BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c17986_g1_i2 len=1658 path=[1:0-253 @255@!:254-836 3128:837-918
838:919-1657]

Length=1658
                                                                      Score     E

emb|CDO97931.1|  unnamed protein product                                288   5e-113   
ref|XP_009765962.1|  PREDICTED: inorganic pyrophosphatase 1-like        284   8e-110   
gb|AIE54289.1|  psi14B protein                                          286   3e-109   
ref|XP_009607352.1|  PREDICTED: inorganic pyrophosphatase 1-like        286   4e-109   
ref|XP_009790004.1|  PREDICTED: inorganic pyrophosphatase 1-like        280   8e-109   
ref|XP_006357372.1|  PREDICTED: inorganic pyrophosphatase 1-like        282   3e-108   
ref|XP_009800756.1|  PREDICTED: inorganic pyrophosphatase 1-like        280   3e-107   
ref|XP_006357373.1|  PREDICTED: inorganic pyrophosphatase 1-like        280   9e-107   
ref|XP_009631067.1|  PREDICTED: inorganic pyrophosphatase 1-like        276   1e-106   
gb|KDP40798.1|  hypothetical protein JCGZ_24797                         271   2e-106   
ref|XP_011072482.1|  PREDICTED: inorganic pyrophosphatase 2             277   3e-106   
ref|XP_006357374.1|  PREDICTED: inorganic pyrophosphatase 1-like        278   2e-105   
ref|NP_001234501.1|  psi14A protein                                     265   5e-105   
ref|XP_006343006.1|  PREDICTED: inorganic pyrophosphatase 1-like        275   6e-105   
ref|NP_001241414.1|  uncharacterized protein LOC100785878               265   6e-105   
emb|CAD30864.1|  putative phosphatase                                   265   1e-104   Solanum lycopersicum
gb|ACU19181.1|  unknown                                                 263   4e-104   Glycine max [soybeans]
ref|NP_001234003.1|  psi14B protein                                     263   5e-104   
ref|XP_009367536.1|  PREDICTED: inorganic pyrophosphatase 1-like        265   2e-103   
ref|NP_001266264.1|  inorganic pyrophosphatase 1-like                   262   2e-103   
ref|XP_004235613.1|  PREDICTED: inorganic pyrophosphatase 1-like        269   2e-103   
ref|XP_008391309.1|  PREDICTED: inorganic pyrophosphatase 1-like        263   9e-103   
gb|KHN11303.1|  Inorganic pyrophosphatase 2                             261   1e-102   
ref|XP_003531628.1|  PREDICTED: inorganic pyrophosphatase 2-like        260   2e-102   
ref|XP_002311810.1|  hypothetical protein POPTR_0008s20130g             256   2e-101   Populus trichocarpa [western balsam poplar]
ref|XP_003529939.1|  PREDICTED: inorganic pyrophosphatase 2-like        256   3e-101   
ref|XP_011012806.1|  PREDICTED: inorganic pyrophosphatase 2-like        248   1e-100   
ref|XP_006426489.1|  hypothetical protein CICLE_v10026096mg             259   2e-100   
ref|XP_004510353.1|  PREDICTED: inorganic pyrophosphatase 2-like        258   4e-100   
gb|KDO58635.1|  hypothetical protein CISIN_1g044553mg                   258   4e-100   
ref|XP_006343003.1|  PREDICTED: inorganic pyrophosphatase 1-like        257   5e-100   
ref|XP_007024447.1|  Pyridoxal phosphate phosphatase-related protein    250   1e-99    
ref|XP_007135578.1|  hypothetical protein PHAVU_010G141200g             249   2e-99    
ref|XP_011034250.1|  PREDICTED: inorganic pyrophosphatase 2-like        251   2e-99    
ref|XP_007135577.1|  hypothetical protein PHAVU_010G141100g             249   2e-99    
ref|XP_006466070.1|  PREDICTED: inorganic pyrophosphatase 1-like        255   3e-99    
ref|XP_009371231.1|  PREDICTED: inorganic pyrophosphatase 1-like        257   5e-99    
ref|XP_007215797.1|  hypothetical protein PRUPE_ppa009904mg             249   2e-98    
gb|KEH18309.1|  2,3-diketo-5-methylthio-1-phosphopentane phosphatase    245   3e-98    
ref|XP_003531627.1|  PREDICTED: inorganic pyrophosphatase 2             245   5e-98    
ref|XP_004297609.1|  PREDICTED: inorganic pyrophosphatase 1-like        252   5e-98    
ref|XP_007135575.1|  hypothetical protein PHAVU_010G140900g             246   5e-98    
ref|XP_008228322.1|  PREDICTED: inorganic pyrophosphatase 1-like        248   6e-98    
ref|XP_006343004.1|  PREDICTED: inorganic pyrophosphatase 1-like        249   8e-98    
ref|XP_007135574.1|  hypothetical protein PHAVU_010G140800g             251   9e-98    
ref|XP_008462365.1|  PREDICTED: inorganic pyrophosphatase 2-like        251   1e-97    
ref|XP_010062595.1|  PREDICTED: inorganic pyrophosphatase 2-like        257   1e-97    
ref|XP_006385338.1|  hypothetical protein POPTR_0003s02940g             246   2e-97    
ref|XP_006343002.1|  PREDICTED: inorganic pyrophosphatase 1-like        256   2e-97    
ref|XP_007135576.1|  hypothetical protein PHAVU_010G141000g             246   2e-97    
gb|ADG23055.1|  haloacid dehalogenase                                   250   2e-97    
ref|XP_006343005.1|  PREDICTED: inorganic pyrophosphatase 1-like        247   3e-97    
gb|KHN11302.1|  Inorganic pyrophosphatase 2                             242   4e-97    
gb|ABP52095.1|  putative phosphatase                                    242   7e-97    Phaseolus vulgaris [French bean]
ref|XP_002527425.1|  Phosphoethanolamine/phosphocholine phosphata...    243   8e-97    Ricinus communis
ref|XP_002527424.1|  Phosphoethanolamine/phosphocholine phosphata...    244   2e-96    Ricinus communis
ref|XP_003597629.1|  Pyridoxal phosphate phosphatase PHOSPHO2           249   4e-96    
ref|XP_004141676.1|  PREDICTED: inorganic pyrophosphatase 2-like        244   5e-96    
ref|XP_009378232.1|  PREDICTED: inorganic pyrophosphatase 1-like        257   7e-96    
ref|XP_004510357.1|  PREDICTED: inorganic pyrophosphatase 2-like        245   2e-95    
ref|XP_003638651.1|  Pyridoxal phosphate phosphatase PHOSPHO2           245   2e-95    
gb|KHG07807.1|  hypothetical protein F383_35186                         242   2e-95    
gb|EYU21393.1|  hypothetical protein MIMGU_mgv1a026205mg                242   3e-95    
ref|XP_010088372.1|  Inorganic pyrophosphatase 1                        246   4e-95    
gb|AFK36724.1|  unknown                                                 238   8e-95    
ref|XP_007216440.1|  hypothetical protein PRUPE_ppa021956mg             236   8e-95    
ref|XP_002280889.1|  PREDICTED: inorganic pyrophosphatase 2             234   9e-95    Vitis vinifera
ref|XP_010267012.1|  PREDICTED: inorganic pyrophosphatase 1-like        247   1e-94    
ref|XP_008795471.1|  PREDICTED: inorganic pyrophosphatase 2             256   1e-94    
ref|XP_003595831.1|  hypothetical protein MTR_2g062320                  251   2e-94    
gb|KHN32679.1|  Inorganic pyrophosphatase 2                             241   2e-94    
ref|XP_008228320.1|  PREDICTED: inorganic pyrophosphatase 2-like ...    237   2e-94    
gb|KHG08585.1|  hypothetical protein F383_11849                         233   5e-94    
gb|AFK41778.1|  unknown                                                 240   5e-94    
ref|XP_003546657.1|  PREDICTED: inorganic pyrophosphatase 2-like        241   1e-93    
ref|XP_006416674.1|  hypothetical protein EUTSA_v10008386mg             232   1e-93    
ref|XP_004510356.1|  PREDICTED: inorganic pyrophosphatase 1-like        236   2e-93    
emb|CDX96757.1|  BnaA08g23000D                                          234   2e-93    
gb|KEH18314.1|  2,3-diketo-5-methylthio-1-phosphopentane phosphatase    238   3e-93    
ref|XP_010924488.1|  PREDICTED: inorganic pyrophosphatase 2-like        254   3e-93    
ref|XP_008779500.1|  PREDICTED: LOW QUALITY PROTEIN: inorganic py...    252   4e-93    
ref|XP_010918519.1|  PREDICTED: inorganic pyrophosphatase 2-like        251   8e-93    
ref|XP_007024470.1|  Inorganic pyrophosphatase 2                        246   1e-92    
ref|XP_002892964.1|  phosphoric monoester hydrolase                     231   1e-92    
ref|XP_008462367.1|  PREDICTED: inorganic pyrophosphatase 2-like        239   1e-92    
gb|KEH18312.1|  2,3-diketo-5-methylthio-1-phosphopentane phosphatase    236   1e-92    
ref|XP_010459378.1|  PREDICTED: inorganic pyrophosphatase 2             228   2e-92    
ref|XP_009110395.1|  PREDICTED: inorganic pyrophosphatase 2-like        233   3e-92    
emb|CDX83896.1|  BnaC08g17490D                                          228   4e-92    
emb|CDX81846.1|  BnaC08g37550D                                          225   7e-92    
emb|CDY59499.1|  BnaC05g50000D                                          233   8e-92    
ref|XP_007150539.1|  hypothetical protein PHAVU_005G160900g             227   1e-91    
ref|XP_009117646.1|  PREDICTED: inorganic pyrophosphatase 2-like        224   3e-91    
ref|XP_009149226.1|  PREDICTED: inorganic pyrophosphatase 2             231   6e-91    
ref|XP_010519214.1|  PREDICTED: inorganic pyrophosphatase 1-like        226   6e-91    
ref|XP_006303573.1|  hypothetical protein CARUB_v10011086mg             225   7e-91    
ref|XP_002280867.1|  PREDICTED: inorganic pyrophosphatase 2             223   8e-91    Vitis vinifera
ref|XP_010262202.1|  PREDICTED: inorganic pyrophosphatase 1             238   1e-90    
gb|EYU18768.1|  hypothetical protein MIMGU_mgv1a011814mg                230   1e-90    
emb|CDY21734.1|  BnaA09g44850D                                          224   2e-90    
ref|NP_173213.2|  phosphoethanolamine/phosphocholine phosphatase        223   4e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010519215.1|  PREDICTED: inorganic pyrophosphatase 1-like        223   4e-90    
ref|XP_010690046.1|  PREDICTED: inorganic pyrophosphatase 2-like ...    228   5e-90    
ref|XP_010428203.1|  PREDICTED: inorganic pyrophosphatase 1             222   7e-90    
ref|XP_010690045.1|  PREDICTED: inorganic pyrophosphatase 2-like        233   8e-90    
gb|KFK41741.1|  hypothetical protein AALP_AA2G166400                    220   1e-89    
ref|XP_010476932.1|  PREDICTED: inorganic pyrophosphatase 2-like        223   1e-89    
ref|XP_006302457.1|  hypothetical protein CARUB_v10020549mg             221   1e-89    
ref|XP_010519212.1|  PREDICTED: inorganic pyrophosphatase 2-like        220   2e-89    
ref|XP_010519213.1|  PREDICTED: inorganic pyrophosphatase 2-like        220   3e-89    
gb|KHG13597.1|  hypothetical protein F383_05241                         228   4e-89    
gb|KFK43955.1|  hypothetical protein AALP_AA1G196200                    220   7e-89    
ref|XP_009127965.1|  PREDICTED: inorganic pyrophosphatase 1             218   2e-88    
ref|NP_565052.1|  inorganic pyrophosphatase 1                           216   2e-88    Arabidopsis thaliana [mouse-ear cress]
emb|CDX82118.1|  BnaC02g21720D                                          219   2e-88    
ref|XP_006390603.1|  hypothetical protein EUTSA_v10018928mg             216   2e-88    
ref|XP_002888902.1|  hypothetical protein ARALYDRAFT_476431             217   2e-88    
gb|AAM63155.1|  putative acid phosphatase                               216   4e-88    Arabidopsis thaliana [mouse-ear cress]
emb|CDY69464.1|  BnaAnng30500D                                          216   5e-88    
ref|XP_009409362.1|  PREDICTED: inorganic pyrophosphatase 2             240   4e-87    
ref|XP_002277629.1|  PREDICTED: inorganic pyrophosphatase 3             227   1e-86    Vitis vinifera
gb|KCW69738.1|  hypothetical protein EUGRSUZ_F03120                     238   2e-86    
gb|EPS62373.1|  hypothetical protein M569_12416                         222   3e-86    
ref|XP_010416075.1|  PREDICTED: inorganic pyrophosphatase 1-like        216   6e-86    
ref|XP_010915327.1|  PREDICTED: inorganic pyrophosphatase 1-like        230   9e-86    
emb|CDY59927.1|  BnaC06g43820D                                          207   2e-84    
dbj|BAJ95704.1|  predicted protein                                      224   2e-84    
dbj|BAJ88911.1|  predicted protein                                      224   3e-84    
ref|XP_009105956.1|  PREDICTED: inorganic pyrophosphatase 1-like        209   7e-84    
ref|XP_009416458.1|  PREDICTED: inorganic pyrophosphatase 3-like        223   9e-84    
ref|XP_010097079.1|  Inorganic pyrophosphatase 2                        215   2e-83    
ref|XP_006426490.1|  hypothetical protein CICLE_v10026265mg             212   2e-83    
ref|XP_010106679.1|  Inorganic pyrophosphatase 2                        218   2e-83    
ref|XP_010471347.1|  PREDICTED: inorganic pyrophosphatase 1-like        218   3e-83    
emb|CDJ26592.1|  unnamed protein product                                220   5e-83    
ref|XP_004291030.1|  PREDICTED: inorganic pyrophosphatase 2-like        211   2e-82    
gb|EMT33032.1|  Putative phosphatase phospho1                           221   2e-82    
ref|XP_010540076.1|  PREDICTED: inorganic pyrophosphatase 2-like        204   4e-82    
ref|XP_009415365.1|  PREDICTED: inorganic pyrophosphatase 2-like        220   3e-81    
ref|XP_006466068.1|  PREDICTED: inorganic pyrophosphatase 1-like ...    206   3e-81    
ref|XP_011009701.1|  PREDICTED: inorganic pyrophosphatase 3-like        212   5e-81    
ref|NP_001242832.1|  uncharacterized protein LOC100789743               210   4e-80    
ref|XP_009385786.1|  PREDICTED: inorganic pyrophosphatase 2-like ...    217   6e-80    
ref|XP_002458417.1|  hypothetical protein SORBIDRAFT_03g033100          198   9e-80    Sorghum bicolor [broomcorn]
ref|XP_003531626.1|  PREDICTED: inorganic pyrophosphatase 2-like        211   1e-79    
ref|XP_006644635.1|  PREDICTED: inorganic pyrophosphatase 1-like        206   2e-79    
ref|XP_010924487.1|  PREDICTED: inorganic pyrophosphatase 2-like        221   2e-79    
ref|XP_003569699.1|  PREDICTED: inorganic pyrophosphatase 1-like        201   3e-79    
gb|ACU18702.1|  unknown                                                 183   3e-79    Glycine max [soybeans]
ref|XP_006582843.1|  PREDICTED: uncharacterized protein LOC100306...    211   4e-79    
ref|XP_008360958.1|  PREDICTED: inorganic pyrophosphatase 2-like        198   4e-79    
ref|XP_006426491.1|  hypothetical protein CICLE_v10026265mg             196   7e-79    
ref|XP_002324759.2|  hypothetical protein POPTR_0018s05070g             214   7e-79    Populus trichocarpa [western balsam poplar]
gb|KHN11301.1|  Inorganic pyrophosphatase 2                             207   2e-78    
ref|XP_008220455.1|  PREDICTED: inorganic pyrophosphatase 2-like        197   3e-78    
gb|ACJ84435.1|  unknown                                                 207   3e-78    Medicago truncatula
ref|XP_003597628.1|  hypothetical protein MTR_2g100340                  203   4e-78    
ref|NP_001235501.1|  uncharacterized protein LOC100306469               208   4e-78    
gb|AFK38500.1|  unknown                                                 207   4e-78    
gb|KDP33737.1|  hypothetical protein JCGZ_07308                         206   4e-78    
ref|XP_007226633.1|  hypothetical protein PRUPE_ppa022611mg             198   4e-78    
gb|KHN39291.1|  Inorganic pyrophosphatase 1                             207   5e-78    
ref|XP_009361749.1|  PREDICTED: inorganic pyrophosphatase 2-like        200   6e-78    
gb|AFK48095.1|  unknown                                                 206   7e-78    
gb|AFK36374.1|  unknown                                                 206   7e-78    
ref|XP_002533762.1|  Phosphoethanolamine/phosphocholine phosphata...    215   7e-78    Ricinus communis
gb|ABI95993.1|  acid phosphatase                                        198   1e-77    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001044089.1|  Os01g0720400                                       198   1e-77    Oryza sativa Japonica Group [Japonica rice]
gb|EAY75640.1|  hypothetical protein OsI_03545                          198   1e-77    Oryza sativa Indica Group [Indian rice]
ref|XP_007012891.1|  Pyridoxal phosphate phosphatase-related protein    203   3e-77    
ref|XP_007012260.1|  Pyridoxal phosphate phosphatase-related protein    228   5e-77    
ref|XP_006466069.1|  PREDICTED: inorganic pyrophosphatase 1-like ...    191   2e-76    
ref|XP_009614749.1|  PREDICTED: inorganic pyrophosphatase 3-like        204   3e-76    
ref|XP_010049560.1|  PREDICTED: inorganic pyrophosphatase 3             204   5e-76    
ref|XP_009779867.1|  PREDICTED: inorganic pyrophosphatase 3-like ...    201   6e-76    
ref|XP_002514153.1|  Pyridoxal phosphate phosphatase PHOSPHO2, pu...    199   1e-75    Ricinus communis
ref|XP_003569309.1|  PREDICTED: inorganic pyrophosphatase 3-like ...    214   2e-75    
emb|CDP03190.1|  unnamed protein product                                205   2e-75    
ref|XP_010666530.1|  PREDICTED: inorganic pyrophosphatase 3             194   2e-75    
ref|XP_007024448.1|  Inorganic pyrophosphatase 2                        249   4e-75    
ref|XP_004486811.1|  PREDICTED: inorganic pyrophosphatase 1-like        197   6e-75    
ref|XP_004969781.1|  PREDICTED: inorganic pyrophosphatase 1-like        193   8e-75    
gb|KDO59254.1|  hypothetical protein CISIN_1g044617mg                   194   3e-74    
ref|XP_007135573.1|  hypothetical protein PHAVU_010G1407000g            198   5e-74    
ref|XP_002282651.1|  PREDICTED: inorganic pyrophosphatase 3             197   8e-74    Vitis vinifera
ref|XP_007160240.1|  hypothetical protein PHAVU_002G304600g             196   1e-73    
ref|XP_006451424.1|  hypothetical protein CICLE_v10009204mg             192   1e-73    
ref|XP_010231985.1|  PREDICTED: inorganic pyrophosphatase 3-like ...    213   1e-73    
ref|XP_007150538.1|  hypothetical protein PHAVU_005G160800g             195   1e-73    
gb|ACG25081.1|  phosphatase phospho1                                    185   7e-73    Zea mays [maize]
ref|XP_010690044.1|  PREDICTED: inorganic pyrophosphatase 2-like        188   1e-72    
emb|CAN67288.1|  hypothetical protein VITISV_021601                     180   2e-72    Vitis vinifera
ref|NP_001130133.1|  phosphatase phospho1                               183   2e-72    Zea mays [maize]
ref|XP_008242421.1|  PREDICTED: inorganic pyrophosphatase 3             191   2e-72    
gb|ACJ84372.1|  unknown                                                 167   4e-72    Medicago truncatula
ref|XP_011093693.1|  PREDICTED: inorganic pyrophosphatase 3             189   6e-72    
ref|NP_001151156.1|  LOC100284789                                       186   7e-72    Zea mays [maize]
gb|KHG05357.1|  hypothetical protein F383_31213                         197   9e-72    
ref|XP_009352621.1|  PREDICTED: inorganic pyrophosphatase 3             189   1e-71    
ref|XP_008337676.1|  PREDICTED: inorganic pyrophosphatase 3             187   2e-71    
ref|XP_004287531.1|  PREDICTED: inorganic pyrophosphatase 3-like        185   8e-71    
ref|XP_008228321.1|  PREDICTED: inorganic pyrophosphatase 2-like ...    238   1e-70    
ref|XP_010047325.1|  PREDICTED: inorganic pyrophosphatase 2-like ...    187   2e-70    
ref|XP_010047326.1|  PREDICTED: inorganic pyrophosphatase 2-like ...    187   2e-70    
ref|XP_003638610.1|  hypothetical protein MTR_138s0008                  236   3e-70    
ref|XP_006646071.1|  PREDICTED: inorganic pyrophosphatase 3-like        208   3e-70    
gb|KDP34111.1|  hypothetical protein JCGZ_07682                         198   3e-70    
ref|XP_010062596.1|  PREDICTED: inorganic pyrophosphatase 2-like        238   4e-70    
gb|EYU27314.1|  hypothetical protein MIMGU_mgv1a012849mg                182   7e-70    
ref|XP_007202473.1|  hypothetical protein PRUPE_ppa010251mg             186   8e-70    
gb|KHN16679.1|  Inorganic pyrophosphatase 3                             195   5e-69    
ref|XP_006854012.1|  hypothetical protein AMTR_s00036p00240530          176   5e-69    
ref|XP_004168220.1|  PREDICTED: inorganic pyrophosphatase 3-like        185   1e-68    
ref|XP_010438289.1|  PREDICTED: inorganic pyrophosphatase 3             180   1e-68    
ref|XP_004135700.1|  PREDICTED: inorganic pyrophosphatase 3-like        184   1e-68    
ref|NP_001235542.1|  uncharacterized protein LOC100306472               194   2e-68    
ref|XP_008450832.1|  PREDICTED: inorganic pyrophosphatase 3 isofo...    186   2e-68    
ref|XP_002458104.1|  hypothetical protein SORBIDRAFT_03g027020          204   2e-68    Sorghum bicolor [broomcorn]
ref|XP_008672854.1|  PREDICTED: LOC100281893 isoform X1                 194   5e-68    
ref|XP_004969082.1|  PREDICTED: inorganic pyrophosphatase 3-like        189   6e-68    
ref|XP_003630643.1|  Pyridoxal phosphate phosphatase PHOSPHO2           192   8e-68    
gb|AGT16668.1|  inorganic pyrophosphatase                               199   1e-67    
ref|XP_006412831.1|  hypothetical protein EUTSA_v10026105mg             177   2e-67    
ref|NP_001077556.1|  phosphoethanolamine/phosphocholine phosphatase     223   4e-67    Arabidopsis thaliana [mouse-ear cress]
gb|KFK29508.1|  hypothetical protein AALP_AA7G143500                    172   4e-66    
gb|ABK21572.1|  unknown                                                 177   4e-66    Picea sitchensis
ref|XP_009128612.1|  PREDICTED: inorganic pyrophosphatase 3 isofo...    172   7e-66    
gb|EAY74825.1|  hypothetical protein OsI_02715                          206   1e-65    Oryza sativa Indica Group [Indian rice]
ref|XP_010447843.1|  PREDICTED: inorganic pyrophosphatase 3-like        175   2e-65    
ref|XP_006854013.1|  hypothetical protein AMTR_s00036p00240870          168   3e-65    
gb|EAZ12585.1|  hypothetical protein OsJ_02491                          206   3e-65    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010433087.1|  PREDICTED: inorganic pyrophosphatase 3-like ...    171   1e-64    
gb|EMT25082.1|  Phosphoethanolamine/phosphocholine phosphatase          171   1e-64    
emb|CDY43512.1|  BnaA01g07320D                                          166   2e-64    
ref|XP_006282700.1|  hypothetical protein CARUB_v10005618mg             167   3e-64    
ref|XP_002869428.1|  2,3-diketo-5-methylthio-1-phosphopentane pho...    171   6e-64    
gb|EMS46703.1|  Inorganic pyrophosphatase 2                             171   1e-63    
ref|XP_007024471.1|  Pyridoxal phosphate phosphatase-related protein    177   2e-63    
ref|NP_194682.1|  pyridoxal phosphate phosphatase-related protein       171   3e-63    Arabidopsis thaliana [mouse-ear cress]
emb|CDY06800.1|  BnaC01g08990D                                          162   3e-63    
ref|XP_009385787.1|  PREDICTED: inorganic pyrophosphatase 2-like ...    218   4e-63    
ref|NP_001046344.1|  Os02g0226200                                       168   2e-62    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010541049.1|  PREDICTED: inorganic pyrophosphatase 3             155   6e-62    
ref|XP_003571132.1|  PREDICTED: inorganic pyrophosphatase 2-like        169   8e-62    
gb|EMS47058.1|  Inorganic pyrophosphatase 2                             162   2e-61    
gb|EAZ13360.1|  hypothetical protein OsJ_03281                          198   3e-61    Oryza sativa Japonica Group [Japonica rice]
gb|EMS63492.1|  Inorganic pyrophosphatase 3                             207   7e-59    
ref|XP_010519235.1|  PREDICTED: inorganic pyrophosphatase 2-like        138   2e-58    
gb|KCW82243.1|  hypothetical protein EUGRSUZ_C03661                     202   1e-57    
ref|XP_003638612.1|  Phosphoethanolamine/phosphocholine phosphatase     200   2e-57    
ref|XP_008656629.1|  PREDICTED: inorganic pyrophosphatase 3-like        157   3e-57    
ref|XP_010089256.1|  Inorganic pyrophosphatase 3                        205   4e-57    
ref|NP_001183910.1|  hypothetical protein                               149   4e-57    
ref|XP_010090022.1|  Inorganic pyrophosphatase 3                        205   1e-56    
ref|XP_004951415.1|  PREDICTED: inorganic pyrophosphatase 1-like        147   6e-56    
gb|AAD55648.1|AC008017_21  Hypothetical protein                         197   8e-56    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002451806.1|  hypothetical protein SORBIDRAFT_04g008010          154   3e-55    Sorghum bicolor [broomcorn]
ref|XP_003638650.1|  Multidrug resistance protein ABC transporter...    211   1e-54    
ref|XP_004503535.1|  PREDICTED: inorganic pyrophosphatase 3-like ...    192   4e-54    
ref|XP_008810403.1|  PREDICTED: inorganic pyrophosphatase 2-like        120   8e-54    
ref|XP_004503534.1|  PREDICTED: inorganic pyrophosphatase 3-like ...    191   7e-53    
ref|XP_008799622.1|  PREDICTED: inorganic pyrophosphatase 2-like        117   8e-52    
gb|KDO58634.1|  hypothetical protein CISIN_1g044369mg                   125   1e-51    
ref|XP_010480520.1|  PREDICTED: inorganic pyrophosphatase 2-like        136   1e-51    
ref|XP_008450833.1|  PREDICTED: inorganic pyrophosphatase 3 isofo...    184   4e-51    
ref|XP_001755323.1|  predicted protein                                  145   2e-49    
ref|XP_002976964.1|  hypothetical protein SELMODRAFT_105861             144   2e-48    
ref|XP_002980704.1|  hypothetical protein SELMODRAFT_113032             143   3e-48    
ref|XP_009128618.1|  PREDICTED: inorganic pyrophosphatase 3 isofo...    173   9e-47    
ref|XP_010433088.1|  PREDICTED: inorganic pyrophosphatase 3-like ...    171   1e-45    
gb|ABA27034.1|  TO66-1                                                  165   5e-45    Taraxacum officinale [dandelion]
ref|XP_006282699.1|  hypothetical protein CARUB_v10005618mg             167   1e-44    
gb|EEE56590.1|  hypothetical protein OsJ_05950                          101   2e-42    Oryza sativa Japonica Group [Japonica rice]
tpg|DAA58849.1|  TPA: phosphoethanolamine/phosphocholine phosphatase    106   5e-42    
ref|XP_009779869.1|  PREDICTED: inorganic pyrophosphatase 3-like ...    113   7e-35    
ref|NP_001148285.1|  LOC100281893                                     93.6    9e-35    Zea mays [maize]
ref|XP_008780745.1|  PREDICTED: inorganic pyrophosphatase 1-like        135   6e-34    
ref|XP_010450970.1|  PREDICTED: probable receptor protein kinase ...    130   3e-33    
gb|KHN30036.1|  Inorganic pyrophosphatase 1                             135   1e-32    
gb|EYU18770.1|  hypothetical protein MIMGU_mgv1a0200771mg               129   5e-32    
emb|CAG00846.1|  unnamed protein product                                125   2e-31    
ref|XP_008290442.1|  PREDICTED: probable phosphatase phospho1           130   9e-31    
ref|XP_009035312.1|  hypothetical protein AURANDRAFT_22824              115   2e-30    
gb|AFW71267.1|  hypothetical protein ZEAMMB73_742307                    102   3e-30    
gb|KFH71806.1|  hypothetical protein MVEG_02100                         110   4e-30    
ref|XP_008780616.1|  PREDICTED: inorganic pyrophosphatase 2-like        124   3e-29    
ref|XP_003961248.1|  PREDICTED: probable phosphatase phospho1-like      121   5e-29    
ref|XP_005471339.1|  PREDICTED: probable phosphatase phospho1-like      125   7e-29    
ref|XP_010773720.1|  PREDICTED: probable phosphatase phospho1 iso...    114   8e-29    
ref|XP_010773721.1|  PREDICTED: probable phosphatase phospho1 iso...    114   9e-29    
ref|XP_005759479.1|  hypothetical protein EMIHUDRAFT_350751             111   1e-28    
emb|CBN78298.1|  putative phosphatase                                   122   1e-28    
ref|XP_008312016.1|  PREDICTED: probable phosphatase phospho1           124   1e-28    
ref|XP_010744186.1|  PREDICTED: probable phosphatase phospho1           120   2e-28    
emb|CBN81463.1|  Probable phosphatase phospho1                          119   2e-28    
ref|XP_003627930.1|  Pyridoxal phosphate phosphatase PHOSPHO2           119   2e-28    
ref|XP_005532526.1|  PREDICTED: phosphoethanolamine/phosphocholin...    115   7e-28    
ref|NP_001003461.1|  probable phosphatase phospho1                      122   1e-27    
gb|ACN27369.1|  unknown                                                 108   1e-27    
gb|EMS45919.1|  Inorganic pyrophosphatase 1                             117   2e-27    
ref|XP_004080287.1|  PREDICTED: probable phosphatase phospho1-like      120   2e-27    
ref|XP_006638204.1|  PREDICTED: probable phosphatase phospho1-like      112   2e-27    
gb|KHN32680.1|  Inorganic pyrophosphatase 2                             119   3e-27    
ref|XP_007256369.1|  PREDICTED: probable phosphatase phospho1-lik...    120   4e-27    
tpg|DAA58847.1|  TPA: hypothetical protein ZEAMMB73_786521              105   7e-27    
ref|XP_009520878.1|  hypothetical protein PHYSODRAFT_487342             109   1e-26    
ref|XP_006791271.1|  PREDICTED: probable phosphatase phospho1-like      118   2e-26    
emb|CDQ66073.1|  unnamed protein product                                111   2e-26    
ref|XP_005928253.1|  PREDICTED: probable phosphatase phospho1-like      118   2e-26    
gb|EYU18769.1|  hypothetical protein MIMGU_mgv1a0200772mg               115   2e-26    
ref|XP_005753200.1|  PREDICTED: probable phosphatase phospho1-lik...    117   5e-26    
ref|XP_005753199.1|  PREDICTED: probable phosphatase phospho1-lik...    117   5e-26    
ref|XP_010738424.1|  PREDICTED: phosphoethanolamine/phosphocholin...    117   5e-26    
ref|XP_007558106.1|  PREDICTED: phosphoethanolamine/phosphocholin...    117   5e-26    
ref|XP_004567534.1|  PREDICTED: probable phosphatase phospho1-like      117   5e-26    
ref|XP_008415217.1|  PREDICTED: phosphoethanolamine/phosphocholin...    116   7e-26    
gb|AFW83765.1|  hypothetical protein ZEAMMB73_179974                    112   7e-26    
ref|XP_005796731.1|  PREDICTED: probable phosphatase phospho1-like      116   7e-26    
ref|XP_002899142.1|  pyridoxal phosphate phosphatase, putative          108   8e-26    
ref|XP_010738416.1|  PREDICTED: phosphoethanolamine/phosphocholin...    117   9e-26    
ref|XP_007241822.1|  PREDICTED: probable phosphatase phospho1-like      115   1e-25    
ref|XP_007899690.1|  PREDICTED: phosphoethanolamine/phosphocholin...    115   1e-25    
ref|XP_007558105.1|  PREDICTED: phosphoethanolamine/phosphocholin...    116   1e-25    
ref|XP_008415216.1|  PREDICTED: phosphoethanolamine/phosphocholin...    115   2e-25    
ref|XP_002904854.1|  pyridoxal phosphate phosphatase, putative          112   3e-25    
ref|XP_005648341.1|  hypothetical protein COCSUDRAFT_41939              115   3e-25    
ref|XP_008898095.1|  hypothetical protein PPTG_06085                    112   4e-25    
gb|ETP02238.1|  hypothetical protein F441_20671                         112   5e-25    
gb|ETO61116.1|  hypothetical protein F444_20828                         112   5e-25    
tpg|DAA58845.1|  TPA: hypothetical protein ZEAMMB73_786521              105   5e-25    
gb|ETM32665.1|  hypothetical protein L914_19986                         112   5e-25    
gb|ETI32383.1|  hypothetical protein F443_20809                         112   5e-25    
gb|ETP30358.1|  hypothetical protein F442_20606                         112   5e-25    
gb|ETL26205.1|  hypothetical protein L916_20090                         112   5e-25    
ref|XP_005350682.1|  PREDICTED: phosphoethanolamine/phosphocholin...    100   5e-25    
gb|ETL79419.1|  hypothetical protein L917_19959                         112   5e-25    
ref|XP_005350683.1|  PREDICTED: phosphoethanolamine/phosphocholin...    100   7e-25    
ref|XP_010795421.1|  PREDICTED: probable phosphatase phospho1           111   7e-25    
ref|XP_006971985.1|  PREDICTED: phosphoethanolamine/phosphocholin...  99.8    8e-25    
gb|ETK72751.1|  hypothetical protein L915_20222                         112   8e-25    
gb|AAI69002.1|  Phosphatase, orphan 1                                   100   9e-25    
ref|XP_004455454.1|  PREDICTED: phosphoethanolamine/phosphocholin...    101   9e-25    
ref|XP_004455456.1|  PREDICTED: phosphoethanolamine/phosphocholin...    102   9e-25    
ref|XP_004455458.1|  PREDICTED: phosphoethanolamine/phosphocholin...    101   1e-24    
ref|XP_004455443.1|  PREDICTED: phosphoethanolamine/phosphocholin...    101   1e-24    
ref|XP_006971986.1|  PREDICTED: phosphoethanolamine/phosphocholin...    100   1e-24    
ref|XP_004455455.1|  PREDICTED: phosphoethanolamine/phosphocholin...    101   1e-24    
ref|XP_008328216.1|  PREDICTED: phosphoethanolamine/phosphocholin...    113   1e-24    
ref|XP_004455449.1|  PREDICTED: phosphoethanolamine/phosphocholin...    101   1e-24    
ref|XP_004455461.1|  PREDICTED: phosphoethanolamine/phosphocholin...    101   1e-24    
ref|NP_001043492.2|  Os01g0600500                                       109   1e-24    
ref|XP_008576600.1|  PREDICTED: phosphoethanolamine/phosphocholin...    100   2e-24    
ref|XP_004455448.1|  PREDICTED: phosphoethanolamine/phosphocholin...    100   2e-24    
ref|XP_004591139.1|  PREDICTED: phosphoethanolamine/phosphocholin...  98.6    2e-24    
ref|NP_001099303.1|  phosphoethanolamine/phosphocholine phosphatase   99.0    2e-24    
ref|XP_008576601.1|  PREDICTED: phosphoethanolamine/phosphocholin...    100   2e-24    
gb|EDL15994.1|  phosphatase, orphan 1, isoform CRA_b                  99.0    2e-24    
ref|XP_004591138.1|  PREDICTED: phosphoethanolamine/phosphocholin...  98.2    2e-24    
ref|XP_010902774.1|  PREDICTED: probable phosphatase phospho1           112   2e-24    
ref|XP_004918666.1|  PREDICTED: phosphoethanolamine/phosphocholin...    102   2e-24    
ref|NP_694744.1|  phosphoethanolamine/phosphocholine phosphatase      99.4    3e-24    
ref|XP_004655601.1|  PREDICTED: phosphoethanolamine/phosphocholin...  99.0    3e-24    
ref|XP_006166217.1|  PREDICTED: phosphoethanolamine/phosphocholin...  97.8    3e-24    
ref|XP_006247246.1|  PREDICTED: phosphoethanolamine/phosphocholin...  99.4    3e-24    
ref|XP_008328215.1|  PREDICTED: phosphoethanolamine/phosphocholin...    112   3e-24    
gb|EDL15993.1|  phosphatase, orphan 1, isoform CRA_a                  99.4    3e-24    
ref|XP_008061841.1|  PREDICTED: phosphoethanolamine/phosphocholin...  97.8    3e-24    
ref|XP_006214238.1|  PREDICTED: phosphoethanolamine/phosphocholin...    100   3e-24    
ref|XP_008328214.1|  PREDICTED: phosphoethanolamine/phosphocholin...    113   3e-24    
ref|XP_003931295.1|  PREDICTED: phosphoethanolamine/phosphocholin...  99.0    4e-24    
ref|XP_006166221.1|  PREDICTED: phosphoethanolamine/phosphocholin...  97.8    4e-24    
ref|XP_004655600.1|  PREDICTED: phosphoethanolamine/phosphocholin...  98.6    4e-24    
ref|XP_003964948.1|  PREDICTED: probable phosphatase phospho1-like      112   4e-24    
ref|XP_010873064.1|  PREDICTED: phosphoethanolamine/phosphocholin...    111   4e-24    
ref|XP_007888165.1|  PREDICTED: pyridoxal phosphate phosphatase P...  92.8    5e-24    
ref|XP_003931294.1|  PREDICTED: phosphoethanolamine/phosphocholin...  99.0    5e-24    
ref|XP_008061842.1|  PREDICTED: phosphoethanolamine/phosphocholin...  97.8    5e-24    
ref|XP_005668918.1|  PREDICTED: phosphoethanolamine/phosphocholin...  97.1    6e-24    
ref|XP_006098997.1|  PREDICTED: phosphoethanolamine/phosphocholin...  98.2    6e-24    
ref|XP_004552403.1|  PREDICTED: probable phosphatase phospho1-lik...    111   7e-24    
ref|XP_006166219.1|  PREDICTED: phosphoethanolamine/phosphocholin...  96.7    7e-24    
ref|XP_010873062.1|  PREDICTED: phosphoethanolamine/phosphocholin...    111   7e-24    
ref|XP_008269548.1|  PREDICTED: phosphoethanolamine/phosphocholin...  98.2    7e-24    
ref|XP_006166218.1|  PREDICTED: phosphoethanolamine/phosphocholin...  96.7    7e-24    
ref|XP_001172566.1|  PREDICTED: phosphoethanolamine/phosphocholin...  98.6    7e-24    
ref|XP_003358137.1|  PREDICTED: phosphoethanolamine/phosphocholin...  97.1    7e-24    
ref|XP_003414702.1|  PREDICTED: phosphoethanolamine/phosphocholin...  98.6    7e-24    
ref|XP_511946.3|  PREDICTED: phosphoethanolamine/phosphocholine p...  97.8    8e-24    
ref|XP_004041469.1|  PREDICTED: phosphoethanolamine/phosphocholin...  97.8    8e-24    
ref|XP_003358139.1|  PREDICTED: phosphoethanolamine/phosphocholin...  97.4    8e-24    
ref|XP_010986251.1|  PREDICTED: phosphoethanolamine/phosphocholin...  99.4    8e-24    
ref|XP_002600728.1|  hypothetical protein BRAFLDRAFT_83471              100   8e-24    
ref|XP_008960654.1|  PREDICTED: phosphoethanolamine/phosphocholin...  97.4    8e-24    
ref|XP_006166220.1|  PREDICTED: phosphoethanolamine/phosphocholin...  96.3    9e-24    
ref|XP_004041472.1|  PREDICTED: phosphoethanolamine/phosphocholin...  97.4    9e-24    
ref|XP_004707131.1|  PREDICTED: phosphoethanolamine/phosphocholin...  97.8    9e-24    
ref|XP_005583667.1|  PREDICTED: phosphoethanolamine/phosphocholin...  98.6    9e-24    
ref|XP_008269552.1|  PREDICTED: phosphoethanolamine/phosphocholin...  98.2    1e-23    
ref|XP_004071604.1|  PREDICTED: probable phosphatase phospho1-like      112   1e-23    
ref|NP_848595.1|  phosphoethanolamine/phosphocholine phosphatase ...  97.8    1e-23    
ref|XP_006166222.1|  PREDICTED: phosphoethanolamine/phosphocholin...  96.7    1e-23    
ref|XP_002719351.1|  PREDICTED: phosphoethanolamine/phosphocholin...  98.2    1e-23    
ref|XP_008295443.1|  PREDICTED: phosphoethanolamine/phosphocholin...    110   1e-23    
ref|NP_001137276.1|  phosphoethanolamine/phosphocholine phosphata...  97.4    1e-23    
ref|XP_004552402.1|  PREDICTED: probable phosphatase phospho1-lik...    110   1e-23    
ref|XP_005075925.1|  PREDICTED: phosphoethanolamine/phosphocholin...  97.4    1e-23    
ref|XP_006721794.1|  PREDICTED: phosphoethanolamine/phosphocholin...  97.1    1e-23    
ref|XP_008609221.1|  hypothetical protein SDRG_05286                    103   1e-23    
ref|XP_009098936.1|  PREDICTED: phosphoethanolamine/phosphocholin...    110   1e-23    
ref|XP_007525695.1|  PREDICTED: phosphoethanolamine/phosphocholin...  97.8    1e-23    
ref|XP_006098998.1|  PREDICTED: phosphoethanolamine/phosphocholin...  97.4    1e-23    
ref|XP_002834315.1|  PREDICTED: phosphoethanolamine/phosphocholin...  98.2    1e-23    
ref|XP_008011246.1|  PREDICTED: phosphoethanolamine/phosphocholin...  98.2    1e-23    
ref|XP_006099000.1|  PREDICTED: phosphoethanolamine/phosphocholin...  97.4    2e-23    
ref|XP_002834316.1|  PREDICTED: phosphoethanolamine/phosphocholin...  97.8    2e-23    
ref|XP_009547323.1|  hypothetical protein HETIRDRAFT_418592           82.0    2e-23    
gb|KDQ57794.1|  hypothetical protein JAAARDRAFT_178264                80.9    2e-23    
ref|XP_006741512.1|  PREDICTED: phosphoethanolamine/phosphocholin...  98.6    2e-23    
ref|XP_006798353.1|  PREDICTED: probable phosphatase phospho1-lik...    110   2e-23    
ref|XP_006832553.1|  PREDICTED: phosphoethanolamine/phosphocholin...  98.6    2e-23    
ref|XP_008836525.1|  PREDICTED: phosphoethanolamine/phosphocholin...  97.4    2e-23    
ref|XP_008011240.1|  PREDICTED: phosphoethanolamine/phosphocholin...  97.4    2e-23    
ref|XP_008011243.1|  PREDICTED: phosphoethanolamine/phosphocholin...  97.8    2e-23    
ref|XP_008995650.1|  PREDICTED: phosphoethanolamine/phosphocholin...  97.1    2e-23    
emb|CDQ65126.1|  unnamed protein product                                110   2e-23    
ref|XP_008836528.1|  PREDICTED: phosphoethanolamine/phosphocholin...  97.4    2e-23    
ref|XP_008995654.1|  PREDICTED: phosphoethanolamine/phosphocholin...  97.4    2e-23    
ref|XP_006062020.1|  PREDICTED: phosphoethanolamine/phosphocholin...    100   2e-23    
emb|CDQ78961.1|  unnamed protein product                                110   2e-23    
ref|XP_008295437.1|  PREDICTED: phosphoethanolamine/phosphocholin...    110   2e-23    
gb|EPT04996.1|  hypothetical protein FOMPIDRAFT_1045665               82.8    2e-23    
ref|XP_008995653.1|  PREDICTED: phosphoethanolamine/phosphocholin...  97.4    2e-23    
ref|XP_004395183.1|  PREDICTED: phosphoethanolamine/phosphocholin...  97.8    2e-23    
ref|XP_008636694.1|  PREDICTED: phosphoethanolamine/phosphocholin...    109   2e-23    
ref|XP_002748502.1|  PREDICTED: phosphoethanolamine/phosphocholin...  97.4    2e-23    
ref|XP_005468941.1|  PREDICTED: probable phosphatase phospho1-like      109   2e-23    
ref|XP_008921885.1|  PREDICTED: phosphoethanolamine/phosphocholin...    108   2e-23    
ref|XP_005220624.1|  PREDICTED: phosphoethanolamine/phosphocholin...  97.8    2e-23    
ref|NP_001133770.1|  Probable phosphatase phospho1                      110   2e-23    
ref|XP_004395184.1|  PREDICTED: phosphoethanolamine/phosphocholin...  97.8    3e-23    
ref|NP_001180048.1|  phosphoethanolamine/phosphocholine phosphatase   98.2    3e-23    
ref|XP_004395186.1|  PREDICTED: phosphoethanolamine/phosphocholin...  97.8    3e-23    
gb|ELK01639.1|  Phosphoethanolamine/phosphocholine phosphatase        97.8    3e-23    
ref|XP_006062019.1|  PREDICTED: phosphoethanolamine/phosphocholin...    100   3e-23    
ref|XP_004859701.1|  PREDICTED: phosphoethanolamine/phosphocholin...    100   3e-23    
ref|XP_004859705.1|  PREDICTED: phosphoethanolamine/phosphocholin...  99.8    3e-23    
ref|XP_006798351.1|  PREDICTED: probable phosphatase phospho1-lik...    109   3e-23    
ref|XP_004859702.1|  PREDICTED: phosphoethanolamine/phosphocholin...  99.8    3e-23    
ref|XP_004859700.1|  PREDICTED: phosphoethanolamine/phosphocholin...  99.8    3e-23    
ref|XP_006062015.1|  PREDICTED: phosphoethanolamine/phosphocholin...    100   3e-23    
ref|XP_009833167.1|  hypothetical protein H257_08810                  97.8    3e-23    
ref|XP_005964731.1|  PREDICTED: phosphoethanolamine/phosphocholin...  99.0    3e-23    
ref|XP_005964730.1|  PREDICTED: phosphoethanolamine/phosphocholin...  98.6    3e-23    
ref|XP_006924837.1|  PREDICTED: phosphoethanolamine/phosphocholin...  97.4    3e-23    
ref|XP_003786527.1|  PREDICTED: phosphoethanolamine/phosphocholin...  95.1    4e-23    
ref|XP_005059878.1|  PREDICTED: phosphoethanolamine/phosphocholin...    109   4e-23    
ref|XP_006940282.1|  PREDICTED: phosphoethanolamine/phosphocholin...  97.4    4e-23    
ref|XP_003786525.1|  PREDICTED: phosphoethanolamine/phosphocholin...  95.5    4e-23    
ref|XP_010358207.1|  PREDICTED: phosphoethanolamine/phosphocholin...  96.7    4e-23    
ref|XP_010814444.1|  PREDICTED: phosphoethanolamine/phosphocholin...  97.8    4e-23    
ref|XP_001092436.1|  PREDICTED: phosphoethanolamine/phosphocholin...  96.7    4e-23    
ref|XP_003786526.1|  PREDICTED: phosphoethanolamine/phosphocholin...  95.1    4e-23    
ref|XP_006460799.1|  hypothetical protein AGABI2DRAFT_192397          82.4    4e-23    
ref|XP_010358192.1|  PREDICTED: phosphoethanolamine/phosphocholin...  96.3    4e-23    
ref|XP_008151957.1|  PREDICTED: phosphoethanolamine/phosphocholin...  97.8    4e-23    
ref|XP_006940287.1|  PREDICTED: phosphoethanolamine/phosphocholin...  97.4    4e-23    
ref|XP_006940289.1|  PREDICTED: phosphoethanolamine/phosphocholin...  97.8    4e-23    
gb|EMD37331.1|  hypothetical protein CERSUDRAFT_50896                 80.1    4e-23    
ref|XP_005583660.1|  PREDICTED: phosphoethanolamine/phosphocholin...  95.9    4e-23    
ref|XP_003912754.1|  PREDICTED: phosphoethanolamine/phosphocholin...  96.3    4e-23    
ref|XP_004764836.1|  PREDICTED: phosphoethanolamine/phosphocholin...  95.1    4e-23    
ref|XP_001092552.1|  PREDICTED: phosphoethanolamine/phosphocholin...  96.3    4e-23    
ref|XP_002589017.1|  hypothetical protein BRAFLDRAFT_87490            97.4    5e-23    
ref|XP_004764838.1|  PREDICTED: phosphoethanolamine/phosphocholin...  95.1    5e-23    
ref|XP_004764839.1|  PREDICTED: phosphoethanolamine/phosphocholin...  95.5    5e-23    
gb|EHH24780.1|  hypothetical protein EGK_08497                        95.1    5e-23    
ref|XP_007940134.1|  PREDICTED: phosphoethanolamine/phosphocholin...  93.6    5e-23    
ref|XP_007328313.1|  hypothetical protein AGABI1DRAFT_112429          82.4    5e-23    
ref|XP_007397112.1|  hypothetical protein PHACADRAFT_258253           80.5    6e-23    
ref|XP_006889383.1|  PREDICTED: phosphoethanolamine/phosphocholin...  97.1    6e-23    
ref|XP_005321753.1|  PREDICTED: phosphoethanolamine/phosphocholin...  95.9    7e-23    
ref|XP_004633912.1|  PREDICTED: phosphoethanolamine/phosphocholin...  98.2    7e-23    
ref|XP_010088370.1|  Inorganic pyrophosphatase 2                        105   8e-23    
ref|XP_005321755.1|  PREDICTED: phosphoethanolamine/phosphocholin...  95.9    8e-23    
ref|XP_004378021.1|  PREDICTED: phosphoethanolamine/phosphocholin...  95.9    8e-23    
ref|XP_006636589.1|  PREDICTED: probable phosphatase phospho2-like      107   8e-23    
ref|XP_005624681.1|  PREDICTED: phosphoethanolamine/phosphocholin...  97.8    9e-23    
ref|XP_007428975.1|  PREDICTED: phosphoethanolamine/phosphocholin...    108   9e-23    
ref|XP_004347362.1|  hypothetical protein CAOG_04615                  87.4    1e-22    
gb|EPQ12202.1|  Phosphoethanolamine/phosphocholine phosphatase        95.1    1e-22    
ref|XP_004333915.1|  2,3diketo-5-methylthio-1-phosphopentane phos...  85.1    1e-22    
ref|XP_005873461.1|  PREDICTED: phosphoethanolamine/phosphocholin...  95.1    1e-22    
ref|XP_004764830.1|  PREDICTED: phosphoethanolamine/phosphocholin...  94.4    1e-22    
ref|XP_004698840.1|  PREDICTED: phosphoethanolamine/phosphocholin...  96.3    1e-22    
ref|XP_006003318.1|  PREDICTED: phosphoethanolamine/phosphocholin...    107   1e-22    
ref|XP_004684370.1|  PREDICTED: phosphoethanolamine/phosphocholin...  95.5    1e-22    
ref|XP_007176470.1|  PREDICTED: phosphoethanolamine/phosphocholin...  95.5    1e-22    
ref|XP_548189.2|  PREDICTED: phosphoethanolamine/phosphocholine p...  97.8    1e-22    
ref|XP_007176467.1|  PREDICTED: phosphoethanolamine/phosphocholin...  95.5    1e-22    
ref|XP_004531138.1|  PREDICTED: probable phosphatase phospho2-like    97.1    1e-22    



>emb|CDO97931.1| unnamed protein product [Coffea canephora]
Length=275

 Score =   288 bits (737),  Expect(2) = 5e-113, Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 155/186 (83%), Gaps = 3/186 (2%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRIVSDANLFFIETIL HLGIR CFSEINTNPGYVDE GRLRILP+HDFHS+ HGC R
Sbjct  89   CDLRIVSDANLFFIETILNHLGIRGCFSEINTNPGYVDENGRLRILPYHDFHSASHGCDR  148

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  ++ERIQAS+ KEGKKR IYLGDGIGDFCPSLKLK GD+MMPRK+FPVW+LI
Sbjct  149  CPPNMCKGMVMERIQASIAKEGKKRFIYLGDGIGDFCPSLKLKEGDYMMPRKNFPVWDLI  208

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIED---SQFLAAESKFQAISMQPCEALP  308
             +NR LL+AEIHEW++GED ER+L  LIN I   +   SQ L+ + KFQ I M   +ALP
Sbjct  209  CKNRMLLKAEIHEWNDGEDLERLLLQLINSIFAAEESLSQLLSTDCKFQTIPMSVHQALP  268

Query  307  KAIRVP  290
            +A+ VP
Sbjct  269  QALSVP  274


 Score =   149 bits (376),  Expect(2) = 5e-113, Method: Compositional matrix adjust.
 Identities = 72/88 (82%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = -1

Query  1184  MAAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKT  1005
             MAAG VVVFDFDKTIID+DSDNWV+DELGFT LF+QLL TMPWNSLMD MM E+HANGKT
Sbjct  1     MAAGIVVVFDFDKTIIDLDSDNWVLDELGFTDLFNQLLPTMPWNSLMDNMMGELHANGKT  60

Query  1004  IGDIERVLQGVPIHPRIVPAIKAVHGLG  921
             I DIE VL+ VPIHPRIVPAIK+ H LG
Sbjct  61    IQDIEEVLKRVPIHPRIVPAIKSAHALG  88



>ref|XP_009765962.1| PREDICTED: inorganic pyrophosphatase 1-like [Nicotiana sylvestris]
Length=271

 Score =   284 bits (727),  Expect(2) = 8e-110, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 154/184 (84%), Gaps = 0/184 (0%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLR+VSDAN+FFIETILKHL IR+CFSEINTNPGYVDEEGRL+ILP+ DF +SPHGC+ 
Sbjct  88   CDLRVVSDANVFFIETILKHLEIRDCFSEINTNPGYVDEEGRLQILPYVDFQTSPHGCSL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  I+ERIQASM KEGKKR+IYLGDGIGDFCPSLKL+ GDF+MPRKDFP W LI
Sbjct  148  CPPNMCKGLIVERIQASMAKEGKKRIIYLGDGIGDFCPSLKLREGDFVMPRKDFPAWNLI  207

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFLAAESKFQAISMQPCEALPKAI  299
            KEN++L++A++HEW++GE+ E IL  LIN I IE+SQ L+ E KF  +S       P+ +
Sbjct  208  KENKTLVKADVHEWTDGEELEHILLQLINAITIEESQLLSVECKFHTMSKASHGPFPRPL  267

Query  298  RVPF  287
             VP+
Sbjct  268  PVPY  271


 Score =   142 bits (359),  Expect(2) = 8e-110, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VV+FDFDKTIID+DSDNWVVDELG   LF+QLL TMPWNSLMDRMMKE+HA GKTI 
Sbjct  2     AGIVVIFDFDKTIIDMDSDNWVVDELGANDLFNQLLSTMPWNSLMDRMMKELHAQGKTIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DIE VL+ VPIHPRIVPAIK+ + LG
Sbjct  62    DIEEVLKRVPIHPRIVPAIKSAYALG  87



>gb|AIE54289.1| psi14B protein [Nicotiana tabacum]
Length=271

 Score =   286 bits (732),  Expect(2) = 3e-109, Method: Compositional matrix adjust.
 Identities = 131/184 (71%), Positives = 153/184 (83%), Gaps = 0/184 (0%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLR+VSDAN+FFIETILKHLGIR CFSEINTNPGYVDEEGRL+ILP+ DF +SPHGC  
Sbjct  88   CDLRVVSDANVFFIETILKHLGIRNCFSEINTNPGYVDEEGRLKILPYVDFQTSPHGCNL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  I+ERIQASM KEGKKR+IYLGDGIGDFCPSLKL+ GDF+MPRKDFP W LI
Sbjct  148  CPPNMCKGLIVERIQASMVKEGKKRIIYLGDGIGDFCPSLKLREGDFVMPRKDFPAWNLI  207

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFLAAESKFQAISMQPCEALPKAI  299
            KENR+L++AE+HEW++GE+ E IL  LIN I IE+SQ L+ E KF  +S       P+ +
Sbjct  208  KENRTLVKAEVHEWTDGEELEHILLQLINAITIEESQLLSVECKFHTMSKASHGPFPRPL  267

Query  298  RVPF  287
             VP+
Sbjct  268  PVPY  271


 Score =   138 bits (348),  Expect(2) = 3e-109, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VV+FDFDKTIIDVDSDNWVVDELG   LF+QLL TMPWNSLMDR+MKE+H  GKTI 
Sbjct  2     AGIVVIFDFDKTIIDVDSDNWVVDELGANDLFNQLLPTMPWNSLMDRLMKELHTQGKTIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DIE VL+ VPIHPRIVPAIK+   LG
Sbjct  62    DIEEVLKRVPIHPRIVPAIKSAFALG  87



>ref|XP_009607352.1| PREDICTED: inorganic pyrophosphatase 1-like [Nicotiana tomentosiformis]
Length=271

 Score =   286 bits (731),  Expect(2) = 4e-109, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 153/184 (83%), Gaps = 0/184 (0%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLR++SDAN+FFIETILKHLGIR CFSEINTNPGYVDEEGRL+ILP+ DF +SPHGC  
Sbjct  88   CDLRVISDANVFFIETILKHLGIRNCFSEINTNPGYVDEEGRLKILPYVDFQTSPHGCNL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  I+ERIQASM KEGKKR+IYLGDGIGDFCPSLKL+ GDF+MPRKDFP W LI
Sbjct  148  CPPNMCKGLIVERIQASMVKEGKKRIIYLGDGIGDFCPSLKLREGDFVMPRKDFPAWNLI  207

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFLAAESKFQAISMQPCEALPKAI  299
            KENR+L++AE+HEW++GE+ E IL  LIN I IE+SQ L+ E KF  +S       P+ +
Sbjct  208  KENRTLVKAEVHEWTDGEELEHILLQLINAITIEESQLLSVECKFHTMSKASHGPFPRPL  267

Query  298  RVPF  287
             VP+
Sbjct  268  PVPY  271


 Score =   138 bits (348),  Expect(2) = 4e-109, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VV+FDFDKTIIDVDSDNWVVDELG   LF+QLL TMPWNSLMDR+MKE+H  GKTI 
Sbjct  2     AGIVVIFDFDKTIIDVDSDNWVVDELGANDLFNQLLPTMPWNSLMDRLMKELHTQGKTIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DIE VL+ VPIHPRIVPAIK+   LG
Sbjct  62    DIEEVLKRVPIHPRIVPAIKSAFALG  87



>ref|XP_009790004.1| PREDICTED: inorganic pyrophosphatase 1-like [Nicotiana sylvestris]
Length=272

