKAQFDPKCILGSGQGIF  523



>ref|XP_009409596.1| PREDICTED: cytokinin dehydrogenase 7-like [Musa acuminata subsp. 
malaccensis]
Length=521

 Score =   511 bits (1316),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 261/494 (53%), Positives = 330/494 (67%), Gaps = 12/494 (2%)
 Frame = -1

Query  1771  SLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSP  1592
             +LP  +L +DI  + ++D   TT  S D+G + Q  PA V  PSS DDI  LVRF+Y SP
Sbjct  31    TLPLGLLDLDIVDKIQLDPNTTTQFSIDYGQLSQAAPAAVYCPSSPDDIAALVRFAYTSP  90

Query  1591  SPFSVAARGHGHSVRGQATAKDGVVVEMGALRGGGKIRVSWSESLG---YFADVGGHELW  1421
               F++AARG GHSVRGQA A  GVVV+M +L  G   R++ S       ++ D GG +LW
Sbjct  91    RYFTIAARGRGHSVRGQAFAPGGVVVDMASLGRGRADRINVSSDDAPPRWYVDAGGEQLW  150

Query  1420  VDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEF  1241
             +DVLH  L HG++P SWTDYLHLTVGGTLSNAGISGQ FR GPQISNV ELDVITGKG+ 
Sbjct  151   IDVLHETLKHGLTPRSWTDYLHLTVGGTLSNAGISGQAFRHGPQISNVYELDVITGKGDM  210

Query  1240  ITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLI  1061
             ITCS++ NS+LF+ VLGGLGQFGIITRARI LE AP RV+W+ ++Y +F  FTRDQE LI
Sbjct  211   ITCSREENSDLFYGVLGGLGQFGIITRARISLEPAPQRVRWLHLVYTNFDMFTRDQEMLI  270

Query  1060  SI--NGLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQT  887
             S    G +Y+EG L+      +   SSF S  D  K+  L  + G +Y LE   +Y+  T
Sbjct  271   SKLEKGFDYVEGRLLKGKDVSS---SSFISEEDSEKVKLLADEFGAIYLLEGAVYYEQAT  327

Query  886   GSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFV  707
              S V QE++ LLK LSFVPG  F KD SY  FL+RV  E+ +       +  HPW NLF+
Sbjct  328   ASMVYQEVESLLKQLSFVPGFAFTKDVSYIGFLDRVHEEDTKQSSTEHEDVLHPWFNLFL  387

Query  706   PKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIP-EEDTFYCVGLLYSG  530
             PKSRI DF SAVF+ IL  +   G +L+YP     WD+++SA IP EE+ FY +GLL S 
Sbjct  388   PKSRIRDFESAVFKGILKNNNPVGLVLIYPFNKNKWDDKISAAIPDEEEVFYTIGLLPSA  447

Query  529   GMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKF  350
                 W+ LD+ + EILSFC+   +EG + KQYLP Y +  DW KHFG+KW+ F + K ++
Sbjct  448   TRENWEYLDKQHHEILSFCH---QEGIEFKQYLPRYVTETDWRKHFGRKWHVFVQLKRQY  504

Query  349   DPKMILSPGQTIFN  308
             DPK +LSPGQ IF 
Sbjct  505   DPKALLSPGQRIFT  518



>ref|XP_010110013.1| Cytokinin dehydrogenase 5 [Morus notabilis]
 gb|EXC25031.1| Cytokinin dehydrogenase 5 [Morus notabilis]
Length=566

 Score =   513 bits (1321),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 257/508 (51%), Positives = 340/508 (67%), Gaps = 30/508 (6%)
 Frame = -1

Query  1765  PYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSP  1586
             P E+L + + G+  VD      AS+DFG + +  P  VL+P+S +D+  L+R +Y S   
Sbjct  42    PTELLRLGVDGQLSVDPADVETASSDFGLMTRAKPLAVLHPASAEDVARLIRAAYGSAPG  101

Query  1585  FSVAARGHGHSVRGQATAKDGVVVEMGALR------------GGGKIRVSWSESLGYFAD  1442
              +V+ARGHGHS+ GQA A +GVV++M + R               + +VS  E    + D
Sbjct  102   LTVSARGHGHSINGQAQATNGVVIKMSSSRERTAADQTSAAAAAARPQVSERE---MYVD  158

Query  1441  VGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDV  1262
             V G +LW+DVL A L HG++P SWTDYL+LTVGGTLSNAGISGQ F  GPQI+NV ELDV
Sbjct  159   VWGGDLWIDVLKATLEHGLAPKSWTDYLYLTVGGTLSNAGISGQTFNHGPQIANVQELDV  218

Query  1261  ITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFT  1082
             +TGKGE +TCS++ NSELF AVLGGLGQFGIITRARI LE AP RV+W+R+LY +FS FT
Sbjct  219   VTGKGELLTCSEEKNSELFHAVLGGLGQFGIITRARIALEPAPQRVRWIRVLYSNFSSFT  278

Query  1081  RDQEHLISINGL------NYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYC  920
             +DQE LIS++GL      +Y+EG ++++    NNWRSSFFS  +  K++S+    G+LYC
Sbjct  279   KDQEFLISLHGLPASQRFDYVEGFVIVDEGLINNWRSSFFSPRNPVKLSSINADGGVLYC  338

Query  919   LEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLW  740
             LE+ K+YD+ T  T+DQE++ LLK L F+P   F  D  Y +FL+RV   EL+ +  GLW
Sbjct  339   LEITKNYDESTAETIDQEVEGLLKKLDFIPTSVFTTDLPYVDFLDRVHKAELKLRSKGLW  398

Query  739   EATHPWLNLFVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDT  560
             +  HPW NLFVPKSRI DF+  VF++I L +KTSGP+L+YP     WD+R SAV P+ED 
Sbjct  399   DVPHPWFNLFVPKSRISDFDEGVFKSI-LGNKTSGPILIYPMNKDKWDQRSSAVTPDEDV  457

Query  559   FYCVGLLYSG-----GMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKH  395
             FY V LL S           + L   N++IL FC      G K KQYLPHY ++++W+ H
Sbjct  458   FYLVALLRSALDTADETQSLEYLMHQNRQILRFCAA---AGIKAKQYLPHYTTQQEWVDH  514

Query  394   FGKKWNTFQENKAKFDPKMILSPGQTIF  311
             FG KW  F + K +FDP+ IL+ GQ IF
Sbjct  515   FGDKWAQFHKRKMEFDPRHILATGQRIF  542



>ref|XP_010254676.1| PREDICTED: cytokinin dehydrogenase 5-like [Nelumbo nucifera]
Length=543

 Score =   512 bits (1318),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 264/509 (52%), Positives = 341/509 (67%), Gaps = 28/509 (6%)
 Frame = -1

Query  1765  PYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSP  1586
             P  +L +   G+  VD+      S DFG + Q  P  VL+P+S DDI  LVR +Y S   
Sbjct  26    PNGLLGLGFDGQLSVDAADVETVSLDFGRMTQVKPLAVLHPASADDIAGLVRTAYQSAQG  85

Query  1585  FSVAARGHGHSVRGQATAKDGVVVEMGA---------LRGGGKIRVSW---SESLGYFAD  1442
             F+V+ARGHGHS+ GQA A DGVV+ M +         L+G    R +     +    + D
Sbjct  86    FTVSARGHGHSINGQAHATDGVVIAMSSSTSKRNRISLQGNPAARPTLLLGDKPSCSYMD  145

Query  1441  VGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDV  1262
             V G ELW+DVL++ L +G++P SWTDYL+L+VGGTLSNAGISGQ F  GPQI+NV ELDV
Sbjct  146   VWGGELWIDVLNSTLEYGLAPRSWTDYLYLSVGGTLSNAGISGQAFNHGPQITNVYELDV  205

Query  1261  ITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFT  1082
             +TGKGE +TCS + NSELF AVLGGLGQFGIITRARI LE AP RV+W+R+LY +FS FT
Sbjct  206   VTGKGEVVTCSNEHNSELFHAVLGGLGQFGIITRARIALEPAPQRVRWIRVLYSNFSAFT  265

Query  1081  RDQEHLISING------LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASL-LTQQGLLY  923
             +DQE+LIS++G       +Y+EG ++++    NNWRSSFFS  +  KI+SL     G+LY
Sbjct  266   KDQEYLISLHGNPSTDRFDYVEGFVIVDEGLINNWRSSFFSPRNPVKISSLGAANGGVLY  325

Query  922   CLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGL  743
             CLEV K+YD+ T  TVDQE+  LLK L F+P   F  D  Y +FL+RV   EL+ +  GL
Sbjct  326   CLEVTKNYDESTADTVDQEVGALLKKLDFIPTTIFTTDIPYLDFLDRVHKAELKLRSKGL  385

Query  742   WEATHPWLNLFVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEED  563
             W+  HPWLNLFVPKSRI DF+  VF+ I L +KTSGP+L+YP     WD R S V P+ED
Sbjct  386   WDVPHPWLNLFVPKSRIADFDRGVFKGI-LGNKTSGPILIYPMNKNKWDHRSSVVTPDED  444

Query  562   TFYCVGLLYSGGMNG-----WKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMK  398
              FY VGLL S   +G      + L+  N++IL FCN   E G K+K YLP++ ++E+W  
Sbjct  445   IFYLVGLLRSALDSGEETQTMEYLNNQNRQILRFCN---EAGIKVKHYLPNHSTQEEWKA  501

Query  397   HFGKKWNTFQENKAKFDPKMILSPGQTIF  311
             HFG+KW+ F + K +FDPK IL+ GQ IF
Sbjct  502   HFGEKWDLFVKRKMEFDPKRILATGQRIF  530



>gb|KCW60467.1| hypothetical protein EUGRSUZ_H03190, partial [Eucalyptus grandis]
Length=462

 Score =   508 bits (1309),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 252/464 (54%), Positives = 334/464 (72%), Gaps = 14/464 (3%)
 Frame = -1

Query  1720  DSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPS-PFSVAARGHGHSVRG  1544
             D  + +AAS D+G IVQE PA VL PS ++DI  LV F YN  S PF+++ARG GHSVRG
Sbjct  4     DPESISAASVDYGFIVQEIPAAVLRPSCLEDITILVAFRYNESSIPFTISARGRGHSVRG  63

Query  1543  QATAKDGVVVEMGALRGGGK-IRVSWSESLGYFADVGGHELWVDVLHACLAHGVSPASWT  1367
             QA A+DGVVV+M +L   G    VS+S+SLG++ADVGGH++W +VL   L HG++P + T
Sbjct  64    QAMARDGVVVDMTSLGNKGHGTTVSYSQSLGHYADVGGHQIWFNVLEHTLKHGLAPVTLT  123

Query  1366  DYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDMNSELFFAVLGG  1187
             DY + TVGGTLSNAGI G+ FR GPQI+NV E+DVITG G+F+TCS   N +LF++VLGG
Sbjct  124   DYQYATVGGTLSNAGIGGEAFRNGPQITNVHEMDVITGTGDFLTCSPHKNPDLFYSVLGG  183

Query  1186  LGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISIN------GLNYLEGSL  1025
             LGQFGIITRARI L  AP R KWVRMLY DFS FT D E LIS +       L+++EG L
Sbjct  184   LGQFGIITRARIALRPAPKRAKWVRMLYSDFSAFTTDHERLISRHQRDQDEALDFVEGCL  243

Query  1024  MMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGSTVDQELKDLLKD  845
             +M H + ++W SS F LSD  ++ SLLT+  LLYC++  K+YD+QT STV+++L+ +LKD
Sbjct  244   LM-HRNMDSWISS-FPLSDHPRLMSLLTEHKLLYCIKAAKYYDEQTESTVEKDLEIILKD  301

Query  844   LSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKSRILDFNSAVFQ  665
             L+ VP   F+KD ++ +FLNR+R  EL+ +E GLW   HPWLNLFVPKS + D N+ +F+
Sbjct  302   LNHVPEFKFEKDVAFIDFLNRMRVAELQLREQGLWNIPHPWLNLFVPKSHMADINTGIFK  361

Query  664   NILLKHK-TSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSGGMNGWKVLDELNQE  488
             +I LK+  T+G +L+YP     WD+RMSAV P+ED FY V   ++ G   W+  +  N+E
Sbjct  362   DIALKNNITTGYVLIYPMNKNKWDDRMSAVTPDEDIFYTVEFFHASGFGDWQECELQNKE  421

Query  487   ILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKA  356
             +LSF   +   G K K+YLP+YR+  +WM+HFG KW TFQE+KA
Sbjct  422   MLSFLKVN---GIKFKRYLPNYRTEREWMEHFGPKWRTFQESKA  462



>ref|XP_007138721.1| hypothetical protein PHAVU_009G231800g [Phaseolus vulgaris]
 gb|ESW10715.1| hypothetical protein PHAVU_009G231800g [Phaseolus vulgaris]
Length=516

 Score =   510 bits (1313),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 253/483 (52%), Positives = 338/483 (70%), Gaps = 12/483 (2%)
 Frame = -1

Query  1744  DIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSPFSVAARG  1565
             +IA +   D +  + ASTD+G IVQ+TP  V  PSSV DI  L+ FS + P+PF++A RG
Sbjct  32    EIASKLSRDPQILSLASTDYGQIVQKTPLEVFEPSSVSDISALINFSNSLPTPFTIAPRG  91

Query  1564  HGHSVRGQATAKDGVVVEMGALRGGGKIRVSWSES---LGYFADVGGHELWVDVLHACLA  1394
               HS+ GQA   +GVV+ M  L G   I VS  +    L  +ADVGG  +W+DVLHA L 
Sbjct  92    KAHSILGQALTGNGVVLNMTNLNGS-LIFVSKCDGENPLNCYADVGGEVVWIDVLHATLE  150

Query  1393  HGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDMNS  1214
              G++P SWTDYL+LTVGGTLSNAGISGQ FR GPQISNVLELDV+TGKG+ ++CS++  S
Sbjct  151   RGLTPLSWTDYLYLTVGGTLSNAGISGQAFRFGPQISNVLELDVVTGKGDLVSCSREKES  210

Query  1213  ELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISINGLNYLE  1034
             ELF+ VLGGLGQFG+ITRARI+L  APTRVKW+ +LY++F+ F+ DQEHLIS    +Y+E
Sbjct  211   ELFYGVLGGLGQFGVITRARILLGPAPTRVKWLHLLYNNFTAFSSDQEHLISFTAADYVE  270

Query  1033  GSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGSTVDQELKDL  854
             G L++N    +    SF+  SD  +I SL+TQ G++Y +E+VK+YD+ + + V++++ DL
Sbjct  271   GMLLLNQPPLD---LSFYPDSDHQRITSLVTQNGIIYIIELVKYYDNNSNAFVEKDVADL  327

Query  853   LKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKSRILDFNSA  674
             +K L+FVP   F+KDASY +FLNRV  EEL  +  GLWE  HPWLN+++P+SRI DFN  
Sbjct  328   VKGLNFVPTFIFEKDASYEDFLNRVLAEELFLRSKGLWEVPHPWLNIWIPRSRISDFNEG  387

Query  673   VFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLL-YSGGMNGWKVLDE  500
             VF+NI+L    +SG  L+YP     WD++MS V PEED FY V LL  +   +  K L +
Sbjct  388   VFKNIILAQNLSSGIALIYPMNRNKWDDKMSPVTPEEDVFYAVSLLRATSSRDMVKKLQD  447

Query  499   LNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFDPKMILSPGQ  320
              NQ+IL FC    + G +I +YL   ++++ WM+HFG KW  F + K +FDPK ILSPGQ
Sbjct  448   QNQQILQFCK---DAGIQITEYLTGNKTQQQWMEHFGSKWELFADRKDQFDPKRILSPGQ  504

Query  319   TIF  311
              IF
Sbjct  505   GIF  507



>ref|NP_001274957.1| cytokinin oxidase/dehydrogenase precursor [Solanum tuberosum]
 gb|ACP40988.1| cytokinin oxidase/dehydrogenase [Solanum tuberosum]
Length=526

 Score =   509 bits (1311),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 257/476 (54%), Positives = 334/476 (70%), Gaps = 17/476 (4%)
 Frame = -1

Query  1702  AASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSPFSVAARGHGHSVRGQATAKDG  1523
             +AS DFGG+ +  P  VL+P++ +D+  LV+ +Y+S   F+V+ARGHGHS+ GQA   +G
Sbjct  45    SASVDFGGVYKAEPMAVLHPATSEDVARLVKAAYDSARGFTVSARGHGHSINGQAMTTNG  104

Query  1522  VVVEMGALRGGGKIRVSWSESLGYFADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVG  1343
             VVV+M    G     ++ SE   Y ADV G ELW+DVL + L +G++P SWTDYL+LTVG
Sbjct  105   VVVQMSGGGGSKNKMLTISEKFMY-ADVWGGELWIDVLTSTLEYGLAPKSWTDYLYLTVG  163

Query  1342  GTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDMNSELFFAVLGGLGQFGIIT  1163
             GTLSNAGISGQ F  GPQISNV ELDV+TGKGE +TCS+  NSELF AVLGGLGQFGIIT
Sbjct  164   GTLSNAGISGQAFNHGPQISNVHELDVVTGKGELLTCSEKENSELFQAVLGGLGQFGIIT  223

Query  1162  RARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISING------LNYLEGSLMMNHTSPN  1001
             RARI LE+AP RV+W+R+LY +FS FT+DQE+LIS++G       +Y+EG ++++    N
Sbjct  224   RARIALEQAPQRVRWIRVLYSNFSTFTQDQEYLISLHGKPASQKFDYVEGFVIVDEGLIN  283

Query  1000  NWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMT  821
             NWRSSFFS S+  KI+SL  + G+LYCLE+ K+Y      T+DQE++ LLK L+++P   
Sbjct  284   NWRSSFFSPSNPVKISSLKAEGGVLYCLEITKNYHLSNADTIDQEIEILLKKLNYIPASE  343

Query  820   FKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKSRILDFNSAVFQNILLKHKT  641
             F  D  Y +FL+RV   EL+ +  GLWE  HPWLNLFVPKSRI +F+  VF+ I L +KT
Sbjct  344   FTTDLPYVDFLDRVHKAELKLRSKGLWEVPHPWLNLFVPKSRIAEFDKGVFKGI-LGNKT  402

Query  640   SGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSGGMNG--WKVLDEL---NQEILSF  476
             SGP+L+YP     WD+R S V PEED FY V  L S   NG   + LD L   N EIL F
Sbjct  403   SGPILIYPMNKNKWDDRSSVVTPEEDVFYLVAFLRSALENGDETQTLDYLSNQNYEILKF  462

Query  475   CNKDDEEGSKIKQYLPHYRSREDWMKHFGKK-WNTFQENKAKFDPKMILSPGQTIF  311
             C   ++E   +KQYLPHY ++ +W  HFG+K W  FQ+ K +FDP+ IL+ GQ IF
Sbjct  463   C---EDEKINVKQYLPHYDNQREWRDHFGEKYWTRFQQRKLEFDPRHILATGQKIF  515



>ref|XP_008804537.1| PREDICTED: cytokinin dehydrogenase 5-like [Phoenix dactylifera]
Length=538

 Score =   509 bits (1311),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 259/498 (52%), Positives = 335/498 (67%), Gaps = 18/498 (4%)
 Frame = -1

Query  1765  PYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSP  1586
             P E+L   + G+  ++      AS DFGG+ +  P  V+ P+S  D+ +LVR +Y S   
Sbjct  25    PAELLQFGVEGQLSLEPADVDRASVDFGGMTRAEPMAVMRPASAGDVASLVRVAYGSALG  84

Query  1585  FSVAARGHGHSVRGQATAKDGVVVEMGALRGGG---KIRVSWSESLG-YFADVGGHELWV  1418
             F V+ARGHGHS+ GQA A  GVV+EM   R  G   + R  +S SLG Y+ DV G ELW+
Sbjct  85    FPVSARGHGHSINGQARAPGGVVIEMSHDRAAGHRPRSRPVYSPSLGEYYVDVWGGELWI  144

Query  1417  DVLHACLAHG-VSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEF  1241
             DVL+  L +G  +P SWTDYL+L+VGGTLSNAGISGQ F  GPQ+SNV E DV+TGKGE 
Sbjct  145   DVLNWTLDNGGRAPKSWTDYLYLSVGGTLSNAGISGQTFHHGPQLSNVYEFDVVTGKGEI  204

Query  1240  ITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLI  1061
             +TCS++ NSELF  VLGGLGQFGIITRARI LE AP RV+W+R+LY +F+ FTRDQE LI
Sbjct  205   VTCSEEQNSELFHGVLGGLGQFGIITRARIALEPAPQRVRWIRVLYSNFTTFTRDQELLI  264

Query  1060  SING---LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQ  890
             S++G    +Y+EG ++++    NNWRSSFFS  +   I+S+    G+LYCLE+ K+YDD 
Sbjct  265   SLHGTHRFDYVEGFVIVDEGLINNWRSSFFSPRNSVNISSIGANGGVLYCLEMTKNYDDS  324

Query  889   TGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLF  710
             T + VDQE++ LLK L F+P   F  D  Y +FL+RV   EL+ +  GLW+  HPWLNLF
Sbjct  325   TAAFVDQEVEALLKRLEFIPASVFTTDLPYVDFLDRVHKAELKLRAKGLWDVPHPWLNLF  384

Query  709   VPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSG  530
             VP SRI DF+  VF+ I L +KTSGP+L+YP     WDER SAV P+E+ FY VG L S 
Sbjct  385   VPASRIADFDRGVFRGI-LGNKTSGPILIYPMNKHKWDERSSAVTPDEEVFYLVGFLRSA  443

Query  529   ------GMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQ  368
                        + L + N+ IL+FC   D  G ++KQYLPH+ +R +W +HFG KW+ F 
Sbjct  444   LPDSGESTQSLEYLSQQNERILAFC---DAAGIEVKQYLPHHLTRAEWARHFGAKWDRFI  500

Query  367   ENKAKFDPKMILSPGQTI  314
               KA+FDPK IL  GQ I
Sbjct  501   RLKAEFDPKGILGSGQGI  518



>ref|XP_003595179.1| Cytokinin dehydrogenase [Medicago truncatula]
Length=530

 Score =   509 bits (1310),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 256/500 (51%), Positives = 340/500 (68%), Gaps = 28/500 (6%)
 Frame = -1

Query  1744  DIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSPFSVAARG  1565
             D+A +   + +  + ASTD+G I+ E P  VL P+S+ DI NL+ +S + P  F+++ RG
Sbjct  36    DLALKLSRNPQILSQASTDYGHIIHENPFAVLEPTSISDIANLINYSNSLPHSFTISPRG  95

Query  1564  HGHSVRGQATAKDGVVVEMGAL---RGGGKIRVS---WSESLGYFADVGGHELWVDVLHA  1403
               HSV GQA  ++G+VV M  L   R G  I VS       LG + DVGG +LW+DVL+A
Sbjct  96    QAHSVLGQAMTQNGIVVNMTQLNWYRNGSGIVVSDCDVKNPLGCYVDVGGEQLWIDVLNA  155

Query  1402  CLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITG--------KG  1247
              L HG++P SWTDYL+L+VGGTLSNAGI GQ FR GPQISNVLELDVITG        +G
Sbjct  156   TLKHGLTPLSWTDYLYLSVGGTLSNAGIGGQTFRFGPQISNVLELDVITGLEAERRRGQG  215

Query  1246  EFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEH  1067
               +TCS++ NSE+F+AVLGGLGQFG+ITRARI+L  APTRVKW+R++Y+DFS F+ DQEH
Sbjct  216   NIVTCSQEKNSEVFYAVLGGLGQFGVITRARILLGPAPTRVKWLRLIYNDFSAFSTDQEH  275

Query  1066  LISI------NGLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVK  905
             LIS       NG +Y+EG L++N         SF+  SD  +I SL+TQ G+ Y LE+VK
Sbjct  276   LISFDRRNDSNGADYVEGMLLLNKPP---LILSFYPPSDHPRITSLVTQYGITYVLELVK  332

Query  904   HYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHP  725
             +YD  + + + +E+ +L+K L FVP   F+KD +Y EFL+RV  EEL  +  GLW+  HP
Sbjct  333   YYDTNSQANITEEVDNLVKGLKFVPTFMFQKDVTYEEFLDRVHSEELILRSKGLWDVPHP  392

Query  724   WLNLFVPKSRILDFNSAVFQNILLKHKTS-GPMLVYPTTTKMWDERMSAVIPEEDTFYCV  548
             WLN+F+PKSRI DFN  VF+ I+LK   S G +LVYP     WD+RMSA+ P+ED FY +
Sbjct  393   WLNMFIPKSRISDFNEGVFKGIILKQNISAGIVLVYPMNRNKWDDRMSAITPDEDVFYTL  452

Query  547   GLLYSGG-MNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTF  371
              LL++   M+  K     N +IL FCN   + G K+K+YL   ++ ++W++HFG KW  F
Sbjct  453   ALLHAAKEMDEVKTFQAQNHQILQFCN---DAGIKVKEYLSGNKTHQEWVEHFGAKWQQF  509

Query  370   QENKAKFDPKMILSPGQTIF  311
             +E KAKFDPK ILSPGQ IF
Sbjct  510   EERKAKFDPKRILSPGQGIF  529



>ref|NP_194703.1| cytokinin dehydrogenase 4 [Arabidopsis thaliana]
 sp|Q9FUJ2.2|CKX4_ARATH RecName: Full=Cytokinin dehydrogenase 4; AltName: Full=Cytokinin 
oxidase 4; Short=AtCKX4; Short=CKO 4; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAB45334.1| cytokinin oxidase-like protein [Arabidopsis thaliana]
 emb|CAB79732.1| cytokinin oxidase-like protein [Arabidopsis thaliana]
 gb|AAK96652.1| cytokinin oxidase-like protein [Arabidopsis thaliana]
 gb|AAN15498.1| cytokinin oxidase-like protein [Arabidopsis thaliana]
 gb|AEE85669.1| cytokinin dehydrogenase 4 [Arabidopsis thaliana]
Length=524

 Score =   508 bits (1309),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 264/486 (54%), Positives = 323/486 (66%), Gaps = 21/486 (4%)
 Frame = -1

Query  1720  DSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRF-----SYN----SP-SPFSVAA  1571
             D  + +AAS DFG I  E P  VL PSS  ++  L+RF     SYN    SP S F VAA
Sbjct  45    DPFSISAASHDFGNITDENPGAVLCPSSTTEVARLLRFANGGFSYNKGSTSPASTFKVAA  104

Query  1570  RGHGHSVRGQATAKDGVVVEMGALRGGGKIRVSWSESLGYFADVGGHELWVDVLHACLAH  1391
             RG GHS+RGQA+A  GVVV M  L    K       + G +ADV    +WVDVL A +  
Sbjct  105   RGQGHSLRGQASAPGGVVVNMTCLAMAAKPAAVVISADGTYADVAAGTMWVDVLKAAVDR  164

Query  1390  GVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDMNSE  1211
             GVSP +WTDYL+L+VGGTLSNAGI GQ FR GPQISNV ELDVITGKGE +TCS  +N E
Sbjct  165   GVSPVTWTDYLYLSVGGTLSNAGIGGQTFRHGPQISNVHELDVITGKGEMMTCSPKLNPE  224

Query  1210  LFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISIN---GLNY  1040
             LF+ VLGGLGQFGIITRARI L+ APTRVKW R+LY DFS F RDQE LIS+    G+++
Sbjct  225   LFYGVLGGLGQFGIITRARIALDHAPTRVKWSRILYSDFSAFKRDQERLISMTNDLGVDF  284

Query  1039  LEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGSTVDQELK  860
             LEG LMM++   +   +SFF LSDQ+++ASL+    ++Y LEV K+YD  T   +DQ + 
Sbjct  285   LEGQLMMSNGFVD---TSFFPLSDQTRVASLVNDHRIIYVLEVAKYYDRTTLPIIDQVID  341

Query  859   DLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKSRILDFN  680
              L + L F PG  F +D  YF+FLNRVR EE + +  GLWE  HPWLN+FVP SRI DF+
Sbjct  342   TLSRTLGFAPGFMFVQDVPYFDFLNRVRNEEDKLRSLGLWEVPHPWLNIFVPGSRIQDFH  401

Query  679   SAVFQNILLKH-KTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYS-GGMNGWKVL  506
               V   +LL    TSG  L YPT    W+ RMS + P+ED FY +GLL S GG   W+ L
Sbjct  402   DGVINGLLLNQTSTSGVTLFYPTNRNKWNNRMSTMTPDEDVFYVIGLLQSAGGSQNWQEL  461

Query  505   DELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFDPKMILSP  326
             + LN +++ FC   +  G KIK+YL HY  +EDW+KHFG KW+ F   K  FDPK +LSP
Sbjct  462   ENLNDKVIQFC---ENSGIKIKEYLMHYTRKEDWVKHFGPKWDDFLRKKIMFDPKRLLSP  518

Query  325   GQTIFN  308
             GQ IFN
Sbjct  519   GQDIFN  524



>ref|XP_011083611.1| PREDICTED: LOW QUALITY PROTEIN: cytokinin dehydrogenase 5 [Sesamum 
indicum]
Length=521

 Score =   508 bits (1308),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 250/494 (51%), Positives = 334/494 (68%), Gaps = 16/494 (3%)
 Frame = -1

Query  1765  PYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSP  1586
             P E+L +++ G+  +D     +AS DFGG+    P  VL+P+S  D+  LV+ +Y S   
Sbjct  24    PTELLRLELEGQLSLDPADVGSASRDFGGMQTAHPMAVLHPASSQDVARLVKSAYESAHG  83

Query  1585  FSVAARGHGHSVRGQATAKDGVVVEMGALRGGGKIRVSWSESLGYFADVGGHELWVDVLH  1406
             F ++ARGHGHS+ GQA   +G +   G+       RVS       + DV G ELW+DVL 
Sbjct  84    FGISARGHGHSINGQAMTGNGXIQMSGSRGKPAPPRVS---EKSMYVDVWGGELWIDVLR  140

Query  1405  ACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSK  1226
             + L +G++P SWTDYL+L+VGGTL+NAGISGQ F  GPQISNV ELDV+TGKGE +TCSK
Sbjct  141   STLEYGLAPKSWTDYLYLSVGGTLANAGISGQAFNHGPQISNVYELDVVTGKGELLTCSK  200

Query  1225  DMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISING-  1049
             + NSEL+ AVLGGLGQFGIITRARI LE+AP RV+W+R+LY +F+ FT+DQE+LIS++G 
Sbjct  201   EQNSELYDAVLGGLGQFGIITRARIALERAPRRVRWIRVLYSNFTAFTQDQEYLISLHGQ  260

Query  1048  ---LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGST  878
                 +Y+EG ++++    NNWRSSFFS  +  KI+SL    G+LYCLE+ K+Y +    T
Sbjct  261   PQKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKISSLNADGGVLYCLEITKNYQESNADT  320

Query  877   VDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKS  698
             +DQE++ LLK L+F+P   F  D  Y +FL+RV   EL+ +   LW+  HPWLNLFVPKS
Sbjct  321   IDQEVEALLKKLNFIPASVFTTDLPYVDFLDRVHKAELKLRAKNLWDVPHPWLNLFVPKS  380

Query  697   RILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSGGMN-  521
             RI DF+  VF+ I L + TSGP+L+YP     WD++ S V P ED FY V LL S   N 
Sbjct  381   RIADFDKGVFKGI-LGNNTSGPILIYPMNKNKWDDKSSVVTPNEDVFYLVALLRSALDNG  439

Query  520   ----GWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAK  353
                 G + L   N+ IL FC   DE G  +KQYLPHY ++++WM+HFG+KW+ F   K +
Sbjct  440   DETQGLEYLSNQNRGILQFC---DEAGINVKQYLPHYSTQQEWMRHFGEKWSLFSRRKME  496

Query  352   FDPKMILSPGQTIF  311
             FDP+ IL+ GQ IF
Sbjct  497   FDPRHILATGQRIF  510



>gb|KFK29530.1| hypothetical protein AALP_AA7G146300 [Arabis alpina]
Length=522

 Score =   508 bits (1308),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 262/486 (54%), Positives = 330/486 (68%), Gaps = 21/486 (4%)
 Frame = -1

Query  1720  DSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRF-----SY----NSPSP-FSVAA  1571
             D  + +AAS DFG I  E P  VL PSS  ++  L+RF     SY    N PSP F VAA
Sbjct  43    DPSSISAASRDFGNITDENPGAVLCPSSAAEVARLLRFASGGFSYRRGSNDPSPGFKVAA  102

Query  1570  RGHGHSVRGQATAKDGVVVEMGALRGGGKIRVSWSESLGYFADVGGHELWVDVLHACLAH  1391
             RG GHS+RGQA+A  G+VV M  L    K       +   +ADV    +WV+VL A +  
Sbjct  103   RGQGHSLRGQASAPGGIVVNMTCLAKAAKPAAVVVSADRTYADVAAGTMWVEVLEAAVER  162

Query  1390  GVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDMNSE  1211
              VSP +WTDYL+L+VGGTLSNAGI GQ FR GPQISNV ELDVITGKGE +TCS ++N E
Sbjct  163   EVSPVTWTDYLYLSVGGTLSNAGIGGQTFRHGPQISNVHELDVITGKGEMMTCSPNLNPE  222

Query  1210  LFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISIN---GLNY  1040
             LF+ VLGGLGQFGIITRARI L+ APTRVKW+R+LY DFS FTRDQE L+S+    G+++
Sbjct  223   LFYGVLGGLGQFGIITRARIALDHAPTRVKWLRILYSDFSAFTRDQERLVSMANDLGVDF  282

Query  1039  LEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGSTVDQELK  860
             LEG LMM++   +   +SFF LSD++++ASL+    ++Y LEV K+YD  T   +D+ + 
Sbjct  283   LEGQLMMSNGFVD---TSFFPLSDRTRVASLVNDHRIIYVLEVAKYYDTTTLPIIDKVID  339

Query  859   DLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKSRILDFN  680
              L + L FVPG  F +D  YF+FLNRVR EE +    GLWE  HPWLN+FVP+SRILDF+
Sbjct  340   ILTRTLGFVPGFMFMQDVPYFDFLNRVRIEEEKLSSLGLWEVPHPWLNMFVPRSRILDFH  399

Query  679   SAVFQNILL-KHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYS-GGMNGWKVL  506
             + V + +LL +  TSG  L YPT    W+  MSA+IPEED FY +G L S GG   W+ L
Sbjct  400   NGVIKGLLLNRTSTSGVTLFYPTNRHKWNNLMSAMIPEEDVFYVIGFLQSAGGSQNWQEL  459

Query  505   DELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFDPKMILSP  326
             + +N +I+ FC   D+ G KIK+YL HY  +EDW+KHFG KW+ F   K  FDPK +LSP
Sbjct  460   ENVNDKIIQFC---DDSGIKIKEYLMHYTRKEDWIKHFGAKWDDFLRKKIMFDPKKLLSP  516

Query  325   GQTIFN  308
             GQ IFN
Sbjct  517   GQDIFN  522



>gb|AAG30907.1|AF303980_1 cytokinin oxidase [Arabidopsis thaliana]
Length=524

 Score =   508 bits (1307),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 264/486 (54%), Positives = 323/486 (66%), Gaps = 21/486 (4%)
 Frame = -1

Query  1720  DSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRF-----SYN----SP-SPFSVAA  1571
             D  + +AAS DFG I  E P  VL PSS  ++  L+RF     SYN    SP S F VAA
Sbjct  45    DPFSISAASHDFGNITDENPGAVLCPSSTTEVARLLRFANGGFSYNKGSTSPASTFKVAA  104

Query  1570  RGHGHSVRGQATAKDGVVVEMGALRGGGKIRVSWSESLGYFADVGGHELWVDVLHACLAH  1391
             RG GHS+RGQA+A  GVVV M  L    K       + G +ADV    +WVDVL A +  
Sbjct  105   RGQGHSLRGQASAPGGVVVNMTCLAMAAKPAAVVISADGTYADVAAGTMWVDVLKAAVDR  164

Query  1390  GVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDMNSE  1211
             GVSP +WTDYL+L+VGGTLSNAGI GQ FR GPQISNV ELDVITGKGE +TCS  +N E
Sbjct  165   GVSPVTWTDYLYLSVGGTLSNAGIGGQTFRHGPQISNVHELDVITGKGEMMTCSPKLNPE  224