 Score =   280 bits (715),  Expect(2) = 8e-109, Method: Compositional matrix adjust.
 Identities = 129/185 (70%), Positives = 153/185 (83%), Gaps = 1/185 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVD-EEGRLRILPFHDFHSSPHGCA  662
            CDLR+VSDAN+FFIETILKHLGIR+CFSEINTNPGYVD EEGRL+ILP+ DF  SPHGC+
Sbjct  88   CDLRVVSDANVFFIETILKHLGIRDCFSEINTNPGYVDDEEGRLQILPYVDFQKSPHGCS  147

Query  661  RCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWEL  482
             CPPNMCK  I+ERIQASM KEGKKR+IYLGDGIGDFCPSLKL+ GDF+MPRKDFP W L
Sbjct  148  LCPPNMCKGLIVERIQASMAKEGKKRIIYLGDGIGDFCPSLKLREGDFVMPRKDFPAWNL  207

Query  481  IKENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFLAAESKFQAISMQPCEALPKA  302
            IKEN++L++A++HEW +GE+ E IL  LIN I IE+SQ L+ E KF  +S       P+ 
Sbjct  208  IKENKTLVKADVHEWIDGEELEHILLQLINAITIEESQLLSVECKFHTMSKASHGPFPRP  267

Query  301  IRVPF  287
            + VP+
Sbjct  268  LPVPY  272


 Score =   144 bits (362),  Expect(2) = 8e-109, Method: Compositional matrix adjust.
 Identities = 69/86 (80%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VV+FDFDKTIIDVDSDNWVVDELG   LF+QLL TMPWNSLMDRMMKE+HA GKTI 
Sbjct  2     AGIVVIFDFDKTIIDVDSDNWVVDELGANDLFNQLLSTMPWNSLMDRMMKELHAQGKTIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DIE VL+ VPIHPRIVPAIK+ + LG
Sbjct  62    DIEEVLKRVPIHPRIVPAIKSAYALG  87



>ref|XP_006357372.1| PREDICTED: inorganic pyrophosphatase 1-like [Solanum tuberosum]
Length=272

 Score =   282 bits (721),  Expect(2) = 3e-108, Method: Compositional matrix adjust.
 Identities = 129/185 (70%), Positives = 155/185 (84%), Gaps = 1/185 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLR++SDAN+FFIETILKH+GIR+CFSEINTNPGYVDEEGRLRILP+ DF +SPHGC  
Sbjct  88   CDLRVISDANVFFIETILKHVGIRDCFSEINTNPGYVDEEGRLRILPYVDFQTSPHGCNL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  I+ERIQAS+ KE K+R+IYLGDGIGDFCPSLKL+ GDF+MPRKDFP W LI
Sbjct  148  CPPNMCKGMIVERIQASIAKEAKRRMIYLGDGIGDFCPSLKLREGDFVMPRKDFPAWNLI  207

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFLAAE-SKFQAISMQPCEALPKA  302
             +NR+L++A +HEW++GE+ ERIL  LIN I IE+SQ L+ E  KFQ I      ALP+A
Sbjct  208  NKNRTLVKAAVHEWTDGEELERILLQLINTINIEESQLLSVEFCKFQTIPKAAHGALPQA  267

Query  301  IRVPF  287
            + VP+
Sbjct  268  LPVPY  272


 Score =   139 bits (350),  Expect(2) = 3e-108, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VV FDFDKTIIDVDSDNWVVDELG T LF+QLL TMPWNSLMDRMMKE+H  GKTI 
Sbjct  2     AGIVVFFDFDKTIIDVDSDNWVVDELGATDLFNQLLPTMPWNSLMDRMMKELHTQGKTIQ  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DIE VL+ VP HPRIVPAIK+ + LG
Sbjct  62    DIEEVLKRVPRHPRIVPAIKSAYALG  87



>ref|XP_009800756.1| PREDICTED: inorganic pyrophosphatase 1-like [Nicotiana sylvestris]
Length=268

 Score =   280 bits (717),  Expect(2) = 3e-107, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 154/184 (84%), Gaps = 3/184 (2%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLR+VSDAN+F+IETILKHLGI +CFSEIN+NPGY+DEEG+LRI P+HDFH+S HGC+ 
Sbjct  88   CDLRVVSDANIFYIETILKHLGIMDCFSEINSNPGYIDEEGKLRIQPYHDFHTSSHGCSL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  IIERIQAS+  EGKKR+IYLGDG GDFCPSLKLK  DF+MPRKDFPVW+LI
Sbjct  148  CPPNMCKGLIIERIQASLATEGKKRMIYLGDGAGDFCPSLKLKKEDFVMPRKDFPVWKLI  207

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFLAAESKFQAISMQPCEALPKAI  299
             ENR L++AEIH W +GE++E IL  +I  I +E++Q L+ + KFQ I   P EALPKA+
Sbjct  208  NENRELVKAEIHGWKDGEEYEHILLQIIKTITMEENQLLSVDCKFQTI---PIEALPKAV  264

Query  298  RVPF  287
             VP+
Sbjct  265  PVPY  268


 Score =   137 bits (346),  Expect(2) = 3e-107, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFDKTIID+DSDNWVVDELG T LF+QLL TMPWNS+MD+MMKE+HA GKTI 
Sbjct  2     AGIVVVFDFDKTIIDLDSDNWVVDELGATDLFNQLLPTMPWNSVMDKMMKELHAQGKTIA  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DIE VL+  PI PR+VPAIK  H LG
Sbjct  62    DIEEVLKRAPIIPRVVPAIKEAHALG  87



>ref|XP_006357373.1| PREDICTED: inorganic pyrophosphatase 1-like [Solanum tuberosum]
Length=272

 Score =   280 bits (715),  Expect(2) = 9e-107, Method: Compositional matrix adjust.
 Identities = 129/185 (70%), Positives = 153/185 (83%), Gaps = 1/185 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLR+ SDAN+FFIETILKH+GIR+CFSEINTNPGYVDEEGRLRILP+ DF +SPHGC  
Sbjct  88   CDLRVTSDANVFFIETILKHVGIRDCFSEINTNPGYVDEEGRLRILPYVDFITSPHGCNL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  I+ERIQASM KEGKKR+IYLGDGIGDFCPSLKL   DF+MPRKDFP W LI
Sbjct  148  CPPNMCKGMIVERIQASMTKEGKKRMIYLGDGIGDFCPSLKLMEADFVMPRKDFPAWNLI  207

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFLAAES-KFQAISMQPCEALPKA  302
             +NR+L++A +HEW++GE+FE IL  LIN I +E+S+ L+ E  KFQ +S     ALP A
Sbjct  208  NKNRTLVKATVHEWADGEEFEHILLQLINTISVEESRLLSVEYCKFQTMSKATHGALPPA  267

Query  301  IRVPF  287
            + VP+
Sbjct  268  LPVPY  272


 Score =   137 bits (344),  Expect(2) = 9e-107, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFDKTIIDVDSDNWVVDELG T LF+QLL TMPWNSLMDR+M E+H  G  I 
Sbjct  2     AGIVVVFDFDKTIIDVDSDNWVVDELGATDLFNQLLPTMPWNSLMDRIMNELHTQGIAIQ  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DIE VL+ VPIHPRIVPAIK+V+ LG
Sbjct  62    DIEEVLKRVPIHPRIVPAIKSVYALG  87



>ref|XP_009631067.1| PREDICTED: inorganic pyrophosphatase 1-like [Nicotiana tomentosiformis]
Length=268

 Score =   276 bits (705),  Expect(2) = 1e-106, Method: Compositional matrix adjust.
 Identities = 125/184 (68%), Positives = 152/184 (83%), Gaps = 3/184 (2%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LR+VSDAN+F+IETILKHLGI +CFSEIN+NPGYVDEEG+LRI P+HDFH+S HGC+ 
Sbjct  88   CELRVVSDANIFYIETILKHLGIMDCFSEINSNPGYVDEEGKLRIQPYHDFHTSSHGCSL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  IIERIQAS+  EGKKR+IYLGDG GDFCPSLKLK  DF+MPRKDFPVW+LI
Sbjct  148  CPPNMCKGLIIERIQASLAMEGKKRMIYLGDGAGDFCPSLKLKKEDFVMPRKDFPVWKLI  207

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFLAAESKFQAISMQPCEALPKAI  299
             ENR L+ AEIH W +GE++E IL  +I  + +E++Q L+ + KFQ I   P EALPK +
Sbjct  208  NENRELVRAEIHGWKDGEEYEHILLQIIKTLTMEENQLLSVDCKFQTI---PIEALPKVV  264

Query  298  RVPF  287
             VP+
Sbjct  265  PVPY  268


 Score =   140 bits (352),  Expect(2) = 1e-106, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFDKTIID+DSDNWVVDELG T LF+QLL TMPWNS+MD+MMKE+HA GKTI 
Sbjct  2     AGIVVVFDFDKTIIDLDSDNWVVDELGATNLFNQLLPTMPWNSVMDKMMKELHAQGKTIA  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DIE VL+  PI PR+VPAIKA H LG
Sbjct  62    DIEEVLKRAPIIPRVVPAIKAAHALG  87



>gb|KDP40798.1| hypothetical protein JCGZ_24797 [Jatropha curcas]
Length=276

 Score =   271 bits (692),  Expect(2) = 2e-106, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 153/188 (81%), Gaps = 5/188 (3%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LRIVSDAN+FFIETIL+HLG+R+CFSEINTNPGYVDEEGRLRI P+HDF  S HGC+R
Sbjct  88   CELRIVSDANMFFIETILEHLGVRDCFSEINTNPGYVDEEGRLRIFPYHDFTQSSHGCSR  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK+ I+ERIQ S+ KEG K+++YLGDGIGD+CPSLKL   D++MPRK+FPVW+LI
Sbjct  148  CPPNMCKALILERIQTSIAKEGNKKIVYLGDGIGDYCPSLKLTESDYLMPRKNFPVWDLI  207

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIEDS-----QFLAAESKFQAISMQPCEA  314
              N  L++AEIHEWS+GE+ E IL  +IN+I +E+S     Q  +A+ K Q IS+   E 
Sbjct  208  CRNPMLIKAEIHEWSDGEELEHILLQIINKISMEESNGISAQLFSADCKLQNISIAGHET  267

Query  313  LPKAIRVP  290
            LPKA+ VP
Sbjct  268  LPKALSVP  275


 Score =   144 bits (364),  Expect(2) = 2e-106, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VV+FDFDKTIIDVDSDNWV+DELGFT LF+QLL TMPWNSLMD+MMKE+H+ GKTI 
Sbjct  2     AGIVVIFDFDKTIIDVDSDNWVIDELGFTDLFNQLLPTMPWNSLMDKMMKELHSQGKTIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI +VL+ VPIHPRIVPAIK+ H LG
Sbjct  62    DIVQVLKRVPIHPRIVPAIKSAHALG  87



>ref|XP_011072482.1| PREDICTED: inorganic pyrophosphatase 2 [Sesamum indicum]
Length=277

 Score =   277 bits (708),  Expect(2) = 3e-106, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 156/188 (83%), Gaps = 6/188 (3%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRIVSDAN+FFIETIL HLGI++CF+EINTNP YVD++GRLRI P+ DFH+SPHGC  
Sbjct  88   CDLRIVSDANMFFIETILDHLGIKDCFTEINTNPSYVDDQGRLRISPYVDFHTSPHGCNL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  IIERIQAS+ KEGKKR+IYLGDG GDFCPSLKLK GDFMMPRK++PVW+LI
Sbjct  148  CPPNMCKGMIIERIQASIAKEGKKRMIYLGDGSGDFCPSLKLKEGDFMMPRKNYPVWDLI  207

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIEDS------QFLAAESKFQAISMQPCE  317
             ENR+LL+AEIHEW+NG + ER+L  LI++I I++S      Q L+ + KF++I M   E
Sbjct  208  CENRALLKAEIHEWANGAELERVLLELIDKISIQESNNSNLAQLLSVDCKFESIPMAGHE  267

Query  316  ALPKAIRV  293
            ALP  +RV
Sbjct  268  ALPPPLRV  275


 Score =   138 bits (347),  Expect(2) = 3e-106, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFDKTII++DSDNWVVDELG T LF+QLL TMPWNS+MDRMM+E+HA GKTI 
Sbjct  2     AGIVVVFDFDKTIIEIDSDNWVVDELGATDLFNQLLPTMPWNSMMDRMMREVHAQGKTIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI+ VL+  P+HPR+VPAIK  H LG
Sbjct  62    DIKEVLRRAPMHPRVVPAIKKAHALG  87



>ref|XP_006357374.1| PREDICTED: inorganic pyrophosphatase 1-like [Solanum tuberosum]
Length=269

 Score =   278 bits (710),  Expect(2) = 2e-105, Method: Compositional matrix adjust.
 Identities = 128/185 (69%), Positives = 154/185 (83%), Gaps = 4/185 (2%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLR++SDAN+FFIETILKH+GIR+CFSEINTNPGYV+EEGRLRILP+ DF +SPHGC  
Sbjct  88   CDLRVISDANVFFIETILKHVGIRDCFSEINTNPGYVNEEGRLRILPYVDFQTSPHGCNL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  I+ERIQA + KEGKKR+IYLGDGIGDFCPSLKL   DF+MPRKDFP W LI
Sbjct  148  CPPNMCKGMIVERIQAILAKEGKKRMIYLGDGIGDFCPSLKLMETDFVMPRKDFPAWNLI  207

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFLAAES-KFQAISMQPCEALPKA  302
             ENR+L++A +HEW++GE+FE IL  LIN I +E++Q L+ E  KFQ +S    EALP A
Sbjct  208  NENRTLVKAAVHEWTDGEEFEHILLQLINTITVEENQLLSVEYCKFQTMSK---EALPLA  264

Query  301  IRVPF  287
            + VP+
Sbjct  265  LPVPY  269


 Score =   134 bits (337),  Expect(2) = 2e-105, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VV FDFDKTIIDVDSDNWVVDELG T LF+QLL TMPWNSLMDRMM E+H    TI 
Sbjct  2     AGIVVFFDFDKTIIDVDSDNWVVDELGATDLFNQLLPTMPWNSLMDRMMNELHTQVITIQ  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DIE VL+ VPIHPRIVPAIK+ + LG
Sbjct  62    DIEEVLKRVPIHPRIVPAIKSAYALG  87



>ref|NP_001234501.1| psi14A protein [Solanum lycopersicum]
 emb|CAD30863.1| putative phosphatase [Solanum lycopersicum]
Length=269

 Score =   265 bits (677),  Expect(2) = 5e-105, Method: Compositional matrix adjust.
 Identities = 123/185 (66%), Positives = 148/185 (80%), Gaps = 4/185 (2%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLR++SDAN+FF+ETILKHLGIR+CFSEINTNPGYVD EGRLRILP+ DF  SPHGC  
Sbjct  88   CDLRVISDANVFFLETILKHLGIRDCFSEINTNPGYVDGEGRLRILPYVDFQKSPHGCNL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  I+ERIQA   KEGKKR+IYLGDGIGDFCPSLKL   DF+MPRKDFP W LI
Sbjct  148  CPPNMCKGMIVERIQA---KEGKKRMIYLGDGIGDFCPSLKLSEADFVMPRKDFPAWNLI  204

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFLAAES-KFQAISMQPCEALPKA  302
             +NR+L++A +HEW+NG++ E IL  LIN I +E+SQ L+ +  K   +S     ALP+A
Sbjct  205  NKNRTLVKATVHEWTNGQELEHILLQLINTINMEESQLLSVDYCKLVTMSKAAHGALPQA  264

Query  301  IRVPF  287
            + VP+
Sbjct  265  LPVPY  269


 Score =   145 bits (367),  Expect(2) = 5e-105, Method: Compositional matrix adjust.
 Identities = 71/86 (83%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFDKTIIDVDSDNWVVDELG T LF+QLL TMPWNSLMDRMMKE+H  GKTI 
Sbjct  2     AGIVVVFDFDKTIIDVDSDNWVVDELGATDLFNQLLPTMPWNSLMDRMMKELHTQGKTIQ  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DIE VL+ VPIHPRIVPAIK+ H LG
Sbjct  62    DIEEVLKRVPIHPRIVPAIKSAHALG  87



>ref|XP_006343006.1| PREDICTED: inorganic pyrophosphatase 1-like [Solanum tuberosum]
Length=274

 Score =   275 bits (702),  Expect(2) = 6e-105, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 154/187 (82%), Gaps = 3/187 (2%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCA-  662
            CDLRIVSDANLF+IETIL HLGI +CF+EINTNPGYVDEEG+LRI P HDFH+S HGC+ 
Sbjct  88   CDLRIVSDANLFYIETILNHLGISDCFTEINTNPGYVDEEGKLRIRPHHDFHTSSHGCSS  147

Query  661  -RCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWE  485
              CPPNMCK  +IERIQAS+ KEGKKR+IYLGDG GD+CPSLKLK  DF+MPRKDFPVW+
Sbjct  148  NTCPPNMCKGLVIERIQASLAKEGKKRMIYLGDGAGDYCPSLKLKEQDFVMPRKDFPVWK  207

Query  484  LIKENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFLAAESKFQAISMQPC-EALP  308
            LI ENR L++A+IH WS+GE+ E IL  +I  I +ED+QFL+ + KFQ I +    EA+P
Sbjct  208  LINENRDLVKADIHGWSDGEEQEHILLQIIKTISMEDNQFLSVDCKFQTIPINAVHEAMP  267

Query  307  KAIRVPF  287
            KA+ VP+
Sbjct  268  KALPVPY  274


 Score =   135 bits (341),  Expect(2) = 6e-105, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFDKTIID+DSDNWVVDELG T LF+QLL TMPWNS+MDRMMKE++  GKTI 
Sbjct  2     AGIVVVFDFDKTIIDLDSDNWVVDELGATDLFNQLLPTMPWNSVMDRMMKELYEQGKTIK  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DIE+VL+  P+ PR+VPAIKA H LG
Sbjct  62    DIEQVLKRAPVIPRVVPAIKAAHALG  87



>ref|NP_001241414.1| uncharacterized protein LOC100785878 [Glycine max]
 gb|ACU20848.1| unknown [Glycine max]
 gb|KHN39289.1| Inorganic pyrophosphatase 2 [Glycine soja]
Length=272

 Score =   265 bits (678),  Expect(2) = 6e-105, Method: Compositional matrix adjust.
 Identities = 123/183 (67%), Positives = 155/183 (85%), Gaps = 1/183 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRIVSDAN+FFIETILKHLGIRE FSEINTNPGYV+EEGRLRILP+HDF+ + HGC  
Sbjct  88   CDLRIVSDANVFFIETILKHLGIREYFSEINTNPGYVNEEGRLRILPYHDFNKASHGCTL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  II+RIQ S+ +EGKKR+IYLGDG GD+CPSL+LK  DFMMPRK+FPVW+LI
Sbjct  148  CPPNMCKGLIIDRIQDSISEEGKKRMIYLGDGSGDYCPSLRLKERDFMMPRKNFPVWDLI  207

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICI-EDSQFLAAESKFQAISMQPCEALPKA  302
             ++  L++AEIH WS+GE+ E++L HLIN+I + E++QF++++ K Q +S+   E LPKA
Sbjct  208  CKDPLLVKAEIHGWSDGEELEQVLLHLINKISMEENAQFISSDCKLQTLSVSALEGLPKA  267

Query  301  IRV  293
            + V
Sbjct  268  LPV  270


 Score =   145 bits (365),  Expect(2) = 6e-105, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             +GTV+VFDFDKTI+DVDSDNWV+DELGFT LF+QLL TMPWNSLMDRMM E+H+NGKTI 
Sbjct  2     SGTVIVFDFDKTIVDVDSDNWVIDELGFTDLFNQLLPTMPWNSLMDRMMMELHSNGKTIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DIE VL+ +P+HPR++PA++A H LG
Sbjct  62    DIEEVLRRIPLHPRVIPALQAAHALG  87



>emb|CAD30864.1| putative phosphatase [Solanum lycopersicum]
Length=269

 Score =   265 bits (677),  Expect(2) = 1e-104, Method: Compositional matrix adjust.
 Identities = 123/185 (66%), Positives = 148/185 (80%), Gaps = 4/185 (2%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLR++SDAN+FF+ETILKHLGIR+CFSEINTNPGYVD EGRLRILP+ DF  SPHGC  
Sbjct  88   CDLRVISDANVFFLETILKHLGIRDCFSEINTNPGYVDGEGRLRILPYVDFQKSPHGCNL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  I+ERIQA   KEGKKR+IYLGDGIGDFCPSLKL   DF+MPRKDFP W LI
Sbjct  148  CPPNMCKGMIVERIQA---KEGKKRMIYLGDGIGDFCPSLKLSEADFVMPRKDFPAWNLI  204

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFLAAES-KFQAISMQPCEALPKA  302
             +NR+L++A +HEW+NG++ E IL  LIN I +E+SQ L+ +  K   +S     ALP+A
Sbjct  205  NKNRTLVKATVHEWTNGQELEHILLQLINTINMEESQLLSVDYCKLVTMSKAAHGALPQA  264

Query  301  IRVPF  287
            + VP+
Sbjct  265  LPVPY  269


 Score =   144 bits (363),  Expect(2) = 1e-104, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFDKTIIDVDSDNWVVDELG T LF+QLL TMPWNSLM+RMMKE+H  GKTI 
Sbjct  2     AGIVVVFDFDKTIIDVDSDNWVVDELGATDLFNQLLPTMPWNSLMNRMMKELHTQGKTIQ  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DIE VL+ VPIHPRIVPAIK+ H LG
Sbjct  62    DIEEVLKRVPIHPRIVPAIKSAHALG  87



>gb|ACU19181.1| unknown [Glycine max]
Length=272

 Score =   263 bits (671),  Expect(2) = 4e-104, Method: Compositional matrix adjust.
 Identities = 122/183 (67%), Positives = 154/183 (84%), Gaps = 1/183 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRIVSDAN+FFIETILKHLGIRE FSEINTNPGYV+EEGRLRILP+HDF+ + HGC  
Sbjct  88   CDLRIVSDANVFFIETILKHLGIREYFSEINTNPGYVNEEGRLRILPYHDFNKASHGCTL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  II+RIQ S+ +EGKKR+IYLGDG GD+CPSL+LK  DFMM RK+FPVW+LI
Sbjct  148  CPPNMCKGLIIDRIQDSISEEGKKRMIYLGDGSGDYCPSLRLKERDFMMSRKNFPVWDLI  207

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICI-EDSQFLAAESKFQAISMQPCEALPKA  302
             ++  L++AEIH WS+GE+ E++L HLIN+I + E++QF++++ K Q +S+   E LPKA
Sbjct  208  CKDPLLVKAEIHGWSDGEELEQVLLHLINKISMEENAQFISSDCKLQTLSVSALEGLPKA  267

Query  301  IRV  293
            + V
Sbjct  268  LPV  270


 Score =   145 bits (365),  Expect(2) = 4e-104, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             +GTV+VFDFDKTI+DVDSDNWV+DELGFT LF+QLL TMPWNSLMDRMM E+H+NGKTI 
Sbjct  2     SGTVIVFDFDKTIVDVDSDNWVIDELGFTDLFNQLLPTMPWNSLMDRMMMELHSNGKTIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DIE VL+ +P+HPR++PA++A H LG
Sbjct  62    DIEEVLRRIPLHPRVIPALQAAHALG  87



>ref|NP_001234003.1| psi14B protein [Solanum lycopersicum]
 emb|CAD30862.1| putative phosphatase [Solanum lycopersicum]
 emb|CAD30865.1| putative phosphatase [Solanum lycopersicum]
Length=269

 Score =   263 bits (671),  Expect(2) = 5e-104, Method: Compositional matrix adjust.
 Identities = 125/185 (68%), Positives = 147/185 (79%), Gaps = 4/185 (2%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLR++SDAN+FFIETILKHLGIR+CFSEINTNPGYVD EGRLRILP+ DF  SPHGC  
Sbjct  88   CDLRVISDANVFFIETILKHLGIRDCFSEINTNPGYVDGEGRLRILPYVDFQKSPHGCNL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  I+ERIQA   KEGKKR+IYLGDGIGDFCPSLKL+  DF+MPRKDFP W LI
Sbjct  148  CPPNMCKGMIVERIQA---KEGKKRMIYLGDGIGDFCPSLKLREADFVMPRKDFPAWNLI  204

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFLAAES-KFQAISMQPCEALPKA  302
             +NR+L++A +HEW+NG++ E IL   IN I IE+SQ L+ E  KFQ        ALP+ 
Sbjct  205  NKNRTLVKAGVHEWTNGKELEHILLQWINTINIEESQLLSMEYCKFQTKPNADHGALPRP  264

Query  301  IRVPF  287
            + VP+
Sbjct  265  LPVPY  269


 Score =   144 bits (364),  Expect(2) = 5e-104, Method: Compositional matrix adjust.
 Identities = 71/86 (83%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFDKTIIDVDSDNWVVDELG T LF+QLL TMPWNSLMDRMMKE+H  GKTI 
Sbjct  2     AGIVVVFDFDKTIIDVDSDNWVVDELGATDLFNQLLPTMPWNSLMDRMMKELHTQGKTIQ  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DIE VL+ VPIHPRIVPAIK+ H LG
Sbjct  62    DIEEVLKRVPIHPRIVPAIKSAHALG  87



>ref|XP_009367536.1| PREDICTED: inorganic pyrophosphatase 1-like [Pyrus x bretschneideri]
Length=269

 Score =   265 bits (676),  Expect(2) = 2e-103, Method: Compositional matrix adjust.
 Identities = 128/183 (70%), Positives = 156/183 (85%), Gaps = 4/183 (2%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRI+SDANLFFIETILKHLG+ E FSEINTNP YVDEEGRLRI P+ DF  SPHGC+R
Sbjct  88   CDLRILSDANLFFIETILKHLGLEEYFSEINTNPSYVDEEGRLRISPYCDFTQSPHGCSR  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCKS IIERIQAS+  +GKKR+IYLGDG GD+CPSLKLK GDF+MPRK+FP+++LI
Sbjct  148  CPPNMCKSVIIERIQASVSTDGKKRLIYLGDGSGDYCPSLKLKEGDFVMPRKNFPLYDLI  207

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIED-SQFLAAESKFQAISMQPCEALPKA  302
             +N  L++AEIHEW++GE+ E+IL +LIN I IE+ +QFL+A+ K Q IS+   EALP+A
Sbjct  208  CKNPLLIKAEIHEWTDGEELEQILLNLINSISIEEHAQFLSADCKLQTISV---EALPQA  264

Query  301  IRV  293
            + V
Sbjct  265  LPV  267


 Score =   141 bits (355),  Expect(2) = 2e-103, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFDKTII+ DSDNWVVDELG T LF++LL TMPWNSLMDRMMKE+H+ GKTI 
Sbjct  2     AGIVVVFDFDKTIIECDSDNWVVDELGATDLFNELLPTMPWNSLMDRMMKELHSQGKTIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI  VLQ  PIHPR+VPAIKA H LG
Sbjct  62    DIVEVLQRTPIHPRVVPAIKAAHALG  87



>ref|NP_001266264.1| inorganic pyrophosphatase 1-like [Solanum lycopersicum]
 gb|AAG40473.1|AF305968_1 putative acid phosphatase [Solanum lycopersicum]
 emb|CAD30861.1| putative phosphatase [Solanum lycopersicum]
 emb|CAD30866.1| putative phosphatase [Solanum lycopersicum]
Length=269

 Score =   262 bits (669),  Expect(2) = 2e-103, Method: Compositional matrix adjust.
 Identities = 124/185 (67%), Positives = 147/185 (79%), Gaps = 4/185 (2%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLR++SDAN+FFIETILKHLGIR+CFSEINTNPGYVD EGRLRILP+ DF  SPH C  
Sbjct  88   CDLRVISDANVFFIETILKHLGIRDCFSEINTNPGYVDGEGRLRILPYVDFQKSPHSCNL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  I+ERIQA   KEGKKR+IYLGDGIGDFCPSLKL+  DF+MPRKDFP W LI
Sbjct  148  CPPNMCKGMIVERIQA---KEGKKRMIYLGDGIGDFCPSLKLREADFVMPRKDFPAWNLI  204

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFLAAES-KFQAISMQPCEALPKA  302
             +NR+L++A +HEW+NG++ E IL   IN I IE+SQ L+ E+ KFQ        ALP+ 
Sbjct  205  NKNRTLVKAGVHEWTNGKELEHILLQWINTINIEESQLLSMENCKFQTKHNAAHGALPRP  264

Query  301  IRVPF  287
            + VP+
Sbjct  265  LPVPY  269


 Score =   143 bits (361),  Expect(2) = 2e-103, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFDKTII+VDSDNWVVDELG T LF+QLL TMPWNSLMDRMMKE+H  GKTI 
Sbjct  2     AGIVVVFDFDKTIIEVDSDNWVVDELGATDLFNQLLPTMPWNSLMDRMMKELHTQGKTIQ  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DIE VL+ VPIHPRIVPAIK+ H LG
Sbjct  62    DIEEVLKRVPIHPRIVPAIKSAHALG  87



>ref|XP_004235613.1| PREDICTED: inorganic pyrophosphatase 1-like [Solanum lycopersicum]
Length=274

 Score =   269 bits (688),  Expect(2) = 2e-103, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 153/187 (82%), Gaps = 3/187 (2%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCA-  662
            CDLRIVSDANLF+IETIL HLGI +CF+EI+TNPGYVDEEGRLRI P HDFH+S HGC+ 
Sbjct  88   CDLRIVSDANLFYIETILNHLGISDCFTEIHTNPGYVDEEGRLRIRPHHDFHTSSHGCSS  147

Query  661  -RCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWE  485
              CPPNMCK  +IE+IQAS+ KEGKKR+IYLGDG GD+CPSLKLK  DF+MPRKDFPVW+
Sbjct  148  NTCPPNMCKGLVIEKIQASLAKEGKKRMIYLGDGAGDYCPSLKLKEQDFVMPRKDFPVWK  207

Query  484  LIKENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFLAAESKFQAISMQPC-EALP  308
            LI EN  L++AEIH WS+GE+ E+IL  +I  I +ED+QFL+ + KFQ I +    EA+ 
Sbjct  208  LINENHDLVKAEIHGWSDGEEQEQILLQIIKTISMEDNQFLSVDCKFQTIPINAVHEAIT  267

Query  307  KAIRVPF  287
            KA+ VP+
Sbjct  268  KALPVPY  274


 Score =   136 bits (342),  Expect(2) = 2e-103, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFDKTIID+DSDNWVVDELG T LF+QLL TMPWNS+MDRMMKE+H  GKTI 
Sbjct  2     AGIVVVFDFDKTIIDLDSDNWVVDELGATDLFNQLLPTMPWNSVMDRMMKELHEQGKTIK  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DIE VL+  P  PR+VPAIKA H LG
Sbjct  62    DIEEVLKRAPAIPRVVPAIKAAHALG  87



>ref|XP_008391309.1| PREDICTED: inorganic pyrophosphatase 1-like [Malus domestica]
Length=269

 Score =   263 bits (673),  Expect(2) = 9e-103, Method: Compositional matrix adjust.
 Identities = 128/183 (70%), Positives = 155/183 (85%), Gaps = 4/183 (2%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRI+SDANLFFIETILKHLG+ E FSEINTNP YVDEEGRLRI P+ DF  SPHGC+R
Sbjct  88   CDLRILSDANLFFIETILKHLGLEEYFSEINTNPSYVDEEGRLRISPYCDFTQSPHGCSR  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCKS IIERIQAS+  +GKKR+IYLGDG GD+CPSLKLK GDF+MPRK+FP+++LI
Sbjct  148  CPPNMCKSVIIERIQASVSTDGKKRLIYLGDGSGDYCPSLKLKEGDFVMPRKNFPLYDLI  207

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICI-EDSQFLAAESKFQAISMQPCEALPKA  302
             +N  L++AEIHEW++GE+ E+IL +LIN I I E +QFL+A+ K Q IS+   EALP+A
Sbjct  208  CKNPLLIKAEIHEWTDGEELEQILLNLINSISIDEHAQFLSADCKLQTISV---EALPQA  264

Query  301  IRV  293
            + V
Sbjct  265  LPV  267


 Score =   139 bits (351),  Expect(2) = 9e-103, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFDKTII+ DSDNWVVDELG T LF++LL TMPWNSLMDRMMKE+H+ GKTI 
Sbjct  2     AGIVVVFDFDKTIIECDSDNWVVDELGATDLFNELLPTMPWNSLMDRMMKELHSQGKTIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI  VL+  PIHPR+VPAIKA H LG
Sbjct  62    DIMEVLKRTPIHPRVVPAIKAAHALG  87



>gb|KHN11303.1| Inorganic pyrophosphatase 2 [Glycine soja]
Length=272

 Score =   261 bits (667),  Expect(2) = 1e-102, Method: Compositional matrix adjust.
 Identities = 121/185 (65%), Positives = 152/185 (82%), Gaps = 1/185 (1%)
 Frame = -2

Query  844  FRCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGC  665
            F CDLRIVSDAN+FFIETILKHLGIRE FSEINTNPGYV+EEGRLRILP+HDF+ + HGC
Sbjct  86   FGCDLRIVSDANMFFIETILKHLGIREYFSEINTNPGYVNEEGRLRILPYHDFNKASHGC  145

Query  664  ARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWE  485
              CPPNMCK  II+RIQ S+ +EG KR+IYLGDG GD+CPSL+LK  DFMMPRK+FP W+
Sbjct  146  TLCPPNMCKGLIIDRIQDSISQEGNKRMIYLGDGSGDYCPSLRLKERDFMMPRKNFPAWD  205

Query  484  LIKENRSLLEAEIHEWSNGEDFERILFHLINRICI-EDSQFLAAESKFQAISMQPCEALP  308
            LI ++  L++AEIH WS+GE+ E++L HLI +I + E+SQF++++ K Q +S+   E LP
Sbjct  206  LICKDPLLVKAEIHGWSDGEELEQVLLHLIAKISMEENSQFISSDCKLQTLSVSALEGLP  265

Query  307  KAIRV  293
            K + V
Sbjct  266  KVLPV  270


 Score =   141 bits (356),  Expect(2) = 1e-102, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             +GTV+VFDFDKTI+DVDSDNWV+DELGFT LF+QLL TMPWNSLMDRMM E+H+ GKTI 
Sbjct  2     SGTVIVFDFDKTIVDVDSDNWVIDELGFTDLFNQLLPTMPWNSLMDRMMMELHSKGKTIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DIE VL  +P+HPR++PAI+A H  G
Sbjct  62    DIEEVLHRIPLHPRVIPAIQAAHAFG  87



>ref|XP_003531628.1| PREDICTED: inorganic pyrophosphatase 2-like [Glycine max]
Length=272

 Score =   260 bits (665),  Expect(2) = 2e-102, Method: Compositional matrix adjust.
 Identities = 120/185 (65%), Positives = 152/185 (82%), Gaps = 1/185 (1%)
 Frame = -2

Query  844  FRCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGC  665
            F CDLRIVSDAN+FFIETILKHLGIRE FSEINTNPGYV+EEGRLRILP+HDF+ + HGC
Sbjct  86   FGCDLRIVSDANMFFIETILKHLGIREYFSEINTNPGYVNEEGRLRILPYHDFNKASHGC  145

Query  664  ARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWE  485
              CPPNMCK  II+RIQ S+ +EG KR+IYLGDG GD+CPSL+LK  D+MMPRK+FP W+
Sbjct  146  TLCPPNMCKGLIIDRIQDSISQEGNKRMIYLGDGSGDYCPSLRLKERDYMMPRKNFPAWD  205

Query  484  LIKENRSLLEAEIHEWSNGEDFERILFHLINRICI-EDSQFLAAESKFQAISMQPCEALP  308
            LI ++  L++AEIH WS+GE+ E++L HLI +I + E+SQF++++ K Q +S+   E LP
Sbjct  206  LICKDPLLVKAEIHGWSDGEELEQVLLHLIAKISMEENSQFISSDCKLQTLSVSALEGLP  265

Query  307  KAIRV  293
            K + V
Sbjct  266  KVLPV  270


 Score =   141 bits (356),  Expect(2) = 2e-102, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             +GTV+VFDFDKTI+DVDSDNWV+DELGFT LF+QLL TMPWNSLMDRMM E+H+ GKTI 
Sbjct  2     SGTVIVFDFDKTIVDVDSDNWVIDELGFTDLFNQLLPTMPWNSLMDRMMMELHSKGKTIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DIE VL  +P+HPR++PAI+A H  G
Sbjct  62    DIEEVLHRIPLHPRVIPAIQAAHAFG  87



>ref|XP_002311810.1| hypothetical protein POPTR_0008s20130g [Populus trichocarpa]
 gb|EEE89177.1| hypothetical protein POPTR_0008s20130g [Populus trichocarpa]
Length=277

 Score =   256 bits (655),  Expect(2) = 2e-101, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 149/187 (80%), Gaps = 5/187 (3%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LRIVSDAN+FFIETILKHLG+++ FSEINTNPG+VDEEGRLRI P+HDF  S HGC+ 
Sbjct  89   CELRIVSDANMFFIETILKHLGLKDYFSEINTNPGFVDEEGRLRISPYHDFTQSSHGCSL  148

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  IIERIQAS+ KEG K++IYLGDG GD+CPSLKL   D+MMPRK+FPVW+LI
Sbjct  149  CPPNMCKGLIIERIQASISKEGSKKIIYLGDGAGDYCPSLKLTEADYMMPRKNFPVWDLI  208

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIED-----SQFLAAESKFQAISMQPCEA  314
             +N  L++AEIHEW++G + ER+L  +I RI  E+     ++  +A+ K Q IS+   +A
Sbjct  209  SKNPKLIKAEIHEWNDGAEMERVLLQIIERISREEINSNSAKLFSADCKLQTISIAGHDA  268

Query  313  LPKAIRV  293
            +P+A+ V
Sbjct  269  MPQALSV  275


 Score =   142 bits (358),  Expect(2) = 2e-101, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = -1

Query  1184  MAAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKT  1005
             MAA  VVVFDFDKTIIDVDSDNWV+DELGFT  F+QLL TM WNSLMDRMMKE+HANGKT
Sbjct  1     MAAAIVVVFDFDKTIIDVDSDNWVIDELGFTESFNQLLPTMSWNSLMDRMMKELHANGKT  60

Query  1004  IGDIERVLQGVPIHPRIVPAIKAVHGLG  921
             + DI  VL+ +PIHP+++ AIKA H LG
Sbjct  61    MEDIAEVLKRIPIHPQVISAIKAAHALG  88



>ref|XP_003529939.1| PREDICTED: inorganic pyrophosphatase 2-like [Glycine max]
 gb|KHN39290.1| Inorganic pyrophosphatase 2 [Glycine soja]
Length=272

 Score =   256 bits (655),  Expect(2) = 3e-101, Method: Compositional matrix adjust.
 Identities = 120/183 (66%), Positives = 154/183 (84%), Gaps = 1/183 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRIVSDAN+FFIETILKHLGIRE FSEI+TNPGYV+EE RLRILP+HDF+ + HGC+ 
Sbjct  88   CDLRIVSDANMFFIETILKHLGIREYFSEISTNPGYVNEEERLRILPYHDFNKASHGCSL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  II+RIQ S+ +EGKKR+IYLGDG GD+CPSL+LK  DFMMPRK+FPVW+LI
Sbjct  148  CPPNMCKGLIIDRIQDSILEEGKKRMIYLGDGSGDYCPSLRLKERDFMMPRKNFPVWDLI  207

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICI-EDSQFLAAESKFQAISMQPCEALPKA  302
             ++  L++AEIH WS+GE+ E++L HLIN+I + E++QF++++ K Q +S+   E LPK 
Sbjct  208  CKDPLLVKAEIHGWSDGEELEQVLLHLINKISMEENAQFISSDCKLQTLSVSAHEDLPKV  267

Query  301  IRV  293
            + V
Sbjct  268  LPV  270


 Score =   142 bits (357),  Expect(2) = 3e-101, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             +G VVVFDFDKTI+DVDSDNWV+DELGFT LF+QLL TMPWNSLMD+MM E+H+NGKTI 
Sbjct  2     SGIVVVFDFDKTIVDVDSDNWVIDELGFTDLFNQLLPTMPWNSLMDKMMMELHSNGKTIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DIE VL  +P+HPR++PAI+A H LG
Sbjct  62    DIEEVLHRIPLHPRVIPAIQAAHTLG  87



>ref|XP_011012806.1| PREDICTED: inorganic pyrophosphatase 2-like [Populus euphratica]
Length=283

 Score =   248 bits (634),  Expect(2) = 1e-100, Method: Compositional matrix adjust.
 Identities = 114/187 (61%), Positives = 145/187 (78%), Gaps = 5/187 (3%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LRIVSDAN+FFIETIL HLG+++ FSEINTNPG+VDE+ RLRI P+HDF  S H C+ 
Sbjct  95   CELRIVSDANMFFIETILNHLGLKDYFSEINTNPGFVDEQERLRISPYHDFTQSSHCCSL  154

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  IIERIQAS+ K+G K++IYLGDG GD+CPSLKL A D++MPRK+FPVW+LI
Sbjct  155  CPPNMCKGLIIERIQASISKDGSKKIIYLGDGAGDYCPSLKLTAADYVMPRKNFPVWDLI  214

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIED-----SQFLAAESKFQAISMQPCEA  314
             EN  L++AEIHEW NG + ER+L  +I RI  ++     +Q L+A+ K Q IS+   E 
Sbjct  215  SENPLLVKAEIHEWINGAELERVLLQIIERISTDEISSNSAQLLSADCKLQTISIAAHEG  274

Query  313  LPKAIRV  293
            LP+ + V
Sbjct  275  LPQPLSV  281


 Score =   147 bits (372),  Expect(2) = 1e-100, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
              G VVVFDFDKTIIDVDSDNWV+DELGFT LF+QLLHTMPWNSLMDRMMKEIH++GKTI 
Sbjct  9     GGIVVVFDFDKTIIDVDSDNWVIDELGFTDLFNQLLHTMPWNSLMDRMMKEIHSHGKTIE  68

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI  VL+ +PIHPR++ AIKA H LG
Sbjct  69    DIAEVLRRIPIHPRVISAIKAAHALG  94



>ref|XP_006426489.1| hypothetical protein CICLE_v10026096mg [Citrus clementina]
 gb|ESR39729.1| hypothetical protein CICLE_v10026096mg [Citrus clementina]
Length=321

 Score =   259 bits (661),  Expect(2) = 2e-100, Method: Compositional matrix adjust.
 Identities = 120/186 (65%), Positives = 146/186 (78%), Gaps = 4/186 (2%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LRIVSDANLFFIETIL+HLGIR+CFSEINTNPG+VDEEGRLRI PFHDF    HGC  
Sbjct  134  CELRIVSDANLFFIETILEHLGIRDCFSEINTNPGFVDEEGRLRIFPFHDFTKCSHGCNL  193

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  +IERIQAS+ KEG K++IYLGDG GD+CPSLKL  GD +MPRK+FP+W+LI
Sbjct  194  CPPNMCKGVVIERIQASLSKEGNKKIIYLGDGSGDYCPSLKLSEGDHVMPRKNFPLWDLI  253

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIED----SQFLAAESKFQAISMQPCEAL  311
              N  L++AEIHEW++GE+ E+IL HL+N I   +    +Q L+A+ K Q IS    E L
Sbjct  254  IRNPMLIKAEIHEWTDGEELEQILLHLVNTIGSTNNNNSAQLLSADCKLQTISAAAHETL  313

Query  310  PKAIRV  293
            P+ + V
Sbjct  314  PQVLSV  319


 Score =   137 bits (344),  Expect(2) = 2e-100, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             +G VV+FDFDKTIID DSDN+VVDELG T LF+QLL TMPWNSLMDRMMKE+H+ GKTI 
Sbjct  48    SGIVVIFDFDKTIIDCDSDNFVVDELGATDLFNQLLPTMPWNSLMDRMMKELHSQGKTIE  107

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI  VL+ +PIHPR+VPAIK+ H LG
Sbjct  108   DILEVLKRIPIHPRVVPAIKSAHALG  133



>ref|XP_004510353.1| PREDICTED: inorganic pyrophosphatase 2-like [Cicer arietinum]
Length=272

 Score =   258 bits (660),  Expect(2) = 4e-100, Method: Compositional matrix adjust.
 Identities = 120/183 (66%), Positives = 152/183 (83%), Gaps = 1/183 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRIVSDAN+FFI+TILKHLGI ECFSEINTNPGYV+EEGRLRILP HDF+ + HGC  
Sbjct  88   CDLRIVSDANVFFIQTILKHLGISECFSEINTNPGYVNEEGRLRILPHHDFNKASHGCTI  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  II+RIQ S+ ++  KR IYLGDG+GD+CPSL+LK  DFMMPRK+FPVW+LI
Sbjct  148  CPPNMCKGLIIDRIQNSISEDNNKRFIYLGDGVGDYCPSLRLKERDFMMPRKNFPVWDLI  207

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICI-EDSQFLAAESKFQAISMQPCEALPKA  302
             ++ SL++AEIH W +GE+ E+IL  LIN+I I E++QF++++ K Q +S+   E+LPKA
Sbjct  208  CKDPSLIKAEIHAWCDGEELEQILIQLINKILIEENAQFISSDCKLQTLSIPVHESLPKA  267

Query  301  IRV  293
            + V
Sbjct  268  LSV  270


 Score =   136 bits (342),  Expect(2) = 4e-100, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             + TV+VFDFDKTIID DSDNWVVDELGFT LF+QLL TMPWNSLMD+MM E+H+ G TI 
Sbjct  2     SNTVIVFDFDKTIIDCDSDNWVVDELGFTDLFNQLLPTMPWNSLMDKMMMELHSEGVTIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DIE+VL  +PIH RI+PAIK+ H LG
Sbjct  62    DIEKVLHRIPIHNRIIPAIKSAHALG  87



>gb|KDO58635.1| hypothetical protein CISIN_1g044553mg [Citrus sinensis]
Length=275

 Score =   258 bits (660),  Expect(2) = 4e-100, Method: Compositional matrix adjust.
 Identities = 120/186 (65%), Positives = 146/186 (78%), Gaps = 4/186 (2%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LRIVSDANLFFIETIL+HLGIR+CFSEINTNPG+VDEEGRLRI PFHDF    HGC  
Sbjct  88   CELRIVSDANLFFIETILEHLGIRDCFSEINTNPGFVDEEGRLRIFPFHDFTKCSHGCNL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  +IERIQAS+ KEG K++IYLGDG GD+CPSLKL  GD +MPRK+FP+W+LI
Sbjct  148  CPPNMCKGVVIERIQASLSKEGNKKIIYLGDGSGDYCPSLKLSEGDHVMPRKNFPLWDLI  207

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIED----SQFLAAESKFQAISMQPCEAL  311
              N  L++AEIHEW++GE+ E+IL HL+N I   +    +Q L+A+ K Q IS    E L
Sbjct  208  IRNPMLIKAEIHEWTDGEELEQILLHLVNTIGSTNNNNSAQLLSADCKLQTISAAAHETL  267

Query  310  PKAIRV  293
            P+ + V
Sbjct  268  PQVLSV  273


 Score =   136 bits (342),  Expect(2) = 4e-100, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             +G VV+FDFDKTIID DSDN+VVDELG T LF+QLL TMPWNSLMDRMMKE+H+ GKTI 
Sbjct  2     SGIVVIFDFDKTIIDCDSDNFVVDELGATDLFNQLLPTMPWNSLMDRMMKELHSQGKTIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI  VL+ +PIHPR+VPAIK+ H LG
Sbjct  62    DIVEVLKRIPIHPRVVPAIKSAHALG  87



>ref|XP_006343003.1| PREDICTED: inorganic pyrophosphatase 1-like [Solanum tuberosum]
Length=271

 Score =   257 bits (656),  Expect(2) = 5e-100, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 150/187 (80%), Gaps = 7/187 (4%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCA-  662
            CDLRIVSDAN+F+IETILKHLGI +CF+EINTNPGYVDEEG+LRILP HDFH   HGC  
Sbjct  88   CDLRIVSDANVFYIETILKHLGIYDCFTEINTNPGYVDEEGKLRILPHHDFH---HGCTF  144

Query  661  -RCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWE  485
              CPPNMCK  IIERIQAS+ KEGKKR+IYLGDG GDFCPSLKLK  DF+MPRKDFPVW+
Sbjct  145  NTCPPNMCKGLIIERIQASLAKEGKKRMIYLGDGAGDFCPSLKLKEQDFVMPRKDFPVWK  204

Query  484  LIKENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFLAAE-SKFQAISMQPC-EAL  311
            LI +NR L+ A IH WS+GE+ ++IL  +I  I IE++Q L+ +  KFQ I +    EAL
Sbjct  205  LINKNRHLIRARIHGWSDGEEQQQILLQIIKAITIEENQILSTDCCKFQTIPINTVHEAL  264

Query  310  PKAIRVP  290
            PKA+ +P
Sbjct  265  PKALPLP  271


 Score =   137 bits (345),  Expect(2) = 5e-100, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFDKTIID+DSDNWV+DELG T LF++LL TMPWNSLMDRMMKE+H  GKTI 
Sbjct  2     AGIVVVFDFDKTIIDLDSDNWVIDELGATDLFNRLLPTMPWNSLMDRMMKELHDQGKTID  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DIE+VL+ VP+ PR+VPAIKA H LG
Sbjct  62    DIEQVLKRVPVIPRVVPAIKAAHALG  87



>ref|XP_007024447.1| Pyridoxal phosphate phosphatase-related protein [Theobroma cacao]
 gb|EOY27069.1| Pyridoxal phosphate phosphatase-related protein [Theobroma cacao]
Length=274

 Score =   250 bits (638),  Expect(2) = 1e-99, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 147/188 (78%), Gaps = 7/188 (4%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LRIVSDANLFFIETIL+HLG++E FSEINTNPG+VD EGRLRI P+HDF    HGC  
Sbjct  88   CELRIVSDANLFFIETILEHLGLKEYFSEINTNPGFVDGEGRLRIFPYHDFTKCSHGCNL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  +IERIQAS+  EGKK++IYLGDG GD+CPSLKL   D+MMPRK+FPVW+LI
Sbjct  148  CPPNMCKGMVIERIQASL--EGKKKIIYLGDGSGDYCPSLKLGEADYMMPRKNFPVWDLI  205

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIED-----SQFLAAESKFQAISMQPCEA  314
              N  L++AEIHEWS+GE+ ER+L  +IN I +E+     +Q ++ + K Q IS    EA
Sbjct  206  CRNPMLIKAEIHEWSDGEELERLLLQIINIISVEENNGSSAQLISVDCKLQTISASTHEA  265

Query  313  LPKAIRVP  290
            LP+A+ VP
Sbjct  266  LPQALPVP  273


 Score =   143 bits (360),  Expect(2) = 1e-99, Method: Compositional matrix adjust.
 Identities = 69/86 (80%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFDKTIID DSDNWVVDELGFT LF+QLL TMPWNSLMDRMMKE+HA GKTI 
Sbjct  2     AGIVVVFDFDKTIIDCDSDNWVVDELGFTDLFNQLLPTMPWNSLMDRMMKELHARGKTID  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI  VL+  P+HPRIVPAIKA + LG
Sbjct  62    DIAEVLKRTPLHPRIVPAIKAANALG  87



>ref|XP_007135578.1| hypothetical protein PHAVU_010G141200g [Phaseolus vulgaris]
 gb|ESW07572.1| hypothetical protein PHAVU_010G141200g [Phaseolus vulgaris]
Length=343

 Score =   249 bits (636),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 115/181 (64%), Positives = 150/181 (83%), Gaps = 2/181 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRIVSDAN +FIETILKHLGIRE FSE+NTNPGYV+EEGRLRILP+HDF+ + HGC  
Sbjct  160  CDLRIVSDANTYFIETILKHLGIREYFSEMNTNPGYVNEEGRLRILPYHDFNKASHGCTL  219

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  +I+RIQ S+ +E  KR+IYLGDG GD+CPSL+LK  DFMMPRK+FPVW+LI
Sbjct  220  CPPNMCKGLVIKRIQDSISEED-KRLIYLGDGSGDYCPSLRLKEKDFMMPRKNFPVWDLI  278

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIE-DSQFLAAESKFQAISMQPCEALPKA  302
             ++ S+++AEIH WS+GE+ E++L  LI+++ +E +S F+ ++ K Q +S+   EALPKA
Sbjct  279  CKDPSVVKAEIHGWSDGEELEQVLLQLISKVSMEHNSPFITSDCKLQTLSLSVLEALPKA  338

Query  301  I  299
            +
Sbjct  339  L  339


 Score =   143 bits (360),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = -1

Query  1184  MAAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKT  1005
             + +G VVVFDFDKTI+DVDSDNWVVDELGFT LF+QLL TMPWN+LMD MMKE+H++GK+
Sbjct  72    IMSGIVVVFDFDKTIVDVDSDNWVVDELGFTDLFNQLLPTMPWNTLMDTMMKELHSHGKS  131

Query  1004  IGDIERVLQGVPIHPRIVPAIKAVHGLG  921
             I DIE VL  +P+HPR++PAIKA H LG
Sbjct  132   IKDIEEVLHKIPLHPRVIPAIKAAHALG  159



>ref|XP_011034250.1| PREDICTED: inorganic pyrophosphatase 2-like [Populus euphratica]
Length=277

 Score =   251 bits (641),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 114/187 (61%), Positives = 147/187 (79%), Gaps = 5/187 (3%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LRIVSDAN+FFIETILKHLG+++ FSEINTNPG+VDEEGRLRI P HDF  S HGC+ 
Sbjct  89   CELRIVSDANMFFIETILKHLGLKDYFSEINTNPGFVDEEGRLRISPHHDFTQSSHGCSL  148

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  +IERIQASM KEG K++IYLGDG GD+CPSLKL   D+MMPRK+FPVW+LI
Sbjct  149  CPPNMCKGLVIERIQASMSKEGSKKIIYLGDGAGDYCPSLKLTEVDYMMPRKNFPVWDLI  208

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIED-----SQFLAAESKFQAISMQPCEA  314
             +N  L++AEIHEW +G + ER+L  +I+RI  E+     ++  +A+ K Q +S+   + 
Sbjct  209  SKNPLLIKAEIHEWKDGAEMERVLLQIIDRISREEINSNSAKLFSADCKLQTMSIAGHDT  268

Query  313  LPKAIRV  293
            +P+A+ V
Sbjct  269  MPQALSV  275


 Score =   140 bits (354),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = -1

Query  1184  MAAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKT  1005
             MAA  VVVFDFDKTIIDVDSDNWV+DELGFT  F+QLL TMPWNSLMDRMMKE+H+NG T
Sbjct  1     MAAAIVVVFDFDKTIIDVDSDNWVIDELGFTESFNQLLPTMPWNSLMDRMMKELHSNGIT  60

Query  1004  IGDIERVLQGVPIHPRIVPAIKAVHGLG  921
             + DI  VL+ +PIHP+++ AIKA H LG
Sbjct  61    VKDIAEVLKRIPIHPQVISAIKAAHALG  88



>ref|XP_007135577.1| hypothetical protein PHAVU_010G141100g [Phaseolus vulgaris]
 gb|ESW07571.1| hypothetical protein PHAVU_010G141100g [Phaseolus vulgaris]
Length=271

 Score =   249 bits (635),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 115/181 (64%), Positives = 149/181 (82%), Gaps = 2/181 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDL+I+SDAN FFIETILKHLGIRE FSEINTNPGYV+EEGRLRILP+HDF+ + HGC  
Sbjct  88   CDLKILSDANTFFIETILKHLGIREYFSEINTNPGYVNEEGRLRILPYHDFNKASHGCTL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  +I+R+Q S+ +E  KR+IYLGDG GD+CPSL+LK  DFMMPRK+FPVW+LI
Sbjct  148  CPPNMCKGLVIKRMQDSISEE-DKRLIYLGDGSGDYCPSLRLKEKDFMMPRKNFPVWDLI  206

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIE-DSQFLAAESKFQAISMQPCEALPKA  302
              + SL++AEIH WS+GE+ E++L HLI+++ +E +S F+ ++ K Q +S+   EALPK 
Sbjct  207  CRDPSLVKAEIHGWSDGEELEQVLLHLISKVSMENNSPFITSDCKLQTLSLSGLEALPKV  266

Query  301  I  299
            +
Sbjct  267  L  267


 Score =   143 bits (360),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             +G VVVFDFDKTI+DVDSDNWVVDELGFT LF+QLL TMPWN+LMD MMKE+H++GKTI 
Sbjct  2     SGIVVVFDFDKTIVDVDSDNWVVDELGFTDLFNQLLPTMPWNTLMDTMMKELHSHGKTIN  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DIE VL  +P+HPR++PAIKA H LG
Sbjct  62    DIEEVLHKIPLHPRVIPAIKAAHALG  87



>ref|XP_006466070.1| PREDICTED: inorganic pyrophosphatase 1-like [Citrus sinensis]
Length=275

 Score =   255 bits (652),  Expect(2) = 3e-99, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 145/186 (78%), Gaps = 4/186 (2%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LRIVSDANLFFIETIL+HLGIR+CFSEINTNPG+VDEEGRLRI PFHDF    HGC  
Sbjct  88   CELRIVSDANLFFIETILEHLGIRDCFSEINTNPGFVDEEGRLRIFPFHDFTKCSHGCNL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  +IERIQAS+ KEG K++IYLGDG GD+CPSLKL  GD +MPRK+FP+W+LI
Sbjct  148  CPPNMCKGVVIERIQASLSKEGNKKIIYLGDGSGDYCPSLKLSEGDHVMPRKNFPLWDLI  207

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIED----SQFLAAESKFQAISMQPCEAL  311
              N  L++AEI EW++GE+ E+IL HL+N I   +    +Q L+A+ K Q IS    E L
Sbjct  208  IRNPMLIKAEIREWTDGEELEQILLHLVNTIGSTNNNNSAQLLSADCKLQTISAAAHETL  267

Query  310  PKAIRV  293
            P+ + V
Sbjct  268  PQVLSV  273


 Score =   136 bits (342),  Expect(2) = 3e-99, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             +G VV+FDFDKTIID DSDN+VVDELG T LF+QLL TMPWNSLMDRMMKE+H+ GKTI 
Sbjct  2     SGIVVIFDFDKTIIDCDSDNFVVDELGATDLFNQLLPTMPWNSLMDRMMKELHSQGKTIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI  VL+ +PIHPR+VPAIK+ H LG
Sbjct  62    DIVEVLKRIPIHPRVVPAIKSAHALG  87



>ref|XP_009371231.1| PREDICTED: inorganic pyrophosphatase 1-like [Pyrus x bretschneideri]
Length=269

 Score =   257 bits (657),  Expect(2) = 5e-99, Method: Compositional matrix adjust.
 Identities = 124/183 (68%), Positives = 153/183 (84%), Gaps = 4/183 (2%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRI+SDANLFFIETILKHLG+ E FSEINTNP YVDEEG LRI P+ DF +SPHGC+ 
Sbjct  88   CDLRILSDANLFFIETILKHLGLEEYFSEINTNPSYVDEEGSLRISPYCDFTNSPHGCSL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCKS IIERIQ S+  EGKKR+IYLGDG GD+CPSLKLK GDF+MPRK+FP+++LI
Sbjct  148  CPPNMCKSVIIERIQTSVSTEGKKRLIYLGDGSGDYCPSLKLKEGDFVMPRKNFPLFDLI  207

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICI-EDSQFLAAESKFQAISMQPCEALPKA  302
             +N  L++A IHEW++GE+ E+IL +LIN I I E++QF++A+ K Q IS+   EALP+A
Sbjct  208  YKNPLLIKAGIHEWTDGEELEQILLNLINSISIEENAQFISADCKLQTISV---EALPQA  264

Query  301  IRV  293
            + V
Sbjct  265  LPV  267


 Score =   133 bits (335),  Expect(2) = 5e-99, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFDKTII+ DSDNWVVDEL  T LF+QLL TMPWNSLMDRMMKE+ + GKTI 
Sbjct  2     AGIVVVFDFDKTIIECDSDNWVVDELCATDLFNQLLPTMPWNSLMDRMMKELRSQGKTIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             D   VL+  PIHPR+VPAIKA H LG
Sbjct  62    DTVEVLKRTPIHPRVVPAIKAAHALG  87



>ref|XP_007215797.1| hypothetical protein PRUPE_ppa009904mg [Prunus persica]
 gb|EMJ16996.1| hypothetical protein PRUPE_ppa009904mg [Prunus persica]
Length=272

 Score =   249 bits (636),  Expect(2) = 2e-98, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 146/183 (80%), Gaps = 1/183 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRIVSDANLFFIETIL HLG+ E FSEINTNP YVDE+GRLRI P HDF    HGC+ 
Sbjct  88   CDLRIVSDANLFFIETILNHLGLEEYFSEINTNPSYVDEQGRLRISPHHDFTKFSHGCSL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  +IERIQ S+  EGKK++IYLGDG GD+CPSLKLK GDF+MPRK+FP+++LI
Sbjct  148  CPPNMCKGVVIERIQTSVSTEGKKKIIYLGDGSGDYCPSLKLKEGDFVMPRKNFPLFDLI  207

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICI-EDSQFLAAESKFQAISMQPCEALPKA  302
             ++  L++A IHEW++GE+ E+IL  LIN I + E++QF++A+ K Q IS    EA PKA
Sbjct  208  CKDPLLIKAGIHEWTDGEELEQILLSLINTISMEENAQFISADCKLQTISASAHEAFPKA  267

Query  301  IRV  293
            + V
Sbjct  268  LPV  270


 Score =   139 bits (351),  Expect(2) = 2e-98, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFDKTII+ DSDNWVVDELG T LF+QLL TMPWNSLMDRMM+E+H+ GKTI 
Sbjct  2     AGIVVVFDFDKTIIECDSDNWVVDELGATDLFNQLLPTMPWNSLMDRMMEELHSQGKTIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI  VL+  PIHPR+VPAIKA H LG
Sbjct  62    DIAEVLKRTPIHPRVVPAIKAAHALG  87



>gb|KEH18309.1| 2,3-diketo-5-methylthio-1-phosphopentane phosphatase [Medicago 
truncatula]
Length=273

 Score =   245 bits (625),  Expect(2) = 3e-98, Method: Compositional matrix adjust.
 Identities = 115/183 (63%), Positives = 147/183 (80%), Gaps = 1/183 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRIVSDAN FFIETILK+LGI E F+EINTNPGYV+++GRLRILP+HDF+   HGC  
Sbjct  89   CDLRIVSDANTFFIETILKNLGISEYFTEINTNPGYVNQQGRLRILPYHDFNKDSHGCIL  148

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  II+RIQ +  +   KR IYLGDGIGD+CPSL+L+  DFMMPRK+FPVW+LI
Sbjct  149  CPPNMCKGLIIDRIQNTFSEGENKRFIYLGDGIGDYCPSLRLREKDFMMPRKNFPVWDLI  208

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICI-EDSQFLAAESKFQAISMQPCEALPKA  302
             ++ SL++AEIH W +GE+ E+IL  LIN+I I E++QF++++ K Q +S+   E LPKA
Sbjct  209  CKDPSLVKAEIHGWCDGEELEQILIQLINKIIIEENAQFISSDCKLQTLSIPVHETLPKA  268

Query  301  IRV  293
            + V
Sbjct  269  LSV  271


 Score =   143 bits (360),  Expect(2) = 3e-98, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = -1

Query  1184  MAAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKT  1005
             M+   VVVFDFDKTIID DSDNWV+DELGFT LF+QLL TMPWNSLMDRMM EIH+NGKT
Sbjct  1     MSNNIVVVFDFDKTIIDCDSDNWVIDELGFTDLFNQLLPTMPWNSLMDRMMMEIHSNGKT  60

Query  1004  IGDIERVLQGVPIHPRIVPAIKAVHGLG  921
             I +IE+VLQ +PIH RI+PAIK+ H LG
Sbjct  61    IEEIEKVLQRIPIHHRIIPAIKSAHALG  88



>ref|XP_003531627.1| PREDICTED: inorganic pyrophosphatase 2 [Glycine max]
Length=262

 Score =   245 bits (625),  Expect(2) = 5e-98, Method: Compositional matrix adjust.
 Identities = 114/173 (66%), Positives = 145/173 (84%), Gaps = 3/173 (2%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRIVSDAN+FFIETILKHLGIRE FSEINTNPGYV+EEGRLRI P HDF+ + HGC+ 
Sbjct  88   CDLRIVSDANVFFIETILKHLGIREYFSEINTNPGYVNEEGRLRIQPCHDFNKASHGCSL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  II+RIQ S+ +EG KR+IYLGDG GD+CPSL+LK  +FMMPRK+FPVW+LI
Sbjct  148  CPPNMCKGLIIDRIQDSISQEGNKRMIYLGDGSGDYCPSLRLKERNFMMPRKNFPVWDLI  207

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIEDS---QFLAAESKFQAISM  329
             ++  L++AEIH WS+GE+ E++L HLIN+I +E++   Q +A++ K Q +S+
Sbjct  208  CKDPLLVKAEIHGWSDGEELEQVLLHLINKISMEENVHEQLIASDCKLQTLSV  260


 Score =   142 bits (359),  Expect(2) = 5e-98, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             +G VVVFDFDKTI+DVDSDNWVVD+LGFT LF+QLL TMPWNSLMDRMM E+H+NGKTI 
Sbjct  2     SGIVVVFDFDKTIVDVDSDNWVVDDLGFTDLFNQLLPTMPWNSLMDRMMMELHSNGKTIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DIE VL  +P+HPR++PAI+A H LG
Sbjct  62    DIEEVLHRIPLHPRVIPAIQAAHALG  87



>ref|XP_004297609.1| PREDICTED: inorganic pyrophosphatase 1-like [Fragaria vesca subsp. 
vesca]
Length=272

 Score =   252 bits (644),  Expect(2) = 5e-98, Method: Compositional matrix adjust.
 Identities = 124/185 (67%), Positives = 150/185 (81%), Gaps = 5/185 (3%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LRIVSDANLFFIETILKHLG+ E FSEINTNPGYVDEEGR+RI PF DF +S HGC+ 
Sbjct  88   CELRIVSDANLFFIETILKHLGLEEYFSEINTNPGYVDEEGRVRISPFCDFTNSSHGCSL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCKS IIERIQAS   EG+KR+IYLGDG+GD+CPSLKLK GDF+MPRK+FP+++ I
Sbjct  148  CPPNMCKSVIIERIQAS--TEGRKRMIYLGDGVGDYCPSLKLKEGDFVMPRKNFPLFDKI  205

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIED---SQFLAAESKFQAISMQPCEALP  308
             +N   L+AEIHEW++GE+ E IL +LIN I IE+   +QF+  + K Q IS+   EA P
Sbjct  206  CQNPLALKAEIHEWTDGEELEHILLNLINTIAIEENTAAQFITTDCKLQTISVSGHEAFP  265

Query  307  KAIRV  293
            KA+ V
Sbjct  266  KALPV  270


 Score =   135 bits (339),  Expect(2) = 5e-98, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFDKTIID DSDNWVVD LG T LF+QLL TMPWNSLMD MMKE+H+ GKTI 
Sbjct  2     AGVVVVFDFDKTIIDCDSDNWVVDGLGATDLFNQLLPTMPWNSLMDEMMKELHSQGKTID  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI  VL+  PIHPRIVPAIKA H  G
Sbjct  62    DIVEVLKRTPIHPRIVPAIKAAHASG  87



>ref|XP_007135575.1| hypothetical protein PHAVU_010G140900g [Phaseolus vulgaris]
 gb|ESW07569.1| hypothetical protein PHAVU_010G140900g [Phaseolus vulgaris]
Length=271

 Score =   246 bits (629),  Expect(2) = 5e-98, Method: Compositional matrix adjust.
 Identities = 114/181 (63%), Positives = 149/181 (82%), Gaps = 2/181 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRI+SDAN +FIETILKHLGIRE FSEINTNPGYV+EEGRLRILP+HDF+ + HGC  
Sbjct  88   CDLRILSDANTYFIETILKHLGIREYFSEINTNPGYVNEEGRLRILPYHDFNKASHGCTL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  +I+R+Q S+ +E  KR+IYLGDG GD+CPSL+LK  DFMMPRK+FPVW+LI
Sbjct  148  CPPNMCKGLVIKRMQDSISEE-DKRLIYLGDGSGDYCPSLRLKEKDFMMPRKNFPVWDLI  206

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIE-DSQFLAAESKFQAISMQPCEALPKA  302
             ++ S+++AEIH WS+GE+ E++L  LI+++ +E  S F+ ++ K Q +S+   EALPKA
Sbjct  207  CKDPSVVKAEIHGWSDGEELEQVLLQLISKVSMEHKSPFITSDCKLQTLSLSVLEALPKA  266

Query  301  I  299
            +
Sbjct  267  L  267


 Score =   140 bits (354),  Expect(2) = 5e-98, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             +G VVVFDFDKTI+DVDSDNWVVDELGFT LF+QLL TMPWN+LMD MMKE+H++GK++ 
Sbjct  2     SGIVVVFDFDKTIVDVDSDNWVVDELGFTDLFNQLLPTMPWNTLMDTMMKELHSHGKSMK  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DIE VL  +P+HPR++PAIKA H LG
Sbjct  62    DIEEVLHKIPLHPRVIPAIKAAHALG  87



>ref|XP_008228322.1| PREDICTED: inorganic pyrophosphatase 1-like [Prunus mume]
Length=273

 Score =   248 bits (632),  Expect(2) = 6e-98, Method: Compositional matrix adjust.
 Identities = 120/184 (65%), Positives = 147/184 (80%), Gaps = 2/184 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRIVSDANLFFIETILKHLG+ E FSEINTNP YVDEEGRLRI P HDF    HGC+ 
Sbjct  88   CDLRIVSDANLFFIETILKHLGLEEYFSEINTNPSYVDEEGRLRIFPHHDFTKFSHGCSS  147

Query  658  -CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWEL  482
             CPPNMCK  +IERIQ S+  EGKK++IYLGDG GD+CPSLKLK GDF+MPRK+FP+++L
Sbjct  148  PCPPNMCKGAVIERIQTSVCTEGKKKIIYLGDGSGDYCPSLKLKEGDFVMPRKNFPLFDL  207

Query  481  IKENRSLLEAEIHEWSNGEDFERILFHLINRICI-EDSQFLAAESKFQAISMQPCEALPK  305
            I ++  L++A IHEW++GE+ E+IL  LIN I + E++QF++A+ K Q IS    EA PK
Sbjct  208  ICKDPLLIKAGIHEWTDGEELEQILLSLINTISMEENAQFISADCKLQTISASAHEAFPK  267

Query  304  AIRV  293
            A+ V
Sbjct  268  ALPV  271


 Score =   139 bits (350),  Expect(2) = 6e-98, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFDKTII+ DSDNWVVDELG T LF+QLL TMPWNSLMDRMMKE+H+ GKTI 
Sbjct  2     AGIVVVFDFDKTIIECDSDNWVVDELGATDLFNQLLPTMPWNSLMDRMMKELHSQGKTIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI  VL+  PIHPR+VPAIK  H LG
Sbjct  62    DIAEVLKRTPIHPRVVPAIKTAHALG  87



>ref|XP_006343004.1| PREDICTED: inorganic pyrophosphatase 1-like [Solanum tuberosum]
Length=272

 Score =   249 bits (636),  Expect(2) = 8e-98, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 150/188 (80%), Gaps = 8/188 (4%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCA-  662
            CDLRIVSDAN+F+IETILKHLGI +CF+EINTNPGYVDE+G+LRILP+HD +   HGC+ 
Sbjct  88   CDLRIVSDANVFYIETILKHLGIHDCFTEINTNPGYVDEQGKLRILPYHDVY---HGCSF  144

Query  661  -RCPPNMCKSKIIERIQASMGKEG-KKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVW  488
              CPPNMCK  +IERIQAS+ KE  KKR+IYLGDG GDFCPSLKLK  DF+MPRKDFPVW
Sbjct  145  NTCPPNMCKGLVIERIQASLAKEDRKKRIIYLGDGAGDFCPSLKLKEQDFVMPRKDFPVW  204

Query  487  ELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFLAAE-SKFQAISMQPC-EA  314
            +LI ENR L+ A IH WS+GE+ ++IL  +I  I IE++Q L+ +  KFQ I +    EA
Sbjct  205  KLINENRHLIRARIHGWSDGEEQQQILLQIITAITIEENQILSTDCCKFQTIPINTVHEA  264

Query  313  LPKAIRVP  290
            LPKA+ +P
Sbjct  265  LPKALPLP  272


 Score =   137 bits (346),  Expect(2) = 8e-98, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFDKTIID+DSDNWV+DELG T LF++LL TMPWNSLMDRMMKE+H  GKTI 
Sbjct  2     AGIVVVFDFDKTIIDLDSDNWVIDELGATDLFNRLLPTMPWNSLMDRMMKELHDQGKTID  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DIE+VL+ VP+ PR+VPAIKA H LG
Sbjct  62    DIEQVLKRVPVIPRVVPAIKAAHALG  87



>ref|XP_007135574.1| hypothetical protein PHAVU_010G140800g [Phaseolus vulgaris]
 gb|ESW07568.1| hypothetical protein PHAVU_010G140800g [Phaseolus vulgaris]
Length=271

 Score =   251 bits (641),  Expect(2) = 9e-98, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 153/183 (84%), Gaps = 2/183 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRIVSDANLFFIE+ILKHLGIRE FSEINTNPGYV+EEGRLRILP HDF+ SPHGC+ 
Sbjct  88   CDLRIVSDANLFFIESILKHLGIREYFSEINTNPGYVNEEGRLRILPCHDFNRSPHGCSL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  +I+R+Q S+ +E  KR+IYLGDG GD+CPSL+LK  DFMMPRK+FPVW+LI
Sbjct  148  CPPNMCKGLVIKRMQDSISEE-DKRLIYLGDGSGDYCPSLRLKEKDFMMPRKNFPVWDLI  206

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIE-DSQFLAAESKFQAISMQPCEALPKA  302
              + S ++AEIH WS+GE+ E++L HLI+++ +E +S F++++ K Q +S+   EA+PKA
Sbjct  207  CRDPSAVKAEIHGWSDGEELEQVLLHLISKVSMEHNSPFISSDCKLQILSVSAHEAIPKA  266

Query  301  IRV  293
            + V
Sbjct  267  LPV  269


 Score =   135 bits (341),  Expect(2) = 9e-98, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = -1

Query  1169  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  990
             VVVFDFDKTI+DVDSDNWV+DELGFT LF+QLL TMPWN+LMD+MM E+H+ GKTI DIE
Sbjct  5     VVVFDFDKTIVDVDSDNWVIDELGFTDLFNQLLPTMPWNTLMDKMMMELHSQGKTIKDIE  64

Query  989   RVLQGVPIHPRIVPAIKAVHGLG  921
              VL  +P+HPR++PA+KA H  G
Sbjct  65    EVLHKIPLHPRVIPAVKAAHASG  87



>ref|XP_008462365.1| PREDICTED: inorganic pyrophosphatase 2-like [Cucumis melo]
Length=353

 Score =   251 bits (640),  Expect(2) = 1e-97, Method: Compositional matrix adjust.
 Identities = 123/185 (66%), Positives = 144/185 (78%), Gaps = 6/185 (3%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRIVSDAN+FFIETIL HLGIRECFSEINTNPGYVDEEGRLRI P HDFH S HGC  
Sbjct  168  CDLRIVSDANMFFIETILDHLGIRECFSEINTNPGYVDEEGRLRIFPIHDFHKSSHGCNL  227

Query  658  CPPNMCKSKIIERIQASMGKEG-KKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWEL  482
            CPPNMCK  ++ERIQAS+  EG KKR IYLGDG GD+CPSLKL  GDF+MPRK+FP+W+L
Sbjct  228  CPPNMCKGLVMERIQASLMAEGKKKRFIYLGDGSGDYCPSLKLGEGDFLMPRKNFPLWDL  287

Query  481  IKENRSLLEAEIHEWSNGEDFERILFHLINRICI-EDSQFLAAESKFQAISMQPCEALPK  305
            I +N  +++AEIHEWS+GE+  RIL +LI  I + E++QFLA     Q + +   EALP 
Sbjct  288  ISQNPLVIKAEIHEWSDGEELARILLNLIKTISMAENAQFLAP----QDMGVPVYEALPS  343

Query  304  AIRVP  290
                P
Sbjct  344  PTPKP  348


 Score =   135 bits (341),  Expect(2) = 1e-97, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFDKTIID+DSDNWVVDELG T LF++LL TMPWNSLMDRMM E+HA GKTI 
Sbjct  82    AGIVVVFDFDKTIIDLDSDNWVVDELGATDLFNELLPTMPWNSLMDRMMAELHAQGKTID  141

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI  VL+  PIHP +VPAI+A H LG
Sbjct  142   DIVEVLKRAPIHPDVVPAIRAAHALG  167



>ref|XP_010062595.1| PREDICTED: inorganic pyrophosphatase 2-like [Eucalyptus grandis]
 gb|KCW69736.1| hypothetical protein EUGRSUZ_F03119 [Eucalyptus grandis]
 gb|KCW69737.1| hypothetical protein EUGRSUZ_F03119 [Eucalyptus grandis]
Length=276

 Score =   257 bits (657),  Expect(2) = 1e-97, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 148/188 (79%), Gaps = 5/188 (3%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLR+VSDANLF+IETIL HLGIRECFSEINTNPG+VDE+GRLRI PFHDF SS HGC  
Sbjct  88   CDLRVVSDANLFYIETILNHLGIRECFSEINTNPGFVDEQGRLRISPFHDFKSSSHGCGL  147

Query  658  CPPNMCKSKIIERIQASMGKEG-KKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWEL  482
            CPPNMCK  +IERIQA++  EG KKR IYLGDG GD+CPSLKL  GDFMMPRK++PVW+L
Sbjct  148  CPPNMCKGVVIERIQAAVSAEGKKKRFIYLGDGNGDYCPSLKLSEGDFMMPRKNYPVWDL  207

Query  481  IKENRSLLEAEIHEWSNGEDFERILFHLINRIC----IEDSQFLAAESKFQAISMQPCEA  314
            I  N  LL+AEIHEW++GE+ ER+L  L+N I     I+  Q ++++ K Q I++   EA
Sbjct  208  ICRNPMLLKAEIHEWTDGEELERVLLQLVNAIITGEEIKSGQLISSDCKMQNIALSAHEA  267

Query  313  LPKAIRVP  290
            L  A+ VP
Sbjct  268  LLPALPVP  275


 Score =   129 bits (323),  Expect(2) = 1e-97, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             A  VV+FDFDKTIID DSDNWVVDELGFT +F++LL TMPWN+LMD+MM E+HA G TI 
Sbjct  2     ADIVVLFDFDKTIIDCDSDNWVVDELGFTDMFNELLPTMPWNTLMDKMMGELHARGITIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
              I  VL+  PIHPRIVPAIK++H LG
Sbjct  62    QIADVLKRAPIHPRIVPAIKSIHALG  87



>ref|XP_006385338.1| hypothetical protein POPTR_0003s02940g [Populus trichocarpa]
 gb|ERP63135.1| hypothetical protein POPTR_0003s02940g [Populus trichocarpa]
Length=283

 Score =   246 bits (628),  Expect(2) = 2e-97, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 144/187 (77%), Gaps = 5/187 (3%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LRIVSDAN+FFIETIL HLG+++ FSEINTNPG+VDE+ RLRI P+HDF  S H C+ 
Sbjct  95   CELRIVSDANMFFIETILNHLGLKDYFSEINTNPGFVDEQERLRISPYHDFTQSSHCCSL  154

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  IIERIQAS+ K+G K++IYLGDG GD+CPSLKL   D++MPRK+FPVW+LI
Sbjct  155  CPPNMCKGLIIERIQASISKDGSKKIIYLGDGAGDYCPSLKLTEADYVMPRKNFPVWDLI  214

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIED-----SQFLAAESKFQAISMQPCEA  314
             EN  L++AEIHEW NG + ER+L  +I RI  ++     +Q L+A+ K Q IS+   E 
Sbjct  215  SENPLLVKAEIHEWINGAELERVLLQIIERISTDEISSNSAQLLSADCKLQTISIAAHEG  274

Query  313  LPKAIRV  293
            LP+ + V
Sbjct  275  LPQPLSV  281


 Score =   139 bits (351),  Expect(2) = 2e-97, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -1

Query  1160  FDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIERVL  981
             FDFDKTIIDVDSDNWV+DELGFT LF+QLLHTMPWNSLMDRMMKEIH++GKTI DI  VL
Sbjct  15    FDFDKTIIDVDSDNWVIDELGFTDLFNQLLHTMPWNSLMDRMMKEIHSHGKTIEDIAEVL  74

Query  980   QGVPIHPRIVPAIKAVHGLG  921
             + +PIHP+++ AIKA H LG
Sbjct  75    RRIPIHPQVISAIKAAHALG  94



>ref|XP_006343002.1| PREDICTED: inorganic pyrophosphatase 1-like [Solanum tuberosum]
Length=275

 Score =   256 bits (654),  Expect(2) = 2e-97, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 153/188 (81%), Gaps = 8/188 (4%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCA-  662
            CDLRIVSDAN+F+IETILKHLGI +CF+EINTNPGYVDE+G+LRILP+HD H   HGC+ 
Sbjct  88   CDLRIVSDANVFYIETILKHLGIHDCFTEINTNPGYVDEQGKLRILPYHDVH---HGCSF  144

Query  661  -RCPPNMCKSKIIERIQASMGKEG-KKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVW  488
              CPPNMCK  +IERIQAS+ KE  KKR+IYLGDG GDFCPSLKLK  DF+MPRKDFPVW
Sbjct  145  NTCPPNMCKGLVIERIQASLAKEDRKKRIIYLGDGAGDFCPSLKLKEQDFVMPRKDFPVW  204

Query  487  ELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFLAAESKFQ-AISMQPC-EA  314
            +LI +NR+L+ AEIH WS+GE+ + IL  +I  I IE++QFL+ ESKFQ  I +    EA
Sbjct  205  KLINDNRNLIRAEIHGWSDGEEQQHILLQIIKAITIEENQFLSDESKFQTTIPINAVHEA  264

Query  313  LPKAIRVP  290
            +PKA+ +P
Sbjct  265  MPKALPLP  272


 Score =   129 bits (324),  Expect(2) = 2e-97, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFDKTII +DSDNWV+DELG T LF++LL TMPWNSLMDRMMKE+H   KTI 
Sbjct  2     AGIVVVFDFDKTIIGLDSDNWVIDELGATDLFNRLLPTMPWNSLMDRMMKELHDQRKTID  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DIE+VL+ VP+ PR+VPAIKA H  G
Sbjct  62    DIEQVLKRVPVIPRVVPAIKAAHASG  87



>ref|XP_007135576.1| hypothetical protein PHAVU_010G141000g [Phaseolus vulgaris]
 gb|ESW07570.1| hypothetical protein PHAVU_010G141000g [Phaseolus vulgaris]
Length=271

 Score =   246 bits (629),  Expect(2) = 2e-97, Method: Compositional matrix adjust.
 Identities = 115/181 (64%), Positives = 148/181 (82%), Gaps = 2/181 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRIVSDAN +FIETILKHLGIRE FSE+NTNPGYV+EEGRLRILP+HDF+ + HGC  
Sbjct  88   CDLRIVSDANTYFIETILKHLGIREYFSEMNTNPGYVNEEGRLRILPYHDFNKASHGCTL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  +I+RIQ S+ +E  KR+IYLGDG GD+CPSL+LK  DFMMPRK+FPVW+LI
Sbjct  148  CPPNMCKGLVIKRIQDSISEE-DKRMIYLGDGSGDYCPSLRLKEKDFMMPRKNFPVWDLI  206

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIE-DSQFLAAESKFQAISMQPCEALPKA  302
             ++ S+++AEIH WS+ E+ E++L  LIN+I +E +S F++++ K Q +S    EALPK 
Sbjct  207  CKDPSVVKAEIHGWSDAEELEQVLLQLINKISMEHNSPFVSSDCKLQTLSASVLEALPKG  266

Query  301  I  299
            +
Sbjct  267  L  267


 Score =   139 bits (349),  Expect(2) = 2e-97, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             +G VVVFDFDKTI+DVDSDNWVVDELGFT LF+QLL TMPWN+LMD MMKE+H++GK++ 
Sbjct  2     SGIVVVFDFDKTIVDVDSDNWVVDELGFTDLFNQLLPTMPWNTLMDTMMKELHSHGKSMK  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DIE VL  +P+HPR++PAIK  H LG
Sbjct  62    DIEEVLHKIPLHPRVIPAIKVAHALG  87



>gb|ADG23055.1| haloacid dehalogenase [Phaseolus vulgaris]
Length=271

 Score =   250 bits (638),  Expect(2) = 2e-97, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 152/183 (83%), Gaps = 2/183 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRIVSDANLFFIE+ILKHLGIRE FSEINTNPGYV+EEGRLRILP HDF+ SPHGC+ 
Sbjct  88   CDLRIVSDANLFFIESILKHLGIREYFSEINTNPGYVNEEGRLRILPCHDFNRSPHGCSL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  +I+R+Q S+ +E  KR+IYLGDG GD+CPSL+LK  DFMMPRK+FPVW LI
Sbjct  148  CPPNMCKGLVIKRMQDSISEE-DKRLIYLGDGSGDYCPSLRLKEKDFMMPRKNFPVWALI  206

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIE-DSQFLAAESKFQAISMQPCEALPKA  302
              + S ++AEIH WS+GE+ E++L HLI+++ +E +S F++++ K Q +S+   EA+PKA
Sbjct  207  CRDPSAVKAEIHGWSDGEELEQVLVHLISKVSMEHNSPFISSDCKLQILSVSAHEAIPKA  266

Query  301  IRV  293
            + V
Sbjct  267  LPV  269


 Score =   135 bits (341),  Expect(2) = 2e-97, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = -1

Query  1169  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  990
             VVVFDFDKTI+DVDSDNWV+DELGFT LF+QLL TMPWN+LMD+MM E+H+ GKTI DIE
Sbjct  5     VVVFDFDKTIVDVDSDNWVIDELGFTDLFNQLLPTMPWNTLMDKMMMELHSQGKTIKDIE  64

Query  989   RVLQGVPIHPRIVPAIKAVHGLG  921
              VL  +P+HPR++PA+KA H  G
Sbjct  65    EVLHKIPLHPRVIPAVKAAHASG  87



>ref|XP_006343005.1| PREDICTED: inorganic pyrophosphatase 1-like [Solanum tuberosum]
Length=272

 Score =   247 bits (631),  Expect(2) = 3e-97, Method: Compositional matrix adjust.
 Identities = 124/188 (66%), Positives = 148/188 (79%), Gaps = 8/188 (4%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCA-  662
            CDLRIVSDAN+F+IETILKH+GI +CF+EINTNPGYVDEE +LRILP HD H   HGC  
Sbjct  88   CDLRIVSDANVFYIETILKHIGIYDCFTEINTNPGYVDEEKKLRILPHHDLH---HGCTL  144

Query  661  -RCPPNMCKSKIIERIQASMGKEG-KKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVW  488
              CPPNMCK  IIERIQAS+ KE  KKR+IYLGDG GDFCPSLKLK  DF+MPRKDFPVW
Sbjct  145  NTCPPNMCKGLIIERIQASLAKEDRKKRIIYLGDGAGDFCPSLKLKEQDFVMPRKDFPVW  204

Query  487  ELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFLAAE-SKFQAISMQPC-EA  314
            +LI +NR+L+ AEIH WS+GE+ + IL  +I  I IE++Q L+ +  KFQ I +    EA
Sbjct  205  KLINDNRNLIRAEIHGWSDGEEQQHILLQIIKAITIEENQILSVDCCKFQTIPINTVHEA  264

Query  313  LPKAIRVP  290
            LPKA+ +P
Sbjct  265  LPKALPLP  272


 Score =   137 bits (346),  Expect(2) = 3e-97, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFDKTIID+DSDNWV+DELG T LF++LL TMPWNSLMDRMMKE+H  GKTI 
Sbjct  2     AGIVVVFDFDKTIIDLDSDNWVIDELGATDLFNRLLPTMPWNSLMDRMMKELHDQGKTID  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DIE+VL+ VP+ PR+VPAIKA H LG
Sbjct  62    DIEQVLKRVPVIPRVVPAIKAAHALG  87



>gb|KHN11302.1| Inorganic pyrophosphatase 2 [Glycine soja]
Length=262

 Score =   242 bits (617),  Expect(2) = 4e-97, Method: Compositional matrix adjust.
 Identities = 112/173 (65%), Positives = 144/173 (83%), Gaps = 3/173 (2%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRIVSDAN+FFIETILKHLGIRE FSEINTNPGYV+EEGRLRI P HDF+ + HGC+ 
Sbjct  88   CDLRIVSDANVFFIETILKHLGIREYFSEINTNPGYVNEEGRLRIQPCHDFNKASHGCSL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  II+RIQ S+ +E  +R+IYLGDG GD+CPSL+LK  +FMMPRK+FPVW+LI
Sbjct  148  CPPNMCKGLIIDRIQDSISQESNRRMIYLGDGSGDYCPSLRLKERNFMMPRKNFPVWDLI  207

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIEDS---QFLAAESKFQAISM  329
             ++  L++AEIH WS+GE+ E++L HLIN+I +E++   Q +A++ K Q +S+
Sbjct  208  CKDPLLVKAEIHGWSDGEELEQVLLHLINKISMEENVHEQLIASDCKLQTLSV  260


 Score =   142 bits (359),  Expect(2) = 4e-97, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             +G VVVFDFDKTI+DVDSDNWVVD+LGFT LF+QLL TMPWNSLMDRMM E+H+NGKTI 
Sbjct  2     SGIVVVFDFDKTIVDVDSDNWVVDDLGFTDLFNQLLPTMPWNSLMDRMMMELHSNGKTIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DIE VL  +P+HPR++PAI+A H LG
Sbjct  62    DIEEVLHRIPLHPRVIPAIQAAHALG  87



>gb|ABP52095.1| putative phosphatase [Phaseolus vulgaris]
Length=271

 Score =   242 bits (617),  Expect(2) = 7e-97, Method: Compositional matrix adjust.
 Identities = 112/181 (62%), Positives = 148/181 (82%), Gaps = 2/181 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRIVSDAN +FIETILKHLGI+E FSE+NTNPGYV+EEGRLRILP+HDF+ + HGC  
Sbjct  88   CDLRIVSDANTYFIETILKHLGIKEYFSEMNTNPGYVNEEGRLRILPYHDFNKASHGCTL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  +I+RIQ S+ +E  KR+IYLGDG GD+CPSL+L   DFMMPRK+FPVW+LI
Sbjct  148  CPPNMCKGLVIKRIQDSISEE-DKRLIYLGDGSGDYCPSLRLIEKDFMMPRKNFPVWDLI  206

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIE-DSQFLAAESKFQAISMQPCEALPKA  302
             ++ S+++AE H WS+GE+ E++L  LI+++ +E +S F+ ++ K Q +S+   EALPKA
Sbjct  207  CKDPSVVKAENHGWSDGEELEQVLLQLISKVSMEHNSPFITSDCKLQTLSLSVLEALPKA  266

Query  301  I  299
            +
Sbjct  267  L  267


 Score =   142 bits (357),  Expect(2) = 7e-97, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             +G VVVFDFDKTI+DVDSDNWVVDELGFT LF+QLL TMPWN+LMD MMKE+H++GK+I 
Sbjct  2     SGIVVVFDFDKTIVDVDSDNWVVDELGFTDLFNQLLPTMPWNTLMDTMMKELHSHGKSIK  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DIE VL  +P+HPR++PAIKA H LG
Sbjct  62    DIEEVLHKIPLHPRVIPAIKAAHALG  87



>ref|XP_002527425.1| Phosphoethanolamine/phosphocholine phosphatase, putative [Ricinus 
communis]
 gb|EEF34991.1| Phosphoethanolamine/phosphocholine phosphatase, putative [Ricinus 
communis]
Length=274

 Score =   243 bits (621),  Expect(2) = 8e-97, Method: Compositional matrix adjust.
 Identities = 114/189 (60%), Positives = 147/189 (78%), Gaps = 9/189 (5%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LRIVSDANLFFIE ILKHLG+R+ FSEINTNPG+VD+EG+LRI P+HDF  S HGC+ 
Sbjct  88   CELRIVSDANLFFIEAILKHLGLRDYFSEINTNPGFVDDEGKLRIFPYHDFTQSSHGCSL  147

Query  658  CPPNMCKSKIIERIQASMGKEGK-KRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWEL  482
            CPPNMCK  IIERIQ+S+ KE K K++IYLGDG GD+CPSLKL   D++MPRK+FPVW+L
Sbjct  148  CPPNMCKGHIIERIQSSISKEDKSKKIIYLGDGAGDYCPSLKLTEADYLMPRKNFPVWDL  207

Query  481  IKENRSLLEAEIHEWSNGEDFERILFHLINRICIED-----SQFLAAESKFQAISMQPCE  317
            I  N  +++AEIHEW +GE+ ER+L  +I+ IC+E+      Q  +++ K Q +   P  
Sbjct  208  ICSNPMVIKAEIHEWIDGEELERVLIEIIDGICLEEINGSSDQLFSSDCKLQTV---PIA  264

Query  316  ALPKAIRVP  290
            ALP+A+ VP
Sbjct  265  ALPQAVPVP  273


 Score =   140 bits (352),  Expect(2) = 8e-97, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG +VVFDFDKTI+DVDSDNWV+DELGFT LF++LL TMPWNSLMDRMMKE+H+ GKTI 
Sbjct  2     AGILVVFDFDKTIVDVDSDNWVIDELGFTDLFNELLPTMPWNSLMDRMMKELHSQGKTIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             D+  VL+ +PIHPR++PAIK+ H LG
Sbjct  62    DMVEVLKRIPIHPRVIPAIKSAHALG  87



>ref|XP_002527424.1| Phosphoethanolamine/phosphocholine phosphatase, putative [Ricinus 
communis]
 gb|EEF34990.1| Phosphoethanolamine/phosphocholine phosphatase, putative [Ricinus 
communis]
Length=274

 Score =   244 bits (623),  Expect(2) = 2e-96, Method: Compositional matrix adjust.
 Identities = 114/189 (60%), Positives = 149/189 (79%), Gaps = 9/189 (5%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LRIVSDAN+FFIETILKHLG+R+ FSEINTNPG+VD+EG+LRI P++DF  S HGC+ 
Sbjct  88   CELRIVSDANVFFIETILKHLGLRDYFSEINTNPGFVDDEGKLRIFPYYDFTQSSHGCSL  147

Query  658  CPPNMCKSKIIERIQASMGKEGK-KRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWEL  482
            C PNMCK  IIERIQASM KE K K++IYLGDG GD+CPSLKL   D++MPRK+FPVW+L
Sbjct  148  CQPNMCKGHIIERIQASMSKEDKSKKIIYLGDGAGDYCPSLKLTEADYLMPRKNFPVWDL  207

Query  481  IKENRSLLEAEIHEWSNGEDFERILFHLINRICIED-----SQFLAAESKFQAISMQPCE  317
            I  N  +++AEIHEW++GE+  R+L  +I+RIC+E+      Q  +++ K Q +S+    
Sbjct  208  ICSNPMVIKAEIHEWTDGEELGRVLIEIIDRICLEERNGSSDQLFSSDCKLQTVSIA---  264

Query  316  ALPKAIRVP  290
            ALP+A+ VP
Sbjct  265  ALPQAVPVP  273


 Score =   137 bits (346),  Expect(2) = 2e-96, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG +VVFDFD TIIDVDSDNWV+DELGFT LF+QLL TMPWNSLMDRMMKE+H+ GKTI 
Sbjct  2     AGVLVVFDFDNTIIDVDSDNWVIDELGFTDLFNQLLPTMPWNSLMDRMMKELHSQGKTIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             D+  VL+ +PIHPR+V AIK+ H LG
Sbjct  62    DMVEVLKRIPIHPRVVHAIKSAHALG  87



>ref|XP_003597629.1| Pyridoxal phosphate phosphatase PHOSPHO2 [Medicago truncatula]
 ref|XP_003636428.1| Pyridoxal phosphate phosphatase PHOSPHO2 [Medicago truncatula]
 gb|AES67880.1| inorganic pyrophosphatase [Medicago truncatula]
Length=271

 Score =   249 bits (637),  Expect(2) = 4e-96, Method: Compositional matrix adjust.
 Identities = 121/183 (66%), Positives = 146/183 (80%), Gaps = 2/183 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRIVSDAN FFIETILKH GIRECFSEINTNPGYVDE GRLRILP+HD +  PH C  
Sbjct  88   CDLRIVSDANTFFIETILKHFGIRECFSEINTNPGYVDE-GRLRILPYHDLNKPPHKCNL  146

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  II RIQ S+  E  KR IYLGDG GD+CPSL+LK  DF+MPRK+FPVW+LI
Sbjct  147  CPPNMCKGLIINRIQESISCEENKRFIYLGDGSGDYCPSLRLKEKDFVMPRKNFPVWDLI  206

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIEDS-QFLAAESKFQAISMQPCEALPKA  302
             ++ SL++A+I+EWS+GED ER+L  LIN+I +E++ +F++ E K Q  S    EA+PKA
Sbjct  207  CKDPSLVKAKIYEWSDGEDQERVLHQLINKISMEETAEFISTEFKLQTPSFSTHEAMPKA  266

Query  301  IRV  293
            +RV
Sbjct  267  LRV  269


 Score =   131 bits (330),  Expect(2) = 4e-96, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             A  VVVFDFDKTI++ DSDNWVVDELGFT LF++L+ TMPWN+LMDRMM E+++NGKTI 
Sbjct  2     ANIVVVFDFDKTIVECDSDNWVVDELGFTDLFNELVPTMPWNNLMDRMMMELNSNGKTIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI +VL+ +PIHPRI+P+IKA + LG
Sbjct  62    DIVQVLKRIPIHPRIIPSIKAAYTLG  87



>ref|XP_004141676.1| PREDICTED: inorganic pyrophosphatase 2-like [Cucumis sativus]
 ref|XP_004155938.1| PREDICTED: inorganic pyrophosphatase 2-like [Cucumis sativus]
 gb|KGN45537.1| hypothetical protein Csa_7G451920 [Cucumis sativus]
Length=273

 Score =   244 bits (623),  Expect(2) = 5e-96, Method: Compositional matrix adjust.
 Identities = 119/185 (64%), Positives = 142/185 (77%), Gaps = 6/185 (3%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRIVSDAN+FFIETIL HLGIRECFSEINTNPGYVDEEGRLRI P HDF  S HGC  
Sbjct  88   CDLRIVSDANMFFIETILDHLGIRECFSEINTNPGYVDEEGRLRIFPIHDFQKSSHGCNL  147

Query  658  CPPNMCKSKIIERIQASMGKEG-KKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWEL  482
            CPPNMCK  ++ERIQAS+  EG KK+ IYLGDG GD+CPSLKL  GDF+MPRK+FP+W+L
Sbjct  148  CPPNMCKGLVMERIQASLMSEGKKKKFIYLGDGSGDYCPSLKLGEGDFLMPRKNFPLWDL  207

Query  481  IKENRSLLEAEIHEWSNGEDFERILFHLINRICI-EDSQFLAAESKFQAISMQPCEALPK  305
            I +N  +++AEIHEWS+GE+  RIL +LI  I + E++Q L+     Q + +   EALP 
Sbjct  208  ISQNPLVIKAEIHEWSDGEELARILLNLIKTISMAENAQLLSP----QNMGVPVYEALPS  263

Query  304  AIRVP  290
                P
Sbjct  264  PTPKP  268


 Score =   136 bits (343),  Expect(2) = 5e-96, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFDKTIID+DSDNWVVDELG T LF+QLL TMPWNSLMDRMM E+HA GKTI 
Sbjct  2     AGIVVVFDFDKTIIDLDSDNWVVDELGATDLFNQLLPTMPWNSLMDRMMTELHAQGKTID  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI  VL+  PIHP +VPAI+A H LG
Sbjct  62    DIVEVLKRAPIHPDVVPAIRAAHALG  87



>ref|XP_009378232.1| PREDICTED: inorganic pyrophosphatase 1-like [Pyrus x bretschneideri]
Length=267

 Score =   257 bits (656),  Expect(2) = 7e-96, Method: Compositional matrix adjust.
 Identities = 124/183 (68%), Positives = 153/183 (84%), Gaps = 4/183 (2%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRI+SDANLFFIETILKHLG+ E FSEINTNP YVDEEG LRI P+ DF +SPHGC+ 
Sbjct  86   CDLRILSDANLFFIETILKHLGLEEYFSEINTNPSYVDEEGSLRISPYCDFTNSPHGCSL  145

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCKS IIERIQ S+  EGKKR+IYLGDG GD+CPSLKLK GDF+MPRK+FP+++LI
Sbjct  146  CPPNMCKSVIIERIQTSVSTEGKKRLIYLGDGSGDYCPSLKLKEGDFVMPRKNFPLFDLI  205

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICI-EDSQFLAAESKFQAISMQPCEALPKA  302
             +N  L++A IHEW++GE+ E+IL +LIN I I E++QF++A+ K Q IS+   EALP+A
Sbjct  206  YKNPLLIKAGIHEWTDGEELEQILLNLINSISIEENAQFISADCKLQTISV---EALPQA  262

Query  301  IRV  293
            + V
Sbjct  263  LPV  265


 Score =   123 bits (309),  Expect(2) = 7e-96, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFDKTII+ DSDNWVVDEL  T LF+QLL TMPWNSLMDRMMKE+ + GKTI 
Sbjct  2     AGIVVVFDFDKTIIECDSDNWVVDELCATDLFNQLLPTMPWNSLMDRMMKELRSQGKTIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAV  933
             D   VL+  PIHPR+VPA KA 
Sbjct  62    DTVEVLKRTPIHPRVVPASKAA  83



>ref|XP_004510357.1| PREDICTED: inorganic pyrophosphatase 2-like [Cicer arietinum]
Length=272

 Score =   245 bits (626),  Expect(2) = 2e-95, Method: Compositional matrix adjust.
 Identities = 112/183 (61%), Positives = 149/183 (81%), Gaps = 1/183 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRIVSDAN+FFI+TILKHL I + FSEINTNPGYV++EGRLRILP+HDF+++ HGC  
Sbjct  88   CDLRIVSDANMFFIQTILKHLEISQYFSEINTNPGYVNQEGRLRILPYHDFNNASHGCTL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  I++RIQ+S+     KR IYLGDG GD+CP+L+LK  DFMMPRK+FPVW+LI
Sbjct  148  CPPNMCKGIIVDRIQSSISVLENKRFIYLGDGAGDYCPTLRLKERDFMMPRKNFPVWDLI  207

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICI-EDSQFLAAESKFQAISMQPCEALPKA  302
             ++ SL++AEIH W +GE+ E++L  LIN+I I E++QF++++ K Q +S+   E+LPK 
Sbjct  208  CKDPSLIKAEIHGWCDGEELEQVLIQLINKITIEENAQFISSDCKLQNLSISVLESLPKV  267

Query  301  IRV  293
            + V
Sbjct  268  LPV  270


 Score =   134 bits (336),  Expect(2) = 2e-95, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             +  V+VFDFDKTIID DSDNWV+DELGFT LF+QLL TMPWNSLMD+MM E+H+ G TI 
Sbjct  2     SNIVIVFDFDKTIIDCDSDNWVIDELGFTDLFNQLLPTMPWNSLMDKMMMELHSEGVTIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DIE+VL  +PIH RI+PAIK+ H LG
Sbjct  62    DIEKVLHRIPIHNRIIPAIKSAHALG  87



>ref|XP_003638651.1| Pyridoxal phosphate phosphatase PHOSPHO2 [Medicago truncatula]
Length=273

 Score =   245 bits (625),  Expect(2) = 2e-95, Method: Compositional matrix adjust.
 Identities = 115/183 (63%), Positives = 147/183 (80%), Gaps = 1/183 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRIVSDAN FFIETILK+LGI E F+EINTNPGYV+++GRLRILP+HDF+   HGC  
Sbjct  89   CDLRIVSDANTFFIETILKNLGISEYFTEINTNPGYVNQQGRLRILPYHDFNKDSHGCIL  148

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  II+RIQ +  +   KR IYLGDGIGD+CPSL+L+  DFMMPRK+FPVW+LI
Sbjct  149  CPPNMCKGLIIDRIQNTFSEGENKRFIYLGDGIGDYCPSLRLREKDFMMPRKNFPVWDLI  208

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICI-EDSQFLAAESKFQAISMQPCEALPKA  302
             ++ SL++AEIH W +GE+ E+IL  LIN+I I E++QF++++ K Q +S+   E LPKA
Sbjct  209  CKDPSLVKAEIHGWCDGEELEQILIQLINKIIIEENAQFISSDCKLQTLSIPVHETLPKA  268

Query  301  IRV  293
            + V
Sbjct  269  LSV  271


 Score =   134 bits (337),  Expect(2) = 2e-95, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = -1

Query  1184  MAAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKT  1005
             M+   V++FDFDKTIID DSDNW++DELGFT LF+QLL TMPWNS+MD+MM E H+NG T
Sbjct  1     MSNNIVIIFDFDKTIIDCDSDNWLIDELGFTDLFNQLLPTMPWNSVMDKMMMEFHSNGVT  60

Query  1004  IGDIERVLQGVPIHPRIVPAIKAVHGLG  921
             I +IE+VLQ +PIH RI+PAIK+ H LG
Sbjct  61    IEEIEKVLQRIPIHHRIIPAIKSAHALG  88



>gb|KHG07807.1| hypothetical protein F383_35186 [Gossypium arboreum]
Length=270

 Score =   242 bits (617),  Expect(2) = 2e-95, Method: Compositional matrix adjust.
 Identities = 113/185 (61%), Positives = 143/185 (77%), Gaps = 5/185 (3%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LRIVSDAN+FFIETIL+HLG++ECFSE+N+NP +VDEEGRLRI P+HDF  + HGC  
Sbjct  88   CELRIVSDANMFFIETILEHLGVKECFSELNSNPSFVDEEGRLRIFPYHDFTKTSHGCNL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  IIERIQA +  EGKK++IYLGDG GD+CPSL+L   D++MPRK+FPVWELI
Sbjct  148  CPPNMCKGVIIERIQACL--EGKKKIIYLGDGSGDYCPSLRLGESDYVMPRKNFPVWELI  205

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIE--DSQFLAAESKFQAISMQPCEALPK  305
              N  L++A+IHEWS+GED ER+L  +IN + +E   +Q  + + K Q IS     ALP 
Sbjct  206  CRNPMLIKADIHEWSDGEDLERVLLDIINMVSVEHNSAQLFSVDCKLQTISTSN-HALPH  264

Query  304  AIRVP  290
             + VP
Sbjct  265  VLPVP  269


 Score =   137 bits (344),  Expect(2) = 2e-95, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFDKTIID DSDNWVVDELGFT LF+QLL TMPWN+LMD MMKE+HA G TI 
Sbjct  2     AGIVVVFDFDKTIIDRDSDNWVVDELGFTDLFNQLLPTMPWNTLMDTMMKEMHAQGTTID  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI  VL+  PIHPRIVPAIK+ H LG
Sbjct  62    DIVEVLKRSPIHPRIVPAIKSAHALG  87



>gb|EYU21393.1| hypothetical protein MIMGU_mgv1a026205mg [Erythranthe guttata]
Length=273

 Score =   242 bits (617),  Expect(2) = 3e-95, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 144/187 (77%), Gaps = 8/187 (4%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRIVSDAN+FFIETIL HLGIR CFSEIN+NP YV+ EGRL I P+ DF +SPHGC  
Sbjct  88   CDLRIVSDANMFFIETILDHLGIRNCFSEINSNPSYVNGEGRLIISPYVDFLTSPHGCNL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  IIERI+A+   EGKK++IYLGDG+GDFCPSLKLK GDFMMPRKDFP W+LI
Sbjct  148  CPPNMCKGMIIERIRAN---EGKKKMIYLGDGVGDFCPSLKLKEGDFMMPRKDFPAWKLI  204

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIEDS----QFLAA-ESKFQAISMQPCEA  314
             ENR+LL+AEI EW  G   E+IL  LI +I IE++    Q L+A + KF+ I M   EA
Sbjct  205  CENRTLLKAEIFEWIGGTKLEQILIGLIEKIKIEEANNGVQLLSAVDCKFEKIPMVAHEA  264

Query  313  LPKAIRV  293
             P  +RV
Sbjct  265  FPPPLRV  271


 Score =   136 bits (343),  Expect(2) = 3e-95, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG +VVFDFDKTII+VDSDNWVVDELG T LF++LL TMPWNSLM+RMMKE+HA GKTI 
Sbjct  2     AGIMVVFDFDKTIIEVDSDNWVVDELGATDLFNELLPTMPWNSLMERMMKEMHAKGKTIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             +I+ VL+ VPIHPR+VPAIK  H LG
Sbjct  62    EIKDVLKKVPIHPRVVPAIKTAHSLG  87



>ref|XP_010088372.1| Inorganic pyrophosphatase 1 [Morus notabilis]
 gb|EXB34846.1| Inorganic pyrophosphatase 1 [Morus notabilis]
Length=270

 Score =   246 bits (627),  Expect(2) = 4e-95, Method: Compositional matrix adjust.
 Identities = 118/185 (64%), Positives = 146/185 (79%), Gaps = 7/185 (4%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGC-A  662
            CDLRIVSDANLFFIETIL+HLG+R+CFSEINTNPG+VDEEGRLRILPFHDF+   HGC  
Sbjct  88   CDLRIVSDANLFFIETILEHLGLRDCFSEINTNPGFVDEEGRLRILPFHDFNKGSHGCPG  147

Query  661  RCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWEL  482
             CPPNMCK  I+ERIQAS+  EG KR+IYLGDG+GD+CPSL+LK  DF+MPRK+FPVW+L
Sbjct  148  LCPPNMCKGVILERIQASLA-EGNKRLIYLGDGVGDYCPSLRLKEADFVMPRKNFPVWDL  206

Query  481  IKENRSLLEAEIHEWSNGEDFERILFHLINRICIED--SQFLAAESKFQAISMQPCEALP  308
            I +N  L++A+IHEW++GE+ E+IL  LI  I  E   + F++ + +   I   P  ALP
Sbjct  207  ISKNPLLIKAKIHEWTDGEELEKILLSLIETISFEKNAAAFISTDYRLPTI---PVSALP  263

Query  307  KAIRV  293
            K + V
Sbjct  264  KVLPV  268


 Score =   132 bits (332),  Expect(2) = 4e-95, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             A  +VVFDFDKTII+ DSDNWVV+ELG+T LF+QLL TMPWNSLMDRMMKE+H  GKTI 
Sbjct  2     ADIIVVFDFDKTIIECDSDNWVVEELGYTDLFNQLLPTMPWNSLMDRMMKELHELGKTIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI  VL+  PIHPR+VPAI A H LG
Sbjct  62    DIVEVLKRTPIHPRVVPAITAAHALG  87



>gb|AFK36724.1| unknown [Lotus japonicus]
Length=272

 Score =   238 bits (608),  Expect(2) = 8e-95, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 148/184 (80%), Gaps = 3/184 (2%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGC-A  662
            CDLRIVSDAN+FFIETIL+HL I+E FSEINTNPGYV EEGRLRILP+HDF+ +PHGC  
Sbjct  88   CDLRIVSDANMFFIETILEHLKIKEYFSEINTNPGYV-EEGRLRILPYHDFNKAPHGCCG  146

Query  661  RCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWEL  482
             CPPNMCK  II+RIQ S  ++  K++IYLGDG GD+CPSL+LK  DFMMPRK+FPVW+L
Sbjct  147  LCPPNMCKGLIIDRIQDSFSQDDDKKIIYLGDGAGDYCPSLRLKQRDFMMPRKNFPVWDL  206

Query  481  IKENRSLLEAEIHEWSNGEDFERILFHLINRICIE-DSQFLAAESKFQAISMQPCEALPK  305
            I ++ SLL+AEIH W++GE+ E++L  LI++I +E D+ F++++ K Q + +   E LPK
Sbjct  207  ICKDPSLLKAEIHGWTDGEELEQVLLQLISQISMEKDALFMSSDCKTQTLLISAHEPLPK  266

Query  304  AIRV  293
             + V
Sbjct  267  VLHV  270


 Score =   138 bits (348),  Expect(2) = 8e-95, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             +G VVVFDFDKTIID+DSDNWVVDELGFT LF+QLL TMPWNSLMD+MM E+H+ G TI 
Sbjct  2     SGIVVVFDFDKTIIDIDSDNWVVDELGFTDLFNQLLPTMPWNSLMDKMMMELHSKGVTIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             +IE VL  +PIHPR++PAIKA H LG
Sbjct  62    EIEEVLHRIPIHPRVIPAIKAAHALG  87



>ref|XP_007216440.1| hypothetical protein PRUPE_ppa021956mg [Prunus persica]
 gb|EMJ17639.1| hypothetical protein PRUPE_ppa021956mg [Prunus persica]
Length=271

 Score =   236 bits (603),  Expect(2) = 8e-95, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 146/184 (79%), Gaps = 4/184 (2%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDL+IVSDANLFFIETILKHLG+ E FSEINTNP YVDE+GR+RI P HDF    HGC+ 
Sbjct  88   CDLKIVSDANLFFIETILKHLGLEEYFSEINTNPSYVDEQGRVRISPHHDFIKCSHGCSL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  +IER+Q S+  EGKK++IYLGDG GD+CPSLKLK  DF+MPRK+FP+++LI
Sbjct  148  CPPNMCKGVVIERVQTSLSSEGKKKIIYLGDGSGDYCPSLKLKEVDFVMPRKNFPLFDLI  207

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICI-EDSQFL-AAESKFQAISMQPCEALPK  305
             ++  L++A+IHEW++GE+ E IL +LIN I   E++QF+ AA+   Q +S    EALP+
Sbjct  208  CKDPLLIKADIHEWTDGEELEHILLNLINTIATEENAQFISAADCNLQTMSAH--EALPQ  265

Query  304  AIRV  293
            A+ V
Sbjct  266  ALPV  269


 Score =   140 bits (352),  Expect(2) = 8e-95, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFDKTII+ DSDNWVVDELG T LF+QLL TMPWNSLMDRMMKE+H+ GKTI 
Sbjct  2     AGIVVVFDFDKTIIECDSDNWVVDELGATDLFNQLLPTMPWNSLMDRMMKELHSQGKTIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI  VL+  PIHPR+VPAIKA H LG
Sbjct  62    DIVEVLKRTPIHPRVVPAIKAAHALG  87



>ref|XP_002280889.1| PREDICTED: inorganic pyrophosphatase 2 [Vitis vinifera]
 emb|CBI35974.3| unnamed protein product [Vitis vinifera]
Length=273

 Score =   234 bits (598),  Expect(2) = 9e-95, Method: Compositional matrix adjust.
 Identities = 114/191 (60%), Positives = 144/191 (75%), Gaps = 14/191 (7%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDL+IVSDANLFFIETILKHLG+ +CFSEINTNP +VDEEGRLRI P HDF SS HGC+ 
Sbjct  88   CDLKIVSDANLFFIETILKHLGVMDCFSEINTNPSFVDEEGRLRIFPHHDFTSSSHGCSL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  +I+RIQAS+  E   + IYLGDG GDFCPSLKL  GD++MPRK+FP+W+LI
Sbjct  148  CPPNMCKGMVIKRIQASISTE---KFIYLGDGSGDFCPSLKLGDGDYVMPRKNFPLWDLI  204

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRI--------CIEDSQFLAAESKFQAISMQP  323
              N +L++AE+HEWS+GE+ E  L HLI +I            +Q ++ + KF+ ++ Q 
Sbjct  205  CRNPNLIKAEVHEWSDGEELEHGLLHLIKKISEENNANNNSAAAQLISVDCKFETMAAQ-  263

Query  322  CEALPKAIRVP  290
              ALP+A+ VP
Sbjct  264  --ALPQALPVP  272


 Score =   142 bits (357),  Expect(2) = 9e-95, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFDKTIIDVDSDNWVVDELG T LF+QLL TMPWNSLMDRMMKE+H+ GKTI 
Sbjct  2     AGIVVVFDFDKTIIDVDSDNWVVDELGATDLFNQLLPTMPWNSLMDRMMKELHSQGKTID  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI  VL+ +PIHPR+VPAIK+ H LG
Sbjct  62    DIAEVLKRIPIHPRVVPAIKSAHALG  87



>ref|XP_010267012.1| PREDICTED: inorganic pyrophosphatase 1-like [Nelumbo nucifera]
Length=270

 Score =   247 bits (630),  Expect(2) = 1e-94, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 143/184 (78%), Gaps = 3/184 (2%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LRIVSDAN+FFIETILKH G+ + F+EINTNP YVDEEG+LRI P+HD  SSPH  + 
Sbjct  88   CELRIVSDANIFFIETILKHHGLMDYFTEINTNPSYVDEEGKLRIFPYHDLTSSPH--SS  145

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  +IERIQ ++  EGKKR IYLGDG GDFCP+LKL+ GD++MPRK+FP+WELI
Sbjct  146  CPPNMCKGLVIERIQETLAAEGKKRFIYLGDGKGDFCPTLKLREGDYVMPRKNFPLWELI  205

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRIC-IEDSQFLAAESKFQAISMQPCEALPKA  302
              N  L++AEIHEWS+GED ER+L  LIN I   E++Q +  + KF  I +   E LPKA
Sbjct  206  SSNPLLVKAEIHEWSDGEDLERVLLQLINNILDQEEAQMIPVDYKFHTIPISTHEPLPKA  265

Query  301  IRVP  290
            + VP
Sbjct  266  LPVP  269


 Score =   129 bits (325),  Expect(2) = 1e-94, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VV+FDFDKTIID DSDNWVVDE+G T LFD+LL TMPWN LMDRMM+E+H+ GKTI 
Sbjct  2     AGIVVIFDFDKTIIDYDSDNWVVDEMGATQLFDELLPTMPWNPLMDRMMRELHSRGKTIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI   L+  P+HPRI+ AIK+ H LG
Sbjct  62    DIVECLKRAPLHPRIITAIKSAHALG  87



>ref|XP_008795471.1| PREDICTED: inorganic pyrophosphatase 2 [Phoenix dactylifera]
Length=275

 Score =   256 bits (655),  Expect(2) = 1e-94, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 145/187 (78%), Gaps = 4/187 (2%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LR+VSDANLFFIETILKH G+ E FSE+NTNP YVDEEGRLRI P+HDF +S HGC+ 
Sbjct  88   CELRVVSDANLFFIETILKHHGLLEYFSEVNTNPSYVDEEGRLRIFPYHDFSTSSHGCSL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK KIIERIQA    EGKKR IYLGDG GD+CPSL+L   D++MPRK++P+W+LI
Sbjct  148  CPPNMCKGKIIERIQAQASVEGKKRFIYLGDGKGDYCPSLRLSEEDYVMPRKEYPLWQLI  207