Query  1210  LFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISIN---GLNY  1040
             LF+ VLGGLGQFGIITRARI L+ APTRVKW R+LY DFS F RDQE LIS+    G+++
Sbjct  225   LFYGVLGGLGQFGIITRARIALDHAPTRVKWSRILYSDFSAFKRDQERLISMTNDLGVDF  284

Query  1039  LEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGSTVDQELK  860
             LEG LMM++   +   +SFF LSDQ+++ASL+    ++Y LEV K+YD  T   +DQ + 
Sbjct  285   LEGQLMMSNGFVD---TSFFPLSDQTRVASLVNDHRIIYVLEVAKYYDRTTLPIIDQVID  341

Query  859   DLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKSRILDFN  680
              L + L F PG  F +D  YF+FLNRVR EE + +  GLWE  HPWLN+FVP SRI DF+
Sbjct  342   TLSRTLGFAPGFMFVQDVPYFDFLNRVRNEEDKLRSLGLWEVPHPWLNIFVPGSRIQDFH  401

Query  679   SAVFQNILLKH-KTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYS-GGMNGWKVL  506
               V   +LL    TSG  L YPT    W+ RMS + P+ED FY +GLL S GG   W+ L
Sbjct  402   DGVINGLLLNQTSTSGVTLFYPTNRNKWNNRMSTMTPDEDVFYVIGLLQSAGGSQNWQEL  461

Query  505   DELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFDPKMILSP  326
             + LN +++ FC   +  G KIK+YL HY  +EDW+KHFG KW+ F   K  FDPK +LSP
Sbjct  462   ENLNDKVIQFC---ENSGIKIKEYLMHYTRKEDWVKHFGPKWDDFLRKKIMFDPKRLLSP  518

Query  325   GQTIFN  308
             GQ IFN
Sbjct  519   GQDIFN  524



>gb|KEH32514.1| cytokinin oxidase/dehydrogenase-like protein [Medicago truncatula]
Length=518

 Score =   508 bits (1307),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 258/508 (51%), Positives = 340/508 (67%), Gaps = 27/508 (5%)
 Frame = -1

Query  1795  GKLKPWNS-SLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIIN  1619
              +L+PW+    P EIL +        D    + ASTDFG I+ + P  +  PSS++DI  
Sbjct  26    AQLQPWSPLDAPKEILQM-----LSRDPVTISLASTDFGHIIHQNPFAIFAPSSINDISK  80

Query  1618  LVRFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEM----GALRGGGKIRVSWSESLGY  1451
             L++FS + P PF++AARG GHSV GQ+   DG+VV M      LR  G   V + +    
Sbjct  81    LIKFSNSLPIPFTIAARGQGHSVNGQSMTNDGIVVNMTELNNELRNNGNGIVVFDK----  136

Query  1450  FADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLE  1271
             + DVGG + W+DVLHA L  G++P SWTDYL+L+VGGTLSNAGISGQ FR GPQISNV E
Sbjct  137   YVDVGGGQRWIDVLHASLEKGLTPLSWTDYLYLSVGGTLSNAGISGQTFRFGPQISNVHE  196

Query  1270  LDVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFS  1091
             LDV+TGKG+ +TCS + NSELF+AVLGGLGQFGIITRARI L  AP RVKW+R+LY+DFS
Sbjct  197   LDVVTGKGDLVTCSTEKNSELFYAVLGGLGQFGIITRARIALGPAPKRVKWLRLLYNDFS  256

Query  1090  KFTRDQEHLISINGL------NYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGL  929
              F+ DQEHLIS+NG+      NY+EG L++N    +    SFF   DQ +I SL+TQ G+
Sbjct  257   AFSGDQEHLISLNGIDETNAPNYVEGFLLLNQPPLD---LSFFPEIDQPRITSLVTQYGI  313

Query  928   LYCLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQEN  749
             +Y +E+ K+YD+ +   VDQE++ LL+ L FVP   F+KD SY EFL+RV  +EL  +  
Sbjct  314   IYIVELAKYYDENSQDHVDQEIEILLQGLKFVPTFKFEKDVSYEEFLDRVHTDELTLRAQ  373

Query  748   GLWEATHPWLNLFVPKSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIP  572
             GLW   HPWL+LFVP SR+ +FN  V + I+LK   T+G ++VYP     WD++MSAV P
Sbjct  374   GLWNIPHPWLDLFVPGSRMSEFNEGVLKGIILKQNITAGLVIVYPMNRTKWDDKMSAVTP  433

Query  571   EEDTFYCVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHF  392
              E+ FY V  L + G +  +     NQ+IL FC    + G +IK YLP  R+ E+W++ +
Sbjct  434   NEEIFYVVDFLRATGFDNLEAYKSQNQQILQFCK---DVGIEIKHYLPLNRTHEEWVEQY  490

Query  391   GKKWNTFQENKAKFDPKMILSPGQTIFN  308
             G KWN F++ K +FDP  ILSPGQ IFN
Sbjct  491   GLKWNAFEKRKNQFDPNKILSPGQGIFN  518



>ref|NP_001266251.1| cytokinin oxidase/dehydrogenase-like precursor [Solanum lycopersicum]
 dbj|BAM09006.1| cytokinin oxidase/dehydrogenase-like [Solanum lycopersicum]
Length=524

 Score =   508 bits (1307),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 256/497 (52%), Positives = 341/497 (69%), Gaps = 19/497 (4%)
 Frame = -1

Query  1765  PYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSP  1586
             P ++L + + G+         +AS DFGG+ +  P  VL+P++ +D+  LV+ +Y+S   
Sbjct  24    PNDLLRLGLDGKLSAAPADLQSASVDFGGVYRAEPMAVLHPATSEDVARLVKAAYDSARG  83

Query  1585  FSVAARGHGHSVRGQATAKDGVVVEMGALRGGGKIRVSWSESLGYFADVGGHELWVDVLH  1406
             F+V+ARGHGHS+ GQA  ++GVVV+M    GG K ++        +ADV G ELW+DVL 
Sbjct  84    FTVSARGHGHSINGQAMTRNGVVVQMS---GGLKNKMLTVSEKFMYADVWGGELWIDVLT  140

Query  1405  ACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSK  1226
             + L +G++P SWTDYL+LTVGGTLSNAGISGQ F  GPQISNV ELDV+TGKGE +TCS+
Sbjct  141   STLEYGLAPKSWTDYLYLTVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGELLTCSE  200

Query  1225  DMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISING-  1049
               NSELF AVLGGLGQFGIITRARI LE+AP RV+W+R+LY +FS FT DQE+LIS++G 
Sbjct  201   KENSELFQAVLGGLGQFGIITRARIALEQAPQRVRWIRVLYSNFSTFTHDQEYLISLHGK  260

Query  1048  -----LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTG  884
                   +Y+EG ++++    NNWRSS FS S+  K++SL  + G+LYCLE+ K+Y     
Sbjct  261   PSSQKFDYVEGFVIVDEGLINNWRSSIFSPSNPVKVSSLKAEGGVLYCLEITKNYHLTNA  320

Query  883   STVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVP  704
              T+DQE++ LLK L+++P   F  D  Y +FL+RV   EL+ +  GLWE  HPWLNLFVP
Sbjct  321   DTIDQEIEILLKKLNYIPASEFTTDLPYVDFLDRVHKAELKLRSKGLWEVPHPWLNLFVP  380

Query  703   KSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSGGM  524
             KSRI +F+  VF+ I L +KTSGP+L+YP     WD+R S V PEED FY V  L S   
Sbjct  381   KSRIAEFDKGVFKGI-LGNKTSGPILIYPMNKNKWDDRSSVVTPEEDVFYLVAFLRSALE  439

Query  523   NG--WKVLDEL---NQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKK-WNTFQEN  362
             +G   + LD L   N EIL FC   ++E   +KQYLPHY ++ +W  HFG+K W  FQ+ 
Sbjct  440   SGDETQTLDYLSNQNNEILKFC---EDESINVKQYLPHYDNQREWRDHFGEKYWTRFQQR  496

Query  361   KAKFDPKMILSPGQTIF  311
             K +FDP+ IL+ GQ IF
Sbjct  497   KLEFDPRHILATGQRIF  513



>ref|XP_006294012.1| hypothetical protein CARUB_v10023000mg [Capsella rubella]
 gb|EOA26910.1| hypothetical protein CARUB_v10023000mg [Capsella rubella]
Length=524

 Score =   507 bits (1305),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 265/497 (53%), Positives = 326/497 (66%), Gaps = 21/497 (4%)
 Frame = -1

Query  1753  LSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRF-----SYN---  1598
             L + +    R D  + +AAS DFG I  E P  VL PSS  ++  L+RF     SYN   
Sbjct  34    LPISLNLTVRTDPFSISAASHDFGNITDENPGAVLCPSSPTEVSRLIRFANGGFSYNGVL  93

Query  1597  -SPSP-FSVAARGHGHSVRGQATAKDGVVVEMGALRGGGKIRVSWSESLGYFADVGGHEL  1424
              SP+P F VAARG GHS+RGQA+A  GVVV M  L    K       + G +ADV    +
Sbjct  94    TSPAPTFKVAARGQGHSLRGQASAPGGVVVNMTCLAMAAKPAAVVISADGTYADVAAGTM  153

Query  1423  WVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGE  1244
             WVDVL A L  GVSP +WTDYL+L+VGGTLSNAGI GQ FR GPQISNV ELDVITGKGE
Sbjct  154   WVDVLKAALERGVSPVTWTDYLYLSVGGTLSNAGIGGQTFRHGPQISNVHELDVITGKGE  213

Query  1243  FITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHL  1064
              +TCS  +N ELF+ VLGGLGQFGIITRARI L  APTRVKW R+LY DFS F RDQE L
Sbjct  214   MMTCSLKLNPELFYGVLGGLGQFGIITRARIALGHAPTRVKWSRILYSDFSAFKRDQERL  273

Query  1063  ISIN---GLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDD  893
             IS+    G+++LEG LMM++   +   +SFF LSDQ+++ASL+    ++Y LEV K+YD 
Sbjct  274   ISMTKDLGVDFLEGQLMMSNGIVD---TSFFPLSDQTRVASLVNDHRIIYVLEVAKYYDS  330

Query  892   QTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNL  713
              T   +DQ +  L + L F PG+ F +D  YF+FLNRVR EE + +  GLWE  HPWLN+
Sbjct  331   TTLPIIDQVMDMLSRSLGFAPGLMFVQDVPYFDFLNRVRTEEEKLRSLGLWEVPHPWLNI  390

Query  712   FVPKSRILDFNSAVFQNILLKH-KTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLY  536
             FVP SRI DF+  V   +LL    T+G  L YPT    W+  MS + P+ED FY +G+L 
Sbjct  391   FVPGSRIQDFHDGVINGLLLNQTSTAGVTLFYPTNRNKWNNGMSTMSPDEDVFYVIGILQ  450

Query  535   S-GGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENK  359
             S GG   W+ L+ LN +I+ FC   +  G KIK+YL HY  +EDW+KHFG KW  F   K
Sbjct  451   SAGGSQNWQELENLNDKIIQFC---ENSGIKIKEYLMHYTRKEDWIKHFGPKWGDFVRRK  507

Query  358   AKFDPKMILSPGQTIFN  308
               FDPK +LSPGQ IFN
Sbjct  508   IMFDPKRLLSPGQDIFN  524



>gb|ABN08744.1| FAD linked oxidase, N-terminal [Medicago truncatula]
Length=535

 Score =   507 bits (1305),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 256/505 (51%), Positives = 340/505 (67%), Gaps = 33/505 (7%)
 Frame = -1

Query  1744  DIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSPFSVAARG  1565
             D+A +   + +  + ASTD+G I+ E P  VL P+S+ DI NL+ +S + P  F+++ RG
Sbjct  36    DLALKLSRNPQILSQASTDYGHIIHENPFAVLEPTSISDIANLINYSNSLPHSFTISPRG  95

Query  1564  HGHSVRGQATAKDGVVVEMGAL---RGGGKIRVS---WSESLGYFADVGGHELWVDVLHA  1403
               HSV GQA  ++G+VV M  L   R G  I VS       LG + DVGG +LW+DVL+A
Sbjct  96    QAHSVLGQAMTQNGIVVNMTQLNWYRNGSGIVVSDCDVKNPLGCYVDVGGEQLWIDVLNA  155

Query  1402  CLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKD  1223
              L HG++P SWTDYL+L+VGGTLSNAGI GQ FR GPQISNVLELDVITG+G  +TCS++
Sbjct  156   TLKHGLTPLSWTDYLYLSVGGTLSNAGIGGQTFRFGPQISNVLELDVITGQGNIVTCSQE  215

Query  1222  MNSELFFAVLGGLGQFGIITRARIVLEKAPTR-------------VKWVRMLYDDFSKFT  1082
              NSE+F+AVLGGLGQFG+ITRARI+L  APTR             VKW+R++Y+DFS F+
Sbjct  216   KNSEVFYAVLGGLGQFGVITRARILLGPAPTRASIIISFSFTHMYVKWLRLIYNDFSAFS  275

Query  1081  RDQEHLISI------NGLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYC  920
              DQEHLIS       NG +Y+EG L++N         SF+  SD  +I SL+TQ G+ Y 
Sbjct  276   TDQEHLISFDRRNDSNGADYVEGMLLLNKPP---LILSFYPPSDHPRITSLVTQYGITYV  332

Query  919   LEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLW  740
             LE+VK+YD  + + + +E+ +L+K L FVP   F+KD +Y EFL+RV  EEL  +  GLW
Sbjct  333   LELVKYYDTNSQANITEEVDNLVKGLKFVPTFMFQKDVTYEEFLDRVHSEELILRSKGLW  392

Query  739   EATHPWLNLFVPKSRILDFNSAVFQNILLKHKTS-GPMLVYPTTTKMWDERMSAVIPEED  563
             +  HPWLN+F+PKSRI DFN  VF+ I+LK   S G +LVYP     WD+RMSA+ P+ED
Sbjct  393   DVPHPWLNMFIPKSRISDFNEGVFKGIILKQNISAGIVLVYPMNRNKWDDRMSAITPDED  452

Query  562   TFYCVGLLYSGG-MNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGK  386
              FY + LL++   M+  K     N +IL FCN   + G K+K+YL   ++ ++W++HFG 
Sbjct  453   VFYTLALLHAAKEMDEVKTFQAQNHQILQFCN---DAGIKVKEYLSGNKTHQEWVEHFGA  509

Query  385   KWNTFQENKAKFDPKMILSPGQTIF  311
             KW  F+E KAKFDPK ILSPGQ IF
Sbjct  510   KWQQFEERKAKFDPKRILSPGQGIF  534



>ref|XP_002869416.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45675.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=525

 Score =   506 bits (1304),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 263/487 (54%), Positives = 324/487 (67%), Gaps = 22/487 (5%)
 Frame = -1

Query  1720  DSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRF-----SYNS----PSP-FSVAA  1571
             D  + +AAS DFG I  E P  VL PSS  ++  L+RF     SYN     P+P F VAA
Sbjct  45    DPFSISAASHDFGNITDENPGAVLCPSSTTEVARLLRFANGGFSYNRDSTRPTPTFKVAA  104

Query  1570  RGHGHSVRGQATAKDGVVVEMGALRGGGKIRVSWSESLGYFADVGGHELWVDVLHACLAH  1391
             RG GHS+RGQA+A  GVVV M  L    K       + G +ADV    +WVDVL A +  
Sbjct  105   RGQGHSLRGQASAPGGVVVNMTCLAKAAKPAAVVISADGTYADVAAGTMWVDVLKAAVER  164

Query  1390  GVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDMNSE  1211
             GVSP SWTD+L+L+VGGTLSNAGI GQ FR GPQISNV ELDVITGKGE +TCS  +N E
Sbjct  165   GVSPVSWTDFLYLSVGGTLSNAGIGGQTFRHGPQISNVHELDVITGKGEMMTCSPKLNPE  224

Query  1210  LFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISIN----GLN  1043
             LF+ VLGGLGQFGIITRARI L+ APTRVKW R+LY DFS F RDQE LIS+     G++
Sbjct  225   LFYGVLGGLGQFGIITRARIALDHAPTRVKWSRILYSDFSTFKRDQERLISMTNDRGGVD  284

Query  1042  YLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGSTVDQEL  863
             +LEG LMM++   +   +SFF LSDQ+++ASL+    ++Y LEV K+YD  T   +DQ +
Sbjct  285   FLEGQLMMSNGFVD---TSFFPLSDQTRVASLVNDHRIIYVLEVAKYYDRTTLPIIDQVI  341

Query  862   KDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKSRILDF  683
               L + L F PG  F +D  YF+FLNRVR EE + +  GLWE  HPWLN+FVP SRILDF
Sbjct  342   DMLTRTLGFAPGFMFVQDVPYFDFLNRVRNEEDKLRSLGLWEVPHPWLNIFVPGSRILDF  401

Query  682   NSAVFQNILLKH-KTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYS-GGMNGWKV  509
             +  V   +LL    T+G  L YPT    W+ RMS + P+ED FY +GLL S GG   W+ 
Sbjct  402   HDGVINGLLLNQTSTTGVTLFYPTNRNKWNNRMSTMTPDEDVFYVIGLLQSAGGSQNWQE  461

Query  508   LDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFDPKMILS  329
             L+ LN +++ FC   +  G KIK+YL HY  +EDW+KHFG KW+ F   K  FDPK +LS
Sbjct  462   LENLNDKVIQFC---ENSGIKIKEYLMHYTRKEDWVKHFGPKWDDFLRKKIMFDPKRLLS  518

Query  328   PGQTIFN  308
             PGQ IFN
Sbjct  519   PGQDIFN  525



>gb|AFK79779.1| cytokinin oxidase/dehydrogenase [Hordeum vulgare subsp. vulgare]
Length=533

 Score =   506 bits (1303),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 256/511 (50%), Positives = 340/511 (67%), Gaps = 20/511 (4%)
 Frame = -1

Query  1804  SILGKLKPWNSS-LPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDD  1628
             ++ G+L+P  +  LP +++++ +A + + D  +T  AS+DFG +V+  P  VL P++  D
Sbjct  19    AVAGQLRPMPAGGLPSDLVALGMASKIQTDRNSTARASSDFGRMVEAAPEAVLQPATAAD  78

Query  1627  IINLVRFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGAL-RGGGKIRVSWSESLGY  1451
             I  L+RFS +SP PF V+ RG GHSVRGQ+ A  GVVV+M AL RG  +I VS       
Sbjct  79    IAELIRFSTSSPVPFPVSPRGQGHSVRGQSLAPGGVVVDMRALGRGDHRINVSAD-----  133

Query  1450  FADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLE  1271
             + D GG +LWVDVL   L HG++P +WTDYL LTVGGTLSNAGI GQ FR GPQI+NV E
Sbjct  134   YVDAGGEQLWVDVLRGTLTHGLAPCAWTDYLRLTVGGTLSNAGIGGQAFRHGPQIANVHE  193

Query  1270  LDVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFS  1091
             LDV+TG GE +TCS     +LFFAVLGGLGQFGIITRARI LE AP +V+WVR+ Y D  
Sbjct  194   LDVVTGTGEMVTCSPHKRKDLFFAVLGGLGQFGIITRARIALEPAPKQVRWVRLAYSDVV  253

Query  1090  KFTRDQEHLISIN----GLNYLEGSLMMNHTSPNNWRSS-FFSLSDQSKIASLLTQQG--  932
              FTRDQE LIS      G +Y+EG + +N T     +S+ FFS +D +++ASL ++ G  
Sbjct  254   AFTRDQELLISKQASEAGFDYVEGQVQLNRTLTEGPKSTPFFSEADINRLASLASETGSR  313

Query  931   LLYCLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQE  752
              +Y +E   +YD+ T   VDQ+L+ +L  LSFVPG  F KD +Y +FL+RVR EE+  + 
Sbjct  314   AIYFIEAAMYYDETTAPYVDQKLETVLAQLSFVPGFVFTKDVTYLQFLDRVRVEEVVLRS  373

Query  751   NGLWEATHPWLNLFVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIP  572
              G+W+  HPWLNLF+P+SRILDF++ V + IL      G +L+YP  T  W+ +M+AV P
Sbjct  374   AGVWDVPHPWLNLFIPRSRILDFDAGVLKGILGGDNPVGLILMYPMNTAKWNSQMTAVTP  433

Query  571   --EEDTFYCVGLLYSG-GMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWM  401
                ED FY VGLL S    N  + L   NQ +L+FC   D+EG + KQYLPHY  ++ W 
Sbjct  434   PTREDVFYTVGLLRSALSTNELERLQRENQSVLAFC---DKEGIECKQYLPHYTCQDGWR  490

Query  400   KHFGKKWNTFQENKAKFDPKMILSPGQTIFN  308
             +HFG KW    + KAK+DP  I+SPGQ IF 
Sbjct  491   RHFGPKWRKITQLKAKYDPHAIMSPGQRIFQ  521



>gb|EAY85042.1| hypothetical protein OsI_06399 [Oryza sativa Indica Group]
Length=524

 Score =   505 bits (1301),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 252/495 (51%), Positives = 336/495 (68%), Gaps = 12/495 (2%)
 Frame = -1

Query  1768  LPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPS  1589
             LP ++ ++ +A + RVD  +T  AS+DFG IV   P  VL+P++  DI  LVRFS +SPS
Sbjct  24    LPGDLFALSVASKLRVDRNSTARASSDFGRIVAAAPEAVLHPATPADIAELVRFSASSPS  83

Query  1588  PFSVAARGHGHSVRGQATAKDGVVVEMGALRGGGKIRVSWSESLGYFADVGGHELWVDVL  1409
             PF VA RG GHS RGQ+ A  GVVV+M AL    + RV+ S     + D GG +LWVDVL
Sbjct  84    PFPVAPRGQGHSARGQSLAPGGVVVDMRAL-ASRRGRVNVSAGAAPYVDAGGEQLWVDVL  142

Query  1408  HACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCS  1229
              A L HG++P  WTDYL +TV GTLSNAGI GQ FR GPQI+NVLELDVITG G+ +TCS
Sbjct  143   RATLEHGLAPRVWTDYLRITVAGTLSNAGIGGQAFRHGPQIANVLELDVITGTGDMVTCS  202

Query  1228  KDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISIN-  1052
             +D +S+LFFAVLGGLGQFGIITRARI L  AP RV+WVR+ Y D + FT+DQE LIS   
Sbjct  203   RDKDSDLFFAVLGGLGQFGIITRARIGLMPAPKRVRWVRLAYSDVATFTKDQELLISKRA  262

Query  1051  ---GLNYLEGSLMMNHTSPNNWRSS-FFSLSDQSKIASLL--TQQGLLYCLEVVKHYDDQ  890
                G +Y+EG + +N T     +S+ FFS SD  ++A L   ++ G++Y +E   +Y++ 
Sbjct  263   SEAGFDYVEGQVQLNRTLTEGPKSTPFFSSSDIGRLAGLASKSESGVIYVIECAMYYNES  322

Query  889   TGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLF  710
             T +T+DQ+L+ +L  LSF  G  F KD  Y +FL+RVR EE   +  G+W+  HPWLNLF
Sbjct  323   TSTTMDQKLESILGQLSFEEGFVFTKDVRYVQFLDRVREEERVLRSIGMWDVPHPWLNLF  382

Query  709   VPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSG  530
             VP+SRILDF++ VF+ +       G +L+YP    MWD+RM AV  + D FY VGLL S 
Sbjct  383   VPRSRILDFDAGVFKGVFAGANPVGVILMYPMNRNMWDDRMMAVASDNDVFYAVGLLRSA  442

Query  529   -GMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAK  353
               ++  + L++ N+ +L+FC+ +D E    KQYLP+Y S++ W +HFG KW+   + KAK
Sbjct  443   VVVDDVERLEKENEAVLAFCHNEDIE---CKQYLPYYTSQDGWQRHFGAKWSRVADLKAK  499

Query  352   FDPKMILSPGQTIFN  308
             +DP  ILSPGQ IF+
Sbjct  500   YDPHRILSPGQRIFS  514



>ref|XP_010061263.1| PREDICTED: cytokinin dehydrogenase 5 [Eucalyptus grandis]
 gb|KCW68188.1| hypothetical protein EUGRSUZ_F01857 [Eucalyptus grandis]
Length=534

 Score =   506 bits (1302),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 261/504 (52%), Positives = 336/504 (67%), Gaps = 26/504 (5%)
 Frame = -1

Query  1765  PYEILSVDIAG-RFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPS  1589
             P E+L + + G R  ++     +AS DFG + +  P  V +PSS DD+  LVR +Y S  
Sbjct  24    PTELLQLCVGGGRLSMERVDVESASLDFGMMSRAEPLAVYHPSSADDVARLVRAAYESSR  83

Query  1588  PFSVAARGHGHSVRGQATAKDGVVVEMG----ALRGGGKIRVSWSESLGYFADVGGHELW  1421
              F+V+ARGHGHS+ GQA A  GVV++M     A +     RV+  E    + D  G ELW
Sbjct  84    GFAVSARGHGHSINGQAQAAGGVVLKMSGAGPAAQSRPAPRVAAEER---YVDAWGGELW  140

Query  1420  VDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEF  1241
             +DVL + L  G++P SWTDYL+L+VGGTLSN GISGQ F  GPQISNV ELDV+TGKG+ 
Sbjct  141   IDVLRSTLERGLAPKSWTDYLYLSVGGTLSNGGISGQAFNHGPQISNVYELDVVTGKGDI  200

Query  1240  ITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLI  1061
             +TCS++ NS+LF AVLGGLGQFGIITRARI LE AP RV+W+R+LY +FS FTRDQE+L 
Sbjct  201   VTCSEEKNSQLFHAVLGGLGQFGIITRARIALEPAPQRVRWIRVLYSNFSSFTRDQEYLT  260

Query  1060  SING------LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHY  899
             S++G       +Y+EG ++++    NNWRSSFFS  +  KI+SL T  G+LYCLEV K+Y
Sbjct  261   SLHGEPASKKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKISSLGTDGGVLYCLEVTKNY  320

Query  898   DDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWL  719
             D+    TVDQE++ LLKDL F+P   F  D  Y +FL+RV   E + +   LW+  HPWL
Sbjct  321   DESKADTVDQEVEYLLKDLDFIPTSVFTTDIPYVDFLDRVHKAESKLRAKNLWDVPHPWL  380

Query  718   NLFVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLL  539
             NLFVP+SRI DF+  VF+ I L  K SGP+L+YP     WD+R S V PEED FY V LL
Sbjct  381   NLFVPRSRIADFDRGVFKGI-LGDKASGPILIYPMNKNKWDQRSSVVTPEEDVFYLVALL  439

Query  538   YSGGMNG-------WKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFG-KK  383
              S  ++G        + L + N+ IL FC    +EG ++KQYLPHY +RE+W  HFG  K
Sbjct  440   RSATVDGSGDASRRLEHLADQNRRILKFCG---DEGIEVKQYLPHYSTREEWTGHFGDDK  496

Query  382   WNTFQENKAKFDPKMILSPGQTIF  311
             W  F +NK +FDPK ILS GQ IF
Sbjct  497   WARFYQNKMEFDPKQILSTGQRIF  520



>gb|ABN05767.1| FAD linked oxidase, N-terminal [Medicago truncatula]
Length=496

 Score =   504 bits (1298),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 254/492 (52%), Positives = 335/492 (68%), Gaps = 33/492 (7%)
 Frame = -1

Query  1705  TAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSPFSVAARGHGHSVRGQATAKD  1526
             + ASTD+G I+ E P  VL P+S+ DI NL+ +S + P  F+++ RG  HSV GQA  ++
Sbjct  10    SQASTDYGHIIHENPFAVLEPTSISDIANLINYSNSLPHSFTISPRGQAHSVLGQAMTQN  69

Query  1525  GVVVEMGAL---RGGGKIRVSWSE---SLGYFADVGGHELWVDVLHACLAHGVSPASWTD  1364
             G+VV M  L   R G  I VS  +    LG + DVGG +LW+DVL+A L HG++P SWTD
Sbjct  70    GIVVNMTQLNWYRNGSGIVVSDCDVKNPLGCYVDVGGEQLWIDVLNATLKHGLTPLSWTD  129

Query  1363  YLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDMNSELFFAVLGGL  1184
             YL+L+VGGTLSNAGI GQ FR GPQISNVLELDVITG+G  +TCS++ NSE+F+AVLGGL
Sbjct  130   YLYLSVGGTLSNAGIGGQTFRFGPQISNVLELDVITGQGNIVTCSQEKNSEVFYAVLGGL  189

Query  1183  GQFGIITRARIVLEKAPTR-------------VKWVRMLYDDFSKFTRDQEHLISI----  1055
             GQFG+ITRARI+L  APTR             VKW+R++Y+DFS F+ DQEHLIS     
Sbjct  190   GQFGVITRARILLGPAPTRASIIISFSFTHMYVKWLRLIYNDFSAFSTDQEHLISFDRRN  249

Query  1054  --NGLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGS  881
               NG +Y+EG L++N         SF+  SD  +I SL+TQ G+ Y LE+VK+YD  + +
Sbjct  250   DSNGADYVEGMLLLNKPP---LILSFYPPSDHPRITSLVTQYGITYVLELVKYYDTNSQA  306

Query  880   TVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPK  701
              + +E+ +L+K L FVP   F+KD +Y EFL+RV  EEL  +  GLW+  HPWLN+F+PK
Sbjct  307   NITEEVDNLVKGLKFVPTFMFQKDVTYEEFLDRVHSEELILRSKGLWDVPHPWLNMFIPK  366

Query  700   SRILDFNSAVFQNILLKHKTS-GPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSGG-  527
             SRI DFN  VF+ I+LK   S G +LVYP     WD+RMSA+ P+ED FY + LL++   
Sbjct  367   SRISDFNEGVFKGIILKQNISAGIVLVYPMNRNKWDDRMSAITPDEDVFYTLALLHAAKE  426

Query  526   MNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFD  347
             M+  K     N +IL FCN   + G K+K+YL   ++ ++W++HFG KW  F+E KAKFD
Sbjct  427   MDEVKTFQAQNHQILQFCN---DAGIKVKEYLSGNKTHQEWVEHFGAKWQQFEERKAKFD  483

Query  346   PKMILSPGQTIF  311
             PK ILSPGQ IF
Sbjct  484   PKRILSPGQGIF  495



>ref|XP_006595335.1| PREDICTED: cytokinin dehydrogenase 3-like [Glycine max]
Length=524

 Score =   505 bits (1300),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 255/493 (52%), Positives = 333/493 (68%), Gaps = 20/493 (4%)
 Frame = -1

Query  1744  DIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSPFSVAARG  1565
             +I  +   D    + ASTD+G IV + P  +  PSS+ DI  L+ FS +   P ++A RG
Sbjct  38    EITLKLIRDPVTLSLASTDYGHIVHDNPFAIFAPSSISDISLLINFSNSLAIPITIAPRG  97

Query  1564  HGHSVRGQATAKDGVVVEMGALRG----GGKIRVS---WSESLGYFADVGGHELWVDVLH  1406
               HS+ GQA   DGVVV M  L G     G I VS    + ++G +ADVGG ++W+DVLH
Sbjct  98    QAHSIHGQAMTNDGVVVNMTELNGFRNGDGIIVVSDDTTATTIGPYADVGGEQIWIDVLH  157

Query  1405  ACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSK  1226
             A L  G++P SWTDYL+L+VGGTLSNAGISGQ FR GPQISNV ELDV+TGKG+ +TCS 
Sbjct  158   ATLERGLTPLSWTDYLYLSVGGTLSNAGISGQTFRFGPQISNVHELDVVTGKGDLVTCSA  217

Query  1225  DMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISINGL  1046
             + NSELF+AVLGGLGQFGIITRARI L  APTRVKW+R+LY++FS F+ DQE+LIS+NG 
Sbjct  218   ENNSELFYAVLGGLGQFGIITRARIALGPAPTRVKWLRLLYNNFSAFSGDQEYLISVNGR  277

Query  1045  N------YLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTG  884
             N      Y+EG L++N    +    SF+   D  +I SL+TQ G++Y +E+VK+YD+ T 
Sbjct  278   NETNAADYVEGFLLLNQPPQD---LSFYPEPDHPRITSLVTQYGIIYVIELVKYYDNSTQ  334

Query  883   STVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVP  704
               VD+++   +++L FVP   F+KD SY EFLNRV  +EL  +  GLW+  HPWLNLFVP
Sbjct  335   EHVDEDVNFWVEELKFVPTFMFEKDVSYEEFLNRVHADELFLRSQGLWDIPHPWLNLFVP  394

Query  703   KSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSGG  527
              SRI DF+  VF+ I+L+   T+G +++YP     WD+ MSAV P +D FY V  L+S G
Sbjct  395   ASRISDFDEGVFKGIILQQNITAGLVIIYPMNRTKWDDNMSAVTPHDDVFYVVSFLHSTG  454

Query  526   MNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFD  347
              +  +     NQ+IL FC      G  IKQYLP  +++E+W K FG KW TF+E KA+FD
Sbjct  455   FDKLEEFQAQNQQILQFCAN---AGIGIKQYLPQNKTQEEWEKQFGPKWKTFKERKAQFD  511

Query  346   PKMILSPGQTIFN  308
             P  ILSPGQ IFN
Sbjct  512   PNSILSPGQGIFN  524



>ref|XP_003571719.1| PREDICTED: cytokinin dehydrogenase 7-like [Brachypodium distachyon]
Length=532

 Score =   505 bits (1301),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 256/508 (50%), Positives = 340/508 (67%), Gaps = 17/508 (3%)
 Frame = -1

Query  1795  GKLKPWNS--SLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDII  1622
             G+++P  S   LP  +    IA   R D  ATT AS+DFG IV+  P  VL+P++  DI 
Sbjct  24    GQIRPLPSGGQLPSGLFVHSIASMIRTDRNATTKASSDFGRIVEAAPEAVLHPATPADIA  83

Query  1621  NLVRFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGALRGGGKIRVSWSESLGYFAD  1442
              L+RFS +S +PF VA RG GHS RGQ+ A  GVVV+M AL G G  R++ S   GY  D
Sbjct  84    ALIRFSASSKAPFPVAPRGQGHSARGQSLAPGGVVVDMRAL-GRGHRRINVSAGAGYV-D  141

Query  1441  VGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDV  1262
              GG +LW+DVL A L HG++P +WTDYL LTVGGTLSNAGI GQ FR GPQI+NV ELDV
Sbjct  142   AGGEQLWIDVLRATLEHGLAPRAWTDYLRLTVGGTLSNAGIGGQAFRHGPQIANVRELDV  201

Query  1261  ITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFT  1082
             +TG GE +TCS++ +S+LFFAVLGGLGQFG+ITRARI LE AP R +WVR+ Y D + FT
Sbjct  202   VTGTGELVTCSREESSDLFFAVLGGLGQFGVITRARIALEPAPKRARWVRLAYTDVTVFT  261

Query  1081  RDQEHLISIN----GLNYLEGSLMMNHTSPNNWRSS-FFSLSDQSKIASLLTQ--QGLLY  923
              DQE LIS      G +Y+EG + +N T  +   S+ FFS +D +++A L+++   G +Y
Sbjct  262   GDQELLISKKASEAGFDYVEGQVQLNRTLIDGPESTPFFSGADINRLAGLVSRSGSGAIY  321

Query  922   CLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGL  743
              +E   +YD+ T S+VDQ+L+ +L+ LSF PG  F KD +Y +FL+RVR EE   +  G+
Sbjct  322   FIEAAMYYDEATASSVDQKLEAVLEQLSFTPGFVFTKDVTYVQFLDRVRVEEEVLRSVGV  381

Query  742   WEATHPWLNLFVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIP--E  569
             W+  HPWLNLF+P+SRI+ F++ V + IL      G +L+YP  T  WD+RM+AV P  E
Sbjct  382   WDVPHPWLNLFIPRSRIIGFDTGVLKGILGGTNPVGVILMYPMNTNKWDDRMTAVTPQTE  441

Query  568   EDTFYCVGLLYSG-GMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHF  392
             ED FY V LL S   +   + L+  N+ +L+FC +   E  + KQYLPHY S + W +HF
Sbjct  442   EDVFYAVSLLRSAVAVGDVERLERENEAVLAFCTR---EAIRCKQYLPHYTSEDGWRRHF  498

Query  391   GKKWNTFQENKAKFDPKMILSPGQTIFN  308
             G KW    E KAK+DP+ I++PGQ IF 
Sbjct  499   GTKWERIAELKAKYDPQTIMAPGQRIFQ  526