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIED----SQFLAAESKFQAISMQPCEAL  311
             +N   L+AEIHEWSNGE+ ERIL  LINR+   D    +Q  + + KF+ I M P EAL
Sbjct  208  CDNPQQLKAEIHEWSNGEELERILLQLINRLIAVDRKNAAQVFSVDCKFETIPMPPNEAL  267

Query  310  PKAIRVP  290
            P  +RVP
Sbjct  268  PLPLRVP  274


 Score =   119 bits (298),  Expect(2) = 1e-94, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG +VVFDFDKTIID DSDNWVVD+LG T LF++LL TMPWNSLMDRMMKE+H+ GKT+ 
Sbjct  2     AGIIVVFDFDKTIIDCDSDNWVVDQLGATELFERLLPTMPWNSLMDRMMKELHSQGKTVE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             +I   L+  P+ P ++ AIK+ +  G
Sbjct  62    EIADCLKKAPLDPHVIAAIKSAYAHG  87



>ref|XP_003595831.1| hypothetical protein MTR_2g062320 [Medicago truncatula]
 gb|ABN08118.1| HAD-superfamily subfamily IB hydrolase, hypothetical 1 [Medicago 
truncatula]
 gb|AES66082.1| 2,3-diketo-5-methylthio-1-phosphopentane phosphatase [Medicago 
truncatula]
Length=272

 Score =   251 bits (640),  Expect(2) = 2e-94, Method: Compositional matrix adjust.
 Identities = 120/183 (66%), Positives = 143/183 (78%), Gaps = 1/183 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRIVSDAN FFIETILKH GIRECFSEINTNPGYVDEEGRLRILPF+D +  PH C  
Sbjct  88   CDLRIVSDANTFFIETILKHFGIRECFSEINTNPGYVDEEGRLRILPFYDLNKPPHTCNL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  II+RIQ S+  E  KR IYLGDG GD+CPSL LK  DF+MPRK+FPVW+LI
Sbjct  148  CPPNMCKGLIIKRIQDSISSEKNKRFIYLGDGSGDYCPSLSLKEKDFVMPRKNFPVWDLI  207

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIEDS-QFLAAESKFQAISMQPCEALPKA  302
             ++ SL++A+I+EWS+GE+ ER+L  LIN+I +E+S QF++ E      S    E LPKA
Sbjct  208  CKDPSLVKAKIYEWSDGEEQERVLHQLINKISMEESAQFISTEFNMHTPSFSAHETLPKA  267

Query  301  IRV  293
            + V
Sbjct  268  LHV  270


 Score =   125 bits (313),  Expect(2) = 2e-94, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             A  VVVFDFDKTII+ DSDNWVVDELGF  LF+QL  TMP N LMDRMM E+H+NGKTI 
Sbjct  2     ASIVVVFDFDKTIIECDSDNWVVDELGFNDLFNQLFPTMPLNYLMDRMMMELHSNGKTIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI +VL+ +PIHPR + AIKA + LG
Sbjct  62    DIVQVLKMIPIHPRTIHAIKAANALG  87



>gb|KHN32679.1| Inorganic pyrophosphatase 2 [Glycine soja]
Length=268

 Score =   241 bits (615),  Expect(2) = 2e-94, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 140/169 (83%), Gaps = 1/169 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRIVSDAN FFIETILKHL I+ECFSEINTNPGY++ E RLRILP+HDF++SPHGC  
Sbjct  88   CDLRIVSDANTFFIETILKHLKIKECFSEINTNPGYINGEERLRILPYHDFNNSPHGCTL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK +IIE+IQ S+    KKRVIYLGDG GD+CPSL+LK  DF+MPRK+FPVWELI
Sbjct  148  CPPNMCKGEIIEKIQDSISSGEKKRVIYLGDGSGDYCPSLRLKDKDFVMPRKNFPVWELI  207

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICI-EDSQFLAAESKFQAI  335
             ++  L++AEIHEWS+GE+ ERI   LIN+I + E +Q ++A+ K + I
Sbjct  208  CKDPLLIKAEIHEWSDGEELERISLQLINKISLGESAQNISADCKLETI  256


 Score =   134 bits (337),  Expect(2) = 2e-94, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFDKTI+D DSDNWVVDELGF  LF++LL TMPWN+LMD+MM E+H++GKTI 
Sbjct  2     AGIVVVFDFDKTIVDCDSDNWVVDELGFNELFNRLLPTMPWNTLMDKMMMELHSHGKTIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI +VLQ +PIHPRI+ AIKA H LG
Sbjct  62    DIVQVLQRIPIHPRIIHAIKAAHALG  87



>ref|XP_008228320.1| PREDICTED: inorganic pyrophosphatase 2-like isoform X1 [Prunus 
mume]
Length=271

 Score =   237 bits (604),  Expect(2) = 2e-94, Method: Compositional matrix adjust.
 Identities = 115/184 (63%), Positives = 146/184 (79%), Gaps = 4/184 (2%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDL+IVSDANLFFIETILKHLG+ E FSEINTNP YVDE+GRLRI P HDF    HGC+ 
Sbjct  88   CDLKIVSDANLFFIETILKHLGLEEYFSEINTNPSYVDEQGRLRISPHHDFIKCSHGCSL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  +IER+Q  +  EGKK++IYLGDG GD+CPSLKLK  DF+MPRK+FP+++LI
Sbjct  148  CPPNMCKGVVIERVQTYLSSEGKKKIIYLGDGSGDYCPSLKLKEVDFVMPRKNFPLFDLI  207

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICI-EDSQFL-AAESKFQAISMQPCEALPK  305
             ++  L++A+IHEW++GE+ E IL +LIN I   E++QF+ AA+ K Q +S    EALP+
Sbjct  208  CKDPLLIKADIHEWTDGEELEHILLNLINTIATEENAQFISAADCKLQTMSAH--EALPQ  265

Query  304  AIRV  293
            A+ V
Sbjct  266  ALPV  269


 Score =   138 bits (348),  Expect(2) = 2e-94, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFDKTII+ DSDNWVVDELG T LF+QLL TMPWNSLMDRMMKE+H+ GKT  
Sbjct  2     AGIVVVFDFDKTIIECDSDNWVVDELGATDLFNQLLPTMPWNSLMDRMMKELHSQGKTAE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI  VL+  PIHPR+VPAIKA H LG
Sbjct  62    DIVEVLKRTPIHPRVVPAIKAAHALG  87



>gb|KHG08585.1| hypothetical protein F383_11849 [Gossypium arboreum]
 gb|KHG23426.1| hypothetical protein F383_00324 [Gossypium arboreum]
Length=273

 Score =   233 bits (594),  Expect(2) = 5e-94, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 144/188 (77%), Gaps = 8/188 (4%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LR+VSDAN+FFIETIL+HLG+RE FSEI++NP +VDEE +LRI P+HDF  S HGC  
Sbjct  88   CELRVVSDANMFFIETILEHLGLREYFSEIDSNPSFVDEEEKLRIFPYHDFTESSHGCNL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK ++IERIQAS+  EGKK++IYLGDG GD+CP LKL   D+MMPRK++PVW+LI
Sbjct  148  CPPNMCKGRVIERIQASL--EGKKKIIYLGDGSGDYCPGLKLGEADYMMPRKNYPVWDLI  205

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIED-----SQFLAAESKFQAISMQPCEA  314
              N  L++AEI+EW++GE+ E++L  LIN I +E+     SQ ++ + K Q +S     A
Sbjct  206  CRNPMLIKAEIYEWTDGEELEKVLLQLINMISLEEDDANSSQLISVDCKLQTMSASK-NA  264

Query  313  LPKAIRVP  290
             P A+ VP
Sbjct  265  FPHALPVP  272


 Score =   141 bits (355),  Expect(2) = 5e-94, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VV+FDFDKTIID DSDNWV+DELGFT LF+QLL TMPWN LMD+MMKE+HA GKTI 
Sbjct  2     AGIVVIFDFDKTIIDCDSDNWVLDELGFTDLFNQLLPTMPWNPLMDKMMKELHAQGKTID  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI  VL+  PIHPRIVPAIKA H LG
Sbjct  62    DIVEVLKRAPIHPRIVPAIKAAHALG  87



>gb|AFK41778.1| unknown [Medicago truncatula]
 gb|KEH18313.1| 2,3-diketo-5-methylthio-1-phosphopentane phosphatase [Medicago 
truncatula]
Length=274

 Score =   240 bits (613),  Expect(2) = 5e-94, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 147/184 (80%), Gaps = 2/184 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRIVSDAN+F+IETILKHLGI ECFSEIN+NPGYV++EGR+RI P+HDF+ + HGC  
Sbjct  89   CDLRIVSDANMFYIETILKHLGISECFSEINSNPGYVNQEGRVRISPYHDFNKASHGCNN  148

Query  658  -CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWEL  482
             CPPNMCK  II++I+ ++     KR IYLGDG GD+CPSL+ K  DF+MPRK+FPVW+L
Sbjct  149  VCPPNMCKGLIIDKIKNTIYDGDNKRFIYLGDGAGDYCPSLRFKERDFVMPRKNFPVWDL  208

Query  481  IKENRSLLEAEIHEWSNGEDFERILFHLINRICIEDS-QFLAAESKFQAISMQPCEALPK  305
            I ++ SL++AEIH W +GE+ E+IL  LIN+I IED+ QF+A + K Q +S+   E+LPK
Sbjct  209  ICKDPSLVKAEIHGWCDGEELEQILIQLINKIIIEDNVQFIATDCKLQTLSIHVLESLPK  268

Query  304  AIRV  293
            A+ V
Sbjct  269  ALPV  272


 Score =   133 bits (335),  Expect(2) = 5e-94, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = -1

Query  1184  MAAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKT  1005
             M+   V++FDFDKTIID DSDNW++DELGFT LF+QLL TMPWNS+MD+MM E H+NG T
Sbjct  1     MSNNIVIIFDFDKTIIDCDSDNWLIDELGFTDLFNQLLPTMPWNSVMDKMMMEFHSNGVT  60

Query  1004  IGDIERVLQGVPIHPRIVPAIKAVHGLG  921
             I +IE+VLQ +PIH RI+PAIK+ H LG
Sbjct  61    IEEIEKVLQRIPIHHRIIPAIKSAHALG  88



>ref|XP_003546657.1| PREDICTED: inorganic pyrophosphatase 2-like [Glycine max]
Length=268

 Score =   241 bits (615),  Expect(2) = 1e-93, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 140/169 (83%), Gaps = 1/169 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRIVSDAN FFIETILKHL I+ECFSEINTNPGY++ E RLRILP+HDF++SPHGC  
Sbjct  88   CDLRIVSDANTFFIETILKHLKIKECFSEINTNPGYINGEERLRILPYHDFNNSPHGCTL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK +IIE+IQ S+    KKRVIYLGDG GD+CPSL+LK  DF+MPRK+FPVWELI
Sbjct  148  CPPNMCKGEIIEKIQDSISSGEKKRVIYLGDGSGDYCPSLRLKDKDFVMPRKNFPVWELI  207

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICI-EDSQFLAAESKFQAI  335
             ++  L++AEIHEWS+GE+ ERI   LIN+I + E +Q ++A+ K + I
Sbjct  208  CKDPLLIKAEIHEWSDGEELERISLQLINKISLGESAQNISADCKLETI  256


 Score =   132 bits (331),  Expect(2) = 1e-93, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             A  VVVFDFDKTI+D DSDNWVVDELGF  LF++LL TMPWN+LMD+MM E+H++GKTI 
Sbjct  2     AEIVVVFDFDKTIVDCDSDNWVVDELGFNELFNRLLPTMPWNTLMDKMMMELHSHGKTIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI +VLQ +PIHPRI+ AIKA H LG
Sbjct  62    DIVQVLQRIPIHPRIIHAIKAAHALG  87



>ref|XP_006416674.1| hypothetical protein EUTSA_v10008386mg [Eutrema salsugineum]
 gb|ESQ35027.1| hypothetical protein EUTSA_v10008386mg [Eutrema salsugineum]
Length=288

 Score =   232 bits (591),  Expect(2) = 1e-93, Method: Compositional matrix adjust.
 Identities = 114/194 (59%), Positives = 141/194 (73%), Gaps = 12/194 (6%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LRIVSDAN FFIETI++HLGI E FSEINTNPG VDE+GRL+I P+HDF  S HGC+R
Sbjct  93   CELRIVSDANTFFIETIVEHLGISEYFSEINTNPGLVDEQGRLKISPYHDFTKSSHGCSR  152

Query  658  CPPNMCKSKIIERIQASMGKEGKK-RVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWEL  482
            CPPNMCK  IIERIQAS  KEG K R+IYLGDG GD+CPSLKLKA D+MMPRKDFPVW+L
Sbjct  153  CPPNMCKGLIIERIQASFSKEGSKTRMIYLGDGAGDYCPSLKLKAQDYMMPRKDFPVWDL  212

Query  481  IKENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFLAAESKFQA---------ISM  329
            I +N +L++A + +W++GE  E IL  +IN +   D +    + K  +         I+ 
Sbjct  213  ISQNPTLVKAAVRDWTDGEAMESILMGIINDVISSDEEEEEEKDKILSSDHCKISVGIAH  272

Query  328  QPCEALPKAIRVPF  287
            +P   LP A +VP 
Sbjct  273  EPL--LPLARQVPL  284


 Score =   140 bits (354),  Expect(2) = 1e-93, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 79/92 (86%), Gaps = 4/92 (4%)
 Frame = -1

Query  1184  MAAGT----VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHA  1017
             MAA T    VVVFDFDKTIIDVDSDNWVVDELGFT LFDQLL TMPWNSLMD MMKE+H 
Sbjct  1     MAAKTNNNIVVVFDFDKTIIDVDSDNWVVDELGFTALFDQLLPTMPWNSLMDLMMKELHD  60

Query  1016  NGKTIGDIERVLQGVPIHPRIVPAIKAVHGLG  921
             +GKTI +I++VL+ +PIHPR++PAIK+ H LG
Sbjct  61    HGKTIEEIKQVLRRIPIHPRVIPAIKSAHALG  92



>ref|XP_004510356.1| PREDICTED: inorganic pyrophosphatase 1-like [Cicer arietinum]
Length=272

 Score =   236 bits (603),  Expect(2) = 2e-93, Method: Compositional matrix adjust.
 Identities = 108/183 (59%), Positives = 145/183 (79%), Gaps = 1/183 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRIVSDAN+FFI+TILKHL I + FSEINTNPGYV++EGRLRILP+HDF+ +PHGC  
Sbjct  88   CDLRIVSDANMFFIQTILKHLEISDYFSEINTNPGYVNQEGRLRILPYHDFNKAPHGCTL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  +I+RI  S+ ++  KR IYLGDG GD+CPSL+L   DFMMPRK+FPVW+L+
Sbjct  148  CPPNMCKGLVIDRIHNSISEDNNKRFIYLGDGAGDYCPSLRLTERDFMMPRKNFPVWDLM  207

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIED-SQFLAAESKFQAISMQPCEALPKA  302
             ++ SL++AEIH W +G++ E  L  LI +I IE+ +QF+++E + Q +S+   E+LPK 
Sbjct  208  CKDPSLIKAEIHAWCDGKELEHTLMKLIKKIIIEEHAQFISSECRPQNLSIPMLESLPKV  267

Query  301  IRV  293
            + +
Sbjct  268  LPI  270


 Score =   135 bits (341),  Expect(2) = 2e-93, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             +  V+VFDFDKTIID DSDNWV+DELGFT LF+QLL TMPWNSLMD+MM E+H+ G TIG
Sbjct  2     SNIVIVFDFDKTIIDCDSDNWVIDELGFTDLFNQLLPTMPWNSLMDKMMMELHSEGVTIG  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DIE+VL  +PIH RI+PAIK+ H LG
Sbjct  62    DIEKVLHRIPIHNRIIPAIKSAHALG  87



>emb|CDX96757.1| BnaA08g23000D [Brassica napus]
Length=278

 Score =   234 bits (597),  Expect(2) = 2e-93, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 145/185 (78%), Gaps = 2/185 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LRIVSDAN FFIETI++HLGI E FSEINTNPG VDE+GRLRI P+HDF  S HGC+R
Sbjct  91   CELRIVSDANTFFIETIVEHLGISEYFSEINTNPGLVDEQGRLRISPYHDFTKSSHGCSR  150

Query  658  CPPNMCKSKIIERIQASMGKEGKK-RVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWEL  482
            CPPNMCKS IIERIQAS  KEG K ++IYLGDG GD+CPSL+LKA D+MMPRK+FPVW+L
Sbjct  151  CPPNMCKSLIIERIQASFTKEGNKMKMIYLGDGAGDYCPSLRLKAEDYMMPRKNFPVWDL  210

Query  481  IKENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFLAAESKFQAISMQPCEALPKA  302
            I +N +L++A + +W++GE  ERIL  LIN I +E  + ++++ +  ++ +     LP +
Sbjct  211  ISQNPALVKATVRDWTDGEAMERILMGLINEI-MEMEKMVSSDHRKISVGIVHEPLLPIS  269

Query  301  IRVPF  287
            + +P 
Sbjct  270  LPIPL  274


 Score =   137 bits (346),  Expect(2) = 2e-93, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = -1

Query  1169  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  990
             V+VFDFDKTIIDVDSDNWVVDELGFT LF+QLL TMPWNSLMDRMMKE++ +GKTI +I+
Sbjct  8     VIVFDFDKTIIDVDSDNWVVDELGFTELFEQLLPTMPWNSLMDRMMKELYDHGKTIEEIK  67

Query  989   RVLQGVPIHPRIVPAIKAVHGLG  921
             +VL+ +PIHPR++PAIK+ H LG
Sbjct  68    QVLRRIPIHPRVIPAIKSAHALG  90



>gb|KEH18314.1| 2,3-diketo-5-methylthio-1-phosphopentane phosphatase [Medicago 
truncatula]
Length=274

 Score =   238 bits (606),  Expect(2) = 3e-93, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 149/184 (81%), Gaps = 2/184 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRIVSDAN+F+IETILKHLGI E F+EINTNPGYV++EGR+RI P+HDF+ + HGC  
Sbjct  89   CDLRIVSDANMFYIETILKHLGISEYFTEINTNPGYVNQEGRVRISPYHDFNKASHGCNN  148

Query  658  -CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWEL  482
             CPPNMCK  II++IQ S+ +E  KR IYLGDG GD+CPSL+L+  DF+MPRK+FPVW+L
Sbjct  149  VCPPNMCKGLIIDKIQNSIFEEDSKRFIYLGDGAGDYCPSLRLRERDFVMPRKNFPVWDL  208

Query  481  IKENRSLLEAEIHEWSNGEDFERILFHLINRICIEDS-QFLAAESKFQAISMQPCEALPK  305
            I ++ SL++AEIH WS+GE+ E++L +LIN+I +E+  QF++++ K Q +S     +LPK
Sbjct  209  ICKDPSLVKAEIHGWSDGEELEQVLMNLINKIMMEEHVQFISSDCKLQTLSSPVLVSLPK  268

Query  304  AIRV  293
            A+ V
Sbjct  269  AVSV  272


 Score =   134 bits (337),  Expect(2) = 3e-93, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = -1

Query  1184  MAAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKT  1005
             M    V+VFDFDKTIID DSDNW++DELGFT LF+QLL TMPWNS+MD+MM E H+NG T
Sbjct  1     MTNNIVIVFDFDKTIIDCDSDNWLIDELGFTDLFNQLLPTMPWNSVMDKMMMEFHSNGIT  60

Query  1004  IGDIERVLQGVPIHPRIVPAIKAVHGLG  921
             I +IE+VLQ +PIH RI+PAIK+ H LG
Sbjct  61    IEEIEKVLQRIPIHHRIIPAIKSAHALG  88



>ref|XP_010924488.1| PREDICTED: inorganic pyrophosphatase 2-like [Elaeis guineensis]
Length=275

 Score =   254 bits (649),  Expect(2) = 3e-93, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 145/187 (78%), Gaps = 4/187 (2%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LR+VSDANLFFIETILKH G+ E FSEINTNP YVDEEGRLRI P+HDF +S HGC+ 
Sbjct  88   CELRVVSDANLFFIETILKHHGLLEYFSEINTNPSYVDEEGRLRIFPYHDFTTSSHGCSL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK KII+RIQA    EGKKR IYLGDG GD+CPSL+L   D++MPRK++P+W+LI
Sbjct  148  CPPNMCKGKIIKRIQAQASVEGKKRFIYLGDGKGDYCPSLRLSEEDYVMPRKNYPLWQLI  207

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIED----SQFLAAESKFQAISMQPCEAL  311
             +N   L+AE+HEWSNGE+ ERIL  LI+R    D    +Q  + + KF+ I M P EAL
Sbjct  208  CDNPQQLKAEVHEWSNGEELERILLQLIDRSIAVDRKNAAQVFSVDCKFETIPMSPKEAL  267

Query  310  PKAIRVP  290
            P A+RVP
Sbjct  268  PLALRVP  274


 Score =   117 bits (292),  Expect(2) = 3e-93, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             A  +VVFDFDKTIID DSDNWVVDELG T LF++LL TMPWNSLMDRMM+E+H+ GKTI 
Sbjct  2     ARIIVVFDFDKTIIDCDSDNWVVDELGATELFERLLPTMPWNSLMDRMMRELHSQGKTIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             +I   L+  P+ P ++ AIK+ +  G
Sbjct  62    EIADCLKRAPLDPHVIAAIKSAYAHG  87



>ref|XP_008779500.1| PREDICTED: LOW QUALITY PROTEIN: inorganic pyrophosphatase 2-like 
[Phoenix dactylifera]
Length=272

 Score =   252 bits (643),  Expect(2) = 4e-93, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 145/184 (79%), Gaps = 1/184 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LR+VSDANLFFIETILKH G+ E FSE+NTNP YVDEEGRLRI P+HDF +S HGC+ 
Sbjct  88   CELRVVSDANLFFIETILKHHGLLEYFSEVNTNPSYVDEEGRLRIFPYHDFSTSSHGCSL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK KIIERIQA    EGKKR IYLGDG GD+CPSL+L   D++MPRK++P+W+LI
Sbjct  148  CPPNMCKGKIIERIQAQASVEGKKRFIYLGDGKGDYCPSLRLSEEDYVMPRKEYPLWQLI  207

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIED-SQFLAAESKFQAISMQPCEALPKA  302
             +N   L+AEIHEWSNGE+ ERIL  LI+ +  ++ +Q  + + KF+ I M P EALP  
Sbjct  208  CDNPQQLKAEIHEWSNGEELERILLQLIDXVNRKNAAQVFSVDCKFKTIPMPPNEALPLP  267

Query  301  IRVP  290
            +RVP
Sbjct  268  LRVP  271


 Score =   119 bits (298),  Expect(2) = 4e-93, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG +VVFDFDKTIID DSDNWVVD+LG T LF++LL TMPWNSLMDRMMKE+H+ GKT+ 
Sbjct  2     AGIIVVFDFDKTIIDCDSDNWVVDQLGATELFERLLPTMPWNSLMDRMMKELHSQGKTVE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             +I   L+  P+ P ++ AIK+ +  G
Sbjct  62    EIADCLKKAPLDPHVIAAIKSAYAHG  87



>ref|XP_010918519.1| PREDICTED: inorganic pyrophosphatase 2-like [Elaeis guineensis]
Length=275

 Score =   251 bits (642),  Expect(2) = 8e-93, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 142/187 (76%), Gaps = 4/187 (2%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLR+VSDANLFFIET+LKH G+ E FSEINTNP YVDEEGRLRI P+HDF +S HGC+ 
Sbjct  88   CDLRVVSDANLFFIETVLKHHGLLEYFSEINTNPSYVDEEGRLRIFPYHDFTTSSHGCSL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCKS+I+ERIQA    EGKKR IYLGDG GD+CPSLKL   D +MPRK++P+W+LI
Sbjct  148  CPPNMCKSEIVERIQAQATAEGKKRFIYLGDGKGDYCPSLKLSEEDCVMPRKNYPLWQLI  207

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIED----SQFLAAESKFQAISMQPCEAL  311
             +N   L+A +HEWSNGE+ ER L  LIN     D    +Q  + + KF+ I M P EAL
Sbjct  208  CDNPQQLKAGVHEWSNGEELERTLLQLINMSNAADHNHAAQLFSVDCKFETIPMSPNEAL  267

Query  310  PKAIRVP  290
            P A+RVP
Sbjct  268  PLALRVP  274


 Score =   118 bits (296),  Expect(2) = 8e-93, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFDKTIID DSDNWVVD+LG T LF+ LL +MPWNSLMDRMMKE+H  GKTI 
Sbjct  2     AGIVVVFDFDKTIIDCDSDNWVVDQLGATELFELLLPSMPWNSLMDRMMKELHLQGKTIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             +I   L+  P+ P ++ AIK+ + LG
Sbjct  62    EIADCLKRAPLDPHVITAIKSAYDLG  87



>ref|XP_007024470.1| Inorganic pyrophosphatase 2 [Theobroma cacao]
 gb|EOY27092.1| Inorganic pyrophosphatase 2 [Theobroma cacao]
Length=279

 Score =   246 bits (629),  Expect(2) = 1e-92, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 145/191 (76%), Gaps = 8/191 (4%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDL+IVSDAN FFIETILKH G+RE FSEINTNPG+VDEEGRLRI P HDF  SPHGC  
Sbjct  88   CDLKIVSDANAFFIETILKHHGLREYFSEINTNPGFVDEEGRLRIFPHHDFTQSPHGCHH  147

Query  658  -CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWEL  482
             CPPNMCK  +IERIQASM  +GKK +IYLGDG+GDFCPSLKL  GD++MPRK+FPVW+L
Sbjct  148  PCPPNMCKGTVIERIQASMSMKGKKTIIYLGDGVGDFCPSLKLGDGDYVMPRKNFPVWDL  207

Query  481  IKENRSLLEAEIHEWSNGEDFERILFHLINRICIE------DSQFLAAESKFQAISMQPC  320
            I ENR L++AEI EWSNGE+FE +L H+INRI I+       ++  + + K Q +     
Sbjct  208  ICENRRLIKAEICEWSNGEEFEHVLLHVINRISIDRNNSDNTARLYSIDCKLQTLPGAAQ  267

Query  319  E-ALPKAIRVP  290
            E A   A+ VP
Sbjct  268  EKAFSHALYVP  278


 Score =   123 bits (309),  Expect(2) = 1e-92, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = -1

Query  1169  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  990
             VV+FDFDKTIID DSDNWV+DELG T LF+QLL TMPWN LMDRMMKE+H+ G  I DI+
Sbjct  5     VVIFDFDKTIIDCDSDNWVLDELGATKLFNQLLPTMPWNPLMDRMMKELHSQGTKIEDIK  64

Query  989   RVLQGVPIHPRIVPAIKAVHGLG  921
              VL+  PIHPRI+ AIK+ + LG
Sbjct  65    AVLKRTPIHPRIIQAIKSAYALG  87



>ref|XP_002892964.1| phosphoric monoester hydrolase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69223.1| phosphoric monoester hydrolase [Arabidopsis lyrata subsp. lyrata]
Length=284

 Score =   231 bits (590),  Expect(2) = 1e-92, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 144/190 (76%), Gaps = 6/190 (3%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LRIVSDAN  FIETI++HLGIRE FSEINTNPG VDE+GRL + P+HDF  S HGC+R
Sbjct  91   CELRIVSDANTLFIETIIEHLGIREFFSEINTNPGLVDEQGRLIVSPYHDFTKSSHGCSR  150

Query  658  CPPNMCKSKIIERIQASMGKEGKK-RVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWEL  482
            CPPNMCK  IIERIQAS+ KEG+K ++IYLGDG GD+CPSL LKA D+MMPRK+FPVW+L
Sbjct  151  CPPNMCKGLIIERIQASLTKEGRKTKMIYLGDGAGDYCPSLGLKAEDYMMPRKNFPVWDL  210

Query  481  IKENRSLLEAEIHEWSNGEDFERILFHLINRICI-----EDSQFLAAESKFQAISMQPCE  317
            I +N  L++A + +W++GED ERIL  +IN I       +  + L++E+   ++ +    
Sbjct  211  ISQNPMLVKATVRDWTDGEDMERILMEIINEIMSLEEEEDQDKMLSSENCKISVGIVHEP  270

Query  316  ALPKAIRVPF  287
             +P A++VP 
Sbjct  271  MVPLALQVPL  280


 Score =   138 bits (347),  Expect(2) = 1e-92, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = -1

Query  1169  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  990
             V+VFDFDKTIIDVDSDNWVVDELGFT LF+QLL TMPWNSLM+RMMKE+H  GKTI +I+
Sbjct  8     VIVFDFDKTIIDVDSDNWVVDELGFTELFNQLLPTMPWNSLMNRMMKELHDQGKTIEEIK  67

Query  989   RVLQGVPIHPRIVPAIKAVHGLG  921
             +VL+ +PIHPR++PAIK+ H LG
Sbjct  68    QVLRRIPIHPRVIPAIKSAHALG  90



>ref|XP_008462367.1| PREDICTED: inorganic pyrophosphatase 2-like [Cucumis melo]
Length=274

 Score =   239 bits (610),  Expect(2) = 1e-92, Method: Compositional matrix adjust.
 Identities = 115/182 (63%), Positives = 140/182 (77%), Gaps = 7/182 (4%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRIVSDAN FFIETIL HLGIRECFSEI+TNP YV+EEGRLRI P HDFH S HGC  
Sbjct  88   CDLRIVSDANTFFIETILDHLGIRECFSEIHTNPSYVEEEGRLRIFPIHDFHKSSHGCNL  147

Query  658  CPPNMCKSKIIERIQAS-MGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWEL  482
            CPPNMCK  ++ERIQAS M +E  K+ IYLGDG GD+CPSLKL  GDF+MPRK+FP+W+L
Sbjct  148  CPPNMCKGLVVERIQASLMSEEKNKKFIYLGDGSGDYCPSLKLGEGDFLMPRKNFPLWDL  207

Query  481  IKENRSLLEAEIHEWSNGEDFERILFHLINRICIEDS--QFLAAESKFQAISMQPCEALP  308
            + +N  +++AEIHEWS+GE+  RIL  LIN I   ++  QFL      Q++++   EALP
Sbjct  208  VSQNPHVVKAEIHEWSDGEELGRILLRLINTISTAENADQFLPP----QSMAIPVYEALP  263

Query  307  KA  302
             +
Sbjct  264  SS  265


 Score =   130 bits (327),  Expect(2) = 1e-92, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG +++FDFDKTIID+DSDNWVVDELG T +F +LL TMPWN+LMDRMM E+HA GKTI 
Sbjct  2     AGILMIFDFDKTIIDLDSDNWVVDELGATDIFKELLPTMPWNTLMDRMMTELHAQGKTID  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI  VL+ VPIHP +VPAI A H LG
Sbjct  62    DIAEVLKRVPIHPDVVPAIGAAHALG  87



>gb|KEH18312.1| 2,3-diketo-5-methylthio-1-phosphopentane phosphatase [Medicago 
truncatula]
Length=267

 Score =   236 bits (602),  Expect(2) = 1e-92, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 141/171 (82%), Gaps = 1/171 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRIVSDAN  FI+TILKHLGI ECFSEINTNPGYV++EGRL+++P+HDF+ + HGC  
Sbjct  89   CDLRIVSDANTIFIDTILKHLGISECFSEINTNPGYVNQEGRLKVMPYHDFNKASHGCTL  148

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  II+RIQ S+ +  KKR IYLGDG GD+CPSL+L+  DF+MPRK+FPVW+LI
Sbjct  149  CPPNMCKGLIIDRIQKSISEVEKKRFIYLGDGAGDYCPSLRLRERDFVMPRKNFPVWDLI  208

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIEDS-QFLAAESKFQAISM  329
             ++ SL++AEIH WS+GE+ E++L +LIN+I +E+  QF+A++ K    S+
Sbjct  209  CKDPSLVKAEIHGWSDGEELEQVLMNLINKIMMEEHVQFIASDCKLATNSI  259


 Score =   133 bits (334),  Expect(2) = 1e-92, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = -1

Query  1184  MAAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKT  1005
             M+   V+VFDFDKTIID DSDNWVVDELGFT LF+QLL TMP+NSLMDRMM E+H+NGK+
Sbjct  1     MSNNIVIVFDFDKTIIDCDSDNWVVDELGFTDLFNQLLPTMPFNSLMDRMMMELHSNGKS  60

Query  1004  IGDIERVLQGVPIHPRIVPAIKAVHGLG  921
             I DIE+VLQ +PI+ RI+ AIK+ + LG
Sbjct  61    IEDIEKVLQRIPINHRIISAIKSAYALG  88



>ref|XP_010459378.1| PREDICTED: inorganic pyrophosphatase 2 [Camelina sativa]
Length=285

 Score =   228 bits (582),  Expect(2) = 2e-92, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 126/152 (83%), Gaps = 1/152 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LRIVSDAN  FIETI++HLGIRE FSEINTNPG VD++GRL I P+HDF  SPH C R
Sbjct  92   CELRIVSDANTLFIETIIEHLGIREFFSEINTNPGVVDDQGRLIISPYHDFTKSPHDCTR  151

Query  658  CPPNMCKSKIIERIQASMGKEGKK-RVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWEL  482
            CPPNMCK  IIERIQAS+ KEGKK ++IYLGDG GD+CPSL LKA D+MMPRK+FPVW+L
Sbjct  152  CPPNMCKGLIIERIQASLTKEGKKMKMIYLGDGAGDYCPSLGLKAEDYMMPRKNFPVWDL  211

Query  481  IKENRSLLEAEIHEWSNGEDFERILFHLINRI  386
            I +N  L++A + +W++GED ERIL  +IN +
Sbjct  212  ISQNPMLVKATVRDWTDGEDMERILMEIINEV  243


 Score =   140 bits (353),  Expect(2) = 2e-92, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = -1

Query  1169  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  990
             V+VFDFDKTIIDVDSDNWVVDELGFT LF+QLL TMPWNSLMDRMMKE+H +GKTI +I+
Sbjct  9     VIVFDFDKTIIDVDSDNWVVDELGFTDLFNQLLPTMPWNSLMDRMMKELHDHGKTIEEIK  68

Query  989   RVLQGVPIHPRIVPAIKAVHGLG  921
             +VL+ +PIHPR++PAIKA H LG
Sbjct  69    QVLRRIPIHPRVIPAIKAAHALG  91



>ref|XP_009110395.1| PREDICTED: inorganic pyrophosphatase 2-like [Brassica rapa]
Length=278

 Score =   233 bits (594),  Expect(2) = 3e-92, Method: Compositional matrix adjust.
 Identities = 112/185 (61%), Positives = 145/185 (78%), Gaps = 2/185 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LRIVSDAN FFIETI++HLGI E FSEINTNPG VDE+GRLRI P+HDF  S HGC+R
Sbjct  91   CELRIVSDANTFFIETIVEHLGISEYFSEINTNPGLVDEQGRLRISPYHDFTKSSHGCSR  150

Query  658  CPPNMCKSKIIERIQASMGKEGKK-RVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWEL  482
            CPPNMCKS IIERIQAS  KEG K ++IYLGDG GD+CPSL+LKA D+MMPRK+FPVW+L
Sbjct  151  CPPNMCKSLIIERIQASFTKEGNKMKMIYLGDGAGDYCPSLRLKAEDYMMPRKNFPVWDL  210

Query  481  IKENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFLAAESKFQAISMQPCEALPKA  302
            I +N +L++A + +W++GE  ERIL  LIN I +E  + +++++   ++ +     LP +
Sbjct  211  ISQNPALVKATVRDWTDGEAMERILMGLINEI-MEMEKMVSSDNCKISVGIVHEPLLPIS  269

Query  301  IRVPF  287
            + VP 
Sbjct  270  LPVPL  274


 Score =   135 bits (340),  Expect(2) = 3e-92, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = -1

Query  1169  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  990
             V+VFDFDKTIIDVDSDNWVVDELGFT LF+QLL TMPWNSLMDRMMKE++ +GK I +I+
Sbjct  8     VIVFDFDKTIIDVDSDNWVVDELGFTELFEQLLPTMPWNSLMDRMMKELYDHGKIIEEIK  67

Query  989   RVLQGVPIHPRIVPAIKAVHGLG  921
             +VL+ +PIHPR++PAIK+ H LG
Sbjct  68    QVLRRIPIHPRVIPAIKSAHALG  90



>emb|CDX83896.1| BnaC08g17490D [Brassica napus]
Length=278

 Score =   228 bits (581),  Expect(2) = 4e-92, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 128/152 (84%), Gaps = 1/152 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LRIVSDAN FFIETI++HLGI E FSEINTNPG VDE+GRLRI P++DF  S HGC+R
Sbjct  91   CELRIVSDANTFFIETIVEHLGISEYFSEINTNPGLVDEQGRLRISPYNDFTKSSHGCSR  150

Query  658  CPPNMCKSKIIERIQASMGKEGKK-RVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWEL  482
            CPPNMCKS IIERIQAS  +EGK  ++IYLGDG GD+CPSL+LKA D+MMPRK+FPVW+L
Sbjct  151  CPPNMCKSLIIERIQASFTQEGKNMKMIYLGDGAGDYCPSLRLKAEDYMMPRKNFPVWDL  210

Query  481  IKENRSLLEAEIHEWSNGEDFERILFHLINRI  386
            I +N +L++A + +W++GE  ERIL  LIN I
Sbjct  211  ISQNPALVKATVRDWTDGEAMERILMGLINEI  242


 Score =   140 bits (352),  Expect(2) = 4e-92, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = -1

Query  1169  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  990
             V+VFDFDKTIIDVDSDNWVVDELGFT LF+QLL TMPWNSLMDRMMKE+H +GKTI +I+
Sbjct  8     VIVFDFDKTIIDVDSDNWVVDELGFTELFEQLLPTMPWNSLMDRMMKELHDHGKTIEEIK  67

Query  989   RVLQGVPIHPRIVPAIKAVHGLG  921
             +VL+ +PIHPR++PAIK+ H LG
Sbjct  68    QVLRRIPIHPRVIPAIKSAHALG  90



>emb|CDX81846.1| BnaC08g37550D [Brassica napus]
Length=287

 Score =   225 bits (574),  Expect(2) = 7e-92, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 139/192 (72%), Gaps = 8/192 (4%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LRIVSDAN FFIETI++HLGIR+ FSEINTNPG VDE+GRLRI P+HDF+ S HGC R
Sbjct  92   CELRIVSDANTFFIETIVEHLGIRKYFSEINTNPGLVDEQGRLRISPYHDFNKSSHGCPR  151

Query  658  CPPNMCKSKIIERIQASMGKEGKK-RVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWEL  482
            CPP+MCK  IIE IQAS  KEG K ++IYLGDG GD+CPSL LKA D+MMPRK FPVW+L
Sbjct  152  CPPHMCKGLIIESIQASFTKEGSKMKMIYLGDGAGDYCPSLSLKAEDYMMPRKYFPVWDL  211

Query  481  IKENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQ-------FLAAESKFQAISMQP  323
            I +N++L++A I +W++GE  E+IL   +N I + D +         A   K   + +  
Sbjct  212  ISQNQTLVKAMIRDWTDGEAMEKILVGTVNEIILSDEEEEKEKMLSSADHCKISVVGIVH  271

Query  322  CEALPKAIRVPF  287
               LP +++VP 
Sbjct  272  EPLLPLSLQVPL  283


 Score =   141 bits (356),  Expect(2) = 7e-92, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = -1

Query  1169  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  990
             VVVFDFDKTIIDVDSDNWVVDELGFT LFDQLL TMPWNSLMDRMMKE+H +GKTI +I+
Sbjct  9     VVVFDFDKTIIDVDSDNWVVDELGFTELFDQLLPTMPWNSLMDRMMKELHDHGKTIEEIK  68

Query  989   RVLQGVPIHPRIVPAIKAVHGLG  921
             +VL+ +PIHPR++PAIK+ H LG
Sbjct  69    QVLRRIPIHPRVIPAIKSAHALG  91



>emb|CDY59499.1| BnaC05g50000D [Brassica napus]
Length=283

 Score =   233 bits (593),  Expect(2) = 8e-92, Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 143/189 (76%), Gaps = 5/189 (3%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LRIVSDAN  FIET+L+HLGIRE FSEINTNPG VDE+GRL + P+HDF  S HGC+R
Sbjct  91   CELRIVSDANTLFIETVLEHLGIREYFSEINTNPGLVDEQGRLIVSPYHDFTKSSHGCSR  150

Query  658  CPPNMCKSKIIERIQASMGKEGKK-RVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWEL  482
            CPPNMCK  IIERIQAS  KEG K ++IYLGDG GD+CPSL+LKA D+MMPRK+FPVW+L
Sbjct  151  CPPNMCKGLIIERIQASFTKEGNKMKMIYLGDGAGDYCPSLRLKAEDYMMPRKNFPVWDL  210

Query  481  IKENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQ----FLAAESKFQAISMQPCEA  314
            I +NR+L++A + +W++GE  ERIL  +IN I   D +     L+++    ++ +     
Sbjct  211  ISQNRTLVKATVRDWTDGEAMERILMGIINEIISSDEEEMEKMLSSDHCKISVGIVHEPL  270

Query  313  LPKAIRVPF  287
            +P A++VP 
Sbjct  271  VPLALQVPL  279


 Score =   134 bits (337),  Expect(2) = 8e-92, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = -1

Query  1169  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  990
             V+VFDFDKTIIDVDSDNWVVD+LGFT LFDQLL TMP+NSLM RMMKE+H +GKTI +I+
Sbjct  8     VIVFDFDKTIIDVDSDNWVVDQLGFTDLFDQLLPTMPFNSLMARMMKELHDHGKTIEEIK  67

Query  989   RVLQGVPIHPRIVPAIKAVHGLG  921
             +VL+ +PIHPR++PAIK+ H LG
Sbjct  68    QVLRRIPIHPRVIPAIKSAHALG  90



>ref|XP_007150539.1| hypothetical protein PHAVU_005G160900g [Phaseolus vulgaris]
 gb|ESW22533.1| hypothetical protein PHAVU_005G160900g [Phaseolus vulgaris]
Length=259

 Score =   227 bits (578),  Expect(2) = 1e-91, Method: Compositional matrix adjust.
 Identities = 109/169 (64%), Positives = 137/169 (81%), Gaps = 4/169 (2%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRIVSDAN FFIETILKHL IRECFS+INTNP Y++E+GRL+ILP+HDF++  HGC  
Sbjct  88   CDLRIVSDANTFFIETILKHLKIRECFSDINTNPSYINEDGRLQILPYHDFNNFSHGCTL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPP MCK  IIE+IQ S+G+  KKR+IYLGDG GD+CPSL+LK  DFMMPRK+FPVWELI
Sbjct  148  CPP-MCKGGIIEKIQESLGE--KKRLIYLGDGSGDYCPSLRLKEQDFMMPRKNFPVWELI  204

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICI-EDSQFLAAESKFQAI  335
             ++  L++A+IHEW+NGE+ ERI   LIN+IC  E  +F+++  K   +
Sbjct  205  CKDPLLVKAQIHEWTNGEELERISLQLINKICSGESDEFISSNCKLHIM  253


 Score =   139 bits (351),  Expect(2) = 1e-91, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFDKTI+D DSDNWVVDELGF  LF++LL TMPWN+LMDRMM E+H++GKTI 
Sbjct  2     AGIVVVFDFDKTIVDCDSDNWVVDELGFNVLFNRLLPTMPWNTLMDRMMMELHSHGKTID  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI +VLQ +PIHPRI+PAIKAVH LG
Sbjct  62    DIVQVLQRIPIHPRIIPAIKAVHSLG  87



>ref|XP_009117646.1| PREDICTED: inorganic pyrophosphatase 2-like [Brassica rapa]
Length=286

 Score =   224 bits (571),  Expect(2) = 3e-91, Method: Compositional matrix adjust.
 Identities = 108/191 (57%), Positives = 136/191 (71%), Gaps = 7/191 (4%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LRIVSDAN FFIETI++HLGIR+ FSEINTNPG VDE+GRLRI P+HDF+ S HGC R
Sbjct  92   CELRIVSDANTFFIETIVEHLGIRKYFSEINTNPGLVDEQGRLRISPYHDFNKSSHGCPR  151

Query  658  CPPNMCKSKIIERIQASMGKEGKK-RVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWEL  482
            CPPNMCK  IIERIQAS  KEG K ++IYLGDG+GD+CPSL LKA D+MMPRK+FP W+L
Sbjct  152  CPPNMCKGLIIERIQASFSKEGNKMKMIYLGDGVGDYCPSLGLKAEDYMMPRKNFPAWDL  211

Query  481  IKENRSLLEAEIHEWSNGEDFERILFHLINRICIED------SQFLAAESKFQAISMQPC  320
            I +N +L++A + +W +GE  E+IL    N I   D          +   K   + +   
Sbjct  212  ISQNPTLVKATVRDWIDGEAMEKILMGTANEIMSSDEEEEKEKMLCSDHCKISVVGIVHE  271

Query  319  EALPKAIRVPF  287
              LP +++VP 
Sbjct  272  PMLPLSLQVPL  282


 Score =   140 bits (354),  Expect(2) = 3e-91, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = -1

Query  1169  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  990
             VVVFDFDKTIIDVDSDNWVVDELGFT LFDQLL TMPWNSLMDRMMKE+H +GKTI +I+
Sbjct  9     VVVFDFDKTIIDVDSDNWVVDELGFTELFDQLLPTMPWNSLMDRMMKELHDHGKTIEEIK  68

Query  989   RVLQGVPIHPRIVPAIKAVHGLG  921
             +VL+ +PIHPR++PAIK+ H LG
Sbjct  69    QVLRRIPIHPRVIPAIKSAHALG  91



>ref|XP_009149226.1| PREDICTED: inorganic pyrophosphatase 2 [Brassica rapa]
Length=281

 Score =   231 bits (590),  Expect(2) = 6e-91, Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 144/187 (77%), Gaps = 3/187 (2%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LRIVSDAN  FIET+L+HLGIRE FSEINTNPG VDE+GRL + P+HDF  S HGC+R
Sbjct  91   CELRIVSDANTLFIETVLEHLGIREYFSEINTNPGLVDEQGRLIVSPYHDFTKSSHGCSR  150

Query  658  CPPNMCKSKIIERIQASMGKEGKK-RVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWEL  482
            CPPNMCK  IIERIQAS  KEG K ++IYLGDG GD+CPSL+LKA D+MMPRK+FPVW+L
Sbjct  151  CPPNMCKGLIIERIQASFTKEGNKMKMIYLGDGAGDYCPSLRLKAEDYMMPRKNFPVWDL  210

Query  481  IKENRSLLEAEIHEWSNGEDFERILFHLINRICI--EDSQFLAAESKFQAISMQPCEALP  308
            I +N +L++A + +W++GE  ERIL  +IN I +  E+ + L+++    ++ +     +P
Sbjct  211  ISQNPTLVKATVRDWTDGEAMERILMGIINEIILSPEEEKMLSSDHCKISVGIVHEPLVP  270

Query  307  KAIRVPF  287
             A++VP 
Sbjct  271  LALQVPL  277


 Score =   132 bits (332),  Expect(2) = 6e-91, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = -1

Query  1169  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  990
             V+VF FDKTIIDVDSDNWVVDELGFT LFDQLL TMP+NSLM RMMKE+H +GKTI +I+
Sbjct  8     VIVFHFDKTIIDVDSDNWVVDELGFTDLFDQLLPTMPFNSLMARMMKELHDHGKTIEEIK  67

Query  989   RVLQGVPIHPRIVPAIKAVHGLG  921
             +VL+ +PIHPR++PAIK+ H LG
Sbjct  68    QVLRRIPIHPRVIPAIKSAHALG  90



>ref|XP_010519214.1| PREDICTED: inorganic pyrophosphatase 1-like [Tarenaya hassleriana]
Length=284

 Score =   226 bits (575),  Expect(2) = 6e-91, Method: Compositional matrix adjust.
 Identities = 106/171 (62%), Positives = 132/171 (77%), Gaps = 1/171 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LRIVSDAN FFIETIL+HL I++ FSEINTNPG+VD+ GRLRI P+HDF  S HGC+R
Sbjct  95   CELRIVSDANTFFIETILEHLEIKDLFSEINTNPGFVDQHGRLRISPYHDFTESSHGCSR  154

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK+ IIERIQAS+ KEGKK++IYLGDG GD+CPSLKL   D++MPRK +PVW+LI
Sbjct  155  CPPNMCKALIIERIQASLTKEGKKKIIYLGDGAGDYCPSLKLGDEDYVMPRKSYPVWDLI  214

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICI-EDSQFLAAESKFQAISM  329
             +N  L+ A I EW++GE  ER L  +I  I   +D + +    K Q IS+
Sbjct  215  CQNPMLIRANIREWTDGEALERTLSEIIEEIGYGDDKEKILDSCKMQTISV  265


 Score =   138 bits (347),  Expect(2) = 6e-91, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -1

Query  1169  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  990
             V +FDFDKTIIDVDSDNWVVDELGFT LF+QLL TMPWNSLMDRMMKE+H  G TI DI+
Sbjct  12    VAIFDFDKTIIDVDSDNWVVDELGFTDLFNQLLPTMPWNSLMDRMMKELHEQGITIHDIK  71

Query  989   RVLQGVPIHPRIVPAIKAVHGLG  921
             RVL+ +PIHPR+VPA+++ H LG
Sbjct  72    RVLETIPIHPRVVPALRSAHALG  94



>ref|XP_006303573.1| hypothetical protein CARUB_v10011086mg [Capsella rubella]
 gb|EOA36471.1| hypothetical protein CARUB_v10011086mg [Capsella rubella]
Length=285

 Score =   225 bits (573),  Expect(2) = 7e-91, Method: Compositional matrix adjust.
 Identities = 108/191 (57%), Positives = 141/191 (74%), Gaps = 7/191 (4%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LRIVSDAN  FIETI++HLGIRE FSE+NTNPG VD++ RL I P+HDF  SPHGC R
Sbjct  91   CELRIVSDANTLFIETIIEHLGIREFFSEVNTNPGLVDDQCRLIISPYHDFTKSPHGCTR  150

Query  658  CPPNMCKSKIIERIQASMGKEGKK-RVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWEL  482
            CPPNMCK  IIERIQAS+ KEGKK ++IYLGDG GD+CPSL LK+ D+MMPRKDFPVW+L
Sbjct  151  CPPNMCKGLIIERIQASLTKEGKKTKMIYLGDGAGDYCPSLGLKSMDYMMPRKDFPVWDL  210

Query  481  IKENRSLLEAEIHEWSNGEDFERILFHLINRICIED------SQFLAAESKFQAISMQPC  320
            I +N  L++A + +W++GE  E+IL  +IN I   D       + L+++ +  ++ +   
Sbjct  211  ISQNPMLVKATVRDWTDGEAMEKILMEIINEIISLDEEEEEKEKMLSSDIRKISVGIVHE  270

Query  319  EALPKAIRVPF  287
              +P A +VP 
Sbjct  271  PMVPLAFQVPL  281


 Score =   138 bits (348),  Expect(2) = 7e-91, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = -1

Query  1169  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  990
             V+VFDFDKTIIDVDSDNWVVDELGFT LF+QLL TMPWNSLM+RMMKE+H +GKTI +I+
Sbjct  8     VIVFDFDKTIIDVDSDNWVVDELGFTDLFNQLLPTMPWNSLMNRMMKELHEHGKTIEEIK  67

Query  989   RVLQGVPIHPRIVPAIKAVHGLG  921
              VL+ +PIHPR++PAIKA H LG
Sbjct  68    HVLRRIPIHPRVIPAIKAAHALG  90



>ref|XP_002280867.1| PREDICTED: inorganic pyrophosphatase 2 [Vitis vinifera]
 emb|CBI35973.3| unnamed protein product [Vitis vinifera]
Length=273

 Score =   223 bits (567),  Expect(2) = 8e-91, Method: Compositional matrix adjust.
 Identities = 116/191 (61%), Positives = 147/191 (77%), Gaps = 14/191 (7%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDL+IVSDANLFFIETILKHLG+ +CFSEINTNP +VDEEGRLRI P HDF SS HGC+ 
Sbjct  88   CDLKIVSDANLFFIETILKHLGLEDCFSEINTNPSFVDEEGRLRIFPHHDFTSSSHGCSL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCKS +I+RIQAS+  E   ++IYLGDG GDFCPS KL AGD++MPRK+FP+W+LI
Sbjct  148  CPPNMCKSMVIKRIQASISTE---KLIYLGDGSGDFCPSSKLGAGDYVMPRKNFPLWDLI  204

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIED--------SQFLAAESKFQAISMQP  323
              N +L++AEIHEWS+GE+ E +L HLI +I  E+        +Q +  + KF+ ++ Q 
Sbjct  205  CRNPNLIKAEIHEWSDGEELELVLLHLIKKIPEENNPNNNSAAAQLIPVDCKFETMAAQ-  263

Query  322  CEALPKAIRVP  290
               LP+A+ VP
Sbjct  264  --VLPQALPVP  272


 Score =   140 bits (354),  Expect(2) = 8e-91, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFDKTIIDVDSDNWVVDELG T LF+QLL TMPWNSLMDRMM+E+H+ GKTI 
Sbjct  2     AGIVVVFDFDKTIIDVDSDNWVVDELGATDLFNQLLPTMPWNSLMDRMMRELHSQGKTID  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI  VL+ VPIHPR VPAIK+ H LG
Sbjct  62    DIAEVLKRVPIHPRAVPAIKSAHALG  87



>ref|XP_010262202.1| PREDICTED: inorganic pyrophosphatase 1 [Nelumbo nucifera]
Length=270

 Score =   238 bits (606),  Expect(2) = 1e-90, Method: Compositional matrix adjust.
 Identities = 111/183 (61%), Positives = 142/183 (78%), Gaps = 3/183 (2%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRIVSDAN FFI+TILKH G+ +CF+EINTNP YVD+EG+LRI PFHDF SSPH  + 
Sbjct  88   CDLRIVSDANSFFIDTILKHHGLMDCFTEINTNPSYVDDEGKLRIFPFHDFTSSPH--SP  145

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  +IERI+ S+  EGKKR +YLGDG GDFCP+L+L  G+++MPRK+FP+WELI
Sbjct  146  CPPNMCKGLVIERIRESVSAEGKKRFVYLGDGKGDFCPALRLGEGEYVMPRKNFPLWELI  205

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICI-EDSQFLAAESKFQAISMQPCEALPKA  302
              N  L++AE+HEWS+GE+ ERIL  LIN I + E++  ++ +  F  I +   E LPKA
Sbjct  206  HNNPLLVKAEVHEWSDGEELERILLQLINTILVEENNSLISVDCNFHTIPISTHEPLPKA  265

Query  301  IRV  293
            + V
Sbjct  266  LPV  268


 Score =   125 bits (313),  Expect(2) = 1e-90, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             A  VVVFDFDKTIID DSDNWV+DE+G T LFDQLL TMPWN LMDRMM E H+ GKTI 
Sbjct  2     AAVVVVFDFDKTIIDCDSDNWVIDEMGATQLFDQLLPTMPWNPLMDRMMSEFHSQGKTIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI   L+  P+HP I+ AIK+ H LG
Sbjct  62    DIADCLRRAPLHPNIITAIKSAHALG  87



>gb|EYU18768.1| hypothetical protein MIMGU_mgv1a011814mg [Erythranthe guttata]
Length=270

 Score =   230 bits (587),  Expect(2) = 1e-90, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 143/187 (76%), Gaps = 11/187 (6%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRIVSDAN+FFIE IL HLGIR CFSEIN+NP +++ EG L I P+    +SPHGC  
Sbjct  88   CDLRIVSDANMFFIEMILDHLGIRNCFSEINSNPSFINGEGTLIISPYV---TSPHGCNL  144

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  IIERIQA+   EGKK++IYLGDG+GDFCPSLKLK GDFMMPRK+FPVW+LI
Sbjct  145  CPPNMCKGMIIERIQAN---EGKKKIIYLGDGVGDFCPSLKLKEGDFMMPRKNFPVWKLI  201

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIEDS----QFLAA-ESKFQAISMQPCEA  314
             ENR +L+AEI EW +G++ ERIL  LI +I IE++    Q L+A + KF+ I +   EA
Sbjct  202  CENREILKAEIFEWIDGKELERILIGLIEKITIEEANNEVQLLSAVDCKFETIPIVAHEA  261

Query  313  LPKAIRV  293
             P  +RV
Sbjct  262  FPPPLRV  268


 Score =   132 bits (333),  Expect(2) = 1e-90, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG +V+ DFDKTII+VDSDNWVVDELG T LF++LL TMPWNSLM+RMMKE+HANGKTI 
Sbjct  2     AGIMVILDFDKTIIEVDSDNWVVDELGATDLFNELLPTMPWNSLMERMMKEMHANGKTIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             +I+ VL+ VPIH R+VPAIK  H LG
Sbjct  62    EIKDVLKRVPIHHRVVPAIKTAHALG  87



>emb|CDY21734.1| BnaA09g44850D [Brassica napus]
Length=286

 Score =   224 bits (571),  Expect(2) = 2e-90, Method: Compositional matrix adjust.
 Identities = 108/191 (57%), Positives = 136/191 (71%), Gaps = 7/191 (4%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LRIVSDAN FFIETI++HLGIR+ FSEINTNPG VDE+GRLRI P+HDF+ S HGC R
Sbjct  92   CELRIVSDANTFFIETIVEHLGIRKYFSEINTNPGLVDEQGRLRISPYHDFNKSSHGCPR  151

Query  658  CPPNMCKSKIIERIQASMGKEGKK-RVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWEL  482
            CPPNMCK  IIERIQAS  KEG K ++IYLGDG+GD+CPSL LKA D+MMPRK+FP W+L
Sbjct  152  CPPNMCKGLIIERIQASFSKEGNKMKMIYLGDGVGDYCPSLGLKAEDYMMPRKNFPAWDL  211

Query  481  IKENRSLLEAEIHEWSNGEDFERILFHLINRICIED------SQFLAAESKFQAISMQPC  320
            I +N +L++A + +W +GE  E+IL    N I   D          +   K   + +   
Sbjct  212  ISQNPTLVKATVRDWIDGEAMEKILMGTANEIMSSDEEEEKEKMLCSDHCKISVVGIVHE  271

Query  319  EALPKAIRVPF  287
              LP +++VP 
Sbjct  272  PMLPLSLQVPL  282


 Score =   138 bits (347),  Expect(2) = 2e-90, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = -1

Query  1169  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  990
             VVVFDFDKTIIDVDSDNWVVDELGFT LFDQLL TMPWNSLMDRMMKE+H +GKTI +I+
Sbjct  9     VVVFDFDKTIIDVDSDNWVVDELGFTELFDQLLPTMPWNSLMDRMMKELHDHGKTIEEIK  68

Query  989   RVLQGVPIHPRIVPAIKAVHGLG  921
             +VL+ +PIHPR++PAIK+   LG
Sbjct  69    QVLRRIPIHPRVIPAIKSARALG  91



>ref|NP_173213.2| phosphoethanolamine/phosphocholine phosphatase [Arabidopsis thaliana]
 sp|Q9FZ62.1|PPSP2_ARATH RecName: Full=Inorganic pyrophosphatase 2; Short=AtPPsPase2; 
Short=PPi phosphatase 2; Short=Pyrophosphate-specific phosphatase 
2 [Arabidopsis thaliana]
 gb|AAF99814.1|AC034257_6 Hypothetical protein [Arabidopsis thaliana]
 gb|AAU05495.1| At1g17710 [Arabidopsis thaliana]
 gb|AAU15169.1| At1g17710 [Arabidopsis thaliana]
 gb|AEE29624.1| pyridoxal phosphate phosphatase-related protein [Arabidopsis 
thaliana]
Length=279