>ref|XP_006412813.1| hypothetical protein EUTSA_v10024918mg [Eutrema salsugineum]
 gb|ESQ54266.1| hypothetical protein EUTSA_v10024918mg [Eutrema salsugineum]
Length=524

 Score =   504 bits (1299),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 261/486 (54%), Positives = 329/486 (68%), Gaps = 21/486 (4%)
 Frame = -1

Query  1720  DSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRF-----SY----NSPSP-FSVAA  1571
             D  + +AAS DFG I  ETP  VL PSS  ++  L+RF     SY      PSP F VAA
Sbjct  45    DPFSISAASQDFGNITDETPGAVLCPSSSVEVSRLLRFASGEFSYGEDATGPSPGFKVAA  104

Query  1570  RGHGHSVRGQATAKDGVVVEMGALRGGGKIRVSWSESLGYFADVGGHELWVDVLHACLAH  1391
             RG GHS+RGQA+A  G+VV M  L    K       + G +ADV    +WV+VL   +  
Sbjct  105   RGQGHSLRGQASAPGGIVVNMTCLAKAAKPAAVVVSADGTYADVAAGTMWVEVLETAVER  164

Query  1390  GVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDMNSE  1211
             GVSP +WTDYL+L+VGGTLSNAGI GQ FR GPQISNV ELDVITGKGE +TCS  +N+E
Sbjct  165   GVSPVTWTDYLYLSVGGTLSNAGIGGQTFRHGPQISNVHELDVITGKGEMMTCSPKLNTE  224

Query  1210  LFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISING---LNY  1040
             LF+ VLGGLGQFGIITRARI L+ AP RVKW+R+LY+DFS FTRDQE LIS+     +++
Sbjct  225   LFYGVLGGLGQFGIITRARIALDHAPKRVKWLRILYNDFSDFTRDQERLISMVNDIRVDF  284

Query  1039  LEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGSTVDQELK  860
             LEG LMM++   +   +SFF LSDQ+++ASL+    ++Y LEV K+YD  T   ++Q + 
Sbjct  285   LEGQLMMSNGFVD---TSFFPLSDQTRVASLVNDHRIIYVLEVAKYYDTTTLPIINQVID  341

Query  859   DLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKSRILDFN  680
              L + L F+PG  F +D  YF+FLNRVR EE + +  GLWE  HPWLN+FVP+SRI DF+
Sbjct  342   MLTRTLGFIPGFMFMRDVPYFDFLNRVRNEEDKLRSLGLWEVPHPWLNIFVPRSRIQDFH  401

Query  679   SAVFQNILLKH-KTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYS-GGMNGWKVL  506
               + + +LL    TSG  L YPT    W+ RMSA+IP+ED FY +GLL+S GG   W+ L
Sbjct  402   DGIIKGLLLNQTSTSGVTLFYPTNRNKWNNRMSAMIPDEDVFYVIGLLHSAGGSQNWEEL  461

Query  505   DELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFDPKMILSP  326
             D LN +I+ FC   D  G KIK+YL HY  +EDW++HFG KW  F   K  FDPK +LSP
Sbjct  462   DNLNDKIIHFC---DTSGIKIKEYLMHYTRKEDWVQHFGPKWGDFLRRKIMFDPKKLLSP  518

Query  325   GQTIFN  308
             GQ IF+
Sbjct  519   GQDIFS  524



>gb|AEV76973.1| cytokinin oxidase/dehydrogenase 8, partial [Triticum aestivum]
Length=534

 Score =   504 bits (1299),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 257/510 (50%), Positives = 342/510 (67%), Gaps = 21/510 (4%)
 Frame = -1

Query  1801  ILGKLKPW--NSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDD  1628
             + G+L+P     + P ++ ++ IA + R D  +T +AS+DFG I++  P  VL+P++  D
Sbjct  20    VAGQLRPMPCRVAFPVDLFALGIASKIRTDCNSTASASSDFGRIMEAAPEAVLHPATPAD  79

Query  1627  IINLVRFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGAL-RGGGKIRVSWSESLGY  1451
             I  L+RFS +SP PF V+ RG GHSVRGQ+ A  GVVV+M  L RG  +I VS       
Sbjct  80    IAALIRFSASSPVPFPVSPRGQGHSVRGQSLAPGGVVVDMRMLGRGYHRINVSAD-----  134

Query  1450  FADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLE  1271
             + D GG +LWVDVL A L HG++P +WTDYL LTVGGTLSNAGI GQ FR GPQI+NV E
Sbjct  135   YVDAGGEQLWVDVLRATLKHGLAPRAWTDYLQLTVGGTLSNAGIGGQAFRHGPQIANVHE  194

Query  1270  LDVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFS  1091
             LDV+TG GE +TCS+D   +LFFA LGGLGQFGIITRARI LE AP +V+WVR+ Y D  
Sbjct  195   LDVVTGTGEMVTCSRDKRKDLFFAALGGLGQFGIITRARIALELAPKQVRWVRLAYSDVV  254

Query  1090  KFTRDQEHLISIN----GLNYLEGSLMMNHTSPNNWRSS-FFSLSDQSKIASLLTQ--QG  932
              FTRDQE LIS      G +Y+EG + +N T     +S+ FFS +D +++A L ++   G
Sbjct  255   AFTRDQELLISKQASEAGFDYVEGQVQLNRTLTEGPKSTPFFSEADINRLAGLASETGSG  314

Query  931   LLYCLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQE  752
              +Y +E   +YD+ T  +V+Q+LK +L  LSFVPG  F KD +YF+FL+RVR EE E + 
Sbjct  315   AIYFIEAAMYYDETTAPSVNQKLKMVLAQLSFVPGFVFTKDVTYFQFLDRVRVEEAELRW  374

Query  751   NGLWEATHPWLNLFVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIP  572
              G+W+  HPWLNLFVP+SRILDF++ V + IL      G +L+YP  T  W+ RM+A+ P
Sbjct  375   AGVWDVPHPWLNLFVPRSRILDFDAGVLKGILGGDNPVGLILMYPMNTAKWNSRMTAMTP  434

Query  571   E--EDTFYCVGLLYSG-GMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWM  401
                ED FY VGLL S    +  + L   NQ +L+FC   D+EG + KQYLP+Y S++ W 
Sbjct  435   ATGEDVFYTVGLLRSALSADELERLQRENQSVLAFC---DKEGIECKQYLPYYTSQDGWR  491

Query  400   KHFGKKWNTFQENKAKFDPKMILSPGQTIF  311
             +HFG KW+   + KAK+DP  I+S GQ IF
Sbjct  492   RHFGAKWSNIAQLKAKYDPHAIMSRGQRIF  521



>gb|ABM98099.2| cytokinin oxidase [Dendrobium huoshanense]
Length=537

 Score =   503 bits (1296),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 263/503 (52%), Positives = 335/503 (67%), Gaps = 23/503 (5%)
 Frame = -1

Query  1774  SSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNS  1595
             +SLP  +L+  I+   R DS + +AAS+DFGGIV   P+ V  PSS  DI +L+R S+ S
Sbjct  30    NSLPTTLLTHPISTHLRFDSLSLSAASSDFGGIVHSHPSAVFLPSSPSDIASLLRLSHFS  89

Query  1594  PSPFSVAARGHGHSVRGQATAKDGVVVEMGALRGGGKIRVSWSESLGYFADVGGHELWVD  1415
             P PF+++ARG GHS RGQA A  G+V+ M +L     I VS   + G F D GG  +W+D
Sbjct  90    PQPFTISARGLGHSTRGQAQASAGIVINMPSL--DSSITVS---TDGMFVDAGGERMWID  144

Query  1414  VLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFIT  1235
             VL   L +G++P SWTDYL+LT+GGTLSN GISGQ F  GPQISNV ELD+ITGKGE ++
Sbjct  145   VLRETLRYGLTPKSWTDYLYLTLGGTLSNGGISGQAFLHGPQISNVHELDIITGKGEMVS  204

Query  1234  CSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISI  1055
             CS+  N +LFF+VLGGLGQFGIITRARI LE AP  V+W+R++Y DF  FT+DQE LISI
Sbjct  205   CSESANPDLFFSVLGGLGQFGIITRARIALENAPKSVRWMRLMYTDFELFTKDQELLISI  264

Query  1054  NG------LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASL-LTQQGLLYCLEVVKHYD  896
                     LNY+EGSL+M H+  +NWRS FFS  D  +I  L    +G++YCLE   +YD
Sbjct  265   KAEGEGWRLNYVEGSLLMEHSLKSNWRSPFFSEKDLKRIKKLAYGNEGVIYCLEASFYYD  324

Query  895   DQTG--------STVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLW  740
                G        + +DQ++++LL+ L FV G  F  D +Y  FLNRV   EL+ +  GLW
Sbjct  325   FHHGRNFSRADKTQMDQDIEELLRKLRFVSGFAFGNDVTYMSFLNRVHDGELKLRAMGLW  384

Query  739   EATHPWLNLFVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDT  560
             +  HPWLNL V KS I+DF   V + I+   K+ GP+LVYPT    WDERMS  IP+E+ 
Sbjct  385   DVPHPWLNLLVSKSNIMDFYIGVLKGIMKTSKSMGPILVYPTKRSKWDERMSTAIPDEEV  444

Query  559   FYCVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKW  380
             FY +G+L S  MN  + L+  N EIL F    D++G   KQYLPHY S E W KHFGKKW
Sbjct  445   FYSIGILLSSEMNDLEHLENQNAEILKFS---DQQGLNYKQYLPHYTSMEGWKKHFGKKW  501

Query  379   NTFQENKAKFDPKMILSPGQTIF  311
               F E K+++DPK ILSPGQ IF
Sbjct  502   EGFVEMKSRYDPKAILSPGQKIF  524



>ref|XP_003527677.1| PREDICTED: cytokinin dehydrogenase 5-like [Glycine max]
Length=549

 Score =   504 bits (1297),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 254/501 (51%), Positives = 337/501 (67%), Gaps = 27/501 (5%)
 Frame = -1

Query  1759  EILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSPFS  1580
             E+L   + GR  VD+    AAS DFG + +  P+ V++P++ +D+  +V+ ++ SP  F+
Sbjct  45    ELLDQGLQGRLSVDTWELEAASVDFGRLSRGEPSEVVHPATAEDVARVVKAAFKSP--FA  102

Query  1579  VAARGHGHSVRGQATAKD--GVVVEMGALRGGGK---------IRVSWSESLGYFADVGG  1433
             V+ARGHGHS+ GQA  K+  GVV+EMG    G           IRV      G + DV G
Sbjct  103   VSARGHGHSINGQALIKEKKGVVIEMGKSDSGDNNDHNGDSNIIRVC---EKGMYVDVWG  159

Query  1432  HELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITG  1253
              +LW+DVL A L +G++P SWTDYL+L+VGGTLSNAGISGQ F  GPQI+NV ELDV+TG
Sbjct  160   GKLWIDVLSATLEYGLAPMSWTDYLYLSVGGTLSNAGISGQTFNHGPQITNVYELDVVTG  219

Query  1252  KGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQ  1073
             KGE +TCS+D NSELF +VLGGLGQFGIITRARI LE AP RV+W+R+LY +F++F +DQ
Sbjct  220   KGELVTCSEDRNSELFHSVLGGLGQFGIITRARIALEPAPHRVRWIRVLYSNFARFCKDQ  279

Query  1072  EHLISING------LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEV  911
             E+LIS++G       +Y+EG ++++    NNWRSSFF+ S+  KI SL    G+LYCLE+
Sbjct  280   EYLISLHGKAARERFDYVEGFVIVDEGLINNWRSSFFAASNPVKITSLNADGGVLYCLEI  339

Query  910   VKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEAT  731
              K+YD     +VD+E++ LLK L+F+P   F  D  Y +FL+RV   EL+ +  GLW+  
Sbjct  340   TKNYDQGNADSVDEEIQALLKKLNFIPTSVFTTDLPYVDFLDRVHKAELKLKSKGLWDVP  399

Query  730   HPWLNLFVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYC  551
             HPWLNLFVPKSRI DF+  VF+ I L +KTSGP+L+YP     WD R S V PEED FY 
Sbjct  400   HPWLNLFVPKSRIEDFDKGVFKGI-LGNKTSGPILIYPMNKNKWDHRSSVVTPEEDVFYL  458

Query  550   VGLLYSG-GMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNT  374
             V  L S       + L   N++IL FC+  +    K+KQYLPHY ++++WM HFG KW  
Sbjct  459   VAFLRSALDTETLEYLTNQNRQILRFCHDSE---IKVKQYLPHYTTQQEWMDHFGDKWTQ  515

Query  373   FQENKAKFDPKMILSPGQTIF  311
             F   K +FDP+ IL  GQ IF
Sbjct  516   FNARKMQFDPRRILGTGQQIF  536



>ref|XP_009761052.1| PREDICTED: cytokinin dehydrogenase 5 [Nicotiana sylvestris]
Length=527

 Score =   502 bits (1293),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 254/476 (53%), Positives = 326/476 (68%), Gaps = 18/476 (4%)
 Frame = -1

Query  1699  ASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSPFSVAARGHGHSVRGQATAKDGV  1520
             AS DFGG+ +  P  VL P++ +D+  LV+ +Y+S   F+V+ARGHGHS+ GQA   +GV
Sbjct  46    ASVDFGGLHRAEPMAVLNPATAEDVARLVKAAYDSAHGFTVSARGHGHSINGQAMITNGV  105

Query  1519  VVEM-GALRGGGKIRVSWSESLGYFADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVG  1343
             V++M G      K+    SE   Y ADV G ELW+DVL + L +G++P SWTDYL+L+VG
Sbjct  106   VIQMSGGSNSKQKLLTEVSEKFMY-ADVWGGELWIDVLTSTLEYGLAPKSWTDYLYLSVG  164

Query  1342  GTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDMNSELFFAVLGGLGQFGIIT  1163
             GTLSNAGISGQ F  GPQI+NV ELDV+TGKGE +TCS+  NSELF A LGGLGQFGIIT
Sbjct  165   GTLSNAGISGQAFNHGPQINNVHELDVVTGKGELLTCSEKENSELFHAALGGLGQFGIIT  224

Query  1162  RARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISING------LNYLEGSLMMNHTSPN  1001
             RARI LE+AP RV+W+R+LY +FS FT DQE+LIS++G       +Y+EG ++++    N
Sbjct  225   RARIALEQAPQRVRWIRVLYSNFSTFTEDQEYLISLHGKPASQKFDYVEGFVIVDEGLIN  284

Query  1000  NWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMT  821
             NWRSSFFS S+  KI+SL ++ G+LYCLE+ K+Y       VDQE++ LLK L ++P   
Sbjct  285   NWRSSFFSPSNPVKISSLKSEGGVLYCLEITKNYHLSNADIVDQEIETLLKKLKYIPASV  344

Query  820   FKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKSRILDFNSAVFQNILLKHKT  641
             F  D  Y +FL+RV   EL+ +  GLWE  HPWLNLFVPKSRI DF+  VF+ I L +KT
Sbjct  345   FTTDLPYVDFLDRVHKAELKLRSKGLWEVPHPWLNLFVPKSRIADFDKGVFKGI-LGNKT  403

Query  640   SGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSGGMNG-----WKVLDELNQEILSF  476
             SGP+L+YP     WDER S V PEE+ FY VG L S   NG      + L   N +IL F
Sbjct  404   SGPILIYPMNKNKWDERSSVVTPEEEVFYLVGFLRSALTNGDETQTLEYLSNQNYQILKF  463

Query  475   CNKDDEEGSKIKQYLPHYRSREDWMKHFGKK-WNTFQENKAKFDPKMILSPGQTIF  311
             C   ++   KIKQYLPHY ++ +W  HFG K W  FQ+ K  FDP+ IL+ GQ IF
Sbjct  464   C---EDAKIKIKQYLPHYTTQREWRDHFGDKYWTRFQQRKLDFDPRHILATGQRIF  516



>ref|XP_003550630.1| PREDICTED: cytokinin dehydrogenase 3-like [Glycine max]
Length=560

 Score =   503 bits (1296),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 252/482 (52%), Positives = 324/482 (67%), Gaps = 17/482 (4%)
 Frame = -1

Query  1720  DSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSPFSVAARGHGHSVRGQ  1541
             D    + AS D+G IV + P  +  PSS+ DI  L+ FS +   P ++A RG  HSV GQ
Sbjct  85    DPVTLSLASIDYGHIVHDNPFAIFAPSSISDISLLINFSNSLAIPITIAPRGQAHSVHGQ  144

Query  1540  ATAKDGVVVEMGALRG----GGKIRVSWSESLGYFADVGGHELWVDVLHACLAHGVSPAS  1373
             A    GVVV M  L G     G + V    ++G +ADVGG ++W+DVLHA L  G++P S
Sbjct  145   AMTNHGVVVNMTELNGFRNGDGIVVVVDDTTIGPYADVGGEQIWIDVLHATLERGLTPLS  204

Query  1372  WTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDMNSELFFAVL  1193
             WTDYL+L+VGGTLSNAGISGQ FR GPQISNV +LDV+TGKG+ +TCS + NSELF+AVL
Sbjct  205   WTDYLYLSVGGTLSNAGISGQTFRFGPQISNVHQLDVVTGKGDLVTCSAENNSELFYAVL  264

Query  1192  GGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISINGLN------YLEG  1031
             GGLGQFGIITRARI L  APTRVKW+R+LY+DFS F+ DQEHLIS NG+N      Y+EG
Sbjct  265   GGLGQFGIITRARIALGPAPTRVKWLRLLYNDFSAFSGDQEHLISFNGINETNAADYVEG  324

Query  1030  SLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGSTVDQELKDLL  851
              L+ N    +    SF+   DQ +I SL+TQ G++Y +E+VK+YD+ T   VD+++K L+
Sbjct  325   FLLQNQPPLD---LSFYPEPDQPRITSLVTQYGIIYVIELVKYYDNSTQEHVDEDVKLLV  381

Query  850   KDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKSRILDFNSAV  671
             + L F P   F+KD SY EFLNRV  +EL  +  GLW+  HPWLNLFVP SRI DF+  V
Sbjct  382   ERLKFFPTFMFEKDVSYEEFLNRVHADELFLRSQGLWDVPHPWLNLFVPASRISDFDEGV  441

Query  670   FQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSGGMNGWKVLDELN  494
             F+ I+L+   T+G +++YP     WD+ MSAV P +D FY V  L S G +  +     N
Sbjct  442   FKGIILQQNITAGLVIIYPMNRTKWDDNMSAVTPHDDVFYVVSFLRSTGFDKLEEFKAQN  501

Query  493   QEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFDPKMILSPGQTI  314
             ++IL FC      G  IKQYLP  ++RE W + FG KW TF++ KA+FDP  ILSPGQ I
Sbjct  502   RQILQFCAN---AGMGIKQYLPQNKTREKWEEQFGPKWKTFKQRKAQFDPNRILSPGQGI  558

Query  313   FN  308
             FN
Sbjct  559   FN  560



>ref|XP_007136628.1| hypothetical protein PHAVU_009G060200g [Phaseolus vulgaris]
 gb|ESW08622.1| hypothetical protein PHAVU_009G060200g [Phaseolus vulgaris]
Length=550

 Score =   502 bits (1293),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 254/493 (52%), Positives = 333/493 (68%), Gaps = 20/493 (4%)
 Frame = -1

Query  1759  EILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSPFS  1580
             E+L V + GR  VD+    AAS DFG + +  P+ V++P++ +D+  +V+ ++ S   F+
Sbjct  56    ELLDVGLEGRLSVDTWELEAASVDFGRLSRGAPSEVVHPATAEDVSRVVKAAFESE--FA  113

Query  1579  VAARGHGHSVRGQA--TAKDGVVVEMGALRGGGKIRVSWSESLGYFADVGGHELWVDVLH  1406
             V+ARGHGHS+ GQA    K GVV+EMG  +GG  +RV      G + DV G ELW++VL 
Sbjct  114   VSARGHGHSINGQALIREKKGVVIEMG--KGGSGVRVC---EKGMYVDVWGGELWIEVLS  168

Query  1405  ACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSK  1226
             A L +G++P SWTDYL+L+VGGTLSNAGISGQ F  GPQI+NV ELDV+TGKGE +TCS+
Sbjct  169   ATLEYGLAPMSWTDYLYLSVGGTLSNAGISGQTFNHGPQITNVFELDVVTGKGELVTCSE  228

Query  1225  DMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISING-  1049
             D NSELF AVLGGLGQFGIITRARI LE AP RV+W+R+LY DF +F  DQE+LIS++G 
Sbjct  229   DRNSELFHAVLGGLGQFGIITRARIALEPAPHRVRWIRVLYSDFGRFCEDQEYLISLHGK  288

Query  1048  -----LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTG  884
                   +Y+EG ++++    NNWRSSFFS  +   I SL    G+LYCLE+ K+YD    
Sbjct  289   PGRERFDYVEGFVIVDEGLINNWRSSFFSPINPVNITSLNADGGVLYCLEITKNYDHHNA  348

Query  883   STVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVP  704
              +VD+E++ LLK L F+    F  D  Y +FL+RV   EL+ +  GLW+  HPWLNLFVP
Sbjct  349   DSVDEEIQGLLKKLHFLSTSVFTSDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVP  408

Query  703   KSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSG-G  527
             KSRI DF+  VF+ I L +KTSGP+L+YP     WD R S V PEED FY V  L S   
Sbjct  409   KSRIGDFDKGVFKGI-LGNKTSGPILIYPMNKSKWDHRSSVVTPEEDVFYLVAFLRSALD  467

Query  526   MNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFD  347
                 + L   N++IL FC+  +    K+KQYLPHY ++++WM HFG KW  F   K +FD
Sbjct  468   TETLEYLTNQNRQILRFCHGSE---IKVKQYLPHYTTQQEWMDHFGDKWTQFNARKMQFD  524

Query  346   PKMILSPGQTIFN  308
             P+ IL+ GQ IF 
Sbjct  525   PRRILATGQQIFQ  537



>ref|XP_009124316.1| PREDICTED: cytokinin dehydrogenase 2-like [Brassica rapa]
Length=505

 Score =   500 bits (1288),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 254/474 (54%), Positives = 318/474 (67%), Gaps = 16/474 (3%)
 Frame = -1

Query  1720  DSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSPFSVAARGHGHSVRGQ  1541
             D    + AS D+G +   TP GVL PSS  +I  L+R++ N  + F VAARG GHS+ GQ
Sbjct  44    DPSTISTASHDYGNVTAVTPGGVLCPSSSAEISRLLRYAANGDTIFQVAARGQGHSLNGQ  103

Query  1540  ATAKDGVVVEMGALRGGGKIRVSWSESLGYFADVGGHELWVDVLHACLAHGVSPASWTDY  1361
             A+   GVV+ M  L     I VS  +    +ADV G  LWVDVL      GVSP SWTDY
Sbjct  104   ASVSGGVVINMTCL---ADITVSEDKE---YADVAGGTLWVDVLRETAEQGVSPVSWTDY  157

Query  1360  LHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDMNSELFFAVLGGLG  1181
             LH++VGGTLSNAGI GQMFR GPQISNVLELDVITGKGE + CS  +N ELF+ VLGGLG
Sbjct  158   LHISVGGTLSNAGIGGQMFRNGPQISNVLELDVITGKGETLACSPQLNPELFYGVLGGLG  217

Query  1180  QFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISIN---GLNYLEGSLMMNHT  1010
             QFGII+RARIVL  AP R KW +MLY DF+ FT+DQE LIS+N   G++Y+EG  +M++ 
Sbjct  218   QFGIISRARIVLNHAPKRAKWFKMLYSDFTAFTKDQESLISMNNDTGVDYVEGQQLMSNG  277

Query  1009  SPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGSTVDQELKDLLKDLSFVP  830
               +   +SFF  SDQSK+A L+    ++Y LEV K+YDD T  T  Q +  L K LS++P
Sbjct  278   IVD---TSFFPPSDQSKVADLVKNHSIIYVLEVAKYYDDPTVPTTGQVIDKLTKTLSYLP  334

Query  829   GMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKSRILDFNSAVFQNILLK  650
             G     D  YF+FLNRV+ EE + +   LWE  HPWLNL+VPK++ILDF++ V ++ILLK
Sbjct  335   GFISMHDVPYFDFLNRVQAEEDKLRSLALWEVPHPWLNLYVPKTQILDFHNGVVKDILLK  394

Query  649   HK-TSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSGGMNGWKVLDELNQEILSFC  473
                TSG  L YPT    WD RMSA+IP+ED FY VGLL S      + ++ +N+ I+SFC
Sbjct  395   QNSTSGVALFYPTNRNKWDNRMSAMIPDEDVFYVVGLLQSASSQNVQEVESVNEAIISFC  454

Query  472   NKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFDPKMILSPGQTIF  311
                 + G KIKQYL H+  +EDW+ HFG KW  F + K  FDPK +LSPGQ IF
Sbjct  455   K---DSGIKIKQYLMHFTRKEDWVGHFGSKWGAFSKRKDLFDPKKLLSPGQDIF  505



>gb|AEV76972.1| cytokinin oxidase/dehydrogenase 7, partial [Triticum aestivum]
Length=534

 Score =   501 bits (1290),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 254/510 (50%), Positives = 342/510 (67%), Gaps = 21/510 (4%)
 Frame = -1

Query  1801  ILGKLKPW--NSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDD  1628
             + G+L+P     + P ++ ++ IA + R D  +T +A++DFG I++  P  VL+P++  D
Sbjct  20    VAGQLRPMPRRVAFPVDLFALGIASKIRTDCNSTASAASDFGRIMEAAPEAVLHPATPAD  79

Query  1627  IINLVRFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGAL-RGGGKIRVSWSESLGY  1451
             I  L+RFS +SP PF V+ RG GHSVRGQ+ A  GVVV+M  L RG  +I VS       
Sbjct  80    IAALIRFSTSSPVPFPVSPRGQGHSVRGQSLAPGGVVVDMRTLGRGHHRINVSAD-----  134

Query  1450  FADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLE  1271
             + D GG +LWVDVL A L HG++P +WTD+L LTVGGTLSNAGI GQ FR GPQI+NV E
Sbjct  135   YVDAGGEQLWVDVLRATLKHGLAPRAWTDHLQLTVGGTLSNAGIGGQAFRHGPQIANVHE  194

Query  1270  LDVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFS  1091
             LDV+TG GE +TCS+D   +LFFA LGGLGQFGIITRARI LE AP +V+WVR+ Y D  
Sbjct  195   LDVVTGTGEMVTCSRDKRKDLFFAALGGLGQFGIITRARIALESAPKQVRWVRLAYSDVV  254

Query  1090  KFTRDQEHLISIN----GLNYLEGSLMMNHTSPNNWRSS-FFSLSDQSKIASLLTQ--QG  932
              FTRDQE LIS +    G +Y+EG + +N T     +S+ FFS +D +++A L ++   G
Sbjct  255   AFTRDQELLISKHASEAGFDYVEGQVQLNRTLTEGPKSTPFFSEADINRLAGLASETGSG  314

Query  931   LLYCLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQE  752
              +Y +E   +YD+ T  +V+Q+LK +L  LSFVPG  F KD +YF+FL+RVR EE+  + 
Sbjct  315   AIYFIEAAMYYDETTAPSVNQKLKMVLAQLSFVPGFVFTKDVTYFQFLDRVRVEEVVLRS  374

Query  751   NGLWEATHPWLNLFVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIP  572
              G+W+  HPWLNLFVP+SRILDF++ V ++IL      G +L+YP  T  W  +M+AV P
Sbjct  375   AGVWDVPHPWLNLFVPRSRILDFDACVLKDILGGDNPVGLILMYPMNTAKWTSQMTAVKP  434

Query  571   E--EDTFYCVGLLYSG-GMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWM  401
                ED FY VGLL S    +  + L   NQ +L+FC   D+EG + K YLPHY S++ W 
Sbjct  435   PTVEDVFYMVGLLRSALSADELEHLQRENQSVLAFC---DKEGIECKHYLPHYTSQDGWR  491

Query  400   KHFGKKWNTFQENKAKFDPKMILSPGQTIF  311
             +HFG KW+   + K K+DP MI+S GQ IF
Sbjct  492   RHFGAKWSNIAQLKNKYDPHMIMSRGQRIF  521



>ref|XP_010438272.1| PREDICTED: cytokinin dehydrogenase 4-like [Camelina sativa]
Length=524

 Score =   501 bits (1289),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 261/486 (54%), Positives = 321/486 (66%), Gaps = 21/486 (4%)
 Frame = -1

Query  1720  DSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRF-----SYNS----PSP-FSVAA  1571
             D  + +AAS DFG I  E+P  VL PSS  ++  L+ F     SYN     P P F VAA
Sbjct  45    DPFSISAASHDFGNITDESPGAVLCPSSPTEVARLLGFANGGFSYNGVSTIPEPTFKVAA  104

Query  1570  RGHGHSVRGQATAKDGVVVEMGALRGGGKIRVSWSESLGYFADVGGHELWVDVLHACLAH  1391
             RG GHS+RGQA+A  G+VV M  L    K       + G +ADV    +WVDVL A +  
Sbjct  105   RGQGHSLRGQASAPGGIVVNMTCLAMAAKPAAVVISADGTYADVAAGTMWVDVLKAAVER  164

Query  1390  GVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDMNSE  1211
             GVSP +WTDYL+L+VGGTLSNAGI GQ FR GPQISNV ELDVITGKGE ++CS  +N E
Sbjct  165   GVSPVTWTDYLYLSVGGTLSNAGIGGQTFRHGPQISNVHELDVITGKGEMMSCSPKLNPE  224

Query  1210  LFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISIN---GLNY  1040
             LF+ VLGGLGQFGIITRARI L  APTRVKW R+LY DFS F RDQE LIS+    G+++
Sbjct  225   LFYGVLGGLGQFGIITRARIALGHAPTRVKWSRILYSDFSAFKRDQERLISMTNDLGVDF  284

Query  1039  LEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGSTVDQELK  860
             LEG LMM++   +   +SFF LSDQ+++ASL+    ++Y LEV K YD +T    D  + 
Sbjct  285   LEGQLMMSNGIVD---TSFFPLSDQTRVASLVNDHRIIYVLEVAKCYDSKTLPITDLVMD  341

Query  859   DLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKSRILDFN  680
              L + L F PG  F +D  YF+FLNRVR EE + +  GLWE  HPWLN+FVPKSRILDF+
Sbjct  342   MLSRTLGFAPGFMFIQDVPYFDFLNRVRNEEEKLRSLGLWEVPHPWLNIFVPKSRILDFH  401

Query  679   SAVFQNILLKH-KTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYS-GGMNGWKVL  506
               V   +LL    T+G  L YPT    W+ RMS + P+ED FY +GLL S GG   W+ L
Sbjct  402   DGVIHGLLLNQTATAGVTLFYPTNRNKWNNRMSTMSPDEDVFYVIGLLQSAGGSQNWQEL  461

Query  505   DELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFDPKMILSP  326
             + LN +I+ FC   +  G KIK+YL HY  +EDW+KHFG KW+ F   K  FDPK +LSP
Sbjct  462   ENLNDKIIQFC---ENSGIKIKEYLMHYTRKEDWIKHFGPKWDDFLRRKIMFDPKRLLSP  518

Query  325   GQTIFN  308
             GQ IFN
Sbjct  519   GQDIFN  524



>sp|Q6YW50.1|CKX7_ORYSJ RecName: Full=Cytokinin dehydrogenase 7; AltName: Full=Cytokinin 
oxidase 7; Short=OsCKX7; Flags: Precursor [Oryza sativa 
Japonica Group]
 dbj|BAD17197.1| putative cytokinin dehydrogenase 1 precursor [Oryza sativa Japonica 
Group]
 dbj|BAD17610.1| putative cytokinin dehydrogenase 1 precursor [Oryza sativa Japonica 
Group]
Length=524

 Score =   500 bits (1288),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 250/495 (51%), Positives = 335/495 (68%), Gaps = 12/495 (2%)
 Frame = -1

Query  1768  LPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPS  1589
             LP ++ ++ +A + RVD  +T  AS+DFG IV   P  VL+P++  +I  LVRFS +SPS
Sbjct  24    LPGDLFALSVASKLRVDRNSTARASSDFGRIVAAAPEAVLHPATPAEIAELVRFSASSPS  83

Query  1588  PFSVAARGHGHSVRGQATAKDGVVVEMGALRGGGKIRVSWSESLGYFADVGGHELWVDVL  1409
             PF VA RG GHS RGQ+ A  GVVV+M AL    + RV+ S     + D GG +LW DVL
Sbjct  84    PFPVAPRGQGHSARGQSLAPGGVVVDMRAL-ASRRGRVNVSAGAAPYVDAGGEQLWADVL  142

Query  1408  HACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCS  1229
              A L HG++P  WTDYL +TV GTLSNAGI GQ FR GPQI+NVLELDVITG G+ +TCS
Sbjct  143   RATLEHGLAPRVWTDYLRITVAGTLSNAGIGGQAFRHGPQIANVLELDVITGTGDMVTCS  202

Query  1228  KDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISIN-  1052
             +D +S+LFFAVLGGLGQFGIITRARI L  AP RV+WVR+ Y D + FT+DQE LIS   
Sbjct  203   RDKDSDLFFAVLGGLGQFGIITRARIGLMPAPKRVRWVRLAYSDVATFTKDQELLISKRA  262

Query  1051  ---GLNYLEGSLMMNHTSPNNWRSS-FFSLSDQSKIASLLTQ--QGLLYCLEVVKHYDDQ  890
                G +Y+EG + +N T     +S+ FFS SD  ++A L ++   G++Y +E   +Y++ 
Sbjct  263   SEAGFDYVEGQVQLNRTLTEGPKSTPFFSSSDIGRLAGLASKSVSGVIYVIEGTMYYNES  322

Query  889   TGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLF  710
             T +T+DQ+L+ +L  LSF  G  F KD  Y +FL+RVR EE   +  G+W+  HPWLNLF
Sbjct  323   TSTTMDQKLESILGQLSFEEGFVFTKDVRYVQFLDRVREEERVLRSIGMWDVPHPWLNLF  382

Query  709   VPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSG  530
             VP+SRILDF++ VF+ +       G +L+YP  T MWD+ M AV  ++D FY VGLL S 
Sbjct  383   VPRSRILDFDAGVFKGVFAGANPVGVILMYPMNTNMWDDCMMAVASDDDVFYAVGLLRSA  442

Query  529   GMNG-WKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAK  353
              + G  + L++ N+ +L+FC+ +D      KQYLP+Y S++ W +HFG KW+   + KAK
Sbjct  443   AVIGDVERLEKENEAVLAFCHNED---IGCKQYLPYYTSQDGWQRHFGAKWSRVADLKAK  499

Query  352   FDPKMILSPGQTIFN  308
             +DP  ILSPGQ IF+
Sbjct  500   YDPHRILSPGQRIFS  514



>ref|NP_565455.1| cytokinin oxidase 2 [Arabidopsis thaliana]
 sp|Q9FUJ3.2|CKX2_ARATH RecName: Full=Cytokinin dehydrogenase 2; AltName: Full=Cytokinin 
oxidase 2; Short=AtCKX2; Short=CKO 2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAD10149.2| putative cytokinin oxidase [Arabidopsis thaliana]
 gb|AAO42130.1| putative cytokinin oxidase [Arabidopsis thaliana]
 gb|AAO64073.1| putative cytokinin oxidase [Arabidopsis thaliana]
 gb|AEC06889.1| cytokinin oxidase 2 [Arabidopsis thaliana]
Length=501

 Score =   499 bits (1285),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 255/476 (54%), Positives = 323/476 (68%), Gaps = 18/476 (4%)
 Frame = -1

Query  1720  DSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSPFSVAARGHGHSVRGQ  1541
             D    +AAS DFG I   TP GV+ PSS  DI  L++++ N  S F VAARG GHS+ GQ
Sbjct  38    DPSIISAASHDFGNITTVTPGGVICPSSTADISRLLQYAANGKSTFQVAARGQGHSLNGQ  97

Query  1540  ATAKDGVVVEMGALRGGGKIRVSWSESLGYFADVGGHELWVDVLHACLAHGVSPASWTDY  1361
             A+   GV+V M  +     + VS  +    +ADV    LWVDVL      GVSP SWTDY
Sbjct  98    ASVSGGVIVNMTCIT---DVVVSKDKK---YADVAAGTLWVDVLKKTAEKGVSPVSWTDY  151