 Score =   223 bits (569),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 105/169 (62%), Positives = 133/169 (79%), Gaps = 6/169 (4%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LRIVSDAN  FIETI++HLGI E FSEINTNPG VDE+GRL + P+HDF  S HGC+R
Sbjct  91   CELRIVSDANTLFIETIIEHLGIGEFFSEINTNPGLVDEQGRLIVSPYHDFTKSSHGCSR  150

Query  658  CPPNMCKSKIIERIQASMGKEGK-KRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWEL  482
            CPPNMCK  II+RIQAS+ KEGK  ++IYLGDG GD+CPSL LKA D+MMPRK+FPVW+L
Sbjct  151  CPPNMCKGLIIDRIQASLTKEGKTSKMIYLGDGAGDYCPSLGLKAEDYMMPRKNFPVWDL  210

Query  481  IKENRSLLEAEIHEWSNGEDFERILFHLINRICI-----EDSQFLAAES  350
            I +N  L++A + +W++GED ERIL  +IN I       E+ + L++E+
Sbjct  211  ISQNPMLVKATVRDWTDGEDMERILMEIINEIMSSEEGEENDKMLSSEN  259


 Score =   137 bits (346),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = -1

Query  1169  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  990
             V+VFDFDKTIIDVDSDNWVVDELGFT LF+QLL TMPWNSLM+RMMKE+H +GKTI +I+
Sbjct  8     VIVFDFDKTIIDVDSDNWVVDELGFTDLFNQLLPTMPWNSLMNRMMKELHDHGKTIEEIK  67

Query  989   RVLQGVPIHPRIVPAIKAVHGLG  921
             +VL+ +PIHPR++PAIK+ H LG
Sbjct  68    QVLRRIPIHPRVIPAIKSAHALG  90



>ref|XP_010519215.1| PREDICTED: inorganic pyrophosphatase 1-like [Tarenaya hassleriana]
Length=284

 Score =   223 bits (567),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 130/171 (76%), Gaps = 1/171 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LRIVSDAN FFIETIL+HL I++ FSEINTNPG+VD+ GRLRI P+HDF  S HGC+R
Sbjct  95   CELRIVSDANTFFIETILEHLEIKDLFSEINTNPGFVDQHGRLRISPYHDFTESSHGCSR  154

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK+ IIERIQAS+ KEGKK++IYLGDG GD+CPSLKL   D++MPRK +PVW L+
Sbjct  155  CPPNMCKALIIERIQASLTKEGKKKIIYLGDGAGDYCPSLKLGDEDYVMPRKSYPVWALL  214

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICI-EDSQFLAAESKFQAISM  329
             +N  L+ A I EW++GE  ER L  +I  I    D + +    K Q IS+
Sbjct  215  CQNPMLIRANIREWTDGEALERTLSEIIEEIGYGGDKEKILDSCKMQTISV  265


 Score =   138 bits (348),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -1

Query  1169  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  990
             V +FDFDKTIIDVDSDNWVVDELGFT LF+QLL TMPWNSLMDRMMKE+H  G TI DI+
Sbjct  12    VAIFDFDKTIIDVDSDNWVVDELGFTDLFNQLLPTMPWNSLMDRMMKELHEQGITIHDIK  71

Query  989   RVLQGVPIHPRIVPAIKAVHGLG  921
             RVL+ +PIHPR+VPA+++ H LG
Sbjct  72    RVLETIPIHPRVVPALRSAHALG  94



>ref|XP_010690046.1| PREDICTED: inorganic pyrophosphatase 2-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010690047.1| PREDICTED: inorganic pyrophosphatase 2-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010690048.1| PREDICTED: inorganic pyrophosphatase 2-like isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=331

 Score =   228 bits (582),  Expect(2) = 5e-90, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 140/188 (74%), Gaps = 9/188 (5%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRIVSDANLFFIETIL+HLG+ + FSEINTNPGYVDEEGRLRILP HDF  S HGC  
Sbjct  88   CDLRIVSDANLFFIETILEHLGLSDYFSEINTNPGYVDEEGRLRILPHHDFTKSSHGCTN  147

Query  658  -CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWEL  482
             CPPNMCK  +I+R+   + K G K+ IYLGDG+GD+CPSL+L+ GD +MPRK+FPVW+L
Sbjct  148  PCPPNMCKGMVIKRL---LCKHGNKKFIYLGDGLGDYCPSLRLREGDHVMPRKNFPVWDL  204

Query  481  IKENRSLLEAEIHEWSNGEDFERILFHLINRICI-----EDSQFLAAESKFQAISMQPCE  317
            I  N  L+ ++IHEW++GEDFER+L  LI  I       + + F   + KF+++ +   +
Sbjct  205  ISNNPELITSKIHEWTDGEDFERVLLSLIQAIISNADDNDAAHFFNRDCKFESLPISSPD  264

Query  316  ALPKAIRV  293
             LP+A+ V
Sbjct  265  TLPQALGV  272


 Score =   132 bits (332),  Expect(2) = 5e-90, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = -1

Query  1175  GTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGD  996
             G VVVFDFDKTIID DSDNWVVDELGFT LF+QLL+TMPWNS+MD +MKE+H  G TI D
Sbjct  3     GIVVVFDFDKTIIDCDSDNWVVDELGFTDLFNQLLNTMPWNSMMDVLMKEMHEEGITIDD  62

Query  995   IERVLQGVPIHPRIVPAIKAVHGLG  921
             I  VL+ +PIHPRIVPAI+A H  G
Sbjct  63    IADVLKRIPIHPRIVPAIRAAHAAG  87



>ref|XP_010428203.1| PREDICTED: inorganic pyrophosphatase 1 [Camelina sativa]
Length=295

 Score =   222 bits (566),  Expect(2) = 7e-90, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 122/146 (84%), Gaps = 2/146 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LRIVSDAN+FFIETI++HLGI E FSEIN+NPGYVDE G LRI P+HDF  +PHGC+ 
Sbjct  96   CELRIVSDANMFFIETIVEHLGISEFFSEINSNPGYVDERGTLRISPYHDFTKTPHGCSN  155

Query  658  --CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWE  485
              CPPNMCK  IIERIQ S+ KEGKK++IYLGDG GD+CPSLKLKA D++MPRK+FPVW+
Sbjct  156  STCPPNMCKGLIIERIQQSLAKEGKKKMIYLGDGAGDYCPSLKLKAEDYVMPRKNFPVWD  215

Query  484  LIKENRSLLEAEIHEWSNGEDFERIL  407
            LI +N  L++A I EW++G+  E IL
Sbjct  216  LISQNPMLIKAAIREWTDGQSLEMIL  241


 Score =   138 bits (347),  Expect(2) = 7e-90, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = -1

Query  1169  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  990
             VVVFDFDKTIIDVDSDNWV+DELGFT LF+QLL TMPWN+LMDRMMKE+H  GKTI +I+
Sbjct  13    VVVFDFDKTIIDVDSDNWVIDELGFTDLFNQLLPTMPWNTLMDRMMKELHDQGKTIEEIK  72

Query  989   RVLQGVPIHPRIVPAIKAVHGLG  921
             + L+ +PIHPR+VPAIK+ H LG
Sbjct  73    QALRTIPIHPRVVPAIKSAHELG  95



>ref|XP_010690045.1| PREDICTED: inorganic pyrophosphatase 2-like [Beta vulgaris subsp. 
vulgaris]
Length=274

 Score =   233 bits (594),  Expect(2) = 8e-90, Method: Compositional matrix adjust.
 Identities = 114/190 (60%), Positives = 141/190 (74%), Gaps = 9/190 (5%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRIVSDANLFFIETIL+HLG+ +CFSEINTNPGYVDEEGRLRILP HDF  S HGC  
Sbjct  88   CDLRIVSDANLFFIETILEHLGLSDCFSEINTNPGYVDEEGRLRILPHHDFTKSLHGCTN  147

Query  658  -CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWEL  482
             CPPNMCK  +I+R+   + + G K+ IYLGDG+GD+CPSLKL+ GD +MPRK+FPVW+L
Sbjct  148  PCPPNMCKGSVIKRL---LCEHGNKKFIYLGDGLGDYCPSLKLREGDHVMPRKNFPVWDL  204

Query  481  IKENRSLLEAEIHEWSNGEDFERILFHLINRICI-----EDSQFLAAESKFQAISMQPCE  317
            I  N   + ++IHEWS+GEDFERIL  LI  I         +Q L  + KF++  +   +
Sbjct  205  ISNNPERMTSKIHEWSDGEDFERILLSLIQAIISNADDNNAAQLLNLDWKFKSFPIASHK  264

Query  316  ALPKAIRVPF  287
             LP+A+ VPF
Sbjct  265  TLPQALGVPF  274


 Score =   127 bits (318),  Expect(2) = 8e-90, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -1

Query  1175  GTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGD  996
             G VVVFDFDKTIID DSDNWVVDELGFT LF+QLL+TMPWNS+MD +MK +H  G TI +
Sbjct  3     GIVVVFDFDKTIIDCDSDNWVVDELGFTDLFNQLLNTMPWNSMMDVLMKRMHEKGITINE  62

Query  995   IERVLQGVPIHPRIVPAIKAVHGLG  921
             I  VL+ +PIHPRIVPAI+  H  G
Sbjct  63    IAEVLKRIPIHPRIVPAIRDAHAAG  87



>gb|KFK41741.1| hypothetical protein AALP_AA2G166400 [Arabis alpina]
Length=289

 Score =   220 bits (560),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 110/191 (58%), Positives = 141/191 (74%), Gaps = 9/191 (5%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LRIVSDAN+FFIET+++HLGI E FSEIN+NPG+VDE   LRI P+HDF  S HGC+R
Sbjct  95   CELRIVSDANMFFIETLVEHLGISEYFSEINSNPGFVDEHDTLRISPYHDFTKSSHGCSR  154

Query  658  --CPPNMCKSKIIERIQASMGKEGKKR-VIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVW  488
              CPPNMCK  IIERIQ S+ KEGKK+ VIYLGDG GD+CPSL LKA D++MPRK+FPVW
Sbjct  155  STCPPNMCKGLIIERIQESLAKEGKKKKVIYLGDGAGDYCPSLNLKAEDYVMPRKNFPVW  214

Query  487  ELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQ---FLAAES--KFQAISMQ-  326
            +LI +N  L+ A I EW++GE  E +L  +I  I +ED +    ++AE+  K   I +  
Sbjct  215  DLISQNPMLVNAAIREWTDGESLEMVLMGVIEEIRLEDEKEKLLISAENTCKMHTIPVGI  274

Query  325  PCEALPKAIRV  293
                +P+A+RV
Sbjct  275  NVPIMPRALRV  285


 Score =   140 bits (352),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = -1

Query  1169  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  990
             VVVFDFDKTIIDVDSDNWV+DELGFT LF+QLL TMPWN+LMDRMMKE+H  GKTI +I+
Sbjct  12    VVVFDFDKTIIDVDSDNWVIDELGFTDLFNQLLPTMPWNTLMDRMMKELHDQGKTIEEIK  71

Query  989   RVLQGVPIHPRIVPAIKAVHGLG  921
             +VL+ +PIHPR+VPAIK+ H LG
Sbjct  72    QVLRTIPIHPRVVPAIKSAHALG  94



>ref|XP_010476932.1| PREDICTED: inorganic pyrophosphatase 2-like [Camelina sativa]
Length=284

 Score =   223 bits (568),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 122/146 (84%), Gaps = 1/146 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LRIVSDAN  FIETI++HLGIRE FSEINTNPG VD++GRL I P+HDF  SPHGC R
Sbjct  91   CELRIVSDANTLFIETIIEHLGIREFFSEINTNPGIVDDQGRLVISPYHDFTKSPHGCTR  150

Query  658  CPPNMCKSKIIERIQASMGKEGKK-RVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWEL  482
            CPPNMCK  IIERIQAS+ KEGKK ++IYLGDG GD+CPSL LKA D+MMPRK+FPVW+L
Sbjct  151  CPPNMCKGLIIERIQASLTKEGKKMKMIYLGDGAGDYCPSLGLKAEDYMMPRKNFPVWDL  210

Query  481  IKENRSLLEAEIHEWSNGEDFERILF  404
            I +N  L++A + +W++GE  ERIL 
Sbjct  211  ISQNPMLVKATVRDWTDGEAMERILM  236


 Score =   136 bits (343),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = -1

Query  1169  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  990
             V+VFDFDKTIIDVDSDNWVVDELGFT LF+QLL TMPWNSLM+ MMKE+H +GKTI +I+
Sbjct  8     VIVFDFDKTIIDVDSDNWVVDELGFTDLFNQLLRTMPWNSLMNGMMKELHDHGKTIEEIK  67

Query  989   RVLQGVPIHPRIVPAIKAVHGLG  921
             +VL+ +PIHPR++PAIKA H LG
Sbjct  68    QVLRRIPIHPRVIPAIKAAHALG  90



>ref|XP_006302457.1| hypothetical protein CARUB_v10020549mg [Capsella rubella]
 gb|EOA35355.1| hypothetical protein CARUB_v10020549mg [Capsella rubella]
Length=354

 Score =   221 bits (563),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 123/146 (84%), Gaps = 2/146 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LRIVSDAN+FFIET+++HLGI E FSEIN+NPG+VDE G LRI P+HDF ++PHGC+ 
Sbjct  156  CELRIVSDANMFFIETLVEHLGISELFSEINSNPGFVDERGTLRISPYHDFTTTPHGCSN  215

Query  658  --CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWE  485
              CPPNMCK  IIERIQ S+ KEGKK++IYLGDG GD+CPSLKLKA D++MPRK+FPVW+
Sbjct  216  STCPPNMCKGLIIERIQQSLAKEGKKKMIYLGDGAGDYCPSLKLKAEDYVMPRKNFPVWD  275

Query  484  LIKENRSLLEAEIHEWSNGEDFERIL  407
            LI +N  L++A I EW++G+  E +L
Sbjct  276  LISQNPMLIKAAIREWTDGQSLEMVL  301


 Score =   138 bits (347),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = -1

Query  1169  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  990
             VVVFDFDKTIIDVDSDNWV+DELGFT LF+QLL TMPWN+LMDRMMKE+H +GKTI +I+
Sbjct  73    VVVFDFDKTIIDVDSDNWVIDELGFTDLFNQLLPTMPWNTLMDRMMKELHDHGKTIEEIK  132

Query  989   RVLQGVPIHPRIVPAIKAVHGLG  921
             +VL  +PIHPR+VPAIK+ + LG
Sbjct  133   QVLTTIPIHPRVVPAIKSAYALG  155



>ref|XP_010519212.1| PREDICTED: inorganic pyrophosphatase 2-like [Tarenaya hassleriana]
Length=287

 Score =   220 bits (560),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 108/173 (62%), Positives = 134/173 (77%), Gaps = 4/173 (2%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LRIVSDAN FFIETIL+HL I++ FSEINTNPG+VD+ GRLRI P+HDF  S HGC+R
Sbjct  95   CELRIVSDANTFFIETILEHLEIKDLFSEINTNPGFVDQHGRLRISPYHDFTESSHGCSR  154

Query  658  CPPNMCKSKIIERIQASMGKEG-KKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWEL  482
            CPPNMCK+ IIERIQAS+ KEG KK++IYLGDG GD+CPSLKL   D++MPRK +PVW+L
Sbjct  155  CPPNMCKALIIERIQASLTKEGKKKKIIYLGDGAGDYCPSLKLGDEDYVMPRKSYPVWDL  214

Query  481  IKENRSLLEAEIHEWSNGEDFERILFHLINRICIE--DSQFLAAES-KFQAIS  332
            I +N  L+ A I EW++GE  ER L  +I  I  E    + +AA+S K + IS
Sbjct  215  ICQNPMLIRANIREWTDGEALERTLSEIIEEIGYEGDKEKIMAADSCKTRTIS  267


 Score =   138 bits (348),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -1

Query  1169  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  990
             V +FDFDKTIIDVDSDNWVVDELGFT LF+QLL TMPWNSLMDRMMKE+H  G TI DI+
Sbjct  12    VAIFDFDKTIIDVDSDNWVVDELGFTDLFNQLLPTMPWNSLMDRMMKELHEQGITIHDIK  71

Query  989   RVLQGVPIHPRIVPAIKAVHGLG  921
             RVL+ +PIHPR+VPA+++ H LG
Sbjct  72    RVLETIPIHPRVVPALRSAHALG  94



>ref|XP_010519213.1| PREDICTED: inorganic pyrophosphatase 2-like [Tarenaya hassleriana]
Length=287

 Score =   220 bits (560),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 134/174 (77%), Gaps = 4/174 (2%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LRIVSDAN FFIETIL+HL I++ FSEINTNPG+VD+ GRLRI P+HDF  S HGC+R
Sbjct  95   CELRIVSDANTFFIETILEHLEIKDLFSEINTNPGFVDQHGRLRISPYHDFTESSHGCSR  154

Query  658  CPPNMCKSKIIERIQASMGKEG-KKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWEL  482
            CPPNMCK+ IIERIQAS+ KEG KK++IYLGDG GD+CPSLKL   D++MPRK +PVW+L
Sbjct  155  CPPNMCKALIIERIQASLTKEGKKKKIIYLGDGAGDYCPSLKLGDEDYVMPRKSYPVWDL  214

Query  481  IKENRSLLEAEIHEWSNGEDFERILFHLINRICI--EDSQFLAAES-KFQAISM  329
            I +N  L+ A I EW++GE  ER L  +I  I    +  + LA +S K Q +S+
Sbjct  215  ICQNPMLIRANIREWTDGEALERTLSEIIEEIGYGGDTEKILAPDSCKMQTLSV  268


 Score =   138 bits (348),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -1

Query  1169  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  990
             V +FDFDKTIIDVDSDNWVVDELGFT LF+QLL TMPWNSLMDRMMKE+H  G TI DI+
Sbjct  12    VAIFDFDKTIIDVDSDNWVVDELGFTDLFNQLLPTMPWNSLMDRMMKELHEQGITIHDIK  71

Query  989   RVLQGVPIHPRIVPAIKAVHGLG  921
             RVL+ +PIHPR+VPA+++ H LG
Sbjct  72    RVLETIPIHPRVVPALRSAHALG  94



>gb|KHG13597.1| hypothetical protein F383_05241 [Gossypium arboreum]
Length=287

 Score =   228 bits (582),  Expect(2) = 4e-89, Method: Compositional matrix adjust.
 Identities = 115/196 (59%), Positives = 141/196 (72%), Gaps = 14/196 (7%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGC--  665
            CDL+IVSDAN FFIETIL+H G++ECFSEINTNPG+VDE+GRLRI P HDF  S HGC  
Sbjct  90   CDLKIVSDANTFFIETILEHHGLKECFSEINTNPGFVDEQGRLRIFPHHDFTKSSHGCQH  149

Query  664  ARCPPNMCKSKIIERIQASMGKEG-KKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVW  488
            + CPPNMCK  +IERIQAS+  E  KK +IYLGDG+GDFCP+LKL  GD++MPRK FPVW
Sbjct  150  SSCPPNMCKGVVIERIQASLSMEDQKKTIIYLGDGLGDFCPTLKLGDGDYVMPRKGFPVW  209

Query  487  ELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIED--------SQFLAAESKFQAIS  332
            +LI  NR L+ AEI EWS+GE+FE +L HLI+RI   D         Q  + + K + + 
Sbjct  210  DLICNNRKLVNAEICEWSDGEEFENVLLHLISRIISIDRNNTSAKMGQLYSVDCKLETMP  269

Query  331  MQPC---EALPKAIRV  293
            +      EA P A+ V
Sbjct  270  LPVATGHEAFPLALPV  285


 Score =   129 bits (324),  Expect(2) = 4e-89, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = -1

Query  1181  AAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTI  1002
             AAG VV++DFDKTIID DSDNWVVDELG T LF+QLL TMPWNSLMDR+MKE+H+ G  I
Sbjct  3     AAGIVVIYDFDKTIIDCDSDNWVVDELGATELFNQLLPTMPWNSLMDRIMKELHSQGIRI  62

Query  1001  GDIERVLQGVPIHPRIVPAIKAVHGLG  921
              DI  VL+  PIHPRI+ AIK+ H LG
Sbjct  63    EDIATVLKRSPIHPRIIEAIKSAHALG  89



>gb|KFK43955.1| hypothetical protein AALP_AA1G196200 [Arabis alpina]
Length=329

 Score =   220 bits (560),  Expect(2) = 7e-89, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 124/153 (81%), Gaps = 1/153 (1%)
 Frame = -2

Query  847  IFRCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHG  668
            I RC+LRIVSDAN  FIETI++ LGI E FSEINTNP  VDE+GRL+I P+HDF  S HG
Sbjct  103  ILRCELRIVSDANTLFIETIVEDLGISEFFSEINTNPVLVDEQGRLKIFPYHDFTKSSHG  162

Query  667  CARCPPNMCKSKIIERIQASMGKEGKK-RVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPV  491
            C+RCPPNMCK  IIERIQAS+ KEG K +++YLGDG GD+CPSLKLK  D+MMPRK+FPV
Sbjct  163  CSRCPPNMCKGLIIERIQASLTKEGNKMKMVYLGDGAGDYCPSLKLKIEDYMMPRKNFPV  222

Query  490  WELIKENRSLLEAEIHEWSNGEDFERILFHLIN  392
            W+LI +N +L++A + +W++GE  ERIL   IN
Sbjct  223  WDLISQNPNLVKATVRDWTDGEAMERILMGTIN  255


 Score =   137 bits (345),  Expect(2) = 7e-89, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -1

Query  1175  GTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGD  996
               V+VFDFDKTIIDVDSDNWVVDELGFT LFD+LL TMPWNSLMDRMMKE+H +GKTI +
Sbjct  6     NVVIVFDFDKTIIDVDSDNWVVDELGFTDLFDKLLPTMPWNSLMDRMMKELHDHGKTIDE  65

Query  995   IERVLQGVPIHPRIVPAIKAVHGLG  921
             I++VL+ VPIHPR++ AIK+ H LG
Sbjct  66    IKQVLRRVPIHPRVITAIKSAHALG  90



>ref|XP_009127965.1| PREDICTED: inorganic pyrophosphatase 1 [Brassica rapa]
Length=292

 Score =   218 bits (555),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 121/147 (82%), Gaps = 2/147 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LRIVSDAN+FFIETI++HLGI E FSEIN+NPG+VDE   LRI P+HDF +S HGC+ 
Sbjct  95   CELRIVSDANMFFIETIVEHLGISEYFSEINSNPGFVDEHDTLRISPYHDFTNSSHGCSH  154

Query  658  --CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWE  485
              CPPNMCK  IIERIQ S+ KEGKK+++YLGDG GD+CPSLKLKA D+ MPRK+FPVW+
Sbjct  155  RTCPPNMCKGLIIERIQESLAKEGKKKMVYLGDGAGDYCPSLKLKAEDYAMPRKNFPVWD  214

Query  484  LIKENRSLLEAEIHEWSNGEDFERILF  404
            LI +N  L++A I EW++GE  ERIL 
Sbjct  215  LISQNPMLVKAAIREWTDGESLERILL  241


 Score =   137 bits (345),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -1

Query  1169  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  990
             VVVFDFDKTIIDVDSDNWVVD LGFT LF+QLL TMPWNSLMDRMMK+IH  GKTI +I+
Sbjct  12    VVVFDFDKTIIDVDSDNWVVDGLGFTDLFNQLLPTMPWNSLMDRMMKDIHDQGKTIEEIK  71

Query  989   RVLQGVPIHPRIVPAIKAVHGLG  921
              VL+ +PIHPR+VPAIK+ H LG
Sbjct  72    EVLKTIPIHPRVVPAIKSAHALG  94



>ref|NP_565052.1| inorganic pyrophosphatase 1 [Arabidopsis thaliana]
 sp|Q67YC0.1|PPSP1_ARATH RecName: Full=Inorganic pyrophosphatase 1; Short=AtPPsPase1; 
Short=PPi phosphatase 1; Short=Pyrophosphate-specific phosphatase 
1; AltName: Full=Protein PHOSPHATE STARVATION-INDUCED 
GENE 2; Short=AtPS2 [Arabidopsis thaliana]
 dbj|BAD44311.1| unknown protein [Arabidopsis thaliana]
 gb|ABO38747.1| At1g73010 [Arabidopsis thaliana]
 gb|AEE35403.1| inorganic pyrophosphatase 1 [Arabidopsis thaliana]
Length=295

 Score =   216 bits (550),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 119/147 (81%), Gaps = 2/147 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCA-  662
            C+LRIVSDAN+FFIETI++HLGI E FSEIN+NPGYVDE G L+I P+HDF  SPH C+ 
Sbjct  98   CELRIVSDANMFFIETIVEHLGISELFSEINSNPGYVDERGTLKISPYHDFTKSPHSCSC  157

Query  661  -RCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWE  485
              CPPNMCK  IIERIQ S+ KEGKK++IYLGDG GD+CPSLKL   D++MPRK+FPVW+
Sbjct  158  GTCPPNMCKGLIIERIQQSLAKEGKKKMIYLGDGAGDYCPSLKLNTEDYVMPRKNFPVWD  217

Query  484  LIKENRSLLEAEIHEWSNGEDFERILF  404
            LI +N  L++A I EW++G+  E IL 
Sbjct  218  LISQNPMLIKAAIREWTDGQSMEMILI  244


 Score =   139 bits (350),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = -1

Query  1169  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  990
             VVVFDFDKTIIDVDSDNWV+DELGFT LF+QLL TMPWN+LMDRMMKE+H  GKTI +I+
Sbjct  15    VVVFDFDKTIIDVDSDNWVIDELGFTDLFNQLLPTMPWNTLMDRMMKELHDQGKTIEEIK  74

Query  989   RVLQGVPIHPRIVPAIKAVHGLG  921
             +VL+ +PIHPR+VPAIK+ H LG
Sbjct  75    QVLRTIPIHPRVVPAIKSAHDLG  97



>emb|CDX82118.1| BnaC02g21720D [Brassica napus]
Length=291

 Score =   219 bits (557),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 121/147 (82%), Gaps = 2/147 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LRIVSDAN+FFIETI++HLGI E FSEIN+NPG+VDE   LRI P+HDF +S HGC+ 
Sbjct  95   CELRIVSDANMFFIETIVEHLGISEYFSEINSNPGFVDEHDTLRISPYHDFTNSSHGCSH  154

Query  658  --CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWE  485
              CPPNMCK  IIERIQ S+ KEGKK++IYLGDG GD+CPSLKLKA D+ MPRK+FPVW+
Sbjct  155  RTCPPNMCKGLIIERIQESLAKEGKKKMIYLGDGAGDYCPSLKLKAEDYAMPRKNFPVWD  214

Query  484  LIKENRSLLEAEIHEWSNGEDFERILF  404
            LI +N  L++A I EW++GE  ERIL 
Sbjct  215  LISQNPMLVKAAIKEWTDGESLERILL  241


 Score =   136 bits (343),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -1

Query  1169  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  990
             VVVFDFDKTIIDVDSDNWVVD LGFT LF+QLL TMPWN+LMDRMMK+IH  GKTI +I+
Sbjct  12    VVVFDFDKTIIDVDSDNWVVDGLGFTDLFNQLLPTMPWNTLMDRMMKDIHDQGKTIEEIK  71

Query  989   RVLQGVPIHPRIVPAIKAVHGLG  921
              VL+ +PIHPR+VPAIK+ H LG
Sbjct  72    EVLKTIPIHPRVVPAIKSAHALG  94



>ref|XP_006390603.1| hypothetical protein EUTSA_v10018928mg [Eutrema salsugineum]
 gb|ESQ27889.1| hypothetical protein EUTSA_v10018928mg [Eutrema salsugineum]
Length=303

 Score =   216 bits (550),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 122/148 (82%), Gaps = 3/148 (2%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDE-EGRLRILPFHDFHSSPHGCA  662
            C+LRIVSDAN+FFIETI++HLGI E FSEIN+NPG+VDE E  LRI P+HDF  S HGC+
Sbjct  104  CELRIVSDANMFFIETIVEHLGITEFFSEINSNPGFVDEHEDTLRISPYHDFTKSSHGCS  163

Query  661  R--CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVW  488
               CPPNMCK  IIERIQ S+ KEGKK++IYLGDG GD+CPSLKLKAGD++MPRK+FPVW
Sbjct  164  HSTCPPNMCKGLIIERIQESLAKEGKKKMIYLGDGAGDYCPSLKLKAGDYVMPRKNFPVW  223

Query  487  ELIKENRSLLEAEIHEWSNGEDFERILF  404
            +LI +N  L++  I EW++GE  E++L 
Sbjct  224  DLISQNPMLIKGAIREWTDGESLEKVLM  251


 Score =   139 bits (350),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = -1

Query  1169  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  990
             VVVFDFDKTI+DVDSDNWV+DELGFT LF+QLL TMPWN+LMDRMMKE+H  GKTI +I+
Sbjct  21    VVVFDFDKTIVDVDSDNWVIDELGFTDLFNQLLPTMPWNTLMDRMMKELHDQGKTIEEIK  80

Query  989   RVLQGVPIHPRIVPAIKAVHGLG  921
             +VL+ +PIHPR+VPAIKA H LG
Sbjct  81    QVLRTIPIHPRVVPAIKAAHDLG  103



>ref|XP_002888902.1| hypothetical protein ARALYDRAFT_476431 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65161.1| hypothetical protein ARALYDRAFT_476431 [Arabidopsis lyrata subsp. 
lyrata]
Length=294

 Score =   217 bits (552),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 119/147 (81%), Gaps = 2/147 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCA-  662
            C+LRIVSDAN+FFIETI++HLGI E FSEIN+NPGYVDE G LRI P+HDF  S HGC+ 
Sbjct  97   CELRIVSDANMFFIETIVEHLGISELFSEINSNPGYVDERGTLRISPYHDFTKSSHGCSC  156

Query  661  -RCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWE  485
              CPPNMCK  IIERIQ S+ KEGKK++IYLGDG GD+CPSLKL   D++MPRK+FPVW+
Sbjct  157  GTCPPNMCKGLIIERIQQSLAKEGKKKMIYLGDGAGDYCPSLKLNTEDYVMPRKNFPVWD  216

Query  484  LIKENRSLLEAEIHEWSNGEDFERILF  404
            LI +N  L++A I EW++G+  E IL 
Sbjct  217  LISQNPMLIKATIREWTDGQSLEMILI  243


 Score =   138 bits (347),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = -1

Query  1169  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  990
             VVVFDFDKTIIDVDSDNWV+DELG+T LF+QLL TMPWN+LMDRMMKE+H  GKTI +I+
Sbjct  14    VVVFDFDKTIIDVDSDNWVIDELGYTDLFNQLLPTMPWNTLMDRMMKELHDQGKTIEEIK  73

Query  989   RVLQGVPIHPRIVPAIKAVHGLG  921
             +VL+ +PIHPR+VPAIK+ H LG
Sbjct  74    QVLRTIPIHPRVVPAIKSAHDLG  96



>gb|AAM63155.1| putative acid phosphatase [Arabidopsis thaliana]
Length=293

 Score =   216 bits (549),  Expect(2) = 4e-88, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 119/147 (81%), Gaps = 2/147 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCA-  662
            C+LRIVSDAN+FFIETI++HLGI E FSEIN+NPGYVDE G L+I P+HDF  SPH C+ 
Sbjct  96   CELRIVSDANMFFIETIVEHLGISELFSEINSNPGYVDERGTLKISPYHDFTKSPHSCSC  155

Query  661  -RCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWE  485
              CPPNMCK  IIERIQ S+ KEGKK++IYLGDG GD+CPSLKL   D++MPRK+FPVW+
Sbjct  156  GTCPPNMCKGLIIERIQQSLAKEGKKKMIYLGDGAGDYCPSLKLNTEDYVMPRKNFPVWD  215

Query  484  LIKENRSLLEAEIHEWSNGEDFERILF  404
            LI +N  L++A I EW++G+  E IL 
Sbjct  216  LISQNPMLIKAVIREWTDGQSMEMILI  242


 Score =   139 bits (349),  Expect(2) = 4e-88, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = -1

Query  1169  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  990
             VVVFDFDKTIIDVDSDNWV+DELGFT LF+QLL TMPWN+LMDRMMKE+H  GKTI +I+
Sbjct  13    VVVFDFDKTIIDVDSDNWVIDELGFTDLFNQLLPTMPWNTLMDRMMKELHDQGKTIEEIK  72

Query  989   RVLQGVPIHPRIVPAIKAVHGLG  921
             +VL+ +PIHPR+VPAIK+ H LG
Sbjct  73    QVLRTIPIHPRVVPAIKSAHDLG  95



>emb|CDY69464.1| BnaAnng30500D [Brassica napus]
Length=292

 Score =   216 bits (551),  Expect(2) = 5e-88, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 121/147 (82%), Gaps = 2/147 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LRIVSDAN+FFIET+++HLGI E FSEIN+NPG+VDE   LRI P+HDF +S HGC+ 
Sbjct  95   CELRIVSDANMFFIETLVEHLGISEYFSEINSNPGFVDEHDTLRISPYHDFTNSSHGCSH  154

Query  658  --CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWE  485
              CPPNMCK  IIERIQ S+ KEGKK+++YLGDG GD+CPSLKLKA D+ MPRK+FP+W+
Sbjct  155  RTCPPNMCKGLIIERIQESLAKEGKKKMVYLGDGAGDYCPSLKLKAEDYAMPRKNFPIWD  214

Query  484  LIKENRSLLEAEIHEWSNGEDFERILF  404
            LI +N  L++A I EW++GE  ERIL 
Sbjct  215  LISQNPMLVKAAIREWTDGESLERILL  241


 Score =   137 bits (346),  Expect(2) = 5e-88, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -1

Query  1169  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  990
             VVVFDFDKTIIDVDSDNWVVD LGFT LF+QLL TMPWNSLMDRMMK+IH  GKTI +I+
Sbjct  12    VVVFDFDKTIIDVDSDNWVVDGLGFTDLFNQLLPTMPWNSLMDRMMKDIHDQGKTIEEIK  71

Query  989   RVLQGVPIHPRIVPAIKAVHGLG  921
              VL+ +PIHPR+VPAIK+ H LG
Sbjct  72    EVLKTIPIHPRVVPAIKSAHALG  94



>ref|XP_009409362.1| PREDICTED: inorganic pyrophosphatase 2 [Musa acuminata subsp. 
malaccensis]
Length=275

 Score =   240 bits (613),  Expect(2) = 4e-87, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 138/187 (74%), Gaps = 4/187 (2%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LRIVSDAN FFIETILKH G+   FSEI+TNPGYVDEEGRLRI P HDF SS HGC  
Sbjct  88   CELRIVSDANRFFIETILKHHGLMAYFSEIHTNPGYVDEEGRLRIFPHHDFKSSSHGCCL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCKS IIERIQAS   EG+KR IYLGDG GD+CPSL+L  GD +MPRK++P+W+LI
Sbjct  148  CPPNMCKSAIIERIQASAFLEGRKRFIYLGDGKGDYCPSLRLNEGDCVMPRKNYPLWQLI  207

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIED----SQFLAAESKFQAISMQPCEAL  311
             +N   L AEIHEWSN E+ ER+L  LI+     D    SQ ++ + KFQ +     EA 
Sbjct  208  VDNPQALRAEIHEWSNAEELERVLLRLISESASADRSSPSQLISVDCKFQTLPPSSIEAF  267

Query  310  PKAIRVP  290
            PK++ VP
Sbjct  268  PKSLPVP  274


 Score =   110 bits (276),  Expect(2) = 4e-87, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             A  VVVFDFDKTIID DSDNWV+D+LG T LFD+LL  MPWNS MDR+M+E+H+ G+TI 
Sbjct  2     ADVVVVFDFDKTIIDCDSDNWVIDDLGGTQLFDELLKAMPWNSAMDRVMEELHSQGRTIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             +I   L+  P+    V AIK+ + LG
Sbjct  62    EISENLKRAPLPANAVAAIKSAYALG  87



>ref|XP_002277629.1| PREDICTED: inorganic pyrophosphatase 3 [Vitis vinifera]
 emb|CBI20628.3| unnamed protein product [Vitis vinifera]
Length=269

 Score =   227 bits (578),  Expect(2) = 1e-86, Method: Compositional matrix adjust.
 Identities = 106/183 (58%), Positives = 135/183 (74%), Gaps = 1/183 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRIVSDAN FFIET+LKH G+ +CFSEI TNP +VD EGRLRILP+HD  SS HGC  
Sbjct  87   CDLRIVSDANAFFIETVLKHHGLMDCFSEIKTNPSFVDGEGRLRILPYHDLKSSSHGCNF  146

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  ++ER++ S+  EGKKR IYLGDG  DFC  LKL  GD++MPRK++P+WE+I
Sbjct  147  CPPNMCKGLVMERVRTSVSAEGKKRFIYLGDGSADFCSGLKLGEGDYLMPRKNYPIWEII  206

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFLAAESKFQAISMQPCEALPKAI  299
              N  L++++I+EWSNGE+ E+IL HLI  I IE+   + ++ K QA SM   +     +
Sbjct  207  CSNPKLIKSKINEWSNGEELEKILLHLITTISIEEKCNMRSD-KCQASSMDSHKTFQSVL  265

Query  298  RVP  290
             VP
Sbjct  266  PVP  268


 Score =   122 bits (307),  Expect(2) = 1e-86, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = -1

Query  1175  GTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGD  996
               VVVFDFDKTIID DSDNWVVDELG T LF QLL TMPWNSLMDRM  E+H+ GKT+ +
Sbjct  2     AVVVVFDFDKTIIDCDSDNWVVDELGLTPLFTQLLPTMPWNSLMDRMFMELHSQGKTMEE  61

Query  995   IERVLQGVPIHPRIVPAIKAVHGLG  921
             I   L+  P+HPRI+ AIK+ H  G
Sbjct  62    IAECLKRAPLHPRIISAIKSAHASG  86



>gb|KCW69738.1| hypothetical protein EUGRSUZ_F03120 [Eucalyptus grandis]
Length=314

 Score =   238 bits (607),  Expect(2) = 2e-86, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 143/179 (80%), Gaps = 6/179 (3%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEE-GRLRILPFHDFHSSPHGCA  662
            C+LRI+SDA+LF+IETIL HLGIRECFS+I TNP +VDEE GRLRILPFHDF SSPHGC 
Sbjct  133  CELRILSDADLFYIETILNHLGIRECFSQITTNPSFVDEEKGRLRILPFHDFRSSPHGCG  192

Query  661  RCPPNMCKSKIIERIQASMGKEGKK-RVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWE  485
             CPPN+CK  +IER+QAS+  EGKK R IY+GDG+GD+CPSLKL  GDFMMPRKD+P W+
Sbjct  193  LCPPNLCKGAVIERVQASVSAEGKKKRFIYVGDGVGDYCPSLKLSEGDFMMPRKDYPAWD  252

Query  484  LIKENRSLLEAEIHEWSNGEDFERILFHLINRICIED----SQFLAAESKFQAISMQPC  320
            LI +N +LL+AEIHEW++GE+ ER++  LI+ I  E+     + ++++ + Q I+   C
Sbjct  253  LICQNPALLKAEIHEWTDGEELERVVLRLIDAIITEEEIKSGRSISSDREMQNIADHRC  311


 Score =   110 bits (276),  Expect(2) = 2e-86, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             A  +VVFDFDKTI+D + D+W+V E G   L ++LL T PWNSLMD+MM E+H+ GKTI 
Sbjct  47    ADIMVVFDFDKTIMDWECDDWIVHEFGLIDLVNELLPTTPWNSLMDKMMGELHSRGKTIA  106

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI  VL+   +HPRIVPAIK++H LG
Sbjct  107   DIADVLKRATMHPRIVPAIKSIHALG  132



>gb|EPS62373.1| hypothetical protein M569_12416, partial [Genlisea aurea]
Length=241

 Score =   222 bits (566),  Expect(2) = 3e-86, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 120/148 (81%), Gaps = 3/148 (2%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRIVSDAN FFIETI++HLGI++CFSEINTNP   DEEGRLRI P+ DFH++PHGC R
Sbjct  88   CDLRIVSDANSFFIETIIQHLGIKDCFSEINTNPSRFDEEGRLRISPYVDFHTNPHGCPR  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  II RIQ  +   G KR++YLGDG GDFCP LKLK  DFMMPRKDFPVW+LI
Sbjct  148  CPPNMCKGSIIGRIQDQI---GAKRIVYLGDGAGDFCPCLKLKEEDFMMPRKDFPVWDLI  204

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLI  395
             ENR  + A+IHEWS+G+  E++L  +I
Sbjct  205  CENRDAVRAQIHEWSDGDQLEKVLLKII  232


 Score =   125 bits (315),  Expect(2) = 3e-86, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AGTVV+FDFDKTIID DSDNWVVDELG T LF++LLHTMPWN++MD +M E+H+ G++  
Sbjct  2     AGTVVIFDFDKTIIDADSDNWVVDELGATDLFNRLLHTMPWNTMMDTIMGELHSRGRSSE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI  VL+ +PIH R+VPAI+  H LG
Sbjct  62    DIRGVLRRIPIHSRVVPAIRRAHSLG  87



>ref|XP_010416075.1| PREDICTED: inorganic pyrophosphatase 1-like [Camelina sativa]
Length=296

 Score =   216 bits (550),  Expect(2) = 6e-86, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 117/140 (84%), Gaps = 2/140 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LRIVSDAN+FFIETI++HLGI E FSEIN+NPGY DE G LRI P+HDF  +PHGC+ 
Sbjct  96   CELRIVSDANMFFIETIVEHLGISEFFSEINSNPGYADERGTLRISPYHDFTKTPHGCSN  155

Query  658  --CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWE  485
              CPPNMCK  IIERIQ S+ KEGKK++IYLGDG GD+CPSLKL A D++MPRK+FPVW+
Sbjct  156  STCPPNMCKGLIIERIQQSLAKEGKKKMIYLGDGAGDYCPSLKLNAEDYVMPRKNFPVWD  215

Query  484  LIKENRSLLEAEIHEWSNGE  425
            LI +N  L++A I EW+NG+
Sbjct  216  LISQNPMLIKAAIREWTNGQ  235


 Score =   131 bits (329),  Expect(2) = 6e-86, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  1160  FDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIERVL  981
             FDFDKTIIDVDSDNWV+DELGFT LF QLL TMPWN+LMDRMM E+H  GKTI +I++ L
Sbjct  16    FDFDKTIIDVDSDNWVIDELGFTDLFTQLLPTMPWNTLMDRMMTELHDQGKTIEEIKQAL  75

Query  980   QGVPIHPRIVPAIKAVHGLG  921
             + +PIHPR+VPAIK+ H LG
Sbjct  76    KTIPIHPRVVPAIKSAHELG  95



>ref|XP_010915327.1| PREDICTED: inorganic pyrophosphatase 1-like [Elaeis guineensis]
Length=275

 Score =   230 bits (587),  Expect(2) = 9e-86, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 136/187 (73%), Gaps = 4/187 (2%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LRIVSDANLFFIETIL H G+   FSEINTNPGYVDE+GRLRI P+HDF +S HGC  
Sbjct  88   CELRIVSDANLFFIETILNHHGLVGYFSEINTNPGYVDEKGRLRIFPYHDFTTSSHGCCL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK K+IERI+ S     K R IYLGDG GD+CPSL+L  GD++MPRK++P+WELI
Sbjct  148  CPPNMCKGKVIERIRTSAFAVEKNRFIYLGDGKGDYCPSLELNEGDYVMPRKNYPLWELI  207

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIED----SQFLAAESKFQAISMQPCEAL  311
              +   L+A IHEWS+ E+ + +L  LIN     D    ++ L+A+ K Q I + P E L
Sbjct  208  CNDPQALKAAIHEWSDAEELKTVLLRLINDSVSADLNNAARLLSADCKLQTIPLSPHEPL  267

Query  310  PKAIRVP  290
            PKA+ VP
Sbjct  268  PKALPVP  274


 Score =   116 bits (290),  Expect(2) = 9e-86, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFDKTIID DSDNWVVD+LG T  FD+LL ++PWNS +DRMM E+H+ GKTI 
Sbjct  2     AGIVVVFDFDKTIIDCDSDNWVVDDLGATRRFDELLESLPWNSAIDRMMGELHSQGKTIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             +I   L+  P+ P  + AIK+ H LG
Sbjct  62    EISNSLKKAPLSPHTIAAIKSAHSLG  87



>emb|CDY59927.1| BnaC06g43820D [Brassica napus]
Length=292

 Score =   207 bits (526),  Expect(2) = 2e-84, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 120/147 (82%), Gaps = 3/147 (2%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LRIVSDAN+FFIET+++HLGI E FSEIN+NPG+VDE+  LRI P+HDF +S HGC  
Sbjct  95   CELRIVSDANMFFIETMVEHLGISELFSEINSNPGFVDEKDTLRISPYHDFTNSSHGCTH  154

Query  658  --CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWE  485
              CP NMCK  +IERIQ S+ KEGKK +IYLGDG GD+CPSLKLKA D++MPRK+FPVW+
Sbjct  155  GSCPLNMCKGLVIERIQESLAKEGKK-MIYLGDGAGDYCPSLKLKAEDYVMPRKNFPVWD  213

Query  484  LIKENRSLLEAEIHEWSNGEDFERILF  404
            LI +N  L++A I EW++GE  E+IL 
Sbjct  214  LISQNPLLVKATIREWTDGESLEKILM  240


 Score =   135 bits (340),  Expect(2) = 2e-84, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -1

Query  1169  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  990
             VVVFDFDKTIIDVDSDNWV+DELGFT LF+QLL TMPWN++MD MMKE+H  GKTI +I+
Sbjct  12    VVVFDFDKTIIDVDSDNWVIDELGFTDLFNQLLPTMPWNTVMDCMMKELHDQGKTIEEIK  71

Query  989   RVLQGVPIHPRIVPAIKAVHGLG  921
             + L+ +PIHPRIVPAIKA H LG
Sbjct  72    QALRTIPIHPRIVPAIKAAHALG  94



>dbj|BAJ95704.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=274

 Score =   224 bits (572),  Expect(2) = 2e-84, Method: Compositional matrix adjust.
 Identities = 104/185 (56%), Positives = 134/185 (72%), Gaps = 3/185 (2%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCA-  662
            CDLR++SDAN FFIE +L H G+R  FSEINTNP  VD +GRLRI P HDFH+ PHGC  
Sbjct  88   CDLRVLSDANRFFIEAVLDHHGLRGYFSEINTNPSRVDADGRLRIAPHHDFHAGPHGCGL  147

Query  661  -RCPPNMCKSKIIERIQASMGK-EGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVW  488
              CPPNMCK ++++RI+AS    +G KR IYLGDG GD+CPSL+L   DFMMPRK FPVW
Sbjct  148  GTCPPNMCKGQVLDRIRASSATADGTKRFIYLGDGRGDYCPSLRLAREDFMMPRKGFPVW  207

Query  487  ELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFLAAESKFQAISMQPCEALP  308
            ELI EN  LL+AE+H WS+G+D E  L  LI+R+ +E+SQ L  + K +++ +   + +P
Sbjct  208  ELICENPGLLQAEVHPWSDGKDMEETLLRLISRVLVEESQLLPLDCKLESLPVAVQDGMP  267

Query  307  KAIRV  293
              + V
Sbjct  268  MPLGV  272


 Score =   117 bits (294),  Expect(2) = 2e-84, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFDKTIIDVDSDNWVVD LG T LFD+LL TMPWN+L+D +M E+HA GKT+ 
Sbjct  2     AGVVVVFDFDKTIIDVDSDNWVVDGLGATELFDRLLPTMPWNTLIDTVMGELHAQGKTLR  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             D+  VL+  PI P +V AI+A + LG
Sbjct  62    DVADVLRAAPIDPHVVAAIRAAYSLG  87



>dbj|BAJ88911.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=274

 Score =   224 bits (571),  Expect(2) = 3e-84, Method: Compositional matrix adjust.
 Identities = 104/185 (56%), Positives = 134/185 (72%), Gaps = 3/185 (2%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCA-  662
            CDLR++SDAN FFIE +L H G+R  FSEINTNP  VD +GRLRI P HDFH+ PHGC  
Sbjct  88   CDLRVLSDANRFFIEAVLDHHGLRGYFSEINTNPSRVDADGRLRIAPHHDFHAGPHGCGL  147

Query  661  -RCPPNMCKSKIIERIQASMGK-EGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVW  488
              CPPNMCK ++++RI+AS    +G KR IYLGDG GD+CPSL+L   DFMMPRK FPVW
Sbjct  148  GTCPPNMCKGQVLDRIRASSATADGTKRFIYLGDGRGDYCPSLRLAREDFMMPRKGFPVW  207

Query  487  ELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFLAAESKFQAISMQPCEALP  308
            ELI EN  LL+AE+H WS+G+D E  L  LI+R+ +E+SQ L  + K +++ +   + +P
Sbjct  208  ELICENPGLLQAEVHPWSDGKDMEETLLRLISRVLVEESQLLPLDCKLESLPVAVQDGVP  267

Query  307  KAIRV  293
              + V
Sbjct  268  MPLGV  272


 Score =   117 bits (293),  Expect(2) = 3e-84, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFDKTIIDVDSDNWVVD LG T LFD+LL TMPWN+L+D +M E+HA GKT+ 
Sbjct  2     AGVVVVFDFDKTIIDVDSDNWVVDGLGATELFDRLLPTMPWNTLIDTVMGELHAQGKTLR  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             D+  VL+  PI P +V AI+A + LG
Sbjct  62    DVADVLRAAPIDPHVVAAIRAAYSLG  87



>ref|XP_009105956.1| PREDICTED: inorganic pyrophosphatase 1-like [Brassica rapa]
 emb|CDX96443.1| BnaA07g30540D [Brassica napus]
Length=291

 Score =   209 bits (532),  Expect(2) = 7e-84, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 120/147 (82%), Gaps = 3/147 (2%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCA-  662
            C+LRIVSDAN+FFIET+++HLGI E FSEIN+NPG+VDE   LRI P+HDF +S HGC  
Sbjct  94   CELRIVSDANMFFIETMVEHLGISELFSEINSNPGFVDEHDTLRISPYHDFTNSSHGCTL  153

Query  661  -RCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWE  485
              CPPNMCK  +IERIQ S+ KEGKK+ IYLGDG GD+CPSLKLKA D++MPRK+FPVW+
Sbjct  154  GTCPPNMCKGLVIERIQDSLAKEGKKK-IYLGDGAGDYCPSLKLKAEDYVMPRKNFPVWD  212

Query  484  LIKENRSLLEAEIHEWSNGEDFERILF  404
            LI +N  L++A I EW++GE  E+IL 
Sbjct  213  LISQNPLLVKATIREWTDGESLEKILM  239


 Score =   131 bits (329),  Expect(2) = 7e-84, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = -1

Query  1196  VCSPMAAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHA  1017
              C+      VVVFDFDKTIIDVDSDNWV+DELGFT LF+QLL TMPWN++MD MMKE+H 
Sbjct  2     ACNNNKNNIVVVFDFDKTIIDVDSDNWVIDELGFTDLFNQLLPTMPWNTVMDCMMKELHD  61

Query  1016  NGKTIGDIERVLQGVPIHPRIVPAIKAVHGLG  921
              GKTI +I++ L+ +PIHPRIVPAIKA H LG
Sbjct  62    QGKTIEEIKQALRTIPIHPRIVPAIKAAHALG  93



>ref|XP_009416458.1| PREDICTED: inorganic pyrophosphatase 3-like [Musa acuminata subsp. 
malaccensis]
Length=275

 Score =   223 bits (568),  Expect(2) = 9e-84, Method: Compositional matrix adjust.
 Identities = 106/187 (57%), Positives = 132/187 (71%), Gaps = 4/187 (2%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLR+VSDAN FFI+TIL+H G+ ECF EINTNP  VDEEGRLRI P HDF +  HGC+ 
Sbjct  88   CDLRVVSDANQFFIDTILRHHGLLECFKEINTNPSIVDEEGRLRIFPCHDFTTRSHGCSI  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK KII+RI+A+   EGKKR IYLGDG GD+CPSL L   D++MPRK +P+W LI
Sbjct  148  CPPNMCKGKIIDRIRAAAFVEGKKRFIYLGDGQGDYCPSLGLSEEDYVMPRKHYPLWSLI  207

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIED----SQFLAAESKFQAISMQPCEAL  311
              +   L AE+HEWS GE+ E++L  L++R    D    SQ  + + K + +   P E L
Sbjct  208  CNSPQPLRAEVHEWSTGEELEKVLLQLVDRSIDADRNCPSQMFSVDCKPKMVPASPTETL  267

Query  310  PKAIRVP  290
            P  +RVP
Sbjct  268  PLPLRVP  274


 Score =   117 bits (292),  Expect(2) = 9e-84, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFDKTIID DSDNWVVD LG   +F++L+ TMPWNSLMDRMM+E+HA G++I 
Sbjct  2     AGIVVVFDFDKTIIDCDSDNWVVDRLGVADVFERLIPTMPWNSLMDRMMRELHAGGRSIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI   L+  P+ P +V AIK  + LG
Sbjct  62    DIAACLRTAPLDPHVVEAIKTAYALG  87



>ref|XP_010097079.1| Inorganic pyrophosphatase 2 [Morus notabilis]
 gb|EXB66880.1| Inorganic pyrophosphatase 2 [Morus notabilis]
Length=277

 Score =   215 bits (548),  Expect(2) = 2e-83, Method: Compositional matrix adjust.
 Identities = 105/193 (54%), Positives = 133/193 (69%), Gaps = 11/193 (6%)
 Frame = -2

Query  844  FRCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGC  665
            F CDLRI+SDAN FFIET+LKH GI +CF EI TNP ++D EGRLRI P+HDF+SS HGC
Sbjct  87   FGCDLRILSDANAFFIETVLKHHGILDCFKEIKTNPSHIDGEGRLRISPYHDFNSSSHGC  146

Query  664  ARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWE  485
              CPPNMCK  I+ER++AS+  EGKKR ++ GDG  DFC  LKL+ G++++PRKDFPVW+
Sbjct  147  KICPPNMCKGAILERMRASLSAEGKKRFVHAGDGTADFCAGLKLEEGEYLLPRKDFPVWD  206

Query  484  LIKENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFLAAES--------KFQAISM  329
            +I +N  L++A I EWSN E+FE +L   IN     D    AA +        KFQ  S+
Sbjct  207  VICKNPMLIKANIREWSNWEEFEAVLLDTINGFLFADDSSTAARADQVIPVDCKFQQSSI  266

Query  328  QPCEALPKAIRVP  290
                A   A+RVP
Sbjct  267  S---ARQSALRVP  276


 Score =   124 bits (310),  Expect(2) = 2e-83, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 65/88 (74%), Gaps = 0/88 (0%)
 Frame = -1

Query  1184  MAAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKT  1005
             MA   V VFDFDKTIID DSDNWVV+ELGF  LF QLL TMPWNSLMDRMM EIH+ GKT
Sbjct  1     MANDVVFVFDFDKTIIDCDSDNWVVEELGFNDLFTQLLPTMPWNSLMDRMMMEIHSQGKT  60

Query  1004  IGDIERVLQGVPIHPRIVPAIKAVHGLG  921
             I DI   L+  PI P I+ AIK+ H  G
Sbjct  61    IHDIAECLKRAPIDPTIISAIKSAHAFG  88



>ref|XP_006426490.1| hypothetical protein CICLE_v10026265mg [Citrus clementina]
 gb|ESR39730.1| hypothetical protein CICLE_v10026265mg [Citrus clementina]
Length=272

 Score =   212 bits (540),  Expect(2) = 2e-83, Method: Compositional matrix adjust.
 Identities = 98/151 (65%), Positives = 120/151 (79%), Gaps = 4/151 (3%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDL+IVSDAN+FFIETILKH GI E FSEINTN  +VDEEGRLRI P HDF  S H C+ 
Sbjct  88   CDLKIVSDANVFFIETILKHHGIWELFSEINTNSSFVDEEGRLRIFPHHDFTKSSHACST  147

Query  658  --CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWE  485
              CPPNMCK  +IE+IQ SM KE  K++IY+GDG GDFCPSLKLK  D++MPRK+FPVW+
Sbjct  148  KICPPNMCKGVVIEKIQESMSKE--KKIIYIGDGTGDFCPSLKLKQTDYIMPRKNFPVWD  205

Query  484  LIKENRSLLEAEIHEWSNGEDFERILFHLIN  392
            LI +N  L++A+IHEW +G++ + +L  LIN
Sbjct  206  LICQNHKLIKADIHEWYDGQELQHVLLQLIN  236


 Score =   127 bits (318),  Expect(2) = 2e-83, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             A  VVVFDFDKTIID DSDNWVVDEL  T LF+QLL TMPWNSLM RMM+E+HA GKTI 
Sbjct  2     ADIVVVFDFDKTIIDCDSDNWVVDELHATELFNQLLPTMPWNSLMGRMMEELHAQGKTIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI  VL+  PIHP I+ AIKA H LG
Sbjct  62    DIAEVLKRAPIHPSIISAIKAAHDLG  87



>ref|XP_010106679.1| Inorganic pyrophosphatase 2 [Morus notabilis]
 gb|EXC11128.1| Inorganic pyrophosphatase 2 [Morus notabilis]
Length=252

 Score =   218 bits (555),  Expect(2) = 2e-83, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 124/159 (78%), Gaps = 1/159 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRIVSDAN FFIETIL+HLG+ ECF+EI TNP +VDEEGRLRI PFH  +  P G   
Sbjct  88   CDLRIVSDANAFFIETILEHLGLMECFTEIYTNPSFVDEEGRLRIFPFH-VNKCPLGWNL  146

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  I+ERI+ASM  EG KR IYLGDG+GD+CPSLKLK  DF+MPRK+FPVWELI
Sbjct  147  CPPNMCKGLILERIRASMAAEGNKRFIYLGDGVGDYCPSLKLKGRDFVMPRKNFPVWELI  206

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFL  362
             +N  L++A I  W++GE+ E+ L  LI+ I IE++  L
Sbjct  207  SKNPQLIKANIQAWTDGEELEKTLLSLIDTIFIEENASL  245


 Score =   120 bits (302),  Expect(2) = 2e-83, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = -1

Query  1169  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  990
             VVVFDFDKTII+ D +N VVDELG T LF+QLL TM WNSLM+RMMKE+H  GKTI DI 
Sbjct  5     VVVFDFDKTIIECDCENLVVDELGATDLFNQLLPTMTWNSLMNRMMKELHEQGKTIEDIV  64

Query  989   RVLQGVPIHPRIVPAIKAVHGLG  921
              VL+  PIHPR+V AIKA H LG
Sbjct  65    EVLKQTPIHPRVVAAIKAAHALG  87



>ref|XP_010471347.1| PREDICTED: inorganic pyrophosphatase 1-like [Camelina sativa]
Length=291

 Score =   218 bits (556),  Expect(2) = 3e-83, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 120/146 (82%), Gaps = 2/146 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LRIVSDAN+FFIETI++HLGI E FSEIN+NPGYVDE G LRI P+HDF  +PHGC+ 
Sbjct  92   CELRIVSDANMFFIETIVEHLGISEFFSEINSNPGYVDERGTLRISPYHDFTKTPHGCSN  151