Query  1360  LHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDMNSELFFAVLGGLG  1181
             LH+TVGGTLSN GI GQ+FR GP +SNVLELDVITGKGE +TCS+ +N ELF+ VLGGLG
Sbjct  152   LHITVGGTLSNGGIGGQVFRNGPLVSNVLELDVITGKGEMLTCSRQLNPELFYGVLGGLG  211

Query  1180  QFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISIN---GLNYLEGSLMMNHT  1010
             QFGIITRARIVL+ AP R KW RMLY DF+ FT+DQE LIS+    G++YLEG + +++ 
Sbjct  212   QFGIITRARIVLDHAPKRAKWFRMLYSDFTTFTKDQERLISMANDIGVDYLEGQIFLSNG  271

Query  1009  SPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGSTVDQELKDLLKDLSFVP  830
               +   +SFF  SDQSK+A L+ Q G++Y LEV K+YDD     + + +  L K LS++P
Sbjct  272   VVD---TSFFPPSDQSKVADLVKQHGIIYVLEVAKYYDDPNLPIISKVIDTLTKTLSYLP  328

Query  829   GMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKSRILDFNSAVFQNILLK  650
             G     D +YF+FLNRV  EE + +  GLWE  HPWLNL+VPKSRILDF++ V ++ILLK
Sbjct  329   GFISMHDVAYFDFLNRVHVEENKLRSLGLWELPHPWLNLYVPKSRILDFHNGVVKDILLK  388

Query  649   HKT-SGPMLVYPTTTKMWDERMSAVIPE--EDTFYCVGLLYSGGMNGWKVLDELNQEILS  479
              K+ SG  L+YPT    WD RMSA+IPE  ED  Y +GLL S        ++ +N++I+ 
Sbjct  389   QKSASGLALLYPTNRNKWDNRMSAMIPEIDEDVIYIIGLLQSATPKDLPEVESVNEKIIR  448

Query  478   FCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFDPKMILSPGQTIF  311
             FC    + G KIKQYL HY S+EDW++HFG KW+ F + K  FDPK +LSPGQ IF
Sbjct  449   FCK---DSGIKIKQYLMHYTSKEDWIEHFGSKWDDFSKRKDLFDPKKLLSPGQDIF  501



>gb|ADB45879.1| cytokinin oxidase/dehydrogenase [Bambusa oldhamii]
Length=523

 Score =   500 bits (1287),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 245/500 (49%), Positives = 330/500 (66%), Gaps = 13/500 (3%)
 Frame = -1

Query  1783  PWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFS  1604
             PW   L  E+  +  AG+ R+D  AT  ASTDFG +    PA VL+P S DD+  L+R +
Sbjct  25    PWTLPLSGELAVLAAAGKLRMDPNATVPASTDFGNVTSALPAAVLFPDSPDDVAALLRAA  84

Query  1603  YNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGALRGGGKIRVSWSESLGYFADVGGHEL  1424
             +  P+P +VA RG GHSV GQA A  GVVV M ++      R++ S   G + D GG +L
Sbjct  85    HAYPAPITVAFRGRGHSVMGQALAPGGVVVHMPSMGAAAAPRINVSAD-GSYVDAGGEQL  143

Query  1423  WVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGE  1244
             W DVL A  A GV+P +WTDYL LTVGGTLSNAG+SGQ FR GPQI+NV ELDVITGKGE
Sbjct  144   WADVLRAATARGVAPRAWTDYLRLTVGGTLSNAGVSGQAFRHGPQIANVYELDVITGKGE  203

Query  1243  FITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHL  1064
              +TCSK + SELF AVLGGLGQFG+ITRARI ++ AP R +W+R++Y D + FT DQE L
Sbjct  204   MVTCSKRVRSELFDAVLGGLGQFGVITRARIAMDPAPMRTRWLRLIYTDVASFTADQERL  263

Query  1063  I------SINGLNYLEGSLMMNHTSPNNWRS-SFFSLSDQSKIASLLTQQ--GLLYCLEV  911
                     +  ++Y+EGS+ +N +  +  ++ +FFS  D  +IA+L  ++   ++Y +E 
Sbjct  264   AVPGRDGVLGPVSYVEGSVYVNRSLASGLKATAFFSDGDVERIAALAERRNAAVVYSIEA  323

Query  910   VKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEAT  731
               HY+  T  +VDQE++ LL++LS+  G +F++D  Y EFL+RV  EEL  ++ GLW   
Sbjct  324   AVHYNRTTAGSVDQEVRALLEELSYEEGFSFERDVPYVEFLDRVHHEELVLEKAGLWRVP  383

Query  730   HPWLNLFVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYC  551
             HPWL LFVP+SRILDF+  VF+ IL     +GP+LVYP +   WD+ MSA+ P+E+ FY 
Sbjct  384   HPWLMLFVPRSRILDFDIGVFKGILRHADIAGPLLVYPMSKSKWDDGMSAMTPDENVFYA  443

Query  550   VGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTF  371
             V +L+S   +  + ++  N+ IL FC   D  G   KQYLPHY S  +W  HFG KW+ F
Sbjct  444   VNMLFSSVKHDLRRMEVRNRRILQFC---DRAGIGYKQYLPHYTSHAEWASHFGAKWDRF  500

Query  370   QENKAKFDPKMILSPGQTIF  311
              E K K+DP+ +LSPGQ IF
Sbjct  501   VEMKNKYDPRKMLSPGQKIF  520



>ref|XP_009609662.1| PREDICTED: cytokinin dehydrogenase 5 [Nicotiana tomentosiformis]
Length=527

 Score =   499 bits (1284),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 252/476 (53%), Positives = 322/476 (68%), Gaps = 18/476 (4%)
 Frame = -1

Query  1699  ASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSPFSVAARGHGHSVRGQATAKDGV  1520
             AS DFG + +  P  VL+P++ +D+  LV+ +Y+S   F+V+ARGHGHS+ GQA    GV
Sbjct  46    ASVDFGRLHRAEPMAVLHPATAEDVARLVKAAYDSARGFTVSARGHGHSINGQAMTTKGV  105

Query  1519  VVEM-GALRGGGKIRVSWSESLGYFADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVG  1343
             V++M G      K+    SE   Y ADV G ELW+DVL + L +G++P SWTDYL+L+VG
Sbjct  106   VIQMSGGSNSKQKLLTEVSEKFMY-ADVWGGELWIDVLTSTLEYGLAPKSWTDYLYLSVG  164

Query  1342  GTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDMNSELFFAVLGGLGQFGIIT  1163
             GTLSNAGISGQ F  GPQI+NV ELDV+TGKGE +TCS+  NSELF A LGGLGQFGIIT
Sbjct  165   GTLSNAGISGQAFNHGPQINNVHELDVVTGKGELLTCSEKENSELFHAALGGLGQFGIIT  224

Query  1162  RARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISING------LNYLEGSLMMNHTSPN  1001
             RARI LE+AP RV+W+R+LY +FS FT DQE+LIS+         +Y+EG ++++    N
Sbjct  225   RARIALEQAPQRVRWIRVLYSNFSTFTEDQEYLISLQAKPASQKFDYVEGFVIVDEGLIN  284

Query  1000  NWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMT  821
             NWRSSFFS S+  KI+SL    G+LYCLE+ K+Y       VDQE++ LLK L ++P   
Sbjct  285   NWRSSFFSPSNPVKISSLKADGGVLYCLEITKNYHLSNADIVDQEIETLLKKLKYIPASV  344

Query  820   FKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKSRILDFNSAVFQNILLKHKT  641
             F  D  Y +FL+RV   EL+ +  GLWE  HPWLNLFVPKSRI+DF+  VF+ I L +KT
Sbjct  345   FTTDLPYVDFLDRVHKAELKLRSKGLWEVPHPWLNLFVPKSRIVDFDKGVFKGI-LGNKT  403

Query  640   SGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSGGMNG-----WKVLDELNQEILSF  476
             SGP+L+YP     WDER S V PEE+ FY VG L S   N       + L   N EIL F
Sbjct  404   SGPILIYPMNKNKWDERSSVVTPEEEVFYLVGFLRSALTNSDETQTLEYLSNQNYEILKF  463

Query  475   CNKDDEEGSKIKQYLPHYRSREDWMKHFGKK-WNTFQENKAKFDPKMILSPGQTIF  311
             C   ++   KIKQYLPHY ++ +W  HFG K W  FQ+ K +FDP+ IL+ GQ IF
Sbjct  464   C---EDANIKIKQYLPHYTTQREWRDHFGDKYWTRFQQRKLEFDPRHILATGQRIF  516



>gb|KDP25108.1| hypothetical protein JCGZ_22643 [Jatropha curcas]
Length=515

 Score =   498 bits (1282),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 248/489 (51%), Positives = 336/489 (69%), Gaps = 27/489 (6%)
 Frame = -1

Query  1744  DIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSPFSVAARG  1565
             +++ +  VD+ +  + STD+G IV   PA VLYP+SV DI +LV+ S+    PF ++ RG
Sbjct  40    ELSDKLHVDATSIESVSTDYGNIVHNKPAAVLYPTSVQDISSLVKASFMCCVPFGISVRG  99

Query  1564  HGHSVRGQATAKDGVVVEMGALRGGGK-IRVSWSESLGYFADVGGHELWVDVLHACLAHG  1388
             +GHS  GQ  A +GVVV+M  LR  GK I +        FADVGG +LW+DVL+A +  G
Sbjct  100   NGHSTHGQDMAYNGVVVDMKGLRDSGKGISIDKERR---FADVGGEQLWIDVLNATVKEG  156

Query  1387  VSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDMNSEL  1208
             VS  SWTDYL L+VGGTLSNAGISGQ FR GPQISNV E+DV+TGKGE +TCS+  NSEL
Sbjct  157   VSAVSWTDYLKLSVGGTLSNAGISGQAFRYGPQISNVYEMDVVTGKGELLTCSRYNNSEL  216

Query  1207  FFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLIS--------IN  1052
             F+AVLGGLGQFGIITRARI L+    RV+W ++LY +FS F   +E+ IS        IN
Sbjct  217   FYAVLGGLGQFGIITRARIALDTHINRVRWTQILYSNFSDFIEAEEYYISQLSENEQRIN  276

Query  1051  GLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGSTVD  872
              ++YLEG ++ ++ +PNNWR+ FF  +D  KI SL+   G++Y +EV        GS+ D
Sbjct  277   EISYLEGGILFDNGTPNNWRNFFFPPADIPKITSLIKNYGIIYSVEVAT----TIGSSAD  332

Query  871   QELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKSRI  692
             + L+ L++ L+ VP  ++ K+ SY +FL RV   ++  Q+N     +HPWLN+F+PKS I
Sbjct  333   KHLQRLMEGLNNVPEYSYAKNVSYVDFLTRV---QITVQKN----ESHPWLNIFIPKSGI  385

Query  691   LDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSGGMNGW  515
              DFNS VF++I+LK   T GP+L YP     WD+RMSAVIP+ED FY  G+LY+ G N W
Sbjct  386   SDFNSGVFRDIVLKQNITRGPVLFYPMLRDKWDDRMSAVIPDEDIFYAAGILYTSGANDW  445

Query  514   KVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFDPKMI  335
             +V ++ N+ I+ FC   D+ G ++KQYLP+Y ++ +W+ HFG KW TF++ KA FDPK I
Sbjct  446   QVYEDQNKAIMEFC---DKYGIEVKQYLPNYATKNEWITHFGSKWATFKQRKALFDPKNI  502

Query  334   LSPGQTIFN  308
             +SPGQ IFN
Sbjct  503   MSPGQRIFN  511



>ref|XP_010907734.1| PREDICTED: cytokinin dehydrogenase 5-like [Elaeis guineensis]
Length=540

 Score =   499 bits (1284),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 253/489 (52%), Positives = 333/489 (68%), Gaps = 22/489 (4%)
 Frame = -1

Query  1723  VDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSPFSVAARGHGHSVRG  1544
             +D      AS DFGG+ +  P  V+ P+S  D+++LVR +Y S   F V+ARGHGHS+ G
Sbjct  39    LDRSDVGRASVDFGGMTRAEPMAVMRPASAGDVVSLVRAAYGSAQGFPVSARGHGHSING  98

Query  1543  QATAKDGVVVEMG----ALRGGGKIRVSWSESLG-YFADVGGHELWVDVLHACLAHG-VS  1382
             QA A  GVV+EM     A+    + R  +S+SL  Y+ DV G ELW+D+L+  L +G ++
Sbjct  99    QAQAPGGVVIEMSQYGRAVGPRERSRPVYSQSLEEYYVDVWGGELWIDILNWTLENGGLA  158

Query  1381  PASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDMNSELFF  1202
             P SWTDYL+L+VGGTLSNAGISGQ F  GPQISNV ELDV+TGKGE +TCSK+ NSELF+
Sbjct  159   PKSWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVYELDVVTGKGEILTCSKEQNSELFY  218

Query  1201  AVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISING------LNY  1040
              VLGGLGQFGIITRARI LE AP RV+W+R+LY +F+ FTRDQEHLIS++        +Y
Sbjct  219   GVLGGLGQFGIITRARIALEPAPRRVRWIRVLYSNFTTFTRDQEHLISLHTAHRSERFDY  278

Query  1039  LEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGSTVDQELK  860
             +EG ++++    NNWRSSFFS  +  KI+S+ +  G+LYCLE+ K++D+   S +DQE++
Sbjct  279   VEGFVIVDEGLINNWRSSFFSPRNPVKISSIGSNGGVLYCLEMTKNHDESAASLLDQEVE  338

Query  859   DLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKSRILDFN  680
              LLK L FVP   F  D  Y +FL+RV   EL+ +  G+W+  HPWLNLFVP SRI DF+
Sbjct  339   ALLKKLEFVPASVFMTDLPYADFLDRVHKGELKLRAKGMWDVPHPWLNLFVPGSRIADFD  398

Query  679   SAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSG------GMNG  518
               VF+ I L +KTSGP+L+YP     WDER S V P+E+ FY V  L S           
Sbjct  399   RGVFRTI-LGNKTSGPILIYPMNKHKWDERSSVVTPDEEVFYVVAFLRSALPDSDESTQS  457

Query  517   WKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFDPKM  338
              + L + N+ IL+FC   DE G ++KQYLPH+ +R +W +HFG KW  F + KA+FDP+ 
Sbjct  458   LEYLSDQNERILAFC---DEAGIEVKQYLPHHVTRAEWARHFGAKWGRFLKLKAQFDPEC  514

Query  337   ILSPGQTIF  311
             IL  GQ IF
Sbjct  515   ILGLGQGIF  523



>ref|XP_010433070.1| PREDICTED: cytokinin dehydrogenase 4 [Camelina sativa]
Length=525

 Score =   498 bits (1282),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 259/486 (53%), Positives = 322/486 (66%), Gaps = 21/486 (4%)
 Frame = -1

Query  1720  DSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRF-----SYNS----PSP-FSVAA  1571
             D  + +AAS DFG I  E+P  VL PSS  ++  L+ F     SYN     P P F VAA
Sbjct  46    DPFSISAASHDFGNITDESPGAVLCPSSPTEVARLLGFANGGFSYNGVSTIPEPTFKVAA  105

Query  1570  RGHGHSVRGQATAKDGVVVEMGALRGGGKIRVSWSESLGYFADVGGHELWVDVLHACLAH  1391
             RG GHS+RGQA+A  G+VV M  L    K       + G +ADV    +WVDVL A +  
Sbjct  106   RGQGHSLRGQASAPGGIVVNMTCLAMAAKPAAVVVSADGTYADVAAGTMWVDVLKAAVER  165

Query  1390  GVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDMNSE  1211
             GVSP +WTDYL+L+VGGTLSNAGI GQ FR GPQISNV ELDVITGKG+ +TCS  +N E
Sbjct  166   GVSPVTWTDYLYLSVGGTLSNAGIGGQTFRHGPQISNVHELDVITGKGKMMTCSPKLNPE  225

Query  1210  LFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISIN---GLNY  1040
             LF+ VLGGLGQFGIITRARI L  APTRVKW R+LY DFS F RDQE LIS+    G+++
Sbjct  226   LFYGVLGGLGQFGIITRARIALGHAPTRVKWSRILYSDFSAFKRDQERLISMTNDLGVDF  285

Query  1039  LEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGSTVDQELK  860
             LEG LMM++   +   +SFF LSDQ+++ASL+    ++Y LEV K+YD  T   + Q + 
Sbjct  286   LEGQLMMSNGIVD---TSFFPLSDQTRVASLVNDHRIIYVLEVAKYYDSTTLPIIGQVMD  342

Query  859   DLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKSRILDFN  680
              L + L F PG  F +D  YF+FLNRVR EE + +  GLWE  HPWLN+FVP+SRI DF+
Sbjct  343   MLSRTLGFAPGFMFIQDVPYFDFLNRVRNEEEKLRSLGLWEVPHPWLNIFVPESRIQDFH  402

Query  679   SAVFQNILLKH-KTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYS-GGMNGWKVL  506
               V   +LL    T+G  L YPT    W++RMS + P+ED FY +GLL S GG   W+ L
Sbjct  403   DGVINGLLLNQTATAGVTLFYPTNRNKWNDRMSTMSPDEDVFYVIGLLQSAGGSQNWQEL  462

Query  505   DELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFDPKMILSP  326
             + LN +I+ FC   +  G KIK+YL HY  +EDW+KHFG KW+ F   K  FDPK +LSP
Sbjct  463   ENLNDKIIQFC---ENSGIKIKEYLMHYIRKEDWVKHFGPKWDDFLRRKIMFDPKRLLSP  519

Query  325   GQTIFN  308
             GQ IFN
Sbjct  520   GQDIFN  525



>ref|XP_002889026.1| hypothetical protein ARALYDRAFT_476695 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65285.1| hypothetical protein ARALYDRAFT_476695 [Arabidopsis lyrata subsp. 
lyrata]
Length=537

 Score =   498 bits (1283),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 257/499 (52%), Positives = 337/499 (68%), Gaps = 19/499 (4%)
 Frame = -1

Query  1765  PYEIL---SVDIAGRFRVDSRATTAASTDFGGIVQ-ETPAGVLYPSSVDDIINLVRFSYN  1598
             P E+L   ++D+ G F V   A  + S+DFG +   E P  VL+PSS +D+  LVR +Y 
Sbjct  29    PSELLHIGAIDVDGHFTVHPSALASVSSDFGMLRSPEEPLAVLHPSSAEDVARLVRTAYG  88

Query  1597  SPSPFSVAARGHGHSVRGQATA-KDGVVVEMGALRGGGKIRVSWSESLGYFADVGGHELW  1421
             S + F V+ARGHGHS+ GQA A ++GVVVEM     G    +   + +  + DV G ELW
Sbjct  89    SATAFPVSARGHGHSINGQAAAGRNGVVVEMNHGVTGTPESLVRPDEM--YVDVWGGELW  146

Query  1420  VDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEF  1241
             VDVL   L +G++P SWTDYL+LTVGGTLSNAGISGQ F  GPQISNVLELDV+TGKGE 
Sbjct  147   VDVLKKTLEYGLAPKSWTDYLYLTVGGTLSNAGISGQAFHHGPQISNVLELDVVTGKGEV  206

Query  1240  ITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLI  1061
             + CS++ N+ LF  VLGGLGQFGIITRARI LE AP RV+W+R+LY  F  FT DQE+LI
Sbjct  207   MRCSEEENTRLFHGVLGGLGQFGIITRARISLEPAPQRVRWIRVLYSSFKVFTEDQEYLI  266

Query  1060  SING---LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQ  890
             S++G    +Y+EG ++++    NNWRSSFFS  +  KI+S+ +   +LYCLE+ K+Y D 
Sbjct  267   SMHGQLKFDYVEGFVIVDEGLVNNWRSSFFSPRNPVKISSVSSNGSVLYCLEITKNYHDS  326

Query  889   TGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLF  710
                TVDQE++ L+K L+F+P   F  D  Y +FL+RV   EL+ +   LWE  HPWLNLF
Sbjct  327   DSETVDQEVEILMKKLNFIPTSVFTTDLQYVDFLDRVHKAELKLRSKNLWEVPHPWLNLF  386

Query  709   VPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSG  530
             VPKSRI DF+  VF+ I L +KTSGP+L+YP     WDER SAV P+E+ FY V LL S 
Sbjct  387   VPKSRISDFDKGVFKGI-LGNKTSGPILIYPMNKDKWDERSSAVTPDEEVFYLVALLRSA  445

Query  529   GMNG-----WKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQE  365
               +G      + L + N+ IL FC   ++    +KQYLPH+ ++E+W  HFG KW+ F+ 
Sbjct  446   LTDGEETQKLEYLKDQNRRILEFC---EQAKINVKQYLPHHATQEEWEAHFGDKWDRFRR  502

Query  364   NKAKFDPKMILSPGQTIFN  308
              KA+FDP+ IL+ GQ IF 
Sbjct  503   LKAEFDPRHILATGQRIFQ  521



>ref|XP_010447814.1| PREDICTED: cytokinin dehydrogenase 4-like [Camelina sativa]
Length=524

 Score =   498 bits (1282),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 260/486 (53%), Positives = 320/486 (66%), Gaps = 21/486 (4%)
 Frame = -1

Query  1720  DSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRF-----SYNS----PSP-FSVAA  1571
             D  + +AAS DFG I  E+P  VL PSS  ++  L+ F     SYN     P P F VAA
Sbjct  45    DPFSISAASHDFGNITDESPGAVLCPSSPTEVARLLGFANGGFSYNGVSSIPEPTFKVAA  104

Query  1570  RGHGHSVRGQATAKDGVVVEMGALRGGGKIRVSWSESLGYFADVGGHELWVDVLHACLAH  1391
             RG GHS+RGQA+A  G+VV M  L    K       + G +ADV    +WVDVL A +  
Sbjct  105   RGQGHSLRGQASAPGGIVVNMTCLAMAAKPAAVVISADGTYADVAAGTMWVDVLKAAVER  164

Query  1390  GVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDMNSE  1211
             GVSP +WTDYL+L+VGGTLSNAGI GQ FR GPQISNV ELDVITGKG+ +TCS  +N E
Sbjct  165   GVSPVTWTDYLYLSVGGTLSNAGIGGQTFRHGPQISNVHELDVITGKGDLMTCSPKLNPE  224

Query  1210  LFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISIN---GLNY  1040
             LF+ VLGGLGQFGIITRARI L  APTRVKW R+LY DFS F RDQE LIS+    G+++
Sbjct  225   LFYGVLGGLGQFGIITRARIALGHAPTRVKWSRILYSDFSAFKRDQERLISMTNDLGVDF  284

Query  1039  LEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGSTVDQELK  860
             LEG LMM++   +   +SFF LSDQ+++ASL+    ++Y LEV K+YD  T   ++  + 
Sbjct  285   LEGQLMMSNGIVD---TSFFPLSDQTRVASLVNDHRIIYVLEVAKYYDSTTLPIINLVMD  341

Query  859   DLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKSRILDFN  680
              L K L F PG  F +D  YF+FLNRVR EE + +  GLWE  HPWLN+FVPKSRILDF+
Sbjct  342   MLSKTLGFAPGFMFIQDVPYFDFLNRVRNEEEKLRSLGLWEVPHPWLNIFVPKSRILDFH  401

Query  679   SAVFQNILLKH-KTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYS-GGMNGWKVL  506
               V   +LL    T+G  L YPT    W+  MS + P+ED FY +GLL S GG   W+ L
Sbjct  402   DGVISGLLLNQTATAGVTLFYPTNRNKWNNLMSTMSPDEDVFYVIGLLQSAGGSQNWQEL  461

Query  505   DELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFDPKMILSP  326
             + LN +I+ FC   +  G KIK+YL HY  +EDW+KHFG KW  F   K  FDPK +LSP
Sbjct  462   ENLNDKIIQFC---ENSGIKIKEYLMHYTRKEDWIKHFGPKWYDFLRRKIMFDPKRLLSP  518

Query  325   GQTIFN  308
             GQ IFN
Sbjct  519   GQDIFN  524



>ref|XP_009137860.1| PREDICTED: cytokinin dehydrogenase 4 [Brassica rapa]
Length=524

 Score =   498 bits (1281),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 258/486 (53%), Positives = 324/486 (67%), Gaps = 21/486 (4%)
 Frame = -1

Query  1720  DSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRF-----SYNSPSP-----FSVAA  1571
             D  + +AAS DFG I    P  VL PS+  ++  L+RF     SY+S S      F VAA
Sbjct  45    DPFSISAASRDFGNITDVNPGAVLCPSTPAEVARLLRFANGDFSYDSESTTSSPGFKVAA  104

Query  1570  RGHGHSVRGQATAKDGVVVEMGALRGGGKIRVSWSESLGYFADVGGHELWVDVLHACLAH  1391
             RG GHS+RGQA+A  GVVV M  L            + G +ADV    +WV+VL A LA 
Sbjct  105   RGQGHSLRGQASAPGGVVVNMTCLAKTATPAAVVVSTHGTYADVAAGAMWVEVLEAALAR  164

Query  1390  GVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDMNSE  1211
             GVSP ++TDYL+L+VGGTLSNAGI GQ+FR GPQISNV ELDVITGKG  +TCS  +N E
Sbjct  165   GVSPVTFTDYLYLSVGGTLSNAGIGGQVFRHGPQISNVHELDVITGKGGMVTCSPKLNPE  224

Query  1210  LFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISING---LNY  1040
             LF+ VLGGLGQFGIITRARI L+ APTRVKW+R+LY DFS FTRDQE LIS+     +++
Sbjct  225   LFYGVLGGLGQFGIITRARIALDHAPTRVKWLRILYSDFSAFTRDQERLISMANDLRVDF  284

Query  1039  LEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGSTVDQELK  860
             LEG LMM++   +   +SFF LSDQ+++ASL+ +  ++Y LEV K+YD  T   +DQ + 
Sbjct  285   LEGQLMMSNGIVD---TSFFPLSDQTRVASLVNEHRIIYVLEVAKYYDTTTLPIIDQVID  341

Query  859   DLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKSRILDFN  680
              L + L F     F +D  YF+FLNRVR EE + +  GLWE  HPWLN+FVPKSR+LDF+
Sbjct  342   TLTRTLGFTSEFMFMQDVPYFDFLNRVRNEEDKLRSIGLWEVPHPWLNMFVPKSRVLDFH  401

Query  679   SAVFQNILLKH-KTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYS-GGMNGWKVL  506
               V + +LL    TSG  L YPT    W+  MSA+IP ED FY VG L S GG + ++ L
Sbjct  402   EGVIKGLLLNQTATSGVTLFYPTNRNKWNNLMSAMIPNEDVFYVVGFLQSAGGSHNFEEL  461

Query  505   DELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFDPKMILSP  326
             + LN  I++FCN     G KIK+YL HY  +EDW+KHFG KW+ F   K  FDP+ +LSP
Sbjct  462   ESLNDRIINFCNN---SGIKIKEYLMHYTKKEDWIKHFGPKWSDFSRRKMMFDPEKLLSP  518

Query  325   GQTIFN  308
             GQ IFN
Sbjct  519   GQDIFN  524



>sp|Q5Z620.1|CKX10_ORYSJ RecName: Full=Cytokinin dehydrogenase 10; AltName: Full=Cytokinin 
oxidase 10; Short=OsCKX10; Flags: Precursor [Oryza sativa 
Japonica Group]
 dbj|BAD61835.1| putative cytokinin oxidase [Oryza sativa Japonica Group]
 dbj|BAD61939.1| putative cytokinin oxidase [Oryza sativa Japonica Group]
Length=550

 Score =   499 bits (1284),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 263/502 (52%), Positives = 329/502 (66%), Gaps = 24/502 (5%)
 Frame = -1

Query  1762  YEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSPF  1583
             Y++ S+DI  +   D  ATT AS+DFG IV  TP GV  P+   DI  L+R S + P+PF
Sbjct  35    YDVSSLDIMSKIHTDHDATTKASSDFGHIVHATPNGVFRPTFPADIAALIRLSLSQPTPF  94

Query  1582  SVAARGHGHSVRGQATAKDGVVVEMGALRGGG-----KIRVSWSESLGYFADVGGHELWV  1418
             +VA RG GHS RGQA A  G+VV+M AL   G     +I VS       + D GG +LW+
Sbjct  95    TVAPRGKGHSSRGQAFAPGGIVVDMSALGDHGHHTSHRIDVSVDR---MYVDAGGEQLWI  151

Query  1417  DVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFI  1238
             DVLH  L HG++P  WTDYL +TVGGTLSNAGI GQ FR GPQISNV ELDV+TG GE I
Sbjct  152   DVLHTALKHGLTPRVWTDYLRITVGGTLSNAGIGGQAFRHGPQISNVHELDVVTGMGEMI  211

Query  1237  TCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLIS  1058
             TCS ++NS LFFAVLGGLGQFG+ITRARI LE AP RVKWVR+ Y D   FT DQE LIS
Sbjct  212   TCSPEVNSALFFAVLGGLGQFGVITRARIRLEPAPKRVKWVRIAYSDVHPFTTDQELLIS  271

Query  1057  I----NGLNYLEGSLMMNHTSPNNWR-SSFFSLSDQSKIASLLTQQG--LLYCLEVVKHY  899
                  +G +Y+EG + +N T     R SSFFS +D +++  L    G   +Y +E   +Y
Sbjct  272   KWASGSGFDYVEGQVQLNRTLTQGRRSSSFFSATDLARLTGLAIDTGSVAIYYIEGAMYY  331

Query  898   DDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWL  719
             DD T ++VDQ+L  LL++LSFV G  F +DASY EFL+RV  EE   +  G W+  HPWL
Sbjct  332   DDNTAASVDQKLDALLEELSFVRGFVFVRDASYVEFLDRVGREEQNLRSAGAWDVPHPWL  391

Query  718   NLFVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLL  539
             NLFVP+SRIL F++AVF+ IL      G +L+YP    MWD+RM+A+ P+ED FY VGLL
Sbjct  392   NLFVPRSRILHFDAAVFKGILRNANPVGLILMYPMNKDMWDDRMTAMTPDEDVFYAVGLL  451

Query  538   YS---GGMNG-WKVLDELNQEILSFCNKDDEEGSKI--KQYLPHYRSREDWMKHFGKKWN  377
              S   GG  G  + L+  N  +L  C   D  G  I  +QYLPH+ SR+ W +HFG KW 
Sbjct  452   RSAVAGGSGGDVEQLERENAAVLELC---DLAGGGIGCRQYLPHHASRDGWRRHFGAKWG  508

Query  376   TFQENKAKFDPKMILSPGQTIF  311
                + KA++DP+ ILSPGQ IF
Sbjct  509   RVADLKARYDPRAILSPGQGIF  530



>ref|NP_177678.2| cytokinin dehydrogenase 5 [Arabidopsis thaliana]
 sp|Q67YU0.1|CKX5_ARATH RecName: Full=Cytokinin dehydrogenase 5; AltName: Full=Cytokinin 
oxidase 5; Short=AtCKX5; Short=AtCKX6; Short=CKO5; Flags: 
Precursor [Arabidopsis thaliana]
 dbj|BAD44141.1| cytokinin oxidase (CKX6) [Arabidopsis thaliana]
 gb|AEE35721.1| cytokinin dehydrogenase 5 [Arabidopsis thaliana]
Length=540

 Score =   498 bits (1282),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 259/500 (52%), Positives = 337/500 (67%), Gaps = 21/500 (4%)
 Frame = -1

Query  1765  PYEIL---SVDIAGRFRVDSRATTAASTDFGGIVQ-ETPAGVLYPSSVDDIINLVRFSYN  1598
             P E+L   ++D+ G F V      + S+DFG +   E P  VL+PSS +D+  LVR +Y 
Sbjct  29    PSELLRIGAIDVDGHFTVHPSDLASVSSDFGMLKSPEEPLAVLHPSSAEDVARLVRTAYG  88

Query  1597  SPSPFSVAARGHGHSVRGQATA-KDGVVVEMG-ALRGGGKIRVSWSESLGYFADVGGHEL  1424
             S + F V+ARGHGHS+ GQA A ++GVVVEM   + G  K  V   E    + DV G EL
Sbjct  89    SATAFPVSARGHGHSINGQAAAGRNGVVVEMNHGVTGTPKPLVRPDE---MYVDVWGGEL  145

Query  1423  WVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGE  1244
             WVDVL   L HG++P SWTDYL+LTVGGTLSNAGISGQ F  GPQISNVLELDV+TGKGE
Sbjct  146   WVDVLKKTLEHGLAPKSWTDYLYLTVGGTLSNAGISGQAFHHGPQISNVLELDVVTGKGE  205

Query  1243  FITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHL  1064
              + CS++ N+ LF  VLGGLGQFGIITRARI LE AP RV+W+R+LY  F  FT DQE+L
Sbjct  206   VMRCSEEENTRLFHGVLGGLGQFGIITRARISLEPAPQRVRWIRVLYSSFKVFTEDQEYL  265

Query  1063  ISING---LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDD  893
             IS++G    +Y+EG ++++    NNWRSSFFS  +  KI+S+ +   +LYCLE+ K+Y D
Sbjct  266   ISMHGQLKFDYVEGFVIVDEGLVNNWRSSFFSPRNPVKISSVSSNGSVLYCLEITKNYHD  325

Query  892   QTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNL  713
                  VDQE++ L+K L+F+P   F  D  Y +FL+RV   EL+ +   LWE  HPWLNL
Sbjct  326   SDSEIVDQEVEILMKKLNFIPTSVFTTDLQYVDFLDRVHKAELKLRSKNLWEVPHPWLNL  385

Query  712   FVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYS  533
             FVPKSRI DF+  VF+ I L +KTSGP+L+YP     WDER SAV P+E+ FY V LL S
Sbjct  386   FVPKSRISDFDKGVFKGI-LGNKTSGPILIYPMNKDKWDERSSAVTPDEEVFYLVALLRS  444

Query  532   GGMNG-----WKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQ  368
                +G      + L + N+ IL FC   ++    +KQYLPH+ ++E+W+ HFG KW+ F+
Sbjct  445   ALTDGEETQKLEYLKDQNRRILEFC---EQAKINVKQYLPHHATQEEWVAHFGDKWDRFR  501

Query  367   ENKAKFDPKMILSPGQTIFN  308
               KA+FDP+ IL+ GQ IF 
Sbjct  502   SLKAEFDPRHILATGQRIFQ  521



>ref|XP_004951450.1| PREDICTED: cytokinin dehydrogenase 7-like [Setaria italica]
Length=537

 Score =   498 bits (1282),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 252/511 (49%), Positives = 344/511 (67%), Gaps = 18/511 (4%)
 Frame = -1

Query  1801  ILGKLKPWNSS-LPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDI  1625
             + G+L+P  ++ LP ++ ++ IA R R D  AT  ASTDFG +V   P  V +P +  DI
Sbjct  19    VAGQLRPLPAAGLPGDLFNLGIASRLRTDGNATARASTDFGQMVTAAPEAVFHPRTPADI  78

Query  1624  INLVRFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGAL---RGGGKIRVSWSESLG  1454
               L+RFS +SP+PF VA RG GHS RGQ+ A  GVVV+M ++   R G +I VS + +  
Sbjct  79    AALIRFSASSPAPFPVAPRGQGHSWRGQSLAPGGVVVDMRSMGRGRRGARINVSAAGAEP  138

Query  1453  YFADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVL  1274
             Y  D GG +LW+DVL A L HG++P  WTDYL LTVGGTLSNAGI GQ FR GPQI+NV 
Sbjct  139   Y-VDAGGEQLWIDVLRATLRHGLAPRVWTDYLRLTVGGTLSNAGIGGQAFRHGPQIANVH  197

Query  1273  ELDVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDF  1094
             ELDV+TG GE +TCS+D NS+LFFA LGGLGQFG+ITRARI+LE AP RV+WVR+ Y D 
Sbjct  198   ELDVVTGTGEMVTCSRDKNSDLFFAALGGLGQFGVITRARIMLETAPKRVRWVRLAYTDV  257

Query  1093  SKFTRDQEHLISIN----GLNYLEGSLMMNHTSPNNWRSS-FFSLSDQSKIASLLTQQG-  932
               FT+DQE LIS      G NY+EG + +N +     +S+ FFS +D +++A L  ++G 
Sbjct  258   VTFTKDQEFLISDRAREVGFNYVEGQVQLNRSFAEGPKSTPFFSATDLNRLAKLALRKGS  317

Query  931   -LLYCLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQ  755
               +Y +E   +Y++    +VDQ+++ L+ +LSF PG  F KD ++ +FL+RV  EE   +
Sbjct  318   AAIYYIEGAMYYNEDNPESVDQKMEALMDNLSFEPGFVFTKDVTFVQFLDRVLEEERVLR  377

Query  754   ENGLWEATHPWLNLFVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVI  575
               G+WE  HPWLNLFVP+SRILDF++ VF+ +L     +G +L+YP     WD+RM+A+ 
Sbjct  378   SAGVWEVPHPWLNLFVPRSRILDFDNGVFKGLLRDANPAGIILMYPMNKDKWDDRMTAMT  437

Query  574   P--EEDTFYCVGLLYSG-GMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDW  404
             P  +ED FY V LL+S   ++    L+  N+ +++ C   D+ G K KQYLPH+ S++ W
Sbjct  438   PTDDEDVFYAVSLLWSALSVDEVVKLERENESVMNLC---DKAGIKWKQYLPHHTSQDGW  494

Query  403   MKHFGKKWNTFQENKAKFDPKMILSPGQTIF  311
              +HFG KW    E KAK+DP+ ILSPGQ IF
Sbjct  495   QQHFGAKWGKITELKAKYDPQAILSPGQKIF  525



>gb|AAG30905.1|AF303978_1 cytokinin oxidase [Arabidopsis thaliana]
Length=501

 Score =   496 bits (1277),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 254/476 (53%), Positives = 322/476 (68%), Gaps = 18/476 (4%)
 Frame = -1

Query  1720  DSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSPFSVAARGHGHSVRGQ  1541
             D    +AAS DFG I   TP GV+ PSS  DI  L++++ N  S F VAARG GHS+ GQ
Sbjct  38    DPSIISAASHDFGNITTVTPGGVICPSSTADISRLLQYAANGKSTFQVAARGQGHSLNGQ  97

Query  1540  ATAKDGVVVEMGALRGGGKIRVSWSESLGYFADVGGHELWVDVLHACLAHGVSPASWTDY  1361
             A+   GV+V M  +     + VS  +    +ADV    LWVDVL      GVSP SWTDY
Sbjct  98    ASVSGGVIVNMTCIT---DVVVSKDKK---YADVAAGTLWVDVLKKTAEKGVSPVSWTDY  151

Query  1360  LHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDMNSELFFAVLGGLG  1181
             LH+TV GTLSN GI GQ+FR GP +SNVLELDVITGKGE +TCS+ +N ELF+ VLGGLG
Sbjct  152   LHITVRGTLSNGGIGGQVFRNGPLVSNVLELDVITGKGEMLTCSRQLNPELFYGVLGGLG  211

Query  1180  QFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISIN---GLNYLEGSLMMNHT  1010
             QFGIITRARIVL+ AP R KW RMLY DF+ FT+DQE LIS+    G++YLEG + +++ 
Sbjct  212   QFGIITRARIVLDHAPKRAKWFRMLYSDFTTFTKDQERLISMANDIGVDYLEGQIFLSNG  271

Query  1009  SPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGSTVDQELKDLLKDLSFVP  830
               +   +SFF  SDQSK+A L+ Q G++Y LEV K+YDD     + + +  L K LS++P
Sbjct  272   VVD---TSFFPPSDQSKVADLVKQHGIIYVLEVAKYYDDPNLPIISKVIDTLTKTLSYLP  328

Query  829   GMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKSRILDFNSAVFQNILLK  650
             G     D +YF+FLNRV  EE + +  GLWE  HPWLNL+VPKSRILDF++ V ++ILLK
Sbjct  329   GFISMHDVAYFDFLNRVHVEENKLRSLGLWELPHPWLNLYVPKSRILDFHNGVVKDILLK  388

Query  649   HKT-SGPMLVYPTTTKMWDERMSAVIPE--EDTFYCVGLLYSGGMNGWKVLDELNQEILS  479
              K+ SG  L+YPT    WD RMSA+IPE  ED  Y +GLL S        ++ +N++I+ 
Sbjct  389   QKSASGLALLYPTNRNKWDNRMSAMIPEIDEDVIYIIGLLQSATPKDLPEVESVNEKIIR  448

Query  478   FCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFDPKMILSPGQTIF  311
             FC    + G KIKQYL HY S+EDW++HFG KW+ F + K  FDPK +LSPGQ IF
Sbjct  449   FCK---DSGIKIKQYLMHYTSKEDWIEHFGSKWDDFSKRKDLFDPKKLLSPGQDIF  501



>emb|CDY30204.1| BnaA03g49660D [Brassica napus]
Length=516

 Score =   496 bits (1277),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 256/481 (53%), Positives = 322/481 (67%), Gaps = 19/481 (4%)
 Frame = -1

Query  1720  DSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSP-----FSVAARGHGH  1556
             D  + +AAS DFG I    P  VL PS+  ++     FSY+S S      F VAARG GH
Sbjct  45    DPFSISAASRDFGNITDVNPGAVLCPSTPAEV---AHFSYDSESTTSSPGFKVAARGQGH  101

Query  1555  SVRGQATAKDGVVVEMGALRGGGKIRVSWSESLGYFADVGGHELWVDVLHACLAHGVSPA  1376
             S+RGQA+A  GVVV M  L            + G +ADV    +WV+VL A LA GVSP 
Sbjct  102   SLRGQASAPGGVVVNMTCLAKTATPAAVVVSADGTYADVAAGAMWVEVLEAALARGVSPV  161

Query  1375  SWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDMNSELFFAV  1196
             ++TDYL+L+VGGTLSNAGI GQ+FR GPQISNV ELDVITGKG+ +TCS  +N ELF+ V
Sbjct  162   TFTDYLYLSVGGTLSNAGIGGQVFRHGPQISNVHELDVITGKGDMVTCSPKLNPELFYGV  221

Query  1195  LGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISING---LNYLEGSL  1025
             LGGLGQFGIITRARI L+ APTRVKW+R+LY DFS FTRDQE LIS+     +++LEG L
Sbjct  222   LGGLGQFGIITRARIALDHAPTRVKWLRILYSDFSAFTRDQERLISMANDLRVDFLEGQL  281

Query  1024  MMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGSTVDQELKDLLKD  845
             MM++   +   +SFF LSDQ+++ASL+ +  ++Y LEV K+YD  T   +DQ +  L + 
Sbjct  282   MMSNGIVD---TSFFPLSDQTRVASLVNEHRIIYVLEVAKYYDTTTLPIIDQVIDTLTRT  338

Query  844   LSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKSRILDFNSAVFQ  665
             L F     F +D  YF+FLNRVR EE + +  GLWE  HPWLN+FVPKSR+LDF+  V +
Sbjct  339   LGFTSEFMFMQDVPYFDFLNRVRNEEDKLRSIGLWEVPHPWLNMFVPKSRVLDFHEGVIK  398

Query  664   NILLKH-KTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYS-GGMNGWKVLDELNQ  491
              +LL    TSG  L YPT    W+  MSA+IP ED FY VG L S GG + ++ L+ LN 
Sbjct  399   GLLLNQTATSGVTLFYPTNRNKWNNLMSAMIPNEDVFYVVGFLQSAGGSHNFEELESLND  458

Query  490   EILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFDPKMILSPGQTIF  311
              I++FCN     G KIK+YL HY  +EDW+KHFG KW+ F   K  FDP+ +LSPGQ IF
Sbjct  459   RIINFCNN---SGIKIKEYLMHYTKKEDWIKHFGPKWSDFSRRKMMFDPEKLLSPGQDIF  515

Query  310   N  308
             N
Sbjct  516   N  516



>ref|NP_001185809.1| cytokinin dehydrogenase 8 precursor [Zea mays]
 ref|XP_008679836.1| PREDICTED: cytokinin dehydrogenase 7-like [Zea mays]
 gb|ADP38083.1| cytokinin dehydrogenase 8 [Zea mays]
 gb|AFW66034.1| hypothetical protein ZEAMMB73_850983 [Zea mays]
 gb|AFW66037.1| hypothetical protein ZEAMMB73_202507 [Zea mays]
Length=539

 Score =   497 bits (1279),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 250/500 (50%), Positives = 329/500 (66%), Gaps = 15/500 (3%)
 Frame = -1

Query  1774  SSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNS  1595
             + LP ++  + IA R R DS +T  A+TDFG +V+  P  V +P++  DI  LVRFS  S
Sbjct  31    AGLPGDLFGLGIASRIRTDSNSTAKAATDFGQMVRAAPEAVFHPATPADIAALVRFSATS  90

Query  1594  PSPFSVAARGHGHSVRGQATAKDGVVVEMGALRGGGKIRVSWSESLGYFADVGGHELWVD  1415
              +PF VA RG GHS RGQA A  GVVV+MG+L  G +I VS +     F D GG +LWVD
Sbjct  91    AAPFPVAPRGQGHSWRGQALAPGGVVVDMGSLGRGPRINVSAATGAEPFVDAGGEQLWVD  150

Query  1414  VLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFIT  1235
             VL A L HG++P  WTDYL LTVGGTLSNAGI GQ FR GPQI+NV ELDV+TG GE +T
Sbjct  151   VLRATLRHGLAPRVWTDYLRLTVGGTLSNAGIGGQAFRHGPQIANVHELDVVTGTGEMVT  210

Query  1234  CSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISI  1055
             CS D+NS+LF A LGGLGQFG+ITRARI LE AP RV+WVR+ Y D + FT+DQE LIS 
Sbjct  211   CSMDVNSDLFMAALGGLGQFGVITRARIRLEPAPKRVRWVRLAYTDVATFTKDQEFLISN  270

Query  1054  N----GLNYLEGSLMMNHTSPNNWRSS-FFSLSDQSKIASLLTQQG--LLYCLEVVKHYD  896
                  G +Y+EG + +N +     +S+ FFS +D +++A L ++ G   +Y +E   +Y 
Sbjct  271   RTSQVGFDYVEGQVQLNRSLVEGPKSTPFFSGADLARLAGLASRTGPTAIYYIEGAMYYT  330

Query  895   DQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLN  716
             + T  +VD+++K LL  LSF PG  F KD ++ +FL+RVR EE   +  G WE  HPWLN
Sbjct  331   EDTAISVDKKMKALLDQLSFEPGFPFTKDVTFVQFLDRVREEERVLRSAGAWEVPHPWLN  390

Query  715   LFVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEED----TFYCV  548
             LFVP+SRILDF+  VF+ +L     +G +L+YP     WD+RM+A+ P  D     FY V
Sbjct  391   LFVPRSRILDFDDGVFKALLKDANPAGIILMYPMNKDRWDDRMTAMTPATDDDDNVFYAV  450

Query  547   GLLYSG-GMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTF  371
               L+S    +    L+  N+ +L FC   D  G + KQYLPHY S++ W +HFG KW+  
Sbjct  451   SFLWSALSADDVPQLERWNKAVLDFC---DRSGIECKQYLPHYTSQDGWRRHFGAKWSRI  507

Query  370   QENKAKFDPKMILSPGQTIF  311
              E KA++DP+ +LSPGQ IF
Sbjct  508   AELKARYDPRALLSPGQRIF  527



>ref|XP_004141168.1| PREDICTED: uncharacterized protein LOC101212791 [Cucumis sativus]
Length=881

 Score =   508 bits (1308),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 252/454 (56%), Positives = 328/454 (72%), Gaps = 28/454 (6%)
 Frame = -1

Query  1720  DSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSPFSVAARGHGHSVRGQ  1541
             D    T AS+D+G +V+ETPA VL PSS++D++ L+ ++YN+P PF +AARG GHSVRGQ
Sbjct  46    DPETLTIASSDYGNMVKETPAAVLEPSSINDVVQLISYAYNNPIPFHIAARGQGHSVRGQ  105

Query  1540  ATAKDGVVVEMGALRGGGK---IRVS---WSESLGYFADVGGHELWVDVLHACLAHGVSP  1379
             A AK+GVV++M ALR   K   I VS   W+    ++ DVGG +LW++VL+A L +G++P
Sbjct  106   AMAKNGVVIDMSALRRNRKTPGIVVSCRRWTTG-EFYVDVGGEQLWIEVLNATLGYGMTP  164

Query  1378  ASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDMNSELFFA  1199
              SWTDYL++TVGGTLSNAGISGQ FR GPQ+SNV+E+DV+TGKG  +TCS   N ELF A
Sbjct  165   VSWTDYLYITVGGTLSNAGISGQSFRYGPQVSNVVEMDVVTGKGNMMTCSPRKNCELFHA  224

Query  1198  VLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISING------LNYL  1037
             VLGGLGQFGII RARI LE APTRVKWVRMLY +F  FT+DQEHLIS+NG      LNYL
Sbjct  225   VLGGLGQFGIIARARIALEPAPTRVKWVRMLYTNFVAFTKDQEHLISLNGRKQVNALNYL  284

Query  1036  EGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGSTVDQELKD  857
             EG ++++H SP+NWRSSFF LSD S+I SL  Q  ++YCLEVVK+YD  T STVD++L+ 
Sbjct  285   EGLVLLHHGSPDNWRSSFFPLSDHSRIISLANQNSVIYCLEVVKYYDHHTQSTVDKDLEV  344

Query  856   LLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKSRILDFNS  677
             LL+ L +  G  F+KD +Y EFLNRVR  EL+ Q  GLW+  HPWLNLFVP+SRI+DF+S
Sbjct  345   LLEGLDYESGFKFEKDVTYVEFLNRVRSGELKLQSKGLWDVPHPWLNLFVPRSRIIDFDS  404

Query  676   AVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIPEEDTFYCV-----GLLYSGGMNGW  515
              VF++I+++   T GP+L+YP     WD+R S VIP+E+ FY +     G L S  MN  
Sbjct  405   GVFKDIIVRRNITKGPILIYPMNRSKWDDRNSTVIPDEEVFYYIYIYRLGFLLSCLMN--  462

Query  514   KVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSR  413
               LD L +E     ++DD++  +    L  ++ R
Sbjct  463   --LDGLFRE-----DEDDDQKKQPSSSLGSFQRR  489



>gb|AAG30909.1|AF303982_1 cytokinin oxidase [Arabidopsis thaliana]
Length=540

 Score =   496 bits (1277),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 258/500 (52%), Positives = 336/500 (67%), Gaps = 21/500 (4%)
 Frame = -1

Query  1765  PYEIL---SVDIAGRFRVDSRATTAASTDFGGIVQ-ETPAGVLYPSSVDDIINLVRFSYN  1598
             P E+L   ++D+ G F V      + S+DFG +   E P  VL+PSS +D+  LVR +Y 
Sbjct  29    PSELLRIGAIDVDGHFTVHPSDLASVSSDFGMLKSPEEPLAVLHPSSAEDVARLVRTAYG  88

Query  1597  SPSPFSVAARGHGHSVRGQATA-KDGVVVEMG-ALRGGGKIRVSWSESLGYFADVGGHEL  1424
             S + F V+ARGHGHS+ GQA A ++GVVVEM   + G  K  V   E    + DV G EL
Sbjct  89    SATAFPVSARGHGHSINGQAAAGRNGVVVEMNHGVTGTPKPLVRPDE---MYVDVWGGEL  145

Query  1423  WVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGE  1244
             WVDVL   L HG++P SWTDYL+LTVGGTLSNAGISGQ    GPQISNVLELDV+TGKGE
Sbjct  146   WVDVLKKTLEHGLAPKSWTDYLYLTVGGTLSNAGISGQALHHGPQISNVLELDVVTGKGE  205

Query  1243  FITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHL  1064
              + CS++ N+ LF  VLGGLGQFGIITRARI LE AP RV+W+R+LY  F  FT DQE+L
Sbjct  206   VMRCSEEENTRLFHGVLGGLGQFGIITRARISLEPAPQRVRWIRVLYSSFKVFTEDQEYL  265

Query  1063  ISING---LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDD  893
             IS++G    +Y+EG ++++    NNWRSSFFS  +  KI+S+ +   +LYCLE+ K+Y D
Sbjct  266   ISMHGQLKFDYVEGFVIVDEGLVNNWRSSFFSPRNPVKISSVSSNGSVLYCLEITKNYHD  325

Query  892   QTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNL  713
                  VDQE++ L+K L+F+P   F  D  Y +FL+RV   EL+ +   LWE  HPWLNL
Sbjct  326   SDSEIVDQEVEILMKKLNFIPTSVFTTDLQYVDFLDRVHKAELKLRSKNLWEVPHPWLNL  385

Query  712   FVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYS  533
             FVPKSRI DF+  VF+ I L +KTSGP+L+YP     WDER SAV P+E+ FY V LL S
Sbjct  386   FVPKSRISDFDKGVFKGI-LGNKTSGPILIYPMNKDKWDERSSAVTPDEEVFYLVALLRS  444

Query  532   GGMNG-----WKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQ  368
                +G      + L + N+ IL FC   ++    +KQYLPH+ ++E+W+ HFG KW+ F+
Sbjct  445   ALTDGEETQKLEYLKDQNRRILEFC---EQAKINVKQYLPHHATQEEWVAHFGDKWDRFR  501

Query  367   ENKAKFDPKMILSPGQTIFN  308
               KA+FDP+ IL+ GQ IF 
Sbjct  502   SLKAEFDPRHILATGQRIFQ  521



>ref|XP_006390301.1| hypothetical protein EUTSA_v10018378mg [Eutrema salsugineum]
 gb|ESQ27587.1| hypothetical protein EUTSA_v10018378mg [Eutrema salsugineum]
Length=535

 Score =   496 bits (1276),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 254/499 (51%), Positives = 336/499 (67%), Gaps = 19/499 (4%)
 Frame = -1

Query  1765  PYEIL---SVDIAGRFRVDSRATTAASTDFGGIVQ-ETPAGVLYPSSVDDIINLVRFSYN  1598
             P E+L   ++++ G F        + S+DFG +   E P  VL+PSS +D+  LVR +Y 
Sbjct  26    PSELLRIGTINVDGHFTFHPSDLASVSSDFGMLKSPEEPLAVLHPSSAEDVARLVRTAYG  85

Query  1597  SPSPFSVAARGHGHSVRGQA-TAKDGVVVEMGALRGGGKIRVSWSESLGYFADVGGHELW  1421
             S + F ++ARGHGHS+ GQA T ++GVVVEM   + G    +   E +  + DV G ELW
Sbjct  86    SATAFPISARGHGHSINGQAATGRNGVVVEMNHRKTGTPEPLVRPEEM--YVDVWGGELW  143

Query  1420  VDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEF  1241
             VDVL   L +G++P SWTDYL+L+VGGTLSNAGISGQ F  GPQISNVLELDV+TGKGE 
Sbjct  144   VDVLKKTLEYGLAPKSWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVLELDVVTGKGEV  203

Query  1240  ITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLI  1061
             + CS++ N+ LF  VLGGLGQFGIITRARI LE AP RV+W+R+LY  F  FT DQE+LI
Sbjct  204   MRCSEEQNTRLFHGVLGGLGQFGIITRARISLEPAPQRVRWIRVLYSSFKVFTEDQEYLI  263

Query  1060  SING---LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQ  890
             S++G    +Y+EG ++++    NNWRSSFFS  +  KI+S+ +   +LYCLE+ K+Y D 
Sbjct  264   SMHGQLKFDYVEGFVIVDEGLVNNWRSSFFSPRNPVKISSVSSNGSVLYCLEITKNYHDS  323

Query  889   TGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLF  710
                TVDQE++ L+K L+F+P   F  D  Y +FL+RV   EL+ +   LWE  HPWLNLF
Sbjct  324   DSDTVDQEVEILMKKLNFIPTSVFTTDLQYVDFLDRVHKAELKLRSKNLWEVPHPWLNLF  383

Query  709   VPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSG  530
             VPKSRI DF+  VF+ I L +KTSGP+L+YP     WDER SAV P+E+ FY V LL S 
Sbjct  384   VPKSRISDFDKGVFKGI-LGNKTSGPILIYPMNNDKWDERSSAVTPDEEVFYLVALLRSA  442

Query  529   GMNG-----WKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQE  365
               +G      + L   N+ IL FC   D+    +KQYLPH+ ++E+W+ HFG KW  F+ 
Sbjct  443   LSDGEETQKLEYLKNQNRRILEFC---DKAKISVKQYLPHHATQEEWVAHFGDKWERFRS  499

Query  364   NKAKFDPKMILSPGQTIFN  308
              KA+FDP+ IL+ GQ IF+
Sbjct  500   MKAEFDPRHILATGQRIFH  518



>ref|XP_002453544.1| hypothetical protein SORBIDRAFT_04g007730 [Sorghum bicolor]
 gb|EES06520.1| hypothetical protein SORBIDRAFT_04g007730 [Sorghum bicolor]
Length=537

 Score =   496 bits (1276),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 251/511 (49%), Positives = 343/511 (67%), Gaps = 16/511 (3%)
 Frame = -1

Query  1801  ILGKLKPWNSS-LPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDI  1625
             +  +L+P  ++ LP ++ S+ IA R R D  +T  ASTDFG +V+  P  V +P++  DI
Sbjct  19    VASQLRPLPAAGLPDDLFSLGIAPRIRTDRNSTAKASTDFGQMVKAAPEAVFHPATPADI  78

Query  1624  INLVRFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGAL-RGGGKIRVSWSESLGY-  1451
               L+RFS +S +PF VA RG GHS RGQA A  GVVV+M +L RG    R++ S +    
Sbjct  79    AELIRFSASSAAPFPVAPRGEGHSWRGQALAPGGVVVDMSSLGRGHRAPRINVSAAGAEP  138

Query  1450  FADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLE  1271
             F D GG +LWVDVL A L HG++P  WTDYL LTVGGTLSNAGI GQ FR GPQI+NV E
Sbjct  139   FVDAGGEQLWVDVLRATLRHGLAPRVWTDYLRLTVGGTLSNAGIGGQAFRHGPQIANVQE  198

Query  1270  LDVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFS  1091
             LDV+TG GE +TCS+D+NS+LFFA LGGLGQFG+ITRARI L  AP RV+WVR+ Y D +
Sbjct  199   LDVVTGTGEMVTCSRDVNSDLFFAALGGLGQFGVITRARIRLAPAPKRVRWVRLAYSDVA  258

Query  1090  KFTRDQEHLIS----INGLNYLEGSLMMNHTSPNNWRSS-FFSLSDQSKIASLLTQQG--  932
              FT+DQE LIS    + G +Y+EG + +N +     +S+ FFS +D +++A L ++ G  
Sbjct  259   TFTKDQELLISNRTGLIGFDYVEGQVQLNRSFIEGPKSTPFFSGTDLARLARLASRTGSV  318

Query  931   LLYCLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQE  752
              +Y +E   +Y +    ++D+++K LL  LSF  G  F KD ++ +FL+RVR EE   + 
Sbjct  319   AIYYIEAAMYYTEDNAISMDKKMKALLDQLSFEKGFVFTKDVTFMQFLDRVREEESVLRS  378

Query  751   NGLWEATHPWLNLFVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIP  572
              G+WE  HPWLNLFVP+SRILDF++ VF+ +L     +G +L+YP    MWD+RM+AV P
Sbjct  379   AGVWEVPHPWLNLFVPRSRILDFDNGVFKALLKDANPAGIILMYPMNKDMWDDRMTAVTP  438

Query  571   --EEDTFYCVGLLYSG-GMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWM  401
                +D FY V +L+S   M+    L+  N+ +L FC   D+ G + KQYLPHY S++ W 
Sbjct  439   TMNDDVFYAVSMLWSALSMDDVPQLERGNKAVLDFC---DQAGIECKQYLPHYTSQDGWR  495

Query  400   KHFGKKWNTFQENKAKFDPKMILSPGQTIFN  308
             +HFG KW    E KA++DP+ +LSPGQ IF+
Sbjct  496   QHFGTKWRQIAELKARYDPQALLSPGQRIFS  526



>ref|XP_002451780.1| hypothetical protein SORBIDRAFT_04g007740 [Sorghum bicolor]
 gb|EES04756.1| hypothetical protein SORBIDRAFT_04g007740 [Sorghum bicolor]
Length=534

 Score =   495 bits (1275),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 252/509 (50%), Positives = 340/509 (67%), Gaps = 15/509 (3%)
 Frame = -1

Query  1801  ILGKLKPWNSS-LPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDI  1625
             + G+L+P  S+ LP ++  + IA R R D  +T  ASTDFG +V   P  V +P++  DI
Sbjct  19    VAGQLRPMPSAGLPGDLFGLGIASRIRTDHNSTAKASTDFGQMVNAAPEAVFHPATPADI  78

Query  1624  INLVRFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGAL-RGGGKIRVSWSESLGY-  1451
               L+RFS +S +PF VA RG GHS RGQA A  GVVV+M +L RG    R++ S +    
Sbjct  79    AELIRFSASSAAPFPVAPRGEGHSWRGQALAPGGVVVDMSSLGRGHRAPRINVSAAGAEP  138

Query  1450  FADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLE  1271
             F D GG +LW+DVL A L HG++P  WTDYL LTVGGTLSNAGI GQ FR GPQI+NV E
Sbjct  139   FVDAGGEQLWIDVLRATLQHGLAPRVWTDYLRLTVGGTLSNAGIGGQAFRHGPQIANVQE  198

Query  1270  LDVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFS  1091
             LDV+TG GE +TCS+DMNS+LFFA LGGLGQFG+ITRARI LE AP RV+WVR+ Y D +
Sbjct  199   LDVVTGTGEMVTCSRDMNSDLFFAALGGLGQFGVITRARIRLEPAPKRVRWVRLAYSDVA  258

Query  1090  KFTRDQEHLISIN----GLNYLEGSLMMNHTSPNNWRSS-FFSLSDQSKIASLLTQQGLL  926
              FT+DQE LIS        +Y+EG + +N +     +S+ FFS +D +++AS  T    +
Sbjct  259   TFTKDQEFLISKRTDQIKFDYVEGQVQLNRSFIEGPKSTPFFSGTDLARLAS-KTGSAAI  317

Query  925   YCLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENG  746
             Y +E   +Y + T   VD+++K LL  LSF  G  F KD ++ +FL+RVR EE   +  G
Sbjct  318   YYIEAAMYYTEDTAILVDKKMKALLDHLSFEKGFVFTKDVTFLQFLDRVREEESVLRSAG  377

Query  745   LWEATHPWLNLFVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIP--  572
             +WE  HPWLNLFVP+SRILDF++ VF+ +L     +G +L+YP    MWD+RM+A+ P  
Sbjct  378   VWEVPHPWLNLFVPRSRILDFDNGVFKALLKDANPAGIILMYPMNKDMWDDRMTAMTPTT  437

Query  571   EEDTFYCVGLLYSG-GMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKH  395
              +D FY V +L+S   M+    L+  N+ +L FC    ++G + KQYLPHY S++ W +H
Sbjct  438   NDDVFYAVSMLWSALSMDDVPQLERGNKAVLDFCY---QQGIECKQYLPHYTSQDGWQQH  494

Query  394   FGKKWNTFQENKAKFDPKMILSPGQTIFN  308
             FG KW+   E KA++DP+ +LSPGQ IF+
Sbjct  495   FGTKWSKIAELKARYDPQALLSPGQRIFS  523



>emb|CDY47521.1| BnaAnng09190D [Brassica napus]
Length=531

 Score =   495 bits (1274),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 252/499 (51%), Positives = 336/499 (67%), Gaps = 19/499 (4%)
 Frame = -1

Query  1765  PYEIL---SVDIAGRFRVDSRATTAASTDFGGIVQ-ETPAGVLYPSSVDDIINLVRFSYN  1598
             P E+L   ++D+ G F        + S+DFG +   E P  VL+PSS +D+  L+R +Y 
Sbjct  21    PSELLRIGAIDVDGHFTFKPSDLASVSSDFGMLKSPEEPLAVLHPSSAEDVARLIRTAYG  80

Query  1597  SPSPFSVAARGHGHSVRGQA-TAKDGVVVEMGALRGGGKIRVSWSESLGYFADVGGHELW  1421
             S + F V+ARGHGHS+ GQA T ++GVVVEM     G    +   E +  + DV G ELW
Sbjct  81    SATAFPVSARGHGHSINGQASTGRNGVVVEMSHRNIGTPEPLVEPEEM--YVDVWGGELW  138

Query  1420  VDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEF  1241
             VDVL   L HG++P SWTDYL+L+VGGTLSNAGISGQ F  GPQISNVLELDV+TG+GE 
Sbjct  139   VDVLKKTLEHGLAPKSWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVLELDVVTGRGEV  198

Query  1240  ITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLI  1061
             + CS++ N+ LF  VLGGLGQFGIITRARI LE AP RV+W+R+LY  F  FT DQE+LI
Sbjct  199   MRCSEEENTRLFHGVLGGLGQFGIITRARISLEPAPQRVRWIRVLYSSFEVFTEDQEYLI  258

Query  1060  SING---LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQ  890
             S++G    +Y+EG ++++    NNWRSSFFS  +  KI+S+ +   +LYCLE+ K+Y + 
Sbjct  259   SMHGQSKFDYVEGFVIVDEGLVNNWRSSFFSPRNPVKISSVSSNGSVLYCLEITKNYHES  318

Query  889   TGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLF  710
                TVDQE++ L+K L+F+P   F  D  Y +FL+RV   EL+ +   LWE  HPWLNLF
Sbjct  319   ESDTVDQEVEILMKKLNFIPTSVFTTDLQYVDFLDRVHKAELKLRSKNLWEVPHPWLNLF  378

Query  709   VPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSG  530
             VPKSRI DF+  VF+ I L +KTSGP+L+YP     WDER SAV P+E+ FY V LL S 
Sbjct  379   VPKSRISDFDKGVFKGI-LGNKTSGPILIYPMNKDKWDERSSAVTPDEEVFYLVALLRSA  437

Query  529   GMNG-----WKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQE  365
               +G      + L + N+ IL FC   ++    +KQYLPH+ ++E+W+ H+G KW+ F+ 
Sbjct  438   LSDGEETQKLEYLKDQNRRILEFC---EQAKINVKQYLPHHATQEEWVAHYGDKWDQFRS  494

Query  364   NKAKFDPKMILSPGQTIFN  308
              KA+FDP+ IL+ GQ IF 
Sbjct  495   MKAEFDPRHILATGQKIFQ  513



>ref|XP_006409043.1| hypothetical protein EUTSA_v10023158mg [Eutrema salsugineum]
 gb|ESQ50496.1| hypothetical protein EUTSA_v10023158mg [Eutrema salsugineum]
Length=505

 Score =   493 bits (1270),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 254/475 (53%), Positives = 315/475 (66%), Gaps = 16/475 (3%)
 Frame = -1

Query  1720  DSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSPFSVAARGHGHSVRGQ  1541
             D    +AAS DFG I   TP GVL PSS  +I  L+ ++      F VAARG GHS+ GQ
Sbjct  43    DPSTISAASHDFGNITTVTPGGVLCPSSPAEISRLLHYAATGERMFQVAARGQGHSLNGQ  102

Query  1540  ATAKDGVVVEMGALRGGGKIRVSWSESLGYFADVGGHELWVDVLHACLAHGVSPASWTDY  1361
             A+   GV++ M  L G     V  SE   Y ADV    LWVDVL      GVSP SWTDY
Sbjct  103   ASVSGGVIINMTCLSG-----VVVSEDKKY-ADVAAGTLWVDVLKETAEKGVSPVSWTDY  156

Query  1360  LHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDMNSELFFAVLGGLG  1181
             LH++VGGTLSNAGI GQ+FR GPQISNVLELDVITGKGE + CS+ +N ELF+ VLGGLG
Sbjct  157   LHVSVGGTLSNAGIGGQVFRNGPQISNVLELDVITGKGEMLVCSRRLNRELFYGVLGGLG  216

Query  1180  QFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISIN---GLNYLEGSLMMNHT  1010
             QFGIITRAR+ L  AP RVKW RMLY DF+ FT DQE LIS+    G++YLEG LM+   
Sbjct  217   QFGIITRARVFLNHAPKRVKWFRMLYSDFTAFTNDQERLISMANDIGIDYLEGQLML---  273

Query  1009  SPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGSTVDQELKDLLKDLSFVP  830
             S     ++FF  SDQSK+  L+   G++Y LEV K+YDD T   + Q ++ L+K LS++P
Sbjct  274   SNGIVETTFFPPSDQSKVTDLVKNHGIIYVLEVAKYYDDPTLPLIGQVIEKLIKTLSYLP  333

Query  829   GMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKSRILDFNSAVFQNILLK  650
             G     D  YF+FLNRV+ EE + +  GLWE  HPWLNL+VPKS+I  F++ V ++ILLK
Sbjct  334   GFITMHDVPYFDFLNRVQNEEDKLRSLGLWEVPHPWLNLYVPKSQIHAFHNGVIKDILLK  393

Query  649   HK-TSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSGGMNGWKVLDELNQEILSFC  473
                TSG  L+YPT    WD RMSA IP  D  Y VG+L+S        ++ +N++I+SFC
Sbjct  394   QNSTSGLALIYPTNRNKWDNRMSATIPNGDVIYIVGILHSTSPKKLPEVESINEKIISFC  453

Query  472   NKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFDPKMILSPGQTIFN  308
                 E G KIKQYL HY  +EDW++HFG KW+ F + K  FDPK +LSPGQ IF+
Sbjct  454   K---ESGIKIKQYLMHYTRKEDWIQHFGSKWSDFSKRKDLFDPKKLLSPGQDIFD  505



>ref|XP_006297443.1| hypothetical protein CARUB_v10013466mg, partial [Capsella rubella]
 gb|EOA30341.1| hypothetical protein CARUB_v10013466mg, partial [Capsella rubella]
Length=516

 Score =   494 bits (1271),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 254/471 (54%), Positives = 318/471 (68%), Gaps = 17/471 (4%)
 Frame = -1

Query  1705  TAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSPFSVAARGHGHSVRGQATAKD  1526
             +AAS DFG I   TP+GV+ PSS  DI  L+ ++ N  + F VAARG GHS+ GQA+   
Sbjct  57    SAASQDFGNITTVTPSGVICPSSSSDISRLLHYAANEKTTFQVAARGQGHSLNGQASVSG  116

Query  1525  GVVVEMGALRGGGKIRVSWSESLGYFADVGGHELWVDVLHACLAHGVSPASWTDYLHLTV  1346
             GVVV M  L     + VS  +    +ADV    LWVDVL      GVSP SWTDYLH++V
Sbjct  117   GVVVNMTCL--ADDVVVSKDKK---YADVAAGTLWVDVLKKTAEEGVSPVSWTDYLHISV  171

Query  1345  GGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDMNSELFFAVLGGLGQFGII  1166
             GGTLSN GI GQ+FR GP ISNVLELDVITGKGE +TCS  +NSELF+ VLGGLGQFGII
Sbjct  172   GGTLSNGGIGGQVFRNGPLISNVLELDVITGKGEMLTCSPKLNSELFYGVLGGLGQFGII  231

Query  1165  TRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISIN---GLNYLEGSLMMNHTSPNNW  995
             TRARIVL+ AP R KW RMLY DF+ FT+DQE LIS+    G++YLEG + M++   +  
Sbjct  232   TRARIVLDHAPKRAKWFRMLYSDFTAFTKDQERLISMANDIGVDYLEGQIFMSNGVVD--  289

Query  994   RSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFK  815
              +SFF  SDQSK+  L+ + G++Y LE  K+YDD     + + +  L + LS++PG    
Sbjct  290   -TSFFPPSDQSKVTDLVKKHGIIYVLETAKYYDDPNLPIIREVVDKLKQSLSYLPGFISM  348

Query  814   KDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKSRILDFNSAVFQNILLKHKT-S  638
              D SYF+FLNRV+ EE + +  GLWE  HPWLNL+VPKSRILDF++ V ++ILLK KT S
Sbjct  349   HDVSYFDFLNRVQVEENKLRSLGLWEVPHPWLNLYVPKSRILDFHNGVVKDILLKQKTAS  408

Query  637   GPMLVYPTTTKMWDERMSAVIPE--EDTFYCVGLLYSGGMNGWKVLDELNQEILSFCNKD  464
             G  L+YPT    WD RMSA+IPE  ED  Y +GLL S        ++ +N +I+ FC   
Sbjct  409   GLALLYPTNRNKWDNRMSAMIPEIDEDVIYVIGLLQSATPQTLPEMESVNAKIIRFCK--  466

Query  463   DEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFDPKMILSPGQTIF  311
              + G KIKQYL  Y  +EDW++HFG KWN F + K  FDPK +LSPGQ IF
Sbjct  467   -DSGIKIKQYLMRYTRKEDWIEHFGSKWNDFSKRKELFDPKKLLSPGQDIF  516