Query  658  --CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWE  485
              CPPNMCK  IIERIQ S+ KEGK ++IYLGDG GD+CPSLKL A D++MPRK+FPVW+
Sbjct  152  STCPPNMCKGLIIERIQQSLAKEGKNKMIYLGDGAGDYCPSLKLTAEDYVMPRKNFPVWD  211

Query  484  LIKENRSLLEAEIHEWSNGEDFERIL  407
            LI +N  L++A I EW++G+  E IL
Sbjct  212  LISQNPMLIKAAIREWTDGQSLEMIL  237


 Score =   119 bits (299),  Expect(2) = 3e-83, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 67/80 (84%), Gaps = 4/80 (5%)
 Frame = -1

Query  1160  FDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIERVL  981
             FDFD    +VDSDNWV+DELGFT LF+QLL TMPWN+LMDRMMKE+H  GKTI +I++ L
Sbjct  16    FDFD----NVDSDNWVIDELGFTDLFNQLLPTMPWNTLMDRMMKELHDQGKTIEEIKQAL  71

Query  980   QGVPIHPRIVPAIKAVHGLG  921
             + +PIHPR+VPAIK+ H LG
Sbjct  72    RTIPIHPRVVPAIKSAHELG  91



>emb|CDJ26592.1| unnamed protein product [Triticum aestivum]
Length=275

 Score =   220 bits (560),  Expect(2) = 5e-83, Method: Compositional matrix adjust.
 Identities = 104/186 (56%), Positives = 136/186 (73%), Gaps = 4/186 (2%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCA-  662
            CDLRI+SDAN FFIET+L H G+R CFSEINTNP  VD +GRLRI P HDFH++PHGC  
Sbjct  88   CDLRILSDANRFFIETVLDHHGLRGCFSEINTNPSRVDADGRLRIAPHHDFHAAPHGCGL  147

Query  661  -RCPPNMCKSKIIERIQASMGKEG--KKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPV  491
              CPPNMCK ++++RI+AS       +KR IYLGDG GD+CPSL+L   DFMMPRK +PV
Sbjct  148  GTCPPNMCKGQVLDRIRASAAAADGARKRFIYLGDGRGDYCPSLRLAREDFMMPRKGYPV  207

Query  490  WELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFLAAESKFQAISMQPCEAL  311
            W+LI EN  LL+AE+H WS+G+D E  L  LI+R+ +E+SQ L  + K +++ +   + +
Sbjct  208  WDLICENPGLLQAEVHLWSDGKDMEETLLRLISRVLVEESQLLPLDCKLESLPVAVQDGM  267

Query  310  PKAIRV  293
            P  + V
Sbjct  268  PMPLGV  273


 Score =   117 bits (293),  Expect(2) = 5e-83, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFDKTIIDVDSDNWVVD LG T LFD+LL TMPWN+L+D +M E+HA G+T+ 
Sbjct  2     AGVVVVFDFDKTIIDVDSDNWVVDGLGATELFDRLLPTMPWNTLIDTVMGELHAQGRTLR  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             D+  VL+  PI P++V AI+A + LG
Sbjct  62    DVADVLRAAPIDPQVVAAIRAAYSLG  87



>ref|XP_004291030.1| PREDICTED: inorganic pyrophosphatase 2-like [Fragaria vesca subsp. 
vesca]
Length=278

 Score =   211 bits (538),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 137/187 (73%), Gaps = 5/187 (3%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRIVSDAN+FFIETILKH G+ + FSEINTNPG+VDE+GRLRILP++DF SS HGC  
Sbjct  88   CDLRIVSDANVFFIETILKHHGLLDYFSEINTNPGFVDEQGRLRILPYYDFSSSSHGCNI  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CP NMCK  ++E+I+AS+  +GKK+++Y+GDG  DFC  LKL+ GD +MPRKDFP+ +LI
Sbjct  148  CPSNMCKGLVMEKIRASVSADGKKQLVYVGDGTPDFCAGLKLEEGDVLMPRKDFPICDLI  207

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIEDS---QFLAAESKFQ--AISMQPCEA  314
              N  L++A+IHEWSN ++    L   +N   I++S     L    K+Q  +IS+   EA
Sbjct  208  SANPLLIKAKIHEWSNWDELSTNLLSTVNNALIDESAKTDQLVPLCKYQNSSISVTAHEA  267

Query  313  LPKAIRV  293
            L KA+ V
Sbjct  268  LQKALPV  274


 Score =   124 bits (310),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             A  VV+FDFDKTIID DSDNWVV+ELG   LF QLLH  PWN++MDRMM E+H  GKTI 
Sbjct  2     ARLVVIFDFDKTIIDCDSDNWVVEELGINHLFTQLLHNFPWNAIMDRMMTELHHRGKTIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DIE  L+ VP+HP I  AI++VH LG
Sbjct  62    DIEECLKKVPLHPSIASAIESVHALG  87



>gb|EMT33032.1| Putative phosphatase phospho1 [Aegilops tauschii]
Length=271

 Score =   221 bits (563),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 101/184 (55%), Positives = 133/184 (72%), Gaps = 4/184 (2%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCA-  662
            CDLR++SDAN FFIE +L H G+R CFSEINTNP  VD +GRLRI P HDFH+ PHGC  
Sbjct  88   CDLRVLSDANRFFIEAVLDHHGLRGCFSEINTNPSRVDADGRLRIAPHHDFHAGPHGCGL  147

Query  661  -RCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWE  485
              CPPNMCK ++++RI+AS   + +KR IYLGDG GD+CPSL+L   DFMMPRK FPVW+
Sbjct  148  GTCPPNMCKGQVLDRIRAS--ADARKRFIYLGDGRGDYCPSLRLAREDFMMPRKGFPVWD  205

Query  484  LIKENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFLAAESKFQAISMQPCEALPK  305
            LI EN  LL+AE+H WS+G+D +  L  LI+R+ +E+S  L  + K +++     + +P 
Sbjct  206  LICENPGLLQAEVHPWSDGKDMQETLLRLISRVLVEESTLLPLDCKLESLPAAVQDGMPM  265

Query  304  AIRV  293
             + V
Sbjct  266  PLGV  269


 Score =   114 bits (285),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = -1

Query  1175  GTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGD  996
             G VVVFDFDKTIIDVDSDNWVVD LG T LFD+LL TMPWN+L+D +M E+HA G+ + D
Sbjct  3     GVVVVFDFDKTIIDVDSDNWVVDGLGATELFDRLLPTMPWNTLIDTVMGELHAQGRPLRD  62

Query  995   IERVLQGVPIHPRIVPAIKAVHGLG  921
             +  VL+  PI P +V AI+A H LG
Sbjct  63    VADVLRAAPIDPHVVAAIRAAHSLG  87



>ref|XP_010540076.1| PREDICTED: inorganic pyrophosphatase 2-like [Tarenaya hassleriana]
Length=285

 Score =   204 bits (518),  Expect(2) = 4e-82, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 121/146 (83%), Gaps = 2/146 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LRIVSDAN+FFIET+L+HLGI++ FSEINTNPG++DE GRLRI P+HDF  S HGC+R
Sbjct  95   CELRIVSDANMFFIETVLEHLGIKDLFSEINTNPGFIDEHGRLRISPYHDFTKSSHGCSR  154

Query  658  CPPNMCKSKIIERIQASMG--KEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWE  485
            CPPNMCK+ +IE+IQ S+    E KK++IYLGDG GD+CP+LKL   D+MMPRK++PVW+
Sbjct  155  CPPNMCKALVIEKIQDSLSKEAEKKKKIIYLGDGAGDYCPALKLDDVDYMMPRKNYPVWD  214

Query  484  LIKENRSLLEAEIHEWSNGEDFERIL  407
            LI EN  L+ A+I EW +GE  E++L
Sbjct  215  LISENTMLISAKIREWIDGETLEKVL  240


 Score =   131 bits (329),  Expect(2) = 4e-82, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = -1

Query  1169  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  990
             VV+FDFDKTIIDVDSDNWV+DELGFT LF+QLL +MPWNSLMDRMM+E+     TI D++
Sbjct  12    VVIFDFDKTIIDVDSDNWVLDELGFTDLFNQLLPSMPWNSLMDRMMEELRDEDVTIDDVK  71

Query  989   RVLQGVPIHPRIVPAIKAVHGLG  921
             RVL+ +PIHPR+VPAIK+ H LG
Sbjct  72    RVLRTIPIHPRVVPAIKSAHALG  94



>ref|XP_009415365.1| PREDICTED: inorganic pyrophosphatase 2-like [Musa acuminata subsp. 
malaccensis]
Length=279

 Score =   220 bits (560),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 109/193 (56%), Positives = 133/193 (69%), Gaps = 8/193 (4%)
 Frame = -2

Query  844  FRCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGC  665
              C+LRIVSDAN FFI TIL+H  +   FSEINTNPGYVDE GRLRI P HDF +SPHGC
Sbjct  86   LECELRIVSDANRFFINTILEHHKLMSYFSEINTNPGYVDEVGRLRIFPHHDFETSPHGC  145

Query  664  ARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWE  485
            + CPPNMCKS IIER+QAS   EG+KR IYLGDG GD+CPSL+L   D++MPRK +P+WE
Sbjct  146  SLCPPNMCKSTIIERMQASPLVEGRKRFIYLGDGKGDYCPSLRLNKEDYVMPRKKYPLWE  205

Query  484  LIKEN--RSLLEAEIHEWSNGEDFERILFHLINRICIE-----DSQFLAAESKFQAISMQ  326
            LI +N     L A IHEWS+ E+ E++L  LIN          D+Q ++ + KFQ   + 
Sbjct  206  LIVDNPPEGALRASIHEWSDAEELEKVLLRLINESVTADRGNVDNQLVSVDCKFQTTPLS  265

Query  325  PCE-ALPKAIRVP  290
              E  LP  + VP
Sbjct  266  SHEDNLPNPLPVP  278


 Score =   111 bits (278),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 62/85 (73%), Gaps = 0/85 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             A  VVVFDFDKTIID DSDNWVVD LG T LFD+LL TMPWNS MDRMM E H+ G+TI 
Sbjct  2     ANVVVVFDFDKTIIDCDSDNWVVDHLGGTQLFDELLKTMPWNSAMDRMMGEFHSQGRTIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGL  924
             +IE  L+  P+    + AIK+ + L
Sbjct  62    EIEESLRRAPLPANTIAAIKSAYSL  86



>ref|XP_006466068.1| PREDICTED: inorganic pyrophosphatase 1-like isoform X1 [Citrus 
sinensis]
Length=272

 Score =   206 bits (524),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 117/147 (80%), Gaps = 4/147 (3%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDL+IVSDANLFFIETILKH GI E FSEINTN  +VDEEGRL+I P HDF  S H C+ 
Sbjct  88   CDLKIVSDANLFFIETILKHHGIWELFSEINTNSSFVDEEGRLKIFPHHDFTKSSHACST  147

Query  658  --CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWE  485
              CPPNMCK  +IE+IQ SM KE  K++IY+GDG GDFCPSLKLK  D++MPRK+FPVW+
Sbjct  148  NICPPNMCKGVVIEKIQESMSKE--KKIIYIGDGTGDFCPSLKLKQTDYIMPRKNFPVWD  205

Query  484  LIKENRSLLEAEIHEWSNGEDFERILF  404
            LI +N  L++A+IHEW +G++ + +L 
Sbjct  206  LICQNHKLIKADIHEWYDGQELQHVLL  232


 Score =   125 bits (313),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             A  VVVFDFDKTIID DSDNWVVDEL  T LF+QLL TMPWNSLM RMM+E+HA GKTI 
Sbjct  2     ADIVVVFDFDKTIIDCDSDNWVVDELHATELFNQLLPTMPWNSLMGRMMEELHAQGKTIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI  VL+  PIHP I+ A+KA H LG
Sbjct  62    DIVEVLKRAPIHPSIISAVKAAHDLG  87



>ref|XP_011009701.1| PREDICTED: inorganic pyrophosphatase 3-like [Populus euphratica]
Length=313

 Score =   212 bits (540),  Expect(2) = 5e-81, Method: Compositional matrix adjust.
 Identities = 101/187 (54%), Positives = 132/187 (71%), Gaps = 7/187 (4%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSP-HGCA  662
            CDLR+VSD+N FFIET+LKH G+ +CFSEINTNP YVD EGRLRIL +HD +  P HGC 
Sbjct  122  CDLRVVSDSNYFFIETVLKHNGLMDCFSEINTNPSYVDAEGRLRILQYHDVNKFPSHGCT  181

Query  661  RCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWEL  482
             CPPNMCK  +++RIQAS+  EG+K+ IY+GDG  DFCP+L LK  D +MPRK+FP+WEL
Sbjct  182  SCPPNMCKGLVMKRIQASVSAEGEKQFIYVGDGKNDFCPALTLKETDALMPRKNFPLWEL  241

Query  481  IKENRSLLEAEIHEWSNGEDFERILFHLINRICIED------SQFLAAESKFQAISMQPC  320
            I  N+ L+EA I EWS+ E+ E  L +L N I IE+       Q +  + KF+  S+   
Sbjct  242  ICNNKMLVEANIQEWSDWEELETKLHNLTNTIFIEEKCSVRSDQLVPVDCKFETSSISAP  301

Query  319  EALPKAI  299
             A+ + +
Sbjct  302  AAVNRNV  308


 Score =   118 bits (296),  Expect(2) = 5e-81, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             A  VVVFDFDKTIID DSDNWVV+EL   GLF QLL ++PWN LMD+MM E+H+ GKTI 
Sbjct  36    AKVVVVFDFDKTIIDCDSDNWVVEELDVHGLFAQLLPSLPWNRLMDKMMMELHSRGKTIQ  95

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI   L+ VP+HPRI+  IK+ H  G
Sbjct  96    DIAECLKKVPLHPRIISTIKSAHASG  121



>ref|NP_001242832.1| uncharacterized protein LOC100789743 [Glycine max]
 gb|ACU21395.1| unknown [Glycine max]
Length=277

 Score =   210 bits (535),  Expect(2) = 4e-80, Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 132/190 (69%), Gaps = 8/190 (4%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+L+IVSDAN+FFIETILKH G+  CFSE+  NP YV+EEGRLRI P+HD+    HGC  
Sbjct  88   CELKIVSDANIFFIETILKHHGVWNCFSEVTANPSYVNEEGRLRISPYHDYLKCSHGCNL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  I ERIQ S+   GKK  IYLGDG GDFCPSLKLK  D++MPRK+FP+ +L+
Sbjct  148  CPPNMCKGMITERIQNSVDAAGKK-FIYLGDGSGDFCPSLKLKDRDYLMPRKNFPLCDLV  206

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLI-------NRICIEDSQFLAAESKFQAISMQPC  320
             EN   ++AE+H W +GE+   +L H I       N+  I  +  ++ + K  +IS++  
Sbjct  207  SENSKHIKAEVHAWRDGEELYDVLLHFIDKAIGEGNKNIISSTPIVSVDCKLGSISIEAH  266

Query  319  EALPKAIRVP  290
            + LP+AI VP
Sbjct  267  KPLPRAIPVP  276


 Score =   117 bits (294),  Expect(2) = 4e-80, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VV+FDFD TII+ DSDNWV+DE G T  F QLL  M WN LMD+MM E+H+ GKTI 
Sbjct  2     AGIVVIFDFDSTIIECDSDNWVLDEFGLTEKFYQLLPNMLWNPLMDKMMNELHSQGKTIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI +VL   P+HPRIVPAIKA + LG
Sbjct  62    DIVQVLNRTPMHPRIVPAIKAAYSLG  87



>ref|XP_009385786.1| PREDICTED: inorganic pyrophosphatase 2-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=277

 Score =   217 bits (553),  Expect(2) = 6e-80, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 137/188 (73%), Gaps = 5/188 (3%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LRIVSDAN FFIETIL+H G+   FSEINTNPGYVDEEGRLRILP+HDF +S HGC  
Sbjct  89   CELRIVSDANRFFIETILEHHGLGSYFSEINTNPGYVDEEGRLRILPYHDFKTSSHGCGL  148

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCKS IIERIQAS   EG+KR IYLGDG GD+CP+L+L   D++MPRK+ P WELI
Sbjct  149  CPPNMCKSTIIERIQASASLEGRKRFIYLGDGKGDYCPALRLSEEDYVMPRKNHPAWELI  208

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLI-NRICIEDS---QFLAAESKFQ-AISMQPCEA  314
              N   L AEIH W + E+ E +L  LI + I    S   + ++A+ KFQ  + +   EA
Sbjct  209  LANPRALRAEIHGWGDAEELEEVLLRLIGDSISARGSDANRLISADCKFQTTMPLSSHEA  268

Query  313  LPKAIRVP  290
            LPK +RVP
Sbjct  269  LPKPLRVP  276


 Score =   110 bits (274),  Expect(2) = 6e-80, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 64/88 (73%), Gaps = 0/88 (0%)
 Frame = -1

Query  1184  MAAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKT  1005
             MA   +VVFDFDKTIID DSDNWV+D+LG T LFDQ+L TMPWNS MDR+M  +H+ G+T
Sbjct  1     MADNVIVVFDFDKTIIDCDSDNWVIDDLGGTQLFDQMLQTMPWNSAMDRVMGALHSQGRT  60

Query  1004  IGDIERVLQGVPIHPRIVPAIKAVHGLG  921
             + +I   L+  P+    V A+KA + LG
Sbjct  61    VDEITASLRRAPLPAHTVAAVKAAYALG  88



>ref|XP_002458417.1| hypothetical protein SORBIDRAFT_03g033100 [Sorghum bicolor]
 gb|EES03537.1| hypothetical protein SORBIDRAFT_03g033100 [Sorghum bicolor]
Length=278

 Score =   198 bits (504),  Expect(2) = 9e-80, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 123/164 (75%), Gaps = 9/164 (5%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCA-  662
            CDLR++SDAN FFIET+L+H GIR CFS+INTNP +VD +GRLRI P+H   ++PHGC  
Sbjct  88   CDLRVLSDANAFFIETVLEHHGIRGCFSQINTNPSHVDADGRLRIGPYH---AAPHGCGV  144

Query  661  -RCPPNMCKSKIIERI--QASMGKEGK--KRVIYLGDGIGDFCPSLKLKAGDFMMPRKDF  497
              CPPNMCK  +++RI  +A+ G  G+  KRVIYLGDG GD+CPSL+L   DFMMPR+ +
Sbjct  145  GTCPPNMCKGLVLDRILREAAAGTTGRSTKRVIYLGDGRGDYCPSLRLAREDFMMPRRGY  204

Query  496  PVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQF  365
            PVW+LI+E+ + ++AE+H W++G D E  L  L+ R  +E++  
Sbjct  205  PVWDLIREDPARVQAEVHPWADGADLEETLLRLVGRALVEEAAL  248


 Score =   128 bits (321),  Expect(2) = 9e-80, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFDKTIIDVDSDNWVVD LGFT LF++LL TMPWN+LMD MM E+HA GKT+G
Sbjct  2     AGIVVVFDFDKTIIDVDSDNWVVDNLGFTELFERLLPTMPWNTLMDTMMGELHAAGKTLG  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG*CSFL*LS  897
             D+  VL+  PI PR+  AIKA + LG C    LS
Sbjct  62    DVAEVLRAAPIDPRVPAAIKAAYALG-CDLRVLS  94



>ref|XP_003531626.1| PREDICTED: inorganic pyrophosphatase 2-like [Glycine max]
Length=276

 Score =   211 bits (538),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 99/189 (52%), Positives = 134/189 (71%), Gaps = 7/189 (4%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C L+IVSDAN+FFIETILKH G+  CFSE+  NP +V+E GRL I P+HD+  S HGC  
Sbjct  88   CHLKIVSDANIFFIETILKHHGVWNCFSEVIANPSHVNE-GRLNICPYHDYLKSSHGCNL  146

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  +IERIQ S+   GKK++IYLGDG GDFCPSL+LK  D++MPRKDFP+ +L+
Sbjct  147  CPPNMCKGLVIERIQNSLAAAGKKKIIYLGDGNGDFCPSLRLKDSDYLMPRKDFPLCDLV  206

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIEDS------QFLAAESKFQAISMQPCE  317
             +N + ++AE+H W +G++ E +L H+IN+   E S      Q ++ + K   I +   +
Sbjct  207  SKNSNKIKAEVHGWRDGKELEHVLLHVINKAIGEGSNINNSTQKVSVDCKMGPIPIDTLQ  266

Query  316  ALPKAIRVP  290
             LPKA+ VP
Sbjct  267  PLPKALSVP  275


 Score =   114 bits (286),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VV+FDFD TII+ DSDNWV+DE G T  F QLL +M WN LMD+MM E+H+ GKTI 
Sbjct  2     AGIVVIFDFDSTIIECDSDNWVLDETGLTEKFYQLLPSMAWNPLMDKMMNELHSQGKTIQ  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI  +L   P+HPR VPAI+A + LG
Sbjct  62    DIVEILNRTPMHPRTVPAIEAAYSLG  87



>ref|XP_006644635.1| PREDICTED: inorganic pyrophosphatase 1-like [Oryza brachyantha]
Length=278

 Score =   206 bits (523),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 119/149 (80%), Gaps = 4/149 (3%)
 Frame = -2

Query  856  SC*IFRCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSS  677
            +C    CDLRI+SDAN FFIETIL H G+   FSEINTNPG VD +GRLRI P+HDFH++
Sbjct  82   ACYGLGCDLRILSDANRFFIETILDHHGLGGYFSEINTNPGAVDGDGRLRIAPYHDFHAA  141

Query  676  PHGCAR--CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRK  503
            PHGC    CPPNMCK ++++RI+AS G +  KRVIYLGDG GD+CPSL+L  GDFMMPRK
Sbjct  142  PHGCGLGICPPNMCKGQVLDRIRASAGAD--KRVIYLGDGRGDYCPSLRLGRGDFMMPRK  199

Query  502  DFPVWELIKENRSLLEAEIHEWSNGEDFE  416
             FPVW+LI E+ SLL+AE+H W++G++ E
Sbjct  200  GFPVWDLICEDPSLLQAEVHPWTDGQEME  228


 Score =   120 bits (300),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFDKTIIDVDSDNWVVD LG T  F++LL TMPWN+LMD MM E+HA GKT G
Sbjct  2     AGIVVVFDFDKTIIDVDSDNWVVDGLGATEEFERLLPTMPWNTLMDTMMGELHARGKTAG  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             D+  VL+  P+ P +V AIKA +GLG
Sbjct  62    DVAAVLRAAPLDPCVVDAIKACYGLG  87



>ref|XP_010924487.1| PREDICTED: inorganic pyrophosphatase 2-like [Elaeis guineensis]
Length=248

 Score =   221 bits (562),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 103/160 (64%), Positives = 123/160 (77%), Gaps = 0/160 (0%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LR+VSDANLFFIETILKH G+ E FSEINTNP YVDEEGRLRI P+HDF +S HGC+ 
Sbjct  88   CELRVVSDANLFFIETILKHHGLLEYFSEINTNPSYVDEEGRLRIFPYHDFTTSLHGCSL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            C PNMCK KIIERIQA    E KKR IYLGDG GD+CPSL+L   D +MPRK++P+W+LI
Sbjct  148  CLPNMCKGKIIERIQAQASAERKKRFIYLGDGRGDYCPSLRLSEEDHVMPRKNYPLWKLI  207

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFLA  359
             +N    +AE+HEWSN E+ +RIL  LI+R    D +  A
Sbjct  208  GDNPQQFKAEVHEWSNAEELQRILLQLIDRSITVDRKNAA  247


 Score =   105 bits (261),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG +VVFDFD+T+ID DSD+WVV+ELG T LF  L   M WNSLM+RMM+E+H+ GKTI 
Sbjct  2     AGIIVVFDFDRTMIDCDSDSWVVNELGATELFQSLRPAMSWNSLMERMMRELHSQGKTIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             +I   L+ +P  P ++ AIK+ +  G
Sbjct  62    EIADCLKRIPFDPHVIAAIKSAYAHG  87



>ref|XP_003569699.1| PREDICTED: inorganic pyrophosphatase 1-like [Brachypodium distachyon]
Length=270

 Score =   201 bits (512),  Expect(2) = 3e-79, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 132/187 (71%), Gaps = 12/187 (6%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCA-  662
            CDLR++SDAN FFIETIL H G+R CFSEINTNP  VD +GRLRI P+H   ++PHGC  
Sbjct  88   CDLRVLSDANGFFIETILDHHGLRGCFSEINTNPSLVDADGRLRIGPYH---ATPHGCGV  144

Query  661  -RCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWE  485
              CPPNMCK ++++RI+AS      KRVIYLGDG GD+CPSL+L   DF+MPR+ FPVW+
Sbjct  145  GTCPPNMCKGQVLDRIRAS---SVGKRVIYLGDGRGDYCPSLRLGRDDFVMPRRGFPVWD  201

Query  484  LIKENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFLAAE-SKFQAISMQPCEALP  308
            LI EN  LL+AE+H WS+G D E  L  L+ ++ +E+S+ L  +  K +++   P  A+ 
Sbjct  202  LICENPGLLQAEVHPWSDGGDMEETLLRLVRKVLVEESRLLPLDCCKLESL---PVAAVQ  258

Query  307  KAIRVPF  287
              + +P 
Sbjct  259  DGMPMPL  265


 Score =   123 bits (309),  Expect(2) = 3e-79, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFDKTIIDVDSDNWVVD LG T LFD+LL TMPWN+L+D MM E+HA GKT+ 
Sbjct  2     AGVVVVFDFDKTIIDVDSDNWVVDSLGATELFDRLLPTMPWNALIDTMMGELHARGKTVH  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             D+  VL+  PI PR+  AIKA +GLG
Sbjct  62    DVAEVLRSAPIDPRVGAAIKAAYGLG  87



>gb|ACU18702.1| unknown [Glycine max]
Length=198

 Score =   183 bits (464),  Expect(2) = 3e-79, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRIVSDAN+FFIETILKHLGIRE FSEINTNPGYV+EEGRLRI P HDF+ + HGC+ 
Sbjct  88   CDLRIVSDANVFFIETILKHLGIREYFSEINTNPGYVNEEGRLRIQPCHDFNKASHGCSL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPR  506
            CPPNMCK  II+RIQ S+ +EG KR+IYLGDG GD+CPSL+LK  +FMMPR
Sbjct  148  CPPNMCKGLIIDRIQDSISQEGNKRMIYLGDGSGDYCPSLRLKERNFMMPR  198


 Score =   142 bits (357),  Expect(2) = 3e-79, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             +G VVVFDFDKTI+DVDSDNWVVD+LGFT LF+QLL TMPWNSLMDRMM E+H+NGKTI 
Sbjct  2     SGIVVVFDFDKTIVDVDSDNWVVDDLGFTDLFNQLLPTMPWNSLMDRMMMELHSNGKTIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DIE VL  +P+HPR++PAI+A H LG
Sbjct  62    DIEEVLHRIPLHPRVIPAIQAAHALG  87



>ref|XP_006582843.1| PREDICTED: uncharacterized protein LOC100306469 isoform X1 [Glycine 
max]
Length=276

 Score =   211 bits (538),  Expect(2) = 4e-79, Method: Compositional matrix adjust.
 Identities = 99/189 (52%), Positives = 137/189 (72%), Gaps = 7/189 (4%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDL+IVSDAN+FFIETILKH G+  CFS++  NP +V+E GRL I P+HD+  S HGC  
Sbjct  88   CDLKIVSDANIFFIETILKHHGVWNCFSDVIANPIHVNE-GRLNICPYHDYLKSSHGCNL  146

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  +IERIQ S+   GKK++IYLGDG GDFCPSL+LK GD++MPRKDFP+ +L+
Sbjct  147  CPPNMCKGLVIERIQNSLAAAGKKKLIYLGDGNGDFCPSLRLKDGDYVMPRKDFPLCDLV  206

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIE------DSQFLAAESKFQAISMQPCE  317
             +N + ++AE+H W +G++ E +L H+IN+   E       +Q ++ + K   I++   +
Sbjct  207  SKNSNKIKAEVHGWRDGKELEHVLLHVINKEIGEGNNINNSTQKVSVDCKMGPIAIDTRQ  266

Query  316  ALPKAIRVP  290
             LPKA+ VP
Sbjct  267  PLPKALSVP  275


 Score =   113 bits (282),  Expect(2) = 4e-79, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VV+FDFD TII+ DSDNWV+DE G T  F QLL +  WN LMD+MM E+H+ GKTI 
Sbjct  2     AGIVVIFDFDSTIIECDSDNWVLDETGLTEKFYQLLPSTHWNPLMDKMMNELHSQGKTIQ  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI ++L   P+HPRIVPAI+A + LG
Sbjct  62    DIVQILSRTPMHPRIVPAIEAAYSLG  87



>ref|XP_008360958.1| PREDICTED: inorganic pyrophosphatase 2-like [Malus domestica]
Length=284

 Score =   198 bits (503),  Expect(2) = 4e-79, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 117/157 (75%), Gaps = 0/157 (0%)
 Frame = -2

Query  844  FRCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGC  665
            F CDLR++SDAN FFI+ ILKH GI +CFSEI TNP ++DE+ RLRILPFHDF SS HGC
Sbjct  87   FGCDLRVLSDANDFFIDAILKHHGIMDCFSEIKTNPSFIDEQRRLRILPFHDFISSSHGC  146

Query  664  ARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWE  485
              CPPNMCK  ++E+I+AS+  +GKK  IY+GDG  DFC  LKL+ GDF++PRK++P+W+
Sbjct  147  TLCPPNMCKGLVMEKIRASVSADGKKHFIYVGDGAPDFCAGLKLEEGDFLLPRKNYPIWD  206

Query  484  LIKENRSLLEAEIHEWSNGEDFERILFHLINRICIED  374
            LI  N  L +A+IHEW+  ++   IL + +    I D
Sbjct  207  LISANPLLTKAKIHEWNECDELGTILLNTVKAFFIGD  243


 Score =   126 bits (316),  Expect(2) = 4e-79, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 66/88 (75%), Gaps = 0/88 (0%)
 Frame = -1

Query  1184  MAAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKT  1005
             MAAG VVVFDFDKTIID DSDNWVVDELG   LF QLL TMPWN LMDRMM  +HA  KT
Sbjct  1     MAAGMVVVFDFDKTIIDCDSDNWVVDELGVDDLFTQLLPTMPWNPLMDRMMTALHARRKT  60

Query  1004  IGDIERVLQGVPIHPRIVPAIKAVHGLG  921
             I DI   L+ VPIHP IV AIK+ H  G
Sbjct  61    IQDISECLKRVPIHPNIVSAIKSAHAFG  88



>ref|XP_006426491.1| hypothetical protein CICLE_v10026265mg [Citrus clementina]
 gb|ESR39731.1| hypothetical protein CICLE_v10026265mg [Citrus clementina]
Length=264

 Score =   196 bits (499),  Expect(2) = 7e-79, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 114/151 (75%), Gaps = 12/151 (8%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDL+IVSDAN+FFIETILKH GI E FSEINTN  +VDEEGRLRI P HDF  S H C+ 
Sbjct  88   CDLKIVSDANVFFIETILKHHGIWELFSEINTNSSFVDEEGRLRIFPHHDFTKSSHACST  147

Query  658  --CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWE  485
              CPPNMCK         SM KE  K++IY+GDG GDFCPSLKLK  D++MPRK+FPVW+
Sbjct  148  KICPPNMCKE--------SMSKE--KKIIYIGDGTGDFCPSLKLKQTDYIMPRKNFPVWD  197

Query  484  LIKENRSLLEAEIHEWSNGEDFERILFHLIN  392
            LI +N  L++A+IHEW +G++ + +L  LIN
Sbjct  198  LICQNHKLIKADIHEWYDGQELQHVLLQLIN  228


 Score =   127 bits (318),  Expect(2) = 7e-79, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             A  VVVFDFDKTIID DSDNWVVDEL  T LF+QLL TMPWNSLM RMM+E+HA GKTI 
Sbjct  2     ADIVVVFDFDKTIIDCDSDNWVVDELHATELFNQLLPTMPWNSLMGRMMEELHAQGKTIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI  VL+  PIHP I+ AIKA H LG
Sbjct  62    DIAEVLKRAPIHPSIISAIKAAHDLG  87



>ref|XP_002324759.2| hypothetical protein POPTR_0018s05070g [Populus trichocarpa]
 gb|EEF03324.2| hypothetical protein POPTR_0018s05070g [Populus trichocarpa]
Length=287

 Score =   214 bits (544),  Expect(2) = 7e-79, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 133/187 (71%), Gaps = 7/187 (4%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSP-HGCA  662
            CDLRIVSD+N FFIET+LKH G+ +CFSEINTNP YVD EGRLRIL +HD +  P HGC 
Sbjct  96   CDLRIVSDSNYFFIETVLKHNGLMDCFSEINTNPSYVDGEGRLRILQYHDVNKFPSHGCT  155

Query  661  RCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWEL  482
             CPPNMCK  +++RIQAS+  EG+K+ IY+GDG  DFCP+L LK  D +MPRK+FP+WEL
Sbjct  156  SCPPNMCKGLVMKRIQASVSAEGEKQFIYVGDGKNDFCPALTLKETDALMPRKNFPLWEL  215

Query  481  IKENRSLLEAEIHEWSNGEDFERILFHLINRICIED------SQFLAAESKFQAISMQPC  320
            I  N+ L+EA I EWS+ E+ E  L +L N I IE+       Q +  + KFQ  S+   
Sbjct  216  ICNNKMLVEANIQEWSDWEELESKLHNLTNTIFIEEKCSVRADQLVPVDCKFQTSSISAP  275

Query  319  EALPKAI  299
            +A+ + +
Sbjct  276  DAVNRNV  282


 Score =   110 bits (274),  Expect(2) = 7e-79, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             A  VVVFDFDKTIID DSDNWVV++L    LF QLL ++PWN LMD+MM E+H+ GKTI 
Sbjct  10    AKVVVVFDFDKTIIDCDSDNWVVEKLDVHDLFAQLLPSLPWNRLMDKMMMELHSRGKTIQ  69

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI   L+ VP++PR++ AIK+ +  G
Sbjct  70    DIAECLKKVPLNPRMISAIKSAYASG  95



>gb|KHN11301.1| Inorganic pyrophosphatase 2 [Glycine soja]
Length=277

 Score =   207 bits (528),  Expect(2) = 2e-78, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 135/190 (71%), Gaps = 8/190 (4%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C L+IVSDAN+FFIETILKH G+  CFSE+  NP +V+E GRL I P+HD+  S HGC  
Sbjct  88   CHLKIVSDANIFFIETILKHHGVWNCFSEVIANPSHVNE-GRLNICPYHDYLKSSHGCNL  146

Query  658  CPPNMCKSK-IIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWEL  482
            CPPNMCK+  +IERIQ S+   GKK++IYLGDG GDFCPSL+LK  D++MPRKDFP+ +L
Sbjct  147  CPPNMCKAGLVIERIQNSLAAAGKKKIIYLGDGNGDFCPSLRLKDSDYLMPRKDFPLCDL  206

Query  481  IKENRSLLEAEIHEWSNGEDFERILFHLINRICIEDS------QFLAAESKFQAISMQPC  320
            + +N + ++AE+H W +G++ E +L H+IN+   E S      Q ++ + K   I +   
Sbjct  207  VSKNSNKIKAEVHGWRDGKELEHVLLHVINKAIGEGSNINNSTQKVSVDCKMGPIPIDTL  266

Query  319  EALPKAIRVP  290
            + LPKA+ VP
Sbjct  267  QPLPKALSVP  276


 Score =   114 bits (286),  Expect(2) = 2e-78, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VV+FDFD TII+ DSDNWV+DE G T  F QLL +M WN LMD+MM E+H+ GKTI 
Sbjct  2     AGIVVIFDFDSTIIECDSDNWVLDETGLTEKFYQLLPSMAWNPLMDKMMNELHSQGKTIQ  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI  +L   P+HPR VPAI+A + LG
Sbjct  62    DIVEILNRTPMHPRTVPAIEAAYSLG  87



>ref|XP_008220455.1| PREDICTED: inorganic pyrophosphatase 2-like [Prunus mume]
Length=283

 Score =   197 bits (502),  Expect(2) = 3e-78, Method: Compositional matrix adjust.
 Identities = 97/195 (50%), Positives = 131/195 (67%), Gaps = 9/195 (5%)
 Frame = -2

Query  844  FRCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGC  665
            F CDLR++S AN FFI+TILKH G+ + FSEINTNP  +DE+GRLRILP+HDFHSS HGC
Sbjct  86   FGCDLRVLSAANEFFIDTILKHHGLMDFFSEINTNPSIIDEQGRLRILPYHDFHSSSHGC  145

Query  664  ARCPPNMCKSKIIERIQASMGKEGK--KRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPV  491
              CPP+MCK  I+E+IQAS+  +GK  K+ IY+GDG  DFC  LKL+ GDF+MPR+DFP+
Sbjct  146  TICPPSMCKGLIMEKIQASVAADGKKHKQFIYVGDGAPDFCAGLKLEEGDFLMPRRDFPI  205

Query  490  WELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIED-----SQFLAAESKFQAIS--  332
            W+LI  N    +A+I+EW+  ++   +L + +N     +      Q +  + K Q  S  
Sbjct  206  WDLISANPLFTKAKIYEWNECDELGAVLLNTVNAFFTANKSRSTDQLVPVDCKSQNSSTC  265

Query  331  MQPCEALPKAIRVPF  287
            +   EA   A+ VP 
Sbjct  266  LTAHEAFQNALPVPL  280


 Score =   124 bits (310),  Expect(2) = 3e-78, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFDKTIID DSDNWVV+ELG   LF +LL TMPWNSLMDRMM+E+H+ GKTI 
Sbjct  2     AGLVVVFDFDKTIIDWDSDNWVVEELGVKDLFTRLLPTMPWNSLMDRMMRELHSRGKTIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI   L+ +P+HP I  AIK+ H  G
Sbjct  62    DIAECLKKIPLHPNIASAIKSAHAFG  87



>gb|ACJ84435.1| unknown [Medicago truncatula]
 gb|AFK35188.1| unknown [Medicago truncatula]
 gb|AES67879.2| 2,3-diketo-5-methylthio-1-phosphopentane phosphatase [Medicago 
truncatula]
Length=276

 Score =   207 bits (528),  Expect(2) = 3e-78, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 131/188 (70%), Gaps = 5/188 (3%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LRIVSDAN+FFIETILKH G+  CFS+I  NP YV+ EGRL I P+HD+  S HGC  
Sbjct  88   CELRIVSDANIFFIETILKHHGVLNCFSKITANPSYVNGEGRLIICPYHDYLKSSHGCNL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK K++E  Q S+  EGKK++IYLGDG GDFCPSLKLK  D++MPR +F + +L+
Sbjct  148  CPPNMCKGKVMEMFQNSLDDEGKKKIIYLGDGSGDFCPSLKLKESDYLMPRMNFALSDLV  207

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIEDS-----QFLAAESKFQAISMQPCEA  314
             +N + ++A +H W +GE+ E +L H+IN+  I        + ++ + K   IS+   + 
Sbjct  208  SKNSNDIKAHVHGWRDGEELENVLLHIINKANIGKGNIVGPKIISVDCKMGNISIDAHKH  267

Query  313  LPKAIRVP  290
             P+A+ VP
Sbjct  268  FPEALSVP  275


 Score =   114 bits (284),  Expect(2) = 3e-78, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VV+FDFD TII+ DSDNWV+DE G T  F QLL +M WN LMD++M E+HA GKT+ 
Sbjct  2     AGVVVIFDFDSTIIECDSDNWVLDEFGLTEKFYQLLPSMLWNPLMDKIMNELHAQGKTME  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             +I  VL   PIHPRI+PAI+A + LG
Sbjct  62    EIVEVLNRTPIHPRIIPAIEAAYSLG  87



>ref|XP_003597628.1| hypothetical protein MTR_2g100340 [Medicago truncatula]
 ref|XP_003636427.1| hypothetical protein MTR_040s0060 [Medicago truncatula]
Length=368

 Score =   203 bits (517),  Expect(2) = 4e-78, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 132/190 (69%), Gaps = 7/190 (4%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LRIVSDAN+FFIETILKH G+  CFS+I  NP YV+ EGRL I P+HD+  S HGC  
Sbjct  178  CELRIVSDANIFFIETILKHHGVLNCFSKITANPSYVNGEGRLIICPYHDYLKSSHGCNL  237

Query  658  CPPNMCKS--KIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWE  485
            CPPNMCK+  K++E  Q S+  EGKK++IYLGDG GDFCPSLKLK  D++MPR +F + +
Sbjct  238  CPPNMCKAIGKVMEMFQNSLDDEGKKKIIYLGDGSGDFCPSLKLKESDYLMPRMNFALSD  297

Query  484  LIKENRSLLEAEIHEWSNGEDFERILFHLINRICIEDS-----QFLAAESKFQAISMQPC  320
            L+ +N + ++A +H W +GE+ E +L H+IN+  I        + ++ + K   IS+   
Sbjct  298  LVSKNSNDIKAHVHGWRDGEELENVLLHIINKANIGKGNIVGPKIISVDCKMGNISIDAH  357

Query  319  EALPKAIRVP  290
            +  P+A+ VP
Sbjct  358  KHFPEALSVP  367


 Score =   117 bits (294),  Expect(2) = 4e-78, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 68/91 (75%), Gaps = 0/91 (0%)
 Frame = -1

Query  1193  CSPMAAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHAN  1014
             CS + AG VV+FDFD TII+ DSDNWV+DE G T  F QLL +M WN LMD++M E+HA 
Sbjct  87    CSFIMAGVVVIFDFDSTIIECDSDNWVLDEFGLTEKFYQLLPSMLWNPLMDKIMNELHAQ  146

Query  1013  GKTIGDIERVLQGVPIHPRIVPAIKAVHGLG  921
             GKT+ +I  VL   PIHPRI+PAI+A + LG
Sbjct  147   GKTMEEIVEVLNRTPIHPRIIPAIEAAYSLG  177



>ref|NP_001235501.1| uncharacterized protein LOC100306469 [Glycine max]
 gb|ACU14664.1| unknown [Glycine max]
Length=276

 Score =   208 bits (529),  Expect(2) = 4e-78, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 137/190 (72%), Gaps = 7/190 (4%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDL+IVSDAN+FFIETILKH G+  CFS++  NP +V+E GRL I P+HD+  S HGC  
Sbjct  88   CDLKIVSDANIFFIETILKHHGVWNCFSDVIANPIHVNE-GRLNICPYHDYLKSSHGCNL  146

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  +IERIQ S+   GKK++IYLGDG GDFCPSL+LK GD++MPRKDFP+ +L+
Sbjct  147  CPPNMCKGLVIERIQNSLAAAGKKKLIYLGDGNGDFCPSLRLKDGDYVMPRKDFPLCDLV  206

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIE------DSQFLAAESKFQAISMQPCE  317
             +N + ++AE+H W +G++ E +L H+I++   E       +Q ++ + K   I++   +
Sbjct  207  SKNSNKIKAEVHGWRDGKELEHVLLHVIDKEIGERNNINNSTQKVSVDCKMGPIAIDTRQ  266

Query  316  ALPKAIRVPF  287
             LPKA+ V +
Sbjct  267  PLPKALSVSY  276


 Score =   113 bits (283),  Expect(2) = 4e-78, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VV+FDFD TII+ DSDNWV+DE G T  F QLL +  WN LMD+MM E+H+ GKTI 
Sbjct  2     AGIVVIFDFDSTIIECDSDNWVLDETGLTEKFYQLLPSTHWNPLMDKMMNELHSQGKTIQ  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI ++L   P+HPRIVPAI+A + LG
Sbjct  62    DIVQILSRTPMHPRIVPAIEAAYSLG  87



>gb|AFK38500.1| unknown [Lotus japonicus]
Length=282

 Score =   207 bits (528),  Expect(2) = 4e-78, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 134/193 (69%), Gaps = 9/193 (5%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+L+IVSDAN+FFIETILKH G+R CFSEI  NP +V+EEGRLRI P++D+  S HGC+ 
Sbjct  90   CELKIVSDANIFFIETILKHHGVRHCFSEITANPSFVNEEGRLRIGPYYDYLKSSHGCSL  149

Query  658  CPPNMCKSKIIERIQASMGKEGKKR-VIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWEL  482
            CPPNMCK  +++RIQ S+   GKK+ +IYLGDG GDFCPSLKLK  D++MPR +F + +L
Sbjct  150  CPPNMCKGLVMDRIQNSLDAAGKKKFMIYLGDGSGDFCPSLKLKDSDYLMPRTNFRLCDL  209

Query  481  IKENRSLLEAEIHEWSNGEDFERILFHLINRI--------CIEDSQFLAAESKFQAISMQ  326
            + +N + ++AE+H W +G + E +L H+IN+             +  ++ + KF  IS+ 
Sbjct  210  VSKNSNAIKAEVHAWRDGAELENVLLHIINKTINGEGSNGTSGSTPIISVDCKFGTISID  269

Query  325  PCEALPKAIRVPF  287
                 PKA+ VP 
Sbjct  270  GHNPFPKALSVPI  282


 Score =   113 bits (283),  Expect(2) = 4e-78, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 64/88 (73%), Gaps = 2/88 (2%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPW--NSLMDRMMKEIHANGKT  1005
             AG VVVFDFD TII+ DSDNW++DE G T  F QLL T PW  N LMD+MM E+H  GKT
Sbjct  2     AGIVVVFDFDSTIIECDSDNWLLDEFGLTEKFYQLLPTTPWGWNPLMDKMMNELHPQGKT  61

Query  1004  IGDIERVLQGVPIHPRIVPAIKAVHGLG  921
             I DI  VL+  PIHP IVPAIKA H LG
Sbjct  62    IEDIVEVLKRTPIHPCIVPAIKAAHSLG  89



>gb|KDP33737.1| hypothetical protein JCGZ_07308 [Jatropha curcas]
Length=273

 Score =   206 bits (525),  Expect(2) = 4e-78, Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 128/185 (69%), Gaps = 2/185 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRI+SDAN FFIE IL H G+  CFS+I TNP   D EGRLRI P+HD  S  HGC  
Sbjct  88   CDLRIISDANQFFIEKILDHHGLLGCFSQITTNPSLEDGEGRLRIFPYHDLSSPTHGCNL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CP N+CK  ++E+I AS+ +  + R IYLGDG GDFCPSLKL  GD++MPRK +P+W  I
Sbjct  148  CPSNLCKGLVLEQIHASISRNERTRFIYLGDGSGDFCPSLKLGEGDYVMPRKKYPLWNRI  207

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFLAAESKFQAI--SMQPCEALPK  305
            + N SL++AE+HEWS+GE+ E+IL HLIN I  +++   +  ++  +    +   +A P+
Sbjct  208  RSNPSLIKAEVHEWSSGEELEKILLHLINTISSKENIRSSNSNQLNSTECKISTHKAQPQ  267

Query  304  AIRVP  290
             + VP
Sbjct  268  TLYVP  272


 Score =   114 bits (286),  Expect(2) = 4e-78, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 65/83 (78%), Gaps = 0/83 (0%)
 Frame = -1

Query  1169  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  990
             VV+FDFD+T+ID DSD+WVV ++G T LF++L  T+PWNSLMDRMMKE+H+ G+T+GDI 
Sbjct  5     VVIFDFDRTLIDGDSDSWVVTQMGLTPLFNRLRSTLPWNSLMDRMMKELHSQGRTVGDIT  64

Query  989   RVLQGVPIHPRIVPAIKAVHGLG  921
               L   P+ P ++ AIKA H LG
Sbjct  65    ECLNQTPLQPPVIAAIKAAHALG  87



>ref|XP_007226633.1| hypothetical protein PRUPE_ppa022611mg, partial [Prunus persica]
 gb|EMJ27832.1| hypothetical protein PRUPE_ppa022611mg, partial [Prunus persica]
Length=246

 Score =   198 bits (504),  Expect(2) = 4e-78, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 119/159 (75%), Gaps = 2/159 (1%)
 Frame = -2

Query  844  FRCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGC  665
            F CDLR++S AN FFI+TILKH G+ +CFSEINTNP  +DE+GRLRI P+HDFHSS HGC
Sbjct  86   FGCDLRVLSAANEFFIDTILKHHGLMDCFSEINTNPSIIDEQGRLRIFPYHDFHSSSHGC  145

Query  664  ARCPPNMCKSKIIERIQASMGKEGK--KRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPV  491
              CPP+MCK  I+E+IQAS+  +GK  K+ IY+GDG  DFC  LKL+ GDF+MPR+DFP+
Sbjct  146  TICPPSMCKGLIMEKIQASVAADGKKHKQFIYVGDGAPDFCAGLKLEEGDFLMPRRDFPI  205

Query  490  WELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIED  374
            W+LI  N    +A+I+EW+  ++   +L + +N    E+
Sbjct  206  WDLISANPLFTKAKIYEWNECDELGAVLLNTVNAFFTEN  244


 Score =   122 bits (307),  Expect(2) = 4e-78, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFDKTIID DSDNWVV+ELG   LF QLL TMPWNSLMDRMM+E+H+ G TI 
Sbjct  2     AGLVVVFDFDKTIIDWDSDNWVVEELGVKDLFTQLLPTMPWNSLMDRMMRELHSRGMTIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI   L+ +P+HP I  AIK+ H  G
Sbjct  62    DIAECLKKIPLHPNIASAIKSAHAFG  87



>gb|KHN39291.1| Inorganic pyrophosphatase 1 [Glycine soja]
Length=277

 Score =   207 bits (528),  Expect(2) = 5e-78, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 138/190 (73%), Gaps = 8/190 (4%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDL+IVSDAN+FFIETILKH G+  CFS++  NP +V+E GRL I P+HD+  S HGC  
Sbjct  88   CDLKIVSDANIFFIETILKHHGVWNCFSDVIANPIHVNE-GRLNICPYHDYLKSSHGCNL  146

Query  658  CPPNMCKSK-IIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWEL  482
            CPPNMCK+  +IERIQ S+   GKK++IYLGDG GDFCPSL+LK GD++MPRKDFP+ +L
Sbjct  147  CPPNMCKAGLVIERIQNSLAAAGKKKLIYLGDGNGDFCPSLRLKDGDYVMPRKDFPLCDL  206

Query  481  IKENRSLLEAEIHEWSNGEDFERILFHLINRICIE------DSQFLAAESKFQAISMQPC  320
            + +N + ++AE+H W +G++ E +L H+IN+   E       +Q ++ + K   I++   
Sbjct  207  VSKNSNKIKAEVHGWRDGKELEHVLLHVINKEIGEGNNINNSTQKVSVDCKMGPIAIDTR  266

Query  319  EALPKAIRVP  290
            + LPKA+ VP
Sbjct  267  QPLPKALSVP  276


 Score =   113 bits (282),  Expect(2) = 5e-78, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VV+FDFD TII+ DSDNWV+DE G T  F QLL +  WN LMD+MM E+H+ GKTI 
Sbjct  2     AGIVVIFDFDSTIIECDSDNWVLDETGLTEKFYQLLPSTHWNPLMDKMMNELHSQGKTIQ  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI ++L   P+HPRIVPAI+A + LG
Sbjct  62    DIVQILSRTPMHPRIVPAIEAAYSLG  87



>ref|XP_009361749.1| PREDICTED: inorganic pyrophosphatase 2-like [Pyrus x bretschneideri]
Length=284

 Score =   200 bits (508),  Expect(2) = 6e-78, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 119/157 (76%), Gaps = 0/157 (0%)
 Frame = -2

Query  844  FRCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGC  665
            F CDLR++SDAN FFI+ ILKH GIR+CFSEI TNP ++DE+GRLRILPFHDF SS HGC
Sbjct  87   FGCDLRVLSDANDFFIDAILKHHGIRDCFSEIKTNPSFIDEQGRLRILPFHDFISSSHGC  146

Query  664  ARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWE  485
              CPPNMCK  ++ +I+AS+  +GKK +IY+GDG  DFC  LKL+ GDF++PRK++P+W+
Sbjct  147  TLCPPNMCKGLMMGKIRASVSADGKKHLIYVGDGAPDFCAGLKLEEGDFLLPRKNYPIWD  206

Query  484  LIKENRSLLEAEIHEWSNGEDFERILFHLINRICIED  374
            LI  N  L +A+I+EW+  ++   IL + +    I D
Sbjct  207  LISANPLLTKAKIYEWNECDELGTILLNTVKAFFIGD  243


 Score =   120 bits (302),  Expect(2) = 6e-78, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 65/88 (74%), Gaps = 0/88 (0%)
 Frame = -1

Query  1184  MAAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKT  1005
             MAA  VVVFDFDKTII+ DSDNW+VDELG   LF QLL TM WN LMDRMM E+HA  KT
Sbjct  1     MAARMVVVFDFDKTIINCDSDNWIVDELGVKDLFTQLLPTMTWNPLMDRMMTELHARRKT  60

Query  1004  IGDIERVLQGVPIHPRIVPAIKAVHGLG  921
             I DI   L+ VPIHP IV AIK+ H  G
Sbjct  61    IQDISECLKRVPIHPNIVSAIKSAHAFG  88



>gb|AFK48095.1| unknown [Lotus japonicus]
Length=282

 Score =   206 bits (523),  Expect(2) = 7e-78, Method: Compositional matrix adjust.
 Identities = 95/193 (49%), Positives = 133/193 (69%), Gaps = 9/193 (5%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+L+IVSDAN+FFIETILKH G+R CFSEI  NP +V+EEGRLRI P++D+  S HGC+ 
Sbjct  90   CELKIVSDANIFFIETILKHHGVRHCFSEITANPSFVNEEGRLRIGPYYDYLKSSHGCSL  149

Query  658  CPPNMCKSKIIERIQASMGKEGKKR-VIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWEL  482
            CPPNMCK  +++RIQ S+   GKK+ +IYLGDG GDFCPSLKLK  D++ PR +F + +L
Sbjct  150  CPPNMCKGLVMDRIQNSLDAAGKKKFMIYLGDGSGDFCPSLKLKDSDYLTPRTNFRLCDL  209

Query  481  IKENRSLLEAEIHEWSNGEDFERILFHLINRI--------CIEDSQFLAAESKFQAISMQ  326
            + +N + ++AE+H W +G + E +L H+IN+             +  ++ + KF  IS+ 
Sbjct  210  VSKNSNAIKAEVHAWRDGAELENVLLHIINKTINGEGSNGTSGSTPIISVDCKFGTISID  269

Query  325  PCEALPKAIRVPF  287
                 PKA+ VP 
Sbjct  270  GHNPFPKALSVPI  282


 Score =   115 bits (287),  Expect(2) = 7e-78, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 65/88 (74%), Gaps = 2/88 (2%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPW--NSLMDRMMKEIHANGKT  1005
             AG VVVFDFD TII+ DSDNW++DE G T  F QLL T PW  N LMD+MM E+H+ GKT
Sbjct  2     AGIVVVFDFDSTIIECDSDNWLLDEFGLTEKFYQLLPTTPWGWNPLMDKMMNELHSQGKT  61

Query  1004  IGDIERVLQGVPIHPRIVPAIKAVHGLG  921
             I DI  VL+  PIHP IVPAIKA H LG
Sbjct  62    IEDIVEVLKRTPIHPCIVPAIKAAHSLG  89



>gb|AFK36374.1| unknown [Medicago truncatula]
Length=276

 Score =   206 bits (525),  Expect(2) = 7e-78, Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 131/188 (70%), Gaps = 5/188 (3%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LRIVSDAN+FFIETILKH G+  CFS+I  NP YV+ EGRL I P+HD+  S HGC  
Sbjct  88   CELRIVSDANIFFIETILKHHGVLNCFSKITANPSYVNGEGRLIICPYHDYLKSSHGCNL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK K++E  Q S+  EGKK++IYLGDG GDFCPSLKLK  D++MP+ +F + +L+
Sbjct  148  CPPNMCKGKVMEMFQNSLDDEGKKKIIYLGDGSGDFCPSLKLKESDYLMPKMNFALSDLV  207

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIEDS-----QFLAAESKFQAISMQPCEA  314
             +N + ++A +H W +GE+ E +L H+IN+  I        + ++ + K   IS+   + 
Sbjct  208  SKNSNDIKAHVHGWRDGEELENVLLHIINKANIGKGNIVGPKIISVDCKMGNISIDAHKH  267

Query  313  LPKAIRVP  290
             P+A+ VP
Sbjct  268  FPEALSVP  275


 Score =   114 bits (284),  Expect(2) = 7e-78, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VV+FDFD TII+ DSDNWV+DE G T  F QLL +M WN LMD++M E+HA GKT+ 
Sbjct  2     AGVVVIFDFDSTIIECDSDNWVLDEFGLTEKFYQLLPSMLWNPLMDKIMNELHAQGKTME  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             +I  VL   PIHPRI+PAI+A + LG
Sbjct  62    EIVEVLNRTPIHPRIIPAIEAAYSLG  87



>ref|XP_002533762.1| Phosphoethanolamine/phosphocholine phosphatase, putative [Ricinus 
communis]
 gb|EEF28621.1| Phosphoethanolamine/phosphocholine phosphatase, putative [Ricinus 
communis]
Length=263

 Score =   215 bits (547),  Expect(2) = 7e-78, Method: Compositional matrix adjust.
 Identities = 101/178 (57%), Positives = 133/178 (75%), Gaps = 5/178 (3%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LRIVSDAN FFI+TIL+H+G+R+CFSEINTNPG+VDEEGRL I PFHD       C+ 
Sbjct  90   CELRIVSDANTFFIDTILEHVGLRDCFSEINTNPGFVDEEGRLNIFPFHDSGC----CSL  145

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK +IIE     + + G++R+IYLGDG GD+CP LKL   D+MMPRK+FPVW+LI
Sbjct  146  CPPNMCKGRIIENPNIFI-QGGEQRIIYLGDGAGDYCPGLKLTHADYMMPRKNFPVWDLI  204

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFLAAESKFQAISMQPCEALPK  305
              N + + A+IHEW+NGE+FER+L  +I+ I + +S   + +SK   I +   EALP+
Sbjct  205  CGNPTPIRADIHEWTNGEEFERVLLRIIDSISMNESAQFSTDSKLMPIPIPAHEALPR  262


 Score =   105 bits (262),  Expect(2) = 7e-78, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 62/85 (73%), Gaps = 0/85 (0%)
 Frame = -1

Query  1175  GTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGD  996
             G VV+ DF KTIIDVDSD WVV ELG T  F QLL TMP NS M  MMKE+++ GKTI  
Sbjct  5     GIVVILDFYKTIIDVDSDYWVVKELGLTDFFYQLLPTMPLNSAMAEMMKELYSRGKTIKQ  64

Query  995   IERVLQGVPIHPRIVPAIKAVHGLG  921
             I +VL+ VPIHPRIV A+K+   LG
Sbjct  65    IVQVLERVPIHPRIVHALKSARALG  89



>gb|ABI95993.1| acid phosphatase [Oryza sativa Japonica Group]
Length=274

 Score =   198 bits (503),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 135/194 (70%), Gaps = 9/194 (5%)
 Frame = -2

Query  856  SC*IFRCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDE-EGRLRILPFHDFHS  680
            +C    CDLRI+SDAN FFI+TIL H G+   FSEINTNP  VD   GRLRI P+HDFH+
Sbjct  82   ACYGLGCDLRILSDANRFFIDTILDHHGLTGYFSEINTNPSAVDAATGRLRIAPYHDFHA  141

Query  679  SPHGCAR--CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPR  506
             PHGC    CPPNMCK ++++RI+AS G  GK RVIYLGDG GD+CPSL+L   DFMMPR
Sbjct  142  GPHGCGLGICPPNMCKGQVLDRIRASAGAAGK-RVIYLGDGRGDYCPSLRLGRDDFMMPR  200

Query  505  KDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFLAAESKFQ---AI  335
            + FPVWELI E+ SLL AE+H W++G + E  L  L+ R+ +E+      + K +   A+
Sbjct  201  RGFPVWELICEDPSLLHAEVHSWADGAEMEETLLRLVGRVLLEERNLPPLDCKLESLPAV  260

Query  334  SMQPCEALPKAIRV  293
            ++Q  + +P  +R+
Sbjct  261  AVQ--DGMPMTLRI  272


 Score =   121 bits (304),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFDKTIIDVDSDNWVVD LG T  F++LL TMPWN+LMD MM E+HA+GK++ 
Sbjct  2     AGIVVVFDFDKTIIDVDSDNWVVDGLGTTEEFERLLPTMPWNTLMDTMMGELHASGKSLA  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             D+  VL+  P+ PR+V AIKA +GLG
Sbjct  62    DVAGVLRSAPLDPRVVAAIKACYGLG  87



>ref|NP_001044089.1| Os01g0720400 [Oryza sativa Japonica Group]
 dbj|BAB84416.1| phosphatase-like [Oryza sativa Japonica Group]
 dbj|BAF06003.1| Os01g0720400 [Oryza sativa Japonica Group]
Length=274

 Score =   198 bits (503),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 135/194 (70%), Gaps = 9/194 (5%)
 Frame = -2

Query  856  SC*IFRCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDE-EGRLRILPFHDFHS  680
            +C    CDLRI+SDAN FFI+TIL H G+   FSEINTNP  VD   GRLRI P+HDFH+
Sbjct  82   ACYGLGCDLRILSDANRFFIDTILDHHGLTGYFSEINTNPSAVDAATGRLRIAPYHDFHA  141

Query  679  SPHGCAR--CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPR  506
             PHGC    CPPNMCK ++++RI+AS G  GK RVIYLGDG GD+CPSL+L   DFMMPR
Sbjct  142  GPHGCGLGICPPNMCKGQVLDRIRASAGAAGK-RVIYLGDGRGDYCPSLRLGRDDFMMPR  200

Query  505  KDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFLAAESKFQ---AI  335
            + FPVWELI E+ SLL AE+H W++G + E  L  L+ R+ +E+      + K +   A+
Sbjct  201  RGFPVWELICEDPSLLHAEVHSWADGAEMEETLLRLVGRVLLEERNLPPLDCKLESLPAV  260

Query  334  SMQPCEALPKAIRV  293
            ++Q  + +P  +R+
Sbjct  261  AVQ--DGMPMTLRI  272


 Score =   122 bits (305),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFDKTIIDVDSDNWVVD LG T  F++LL TMPWN+LMD MM E+HA+GK++ 
Sbjct  2     AGIVVVFDFDKTIIDVDSDNWVVDGLGATEEFERLLPTMPWNTLMDTMMGELHASGKSLA  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             D+  VL+  P+ PR+V AIKA +GLG
Sbjct  62    DVAGVLRSAPLDPRVVAAIKACYGLG  87



>gb|EAY75640.1| hypothetical protein OsI_03545 [Oryza sativa Indica Group]
Length=274

 Score =   198 bits (504),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 136/194 (70%), Gaps = 9/194 (5%)
 Frame = -2

Query  856  SC*IFRCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDE-EGRLRILPFHDFHS  680
            +C    CDLRI+SDAN FFI+TIL H G+   FSEINTNP  VD   GRLRI P+HDFH+
Sbjct  82   ACYGLGCDLRILSDANRFFIDTILDHHGLTGYFSEINTNPSAVDAATGRLRIAPYHDFHA  141

Query  679  SPHGCAR--CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPR  506
             PHGC    CPPNMCK ++++RI+AS G  GK RVIYLGDG GD+CPSL+L   DFMMPR
Sbjct  142  GPHGCGLGICPPNMCKGQVLDRIRASAGAAGK-RVIYLGDGRGDYCPSLRLGRDDFMMPR  200

Query  505  KDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFLAAESKFQ---AI  335
            + FPVWELI E+ SLL+AE+H W++G + E  L  L+ R+ +E+      + K +   A+
Sbjct  201  RGFPVWELICEDPSLLQAEVHPWADGAEMEETLLRLVGRVLLEERNLPPLDCKLESLPAV  260

Query  334  SMQPCEALPKAIRV  293
            ++Q  + +P  +R+
Sbjct  261  AVQ--DGMPMTLRI  272


 Score =   121 bits (303),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFDKTIIDVDSDNWVVD LG T  F++LL TMPWN+LMD MM E+HA GK++ 
Sbjct  2     AGIVVVFDFDKTIIDVDSDNWVVDGLGATEEFERLLPTMPWNTLMDTMMGELHARGKSLS  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             D+  VL+  P+ PR+V AIKA +GLG
Sbjct  62    DVAGVLRSAPLDPRVVAAIKACYGLG  87



>ref|XP_007012891.1| Pyridoxal phosphate phosphatase-related protein [Theobroma cacao]
 gb|EOY30510.1| Pyridoxal phosphate phosphatase-related protein [Theobroma cacao]
Length=278

 Score =   203 bits (517),  Expect(2) = 3e-77, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 132/190 (69%), Gaps = 7/190 (4%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRIVSDAN FFIE IL++ G+  CFS+I TNP +VDEEGRLRI P+HD   SPHGC+ 
Sbjct  88   CDLRIVSDANQFFIEKILEYQGLLGCFSKIYTNPSFVDEEGRLRIFPYHDSTLSPHGCSL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CP N+CK  ++E I AS  + G++  IYLGDG GD+CP+L+L+  D++MPRK +P+W+ I
Sbjct  148  CPSNLCKGLVLEHIYASAPEGGRQNFIYLGDGRGDYCPTLRLQGSDYVMPRKKYPLWDRI  207

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFLAAESKFQA-------ISMQPC  320
                +L++AE+HEWSNGE+ E+IL HLI++I  E S   +  S           IS+   
Sbjct  208  FREPALVKAEVHEWSNGEELEKILLHLIDKIPAEQSISGSNPSSQSNSSDCKLHISVSSP  267

Query  319  EALPKAIRVP  290
            E+  + +RVP
Sbjct  268  ESFTQTLRVP  277


 Score =   114 bits (286),  Expect(2) = 3e-77, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFD+TIID DSD+WVV E+G + LF +L  T+PWNSLMDRMMKE+H+ G+T  
Sbjct  2     AGIVVVFDFDRTIIDGDSDSWVVAEMGLSDLFHRLRSTLPWNSLMDRMMKELHSQGRTAE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             +I   L+  P+HPRI  AIK+ + LG
Sbjct  62    EIAACLKRTPLHPRIAAAIKSAYALG  87



>ref|XP_007012260.1| Pyridoxal phosphate phosphatase-related protein [Theobroma cacao]
 gb|EOY29879.1| Pyridoxal phosphate phosphatase-related protein [Theobroma cacao]
Length=290

 Score =   228 bits (581),  Expect(2) = 5e-77, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 131/176 (74%), Gaps = 6/176 (3%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLR++SDAN+FFIETILK+ G+ +CFSEINTNP YVD EGRLRI P+HDF SS HGC  
Sbjct  109  CDLRLISDANVFFIETILKNHGLLDCFSEINTNPSYVDGEGRLRISPYHDFESSSHGCNI  168

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  I+ER+QAS+   GKKR IYLGDG  DFCP LKL   DF+MPRK+FPVWELI
Sbjct  169  CPPNMCKGLIMERVQASVSATGKKRFIYLGDGTADFCPGLKLGEDDFLMPRKNFPVWELI  228

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIEDS------QFLAAESKFQAISM  329
              N  L+ A IHEW++GE+   +L HL+N+I IE++      Q +    KF+  S+
Sbjct  229  CSNPKLIRANIHEWNDGEELGDVLSHLVNKISIEENYAVGVDQMVPVHCKFKTSSV  284


 Score = 89.4 bits (220),  Expect(2) = 5e-77, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 60/107 (56%), Gaps = 21/107 (20%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLM---------------  1044
             AG V+VFDFDKTII+ DSD+WVV+  G + LF QL  T P N+LM               
Sbjct  2     AGVVLVFDFDKTIIECDSDDWVVEGFGVSELFTQLRPTFPLNTLMDFHHDNYQRFTLDAF  61

Query  1043  ------DRMMKEIHANGKTIGDIERVLQGVPIHPRIVPAIKAVHGLG  921
                   DRM+ E+ + G +  DI   L+ VP+HPRIV  IKA H  G
Sbjct  62    SRLFFQDRMIMEVQSRGNSTADIAACLRQVPLHPRIVSVIKAAHASG  108



>ref|XP_006466069.1| PREDICTED: inorganic pyrophosphatase 1-like isoform X2 [Citrus 
sinensis]
Length=264

 Score =   191 bits (484),  Expect(2) = 2e-76, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 111/147 (76%), Gaps = 12/147 (8%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDL+IVSDANLFFIETILKH GI E FSEINTN  +VDEEGRL+I P HDF  S H C+ 
Sbjct  88   CDLKIVSDANLFFIETILKHHGIWELFSEINTNSSFVDEEGRLKIFPHHDFTKSSHACST  147

Query  658  --CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWE  485
              CPPNMCK         SM KE  K++IY+GDG GDFCPSLKLK  D++MPRK+FPVW+
Sbjct  148  NICPPNMCKE--------SMSKE--KKIIYIGDGTGDFCPSLKLKQTDYIMPRKNFPVWD  197

Query  484  LIKENRSLLEAEIHEWSNGEDFERILF  404
            LI +N  L++A+IHEW +G++ + +L 
Sbjct  198  LICQNHKLIKADIHEWYDGQELQHVLL  224


 Score =   125 bits (313),  Expect(2) = 2e-76, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             A  VVVFDFDKTIID DSDNWVVDEL  T LF+QLL TMPWNSLM RMM+E+HA GKTI 
Sbjct  2     ADIVVVFDFDKTIIDCDSDNWVVDELHATELFNQLLPTMPWNSLMGRMMEELHAQGKTIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI  VL+  PIHP I+ A+KA H LG
Sbjct  62    DIVEVLKRAPIHPSIISAVKAAHDLG  87



>ref|XP_009614749.1| PREDICTED: inorganic pyrophosphatase 3-like [Nicotiana tomentosiformis]
Length=280

 Score =   204 bits (520),  Expect(2) = 3e-76, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 118/154 (77%), Gaps = 1/154 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDL+++SDAN F+IETILKH G+  CFSEI TNP  VD EGRLRI P+HD  +S HGC  
Sbjct  128  CDLKVLSDANQFYIETILKHHGLYRCFSEIITNPTTVDGEGRLRIFPYHDL-ASFHGCNL  186

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPN+CK  +IE+IQASM ++GK R IYLGDG GD+CP+LKL  GD +MPRK FP+W+ +
Sbjct  187  CPPNLCKGLVIEQIQASMSEKGKSRFIYLGDGRGDYCPTLKLDRGDHVMPRKGFPLWDRL  246

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
              N SLL+A+ HEWSNGE+   IL  L+ ++C E
Sbjct  247  LSNPSLLKADCHEWSNGEELASILLKLVEKVCKE  280


 Score =   110 bits (275),  Expect(2) = 3e-76, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             A  V++FDFD+T+ID DSD WVV+ +G T LF+QL  T+PWN+LMDRMM+E+H+ GKT+ 
Sbjct  42    AKMVIIFDFDRTLIDDDSDRWVVENMGLTHLFNQLRPTLPWNALMDRMMEELHSQGKTVE  101

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
              I   L+ VP+HP+ + AI++ H LG
Sbjct  102   QIAECLKHVPLHPQTISAIESAHALG  127



>ref|XP_010049560.1| PREDICTED: inorganic pyrophosphatase 3 [Eucalyptus grandis]
 gb|KCW82242.1| hypothetical protein EUGRSUZ_C03661 [Eucalyptus grandis]
Length=265

 Score =   204 bits (518),  Expect(2) = 5e-76, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 122/157 (78%), Gaps = 0/157 (0%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRI+SDAN FFIETILKH G+ +CF+EI TNP +VD EGRL I+PFHD   SPHGC+ 
Sbjct  89   CDLRIISDANRFFIETILKHHGLLDCFTEIVTNPAFVDAEGRLNIVPFHDSADSPHGCSL  148

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  +++RIQA+  +   +R IYLGDG GD+CP LKL   DF++PRK FP+W+LI
Sbjct  149  CPPNMCKGLVLKRIQAADSEIRNRRYIYLGDGKGDYCPCLKLGTRDFVVPRKSFPLWKLI  208

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQ  368
              +++L++A IHEWS+GE+   IL  +I+RI ++++ 
Sbjct  209  FNDQTLIKAVIHEWSDGEELAAILLDIIDRILMDENT  245


 Score =   110 bits (275),  Expect(2) = 5e-76, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 63/88 (72%), Gaps = 0/88 (0%)
 Frame = -1

Query  1184  MAAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKT  1005
             MA    VVFDFD+T+ID DSDNWVV E+G T LF +L  TMPW SLM+RMM E+H  GK 
Sbjct  1     MADTAAVVFDFDRTLIDGDSDNWVVTEMGLTQLFRELYSTMPWTSLMNRMMVELHTQGKA  60

Query  1004  IGDIERVLQGVPIHPRIVPAIKAVHGLG  921
               DIE  L+ +P+HPR++ +I+A H  G
Sbjct  61    AEDIEECLKRMPLHPRVIESIRAAHRNG  88



>ref|XP_009779867.1| PREDICTED: inorganic pyrophosphatase 3-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009779868.1| PREDICTED: inorganic pyrophosphatase 3-like isoform X1 [Nicotiana 
sylvestris]
Length=306

 Score =   201 bits (510),  Expect(2) = 6e-76, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 116/154 (75%), Gaps = 1/154 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDL+++SDAN F+IETILKH G+  CFSEI TNP  VD EGRLRI P+H+  +S HGC  
Sbjct  154  CDLKVLSDANQFYIETILKHHGLYRCFSEIITNPTMVDAEGRLRIFPYHEL-ASFHGCNL  212

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPN+CK  +IE+IQASM  + K R IYLGDG GD+CP+LKL  GD +MPRK FP+W+ +
Sbjct  213  CPPNLCKGLVIEQIQASMSDKRKSRFIYLGDGRGDYCPTLKLDRGDHVMPRKGFPLWDRL  272

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
              N SLL+A+ HEWSNGE+   IL  L+ ++C E
Sbjct  273  LSNPSLLKADCHEWSNGEELASILLQLVEKVCEE  306


 Score =   113 bits (283),  Expect(2) = 6e-76, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 67/87 (77%), Gaps = 0/87 (0%)
 Frame = -1

Query  1181  AAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTI  1002
              A TV++FDFD+T+ID DSD WVV+ +G T LF+QL  T+PWN+LMDRMM+E+H+ GKT+
Sbjct  67    GAKTVIIFDFDRTLIDDDSDRWVVENMGLTYLFNQLRPTLPWNALMDRMMEELHSQGKTV  126

Query  1001  GDIERVLQGVPIHPRIVPAIKAVHGLG  921
               I   L+ VP+HP+ + AI++ H LG
Sbjct  127   EQIAECLKHVPLHPQTISAIESAHALG  153



>ref|XP_002514153.1| Pyridoxal phosphate phosphatase PHOSPHO2, putative [Ricinus communis]
 gb|EEF48107.1| Pyridoxal phosphate phosphatase PHOSPHO2, putative [Ricinus communis]
Length=253

 Score =   199 bits (505),  Expect(2) = 1e-75, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 114/151 (75%), Gaps = 0/151 (0%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LRI+SDAN FFIE IL H G+  CFS+I TNP  VD+EGR+RI P+H   + PHGC  
Sbjct  88   CELRIISDANQFFIEKILDHHGLLGCFSQITTNPSLVDDEGRVRIFPYHALGTPPHGCHL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPN+CK  +I +I AS  +  K+R IYLGDG GDFCP+LKL+ GD++MPR+D+P+W  I
Sbjct  148  CPPNLCKGLVINQICASTAEIEKRRFIYLGDGSGDFCPTLKLREGDYVMPRRDYPLWNRI  207

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRI  386
              N +L++AE+H+WS+GE+   IL HLIN I
Sbjct  208  CSNPTLVKAEVHDWSSGEELGEILLHLINTI  238


 Score =   114 bits (285),  Expect(2) = 1e-75, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             A  VVVFDFD+T+ID DSD WVV ++G + LF+QL  T+PWNSLMDRMM+E+H+ GKT+ 
Sbjct  2     AQIVVVFDFDRTLIDGDSDRWVVTQMGLSSLFNQLRSTLPWNSLMDRMMRELHSQGKTVD  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI   L   P+HP+++ AI++ H LG
Sbjct  62    DITECLSRSPLHPQVIAAIQSAHALG  87



>ref|XP_003569309.1| PREDICTED: inorganic pyrophosphatase 3-like isoform X2 [Brachypodium 
distachyon]
Length=272

 Score =   214 bits (544),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 123/164 (75%), Gaps = 1/164 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDL++VSDAN FFIET+L+H GI  CFSEINTNP  VD +GRLRI PFHD  SSPHGC+ 
Sbjct  89   CDLKVVSDANAFFIETVLEHHGILGCFSEINTNPARVDSDGRLRISPFHDPASSPHGCSL  148

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CP NMCK KIIERIQA+   +  K  IY+GDG GD+CPSLKL+ GD++MP++++P+W LI
Sbjct  149  CPENMCKGKIIERIQATDSAK-NKHFIYIGDGKGDYCPSLKLREGDYVMPKENYPLWNLI  207

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFLAAESK  347
              N+ LL+AE+H W+ GE  ERIL  L+N++    +Q    + K
Sbjct  208  TSNKQLLKAEVHAWNTGEGLERILLQLVNKLITPPAQVTQVDYK  251


 Score = 98.2 bits (243),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 59/88 (67%), Gaps = 0/88 (0%)
 Frame = -1

Query  1184  MAAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKT  1005
             MAA  VVVFDFDKTII+ DSDNWVV +LG T  F++L  TM W  LMDRMM E+H  GK+
Sbjct  1     MAAALVVVFDFDKTIIEWDSDNWVVTKLGATDAFNRLRPTMSWTPLMDRMMGELHEQGKS  60

Query  1004  IGDIERVLQGVPIHPRIVPAIKAVHGLG  921
               DI + L+  P+   ++ AI+    LG
Sbjct  61    AEDIRQCLRSAPLDAHVISAIRTASALG  88



>emb|CDP03190.1| unnamed protein product [Coffea canephora]
Length=252

 Score =   205 bits (521),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 95/155 (61%), Positives = 119/155 (77%), Gaps = 1/155 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDL++VSDAN F+IETILKH G+ +CFSEI TNP  VDE GRL+I P++D  +SPHGC  
Sbjct  89   CDLKVVSDANKFYIETILKHHGLYDCFSEIITNPTLVDEHGRLQIFPYNDL-ASPHGCHL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CP NMCK  +I+RIQ S+G   + + IYLGDG GDFCP LKL  GD  +PRKD+P+WELI
Sbjct  148  CPSNMCKGIVIKRIQTSIGPRREAKFIYLGDGNGDFCPILKLGKGDHALPRKDYPLWELI  207

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIED  374
            + N+  +EAE+HEW NGE+ E+IL  LI+RI  ED
Sbjct  208  RSNQEFVEAEVHEWCNGEELEQILLALIDRISGED  242


 Score =   107 bits (267),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 64/88 (73%), Gaps = 0/88 (0%)
 Frame = -1

Query  1184  MAAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKT  1005
             MA+  V++FDFD+T+ID DSD WV+  +G T LF+QL   + W SLMDRM+KE+H+ G+T
Sbjct  1     MASEIVIIFDFDRTLIDDDSDRWVIKGMGLTHLFNQLRPILSWTSLMDRMVKELHSQGRT  60

Query  1004  IGDIERVLQGVPIHPRIVPAIKAVHGLG  921
             + DI   L+GVP+H R   AIK+ H LG
Sbjct  61    VKDIAECLKGVPLHQRTAAAIKSAHALG  88



>ref|XP_010666530.1| PREDICTED: inorganic pyrophosphatase 3 [Beta vulgaris subsp. 
vulgaris]
Length=272

 Score =   194 bits (492),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 93/169 (55%), Positives = 116/169 (69%), Gaps = 0/169 (0%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRIVSDAN FFI+TIL+   +   F+EI TNP  VD++GRLRI+P+HDF  SPHGC  
Sbjct  88   CDLRIVSDANQFFIKTILEQHQLFGFFTEIITNPTSVDDDGRLRIVPYHDFKLSPHGCTL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CP +MCK  I+ERIQA   + GK   IY+GDG GD+CPSLKL   D +MPRK FP+WE I
Sbjct  148  CPSHMCKGMILERIQAFSRQNGKNITIYIGDGGGDYCPSLKLGENDHVMPRKKFPLWERI  207

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFLAAESKFQAIS  332
              N SL++A +HEWSNGE+ E  L HLI    I+ +Q +   +     S
Sbjct  208  HRNPSLVKATVHEWSNGEELETTLLHLITCSAIDGNQCVYTSTGSDTTS  256


 Score =   118 bits (295),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = -1

Query  1169  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  990
             VV+FDFD+TIID DSDNWVV ++G T LFDQL  TMPWNSLM+RMM+E+H   KTI DI 
Sbjct  5     VVIFDFDRTIIDGDSDNWVVTQMGLTHLFDQLFSTMPWNSLMNRMMEELHLQQKTIEDIG  64

Query  989   RVLQGVPIHPRIVPAIKAVHGLG  921
               L+ +P+HP+I+ AIK+ H +G
Sbjct  65    ECLKQIPLHPKIISAIKSAHSMG  87



>ref|XP_007024448.1| Inorganic pyrophosphatase 2 [Theobroma cacao]
 gb|EOY27070.1| Inorganic pyrophosphatase 2 [Theobroma cacao]
Length=232

 Score =   249 bits (637),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 117/180 (65%), Positives = 144/180 (80%), Gaps = 2/180 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDL+IVSDAN FFIETILKH G+RE FSEINTNPG+VDEEGRLRI P HDF  SPHGC  
Sbjct  40   CDLKIVSDANAFFIETILKHHGLREYFSEINTNPGFVDEEGRLRIFPHHDFTQSPHGCHH  99

Query  658  -CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWEL  482
             CPPNMCK  +IERIQASM  EGKK +IYLGDG+GDFCPSLKL  GD++MPRK+FPVW+L
Sbjct  100  PCPPNMCKGTVIERIQASMSTEGKKTIIYLGDGVGDFCPSLKLGDGDYVMPRKNFPVWDL  159

Query  481  IKENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFLAAESKFQAISMQPCEALPKA  302
            I ENR L++AE+ EWSNG++FE +L HLI+RI I+ +    + ++  ++  +P + +P A
Sbjct  160  ICENRRLIKAEVCEWSNGDEFEHVLLHLISRISIDRNNSGNSTAQLYSVDCKP-QTMPGA  218



>ref|XP_004486811.1| PREDICTED: inorganic pyrophosphatase 1-like [Cicer arietinum]
Length=275

 Score =   197 bits (501),  Expect(2) = 6e-75, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 132/187 (71%), Gaps = 6/187 (3%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LRI+SDAN+FFIETILKH G+  CFSEI  NP YV+EEGRLRI P+HD+  S HGC  
Sbjct  88   CELRILSDANIFFIETILKHHGVLNCFSEITANPSYVNEEGRLRIWPYHDYLKSSHGCNL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  +IER Q S+   GKK+ IYLGDG GDFCPSLKLK  D++MPR +F + +L+
Sbjct  148  CPPNMCKGLVIERFQNSL-DTGKKKFIYLGDGSGDFCPSLKLKESDYVMPRINFALCDLV  206

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIEDS-----QFLAAESKFQAISMQPCEA  314
             +N + ++A +H W +GE+ + +L  +IN+   +++     + ++ + K   IS++  + 
Sbjct  207  SKNSNDIKAHVHGWIDGEELKHVLLDIINKTIGKENNIIGPKIISIDCKLGTISIETHKP  266

Query  313  LPKAIRV  293
             P+A+ +
Sbjct  267  FPEALPI  273


 Score =   113 bits (282),  Expect(2) = 6e-75, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VV+FDFD TII+ DSDNWV+DE G T  F QLL  M WN LMD+MM E+H+ GKTI 
Sbjct  2     AGVVVIFDFDSTIIECDSDNWVLDEFGLTEKFYQLLPNMHWNPLMDKMMDELHSQGKTIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             +I  VL   PIHP IVPAI+A + LG
Sbjct  62    EIVEVLNKTPIHPHIVPAIEAAYSLG  87



>ref|XP_004969781.1| PREDICTED: inorganic pyrophosphatase 1-like [Setaria italica]
Length=275

 Score =   193 bits (491),  Expect(2) = 8e-75, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 123/163 (75%), Gaps = 8/163 (5%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCA-  662
            CDLR++SDAN FFI+T+L H G+R CF+E+NTNP  VD +GRLRI P+H   ++PHGC  
Sbjct  88   CDLRVLSDANAFFIDTVLDHHGLRGCFTEVNTNPSRVDADGRLRIGPYH---AAPHGCGV  144

Query  661  -RCPPNMCKSKIIERI--QASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPV  491
              CPPNMCK ++++RI  +A+ G  G+KRVIYLGDG GD+CPSL+L   DF+MPR+ FPV
Sbjct  145  GTCPPNMCKGQVLDRILREAAAGG-GRKRVIYLGDGRGDYCPSLRLAREDFVMPRRGFPV  203

Query  490  WELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFL  362
            W+LI E+ + ++AE+H W++G + E  L  L+ R+ +ED+  L
Sbjct  204  WDLICEDPARVQAEVHPWADGAEMEATLLGLVRRVLVEDAAAL  246


 Score =   116 bits (291),  Expect(2) = 8e-75, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG +VVFDFDKTIIDVDSDNWVVD LGFT  F++LL TMPWN LMD MM +IHA G+T+ 
Sbjct  2     AGIIVVFDFDKTIIDVDSDNWVVDSLGFTEEFERLLPTMPWNDLMDAMMGKIHAAGRTLD  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             D+   L+ VPI PR+  AI+A   LG
Sbjct  62    DVAAALRAVPIDPRVPAAIRAACALG  87



>gb|KDO59254.1| hypothetical protein CISIN_1g044617mg [Citrus sinensis]
Length=265

 Score =   194 bits (494),  Expect(2) = 3e-74, Method: Compositional matrix adjust.
 Identities = 94/183 (51%), Positives = 128/183 (70%), Gaps = 8/183 (4%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDL+IVSDAN F+IETI++H G+  CFSEI TNP YVDE+GRLRILP+HD   S HGC  
Sbjct  88   CDLKIVSDANQFYIETIMEHHGLLGCFSEIYTNPTYVDEQGRLRILPYHDSTLSHHGCNL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CP N+CK  +++ +  S G  GK+R IYLGDG GDFCP+LKL+  DF+MPRK++P+W+ I
Sbjct  148  CPSNLCKGFVLDHVCTSFGC-GKQRFIYLGDGRGDFCPTLKLRDCDFVMPRKNYPLWDRI  206

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFLAAESKFQAISMQPCEALPKAI  299
              N  L++A++HEWS+ E+ ++IL HLI  I I+       E     +S QP  +  ++ 
Sbjct  207  CSNPMLIKAKVHEWSSAEELKKILLHLIGAISIK-------EDVDSTVSSQPNSSECRSQ  259

Query  298  RVP  290
             +P
Sbjct  260  TMP  262


 Score =   114 bits (284),  Expect(2) = 3e-74, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             A  VVVFDFD+T+ID DSDNWVV ++G T LF+QL  T+PWNSLMDRMMKE+H+ GKT+ 
Sbjct  2     ADVVVVFDFDRTLIDDDSDNWVVTQMGLTHLFNQLRSTLPWNSLMDRMMKELHSQGKTVE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI   L+  P+   +  AIK+ H LG
Sbjct  62    DIANCLRQCPLDSHVAAAIKSAHSLG  87



>ref|XP_007135573.1| hypothetical protein PHAVU_010G1407000g, partial [Phaseolus vulgaris]
 gb|ESW07567.1| hypothetical protein PHAVU_010G1407000g, partial [Phaseolus vulgaris]
Length=237

 Score =   198 bits (504),  Expect(2) = 5e-74, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 115/150 (77%), Gaps = 1/150 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDL+IVSDAN+FFIETILKH G+  CFSEI  NP +V +EG L I P+HD+  S HGC  
Sbjct  88   CDLKIVSDANIFFIETILKHHGVWNCFSEIICNPSHV-KEGSLNICPYHDYLKSSHGCNL  146

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  +IERIQ SM   GKK+VIYLGDG GDFCPSLKLK  D++MPR  FP+ +L+
Sbjct  147  CPPNMCKGVVIERIQNSMAGAGKKKVIYLGDGNGDFCPSLKLKENDYLMPRTGFPLCDLV  206

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINR  389
             +N + ++AE+H W +G++ + +L HLIN+
Sbjct  207  SKNSTKIKAEVHGWRDGKELQHVLLHLINK  236


 Score =   108 bits (271),  Expect(2) = 5e-74, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             A  +V+FDFD TII+ DSDNWV+D+   T  F QLL TM WN LMDRMMKE+H+ GKTI 
Sbjct  2     AEIMVIFDFDSTIIECDSDNWVLDDTALTQNFYQLLPTMHWNPLMDRMMKELHSQGKTIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI  +L+  P+HP IVPAI+A + LG
Sbjct  62    DIVEILKRTPMHPCIVPAIEAAYSLG  87



>ref|XP_002282651.1| PREDICTED: inorganic pyrophosphatase 3 [Vitis vinifera]
 emb|CBI27937.3| unnamed protein product [Vitis vinifera]
Length=267

 Score =   197 bits (502),  Expect(2) = 8e-74, Method: Compositional matrix adjust.
 Identities = 91/158 (58%), Positives = 121/158 (77%), Gaps = 0/158 (0%)
 Frame = -2

Query  844  FRCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGC  665
            F CDL++VSDAN F+IETILKH G+   FSEI TNP  VDE GRLRI P+ DF  +PHGC
Sbjct  86   FGCDLKVVSDANNFYIETILKHHGLLGFFSEIYTNPTSVDEVGRLRIFPYRDFTLAPHGC  145

Query  664  ARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWE  485
            + C  NMCK  +IE+I+A+  + GKKR IY+GDG GDFCPSLKL  GD++MPRK++P+W 
Sbjct  146  SLCSYNMCKGLVIEQIRAAASENGKKRFIYVGDGKGDFCPSLKLGHGDYVMPRKNYPLWN  205

Query  484  LIKENRSLLEAEIHEWSNGEDFERILFHLINRICIEDS  371
            LI  +   ++A++ EWS+GE+ E++L HLI+ I IE++
Sbjct  206  LICGDPMHIKAQVLEWSDGEELEKVLLHLIDTISIEEN  243


 Score =   109 bits (272),  Expect(2) = 8e-74, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
              G VV+FDFD+TIID DSD WVV E+G T  F QL   +PWN+LMDRM+ E+H+ G+TI 
Sbjct  2     TGIVVLFDFDRTIIDGDSDKWVVVEMGLTQSFQQLRSILPWNTLMDRMLHELHSQGRTIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             +IE+ L+ VP++PRI  AIKA H  G
Sbjct  62    EIEKCLKRVPMNPRIAAAIKAAHDFG  87



>ref|XP_007160240.1| hypothetical protein PHAVU_002G304600g [Phaseolus vulgaris]
 gb|ESW32234.1| hypothetical protein PHAVU_002G304600g [Phaseolus vulgaris]
Length=254

 Score =   196 bits (498),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 116/152 (76%), Gaps = 1/152 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRI+SDAN FFI TIL+H G+  CFS+I TN G+VD+EGRL + PFHD   SPH C+ 
Sbjct  91   CDLRIISDANEFFIRTILEHHGLLGCFSQIYTNRGFVDDEGRLHVTPFHDSTLSPHACSL  150

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  +I++I+ S+    +++ IYLGDG GD+CP+LKLK GDF+MPRK++P+W  I
Sbjct  151  CPPNMCKGLVIDQIRGSL-PGNERKFIYLGDGSGDYCPTLKLKEGDFVMPRKNYPLWNRI  209

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRIC  383
              +  L+ AE+H+WSNGE+ E IL  LIN+I 
Sbjct  210  HSDPKLVAAEVHDWSNGEELESILLKLINKIA  241


 Score =   110 bits (275),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 63/87 (72%), Gaps = 0/87 (0%)
 Frame = -1

Query  1181  AAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTI  1002
             +    VVFDFD+TIID DSD W+V ELG T LF+QL HTMPW SLMDR+M+E+H++G TI
Sbjct  4     SVAATVVFDFDRTIIDDDSDRWIVTELGLTHLFNQLRHTMPWTSLMDRIMEELHSHGITI  63

Query  1001  GDIERVLQGVPIHPRIVPAIKAVHGLG  921
               I   L   P+HP IV AIK+ H LG
Sbjct  64    DHIAECLIRTPLHPNIVSAIKSAHALG  90



>ref|XP_006451424.1| hypothetical protein CICLE_v10009204mg [Citrus clementina]
 ref|XP_006475406.1| PREDICTED: inorganic pyrophosphatase 3-like [Citrus sinensis]
 gb|ESR64664.1| hypothetical protein CICLE_v10009204mg [Citrus clementina]
Length=265

 Score =   192 bits (488),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 93/183 (51%), Positives = 128/183 (70%), Gaps = 8/183 (4%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDL+IVSDAN F+IETI++H G+  CFSEI TNP YVDE+GRLRILP+HD   S +GC  
Sbjct  88   CDLKIVSDANQFYIETIMEHHGLLGCFSEIYTNPTYVDEQGRLRILPYHDSTLSHYGCNL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CP N+CK  +++ +  S G  GK+R IYLGDG GDFCP+LKL+  DF+MPRK++P+W+ I
Sbjct  148  CPSNLCKGFVLDHVCTSFGC-GKRRFIYLGDGRGDFCPTLKLQDCDFVMPRKNYPLWDRI  206

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFLAAESKFQAISMQPCEALPKAI  299
              N  L++A++HEWS+ E+ ++IL HLI  I I+       E     +S QP  +  ++ 
Sbjct  207  CSNPMLIKAKVHEWSSAEELKKILLHLIGAISIK-------EDVDSTVSSQPNSSECRSQ  259

Query  298  RVP  290
             +P
Sbjct  260  TMP  262


 Score =   114 bits (284),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             A  VVVFDFD+T+ID DSDNWVV ++G T LF+QL  T+PWNSLMDRMMKE+H+ GKT+ 
Sbjct  2     ADVVVVFDFDRTLIDDDSDNWVVTQMGLTHLFNQLRSTLPWNSLMDRMMKELHSQGKTVE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI   L+  P+   +  AIK+ H LG
Sbjct  62    DIANCLRQCPLDSHVAAAIKSAHSLG  87



>ref|XP_010231985.1| PREDICTED: inorganic pyrophosphatase 3-like isoform X1 [Brachypodium 
distachyon]
Length=276

 Score =   213 bits (543),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 123/164 (75%), Gaps = 1/164 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDL++VSDAN FFIET+L+H GI  CFSEINTNP  VD +GRLRI PFHD  SSPHGC+ 
Sbjct  93   CDLKVVSDANAFFIETVLEHHGILGCFSEINTNPARVDSDGRLRISPFHDPASSPHGCSL  152

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CP NMCK KIIERIQA+   +  K  IY+GDG GD+CPSLKL+ GD++MP++++P+W LI
Sbjct  153  CPENMCKGKIIERIQATDSAK-NKHFIYIGDGKGDYCPSLKLREGDYVMPKENYPLWNLI  211

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFLAAESK  347
              N+ LL+AE+H W+ GE  ERIL  L+N++    +Q    + K
Sbjct  212  TSNKQLLKAEVHAWNTGEGLERILLQLVNKLITPPAQVTQVDYK  255


 Score = 92.8 bits (229),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 59/92 (64%), Gaps = 4/92 (4%)
 Frame = -1

Query  1184  MAAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLM----DRMMKEIHA  1017
             MAA  VVVFDFDKTII+ DSDNWVV +LG T  F++L  TM W  LM    DRMM E+H 
Sbjct  1     MAAALVVVFDFDKTIIEWDSDNWVVTKLGATDAFNRLRPTMSWTPLMVCMYDRMMGELHE  60

Query  1016  NGKTIGDIERVLQGVPIHPRIVPAIKAVHGLG  921
              GK+  DI + L+  P+   ++ AI+    LG
Sbjct  61    QGKSAEDIRQCLRSAPLDAHVISAIRTASALG  92



>ref|XP_007150538.1| hypothetical protein PHAVU_005G160800g [Phaseolus vulgaris]
 gb|ADQ85984.1| acid phosphatase [Phaseolus vulgaris]
 gb|ESW22532.1| hypothetical protein PHAVU_005G160800g [Phaseolus vulgaris]
Length=279

 Score =   195 bits (496),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 97/193 (50%), Positives = 132/193 (68%), Gaps = 12/193 (6%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+L+IVSDAN FFIE ILKH G+  CFS+I  NP YV+EEGRLRI P+HD+  S HGC  
Sbjct  88   CELKIVSDANSFFIERILKHHGVWNCFSDITANPSYVNEEGRLRICPYHDYVKSSHGCNL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  +IERIQ    +E  K+ IYLGDG GDFCPSLKLK  D++MPR++FP+ +L+
Sbjct  148  CPPNMCKGLVIERIQNDGAEE--KKYIYLGDGNGDFCPSLKLKEKDYLMPRRNFPLCDLV  205

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQ---------FLAAESKFQAISMQ  326
             +N + ++ E+H W NGE+   ++ H+IN+I  E+ +          ++ + K  +IS+ 
Sbjct  206  SKNPNHIKPEVHAWRNGEELYDVMLHIINKIIGEEGKNSVSSSSTPTISIDCKLGSISID  265

Query  325  -PCEALPKAIRVP  290
                 LPKA+ VP
Sbjct  266  LHNNPLPKALPVP  278


 Score =   110 bits (276),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFD TII+ DSDNWV+DE G T  F +LL    WN LMD+MM E+H+ GKTI 
Sbjct  2     AGIVVVFDFDSTIIECDSDNWVLDEFGLTQKFYELLPNTLWNPLMDKMMDELHSQGKTIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI +VL   P+HP IVPAI+A + LG
Sbjct  62    DIVQVLNRTPMHPSIVPAIQAAYSLG  87



>gb|ACG25081.1| phosphatase phospho1 [Zea mays]
Length=283

 Score =   185 bits (469),  Expect(2) = 7e-73, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 114/164 (70%), Gaps = 6/164 (4%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCA-  662
            CDLR++SDAN FFI T+L H G+ +CFS+INTNP  VD  GRLRI P HD  ++PHGC  
Sbjct  88   CDLRVLSDANAFFIHTVLDHHGLLDCFSQINTNPSRVDAHGRLRIGPCHDPRAAPHGCGV  147

Query  661  -RCPPNMCKSKIIERI----QASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDF  497
              CPPNMCK  +++RI    +A      K RVIYLGDG GD+CP+L+L   DF+MPR+ +
Sbjct  148  GTCPPNMCKGLVLDRILREAEAEAASSAKPRVIYLGDGRGDYCPALRLARTDFVMPRRGY  207

Query  496  PVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQF  365
            PVW+LI E+ + L+AE+H W++G + E  L  L+ R  +ED+  
Sbjct  208  PVWDLICEDPARLQAEVHPWTDGAELEETLLRLVRRALVEDAAL  251


 Score =   118 bits (296),  Expect(2) = 7e-73, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFDKTIIDVDSDNWVVD LG T LF++LL T PWN+LMD MM E+HA G+T+ 
Sbjct  2     AGIVVVFDFDKTIIDVDSDNWVVDSLGLTDLFERLLPTTPWNTLMDTMMGELHARGRTLA  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             ++   L+  PI PR+  A++A H LG
Sbjct  62    EVTEALRAAPIDPRVPAAVRAAHALG  87



>ref|XP_010690044.1| PREDICTED: inorganic pyrophosphatase 2-like [Beta vulgaris subsp. 
vulgaris]
Length=290

 Score =   188 bits (478),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 93/198 (47%), Positives = 128/198 (65%), Gaps = 19/198 (10%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRI+SDAN FFIETIL H GI++ F+EI+TN G+VDE GR+RI P HDF ++PHGC  
Sbjct  94   CDLRILSDANRFFIETILDHHGIKDYFTEIHTNSGFVDENGRVRIFPHHDFTTTPHGCDN  153

Query  658  --CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWE  485
              CPPNMCK  +++++ A    EG    IYLGDG GD CPS KL+  D+ MPR ++P+W 
Sbjct  154  ILCPPNMCKGSVMKKLLA---HEGDNTFIYLGDGNGDHCPSTKLRERDYCMPRINYPLWG  210

Query  484  LIKENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQ-------------FLAAESKF  344
            +I  N  ++ AEIH W++G+D ER+L  LI+ I   D++                 ++KF
Sbjct  211  VITSNPKVITAEIHGWTDGQDLERVLLSLIHSIISNDNKNKQEKNVGGSFQSLTGIKNKF  270

Query  343  QAISMQPC-EALPKAIRV  293
                 +P  E+LP A++V
Sbjct  271  NKNMPRPSRESLPPALKV  288


 Score =   114 bits (286),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             A  +VVFDFDKTI+D D+DNWV+DEL FT +F+QLL TMPWN LMD MMKE+H  G T  
Sbjct  8     ANIMVVFDFDKTIVDCDTDNWVLDELNFTEMFEQLLPTMPWNPLMDLMMKEMHEKGVTTN  67

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI  VL   PIH RI+PAIK+ +  G
Sbjct  68    DIVEVLNRTPIHARIIPAIKSAYDAG  93



>emb|CAN67288.1| hypothetical protein VITISV_021601 [Vitis vinifera]
Length=256

 Score =   180 bits (456),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 116/183 (63%), Gaps = 14/183 (8%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRIVSDAN FFIET+LKH G+ +CFSEI TNP +VD EGRLRILP+HD  SS HGC  
Sbjct  87   CDLRIVSDANAFFIETVLKHHGLMDCFSEIKTNPSFVDGEGRLRILPYHDLKSSSHGCNI  146

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  ++ER++ S+  EGKKR IYLGDG  DFC  LKL  G     +K+ P     
Sbjct  147  CPPNMCKGLVMERVRTSVSAEGKKRFIYLGDGSADFCSGLKLGEGGLPDAQKELP-----  201

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFLAAESKFQAISMQPCEALPKAI  299
                  L   +H   NGE+ E+IL HLI  I IE+   + +E K QA SM   +     +
Sbjct  202  -----HLGDYLH---NGEELEKILLHLITTISIEEKCNMRSE-KCQASSMDSHKTFQSVL  252

Query  298  RVP  290
             VP
Sbjct  253  PVP  255


 Score =   122 bits (307),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = -1

Query  1175  GTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGD  996
               VVVFDFDKTIID DSDNWVVDELG T LF QLL TMPWNSLMDRM  E+H+ GKT+ +
Sbjct  2     AVVVVFDFDKTIIDCDSDNWVVDELGLTPLFTQLLPTMPWNSLMDRMFMELHSQGKTMEE  61

Query  995   IERVLQGVPIHPRIVPAIKAVHGLG  921
             I   L+  P+HPRI+ AIK+ H  G
Sbjct  62    IAECLKRAPLHPRIISAIKSAHASG  86



>ref|NP_001130133.1| phosphatase phospho1 [Zea mays]
 gb|ACF78268.1| unknown [Zea mays]
 gb|ACG25041.1| phosphatase phospho1 [Zea mays]
 gb|ACG25244.1| phosphatase phospho1 [Zea mays]
 gb|AFW83764.1| phosphatase phospho1 [Zea mays]
Length=285

 Score =   183 bits (465),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 113/166 (68%), Gaps = 8/166 (5%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCA-  662
            CDLR++SDAN FFI T+L H G+  CFS++NTNP  VD  GRLRI P HD  ++PHGC  
Sbjct  88   CDLRVLSDANAFFIHTVLDHHGLLACFSQVNTNPSRVDAHGRLRIGPCHDPRAAPHGCGV  147

Query  661  -RCPPNMCKSKIIERI------QASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRK  503
              CPPNMCK  +++RI      +A      K RVIYLGDG GD+CP+L+L   DF+MPR+
Sbjct  148  GTCPPNMCKGLVLDRILREAEAEAETASSAKPRVIYLGDGRGDYCPALRLARTDFVMPRR  207

Query  502  DFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQF  365
             +PVW+LI E+ + L+AE+H W++G + E  L  L+ R  +ED+  
Sbjct  208  GYPVWDLICEDPARLQAEVHPWTDGAELEETLLRLVRRAVVEDAAL  253


 Score =   119 bits (297),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFDKTIIDVDSDNWVVD LG T LF++LL T PWN+LMD MM E+HA G+T+ 
Sbjct  2     AGIVVVFDFDKTIIDVDSDNWVVDSLGLTDLFERLLPTTPWNTLMDTMMGELHARGRTLA  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             ++   L+  PI PR+  A++A H LG
Sbjct  62    EVTEALRAAPIDPRVPAAVRAAHALG  87



>ref|XP_008242421.1| PREDICTED: inorganic pyrophosphatase 3 [Prunus mume]
Length=257

 Score =   191 bits (484),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 117/155 (75%), Gaps = 0/155 (0%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRI+SDAN FFIETIL+  G+  CFS+I TNP +VD +GRLRI P+ D  S  HGC  
Sbjct  88   CDLRIISDANQFFIETILECHGLLGCFSQIVTNPSFVDGDGRLRIFPYRDVGSPSHGCNL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPN+CK  +I++I+AS+   G+KR IYLGDG  DFCP+L+L  GD +MPRKD+ + + I
Sbjct  148  CPPNLCKGVVIDQIRASVSANGRKRYIYLGDGRNDFCPTLRLVEGDHVMPRKDYALSKRI  207

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIED  374
              N+ L++A+IHEWS+GE+  +IL HLI+RI  ++
Sbjct  208  YSNQMLIKADIHEWSDGEELGKILLHLIHRISTKE  242


 Score =   111 bits (278),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFD+T+ID DSD+WVV E+G T LF++L  T+PWN LMDRMMKE+H  GK+  
Sbjct  2     AGIVVVFDFDRTLIDGDSDSWVVAEMGLTQLFNELRSTLPWNKLMDRMMKELHLQGKSSV  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI+  L+ +P+HP ++ AIK+ H  G
Sbjct  62    DIKECLKIIPMHPGVIAAIKSAHASG  87



>gb|ACJ84372.1| unknown [Medicago truncatula]
Length=207

 Score =   167 bits (424),  Expect(2) = 4e-72, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 95/115 (83%), Gaps = 1/115 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRIVSDAN+F+IETILKHLGI ECFSEIN+NPGYV++EGR+RI P+HDF+ + HGC  
Sbjct  89   CDLRIVSDANMFYIETILKHLGISECFSEINSNPGYVNQEGRVRISPYHDFNKASHGCNN  148

Query  658  -CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDF  497
             CPPNMCK  II++I+ ++     KR+IYLGDG GD+CPSL+ K  DF+MPR+ F
Sbjct  149  VCPPNMCKGLIIDKIKNTIYDGDNKRLIYLGDGAGDYCPSLRFKERDFVMPRRIF  203


 Score =   134 bits (336),  Expect(2) = 4e-72, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = -1

Query  1184  MAAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKT  1005
             M+   V++FDFDKTIID DSDNW++DELGFT LF+QLL TMPWNS+MD+MM E H+NG T
Sbjct  1     MSNNIVIIFDFDKTIIDCDSDNWLIDELGFTDLFNQLLPTMPWNSVMDKMMMEFHSNGVT  60

Query  1004  IGDIERVLQGVPIHPRIVPAIKAVHGLG  921
             I +IE+VLQ +PIH RI+PAIK+ H LG
Sbjct  61    IEEIEKVLQRIPIHHRIIPAIKSAHALG  88



>ref|XP_011093693.1| PREDICTED: inorganic pyrophosphatase 3 [Sesamum indicum]
Length=241

 Score =   189 bits (480),  Expect(2) = 6e-72, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 118/155 (76%), Gaps = 2/155 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDL++VSD+NLF+I+TIL+H G+  CFSEI TNP  VD  GRLRI P+HD  SS HGC  
Sbjct  89   CDLKVVSDSNLFYIKTILEHNGVYNCFSEITTNPALVDG-GRLRIFPYHDAASS-HGCDL  146

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPN+CK ++I++I++S+ +   K++IY+GDG+ DFCP+LKL AGD +MPRK+FP+W  I
Sbjct  147  CPPNLCKGRVIQQIRSSISENESKKIIYVGDGMNDFCPTLKLVAGDCVMPRKNFPLWGRI  206

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIED  374
             +N  L++A ++EW + ED  RIL  LIN   IED
Sbjct  207  WKNFQLVKAIVYEWDDSEDLARILLELINSKSIED  241


 Score =   111 bits (278),  Expect(2) = 6e-72, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 65/88 (74%), Gaps = 0/88 (0%)
 Frame = -1

Query  1184  MAAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKT  1005
             MA   V++FDFD+T+I+ DSD WV+  LG   LF QLLH +PWNSLMDRM++E++  GKT
Sbjct  1     MAGSVVILFDFDRTLIEDDSDRWVITNLGLNELFHQLLHALPWNSLMDRMLEELYTQGKT  60

Query  1004  IGDIERVLQGVPIHPRIVPAIKAVHGLG  921
             + DI   L+G+P++P ++  IK+ H LG
Sbjct  61    VDDIVECLKGIPLNPHVIAVIKSAHALG  88



>ref|NP_001151156.1| LOC100284789 [Zea mays]
 gb|ACG41811.1| phosphatase phospho1 [Zea mays]
 tpg|DAA57843.1| TPA: phosphatase phospho1 [Zea mays]
Length=276

 Score =   186 bits (473),  Expect(2) = 7e-72, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 117/163 (72%), Gaps = 6/163 (4%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGY--VDEEGRLRILPFHDFHSSPHGC  665
            CDLR++SDAN FFI+T+L H G+  CFS+INTNP +   D +GRLRI P+HD H    G 
Sbjct  88   CDLRVLSDANAFFIDTVLAHHGLLGCFSQINTNPSHPDADADGRLRIGPYHDLHGC--GV  145

Query  664  ARCPPNMCKSKIIERI--QASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPV  491
              CPPNMCK ++++RI  +AS    G+KRV+YLGDG GD+CP+L+L   DF+MPR+ FPV
Sbjct  146  GTCPPNMCKGQVLDRILREASSSAAGRKRVVYLGDGRGDYCPALRLAREDFVMPRRGFPV  205

Query  490  WELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFL  362
            W+LI E+ + L+AE+H W++G + E  L  L+ R  +E++  L
Sbjct  206  WDLICEDPARLQAEVHPWADGAELEETLLRLVGRARVEEAALL  248


 Score =   114 bits (284),  Expect(2) = 7e-72, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFDKTIIDVDSDNWVVD LGFT  F++LL TMPWN+LMD MM E+HA+G+T+ 
Sbjct  2     AGVVVVFDFDKTIIDVDSDNWVVDSLGFTEPFERLLPTMPWNTLMDTMMGELHAHGRTLD  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             D+   L+  P+   +  AIKA + LG
Sbjct  62    DVAEALRAAPVVAGVPAAIKAAYALG  87



>gb|KHG05357.1| hypothetical protein F383_31213 [Gossypium arboreum]
Length=245

 Score =   197 bits (500),  Expect(2) = 9e-72, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 117/158 (74%), Gaps = 0/158 (0%)
 Frame = -2

Query  844  FRCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGC  665
            F CDLRI+SDAN FFIE IL+H  +  CFS+I TNP +VDEEGRLRI P+HD   SPHGC
Sbjct  86   FGCDLRILSDANQFFIEKILEHHDLLGCFSKIYTNPTFVDEEGRLRIFPYHDSTLSPHGC  145

Query  664  ARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWE  485
            + CP N+CK +++   QAS  +  ++  IYLGDG GD+CP+LKL   D++MPRK++P+W 
Sbjct  146  SLCPSNLCKGQVLNNNQASAPESERQNFIYLGDGSGDYCPTLKLGDKDYVMPRKNYPLWN  205

Query  484  LIKENRSLLEAEIHEWSNGEDFERILFHLINRICIEDS  371
             I  +R+ ++AE+ EWSNGE+ E IL HLINRI  E S
Sbjct  206  CIFSDRAFVKAEVREWSNGEELEGILLHLINRISSERS  243


 Score =   103 bits (256),  Expect(2) = 9e-72, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             A  VVVFDFD+T+ID DSD+WVV E+G + LF QL  T+PWNSLMDRMMKE+H+ G+T  
Sbjct  2     AAIVVVFDFDRTLIDGDSDSWVVTEMGLSDLFHQLRSTLPWNSLMDRMMKELHSRGETAD  61

Query  998   DIERVLQGVPIHPR  957
             DI   L+  P+HPR
Sbjct  62    DIAECLKKTPVHPR  75



>ref|XP_009352621.1| PREDICTED: inorganic pyrophosphatase 3 [Pyrus x bretschneideri]
Length=245

 Score =   189 bits (479),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 117/158 (74%), Gaps = 0/158 (0%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRIVSDAN FFIE IL+  G+  CFS+I TNP  V+++GRLRI P  D  SS HGC  
Sbjct  88   CDLRIVSDANRFFIEAILECHGLLGCFSQIVTNPTSVEQDGRLRIFPHCDLGSSFHGCNL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPN+CK  +I++I+AS+   G+KR +YLGDG  D+CPSL+L  GD +MPRKD+ +W+ I
Sbjct  148  CPPNLCKGVVIDQIRASVSANGRKRFVYLGDGRNDYCPSLRLVEGDHVMPRKDYALWKRI  207

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQF  365
              N  L++A+IHEWS+GE+  + L HLI+RI  E++Q 
Sbjct  208  CSNPVLIKADIHEWSDGEELGKTLLHLIHRISSEENQM  245


 Score =   110 bits (275),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFD+T+ID DSD+WVV E+G T LF+++  T+PWNSLMDRM +E+H  GKT  
Sbjct  2     AGIVVVFDFDRTLIDGDSDSWVVTEMGLTQLFNEIRSTLPWNSLMDRMTEELHLQGKTSE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI+  L+ +P+HP +  AIK+ H  G
Sbjct  62    DIKECLKRIPMHPGVTAAIKSAHASG  87



>ref|XP_008337676.1| PREDICTED: inorganic pyrophosphatase 3 [Malus domestica]
Length=247

 Score =   187 bits (474),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 116/157 (74%), Gaps = 0/157 (0%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRIVSDAN FFIE IL+  G+  CFS+I TNP  V+++GRLRI P  D  SS HGC  
Sbjct  88   CDLRIVSDANQFFIEAILECHGLLGCFSQIVTNPTSVEQDGRLRIFPHCDLGSSSHGCNL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPN+CK  +I++I+AS+   G+KR +YLGDG  D+CPSL+L  GD +MPR+D+ +W+ I
Sbjct  148  CPPNLCKGVVIDQIRASVSANGRKRFVYLGDGRNDYCPSLRLVEGDHVMPRRDYALWKRI  207

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQ  368
              N  L++A+IHEWS+GE+  + L H I+RI  E++Q
Sbjct  208  CSNPVLIKADIHEWSDGEELGKTLLHXIHRISSEENQ  244


 Score =   112 bits (279),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFD+T+ID DSD WVV E+G T LF++L  T+PWNSLMDRM KE+H  GKT  
Sbjct  2     AGIVVVFDFDRTLIDGDSDRWVVTEMGLTQLFNELRSTLPWNSLMDRMTKELHLQGKTSE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI+  L+ +P+HP +  AIK+ H  G
Sbjct  62    DIKECLKRIPMHPGVTAAIKSAHXSG  87



>ref|XP_004287531.1| PREDICTED: inorganic pyrophosphatase 3-like [Fragaria vesca subsp. 
vesca]
Length=236

 Score =   185 bits (470),  Expect(2) = 8e-71, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 111/149 (74%), Gaps = 0/149 (0%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDL+I+SDAN FFIE+IL+  G+  CFS+I TNP  VD +GRLRI P+HD  SS HGC  
Sbjct  88   CDLKIISDANQFFIESILECHGLLGCFSQIVTNPTSVDGDGRLRISPYHDPVSSSHGCNF  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CP NMCK ++I++  AS  + G+KR IYLGDG  DFCP+LKL  GD +MPRK++P+W+ I
Sbjct  148  CPSNMCKGQVIDQFLASASENGRKRYIYLGDGRNDFCPTLKLVEGDHVMPRKEYPLWDRI  207

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLIN  392
              NR L+ A+IHEW++GE+  +IL  LI 
Sbjct  208  CSNRMLINADIHEWTDGEELAKILLQLIQ  236


 Score =   111 bits (278),  Expect(2) = 8e-71, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
              GTVVVFDFD+T+I+ DSD WVV E+G   +F++L  T+PWNSLMDRMM E+H  GKT  
Sbjct  2     TGTVVVFDFDRTLINDDSDRWVVTEMGLKQVFNELRSTLPWNSLMDRMMMELHLQGKTTE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI+  L+  P+HP +V AIK+ H LG
Sbjct  62    DIKECLKRTPMHPLVVAAIKSAHALG  87



>ref|XP_008228321.1| PREDICTED: inorganic pyrophosphatase 2-like isoform X2 [Prunus 
mume]
Length=223

 Score =   238 bits (606),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 115/184 (63%), Positives = 146/184 (79%), Gaps = 4/184 (2%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDL+IVSDANLFFIETILKHLG+ E FSEINTNP YVDE+GRLRI P HDF    HGC+ 
Sbjct  40   CDLKIVSDANLFFIETILKHLGLEEYFSEINTNPSYVDEQGRLRISPHHDFIKCSHGCSL  99

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  +IER+Q  +  EGKK++IYLGDG GD+CPSLKLK  DF+MPRK+FP+++LI
Sbjct  100  CPPNMCKGVVIERVQTYLSSEGKKKIIYLGDGSGDYCPSLKLKEVDFVMPRKNFPLFDLI  159

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICI-EDSQFL-AAESKFQAISMQPCEALPK  305
             ++  L++A+IHEW++GE+ E IL +LIN I   E++QF+ AA+ K Q +S    EALP+
Sbjct  160  CKDPLLIKADIHEWTDGEELEHILLNLINTIATEENAQFISAADCKLQTMSAH--EALPQ  217

Query  304  AIRV  293
            A+ V
Sbjct  218  ALPV  221


 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -1

Query  1037  MMKEIHANGKTIGDIERVLQGVPIHPRIVPAIKAVHGLG  921
             MMKE+H+ GKT  DI  VL+  PIHPR+VPAIKA H LG
Sbjct  1     MMKELHSQGKTAEDIVEVLKRTPIHPRVVPAIKAAHALG  39



>ref|XP_010047325.1| PREDICTED: inorganic pyrophosphatase 2-like isoform X1 [Eucalyptus 
grandis]
Length=317

 Score =   187 bits (475),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 125/188 (66%), Gaps = 7/188 (4%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRI+SD+N+FFIETIL+H G+ ECFS+INTNPG VD EGRL I P+HDF    HGC  
Sbjct  120  CDLRILSDSNVFFIETILRHHGLMECFSQINTNPGSVDAEGRLNISPYHDFSRLLHGCKI  179