>ref|XP_009106198.1| PREDICTED: cytokinin dehydrogenase 5 [Brassica rapa]
Length=535

 Score =   494 bits (1273),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 252/499 (51%), Positives = 336/499 (67%), Gaps = 19/499 (4%)
 Frame = -1

Query  1765  PYEIL---SVDIAGRFRVDSRATTAASTDFGGIVQ-ETPAGVLYPSSVDDIINLVRFSYN  1598
             P E+L   ++D+ G F        + S+DFG +   E P  VL+PSS +D+  L+R +Y 
Sbjct  25    PSELLRIGAIDVDGHFTFKPSDLASVSSDFGMLKSPEEPLAVLHPSSAEDVARLIRTAYG  84

Query  1597  SPSPFSVAARGHGHSVRGQA-TAKDGVVVEMGALRGGGKIRVSWSESLGYFADVGGHELW  1421
             S + F V+ARGHGHS+ GQA T ++GVVVEM     G    +   E +  + DV G ELW
Sbjct  85    SATAFPVSARGHGHSINGQASTGRNGVVVEMSHRNIGTPEPLVEPEEM--YVDVWGGELW  142

Query  1420  VDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEF  1241
             VDVL   L HG++P SWTDYL+L+VGGTLSNAGISGQ F  GPQISNVLELDV+TG+GE 
Sbjct  143   VDVLKKTLEHGLAPKSWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVLELDVVTGRGEV  202

Query  1240  ITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLI  1061
             + CS++ N+ LF  VLGGLGQFGIITRARI LE AP RV+W+R+LY  F  FT DQE+LI
Sbjct  203   MRCSEEENTRLFHGVLGGLGQFGIITRARISLEPAPQRVRWIRVLYSSFEVFTEDQEYLI  262

Query  1060  SING---LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQ  890
             S++G    +Y+EG ++++    NNWRSSFFS  +  KI+S+ +   +LYCLE+ K+Y + 
Sbjct  263   SMHGQSKFDYVEGFVIVDEGLVNNWRSSFFSPRNPVKISSVSSNGSVLYCLEITKNYHES  322

Query  889   TGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLF  710
                TVDQE++ L+K L+F+P   F  D  Y +FL+RV   EL+ +   LWE  HPWLNLF
Sbjct  323   ESDTVDQEVEILMKKLNFIPTSVFTTDLQYVDFLDRVHKAELKLRSKNLWEVPHPWLNLF  382

Query  709   VPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSG  530
             VPKSRI DF+  VF+ I L +KTSGP+L+YP     WDER SAV P+E+ FY V LL S 
Sbjct  383   VPKSRISDFDKGVFKGI-LGNKTSGPILIYPMNKDKWDERSSAVTPDEEVFYLVALLRSA  441

Query  529   GMNG-----WKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQE  365
               +G      + L + N+ IL FC   ++    +KQYLPH+ ++E+W+ H+G KW+ F+ 
Sbjct  442   LSDGEETQKLEYLKDQNRRILEFC---EQAKINVKQYLPHHATQEEWVAHYGDKWDQFRS  498

Query  364   NKAKFDPKMILSPGQTIFN  308
              KA+FDP+ IL+ GQ IF 
Sbjct  499   MKAEFDPRHILATGQKIFQ  517



>sp|Q6YW51.1|CKX6_ORYSJ RecName: Full=Cytokinin dehydrogenase 6; AltName: Full=Cytokinin 
oxidase 6; Short=OsCKX6; Flags: Precursor [Oryza sativa 
Japonica Group]
 dbj|BAD17196.1| putative cytokinin dehydrogenase 1 precursor [Oryza sativa Japonica 
Group]
 dbj|BAD17609.1| putative cytokinin dehydrogenase 1 precursor [Oryza sativa Japonica 
Group]
Length=527

 Score =   494 bits (1272),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 253/500 (51%), Positives = 331/500 (66%), Gaps = 13/500 (3%)
 Frame = -1

Query  1777  NSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYN  1598
             +  LP ++ +  +A + RVD   T  AS+DFG IV   P  VL+P++  +I  LVRFS +
Sbjct  21    SGGLPGDLFAHSVASKLRVDRDTTARASSDFGRIVAAAPEAVLHPATPAEIAELVRFSAS  80

Query  1597  SPSPFSVAARGHGHSVRGQATAKDGVVVEMGALRGG-GKIRVSWSES-LGYFADVGGHEL  1424
             SPSPF VA RG GHS RGQ+ A  GVVV+M AL    G++ VS   +    + D GG +L
Sbjct  81    SPSPFPVAPRGQGHSARGQSLAPGGVVVDMRALAARRGRVNVSAGGAGAAPYVDAGGEQL  140

Query  1423  WVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGE  1244
             W DVL A L HG++P  WTDYL +TV GTLSNAGI GQ FR GPQI+NVLELDVITG+G+
Sbjct  141   WADVLRATLEHGLAPRVWTDYLRITVAGTLSNAGIGGQAFRHGPQIANVLELDVITGRGD  200

Query  1243  FITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHL  1064
              +TCS+D   +LFFAVLGGLGQFGIITRARI LE AP RV+WVR+ Y D   FTRDQE L
Sbjct  201   MVTCSRDKEPDLFFAVLGGLGQFGIITRARIGLEPAPKRVRWVRLAYSDVVTFTRDQELL  260

Query  1063  ISIN----GLNYLEGSLMMNHTSPNNWRSS-FFSLSDQSKIASLLTQ--QGLLYCLEVVK  905
             IS      G +Y+EG + +N T     +S+ FFS  D  ++A L ++   G++Y +E   
Sbjct  261   ISKRASEAGFDYVEGQVQLNRTLTEGPKSTPFFSRFDIDRLAGLASESVSGVIYFIEGAM  320

Query  904   HYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHP  725
             +Y++ T ++VDQ+L  +L+ LSF  G  F KD SY +FL+RVR EE   +  G+W+  HP
Sbjct  321   YYNESTTASVDQKLTSVLEQLSFDKGFVFTKDVSYVQFLDRVREEERILRSIGMWDVPHP  380

Query  724   WLNLFVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVG  545
             WLNLFVP+SRILDF++ V + + +     G +L+YP    MWD+RM+AV   +D FY VG
Sbjct  381   WLNLFVPQSRILDFDTGVLKGVFVGANPVGVILMYPMNRNMWDDRMTAVSGNDDMFYVVG  440

Query  544   LLYSGGMNG-WKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQ  368
             LL S  + G  + L+  N+ +L+FC   D EG   KQYLPHY S++ W  HFG KW+   
Sbjct  441   LLRSAVVPGDVERLERENEAVLAFC---DNEGIGCKQYLPHYASQDGWRSHFGAKWSRVT  497

Query  367   ENKAKFDPKMILSPGQTIFN  308
             E K K+DP  ILSPGQ IF+
Sbjct  498   ELKVKYDPYGILSPGQRIFS  517



>ref|XP_010533263.1| PREDICTED: cytokinin dehydrogenase 5 [Tarenaya hassleriana]
Length=543

 Score =   494 bits (1273),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 267/499 (54%), Positives = 339/499 (68%), Gaps = 18/499 (4%)
 Frame = -1

Query  1765  PYEILSVDIAGRFRVDSRATTAASTDFGGIVQ-ETPAGVLYPSSVDDIINLVRFSYNSPS  1589
             P   L VD+ G          A S+DFG +   E P  VL P+S DD+  L+R SY S +
Sbjct  29    PSPFLLVDVDGHVSDHPSDVAAVSSDFGMLTPPEPPTAVLRPASADDVARLLRASYGSAA  88

Query  1588  PFSVAARGHGHSVRGQATA-KDGVVVEMG---ALRGGGKIRVSWSESL-GYFADVGGHEL  1424
              F V+ARGHGHS+ GQA A K+GVVVEMG    + G G+       S  G   DV G EL
Sbjct  89    AFPVSARGHGHSINGQAKAGKNGVVVEMGRREIISGAGRNPPEPEVSAEGMHVDVWGGEL  148

Query  1423  WVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGE  1244
             W+DVL   L +G++P SWTDYL+LTVGGT+SNAGISGQ F  GPQISNVLELDV+TGKGE
Sbjct  149   WIDVLKKTLEYGLAPKSWTDYLYLTVGGTISNAGISGQAFHHGPQISNVLELDVVTGKGE  208

Query  1243  FITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHL  1064
              + CS++ NSELF  VLGGLGQ GIITRARI LE +P RV+W+R+LY +FS FTRDQE L
Sbjct  209   VMKCSEEENSELFHGVLGGLGQLGIITRARIALEPSPQRVRWIRVLYSNFSVFTRDQEQL  268

Query  1063  ISING---LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDD  893
             IS++G    +Y+EG ++++    NNWRSSFFS  +  KI++L    G+LYCLEV K+YD+
Sbjct  269   ISLHGPPKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKISALGGDGGVLYCLEVTKNYDE  328

Query  892   QTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNL  713
              +  TVDQE++ L+K L+F+PG  F  D  Y +FL+RV   EL+ +   LWE  HPWLNL
Sbjct  329   SSADTVDQEMEQLMKKLNFIPGSVFTTDLPYVDFLDRVHKAELKLRSKNLWEVPHPWLNL  388

Query  712   FVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYS  533
             FVPKSRI DF+  VF+ I L +KTSGP+L+YP     WDER SAVIPEE+ FY V LL S
Sbjct  389   FVPKSRIGDFDRGVFKGI-LGNKTSGPILIYPMNKDKWDERSSAVIPEEEVFYLVALLRS  447

Query  532   GGMNG-----WKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQ  368
                +G      + L++ N+ IL FC   +E G + KQYLPHY ++E WM+HFG KW  F 
Sbjct  448   ALSDGDETQRLEYLEDQNRRILRFC---EESGIEAKQYLPHYVTQEQWMRHFGDKWERFS  504

Query  367   ENKAKFDPKMILSPGQTIF  311
               KA++DP+ IL+ GQ +F
Sbjct  505   HLKAEYDPRHILATGQKVF  523



>ref|XP_002883987.1| hypothetical protein ARALYDRAFT_480522 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60246.1| hypothetical protein ARALYDRAFT_480522 [Arabidopsis lyrata subsp. 
lyrata]
Length=503

 Score =   493 bits (1269),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 254/476 (53%), Positives = 319/476 (67%), Gaps = 18/476 (4%)
 Frame = -1

Query  1720  DSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSPFSVAARGHGHSVRGQ  1541
             D    +AAS DFG I   TP GV+ PSS  DI  L++++ N  S F VAARG GHS+ GQ
Sbjct  40    DPSIISAASHDFGNITTVTPGGVICPSSSADISRLLQYAANGKSTFQVAARGQGHSLNGQ  99

Query  1540  ATAKDGVVVEMGALRGGGKIRVSWSESLGYFADVGGHELWVDVLHACLAHGVSPASWTDY  1361
             A+   GV+V M  L     + VS  +    +ADV    LWV+VL      GVSP SWTDY
Sbjct  100   ASVSGGVIVNMTCLTS---VVVSKDKK---YADVAAGTLWVNVLKKTAEEGVSPVSWTDY  153

Query  1360  LHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDMNSELFFAVLGGLG  1181
             LH+TVGGTLSN GI GQ+FR GP I NVLELDVITGKGE +TCS+ +N ELF+ VLGGLG
Sbjct  154   LHITVGGTLSNGGIGGQVFRNGPLIRNVLELDVITGKGEVLTCSRQLNPELFYGVLGGLG  213

Query  1180  QFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISIN---GLNYLEGSLMMNHT  1010
             QFGIITRARIVL+ AP R KW RMLY DF+ FT+DQE LIS+    G++YLEG + +++ 
Sbjct  214   QFGIITRARIVLDHAPKRAKWFRMLYSDFTTFTKDQERLISMVNDIGVDYLEGQIFLSNG  273

Query  1009  SPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGSTVDQELKDLLKDLSFVP  830
               +   +SFF  SDQSK+A L+ + G++Y LEV K+YDD     + + +  L K LS++P
Sbjct  274   VVD---TSFFPPSDQSKVADLVKEHGVIYVLEVAKYYDDPNLPIISKVIDTLTKSLSYLP  330

Query  829   GMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKSRILDFNSAVFQNILLK  650
             G     D  YF+FLNRV+ EE + +  GLWE  HPWLNL+VPKSRI DF+  V ++ILLK
Sbjct  331   GFISMHDVPYFDFLNRVQVEENKLRSLGLWEVPHPWLNLYVPKSRIRDFHDGVVKDILLK  390

Query  649   HKT-SGPMLVYPTTTKMWDERMSAVIPE--EDTFYCVGLLYSGGMNGWKVLDELNQEILS  479
              KT SG  L+YPT    WD RMSA+IPE  ED  Y +GLL S        ++ +N+EI+ 
Sbjct  391   QKTASGLALLYPTNRNKWDNRMSAMIPEIDEDVIYIIGLLQSATPQNLPEMESVNEEIIR  450

Query  478   FCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFDPKMILSPGQTIF  311
             FC    + G KIKQYL HY  +EDW++HFG KW+ F + K  FDPK +LSPGQ IF
Sbjct  451   FCK---DSGIKIKQYLMHYTRKEDWIEHFGSKWDDFSKRKDLFDPKKLLSPGQDIF  503



>ref|NP_001185402.1| cytokinin dehydrogenase 5 [Arabidopsis thaliana]
 gb|AEE35722.1| cytokinin dehydrogenase 5 [Arabidopsis thaliana]
Length=537

 Score =   494 bits (1271),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 259/501 (52%), Positives = 337/501 (67%), Gaps = 22/501 (4%)
 Frame = -1

Query  1765  PYEIL---SVDIAGRFRVDSRATTAASTDFGGIVQ-ETPAGVLYPSSVDDIINLVRFSYN  1598
             P E+L   ++D+ G F V      + S+DFG +   E P  VL+PSS +D+  LVR +Y 
Sbjct  25    PSELLRIGAIDVDGHFTVHPSDLASVSSDFGMLKSPEEPLAVLHPSSAEDVARLVRTAYG  84

Query  1597  SPSPFSVAARGHGHSVRGQATA-KDGVVVEMG-ALRGGGKIRVSWSESLGYFADVGGHEL  1424
             S + F V+ARGHGHS+ GQA A ++GVVVEM   + G  K  V   E    + DV G EL
Sbjct  85    SATAFPVSARGHGHSINGQAAAGRNGVVVEMNHGVTGTPKPLVRPDE---MYVDVWGGEL  141

Query  1423  WVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVIT-GKG  1247
             WVDVL   L HG++P SWTDYL+LTVGGTLSNAGISGQ F  GPQISNVLELDV+T GKG
Sbjct  142   WVDVLKKTLEHGLAPKSWTDYLYLTVGGTLSNAGISGQAFHHGPQISNVLELDVVTVGKG  201

Query  1246  EFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEH  1067
             E + CS++ N+ LF  VLGGLGQFGIITRARI LE AP RV+W+R+LY  F  FT DQE+
Sbjct  202   EVMRCSEEENTRLFHGVLGGLGQFGIITRARISLEPAPQRVRWIRVLYSSFKVFTEDQEY  261

Query  1066  LISING---LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYD  896
             LIS++G    +Y+EG ++++    NNWRSSFFS  +  KI+S+ +   +LYCLE+ K+Y 
Sbjct  262   LISMHGQLKFDYVEGFVIVDEGLVNNWRSSFFSPRNPVKISSVSSNGSVLYCLEITKNYH  321

Query  895   DQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLN  716
             D     VDQE++ L+K L+F+P   F  D  Y +FL+RV   EL+ +   LWE  HPWLN
Sbjct  322   DSDSEIVDQEVEILMKKLNFIPTSVFTTDLQYVDFLDRVHKAELKLRSKNLWEVPHPWLN  381

Query  715   LFVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLY  536
             LFVPKSRI DF+  VF+ I L +KTSGP+L+YP     WDER SAV P+E+ FY V LL 
Sbjct  382   LFVPKSRISDFDKGVFKGI-LGNKTSGPILIYPMNKDKWDERSSAVTPDEEVFYLVALLR  440

Query  535   SGGMNG-----WKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTF  371
             S   +G      + L + N+ IL FC   ++    +KQYLPH+ ++E+W+ HFG KW+ F
Sbjct  441   SALTDGEETQKLEYLKDQNRRILEFC---EQAKINVKQYLPHHATQEEWVAHFGDKWDRF  497

Query  370   QENKAKFDPKMILSPGQTIFN  308
             +  KA+FDP+ IL+ GQ IF 
Sbjct  498   RSLKAEFDPRHILATGQRIFQ  518



>ref|XP_008679837.1| PREDICTED: cytokinin dehydrogenase 7-like [Zea mays]
 gb|AFW66038.1| hypothetical protein ZEAMMB73_698743 [Zea mays]
Length=534

 Score =   493 bits (1268),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 250/508 (49%), Positives = 337/508 (66%), Gaps = 18/508 (4%)
 Frame = -1

Query  1798  LGKLKPWNSS-LPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDII  1622
             +G+ +P  ++ LP ++  + IA R R D  +T  A+TDFG + +  P  V +P++  DI 
Sbjct  21    VGQPRPLPAAVLPSDLFGLGIASRIRTDRNSTAKAATDFGQMARAAPEAVFHPATPADIA  80

Query  1621  NLVRFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGALRGGGKIRVSWSESLGYFAD  1442
              LVRFS +S +PF VA RG GHS RGQA A  GVVV+MG+L  G +I VS +E    F D
Sbjct  81    ALVRFSASSVAPFPVAPRGQGHSWRGQALAPGGVVVDMGSLGRGPRINVSVAEP---FVD  137

Query  1441  VGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDV  1262
             VGG +LWVDVL A L HG++P  WTDYL LTVGGTLSNAGI GQ FR GPQI+NV ELDV
Sbjct  138   VGGEQLWVDVLRATLRHGLAPRVWTDYLRLTVGGTLSNAGIGGQAFRHGPQIANVHELDV  197

Query  1261  ITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFT  1082
             +TG GE +TCS D+NS+LF A LGGLGQFG+ITRARI LE AP RV+WV + Y D + FT
Sbjct  198   VTGTGEMVTCSMDVNSDLFMAALGGLGQFGVITRARIRLEPAPRRVRWVPLAYTDVATFT  257

Query  1081  RDQEHLISIN----GLNYLEGSLMMNHTSPNNWRSS-FFSLSDQSKIASLLTQQG--LLY  923
             +DQE LIS      G +Y+EG + ++ +     +S+ FFS +D +++A L ++ G   +Y
Sbjct  258   KDQEFLISNRASQVGFDYVEGQVQLSRSLVEGPKSTPFFSGADLARLAGLASRTGPTAIY  317

Query  922   CLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGL  743
              +E   +Y + T  +VD+++K LL  LSF PG  F KD ++ +FL+RVR EE   +  G 
Sbjct  318   YIEGAMYYTEDTAISVDKKMKALLDQLSFEPGFAFTKDVTFVQFLDRVREEERVLRSAGA  377

Query  742   WEATHPWLNLFVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIP---  572
             WE  HPWLNLFVP+SRILDF+  VF+ +L     +G +L+YP     WD+RM+A+ P   
Sbjct  378   WEVPHPWLNLFVPRSRILDFDDGVFKALLKDSNPAGIILMYPMNKDRWDDRMTAMTPATN  437

Query  571   EEDTFYCVGLLYSG-GMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKH  395
             ++D FY V  L+S    +    L+  N+ +L FC   D  G + KQYLPHY S++ W +H
Sbjct  438   DDDVFYAVSFLWSALSADDVPQLERWNKAVLDFC---DRSGIECKQYLPHYTSQDGWRRH  494

Query  394   FGKKWNTFQENKAKFDPKMILSPGQTIF  311
             FG KW+   E KA++DP+ +LSPGQ IF
Sbjct  495   FGAKWSRIAELKARYDPRALLSPGQRIF  522



>gb|KHN06618.1| Cytokinin dehydrogenase 3 [Glycine soja]
Length=433

 Score =   489 bits (1258),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 240/406 (59%), Positives = 298/406 (73%), Gaps = 10/406 (2%)
 Frame = -1

Query  1798  LGKLKPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIIN  1619
             +GK + W + +  E+   +I+ +   D      AS D+G IV E P  V  PSS+DDI  
Sbjct  25    VGKTEQWKAPILTELDIDNISHKLHDDPEIIQMASRDYGHIVHEFPLAVFRPSSIDDIAT  84

Query  1618  LVRFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGALR---GGGKIRVSWSESLGYF  1448
             L++ SYNS +PF +AARG GHS  GQA A+DGVVV+M  LR    G  I VS    +G++
Sbjct  85    LIKSSYNSFAPFGIAARGQGHSTHGQAMARDGVVVDMANLRKQRNGVAISVSKDPLMGHY  144

Query  1447  ADVGGHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLEL  1268
             ADVGG +LW+DVLH  L HG++P SWTDYL+LTVGGTLSNAGISGQ FR GPQISNV E+
Sbjct  145   ADVGGEQLWIDVLHTTLKHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQISNVHEM  204

Query  1267  DVITGKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSK  1088
             DVITGKGEF+TCS   N ELF AVLGGLGQFG+I RARI LE AP RVKWVR+LY DF  
Sbjct  205   DVITGKGEFVTCSSQKNLELFHAVLGGLGQFGVIARARIALEPAPKRVKWVRLLYSDFFA  264

Query  1087  FTRDQEHLISING------LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLL  926
             FT+DQE LISING      L++LEG L+MN    NNWRSSFF LSD  +I+SL+T+  +L
Sbjct  265   FTKDQERLISINGRKQKNALDFLEGMLLMNQGPINNWRSSFFPLSDHPRISSLITEHSIL  324

Query  925   YCLEVVKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENG  746
             YCLEV K+YD+QT   VD+E++ LL+ L+++PG  ++K+ SY EFLNRVR  EL+ Q  G
Sbjct  325   YCLEVAKYYDEQTEINVDKEIQVLLQGLAYIPGFYYEKNVSYVEFLNRVRSGELKLQSQG  384

Query  745   LWEATHPWLNLFVPKSRILDFNSAVFQNILLKHK-TSGPMLVYPTT  611
             LW+  HPWLNLF+PKS+ILDFNS VF++I+LK   +SGP+LVYPT 
Sbjct  385   LWDVPHPWLNLFIPKSQILDFNSRVFKDIVLKRNISSGPVLVYPTN  430



>ref|XP_010415434.1| PREDICTED: cytokinin dehydrogenase 2 [Camelina sativa]
Length=506

 Score =   491 bits (1265),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 253/476 (53%), Positives = 317/476 (67%), Gaps = 18/476 (4%)
 Frame = -1

Query  1720  DSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSPFSVAARGHGHSVRGQ  1541
             D    +AAS DFG I   TP GV+ PSS  DI  L+ ++ N    F VAARG GHS++GQ
Sbjct  43    DPSTISAASQDFGNITTVTPGGVICPSSSSDISRLLHYAANGKITFQVAARGQGHSLKGQ  102

Query  1540  ATAKDGVVVEMGALRGGGKIRVSWSESLGYFADVGGHELWVDVLHACLAHGVSPASWTDY  1361
             A+   GVVV M  L     + VS  +    +ADV    LWVDVL      GVSP  WTDY
Sbjct  103   ASVSGGVVVNMTCL---SDVVVSKDKK---YADVAAGTLWVDVLKKTAEKGVSPVCWTDY  156

Query  1360  LHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDMNSELFFAVLGGLG  1181
             LH++VGGTLSN GI GQ+FR GP ISNVLELDVITGKGE +TCS  +NSELF+ VLGGLG
Sbjct  157   LHISVGGTLSNGGIGGQVFRNGPLISNVLELDVITGKGEMLTCSPKLNSELFYGVLGGLG  216

Query  1180  QFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISIN---GLNYLEGSLMMNHT  1010
             QFGIITRARIVL+ AP R KW RMLY DF+ FT+DQE LIS+    G++YLEG + M++ 
Sbjct  217   QFGIITRARIVLDHAPKRAKWFRMLYSDFTAFTKDQERLISMANDIGVDYLEGQIFMSNG  276

Query  1009  SPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGSTVDQELKDLLKDLSFVP  830
               +   +SFF  SDQSK+A L+ + G++Y LE  K+YDD     +   +  L K LS++P
Sbjct  277   VVD---TSFFPPSDQSKVADLVKKHGIIYVLEAAKYYDDPNLPIIHTVIDKLNKSLSYLP  333

Query  829   GMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKSRILDFNSAVFQNILLK  650
             G     D +YF+FLNRV+ EE + +  GLWE  HPWLNL+VPKSRI DF++ V +NIL K
Sbjct  334   GFISMHDVTYFDFLNRVQVEENKLRSLGLWEVPHPWLNLYVPKSRIHDFHNGVVKNILYK  393

Query  649   HK-TSGPMLVYPTTTKMWDERMSAVIPE--EDTFYCVGLLYSGGMNGWKVLDELNQEILS  479
              K T+G  L+YPT    W+ RMSA+IPE  ED  Y +GLL S      + ++ +N++I+ 
Sbjct  394   QKSTTGLALLYPTNRNKWNNRMSAMIPEVDEDVIYVIGLLQSATPQNLQEMESVNEKIIR  453

Query  478   FCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFDPKMILSPGQTIF  311
             FC    + G KIKQYL HY  +EDW+ HFG KWN F + K  FDPK +LSPGQ IF
Sbjct  454   FCK---DSGIKIKQYLMHYTRKEDWIDHFGSKWNDFSKKKELFDPKKLLSPGQDIF  506



>gb|AIU94750.1| cytokinin oxidase [Morus alba var. multicaulis]
Length=496

 Score =   491 bits (1263),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 245/479 (51%), Positives = 324/479 (68%), Gaps = 30/479 (6%)
 Frame = -1

Query  1678  IVQETPAGVLYPSSVDDIINLVRFSYNSPSPFSVAARGHGHSVRGQATAKDGVVVEMGAL  1499
             + +  P  VL+P+S +D+  L++ +Y S    +V+ARGHGHS+ GQA A +GVV++M   
Sbjct  1     MTRTKPQAVLHPASAEDVARLIQAAYGSAQGLTVSARGHGHSINGQAQATNGVVIKMSGS  60

Query  1498  R------------GGGKIRVSWSESLGYFADVGGHELWVDVLHACLAHGVSPASWTDYLH  1355
             R               + RVS  E    + DV G ELW++VL A L HG++P SWTDYL+
Sbjct  61    RERTAADQTSAVAAAARPRVSERE---MYVDVWGGELWIEVLKATLEHGLAPKSWTDYLY  117

Query  1354  LTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDMNSELFFAVLGGLGQF  1175
             LTVGGTLSNAGISGQ F  GPQI+NV ELDV+TGKGE +TCS++ NSELF AVLGGLGQF
Sbjct  118   LTVGGTLSNAGISGQTFNHGPQIANVQELDVVTGKGELLTCSEEKNSELFHAVLGGLGQF  177

Query  1174  GIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISINGL------NYLEGSLMMNH  1013
             GIITRARI LE AP RV+W+R+LY +FS FT+DQE LIS++GL      +Y+EG ++++ 
Sbjct  178   GIITRARIALEPAPQRVRWIRVLYSNFSSFTKDQEFLISLHGLPASQRVDYVEGFVIVDE  237

Query  1012  TSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGSTVDQELKDLLKDLSFV  833
                NNWRSSFFS  +  K++S+   +G+LYCLE+ K+YD+ T  T+DQE++ LL+ L F+
Sbjct  238   GLINNWRSSFFSPRNPVKLSSINADEGVLYCLEITKNYDESTAETIDQEVEGLLRKLDFI  297

Query  832   PGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKSRILDFNSAVFQNILL  653
             P   F  D  Y +FL+RV   EL+ +  GLW+  HPW NLFVPKSRI DF+  VF++I L
Sbjct  298   PTSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWFNLFVPKSRISDFDEGVFKSI-L  356

Query  652   KHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSGGMNG-----WKVLDELNQE  488
              +KTSGP+L+YP     WD+R SA+ P+ED FY V LL S    G      + L   N++
Sbjct  357   GNKTSGPILIYPMNKGKWDQRSSAMTPDEDVFYLVALLRSALDTGDETQSLEYLMHQNRQ  416

Query  487   ILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFDPKMILSPGQTIF  311
             IL FC      G K KQYLPHY ++++W+ HFG KW  F   K +FDP+ IL+ GQ IF
Sbjct  417   ILRFCAN---AGIKAKQYLPHYTTQQEWVDHFGDKWAQFHMRKMEFDPRHILAIGQRIF  472



>emb|CDY54283.1| BnaC07g50850D [Brassica napus]
Length=516

 Score =   491 bits (1264),  Expect = 9e-164, Method: Compositional matrix adjust.
 Identities = 254/481 (53%), Positives = 320/481 (67%), Gaps = 19/481 (4%)
 Frame = -1

Query  1720  DSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSP-----FSVAARGHGH  1556
             D  + +AAS DFG I    P  VL PS+  ++     FSY+S S      F VAARG GH
Sbjct  45    DPFSISAASRDFGNITDVNPGAVLCPSTPAEV---AHFSYDSESTTSSPGFKVAARGQGH  101

Query  1555  SVRGQATAKDGVVVEMGALRGGGKIRVSWSESLGYFADVGGHELWVDVLHACLAHGVSPA  1376
             S+RGQA+A  GVVV M  L    K       + G +ADV    +WV+VL A LA GVSP 
Sbjct  102   SLRGQASAPGGVVVNMTCLAKTAKPAAVVVLADGTYADVAAGAMWVEVLEAALARGVSPV  161

Query  1375  SWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDMNSELFFAV  1196
             ++TDYL+L+VGGTLSNAGI GQ+FR GPQISNV ELDVITGKG+ +TCS  +N ELF+ V
Sbjct  162   TFTDYLYLSVGGTLSNAGIGGQVFRHGPQISNVHELDVITGKGDMVTCSPKLNPELFYGV  221

Query  1195  LGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISING---LNYLEGSL  1025
             LGGLGQFGIITRARI LE APTR KW+R+LY DFS FTRDQE LIS+     +++LEG L
Sbjct  222   LGGLGQFGIITRARIALEHAPTRAKWIRILYSDFSAFTRDQERLISMANDLRVDFLEGQL  281

Query  1024  MMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGSTVDQELKDLLKD  845
             MM++   +   +SFF LSDQ+++ SL+    ++Y LEV K+YD  T   ++Q +  L + 
Sbjct  282   MMSNGIVD---TSFFPLSDQTRVVSLVNDHRIIYVLEVAKYYDTTTLPIIEQVIDRLTRT  338

Query  844   LSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKSRILDFNSAVFQ  665
             L       F +D  YF+FLNRVR EE + +  GLWE  HPWLN+FVP+SRILDF+  V +
Sbjct  339   LGITSEFMFVQDVPYFDFLNRVRNEEDKLRSIGLWEVPHPWLNMFVPRSRILDFHEGVIK  398

Query  664   NILLKH-KTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYS-GGMNGWKVLDELNQ  491
              +LL    TSG  L YPT  K W+  MSA+IP ED FY +G L S GG + ++ L+ LN 
Sbjct  399   GLLLNQTATSGVTLFYPTNRKKWNNLMSAMIPNEDVFYVIGFLQSAGGSHNFEELENLND  458

Query  490   EILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFDPKMILSPGQTIF  311
              I++FC   D  G KIK+YL HY  +EDW+KHFG KWN F   K  FDP+ +LSPGQ IF
Sbjct  459   RIINFC---DNSGIKIKEYLMHYTRKEDWIKHFGPKWNDFSRRKMMFDPEKLLSPGQDIF  515

Query  310   N  308
             +
Sbjct  516   S  516



>ref|XP_009112608.1| PREDICTED: cytokinin dehydrogenase 2 [Brassica rapa]
Length=502

 Score =   489 bits (1260),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 255/475 (54%), Positives = 315/475 (66%), Gaps = 17/475 (4%)
 Frame = -1

Query  1720  DSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSPFSVAARGHGHSVRGQ  1541
             D  A + AS DFG I    P GV+ PSS  +I  L+ ++ N    F VAARG GHS+ GQ
Sbjct  40    DPSAISVASHDFGNITTVIPGGVICPSSPAEISRLLSYASNGERKFQVAARGQGHSLMGQ  99

Query  1540  ATAKDGVVVEMGALRGGGKIRVSWSESLGYFADVGGHELWVDVLHACLAHGVSPASWTDY  1361
             A   DGV++ M  L G     V  S+ + Y ADV G  LWVDVL      GVSP SWTDY
Sbjct  100   AGVPDGVIINMTCLAG-----VVVSDDMKY-ADVAGGTLWVDVLKKTAEKGVSPVSWTDY  153

Query  1360  LHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDMNSELFFAVLGGLG  1181
             LH++VGGTLSNAGI G++FR GPQISNVLELDVITGKGE + CS  +NSELF+ VLGGLG
Sbjct  154   LHVSVGGTLSNAGIGGEVFRNGPQISNVLELDVITGKGEMLACSPQLNSELFYGVLGGLG  213

Query  1180  QFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISI---NGLNYLEGSLMMNHT  1010
             QFGIITRARIVL  AP R KW RMLY DF+ FT+DQE LIS+    G++YLEG L M++ 
Sbjct  214   QFGIITRARIVLNHAPKRAKWFRMLYSDFTAFTKDQERLISMANDTGVDYLEGQLFMSNG  273

Query  1009  SPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGSTVDQELKDLLKDLSFVP  830
               +   +SFF  SDQSKIA L+   G++Y LEV K YDD T   + Q +  L K LS++P
Sbjct  274   VVD---TSFFPQSDQSKIADLVKSHGIIYVLEVAKFYDDPTLPIIGQVVDMLTKTLSYLP  330

Query  829   GMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKSRILDFNSAVFQNILLK  650
             G     D +YF+FLNRV+ EE + +  GLWE  HPWLNL+VPKS+ILDF++ V ++ILLK
Sbjct  331   GFISVHDVAYFDFLNRVKAEENKLRSLGLWEVPHPWLNLYVPKSQILDFHNGVVKDILLK  390

Query  649   HK-TSGPMLVYPTTTKMWDERMSAVIP-EEDTFYCVGLLYSGGMNGWKVLDELNQEILSF  476
                TSG  L+YP+    WD RMSA++  EED  Y +G+L S        ++ LN  I+  
Sbjct  391   QNSTSGLTLLYPSNRNKWDNRMSAMVTDEEDVVYIIGILQSATPQNVPEVESLNDSIIRV  450

Query  475   CNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFDPKMILSPGQTIF  311
             C    + G KIKQYL HY  +EDW++HFG KW  F + K  FDPK +LSPGQ IF
Sbjct  451   CK---DSGIKIKQYLMHYTRKEDWVEHFGTKWRDFSKRKDLFDPKKLLSPGQDIF  502



>gb|EEC80843.1| hypothetical protein OsI_23446 [Oryza sativa Indica Group]
Length=508

 Score =   489 bits (1260),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 258/492 (52%), Positives = 323/492 (66%), Gaps = 24/492 (5%)
 Frame = -1

Query  1732  RFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSPFSVAARGHGHS  1553
             +   D  ATT AS+DFG IV  TP GV  P+   DI+ L+R S + P+PF+VA RG GHS
Sbjct  3     KIHTDHDATTKASSDFGHIVHATPNGVFRPTFPADIVALIRLSLSQPTPFTVAPRGKGHS  62

Query  1552  VRGQATAKDGVVVEMGALRGGG-----KIRVSWSESLGYFADVGGHELWVDVLHACLAHG  1388
              RGQA A  G+V++M AL   G     +I VS       + D GG +LW+DVLH  L HG
Sbjct  63    SRGQAFAPGGIVIDMSALGDHGHHTSHRIDVSVDR---MYVDAGGEQLWIDVLHTALKHG  119

Query  1387  VSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDMNSEL  1208
             ++P  WTDYL +TVGGTLSNAGI GQ FR GPQISNV ELDV+TG GE ITCS ++NS L
Sbjct  120   LTPRVWTDYLRITVGGTLSNAGIGGQAFRHGPQISNVHELDVVTGMGEMITCSPEVNSAL  179

Query  1207  FFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISI----NGLNY  1040
             FFAVLGGLGQFG+ITRARI LE AP RVKWVR+ Y D   FT DQE LIS     +G +Y
Sbjct  180   FFAVLGGLGQFGVITRARIRLEPAPKRVKWVRIAYSDVHPFTTDQELLISKRASGSGFDY  239

Query  1039  LEGSLMMNHTSPNNWR-SSFFSLSDQSKIASLLTQQG--LLYCLEVVKHYDDQTGSTVDQ  869
             +EG + +N T     R SSFFS +D +++  L    G   +Y +E   +YDD T ++VDQ
Sbjct  240   VEGQVQLNWTLTQGRRSSSFFSATDLARLTGLAIDTGSVAIYYIEGAMYYDDNTAASVDQ  299

Query  868   ELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKSRIL  689
             +L  LL++LSFV G  F +DASY EFL+RV  EE   +  G W+  HPWLNLFVP+SRIL
Sbjct  300   KLDALLEELSFVRGFVFVRDASYVEFLDRVGREEQNLRSAGAWDVPHPWLNLFVPRSRIL  359

Query  688   DFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYS---GGMNG  518
              F++AVF+ IL      G +L+YP    MWD+RM+A+ P+ED FY VGLL S   GG  G
Sbjct  360   HFDAAVFKGILRNANPVGLILMYPMNKDMWDDRMTAMTPDEDVFYAVGLLRSAVAGGSGG  419

Query  517   -WKVLDELNQEILSFCNKDDEEGSKI--KQYLPHYRSREDWMKHFGKKWNTFQENKAKFD  347
               + L+  N  +L  C   D  G  I  +QYLPH+ SR+ W +HFG KW    + KA++D
Sbjct  420   DVEQLERENAAVLELC---DLAGGGIGCRQYLPHHASRDGWRRHFGAKWGRVADLKARYD  476

Query  346   PKMILSPGQTIF  311
             P+ ILSPGQ IF
Sbjct  477   PRAILSPGQGIF  488



>emb|CDP07468.1| unnamed protein product [Coffea canephora]
Length=536

 Score =   490 bits (1262),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 256/506 (51%), Positives = 334/506 (66%), Gaps = 25/506 (5%)
 Frame = -1

Query  1765  PYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSP  1586
             P E+L + +  R  VD     +AS DFGG+ +  P  VL+P+S  D+  LV+ +Y S   
Sbjct  24    PTELLLLGVEERLSVDPLDLESASLDFGGLHRAEPWAVLHPASAQDVAWLVKAAYESSHG  83

Query  1585  FSVAARGHGHSVRGQATAKDGVVVEMGALRG-------GGKIRVSWSESLGYFADVGGHE  1427
             F+V+ARGHGHS+ GQA   +GVV++M +  G       G  +     E   Y  DV G E
Sbjct  84    FTVSARGHGHSINGQAMTTNGVVIQMSSGSGERRRLGIGRPVAPRVYEKFMY-VDVWGGE  142

Query  1426  LWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKG  1247
             LW+DVL + L +G++P SWTDYL+L+VGGTLSNAGISGQ F  GPQISNV ELDV+TGKG
Sbjct  143   LWIDVLRSTLEYGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVYELDVVTGKG  202

Query  1246  EFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEH  1067
             E +TCS++ NS+LF AVLGGLGQFGIITRARI LE AP  V+W+R+LY +FS FT DQE+
Sbjct  203   ELLTCSEEENSDLFHAVLGGLGQFGIITRARIALEPAPQMVRWIRVLYSNFSTFTHDQEY  262

Query  1066  LISING------LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQ--QGLLYCLEV  911
             LIS++G       +Y+EG  +++    NNWRSSFFS  +  KI+S+  +   G+LYCLEV
Sbjct  263   LISLHGQSDSQKFDYVEGFAIVDEGLINNWRSSFFSPRNPVKISSIDAKGNGGVLYCLEV  322

Query  910   VKHYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEAT  731
              ++Y      T+D+E+  LL  L+F+P   F  D  Y +FL+RV   EL  +  GLW+  
Sbjct  323   TRNYGGLDADTIDEEVDALLTKLNFIPNTVFTTDLPYVDFLDRVHKAELTLRSKGLWDVP  382

Query  730   HPWLNLFVPKSRILDFNSAVFQNIL-LKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFY  554
             HPWLNLFVPKSRI DF+  VF+ IL  K++TSGP+L+YP     WDE+ SAV PEED FY
Sbjct  383   HPWLNLFVPKSRIADFDRGVFKGILGSKNRTSGPILIYPMNKNKWDEKTSAVTPEEDVFY  442

Query  553   CVGLLYSGGMNG--WKVLDEL---NQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFG  389
              V LL S   NG   + LD L   N+ IL FC   D+ G  +KQYLP+Y +++ W  HFG
Sbjct  443   LVALLRSALDNGDETQTLDYLSDQNRRILRFC---DDAGINVKQYLPYYTTQQQWRDHFG  499

Query  388   KKWNTFQENKAKFDPKMILSPGQTIF  311
              KW  F + K +FDP+ IL+ GQ IF
Sbjct  500   HKWAQFYQRKLEFDPRHILATGQRIF  525



>emb|CDX73174.1| BnaC06g36220D [Brassica napus]
Length=535

 Score =   490 bits (1262),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 250/499 (50%), Positives = 335/499 (67%), Gaps = 19/499 (4%)
 Frame = -1

Query  1765  PYEIL---SVDIAGRFRVDSRATTAASTDFGGIVQ-ETPAGVLYPSSVDDIINLVRFSYN  1598
             P E+L   ++D+ G F        + S+DFG +   E P  VL+PSS +D+  L+R +Y 
Sbjct  25    PSELLRIGAIDVDGHFTFKPSDLASVSSDFGMLKSPEEPLAVLHPSSAEDVARLIRTAYG  84

Query  1597  SPSPFSVAARGHGHSVRGQA-TAKDGVVVEMGALRGGGKIRVSWSESLGYFADVGGHELW  1421
             S + F V+ARGHGHS+ GQA T ++GVVVEM     G    +   E +  + DV G ELW
Sbjct  85    SATAFPVSARGHGHSINGQASTGRNGVVVEMSHRNIGTLEPLVEPEEM--YVDVWGGELW  142

Query  1420  VDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEF  1241
             VDVL   L HG++P SWTDYL+L+VGGTLSNAGISGQ F  GPQISNVLELDV+TG+GE 
Sbjct  143   VDVLKKTLEHGLAPKSWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVLELDVVTGRGEV  202

Query  1240  ITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLI  1061
             + CS++ N+ LF  VLGGLGQFGIITRARI LE AP RV+W+R+LY  F  FT DQE+LI
Sbjct  203   MRCSEEENTRLFHGVLGGLGQFGIITRARISLEPAPQRVRWIRVLYSSFEVFTDDQEYLI  262

Query  1060  SING---LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQ  890
             S++G    +Y+EG ++++    NNWRSSFFS  +  KI+S+ +   +LYCLE+ K+Y + 
Sbjct  263   SMHGHSKFDYVEGFVIVDEGLVNNWRSSFFSPHNPVKISSVSSNGSVLYCLEITKNYHES  322

Query  889   TGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLF  710
                TVDQE++ L+K L+F+P   F  D  Y +FL+RV   EL+ +   LWE  HPWLNLF
Sbjct  323   ESDTVDQEVEILMKKLNFIPTSVFTTDLQYVDFLDRVHKAELKLRSKNLWEVPHPWLNLF  382

Query  709   VPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSG  530
             VPKSRI DF+  VF+ I L +KTSGP+L+YP     WDER SAV P+E+ FY V LL S 
Sbjct  383   VPKSRISDFDKGVFKGI-LGNKTSGPILIYPMNKDKWDERSSAVTPDEEVFYLVALLRSA  441

Query  529   GMNG-----WKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQE  365
               +G      + L + N+ IL FC   ++    +KQYLPH+ ++E+W+ H+G +W+ F+ 
Sbjct  442   LSDGEETQKLEYLKDQNRRILEFC---EQAKINVKQYLPHHATQEEWVDHYGDRWDQFRS  498

Query  364   NKAKFDPKMILSPGQTIFN  308
              K +FDP+ IL+ GQ IF 
Sbjct  499   MKTEFDPRHILATGQKIFQ  517



>ref|XP_010467897.1| PREDICTED: cytokinin dehydrogenase 2-like [Camelina sativa]
Length=506

 Score =   489 bits (1258),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 251/476 (53%), Positives = 316/476 (66%), Gaps = 18/476 (4%)
 Frame = -1

Query  1720  DSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSPFSVAARGHGHSVRGQ  1541
             D    +AAS DFG I   TP GV+ PSS  DI  L+ ++ N    F VAARG GHS++GQ
Sbjct  43    DPSTISAASQDFGNITTVTPGGVICPSSSSDISRLLHYAANGKITFQVAARGQGHSLKGQ  102

Query  1540  ATAKDGVVVEMGALRGGGKIRVSWSESLGYFADVGGHELWVDVLHACLAHGVSPASWTDY  1361
             A+   GVVV M  L     + VS  +    +ADV    LWVDVL      GVSP  WTDY
Sbjct  103   ASVSGGVVVNMTCL---SDVVVSKDKK---YADVAAGTLWVDVLKKTAEKGVSPVCWTDY  156

Query  1360  LHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDMNSELFFAVLGGLG  1181
             LH++VGGTLSN GI GQ+FR GP ISNVLELDVITGKGE +TCS  +NSELF+ VLGGLG
Sbjct  157   LHISVGGTLSNGGIGGQVFRNGPLISNVLELDVITGKGELLTCSPKLNSELFYGVLGGLG  216

Query  1180  QFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISI---NGLNYLEGSLMMNHT  1010
             QFGIITRARIVL+ AP R KW RMLY DF+ FT+DQE LIS+   +G++YLEG + M++ 
Sbjct  217   QFGIITRARIVLDHAPKRAKWFRMLYSDFTAFTKDQERLISMANDSGVDYLEGQIFMSNG  276

Query  1009  SPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGSTVDQELKDLLKDLSFVP  830
               +   +SFF  SDQSK+A L+ + G++Y LE  K+YDD     +   +  L K  S++P
Sbjct  277   VVD---TSFFPPSDQSKVADLVKKHGIIYVLEAAKYYDDPNLPIIHTVIDKLNKSQSYLP  333

Query  829   GMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKSRILDFNSAVFQNILLK  650
             G     D +YF+FLNRV+ EE + +  GLWE  HPWLNL+VPKSRILDF+    +NIL K
Sbjct  334   GFISMHDVTYFDFLNRVQVEENKLRSLGLWEVPHPWLNLYVPKSRILDFHEGAVKNILSK  393

Query  649   HKT-SGPMLVYPTTTKMWDERMSAVIPE--EDTFYCVGLLYSGGMNGWKVLDELNQEILS  479
              K+ SG  L+YP     W+ RMSA+IPE  ED  Y +GLL S      + ++ +N++I+ 
Sbjct  394   QKSASGLALLYPINRNKWNNRMSAMIPEVDEDVIYVIGLLQSATPQNLQEMESVNEKIIR  453

Query  478   FCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFDPKMILSPGQTIF  311
             FC    + G KIKQYL HY  +EDW++HFG KWN F + K  FDPK +LSPGQ IF
Sbjct  454   FCK---DSGIKIKQYLMHYTKKEDWIEHFGSKWNDFSKKKELFDPKKLLSPGQDIF  506



>gb|KHN17673.1| Cytokinin dehydrogenase 3 [Glycine soja]
Length=377

 Score =   483 bits (1244),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 233/371 (63%), Positives = 286/371 (77%), Gaps = 10/371 (3%)
 Frame = -1

Query  1699  ASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSPFSVAARGHGHSVRGQATAKDGV  1520
             AS D+G +  E P  V  PSS+DDI+ L++ SYNS +PF +AARG GHS  GQA A+DG+
Sbjct  2     ASRDYGHLTHEFPLAVFRPSSIDDIVTLIKSSYNSFAPFDIAARGQGHSTHGQAMARDGI  61

Query  1519  VVEMGALR---GGGKIRVSWSESLGYFADVGGHELWVDVLHACLAHGVSPASWTDYLHLT  1349
             VV+M +LR    G  I VS    +G++ADVGG +LW+DVLHA L +G++P SWTDYL+LT
Sbjct  62    VVDMASLRKQRNGVAISVSKDPLMGHYADVGGEQLWIDVLHATLEYGLAPVSWTDYLYLT  121

Query  1348  VGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDMNSELFFAVLGGLGQFGI  1169
             VGGTLSNAGISGQ FR GPQISNV E+DVITGKGEF+TCS   N ELF AVLGGLGQFG+
Sbjct  122   VGGTLSNAGISGQSFRYGPQISNVHEMDVITGKGEFVTCSSQKNLELFHAVLGGLGQFGV  181

Query  1168  ITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISING------LNYLEGSLMMNHTS  1007
             I RARI LE AP RVKWVR+LY DFS FT+DQE LISING      L++LEG L+MN   
Sbjct  182   IARARIALEPAPKRVKWVRLLYSDFSAFTKDQERLISINGRKQKNALDFLEGMLLMNQGP  241

Query  1006  PNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGSTVDQELKDLLKDLSFVPG  827
              NNWRSSFF LSD  +IASL+T+  +LYCLEV K+YD+QT   VD+E++ LL+ L+++PG
Sbjct  242   INNWRSSFFPLSDHPRIASLITEHSILYCLEVAKYYDEQTELNVDKEIEVLLQGLAYIPG  301

Query  826   MTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKSRILDFNSAVFQNILLKH  647
               ++K+ SY EFLNRVR  EL+ Q  GLWE  HPWLNLF+PKS+ILDFNS VF++I+LK 
Sbjct  302   FNYEKNVSYVEFLNRVRSGELKLQSQGLWEVPHPWLNLFIPKSQILDFNSGVFKDIVLKR  361

Query  646   K-TSGPMLVYP  617
               +SGP+LVYP
Sbjct  362   NISSGPVLVYP  372



>gb|EEC72755.1| hypothetical protein OsI_06398 [Oryza sativa Indica Group]
Length=527

 Score =   489 bits (1258),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 251/500 (50%), Positives = 330/500 (66%), Gaps = 13/500 (3%)
 Frame = -1

Query  1777  NSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYN  1598
             +  LP ++ +  +A + RVD   T  AS+DFG IV   P  VL+P++  DI  LVRFS +
Sbjct  21    SGGLPGDLFAHSVASKLRVDRDTTARASSDFGRIVAAAPEAVLHPATPVDIAELVRFSAS  80

Query  1597  SPSPFSVAARGHGHSVRGQATAKDGVVVEMGALRGG-GKIRVSWSES-LGYFADVGGHEL  1424
             SPSPF VA RG GHS RGQ+ A  GVVV+M AL    G++ VS   +    + D GG +L
Sbjct  81    SPSPFPVAPRGQGHSARGQSLAPGGVVVDMRALAARRGRVNVSAGGAGAAPYVDAGGEQL  140

Query  1423  WVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGE  1244
             W +VL A L HG++P  WTDYL +TV GTLSNAGI GQ FR GPQI+NVLELDVITG+G+
Sbjct  141   WAEVLRATLEHGLAPRVWTDYLRITVAGTLSNAGIGGQAFRHGPQITNVLELDVITGRGD  200

Query  1243  FITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHL  1064
              +TCS+D   +LFFAVLGGLGQFGIITRARI LE AP RV+WVR+ Y D   FTRDQE L
Sbjct  201   MVTCSRDKEPDLFFAVLGGLGQFGIITRARIGLEPAPKRVRWVRLAYSDVVTFTRDQELL  260

Query  1063  ISIN----GLNYLEGSLMMNHTSPNNWRSS-FFSLSDQSKIASLLTQ--QGLLYCLEVVK  905
             IS      G +Y+EG + +N T     +S+ FFS  D  ++  L ++   G++Y +E   
Sbjct  261   ISKRASEAGFDYVEGQVQLNRTLTEGPKSTPFFSRFDIDRLVGLASESVSGVIYFIEGAM  320

Query  904   HYDDQTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHP  725
             +Y++ T ++VDQ+L  +L+ LSF     F KD SY +FL+RVR EE   +  G+W+  HP
Sbjct  321   YYNESTTASVDQKLTSVLEQLSFDKCFVFTKDVSYVQFLDRVREEERILRSIGMWDVPHP  380

Query  724   WLNLFVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVG  545
             WLNLFVP+SRILDF++ V + + +     G +L+YP    MWD+RM+AV   +D FY VG
Sbjct  381   WLNLFVPQSRILDFDTGVLKGVFVGANPVGVILMYPMNRNMWDDRMTAVSGNDDMFYVVG  440

Query  544   LLYSGGMNG-WKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQ  368
             LL S  + G  + L+  N+ +L+FC   D EG   KQYLPHY S+++W  HFG KW+   
Sbjct  441   LLRSAVVPGDVERLERENEAVLAFC---DNEGIGCKQYLPHYASQDEWRSHFGPKWSRVT  497

Query  367   ENKAKFDPKMILSPGQTIFN  308
             E K K+DP  ILSPGQ IF+
Sbjct  498   ELKVKYDPYGILSPGQRIFS  517



>gb|KFK41981.1| hypothetical protein AALP_AA2G196900 [Arabis alpina]
Length=534

 Score =   489 bits (1259),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 250/498 (50%), Positives = 333/498 (67%), Gaps = 19/498 (4%)
 Frame = -1

Query  1765  PYEIL---SVDIAGRFRVDSRATTAASTDFGGIVQ-ETPAGVLYPSSVDDIINLVRFSYN  1598
             P E+L   ++D+ G F        + S+DFG +   E P  V  PSS +D+  LVR SY 
Sbjct  26    PSELLRLGAIDVDGHFTFHPSDLASVSSDFGMLKSPENPLAVFQPSSTEDVARLVRTSYG  85

Query  1597  SPSPFSVAARGHGHSVRGQA-TAKDGVVVEMGALRGGGKIRVSWSESLGYFADVGGHELW  1421
             S + F V+ARGHGHS+ GQA   ++GVVVEM     G    +   + +  + DV G ELW
Sbjct  86    SATAFPVSARGHGHSINGQAAVGRNGVVVEMNHREAGTPEPLVRLKEM--YVDVWGGELW  143

Query  1420  VDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEF  1241
             VDVL   L HG++P SWTDYL+L+VGGTLSNAGISGQ F  GPQISNVLELDV+TGKGE 
Sbjct  144   VDVLKKTLEHGLAPKSWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVLELDVVTGKGEV  203

Query  1240  ITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLI  1061
             + CS++ N+ LF  VLGGLGQFGIITRARI LE AP RV+W+R+LY  F  FT DQE+LI
Sbjct  204   MKCSEEENTRLFHGVLGGLGQFGIITRARISLEPAPQRVRWIRVLYSSFKVFTEDQEYLI  263

Query  1060  SING---LNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQ  890
             S++G    +Y+EG ++++    NNWRSSFFS  +  KI+S+ +   +LYCLE+ K+Y D 
Sbjct  264   SMHGQSKFDYVEGFVIVDEGLVNNWRSSFFSPRNPVKISSVSSNGSVLYCLEITKNYHDS  323

Query  889   TGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLF  710
                T+DQE++ L+K L+F+P   F  D  Y +FL+RV   EL+ +   LW   HPWLNLF
Sbjct  324   ESETIDQEIEILMKKLNFIPTSVFTTDLQYIDFLDRVHKAELKLRSKNLWGVPHPWLNLF  383

Query  709   VPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSG  530
             VPKSRI DF+  VF+ I L +KTSGP+L+YP     WD+R SAV P+E+ FY V LL S 
Sbjct  384   VPKSRISDFDKGVFKGI-LGNKTSGPILIYPMNKDKWDDRSSAVTPDEEIFYLVALLRSA  442

Query  529   GMNG-----WKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQE  365
               +G      + L + N++IL FC   ++    +KQYLPH+ ++E+W++HFG KW+ F+ 
Sbjct  443   LSDGEETQKLEYLKDQNRKILEFC---EQAKINVKQYLPHHATQEEWVEHFGDKWDRFRS  499

Query  364   NKAKFDPKMILSPGQTIF  311
              K +FDP+ IL+ GQ IF
Sbjct  500   MKTEFDPRHILATGQRIF  517



>gb|EMT16465.1| Cytokinin dehydrogenase 1 [Aegilops tauschii]
Length=532

 Score =   489 bits (1258),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 251/493 (51%), Positives = 327/493 (66%), Gaps = 10/493 (2%)
 Frame = -1

Query  1771  SLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSP  1592
             +L  +++++DI  +   D   T  AS+DFG IV+  P GV +P S  DI  L+RFS    
Sbjct  29    ALDDDLVALDIVSKIHTDRSLTARASSDFGHIVEAAPNGVFHPVSPADIAALIRFSLYQQ  88

Query  1591  SPFSVAARGHGHSVRGQATAKDGVVVEMGAL-RGGGKIRVSWSESLGYFADVGGHELWVD  1415
             +PF+VA RG GHS RGQA A  G+VV+M +L RG    RV+ S   G + DVGG +LW D
Sbjct  89    TPFTVAPRGKGHSSRGQALAPGGIVVDMPSLGRGDHGHRVNVSID-GMYVDVGGEQLWFD  147

Query  1414  VLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFIT  1235
             VLHA L HG++P  WTDYL +TVGGTLSNAGI GQ+FR GPQISNV ELDV+TG G+ IT
Sbjct  148   VLHATLKHGLTPRVWTDYLRITVGGTLSNAGIGGQVFRHGPQISNVRELDVVTGTGDMIT  207

Query  1234  CSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISI  1055
             CS   NS+LF+  LGGLGQFG+ITRAR+ LE+AP RVKWVR+ Y D  +FT DQE LIS 
Sbjct  208   CSPGNNSDLFYGALGGLGQFGVITRARVGLERAPKRVKWVRLAYTDVHQFTADQELLISN  267

Query  1054  N-GLNYLEGSLMMNHTSPNNWR-SSFFSLSDQSKIASLL--TQQGLLYCLEVVKHYDDQT  887
               G +Y+EG + +N T     R SSFFS ++ +++  L   T    +Y +E   +YDD +
Sbjct  268   GAGFDYVEGQVQLNRTLTEGRRSSSFFSAAELARLTELALGTGSSAVYYIEGAMYYDDGS  327

Query  886   GSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFV  707
              STVD++L+ LL++LSFVPG  F +DASY +FL+RV  EE + +  G W+  HPWLNLFV
Sbjct  328   ASTVDRKLEALLEELSFVPGFAFVRDASYVQFLDRVGQEEQKLRSAGAWDVPHPWLNLFV  387

Query  706   PKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSGG  527
             P+SRI DF + VF  +L   +  G +L+YP     WD+RM+ V P+ED FY VGLL S  
Sbjct  388   PRSRIHDFAAGVFDGVLRGTRPVGLILMYPMNRDRWDDRMTTVTPDEDVFYAVGLLRSAV  447

Query  526   MNG-WKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKF  350
               G  + L+  N+ +L  C   D  G   KQYLPH+ S++ W +HFG KW+     KA +
Sbjct  448   AAGDLERLERENEAVLGLC---DRAGIGCKQYLPHHASQDGWRRHFGAKWDRVAALKATY  504

Query  349   DPKMILSPGQTIF  311
             DP+ ILSPGQ IF
Sbjct  505   DPRAILSPGQGIF  517



>ref|XP_009408782.1| PREDICTED: cytokinin dehydrogenase 5-like [Musa acuminata subsp. 
malaccensis]
Length=529

 Score =   488 bits (1257),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 249/489 (51%), Positives = 318/489 (65%), Gaps = 18/489 (4%)
 Frame = -1

Query  1735  GRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSPFSVAARGHGH  1556
             G+  +D     AA+ DFGG  +  P  V+ P    D+  LVR +Y S   F V+ARGHGH
Sbjct  36    GQLSLDPSEVAAAAVDFGGAARAEPLAVMRPGCAGDVARLVRAAYRSARWFPVSARGHGH  95

Query  1555  SVRGQATAKDGVVVEMGALRGGGKIRVSWSESLG-YFADVGGHELWVDVLHACLAHG-VS  1382
             S  GQA +  GVVV+M   R   +   ++S S G Y+ DV G +LWVDVL+  LA+G ++
Sbjct  96    STNGQALSPGGVVVQMSRGRIAPRPVPAYSPSTGEYYVDVWGGDLWVDVLNWTLANGGLA  155

Query  1381  PASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDMNSELFF  1202
             P SWTDYL+L+VGGTLSNAGISGQ F  GPQISNV ELDV+TGKGE ITCS++ NSELF 
Sbjct  156   PKSWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVYELDVVTGKGELITCSEEQNSELFH  215

Query  1201  AVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISING------LNY  1040
              VLGGLGQFGIITRARI LE AP RV+W+R+LY DF+ FTRDQE L+S++G       +Y
Sbjct  216   GVLGGLGQFGIITRARIALETAPHRVRWIRVLYSDFAAFTRDQELLVSLHGAHRSERFDY  275

Query  1039  LEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGSTVDQELK  860
             +EG ++++    NNWRSSFFS  +  KI+S+    GLLYCLE+ K+YD     ++D+ ++
Sbjct  276   VEGFVIVDEGLINNWRSSFFSPKNPVKISSVHANAGLLYCLEMTKNYDSSAADSIDEVVE  335

Query  859   DLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKSRILDFN  680
              LL  L ++P   F  D  Y +FL+RV   E+  +  GLW   HPWLNLFVP SRI DFN
Sbjct  336   ALLGQLGYIPASVFTTDLPYVDFLDRVHKAEMRLRAKGLWAVPHPWLNLFVPASRIADFN  395

Query  679   SAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSG------GMNG  518
               VF+ I L +K+SGP+L+YP     WD+R S V P EDTFY V  L S           
Sbjct  396   RGVFRGI-LGNKSSGPILIYPMNKHKWDDRSSVVTPHEDTFYLVAFLRSALPDSGDPTQS  454

Query  517   WKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFDPKM  338
              + L   N++IL FC   D+ G +IKQYLP +RSR  W +HFG KW  F   K +FDPK 
Sbjct  455   LEYLSRQNKKILEFC---DDAGIEIKQYLPDHRSRAKWARHFGPKWGRFLRRKDRFDPKC  511

Query  337   ILSPGQTIF  311
             +L+ GQ I 
Sbjct  512   MLATGQGIL  520



>gb|AFK48435.1| unknown [Lotus japonicus]
Length=525

 Score =   487 bits (1253),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 243/489 (50%), Positives = 330/489 (67%), Gaps = 18/489 (4%)
 Frame = -1

Query  1744  DIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSPFSVAARG  1565
             DIA +F  D    +  S+DFG I     + V  P+S+ DI  L++FS +   PF++A RG
Sbjct  45    DIANKFSRDPATLSQVSSDFGLIFHRNSSAVFTPTSISDISKLIKFSNSLSCPFTIAPRG  104

Query  1564  HGHSVRGQATAKDGVVVEMGAL---RGGGKIRVSWSESLGYFADVGGHELWVDVLHACLA  1394
              GH+  GQA  + GVVV M AL   R G  I V   +   Y  DVGG ++W+DVL A   
Sbjct  105   QGHASYGQAMTRGGVVVNMTALNDYRNGSGIVVHHDKQTPY-VDVGGEQIWIDVLRATFV  163

Query  1393  HGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDMNS  1214
             HG++P +WTDYL+L++G TLSN GI+G+ FR GPQISNV ELDV+TGKG+ +TCS + NS
Sbjct  164   HGLTPFAWTDYLYLSIGATLSNGGINGRAFRFGPQISNVHELDVVTGKGDLVTCSANKNS  223

Query  1213  ELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISINGLN---  1043
             +LF+AVLGGLGQFGIITRARI L  APTRVKWV MLY+DFS F++DQEHLI+  G N   
Sbjct  224   DLFYAVLGGLGQFGIITRARIPLGPAPTRVKWVHMLYNDFSTFSKDQEHLITFKGRNGNN  283

Query  1042  ---YLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGSTVD  872
                ++EG LM+N  S +    SF+  SDQ +I SL+TQ  ++Y +E+VK+YDD T   VD
Sbjct  284   QADFVEGVLMLNQPSQD---LSFYPESDQPRIISLVTQYDIIYVMELVKYYDDNTQDQVD  340

Query  871   QELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKSRI  692
             QE++DL+  L F+P   F K+ASY EF NR+R  EL  +  GLW+  HPWL+L+VP SRI
Sbjct  341   QEIEDLIHGLKFIPTFKFDKNASYEEFQNRIRTIELTLKPLGLWDVPHPWLDLYVPGSRI  400

Query  691   LDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSGGMNGW  515
             +DF+  VF+ I+LK   T+  +LVY T  K WD++ SA+ P+ED FY V +L S   +  
Sbjct  401   MDFDEGVFKGIILKQNITARRILVYATNQKKWDDKTSAMTPDED-FYIVSILPSTRFDNL  459

Query  514   KVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFDPKMI  335
             ++    NQ++L FC   ++ G   KQY PH +++E+W++++G KW T Q+ K +FDP  +
Sbjct  460   ELYLAQNQQVLQFC---EDAGIGAKQYTPHNKTQEEWVEYYGPKWKTIQQRKLQFDPNKL  516

Query  334   LSPGQTIFN  308
             L+PGQ IFN
Sbjct  517   LAPGQGIFN  525



>ref|XP_004968471.1| PREDICTED: cytokinin dehydrogenase 1-like [Setaria italica]
Length=522

 Score =   486 bits (1252),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 249/507 (49%), Positives = 332/507 (65%), Gaps = 22/507 (4%)
 Frame = -1

Query  1786  KPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRF  1607
             +PW    P  +  +   G+ R DS AT  AS DFG I    PA VLYP+S  D+  L+  
Sbjct  24    RPW----PASLAKLAKEGKLRTDSNATVPASMDFGNITSALPAAVLYPASPGDLAALLGA  79

Query  1606  SYNSPS-PFSVAARGHGHSVRGQATAKDGVVVEMGAL--RGGGKIRVSWSESLGYFADVG  1436
             +Y++P  P++VA RG GHS+ GQA A  GVVV M +L   G    R++ S   G + D G
Sbjct  80    AYSTPGWPYTVAFRGRGHSLMGQAFAPGGVVVNMPSLGDPGAAAPRINVSAD-GRYVDAG  138

Query  1435  GHELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVIT  1256
             G ++W+DVLHA LA GV+P SWTDYL+LTVGGTLSNAG+SGQ FR GPQISNV E+DVIT
Sbjct  139   GEQMWIDVLHASLARGVAPRSWTDYLYLTVGGTLSNAGVSGQTFRHGPQISNVYEMDVIT  198

Query  1255  GKGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRD  1076
             G GE +TCSK++N++LF AVLGGLGQFG+ITRARI +E AP R +WVR++Y DF+ FT D
Sbjct  199   GHGETVTCSKELNADLFDAVLGGLGQFGVITRARIAVEPAPARARWVRLVYTDFATFTAD  258

Query  1075  QEHLI------SINGLNYLEGSLMMNHTSPNNWRSS-FFSLSDQSKIASLLTQQGL--LY  923
             QE LI      +   L+Y+EGS+ +N +  ++ +++ FFS +D ++I +L  ++ +  +Y
Sbjct  259   QERLIAPRPGGAFGPLSYVEGSVFVNQSLASDLKNTGFFSDADAARIVALAKERNVTTVY  318

Query  922   CLEVVKHYDDQT-GSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENG  746
              +E   +YD+ T  ++VDQ LK +L  L F PG +F++D +Y EFL+RV  EE+   + G
Sbjct  319   SIEATLNYDNATAAASVDQVLKSVLDGLRFEPGFSFERDVTYVEFLDRVHSEEVALNKVG  378

Query  745   LWEATHPWLNLFVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEE  566
             LW   HPWLN+FVP SRI DF+  VF+ IL      GP++VYP     W + MSA  P E
Sbjct  379   LWRVPHPWLNMFVPGSRIADFDRGVFKGILQGADIVGPLIVYPVNKAKWYDGMSAATPAE  438

Query  565   DTFYCVGLLYSGGMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGK  386
             D FY V LL+S   N    L   NQ I+ FC   D  G + K YL  Y +R+DW++HFG 
Sbjct  439   DVFYVVSLLFSSVANDLARLQTQNQRIVKFC---DSTGIQYKSYLARYTNRDDWIRHFGS  495

Query  385   -KWNTFQENKAKFDPKMILSPGQTIFN  308
              KW  F + K K+DPK +LSPGQ IFN
Sbjct  496   DKWKWFVDMKNKYDPKKLLSPGQDIFN  522



>emb|CDY51023.1| BnaC09g33450D [Brassica napus]
Length=478

 Score =   483 bits (1244),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 239/435 (55%), Positives = 315/435 (72%), Gaps = 7/435 (2%)
 Frame = -1

Query  1774  SSLPYEILSVD-IAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYN  1598
             SSLP+ ILS D  AG+    S +  +A+TDFG I +  P+ VL PSSV DI +L++ S++
Sbjct  33    SSLPWNILSNDNFAGKLTTASSSVESAATDFGHITKIFPSAVLNPSSVQDITDLIKLSFD  92

Query  1597  SPSPFSVAARGHGHSVRGQATAKDGVVVEMGALRGGGK-IRVSWSESLGYFADVGGHELW  1421
             S S F +AARGHGHS RGQA AKDGVVV M ++    + I+VS +   G +ADV    LW
Sbjct  93    SQSSFPLAARGHGHSHRGQAAAKDGVVVNMRSMVNRDRGIKVSRT---GLYADVDSAWLW  149

Query  1420  VDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEF  1241
             ++VL+  L  G++P SWTDYLHLTVGGTLSN GISGQ FR GPQISNVLE+DVITGKGE 
Sbjct  150   IEVLNKTLELGLTPVSWTDYLHLTVGGTLSNGGISGQTFRYGPQISNVLEMDVITGKGEI  209

Query  1240  ITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLI  1061
              TCSKDMNS+LF+A LGGLGQFGIITRARI LE AP   KW+R LY DFS+FTRDQE LI
Sbjct  210   ATCSKDMNSDLFYAALGGLGQFGIITRARIKLELAPKNAKWLRFLYTDFSEFTRDQERLI  269

Query  1060  S-INGLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTG  884
             S  NGL++LEGS+M++H  P+NWRS+++  S+  +I S++ Q  ++YCLEVVK+YD+ + 
Sbjct  270   SETNGLHFLEGSVMLDHGPPDNWRSTYYPPSEHMRIVSMVKQHRVIYCLEVVKYYDETSQ  329

Query  883   STVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVP  704
              +V++E+++L   L++  G  ++KD +Y +FLNRVR  EL+ +  G W+  HPWLNLFVP
Sbjct  330   HSVNEEMEELSDSLNYERGFVYEKDVTYMDFLNRVRTGELKLKSKGQWDVPHPWLNLFVP  389

Query  703   KSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSGG  527
             KS+I  F   VF+ I+L++  T+GP+LVYP     W++RMS V+PEED FY VG L S  
Sbjct  390   KSQISRFEYGVFKGIILRNNITTGPLLVYPMNRNKWNDRMSTVLPEEDVFYAVGFLRSAS  449

Query  526   MNGWKVLDELNQEIL  482
              + W   ++ N E+ 
Sbjct  450   FDNWDDYEKENMELF  464



>pdb|2QKN|A Chain A, Crystal Structure Of Maize Cytokinin OxidaseDEHYDROGENASE 
COMPLEXED With Phenylurea Inhibitor Cppu
 pdb|3BW7|A Chain A, Maize Cytokinin OxidaseDEHYDROGENASE COMPLEXED WITH 
THE ALLENIC Cytokinin Analog Ha-1
 pdb|3C0P|A Chain A, Maize Cytokinin OxidaseDEHYDROGENASE COMPLEXED WITH 
THE ALLENIC Cytokinin Analog Ha-8
 pdb|3DQ0|A Chain A, Maize Cytokinin OxidaseDEHYDROGENASE COMPLEXED WITH 
N6-(3-Methoxy- Phenyl)adenine
 pdb|3S1C|A Chain A, Maize Cytokinin OxidaseDEHYDROGENASE COMPLEXED WITH 
N6- Isopentenyladenosine
Length=516

 Score =   485 bits (1248),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 253/511 (50%), Positives = 333/511 (65%), Gaps = 26/511 (5%)
 Frame = -1

Query  1786  KPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRF  1607
             +PW +SL    L++D  G+ R DS AT AASTDFG I    PA VLYPSS  D++ L+  
Sbjct  14    RPWPASL--AALALD--GKLRTDSNATAAASTDFGNITSALPAAVLYPSSTADLVALLSA  69

Query  1606  SYNSPS-PFSVAARGHGHSVRGQATAKDGVVVEMGAL-RGGGKIRVSWSESLGYFADVGG  1433
             + ++P  P+++A RG GHS+ GQA A  GVVV M +L       R++ S   G + D GG
Sbjct  70    ANSTPGWPYTIAFRGRGHSLMGQAFAPGGVVVNMASLGDAAAPPRINVSAD-GRYVDAGG  128

Query  1432  HELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITG  1253
              ++W+DVL A LA GV+P SWTDYL+LTVGGTLSNAGISGQ FR GPQISNVLE+DVITG
Sbjct  129   EQVWIDVLRASLARGVAPRSWTDYLYLTVGGTLSNAGISGQAFRHGPQISNVLEMDVITG  188

Query  1252  KGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQ  1073
              GE +TCSK +N++LF AVLGGLGQFG+ITRARI +E AP R +WVR++Y DF+ F+ DQ
Sbjct  189   HGEMVTCSKQLNADLFDAVLGGLGQFGVITRARIAVEPAPARARWVRLVYTDFAAFSADQ  248

Query  1072  EHLI---------SINGLNYLEGSLMMNHTSPNNWRSS-FFSLSDQSKIASLLTQQG--L  929
             E L          S   ++Y+EGS+ +N +   +  ++ FF+ +D ++I +L  ++    
Sbjct  249   ERLTAPRPGGGGASFGPMSYVEGSVFVNQSLATDLANTGFFTDADVARIVALAGERNATT  308

Query  928   LYCLEVVKHYDD--QTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQ  755
             +Y +E   +YD+     + VDQEL  +L  LS+V G  F++D +Y  FL+RV GEE+   
Sbjct  309   VYSIEATLNYDNATAAAAAVDQELASVLGTLSYVEGFAFQRDVAYAAFLDRVHGEEVALN  368

Query  754   ENGLWEATHPWLNLFVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVI  575
             + GLW   HPWLN+FVP+SRI DF+  VF+ IL      GP++VYP    MWD+ MSA  
Sbjct  369   KLGLWRVPHPWLNMFVPRSRIADFDRGVFKGILQGTDIVGPLIVYPLNKSMWDDGMSAAT  428

Query  574   PEEDTFYCVGLLYSG-GMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMK  398
             P ED FY V LL+S    N    L E N+ IL FC   D  G + K YL  +  R DW++
Sbjct  429   PSEDVFYAVSLLFSSVAPNDLARLQEQNRRILRFC---DLAGIQYKTYLARHTDRSDWVR  485

Query  397   HFG-KKWNTFQENKAKFDPKMILSPGQTIFN  308
             HFG  KWN F E K K+DPK +LSPGQ IFN
Sbjct  486   HFGAAKWNRFVEMKNKYDPKRLLSPGQDIFN  516



>ref|NP_001105591.1| cytokinin dehydrogenase 1 precursor [Zea mays]
 emb|CAA77151.1| cytokinin oxidase [Zea mays]
Length=534

 Score =   485 bits (1248),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 253/511 (50%), Positives = 333/511 (65%), Gaps = 26/511 (5%)
 Frame = -1

Query  1786  KPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRF  1607
             +PW +SL    L++D  G+ R DS AT AASTDFG I    PA VLYPSS  D++ L+  
Sbjct  32    RPWPASL--AALALD--GKLRTDSNATAAASTDFGNITSALPAAVLYPSSTADLVALLSA  87

Query  1606  SYNSPS-PFSVAARGHGHSVRGQATAKDGVVVEMGAL-RGGGKIRVSWSESLGYFADVGG  1433
             + ++P  P+++A RG GHS+ GQA A  GVVV M +L       R++ S   G + D GG
Sbjct  88    ANSTPGWPYTIAFRGRGHSLMGQAFAPGGVVVNMASLGDAAAPPRINVSAD-GRYVDAGG  146

Query  1432  HELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITG  1253
              ++W+DVL A LA GV+P SWTDYL+LTVGGTLSNAGISGQ FR GPQISNVLE+DVITG
Sbjct  147   EQVWIDVLRASLARGVAPRSWTDYLYLTVGGTLSNAGISGQAFRHGPQISNVLEMDVITG  206

Query  1252  KGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQ  1073
              GE +TCSK +N++LF AVLGGLGQFG+ITRARI +E AP R +WVR++Y DF+ F+ DQ
Sbjct  207   HGEMVTCSKQLNADLFDAVLGGLGQFGVITRARIAVEPAPARARWVRLVYTDFAAFSADQ  266

Query  1072  EHLI---------SINGLNYLEGSLMMNHTSPNNWRSS-FFSLSDQSKIASLLTQQGL--  929
             E L          S   ++Y+EGS+ +N +   +  ++ FF+ +D ++I +L  ++    
Sbjct  267   ERLTAPRPGGGGASFGPMSYVEGSVFVNQSLATDLANTGFFTDADVARIVALAGERNATT  326

Query  928   LYCLEVVKHYDD--QTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQ  755
             +Y +E   +YD+     + VDQEL  +L  LS+V G  F++D +Y  FL+RV GEE+   
Sbjct  327   VYSIEATLNYDNATAAAAAVDQELASVLGTLSYVEGFAFQRDVAYAAFLDRVHGEEVALN  386

Query  754   ENGLWEATHPWLNLFVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVI  575
             + GLW   HPWLN+FVP+SRI DF+  VF+ IL      GP++VYP    MWD+ MSA  
Sbjct  387   KLGLWRVPHPWLNMFVPRSRIADFDRGVFKGILQGTDIVGPLIVYPLNKSMWDDGMSAAT  446

Query  574   PEEDTFYCVGLLYSG-GMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMK  398
             P ED FY V LL+S    N    L E N+ IL FC   D  G + K YL  +  R DW++
Sbjct  447   PSEDVFYAVSLLFSSVAPNDLARLQEQNRRILRFC---DLAGIQYKTYLARHTDRSDWVR  503

Query  397   HFG-KKWNTFQENKAKFDPKMILSPGQTIFN  308
             HFG  KWN F E K K+DPK +LSPGQ IFN
Sbjct  504   HFGAAKWNRFVEMKNKYDPKRLLSPGQDIFN  534



>emb|CDM81697.1| unnamed protein product [Triticum aestivum]
Length=524

 Score =   484 bits (1245),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 246/490 (50%), Positives = 322/490 (66%), Gaps = 20/490 (4%)
 Frame = -1

Query  1735  GRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPS-PFSVAARGHG  1559
             G+ R D  AT AASTDFG I    PA VL+PSS  D+  L+R ++ + + P++++ RG G
Sbjct  38    GKLRSDPNATLAASTDFGNITAALPAAVLFPSSPADVAALLRAAHTTVAWPYTISFRGRG  97

Query  1558  HSVRGQATAKDGVVVEMGALRG---GGKIRVSWSESLGYFADVGGHELWVDVLHACLAHG  1388
             HSV GQA A  GVVV+M +L G     +I VS   + G + D GG ++W+DVL A L  G
Sbjct  98    HSVMGQALALGGVVVDMPSLGGPSSAARINVS---ADGQYVDAGGEQMWIDVLRATLERG  154

Query  1387  VSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDMNSEL  1208
             V+P SWTDYLHLTVGGTLSNAGISGQ +R GPQISNVLELDVITG GE +TCSK +N++L
Sbjct  155   VAPQSWTDYLHLTVGGTLSNAGISGQTYRHGPQISNVLELDVITGYGEMLTCSKSLNADL  214

Query  1207  FFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLI------SINGL  1046
             F AVLGGLGQFG+I RARI LE APTR +W R++Y DF+ F+ DQE L+      +   +
Sbjct  215   FDAVLGGLGQFGVIVRARIALEPAPTRARWARLVYTDFATFSADQERLVAPGPDGAFGPM  274

Query  1045  NYLEGSLMMNHTSPNNWRSS--FFS--LSDQSKIASLLTQQGLLYCLEVVKHYDDQTGST  878
             +YLEG++ +NH+     ++S  FF+     +    +       +Y +E   +YD+ T ++
Sbjct  275   SYLEGAVYVNHSLAAGLKNSGGFFTDADVARIVAVAAARNATTVYVIEATLNYDNATAAS  334

Query  877   VDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKS  698
             VDQEL  ++  L    G+ F +DASY EFL+RV GEE+   + GLW   HPWLN+ VP+S
Sbjct  335   VDQELSSVVATLRHEEGLAFVRDASYLEFLDRVHGEEVALDKIGLWRVPHPWLNVLVPRS  394

Query  697   RILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSGGMNG  518
             RI DF+S VF+ IL     +GP++VYP     WD+ MSAV P E+ FY V LL+S   N 
Sbjct  395   RIADFDSGVFKGILQGTDIAGPLVVYPLNKSKWDDGMSAVTPAEEVFYAVSLLFSSVAND  454

Query  517   WKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFDPKM  338
              K L+  NQ+IL FC   D  G   K+YL HY +  DW++HFG KW  F E K K+DPK 
Sbjct  455   LKRLEAQNQKILRFC---DLAGIGYKEYLAHYTAHGDWVRHFGGKWQRFVEMKDKYDPKR  511

Query  337   ILSPGQTIFN  308
             +LSPGQ IFN
Sbjct  512   LLSPGQDIFN  521



>gb|KFK40311.1| hypothetical protein AALP_AA3G358400 [Arabis alpina]
Length=504

 Score =   483 bits (1243),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 250/476 (53%), Positives = 317/476 (67%), Gaps = 18/476 (4%)
 Frame = -1

Query  1720  DSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYNSPSPFSVAARGHGHSVRGQ  1541
             D     AAS D+G     TP GVL PSS  DI +L+R++      F VAARG GHS+ GQ
Sbjct  41    DPSTIAAASHDYGKTTTVTPGGVLRPSSTADISHLIRYTAERDGIFKVAARGQGHSLDGQ  100

Query  1540  ATAKDGVVVEMGALRGGGKIRVSWSESLGYFADVGGHELWVDVLHACLAHGVSPASWTDY  1361
             A+   GVV+ M  L     + +S  +    +ADV G  LWVDVL      GVSP +WTDY
Sbjct  101   ASVPGGVVINMTCL---ADVVISDDKK---YADVAGGALWVDVLKKTAEKGVSPVTWTDY  154

Query  1360  LHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEFITCSKDMNSELFFAVLGGLG  1181
             L ++VGGTLSNAGI G +FR GPQISNVLELDVITGKG+ +TCS  +N ELF+ VLGGLG
Sbjct  155   LKVSVGGTLSNAGIGGHVFRHGPQISNVLELDVITGKGKMLTCSPQLNRELFYGVLGGLG  214

Query  1180  QFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLISIN---GLNYLEGSLMMNHT  1010
             QFGIITRARIVL+ AP R KW RMLY DF+ FT+DQE LIS++   G++YLEG ++M++ 
Sbjct  215   QFGIITRARIVLDHAPKRAKWFRMLYSDFNAFTKDQERLISLSNDFGVDYLEGQILMSNG  274

Query  1009  SPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTGSTVDQELKDLLKDLSFVP  830
               +   +SFF  S QSKIA+L+   G++Y LEV K+YDD T   + Q +  L K+LS++P
Sbjct  275   FVD---TSFFPTSQQSKIANLVKDHGIIYVLEVAKYYDDPTLPIIGQVIDKLTKNLSYLP  331

Query  829   GMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVPKSRILDFNSAVFQNILLK  650
             G     D   F+FLNRV+ EE   +  GLW+  HPWLNL++PKSRI DF+  VF+NILLK
Sbjct  332   GFIAMHDVPIFDFLNRVQTEENTLRSAGLWDVPHPWLNLYIPKSRIRDFHDGVFKNILLK  391

Query  649   HKT-SGPMLVYPTTTKMWDERMSAVIP-EEDTFYCVGLL-YSGGMNGWKVLDELNQEILS  479
               + SG  L+YPT    WD RMSAVIP +ED  Y VG+L YS      + +  +N++I+ 
Sbjct  392   EASISGIALLYPTNIDKWDNRMSAVIPNDEDVIYIVGILQYSTNQEKLQEIKSVNEKIIR  451

Query  478   FCNKDDEEGSKIKQYLPHYRSREDWMKHFGKKWNTFQENKAKFDPKMILSPGQTIF  311
             FC      G KIKQYL HY  +EDW++HFG KW+ F + K  FDPK +LSPG  IF
Sbjct  452   FCK---NSGIKIKQYLMHYSRKEDWVEHFGSKWSDFSKRKDMFDPKKLLSPGHDIF  504



>pdb|2QPM|A Chain A, Leu492ala Mutant Of Maize Cytokinin OxidaseDEHYDROGENASE 
COMPLEXED With Benzylurea Inhibitor Cpbu
 pdb|3KJM|A Chain A, Leu492ala Mutant Of Maize Cytokinin OxidaseDEHYDROGENASE 
COMPLEXED With Phenylurea Inhibitor Cppu
Length=516

 Score =   483 bits (1243),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 252/511 (49%), Positives = 332/511 (65%), Gaps = 26/511 (5%)
 Frame = -1

Query  1786  KPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRF  1607
             +PW +SL    L++D  G+ R DS AT AASTDFG I    PA VLYPSS  D++ L+  
Sbjct  14    RPWPASL--AALALD--GKLRTDSNATAAASTDFGNITSALPAAVLYPSSTADLVALLSA  69

Query  1606  SYNSPS-PFSVAARGHGHSVRGQATAKDGVVVEMGAL-RGGGKIRVSWSESLGYFADVGG  1433
             + ++P  P+++A RG GHS+ GQA A  GVVV M +L       R++ S   G + D GG
Sbjct  70    ANSTPGWPYTIAFRGRGHSLMGQAFAPGGVVVNMASLGDAAAPPRINVSAD-GRYVDAGG  128

Query  1432  HELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITG  1253
              ++W+DVL A LA GV+P SWTDYL+LTVGGTLSNAGISGQ FR GPQISNVLE+DVITG
Sbjct  129   EQVWIDVLRASLARGVAPRSWTDYLYLTVGGTLSNAGISGQAFRHGPQISNVLEMDVITG  188

Query  1252  KGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQ  1073
              GE +TCSK +N++LF AVLGGLGQFG+ITRARI +E AP R +WVR++Y DF+ F+ DQ
Sbjct  189   HGEMVTCSKQLNADLFDAVLGGLGQFGVITRARIAVEPAPARARWVRLVYTDFAAFSADQ  248

Query  1072  EHLI---------SINGLNYLEGSLMMNHTSPNNWRSS-FFSLSDQSKIASLLTQQGL--  929
             E L          S   ++Y+EGS+ +N +   +  ++ FF+ +D ++I +L  ++    
Sbjct  249   ERLTAPRPGGGGASFGPMSYVEGSVFVNQSLATDLANTGFFTDADVARIVALAGERNATT  308

Query  928   LYCLEVVKHYDD--QTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQ  755
             +Y +E   +YD+     + VDQEL  +L  LS+V G  F++D +Y  FL+RV GEE+   
Sbjct  309   VYSIEATLNYDNATAAAAAVDQELASVLGTLSYVEGFAFQRDVAYAAFLDRVHGEEVALN  368

Query  754   ENGLWEATHPWLNLFVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVI  575
             + GLW   HPWLN+FVP+SRI DF+  VF+ IL      GP++VYP    MWD+ MSA  
Sbjct  369   KLGLWRVPHPWLNMFVPRSRIADFDRGVFKGILQGTDIVGPLIVYPLNKSMWDDGMSAAT  428

Query  574   PEEDTFYCVGLLYSG-GMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMK  398
             P ED FY V LL+S    N    L E N+ IL FC   D  G + K Y   +  R DW++
Sbjct  429   PSEDVFYAVSLLFSSVAPNDLARLQEQNRRILRFC---DLAGIQYKTYAARHTDRSDWVR  485

Query  397   HFG-KKWNTFQENKAKFDPKMILSPGQTIFN  308
             HFG  KWN F E K K+DPK +LSPGQ IFN
Sbjct  486   HFGAAKWNRFVEMKNKYDPKRLLSPGQDIFN  516



>pdb|1W1O|A Chain A, Native Cytokinin Dehydrogenase
 pdb|1W1Q|A Chain A, Plant Cytokinin Dehydrogenase In Complex With Isopentenyladenine
 pdb|1W1R|A Chain A, Plant Cytokinin Dehydrogenase In Complex With Trans-zeatin
 pdb|1W1S|A Chain A, Plant Cytokinin Dehydrogenase In Complex With Benzylaminopurine
Length=534

 Score =   484 bits (1245),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 253/511 (50%), Positives = 332/511 (65%), Gaps = 26/511 (5%)
 Frame = -1

Query  1786  KPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRF  1607
             +PW +SL    L++D  G+ R DS AT AASTDFG I    PA VLYPSS  D++ L+  
Sbjct  32    RPWPASL--AALALD--GKLRTDSNATAAASTDFGNITSALPAAVLYPSSTGDLVALLSA  87

Query  1606  SYNSPS-PFSVAARGHGHSVRGQATAKDGVVVEMGAL-RGGGKIRVSWSESLGYFADVGG  1433
             + ++P  P+++A RG GHS+ GQA A  GVVV M +L       R++ S   G + D GG
Sbjct  88    ANSTPGWPYTIAFRGRGHSLMGQAFAPGGVVVNMASLGDAAAPPRINVSAD-GRYVDAGG  146

Query  1432  HELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITG  1253
              ++W+DVL A LA GV+P SWTDYL+LTVGGTLSNAGISGQ FR GPQISNVLE+DVITG
Sbjct  147   EQVWIDVLRASLARGVAPRSWTDYLYLTVGGTLSNAGISGQAFRHGPQISNVLEMDVITG  206

Query  1252  KGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQ  1073
              GE +TCSK +N++LF AVLGGLGQFG+ITRARI +E AP R +WVR +Y DF+ F+ DQ
Sbjct  207   HGEMVTCSKQLNADLFDAVLGGLGQFGVITRARIAVEPAPARARWVRFVYTDFAAFSADQ  266

Query  1072  EHLI---------SINGLNYLEGSLMMNHTSPNNWRSS-FFSLSDQSKIASLLTQQG--L  929
             E L          S   ++Y+EGS+ +N +   +  ++ FF+ +D ++I +L  ++    
Sbjct  267   ERLTAPRPGGGGASFGPMSYVEGSVFVNQSLATDLANTGFFTDADVARIVALAGERNATT  326

Query  928   LYCLEVVKHYDD--QTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQ  755
             +Y +E   +YD+     + VDQEL  +L  LS+V G  F++D +Y  FL+RV GEE+   
Sbjct  327   VYSIEATLNYDNATAAAAAVDQELASVLGTLSYVEGFAFQRDVAYAAFLDRVHGEEVALN  386

Query  754   ENGLWEATHPWLNLFVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVI  575
             + GLW   HPWLN+FVP+SRI DF+  VF+ IL      GP++VYP    MWD+ MSA  
Sbjct  387   KLGLWRVPHPWLNMFVPRSRIADFDRGVFKGILQGTDIVGPLIVYPLNKSMWDDGMSAAT  446

Query  574   PEEDTFYCVGLLYSG-GMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMK  398
             P ED FY V LL+S    N    L E N+ IL FC   D  G + K YL  +  R DW++
Sbjct  447   PSEDVFYAVSLLFSSVAPNDLARLQEQNRRILRFC---DLAGIQYKTYLARHTDRSDWVR  503

Query  397   HFG-KKWNTFQENKAKFDPKMILSPGQTIFN  308
             HFG  KWN F E K K+DPK +LSPGQ IFN
Sbjct  504   HFGAAKWNRFVEMKNKYDPKRLLSPGQDIFN  534



>pdb|3S1D|A Chain A, Glu381ser Mutant Of Maize Cytokinin OxidaseDEHYDROGENASE 
COMPLEXED With N6-Isopentenyladenosine
Length=516

 Score =   483 bits (1243),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 252/511 (49%), Positives = 332/511 (65%), Gaps = 26/511 (5%)
 Frame = -1

Query  1786  KPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRF  1607
             +PW +SL    L++D  G+ R DS AT AASTDFG I    PA VLYPSS  D++ L+  
Sbjct  14    RPWPASL--AALALD--GKLRTDSNATAAASTDFGNITSALPAAVLYPSSTADLVALLSA  69

Query  1606  SYNSPS-PFSVAARGHGHSVRGQATAKDGVVVEMGAL-RGGGKIRVSWSESLGYFADVGG  1433
             + ++P  P+++A RG GHS+ GQA A  GVVV M +L       R++ S   G + D GG
Sbjct  70    ANSTPGWPYTIAFRGRGHSLMGQAFAPGGVVVNMASLGDAAAPPRINVSAD-GRYVDAGG  128

Query  1432  HELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITG  1253
              ++W+DVL A LA GV+P SWTDYL+LTVGGTLSNAGISGQ FR GPQISNVLE+DVITG
Sbjct  129   EQVWIDVLRASLARGVAPRSWTDYLYLTVGGTLSNAGISGQAFRHGPQISNVLEMDVITG  188

Query  1252  KGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQ  1073
              GE +TCSK +N++LF AVLGGLGQFG+ITRARI +E AP R +WVR++Y DF+ F+ DQ
Sbjct  189   HGEMVTCSKQLNADLFDAVLGGLGQFGVITRARIAVEPAPARARWVRLVYTDFAAFSADQ  248

Query  1072  EHLI---------SINGLNYLEGSLMMNHTSPNNWRSS-FFSLSDQSKIASLLTQQG--L  929
             E L          S   ++Y+EGS+ +N +   +  ++ FF+ +D ++I +L  ++    
Sbjct  249   ERLTAPRPGGGGASFGPMSYVEGSVFVNQSLATDLANTGFFTDADVARIVALAGERNATT  308

Query  928   LYCLEVVKHYDD--QTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQ  755
             +Y +E   +YD+     + VDQEL  +L  LS+V G  F++D +Y  FL+RV G E+   
Sbjct  309   VYSIEATLNYDNATAAAAAVDQELASVLGTLSYVEGFAFQRDVAYAAFLDRVHGSEVALN  368

Query  754   ENGLWEATHPWLNLFVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVI  575
             + GLW   HPWLN+FVP+SRI DF+  VF+ IL      GP++VYP    MWD+ MSA  
Sbjct  369   KLGLWRVPHPWLNMFVPRSRIADFDRGVFKGILQGTDIVGPLIVYPLNKSMWDDGMSAAT  428

Query  574   PEEDTFYCVGLLYSG-GMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMK  398
             P ED FY V LL+S    N    L E N+ IL FC   D  G + K YL  +  R DW++
Sbjct  429   PSEDVFYAVSLLFSSVAPNDLARLQEQNRRILRFC---DLAGIQYKTYLARHTDRSDWVR  485

Query  397   HFG-KKWNTFQENKAKFDPKMILSPGQTIFN  308
             HFG  KWN F E K K+DPK +LSPGQ IFN
Sbjct  486   HFGAAKWNRFVEMKNKYDPKRLLSPGQDIFN  516



>pdb|3S1F|A Chain A, Asp169glu Mutant Of Maize Cytokinin OxidaseDEHYDROGENASE 
COMPLEXED With N6-Isopentenyladenine
Length=516

 Score =   483 bits (1243),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 252/511 (49%), Positives = 333/511 (65%), Gaps = 26/511 (5%)
 Frame = -1

Query  1786  KPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRF  1607
             +PW +SL    L++D  G+ R DS AT AASTDFG I    PA VLYPSS  D++ L+  
Sbjct  14    RPWPASL--AALALD--GKLRTDSNATAAASTDFGNITSALPAAVLYPSSTADLVALLSA  69

Query  1606  SYNSPS-PFSVAARGHGHSVRGQATAKDGVVVEMGAL-RGGGKIRVSWSESLGYFADVGG  1433
             + ++P  P+++A RG GHS+ GQA A  GVVV M +L       R++ S   G + D GG
Sbjct  70    ANSTPGWPYTIAFRGRGHSLMGQAFAPGGVVVNMASLGDAAAPPRINVSAD-GRYVDAGG  128

Query  1432  HELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITG  1253
              ++W+DVL A LA GV+P SWT+YL+LTVGGTLSNAGISGQ FR GPQISNVLE+DVITG
Sbjct  129   EQVWIDVLRASLARGVAPRSWTEYLYLTVGGTLSNAGISGQAFRHGPQISNVLEMDVITG  188

Query  1252  KGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQ  1073
              GE +TCSK +N++LF AVLGGLGQFG+ITRARI +E AP R +WVR++Y DF+ F+ DQ
Sbjct  189   HGEMVTCSKQLNADLFDAVLGGLGQFGVITRARIAVEPAPARARWVRLVYTDFAAFSADQ  248

Query  1072  EHLI---------SINGLNYLEGSLMMNHTSPNNWRSS-FFSLSDQSKIASLLTQQG--L  929
             E L          S   ++Y+EGS+ +N +   +  ++ FF+ +D ++I +L  ++    
Sbjct  249   ERLTAPRPGGGGASFGPMSYVEGSVFVNQSLATDLANTGFFTDADVARIVALAGERNATT  308

Query  928   LYCLEVVKHYDD--QTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQ  755
             +Y +E   +YD+     + VDQEL  +L  LS+V G  F++D +Y  FL+RV GEE+   
Sbjct  309   VYSIEATLNYDNATAAAAAVDQELASVLGTLSYVEGFAFQRDVAYAAFLDRVHGEEVALN  368

Query  754   ENGLWEATHPWLNLFVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVI  575
             + GLW   HPWLN+FVP+SRI DF+  VF+ IL      GP++VYP    MWD+ MSA  
Sbjct  369   KLGLWRVPHPWLNMFVPRSRIADFDRGVFKGILQGTDIVGPLIVYPLNKSMWDDGMSAAT  428

Query  574   PEEDTFYCVGLLYSG-GMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMK  398
             P ED FY V LL+S    N    L E N+ IL FC   D  G + K YL  +  R DW++
Sbjct  429   PSEDVFYAVSLLFSSVAPNDLARLQEQNRRILRFC---DLAGIQYKTYLARHTDRSDWVR  485

Query  397   HFG-KKWNTFQENKAKFDPKMILSPGQTIFN  308
             HFG  KWN F E K K+DPK +LSPGQ IFN
Sbjct  486   HFGAAKWNRFVEMKNKYDPKRLLSPGQDIFN  516



>emb|CDY50467.1| BnaA10g28940D [Brassica napus]
Length=478

 Score =   480 bits (1236),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 238/435 (55%), Positives = 315/435 (72%), Gaps = 7/435 (2%)
 Frame = -1

Query  1774  SSLPYEILSVD-IAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRFSYN  1598
             SSLP+ ILS D  AG+    S +  +A+TDFG I +  P+ VL PSSV DI +L++ S++
Sbjct  33    SSLPWNILSNDNFAGKLTTASSSVESAATDFGHITKIFPSAVLNPSSVQDITDLIKLSFD  92

Query  1597  SPSPFSVAARGHGHSVRGQATAKDGVVVEMGALRGGGK-IRVSWSESLGYFADVGGHELW  1421
             S S F +AARGHGHS RGQA AKDGVVV M ++    + I+VS +   G +ADV    LW
Sbjct  93    SQSSFPLAARGHGHSHRGQAAAKDGVVVNMRSMVNRDRGIKVSRT---GLYADVDSAWLW  149

Query  1420  VDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITGKGEF  1241
             ++VL+  L  G++P SWTDYL+LTVGGTLSN GISGQ FR GPQISNVLE+DVITGKGE 
Sbjct  150   IEVLNKTLELGLTPVSWTDYLYLTVGGTLSNGGISGQTFRYGPQISNVLEMDVITGKGEI  209

Query  1240  ITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQEHLI  1061
              TCSKDMNS+LF+A LGGLGQFGIITRARI LE AP + KW+R LY DFS+FTRDQE LI
Sbjct  210   ATCSKDMNSDLFYAALGGLGQFGIITRARIKLELAPKKAKWLRFLYTDFSEFTRDQERLI  269

Query  1060  S-INGLNYLEGSLMMNHTSPNNWRSSFFSLSDQSKIASLLTQQGLLYCLEVVKHYDDQTG  884
             S  NG ++LEGS+M++H  P+NWRS+++  S+  +I S++ Q  ++YCLEVVK+YD+ + 
Sbjct  270   SETNGPHFLEGSVMLDHGPPDNWRSTYYPPSEHMRIVSMVKQHRVIYCLEVVKYYDETSQ  329

Query  883   STVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQENGLWEATHPWLNLFVP  704
              +V++E+++L   L++  G  ++KD +Y +FLNRVR  EL+ +  G W+  HPWLNLFVP
Sbjct  330   HSVNEEMEELSDSLNYERGFVYEKDVTYMDFLNRVRTGELKLKSKGKWDVPHPWLNLFVP  389

Query  703   KSRILDFNSAVFQNILLKHK-TSGPMLVYPTTTKMWDERMSAVIPEEDTFYCVGLLYSGG  527
             KS+I  F   VF+ I+L++  T+GP+LVYP     W++RMS VIPEED FY VG L S  
Sbjct  390   KSQISRFEYGVFKGIILRNNITTGPLLVYPMNRNKWNDRMSTVIPEEDVFYAVGFLRSAS  449

Query  526   MNGWKVLDELNQEIL  482
              + W   ++ N E+ 
Sbjct  450   FDNWDDYEKENMELF  464



>sp|Q9T0N8.2|CKX1_MAIZE RecName: Full=Cytokinin dehydrogenase 1; AltName: Full=Cytokinin 
oxidase 1; Short=CKO 1; Short=COX 1; AltName: Full=ZmCKX1; 
Flags: Precursor [Zea mays]
 gb|AAC27500.1| cytokinin oxidase [Zea mays]
Length=534

 Score =   482 bits (1240),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 252/511 (49%), Positives = 331/511 (65%), Gaps = 26/511 (5%)
 Frame = -1

Query  1786  KPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRF  1607
             +PW +SL    L++D  G+ R DS AT AASTDFG I    PA VLYPSS  D++ L+  
Sbjct  32    RPWPASL--AALALD--GKLRTDSNATAAASTDFGNITSALPAAVLYPSSTGDLVALLSA  87

Query  1606  SYNSPS-PFSVAARGHGHSVRGQATAKDGVVVEMGAL-RGGGKIRVSWSESLGYFADVGG  1433
             + ++P  P+++A RG GHS+ GQA A  GVVV M +L       R++ S   G + D GG
Sbjct  88    ANSTPGWPYTIAFRGRGHSLMGQAFAPGGVVVNMASLGDAAAPPRINVSAD-GRYVDAGG  146

Query  1432  HELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITG  1253
              ++W+DVL A LA GV+P SW DYL+LTVGGTLSNAGISGQ FR GPQISNVLE+DVITG
Sbjct  147   EQVWIDVLRASLARGVAPRSWNDYLYLTVGGTLSNAGISGQAFRHGPQISNVLEMDVITG  206

Query  1252  KGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQ  1073
              GE +TCSK +N++LF AVLGGLGQFG+ITRARI +E AP R +WVR +Y DF+ F+ DQ
Sbjct  207   HGEMVTCSKQLNADLFDAVLGGLGQFGVITRARIAVEPAPARARWVRFVYTDFAAFSADQ  266

Query  1072  EHLI---------SINGLNYLEGSLMMNHTSPNNWRSS-FFSLSDQSKIASLLTQQGL--  929
             E L          S   ++Y+EGS+ +N +   +  ++ FF+ +D ++I +L  ++    
Sbjct  267   ERLTAPRPGGGGASFGPMSYVEGSVFVNQSLATDLANTGFFTDADVARIVALAGERNATT  326

Query  928   LYCLEVVKHYDD--QTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQ  755
             +Y +E   +YD+     + VDQEL  +L  LS+V G  F++D +Y  FL+RV GEE+   
Sbjct  327   VYSIEATLNYDNATAAAAAVDQELASVLGTLSYVEGFAFQRDVAYAAFLDRVHGEEVALN  386

Query  754   ENGLWEATHPWLNLFVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVI  575
             + GLW   HPWLN+FVP+SRI DF+  VF+ IL      GP++VYP    MWD+ MSA  
Sbjct  387   KLGLWRVPHPWLNMFVPRSRIADFDRGVFKGILQGTDIVGPLIVYPLNKSMWDDGMSAAT  446

Query  574   PEEDTFYCVGLLYSG-GMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMK  398
             P ED FY V LL+S    N    L E N+ IL FC   D  G + K YL  +  R DW++
Sbjct  447   PSEDVFYAVSLLFSSVAPNDLARLQEQNRRILRFC---DLAGIQYKTYLARHTDRSDWVR  503

Query  397   HFG-KKWNTFQENKAKFDPKMILSPGQTIFN  308
             HFG  KWN F E K K+DPK +LSPGQ IFN
Sbjct  504   HFGAAKWNRFVEMKNKYDPKRLLSPGQDIFN  534



>pdb|3S1E|A Chain A, Pro427gln Mutant Of Maize Cytokinin OxidaseDEHYDROGENASE 
COMPLEXED With N6-Isopentenyladenine
Length=516

 Score =   481 bits (1238),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 252/511 (49%), Positives = 332/511 (65%), Gaps = 26/511 (5%)
 Frame = -1

Query  1786  KPWNSSLPYEILSVDIAGRFRVDSRATTAASTDFGGIVQETPAGVLYPSSVDDIINLVRF  1607
             +PW +SL    L++D  G+ R DS AT AASTDFG I    PA VLYPSS  D++ L+  
Sbjct  14    RPWPASL--AALALD--GKLRTDSNATAAASTDFGNITSALPAAVLYPSSTADLVALLSA  69

Query  1606  SYNSPS-PFSVAARGHGHSVRGQATAKDGVVVEMGAL-RGGGKIRVSWSESLGYFADVGG  1433
             + ++P  P+++A RG GHS+ GQA A  GVVV M +L       R++ S   G + D GG
Sbjct  70    ANSTPGWPYTIAFRGRGHSLMGQAFAPGGVVVNMASLGDAAAPPRINVSAD-GRYVDAGG  128

Query  1432  HELWVDVLHACLAHGVSPASWTDYLHLTVGGTLSNAGISGQMFRCGPQISNVLELDVITG  1253
              ++W+DVL A LA GV+P SWTDYL+LTVGGTLSNAGISGQ FR GPQISNVLE+DVITG
Sbjct  129   EQVWIDVLRASLARGVAPRSWTDYLYLTVGGTLSNAGISGQAFRHGPQISNVLEMDVITG  188

Query  1252  KGEFITCSKDMNSELFFAVLGGLGQFGIITRARIVLEKAPTRVKWVRMLYDDFSKFTRDQ  1073
              GE +TCSK +N++LF AVLGGLGQFG+ITRARI +E AP R +WVR++Y DF+ F+ DQ
Sbjct  189   HGEMVTCSKQLNADLFDAVLGGLGQFGVITRARIAVEPAPARARWVRLVYTDFAAFSADQ  248

Query  1072  EHLI---------SINGLNYLEGSLMMNHTSPNNWRSS-FFSLSDQSKIASLLTQQG--L  929
             E L          S   ++Y+EGS+ +N +   +  ++ FF+ +D ++I +L  ++    
Sbjct  249   ERLTAPRPGGGGASFGPMSYVEGSVFVNQSLATDLANTGFFTDADVARIVALAGERNATT  308

Query  928   LYCLEVVKHYDD--QTGSTVDQELKDLLKDLSFVPGMTFKKDASYFEFLNRVRGEELEPQ  755
             +Y +E   +YD+     + VDQEL  +L  LS+V G  F++D +Y  FL+RV GEE+   
Sbjct  309   VYSIEATLNYDNATAAAAAVDQELASVLGTLSYVEGFAFQRDVAYAAFLDRVHGEEVALN  368

Query  754   ENGLWEATHPWLNLFVPKSRILDFNSAVFQNILLKHKTSGPMLVYPTTTKMWDERMSAVI  575
             + GLW   HPWLN+FVP+SRI DF+  VF+ IL      G ++VYP    MWD+ MSA  
Sbjct  369   KLGLWRVPHPWLNMFVPRSRIADFDRGVFKGILQGTDIVGQLIVYPLNKSMWDDGMSAAT  428

Query  574   PEEDTFYCVGLLYSG-GMNGWKVLDELNQEILSFCNKDDEEGSKIKQYLPHYRSREDWMK  398
             P ED FY V LL+S    N    L E N+ IL FC   D  G + K YL  +  R DW++
Sbjct  429   PSEDVFYAVSLLFSSVAPNDLARLQEQNRRILRFC---DLAGIQYKTYLARHTDRSDWVR  485

Query  397   HFG-KKWNTFQENKAKFDPKMILSPGQTIFN  308
             HFG  KWN F E K K+DPK +LSPGQ IFN
Sbjct  486   HFGAAKWNRFVEMKNKYDPKRLLSPGQDIFN  516



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5623316968320