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  ++++I++    +GK+R +Y+GDG  DFC  +KL+  D ++PRKDFPVW+LI
Sbjct  180  CPPNMCKGIVMDKIRSPAFAKGKRRFVYVGDGAADFCAGMKLEEEDVLLPRKDFPVWDLI  239

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRIC-------IEDSQFLAAESKFQAISMQPC  320
              + +L++A + EW++  + E +L   ++ +        ++ ++ + A  KFQ   +   
Sbjct  240  CRSPTLIKARVLEWTDAAELETVLLSSVDTLGRTGNGSNVKAARVVPAACKFQTSLLDAA  299

Query  319  EALPKAIR  296
               P A R
Sbjct  300  PESPAARR  307


 Score =   108 bits (271),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             A  V+VFDFDKTI+D DSD+WVVD+LG +  FD+L  T+P+NSLMDRMM E+H+ GKT+ 
Sbjct  34    AEIVLVFDFDKTILDCDSDDWVVDKLGLSEAFDRLRPTLPYNSLMDRMMMELHSRGKTME  93

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             +I   L+  P+HP+IV AIK+ +  G
Sbjct  94    EIADCLKEAPLHPKIVSAIKSANASG  119



>ref|XP_010047326.1| PREDICTED: inorganic pyrophosphatase 2-like isoform X2 [Eucalyptus 
grandis]
 gb|KCW79212.1| hypothetical protein EUGRSUZ_C00640 [Eucalyptus grandis]
Length=309

 Score =   187 bits (474),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 125/188 (66%), Gaps = 7/188 (4%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRI+SD+N+FFIETIL+H G+ ECFS+INTNPG VD EGRL I P+HDF    HGC  
Sbjct  112  CDLRILSDSNVFFIETILRHHGLMECFSQINTNPGSVDAEGRLNISPYHDFSRLLHGCKI  171

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  ++++I++    +GK+R +Y+GDG  DFC  +KL+  D ++PRKDFPVW+LI
Sbjct  172  CPPNMCKGIVMDKIRSPAFAKGKRRFVYVGDGAADFCAGMKLEEEDVLLPRKDFPVWDLI  231

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRIC-------IEDSQFLAAESKFQAISMQPC  320
              + +L++A + EW++  + E +L   ++ +        ++ ++ + A  KFQ   +   
Sbjct  232  CRSPTLIKARVLEWTDAAELETVLLSSVDTLGRTGNGSNVKAARVVPAACKFQTSLLDAA  291

Query  319  EALPKAIR  296
               P A R
Sbjct  292  PESPAARR  299


 Score =   108 bits (270),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             A  V+VFDFDKTI+D DSD+WVVD+LG +  FD+L  T+P+NSLMDRMM E+H+ GKT+ 
Sbjct  26    AEIVLVFDFDKTILDCDSDDWVVDKLGLSEAFDRLRPTLPYNSLMDRMMMELHSRGKTME  85

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             +I   L+  P+HP+IV AIK+ +  G
Sbjct  86    EIADCLKEAPLHPKIVSAIKSANASG  111



>ref|XP_003638610.1| hypothetical protein MTR_138s0008, partial [Medicago truncatula]
Length=194

 Score =   236 bits (601),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 141/171 (82%), Gaps = 1/171 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRIVSDAN  FI+TILKHLGI ECFSEINTNPGYV++EGRL+++P+HDF+ + HGC  
Sbjct  16   CDLRIVSDANTIFIDTILKHLGISECFSEINTNPGYVNQEGRLKVMPYHDFNKASHGCTL  75

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  II+RIQ S+ +  KKR IYLGDG GD+CPSL+L+  DF+MPRK+FPVW+LI
Sbjct  76   CPPNMCKGLIIDRIQKSISEVEKKRFIYLGDGAGDYCPSLRLRERDFVMPRKNFPVWDLI  135

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIEDS-QFLAAESKFQAISM  329
             ++ SL++AEIH WS+GE+ E++L +LIN+I +E+  QF+A++ K    S+
Sbjct  136  CKDPSLVKAEIHGWSDGEELEQVLMNLINKIMMEEHVQFIASDCKLATNSI  186



>ref|XP_006646071.1| PREDICTED: inorganic pyrophosphatase 3-like, partial [Oryza brachyantha]
Length=273

 Score =   208 bits (529),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 101/184 (55%), Positives = 129/184 (70%), Gaps = 3/184 (2%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLR+VSDAN FFIET+L+H G+  CFSEI+TNP  VD +GRLRI PFHD  SSPHGC+ 
Sbjct  91   CDLRVVSDANAFFIETVLEHHGVLGCFSEISTNPARVDGDGRLRISPFHDPDSSPHGCSL  150

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CP NMCK KIIERIQA+    GK+  IY+GDG GD+CPSLKL  GD++MP+++ P+W LI
Sbjct  151  CPDNMCKGKIIERIQAT--ANGKRHFIYIGDGRGDYCPSLKLGEGDYVMPKENHPLWNLI  208

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFLAAESKFQAISMQPCE-ALPKA  302
              N  LL+AE+H W NGE+ E+ L  L+N++    +Q    E K    +    E    +A
Sbjct  209  SSNTQLLKAEVHPWKNGEELEKTLLKLVNKVINPPAQASQFECKCDMSNPVSTEVGHHQA  268

Query  301  IRVP  290
            +RVP
Sbjct  269  LRVP  272


 Score = 87.0 bits (214),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
 Frame = -1

Query  1160  FDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIERVL  981
             FDFDKTII+ DSD+WV+ ELG    F +L  TM WN LMDRMM E+HA G++  DI   L
Sbjct  11    FDFDKTIIEWDSDHWVITELGAADAFSRLRPTMRWNPLMDRMMAELHAQGRSADDIRECL  70

Query  980   QGVPIHPRIVPAIKAVHGLG  921
             +  P+   ++ AI+    LG
Sbjct  71    RSAPLDAHVLSAIRTASALG  90



>gb|KDP34111.1| hypothetical protein JCGZ_07682 [Jatropha curcas]
Length=281

 Score =   198 bits (503),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 126/179 (70%), Gaps = 9/179 (5%)
 Frame = -2

Query  835  DLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCARC  656
            DLRIVSDAN FFIETIL+  GI  CFSEI+TNP YVDEEGRL+IL +HD  SS HGC+ C
Sbjct  89   DLRIVSDANTFFIETILEKHGIIGCFSEIHTNPSYVDEEGRLKILQYHDSKSSSHGCSIC  148

Query  655  PPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI-  479
            PPNMCK  ++ERI+ S+  EGKKR IY+GDG  DFC +LKL+ GDF+MPRK+FP+ + I 
Sbjct  149  PPNMCKGLVMERIRTSVRSEGKKRFIYVGDGTPDFCATLKLEEGDFVMPRKNFPLCDFIY  208

Query  478  -KENRSLLEAEIHEWSNGEDFERILFHLINRICIE-------DSQFLAAESKFQAISMQ  326
               N++L++A I EWS+GE+    L + IN I I+       D   +  + KFQ  S+ 
Sbjct  209  GNGNKNLIKANIQEWSDGEELSTNLLNAINTIIIQEDYNVRPDDPLVPLDCKFQTSSIS  267


 Score = 96.7 bits (239),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 60/86 (70%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             A  +VVFDFD+T+ID DSD WVV++LG    F QLL T+P NS+MD+MM E+H+  KTI 
Sbjct  2     AKALVVFDFDETLIDCDSDYWVVEQLGVNDTFLQLLPTLPLNSIMDQMMTELHSRKKTIQ  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI   L  VP H +I+ AIK+ +  G
Sbjct  62    DIAECLIQVPFHSKILSAIKSAYASG  87



>ref|XP_010062596.1| PREDICTED: inorganic pyrophosphatase 2-like [Eucalyptus grandis]
 ref|XP_010062597.1| PREDICTED: inorganic pyrophosphatase 2-like [Eucalyptus grandis]
 ref|XP_010062598.1| PREDICTED: inorganic pyrophosphatase 2-like [Eucalyptus grandis]
Length=269

 Score =   238 bits (606),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 143/179 (80%), Gaps = 6/179 (3%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEE-GRLRILPFHDFHSSPHGCA  662
            C+LRI+SDA+LF+IETIL HLGIRECFS+I TNP +VDEE GRLRILPFHDF SSPHGC 
Sbjct  88   CELRILSDADLFYIETILNHLGIRECFSQITTNPSFVDEEKGRLRILPFHDFRSSPHGCG  147

Query  661  RCPPNMCKSKIIERIQASMGKEGKK-RVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWE  485
             CPPN+CK  +IER+QAS+  EGKK R IY+GDG+GD+CPSLKL  GDFMMPRKD+P W+
Sbjct  148  LCPPNLCKGAVIERVQASVSAEGKKKRFIYVGDGVGDYCPSLKLSEGDFMMPRKDYPAWD  207

Query  484  LIKENRSLLEAEIHEWSNGEDFERILFHLINRICIED----SQFLAAESKFQAISMQPC  320
            LI +N +LL+AEIHEW++GE+ ER++  LI+ I  E+     + ++++ + Q I+   C
Sbjct  208  LICQNPALLKAEIHEWTDGEELERVVLRLIDAIITEEEIKSGRSISSDREMQNIADHRC  266


 Score =   110 bits (276),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 71/106 (67%), Gaps = 1/106 (1%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             A  +VVFDFDKTI+D + D+W+V E G   L ++LL T PWNSLMD+MM E+H+ GKTI 
Sbjct  2     ADIMVVFDFDKTIMDWECDDWIVHEFGLIDLVNELLPTTPWNSLMDKMMGELHSRGKTIA  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG*CSFL*LSVLGFLAVLSFLT  861
             DI  VL+   +HPRIVPAIK++H LG C    LS      + + L 
Sbjct  62    DIADVLKRATMHPRIVPAIKSIHALG-CELRILSDADLFYIETILN  106



>gb|EYU27314.1| hypothetical protein MIMGU_mgv1a012849mg [Erythranthe guttata]
Length=238

 Score =   182 bits (462),  Expect(2) = 7e-70, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 111/150 (74%), Gaps = 5/150 (3%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDL+IVSD+N+F+I+TIL+H GI ECFSEI TNP  VD   RLRI PF     SPHGC  
Sbjct  89   CDLKIVSDSNMFYIKTILEHHGIYECFSEITTNPSVVDNR-RLRISPFS---PSPHGCDL  144

Query  658  CPPNMCKSKIIERIQASMGKEGKKR-VIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWEL  482
            CPPN+CK ++++RIQAS  + G+KR +IY+GDG+ DFCP+LKL   D +MPRK+FP+W  
Sbjct  145  CPPNLCKGRVLDRIQASTTESGRKRQLIYVGDGMNDFCPTLKLVERDCVMPRKNFPLWNR  204

Query  481  IKENRSLLEAEIHEWSNGEDFERILFHLIN  392
            I +N  L+ A+IHEW  GED  RI+  LI 
Sbjct  205  IMKNPQLVRAKIHEWGKGEDLARIMLELIT  234


 Score =   111 bits (278),  Expect(2) = 7e-70, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 66/88 (75%), Gaps = 0/88 (0%)
 Frame = -1

Query  1184  MAAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKT  1005
             MA   VV+FDFD+T+I+ DSD WVV  +G T LF+QL  T+PWNSLMDRM++E+H  GKT
Sbjct  1     MAGEIVVIFDFDRTLIEDDSDRWVVTNMGLTQLFNQLRPTLPWNSLMDRMLEELHIRGKT  60

Query  1004  IGDIERVLQGVPIHPRIVPAIKAVHGLG  921
             I +I   L+ +P+HP ++ AIK+ H LG
Sbjct  61    IEEISDCLKSMPLHPHVIEAIKSAHALG  88



>ref|XP_007202473.1| hypothetical protein PRUPE_ppa010251mg [Prunus persica]
 gb|EMJ03672.1| hypothetical protein PRUPE_ppa010251mg [Prunus persica]
Length=257

 Score =   186 bits (472),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 114/155 (74%), Gaps = 0/155 (0%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRI+SDAN FFIETIL+  G+   FS+I TNP  VD +GRLRI P+HD  S  HGC  
Sbjct  88   CDLRIISDANQFFIETILECHGLLGSFSQIVTNPSIVDGDGRLRIFPYHDVGSPSHGCNL  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CP N+CK  +I++I+AS+   G+K  IYLGDG  DFCP+L+L  GD +MPRKD+ + + I
Sbjct  148  CPSNLCKGVVIDQIRASVSANGRKIYIYLGDGRNDFCPTLRLVEGDHVMPRKDYALSKRI  207

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIED  374
              NR L++A+IHEWS+GE+  +IL HLI+RI  E+
Sbjct  208  YSNRMLIKADIHEWSDGEELGKILLHLIHRISTEE  242


 Score =   107 bits (267),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFD+T+ID DSD+WVV E+G T LF++L  T+PWN LMDRMM+E+H  GK+  
Sbjct  2     AGIVVVFDFDRTLIDGDSDSWVVAEMGLTQLFNELRSTLPWNKLMDRMMEELHLQGKSSV  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI+  L+ +P+H  ++ AIK+ H  G
Sbjct  62    DIKECLKRIPMHLGVIAAIKSAHASG  87



>gb|KHN16679.1| Inorganic pyrophosphatase 3 [Glycine soja]
Length=246

 Score =   195 bits (496),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 117/157 (75%), Gaps = 4/157 (3%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRI+SDAN F I TIL+H  +  CFS+I+TNP ++D +GRLR+ PFH    SPH C  
Sbjct  90   CDLRIISDANTFSIRTILQHHALFHCFSQIHTNPAFLDNQGRLRVTPFHHSTHSPHSCPL  149

Query  658  CPPNMCKSKIIERIQASM----GKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPV  491
            CPPNMCK  +I++I++S+    G E ++R IY+GDG GD+CP+LKLK GDF+MPRK++P+
Sbjct  150  CPPNMCKGLVIDQIRSSLLSGTGNEEERRFIYIGDGAGDYCPTLKLKGGDFVMPRKNYPL  209

Query  490  WELIKENRSLLEAEIHEWSNGEDFERILFHLINRICI  380
            W  I  +  L+ A++H+WS GED E IL +LIN+I +
Sbjct  210  WNKIHSDPKLVAAQLHDWSTGEDLETILLNLINKISL  246


 Score = 95.5 bits (236),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = -1

Query  1160  FDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIERVL  981
              DFD+TIID DSD W+V ELG T LF +L H+MPW SLMDR+M ++H+NG T+  I   L
Sbjct  10    LDFDRTIIDDDSDRWIVAELGLTELFKELRHSMPWISLMDRIMAQLHSNGVTVDHIADCL  69

Query  980   QGVPIHPRIVPAIKAVHGLG  921
             + +P  P IV AIK+ H LG
Sbjct  70    KRLPFPPPIVSAIKSAHALG  89



>ref|XP_006854012.1| hypothetical protein AMTR_s00036p00240530 [Amborella trichopoda]
 gb|ERN15479.1| hypothetical protein AMTR_s00036p00240530 [Amborella trichopoda]
Length=284

 Score =   176 bits (445),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 111/151 (74%), Gaps = 7/151 (5%)
 Frame = -2

Query  844  FRCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGC  665
            F CD+RIVSDANLFFI TIL+H G+  CF+EINTNP +VDE GRL I P+H+ H+    C
Sbjct  86   FGCDVRIVSDANLFFIVTILEHHGLLHCFTEINTNPSFVDENGRLNIRPYHNTHN----C  141

Query  664  ARCPPNMCKSKIIERIQASMGKEGKKR-VIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVW  488
              CPPNMCK  IIERIQ+ +   G  R ++YLGDG GD+CPSL+L  GD +MPRK +P+W
Sbjct  142  PLCPPNMCKGLIIERIQSEIA--GNDRCIVYLGDGKGDYCPSLRLGHGDHVMPRKLYPLW  199

Query  487  ELIKENRSLLEAEIHEWSNGEDFERILFHLI  395
            +LI+ + SLL+A +HEW +  + E  L +++
Sbjct  200  DLIQVDPSLLKATLHEWRDAGELEAKLLNIL  230


 Score =   115 bits (287),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             A TVVVFDFDKTIID DSDNWV++E+G   LF +LL TMPWN  MDRMM E+H+ GKT  
Sbjct  2     AKTVVVFDFDKTIIDCDSDNWVIEEMGVDDLFKELLRTMPWNPTMDRMMGELHSMGKTTD  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             +I  V++G P+ PR++ AIKA +  G
Sbjct  62    EIADVMKGAPLDPRVISAIKAAYAFG  87



>ref|XP_004168220.1| PREDICTED: inorganic pyrophosphatase 3-like [Cucumis sativus]
Length=243

 Score =   185 bits (469),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 118/149 (79%), Gaps = 3/149 (2%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRI+SDAN FFIETIL+H G+  CFS INTNP +VD +GRLRI P+HD  SSPHGC  
Sbjct  88   CDLRIISDANQFFIETILEHHGVLGCFSTINTNPTFVDGKGRLRISPYHD-ESSPHGCNL  146

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CP NMCK  ++++I+AS G+  K   IY+GDG GD+CP+L+L+ GD +MPRK +P+ + I
Sbjct  147  CPSNMCKGLVVDQIRASKGE--KNEFIYIGDGGGDYCPTLRLQEGDHVMPRKLYPLSDRI  204

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLIN  392
              N+++++A+IHEWS+G++ E+IL ++++
Sbjct  205  NSNQTIVKAKIHEWSDGKELEKILLNILD  233


 Score =   105 bits (261),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG  +VFDFD+TIID DSDN VV ++G T LF++L  ++ WNSLMD ++ E+ + G+T+G
Sbjct  2     AGITIVFDFDRTIIDGDSDNLVVTQMGLTNLFNKLYSSLAWNSLMDTLIVELQSQGRTMG  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI + L+G  +HPRI+ AI++ H  G
Sbjct  62    DIAKCLEGAALHPRIIAAIRSAHDAG  87



>ref|XP_010438289.1| PREDICTED: inorganic pyrophosphatase 3 [Camelina sativa]
Length=244

 Score =   180 bits (457),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 111/156 (71%), Gaps = 1/156 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDL+IVSDAN FFIE IL+   + +CFSEI TNP  VDE G LRILP+H    +PH C  
Sbjct  89   CDLKIVSDANQFFIEKILEQHDLLDCFSEIYTNPSSVDENGNLRILPYHSDALAPHSCNL  148

Query  658  CPPNMCKSKIIERIQASMGKEG-KKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWEL  482
            CP N+CK  +++ I+AS   +    R IYLGDG GDFCP+LKL+  DF+MPR ++P+W+ 
Sbjct  149  CPTNLCKGLVMDHIRASSANDQIPTRFIYLGDGGGDFCPTLKLRECDFVMPRTNYPLWKK  208

Query  481  IKENRSLLEAEIHEWSNGEDFERILFHLINRICIED  374
            I +N SL++AE+ EWSN E+ +RIL  L++ I  E+
Sbjct  209  ISDNSSLIKAEVKEWSNAEELQRILLQLVSTITKEE  244


 Score =   109 bits (273),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 65/88 (74%), Gaps = 0/88 (0%)
 Frame = -1

Query  1184  MAAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKT  1005
             M A  V+VFDFD+T+ID DSDNWVV E+G T +F QL  T+PWN LMDRMM E+H+ G++
Sbjct  1     MMAKIVIVFDFDRTLIDGDSDNWVVTEMGLTEIFHQLRFTLPWNRLMDRMMMELHSQGRS  60

Query  1004  IGDIERVLQGVPIHPRIVPAIKAVHGLG  921
             I DIE  L+ +PI  +++ AIK+   LG
Sbjct  61    IEDIEACLKKMPIDSQVIEAIKSAKSLG  88



>ref|XP_004135700.1| PREDICTED: inorganic pyrophosphatase 3-like [Cucumis sativus]
 gb|KGN66218.1| hypothetical protein Csa_1G586800 [Cucumis sativus]
Length=245

 Score =   184 bits (468),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 118/149 (79%), Gaps = 3/149 (2%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRI+SDAN FFIETIL+H G+  CFS INTNP +VD +GRLRI P+HD  SSPHGC  
Sbjct  88   CDLRIISDANQFFIETILEHHGVLGCFSTINTNPTFVDGKGRLRISPYHD-ESSPHGCNL  146

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CP NMCK  ++++I+AS G+  K   IY+GDG GD+CP+L+L+ GD +MPRK +P+ + I
Sbjct  147  CPSNMCKGLVVDQIRASKGE--KNEFIYIGDGGGDYCPTLRLQEGDHVMPRKLYPLSDRI  204

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLIN  392
              N+++++A+IHEWS+G++ E+IL ++++
Sbjct  205  NSNQTIVKAKIHEWSDGKELEKILLNILD  233


 Score =   104 bits (260),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG  +VFDFD+TIID DSDN VV ++G T LF++L  ++ WNSLMD ++ E+ + G+T+G
Sbjct  2     AGITIVFDFDRTIIDGDSDNLVVTQMGLTNLFNKLYSSLAWNSLMDTLIVELQSQGRTMG  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI + L+G  +HPRI+ AI++ H  G
Sbjct  62    DIAKCLEGAALHPRIIAAIRSAHDAG  87



>ref|NP_001235542.1| uncharacterized protein LOC100306472 [Glycine max]
 gb|ACU14672.1| unknown [Glycine max]
Length=246

 Score =   194 bits (492),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 84/157 (54%), Positives = 116/157 (74%), Gaps = 4/157 (3%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRI+SD N F I TIL+H  +  CFS+I+TNP ++D +GRLR+ PFH    SPH C  
Sbjct  90   CDLRIISDTNTFSIRTILQHHALFHCFSQIHTNPAFLDNQGRLRVTPFHHSTHSPHSCPL  149

Query  658  CPPNMCKSKIIERIQASM----GKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPV  491
            CPPNMCK  +I++I++S+    G E ++R IY+GDG GD+CP+LKLK GDF+MPRK++P+
Sbjct  150  CPPNMCKGLVIDQIRSSLLSGTGNEEERRFIYIGDGAGDYCPTLKLKGGDFVMPRKNYPL  209

Query  490  WELIKENRSLLEAEIHEWSNGEDFERILFHLINRICI  380
            W  I  +  L+ A++H+WS GED E IL +LIN+I +
Sbjct  210  WNKIHSDPKLVAAQLHDWSTGEDLETILLNLINKISL  246


 Score = 95.5 bits (236),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = -1

Query  1160  FDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIERVL  981
              DFD+TIID DSD W+V ELG T LF +L H+MPW SLMDR+M ++H+NG T+  I   L
Sbjct  10    LDFDRTIIDDDSDRWIVAELGLTELFKELRHSMPWISLMDRIMAQLHSNGVTVDHIADCL  69

Query  980   QGVPIHPRIVPAIKAVHGLG  921
             + +P  P IV AIK+ H LG
Sbjct  70    KRLPFPPPIVSAIKSAHALG  89



>ref|XP_008450832.1| PREDICTED: inorganic pyrophosphatase 3 isoform X1 [Cucumis melo]
Length=237

 Score =   186 bits (471),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 118/149 (79%), Gaps = 3/149 (2%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRI+SDAN FFIETIL+H G+  CFS INTNP +VD +GRLRI P+HD  SSPHGC  
Sbjct  88   CDLRIISDANQFFIETILEHHGVLGCFSTINTNPTFVDGKGRLRISPYHD-ESSPHGCNL  146

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CP NMCK  +I++I+AS G+  K   IY+GDG GD+CP+L+L+ GD +MPRK +P+ + I
Sbjct  147  CPSNMCKGLVIDQIRASKGE--KNEFIYIGDGRGDYCPTLRLQEGDHVMPRKLYPLSDRI  204

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLIN  392
              N+++++A+IHEWS+G++ E+IL ++++
Sbjct  205  NSNQTIVKAKIHEWSDGKELEKILLNILD  233


 Score =   103 bits (257),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG  +VFDFD+TIID DSDN VV ++G T LF++L  ++ WNSLMD +M E+ + G+T+ 
Sbjct  2     AGITIVFDFDRTIIDGDSDNLVVTQMGLTNLFNKLYSSLAWNSLMDTLMVELQSQGRTMR  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI + L+G  +HPRI+ AI++ H  G
Sbjct  62    DIAKCLEGAALHPRIIAAIRSAHDAG  87



>ref|XP_002458104.1| hypothetical protein SORBIDRAFT_03g027020 [Sorghum bicolor]
 gb|EES03224.1| hypothetical protein SORBIDRAFT_03g027020 [Sorghum bicolor]
Length=276

 Score =   204 bits (520),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 95/183 (52%), Positives = 128/183 (70%), Gaps = 8/183 (4%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDL++VSDAN FFIET+L H G+  CFSEI TNP  VD +GRLRI PFHD  ++PHGC+ 
Sbjct  96   CDLKVVSDANTFFIETVLAHHGVLGCFSEIVTNPATVDADGRLRISPFHDSAAAPHGCSL  155

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CP NMCK KIIERIQA+   + K+  IY+GDG GD+CPSLKL  GD++MP++++P+W LI
Sbjct  156  CPDNMCKGKIIERIQAT-ASDKKQHFIYIGDGKGDYCPSLKLGEGDYVMPKENYPLWNLI  214

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFLAAESKFQAISMQPCEALPKAI  299
              N+ LL+AE+H W++GE+ E+ L  L+       S+ +AA ++        CE    AI
Sbjct  215  CNNKQLLKAEVHPWNSGEELEKTLLKLV-------SKMIAAPAQASQFDYSKCEMSNPAI  267

Query  298  RVP  290
            + P
Sbjct  268  QHP  270


 Score = 84.7 bits (208),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 53/81 (65%), Gaps = 1/81 (1%)
 Frame = -1

Query  1160  FDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIERVL  981
             FDFD+TIID DSD+WV+ +LG    F +L  TM WN LMDRMM E+HA GKT  DI   L
Sbjct  15    FDFDRTIIDWDSDDWVITKLGAADAFRRLRPTMRWNPLMDRMMAELHARGKTPEDIRDCL  74

Query  980   QGVPIHPRIVPAIK-AVHGLG  921
             +  P+   +V A+K A   LG
Sbjct  75    RSAPLDAHVVSAVKTAAAALG  95



>ref|XP_008672854.1| PREDICTED: LOC100281893 isoform X1 [Zea mays]
 tpg|DAA58848.1| TPA: phosphoethanolamine/phosphocholine phosphatase [Zea mays]
Length=284

 Score =   194 bits (492),  Expect(2) = 5e-68, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 117/158 (74%), Gaps = 1/158 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDL++VSDAN FFIET+L H G+  CFSEI TNP  VD +GRLRI PFHD  S+PHGC+ 
Sbjct  93   CDLKVVSDANTFFIETVLAHHGVLGCFSEIVTNPASVDADGRLRISPFHDPASAPHGCSL  152

Query  658  CPPNMCKSKIIERIQASMG-KEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWEL  482
            CP NMCK KI+ RIQA+   K+ ++R IY+GDG GD+CPSLKL  GD +M R+++P+W L
Sbjct  153  CPDNMCKGKILGRIQATGSDKKRRRRFIYIGDGKGDYCPSLKLGEGDHVMARENYPLWHL  212

Query  481  IKENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQ  368
            I +N+ LL+AE+H W++GE+ E+ L  L   +    +Q
Sbjct  213  ICDNKQLLKAEVHPWNSGEELEKTLLKLAGEVISPPAQ  250


 Score = 94.0 bits (232),  Expect(2) = 5e-68, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 57/90 (63%), Gaps = 0/90 (0%)
 Frame = -1

Query  1190  SPMAAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANG  1011
             S  A   VVVFDFD+TIID DSD+WV+ +LG    F +L  TM WN LMDRMM E+HA G
Sbjct  3     SASAPEVVVVFDFDRTIIDWDSDDWVITKLGAADAFQRLRPTMRWNPLMDRMMAELHARG  62

Query  1010  KTIGDIERVLQGVPIHPRIVPAIKAVHGLG  921
             KT  DI   L+  P+   +V A+K    LG
Sbjct  63    KTPEDIRDCLRSAPLDTHVVSAVKTAAALG  92



>ref|XP_004969082.1| PREDICTED: inorganic pyrophosphatase 3-like [Setaria italica]
Length=318

 Score =   189 bits (480),  Expect(2) = 6e-68, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 120/158 (76%), Gaps = 1/158 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDL++VSDAN FFIET+L H G+  CFSEI+TNP  VD +GRLRI PFHD  S+PHGC+ 
Sbjct  134  CDLKVVSDANTFFIETVLAHHGVLGCFSEISTNPARVDADGRLRISPFHDSASAPHGCSL  193

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CP NMCK KIIE+IQA +     +  IY+GDG GD+CPSLKL  GD++MP++++P+W LI
Sbjct  194  CPDNMCKGKIIEKIQA-IASTKDQHFIYIGDGKGDYCPSLKLGEGDYVMPKENYPLWNLI  252

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQF  365
              N+ LL+AE+H W++GE+ E+IL  L+NR+    +Q 
Sbjct  253  CSNKHLLKAEVHPWNSGEELEKILLELVNRMITPPAQV  290


 Score = 98.2 bits (243),  Expect(2) = 6e-68, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 58/85 (68%), Gaps = 0/85 (0%)
 Frame = -1

Query  1175  GTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGD  996
             G VVVFDFD+TIID DSD+WVV +LG    F +L  TM WN LMDRMM+E+HA GKT+ D
Sbjct  49    GVVVVFDFDRTIIDWDSDDWVVTKLGAADAFQRLRPTMRWNPLMDRMMEELHARGKTVED  108

Query  995   IERVLQGVPIHPRIVPAIKAVHGLG  921
             I   L+  P+   ++ AIK    LG
Sbjct  109   IRDCLRSAPLDAHVISAIKTAASLG  133



>ref|XP_003630643.1| Pyridoxal phosphate phosphatase PHOSPHO2 [Medicago truncatula]
 gb|AET05119.1| 2,3-diketo-5-methylthio-1-phosphopentane phosphatase [Medicago 
truncatula]
Length=238

 Score =   192 bits (488),  Expect(2) = 8e-68, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 116/151 (77%), Gaps = 2/151 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHS-SPHGCA  662
            CDLRI+SDANLF+I+TIL+H  I  CFS+INTNP +VDE+GRL I PFHD  +  PH C 
Sbjct  87   CDLRIISDANLFYIQTILEHHNILGCFSQINTNPTFVDEKGRLCITPFHDSKTLPPHDCQ  146

Query  661  RCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWEL  482
             CP NMCK  +I+RI+ S+  E K R IY+GDG GD+CP+LKL+ GDF+MPRK++P+W  
Sbjct  147  LCPSNMCKGLVIDRIRGSL-PESKTRFIYVGDGAGDYCPTLKLEGGDFVMPRKNYPLWNR  205

Query  481  IKENRSLLEAEIHEWSNGEDFERILFHLINR  389
            I  +  L+ A++H+WSNGE+ E IL +L+N+
Sbjct  206  ICSDPKLVHAKVHDWSNGEELESILLNLVNK  236


 Score = 94.7 bits (234),  Expect(2) = 8e-68, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 59/84 (70%), Gaps = 1/84 (1%)
 Frame = -1

Query  1169  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMP-WNSLMDRMMKEIHANGKTIGDI  993
             +VV DFD+TIID DSD WV++++G + LF+QL  TMP W SLMDRMM+E+H+ G T   I
Sbjct  3     IVVLDFDRTIIDDDSDRWVINQMGLSDLFNQLRATMPSWTSLMDRMMEELHSKGITTDKI  62

Query  992   ERVLQGVPIHPRIVPAIKAVHGLG  921
                L+   + P IV AIK+ H LG
Sbjct  63    ANCLKTAFLSPNIVSAIKSAHSLG  86



>gb|AGT16668.1| inorganic pyrophosphatase [Saccharum hybrid cultivar R570]
Length=279

 Score =   199 bits (507),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 95/192 (49%), Positives = 129/192 (67%), Gaps = 17/192 (9%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDL++VSDAN FFIET+L H G+  CFSEI  NP  VD +GRLRI PFHD  ++PHGC+ 
Sbjct  95   CDLKVVSDANTFFIETVLAHHGVLGCFSEIVANPASVDADGRLRISPFHDSAAAPHGCSL  154

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CP NMCK KIIERIQA+   + K+  IY+GDG GD+CPSLKL  GD++MP++++P+W LI
Sbjct  155  CPDNMCKGKIIERIQAT-ASDTKQHFIYIGDGKGDYCPSLKLGEGDYVMPKENYPLWNLI  213

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFLAAESKFQAISMQPCE------  317
              N+ L++AE+H W++GE+ E+ L  L        S+ +AA ++        CE      
Sbjct  214  CNNKQLVKAEVHPWNSGEELEKTLLKLT-------SKMIAAPAQASQFDYSKCEMSNPAS  266

Query  316  ---ALPKAIRVP  290
               A  +A+RVP
Sbjct  267  TEVAHHQALRVP  278


 Score = 86.7 bits (213),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 51/80 (64%), Gaps = 0/80 (0%)
 Frame = -1

Query  1160  FDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIERVL  981
             FDFD+TIID DSD+WV+ +LG    F +L  TM WN LMDRMM E+HA G T  DI   L
Sbjct  15    FDFDRTIIDWDSDDWVITKLGAADAFQRLRPTMRWNPLMDRMMAELHARGTTPEDIRDCL  74

Query  980   QGVPIHPRIVPAIKAVHGLG  921
             +  P+   +V A+K    LG
Sbjct  75    RSAPLDAHVVSAVKTAAALG  94



>ref|XP_006412831.1| hypothetical protein EUTSA_v10026105mg [Eutrema salsugineum]
 gb|ESQ54284.1| hypothetical protein EUTSA_v10026105mg [Eutrema salsugineum]
Length=244

 Score =   177 bits (448),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 112/157 (71%), Gaps = 1/157 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDL+IVSDAN FFIE IL+   + +CFSEI TNP  VDE G+L+ILP+H   S PH C  
Sbjct  88   CDLKIVSDANQFFIEKILEQHKLLDCFSEIYTNPISVDENGKLQILPYHGAASPPHNCNL  147

Query  658  CPPNMCKSKIIERIQASMGKEG-KKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWEL  482
            CP N+CK  +++ I+AS   +   +R IYLGDG GDFCP+LKL+  D +MPR ++P+W+ 
Sbjct  148  CPSNLCKGLVMDHIRASSPNDQITRRFIYLGDGGGDFCPTLKLRECDCVMPRTNYPLWKR  207

Query  481  IKENRSLLEAEIHEWSNGEDFERILFHLINRICIEDS  371
            I +N SL++AE+ EWSN E+ +RIL  L++    EDS
Sbjct  208  ISDNSSLIKAEVMEWSNAEELQRILMQLVSTTTKEDS  244


 Score =   108 bits (270),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG V++FDFD+T+ID DSDNWVV ++G + +F QL  T+PWN LMDRMM E+H+ G++I 
Sbjct  2     AGIVIIFDFDRTLIDGDSDNWVVTQMGLSEIFHQLRFTLPWNRLMDRMMTELHSQGRSIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DIE  L+ +PI  +I+ AIK+   LG
Sbjct  62    DIEACLRKMPIDSQIIEAIKSAKSLG  87



>ref|NP_001077556.1| phosphoethanolamine/phosphocholine phosphatase [Arabidopsis thaliana]
 gb|AEE29625.1| pyridoxal phosphate phosphatase-related protein [Arabidopsis 
thaliana]
Length=247

 Score =   223 bits (569),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 105/169 (62%), Positives = 133/169 (79%), Gaps = 6/169 (4%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LRIVSDAN  FIETI++HLGI E FSEINTNPG VDE+GRL + P+HDF  S HGC+R
Sbjct  59   CELRIVSDANTLFIETIIEHLGIGEFFSEINTNPGLVDEQGRLIVSPYHDFTKSSHGCSR  118

Query  658  CPPNMCKSKIIERIQASMGKEGK-KRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWEL  482
            CPPNMCK  II+RIQAS+ KEGK  ++IYLGDG GD+CPSL LKA D+MMPRK+FPVW+L
Sbjct  119  CPPNMCKGLIIDRIQASLTKEGKTSKMIYLGDGAGDYCPSLGLKAEDYMMPRKNFPVWDL  178

Query  481  IKENRSLLEAEIHEWSNGEDFERILFHLINRICI-----EDSQFLAAES  350
            I +N  L++A + +W++GED ERIL  +IN I       E+ + L++E+
Sbjct  179  ISQNPMLVKATVRDWTDGEDMERILMEIINEIMSSEEGEENDKMLSSEN  227


 Score = 61.2 bits (147),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  1052  SLMDRMMKEIHANGKTIGDIERVLQGVPIHPRIVPAIKAVHGLG  921
             S  +RMMKE+H +GKTI +I++VL+ +PIHPR++PAIK+ H LG
Sbjct  15    SKQNRMMKELHDHGKTIEEIKQVLRRIPIHPRVIPAIKSAHALG  58



>gb|KFK29508.1| hypothetical protein AALP_AA7G143500 [Arabis alpina]
Length=244

 Score =   172 bits (436),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 111/157 (71%), Gaps = 1/157 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDL+IVSDAN FFIE IL+   + +CFSEI TNP  VD+ G+L I P+H   S PH C  
Sbjct  88   CDLKIVSDANQFFIEKILEQHILLDCFSEIYTNPSSVDKNGKLHIFPYHGDASLPHSCNL  147

Query  658  CPPNMCKSKIIERIQA-SMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWEL  482
            CP N+CK  +++ I+  S   +  +RVIYLGDG GDFCP+LKLK  D +MPR ++P+W+ 
Sbjct  148  CPSNLCKGLVMDHIRGLSPNDQIPRRVIYLGDGGGDFCPTLKLKETDCVMPRTNYPLWKR  207

Query  481  IKENRSLLEAEIHEWSNGEDFERILFHLINRICIEDS  371
            I +N SL++A++ EWSN E+ ++IL  L+N I  ++S
Sbjct  208  ISDNSSLIKAQVKEWSNAEELQKILMQLVNTITKDNS  244


 Score =   108 bits (271),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG V++FDFD+T+ID DSDNWVV E+G T +F QL  T+PWN LMDRMM E+H+ G++I 
Sbjct  2     AGIVIIFDFDRTLIDGDSDNWVVTEMGLTEIFHQLRFTLPWNRLMDRMMMELHSQGRSID  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DIE  L+ +PI   I+ AIK+   LG
Sbjct  62    DIEACLRKMPIDSHIIEAIKSAKSLG  87



>gb|ABK21572.1| unknown [Picea sitchensis]
Length=236

 Score =   177 bits (449),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 107/148 (72%), Gaps = 0/148 (0%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRIVSDAN F+I+TILK+  + + FSEI+TNP  VD +GRLRI P+H +  + HGC  
Sbjct  87   CDLRIVSDANSFYIKTILKNYDLLQYFSEIHTNPASVDNDGRLRIFPYHSYTVASHGCEL  146

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  I++ IQ     E  KR IYLGDG GDFCPSLKL + D ++ R+++P+W+L+
Sbjct  147  CPPNMCKGAIVDGIQRCFPPESNKRFIYLGDGRGDFCPSLKLGSEDHVLARQEYPLWKLL  206

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLI  395
             +N  L++A++H WSN +D E  L  L+
Sbjct  207  GQNPDLVKAQVHSWSNAKDVEDCLCKLL  234


 Score =   103 bits (258),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = -1

Query  1172  TVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDI  993
             TV++FDFD T+ID +SD WVV++LG T L D L+  +PW SLMDRMM E+H  GKT+ DI
Sbjct  3     TVIMFDFDHTLIDCNSDPWVVNQLGATQLMDSLIKVLPWTSLMDRMMSELHQQGKTVSDI  62

Query  992   ERVLQGVPIHPRIVPAIKAVHGLG  921
             E+ L+ VPI   ++ AIK+ H LG
Sbjct  63    EQSLKTVPICLEMIRAIKSAHSLG  86



>ref|XP_009128612.1| PREDICTED: inorganic pyrophosphatase 3 isoform X1 [Brassica rapa]
Length=247

 Score =   172 bits (436),  Expect(2) = 7e-66, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 114/159 (72%), Gaps = 3/159 (2%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHD-FHSSPHGCA  662
            CDL+IVSDAN FFIE IL+   + +CFS+I TNP  VDE G+LRI P+H    S+PH C 
Sbjct  89   CDLKIVSDANQFFIEKILEQHDLLDCFSDIYTNPTSVDENGKLRISPYHGGAASTPHSCN  148

Query  661  RCPPNMCKSKIIERIQASMGKEGK--KRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVW  488
             CPPN+CK  +++ I+AS  ++ +   R IYLGDG GDFCP+LKL+  D +MPR ++P+W
Sbjct  149  LCPPNLCKGLVMDHIRASSSRKDQVLTRFIYLGDGGGDFCPTLKLRECDCVMPRTNYPLW  208

Query  487  ELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIEDS  371
            + I +  SL++A++ EWS+ E+ +RIL  L++ +  EDS
Sbjct  209  KRISDKSSLIKADVKEWSSAEELQRILMQLVSTMTKEDS  247


 Score =   108 bits (269),  Expect(2) = 7e-66, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 64/87 (74%), Gaps = 1/87 (1%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG V+VFDFD+T+ID DSDNWVV E+G T +F QL  T+PWN LMDRMM E+H+ G++I 
Sbjct  2     AGIVIVFDFDRTLIDGDSDNWVVTEMGLTEIFHQLRFTLPWNRLMDRMMTELHSQGRSIQ  61

Query  998   DIERVLQGV-PIHPRIVPAIKAVHGLG  921
             DIE  LQ + PI   IV AIK+   LG
Sbjct  62    DIEACLQRIMPIDSHIVDAIKSAKSLG  88



>gb|EAY74825.1| hypothetical protein OsI_02715 [Oryza sativa Indica Group]
Length=284

 Score =   206 bits (525),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 131/184 (71%), Gaps = 4/184 (2%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHD-FHSSPHGCA  662
            CDLR+ SDAN FFIET+L+H G+  CFSEI+TNP  VD  GRLRI PFHD   SSPHGC+
Sbjct  103  CDLRVASDANAFFIETVLEHHGVLGCFSEISTNPARVDGNGRLRISPFHDPDDSSPHGCS  162

Query  661  RCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWEL  482
             CP NMCK KIIERIQA+    GK+  IY+GDG GD+CPSLKL  GD++MP++++P+W L
Sbjct  163  LCPENMCKGKIIERIQAT--ANGKRHFIYIGDGRGDYCPSLKLGEGDYVMPKENYPLWNL  220

Query  481  IKENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFLAAESKFQAISMQPCEALPKA  302
            I  N+ LL+AE+H W+NGE+ E+ L  L+N++    +Q    E K   +S      + +A
Sbjct  221  ISSNKQLLKAEVHPWNNGEELEQTLLKLVNKLITPPAQPSQFEYKCD-MSNPVSTEVGQA  279

Query  301  IRVP  290
            +RVP
Sbjct  280  LRVP  283


 Score = 72.8 bits (177),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = -1

Query  1151  DKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIERVLQGV  972
             D+TII+ DSD+WV+ +LG +  F +L  TM WN LMDRMM E+HA G++  DI   L+  
Sbjct  26    DRTIIEWDSDDWVITKLGASDAFRRLRPTMRWNPLMDRMMVELHAQGRSADDIRDCLKSA  85

Query  971   PIHPRIVPAIKAVHGLG  921
             P+   ++ AI     LG
Sbjct  86    PLDAHVLSAITTASALG  102



>ref|XP_010447843.1| PREDICTED: inorganic pyrophosphatase 3-like [Camelina sativa]
Length=245

 Score =   175 bits (444),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 106/151 (70%), Gaps = 2/151 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDL+IVSDAN FFIE IL+   + +CFSEI TNP  VD+ G LRILP+H     PH C  
Sbjct  88   CDLKIVSDANQFFIEKILEQHDLLDCFSEIYTNPSSVDDNGNLRILPYHSDALPPHSCNL  147

Query  658  CPPNMCKSKIIERIQASMGKEGK--KRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWE  485
            CP N+CK  +++ I++S         R IYLGDG GDFCP+LKL+  DF+MPR ++P+W+
Sbjct  148  CPSNLCKGLVMDHIRSSSSSNDHIPTRFIYLGDGGGDFCPTLKLRECDFVMPRTNYPLWK  207

Query  484  LIKENRSLLEAEIHEWSNGEDFERILFHLIN  392
             I +N SL++AE+ EWSN E+ +RIL  L+N
Sbjct  208  KISDNSSLIKAEVKEWSNAEELQRILLQLVN  238


 Score =   103 bits (257),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             A  V+VFDFD+T+ID DSDNWVV ++G   +F QL  T+PWN LMDRMM E+H+ G+++ 
Sbjct  2     AKIVIVFDFDRTLIDGDSDNWVVTKMGLAEIFHQLRFTLPWNRLMDRMMMELHSQGRSVE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DIE  L+ +PI  +++ AIK+   LG
Sbjct  62    DIEACLKKMPIDSQVIEAIKSAKSLG  87



>ref|XP_006854013.1| hypothetical protein AMTR_s00036p00240870 [Amborella trichopoda]
 gb|ERN15480.1| hypothetical protein AMTR_s00036p00240870 [Amborella trichopoda]
Length=247

 Score =   168 bits (425),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 106/151 (70%), Gaps = 7/151 (5%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CD+RIVSDAN FFI +IL+H G+  CF+EINTNP ++D+ GRL I P H      H C  
Sbjct  88   CDVRIVSDANTFFIVSILEHHGLLHCFTEINTNPAFIDDNGRLNIRPCH----KSHNCPI  143

Query  658  CPPNMCKSKIIERIQASMGKEGKKR-VIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWEL  482
            CPPNMCK  +IERIQ+ +   G  R ++YLGDG GD+CPSLKL  GD +MPRK +P W+L
Sbjct  144  CPPNMCKGLVIERIQSEI--VGSDRCIVYLGDGKGDYCPSLKLGHGDHVMPRKLYPFWDL  201

Query  481  IKENRSLLEAEIHEWSNGEDFERILFHLINR  389
            ++ N SL++A IHEWS+  + E  L + I +
Sbjct  202  LQSNPSLIKATIHEWSDAGELEAKLLNFIRK  232


 Score =   110 bits (275),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             A  VVVFDFD+TI+D DSDNWVV+E+G   LF +LL TMP N  MDRMM E+H+ GKTI 
Sbjct  2     AKAVVVFDFDETILDCDSDNWVVEEMGVDDLFKELLRTMPLNPTMDRMMGELHSRGKTIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             +I  +L+  P  PR++ AIKA H LG
Sbjct  62    EIAEILKRAPFDPRVISAIKAAHALG  87



>gb|EAZ12585.1| hypothetical protein OsJ_02491 [Oryza sativa Japonica Group]
Length=284

 Score =   206 bits (523),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 130/184 (71%), Gaps = 4/184 (2%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHD-FHSSPHGCA  662
            CDLR+ SDAN FFIET+L+H G+  CFSEI+TNP  VD  GRLRI PFHD   SSPHGC+
Sbjct  103  CDLRVASDANAFFIETVLEHHGVLGCFSEISTNPARVDGNGRLRISPFHDPDDSSPHGCS  162

Query  661  RCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWEL  482
             CP NMCK KIIERIQA+    GK+  IY+GDG GD+CPSLKL  GD++MP++ +P+W L
Sbjct  163  LCPENMCKGKIIERIQAT--ANGKRHFIYIGDGRGDYCPSLKLGEGDYVMPKEKYPLWNL  220

Query  481  IKENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFLAAESKFQAISMQPCEALPKA  302
            I  N+ LL+AE+H W+NGE+ E+ L  L+N++    +Q    E K   +S      + +A
Sbjct  221  ISSNKQLLKAEVHPWNNGEELEQTLLKLVNKLITPPAQPSQFEYKCD-MSNPVSTEVGQA  279

Query  301  IRVP  290
            +RVP
Sbjct  280  LRVP  283


 Score = 72.8 bits (177),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = -1

Query  1151  DKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIERVLQGV  972
             D+TII+ DSD+WV+ +LG +  F +L  TM WN LMDRMM E+HA G++  DI   L+  
Sbjct  26    DRTIIEWDSDDWVITKLGASDAFRRLRPTMRWNPLMDRMMVELHAQGRSADDIRDCLKSA  85

Query  971   PIHPRIVPAIKAVHGLG  921
             P+   ++ AI     LG
Sbjct  86    PLDAHVLSAITTASALG  102



>ref|XP_010433087.1| PREDICTED: inorganic pyrophosphatase 3-like isoform X1 [Camelina 
sativa]
Length=247

 Score =   171 bits (433),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 109/160 (68%), Gaps = 5/160 (3%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDL+IVSDAN FFIE IL+   + +CFSEI TNP  VDE G LRILP+H    +PH C  
Sbjct  88   CDLKIVSDANQFFIEKILEQHDLLDCFSEIYTNPTSVDENGNLRILPYHSDALAPHSCNL  147

Query  658  CPPNMCKSKIIERIQ-----ASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFP  494
            CP N+CK  +++ I+     +S   +   R IYLGDG GDFCP++KL+  DF+MPR ++P
Sbjct  148  CPTNLCKGIVMDHIRSSSSSSSSNDQIPTRFIYLGDGGGDFCPTMKLRECDFVMPRTNYP  207

Query  493  VWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIED  374
            +W+ I +N SL+ A++ EW N E+ +RIL  L+N I  E+
Sbjct  208  LWKKISDNSSLINADVKEWGNAEELQRILLQLVNTITKEE  247


 Score =   105 bits (262),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             A  V+VFDFD+T+ID DSDNWVV E+G   +F QL  T+PWN LMDRMM E+H+ G++I 
Sbjct  2     AKIVIVFDFDRTLIDGDSDNWVVTEMGLAEIFHQLRFTLPWNRLMDRMMMELHSQGRSIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DIE  L+ +PI  +++ AIK+   LG
Sbjct  62    DIEACLKKMPIDSQVIEAIKSAKSLG  87



>gb|EMT25082.1| Phosphoethanolamine/phosphocholine phosphatase [Aegilops tauschii]
Length=298

 Score =   171 bits (432),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 107/160 (67%), Gaps = 11/160 (7%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHS---SPHG  668
            C+LRI+SDAN FFI+T+L H G+   FSEI+TNP  VD  GRLRI P HDF     S HG
Sbjct  93   CELRILSDANAFFIDTVLAHHGLAGYFSEISTNPASVDAGGRLRITPHHDFRHGSCSSHG  152

Query  667  CA--RCPPNMCKSKIIERI------QASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMM  512
            CA   CPPNMCK K++E +       A+ G     RV+YLGDG GD+CP+LKL   D+MM
Sbjct  153  CALATCPPNMCKGKVMEAMLQELSAAAAAGTRRPSRVVYLGDGRGDYCPTLKLAERDYMM  212

Query  511  PRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLIN  392
            PRK +PVW+LI  +R  + A++  W++ +D E +L  +I+
Sbjct  213  PRKGYPVWDLIAGDRRAVRADVRGWADFKDLETVLLDIIH  252


 Score =   105 bits (262),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 64/94 (68%), Gaps = 1/94 (1%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFDKTIID DSDNWVVD LG T  FD+LL  +PWNS +D MM E+H+ GKTI 
Sbjct  7     AGVVVVFDFDKTIIDCDSDNWVVDALGATQRFDELLLHLPWNSAIDAMMGELHSQGKTID  66

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG*CSFL*LS  897
             +I   ++  P+   +V AIKA   LG C    LS
Sbjct  67    EIAGSIRTAPLSHHVVAAIKAAQALG-CELRILS  99



>emb|CDY43512.1| BnaA01g07320D [Brassica napus]
Length=432

 Score =   166 bits (419),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 77/150 (51%), Positives = 108/150 (72%), Gaps = 3/150 (2%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHD-FHSSPHGCA  662
            CDL+IVSDAN FFIE IL+   + +CFS+I TNP  VDE G+LRI P+H    S+PH C 
Sbjct  90   CDLKIVSDANQFFIEKILEQHDLLDCFSDIYTNPTSVDENGKLRISPYHGGAASTPHSCN  149

Query  661  RCPPNMCKSKIIERIQASMGKEGK--KRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVW  488
             CPPN+CK  +++ I+AS  ++ +   R IYLGDG GDFCP+LKL+  D +MPR ++P+W
Sbjct  150  LCPPNLCKGLVMDHIRASSSRKDQVLTRFIYLGDGGGDFCPTLKLRECDCVMPRTNYPLW  209

Query  487  ELIKENRSLLEAEIHEWSNGEDFERILFHL  398
            + I +  SL++A++ EWS+ E+ +RIL  L
Sbjct  210  KRISDKSSLIKADVKEWSSAEELQRILMQL  239


 Score =   110 bits (274),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 65/89 (73%), Gaps = 1/89 (1%)
 Frame = -1

Query  1184  MAAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKT  1005
             MA G V+VFDFD+T+ID DSDNWVV E+G T +F QL  T+PWN LMDRMM E+H+ G++
Sbjct  1     MAEGIVIVFDFDRTLIDGDSDNWVVTEMGLTEIFHQLRFTLPWNRLMDRMMTELHSQGRS  60

Query  1004  IGDIERVLQGV-PIHPRIVPAIKAVHGLG  921
             I DIE  LQ + PI   IV AIK+   LG
Sbjct  61    IQDIEACLQRIMPIDSHIVDAIKSAKSLG  89



>ref|XP_006282700.1| hypothetical protein CARUB_v10005618mg [Capsella rubella]
 gb|EOA15598.1| hypothetical protein CARUB_v10005618mg [Capsella rubella]
Length=242

 Score =   167 bits (422),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 109/155 (70%), Gaps = 2/155 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDL+IVSDAN FFIE IL+   + +CFSEI TN   VDE G+LRILP+H     PH C  
Sbjct  88   CDLKIVSDANHFFIEKILEQHDLLDCFSEIYTNQSSVDEIGKLRILPYHSDALPPHSCNF  147

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CP N+CK  +++ I+AS   +  +  IYLGDG GDFCP+LKL+  DF+MPR ++P+W+ I
Sbjct  148  CPSNLCKGLVMDHIRASCPSD--QIFIYLGDGGGDFCPTLKLRECDFVMPRTNYPLWKKI  205

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIED  374
             +N  L++AE+ EWSN E+ +RIL  L++ I  E+
Sbjct  206  SDNSLLIKAEVKEWSNAEEQQRILMQLVSTITQEE  240


 Score =   108 bits (269),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             A  V++FDFD+T+ID DSDNWVV E+G T +F QL  T+PWN LMDRMM E+H+ G++I 
Sbjct  2     AKIVIIFDFDRTLIDGDSDNWVVTEMGLTEIFHQLRFTLPWNRLMDRMMMELHSQGRSIE  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DIE  L+ +PI  +I+ AIK+   LG
Sbjct  62    DIEACLKKMPIDSQIIEAIKSAKSLG  87



>ref|XP_002869428.1| 2,3-diketo-5-methylthio-1-phosphopentane phosphatase family [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH45687.1| 2,3-diketo-5-methylthio-1-phosphopentane phosphatase family [Arabidopsis 
lyrata subsp. lyrata]
Length=242

 Score =   171 bits (434),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 109/155 (70%), Gaps = 1/155 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDL+IVSDAN F+IE IL+   + +CFSEI TNP  +DE G LRILP+H     PH C  
Sbjct  88   CDLKIVSDANQFYIEKILEQHDLLDCFSEIYTNPTSLDENGNLRILPYHSDALPPHSCNL  147

Query  658  CPPNMCKSKIIERIQASMGKEG-KKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWEL  482
            CP N+CK  +++ I+AS   +   +R IYLGDG GDFCP+LKL+  DF+MPR ++P+W+ 
Sbjct  148  CPSNLCKGLVMDHIRASSSNDQIPRRFIYLGDGGGDFCPTLKLRECDFVMPRTNYPLWKK  207

Query  481  IKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
            I +N  L++AE+ EWS+ E+ +RIL  L++ I  E
Sbjct  208  ISDNALLIKAEVKEWSSAEELQRILLQLVSTITKE  242


 Score =   102 bits (254),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = -1

Query  1169  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  990
             V++FDFD+T+ID DSD WVV E+G T +F QL  T+PWN LMDRMM EI + G++I DIE
Sbjct  5     VIIFDFDRTLIDGDSDRWVVTEMGLTEIFHQLRFTLPWNRLMDRMMMEIQSQGRSIDDIE  64

Query  989   RVLQGVPIHPRIVPAIKAVHGLG  921
               L+ +PI   I+ AIK+   LG
Sbjct  65    SCLKKMPIDSHIIEAIKSTKSLG  87



>gb|EMS46703.1| Inorganic pyrophosphatase 2 [Triticum urartu]
Length=412

 Score =   171 bits (432),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 81/164 (49%), Positives = 108/164 (66%), Gaps = 11/164 (7%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHS---SPHG  668
            C+LRI+SDAN FFI+T+L H G+   FSEI+TNP  VD  GRLRI P HDF     S HG
Sbjct  93   CELRILSDANAFFIDTVLAHHGLAGYFSEISTNPASVDAGGRLRITPHHDFRHGSCSSHG  152

Query  667  CA--RCPPNMCKSKIIER------IQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMM  512
            CA   CPPNMCK K++E       + A+ G     RV+YLGDG GD+CP+LKL   D+MM
Sbjct  153  CALATCPPNMCKGKVMEEMLQELSVAAAAGMRRPSRVVYLGDGRGDYCPTLKLAERDYMM  212

Query  511  PRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICI  380
            PRK +PVW+LI  +R  + A++  W++ +D E +L  +I+   +
Sbjct  213  PRKGYPVWDLIAGDRRAVRADVRGWADFKDLETVLLDIIHECAV  256


 Score =   102 bits (255),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 64/94 (68%), Gaps = 1/94 (1%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFDKTIID DSDNWVVD LG +  FD+LL  +PWNS +D MM E+H+ GK++ 
Sbjct  7     AGVVVVFDFDKTIIDCDSDNWVVDALGASQRFDELLLHLPWNSAIDAMMGELHSQGKSMD  66

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG*CSFL*LS  897
             +I   ++  P+   +V AIK  H LG C    LS
Sbjct  67    EIAGSIRTAPLSRHVVAAIKTAHALG-CELRILS  99



>ref|XP_007024471.1| Pyridoxal phosphate phosphatase-related protein [Theobroma cacao]
 gb|EOY27093.1| Pyridoxal phosphate phosphatase-related protein [Theobroma cacao]
Length=219

 Score =   177 bits (450),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 115/182 (63%), Gaps = 30/182 (16%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LRIVSDANLFFIE IL++LG++E FSEINTNPG+VDEEGRLRI  +HDF+   HGC  
Sbjct  66   CELRIVSDANLFFIEKILEYLGLKEYFSEINTNPGFVDEEGRLRIFSYHDFNKCSHGCNL  125

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
             P NMCK  IIERIQAS+  EGKK++IYLG G GD+CPSL+L   D MMPRK+FPV   +
Sbjct  126  SPLNMCKGMIIERIQASL--EGKKKIIYLGYGSGDYCPSLRLGEADCMMPRKNFPVMISV  183

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFLAAESKFQAISMQPCEALPKAI  299
            +EN                                 Q ++ + K Q IS    EALP+A+
Sbjct  184  EENND----------------------------NSVQLISIDGKLQTISASTHEALPQAL  215

Query  298  RV  293
             V
Sbjct  216  PV  217


 Score = 94.7 bits (234),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 53/86 (62%), Gaps = 22/86 (26%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFDKTIID DSDNWVVDELGF+ LF+Q L TMPWNS M               
Sbjct  2     AGIVVVFDFDKTIIDYDSDNWVVDELGFSDLFNQFLPTMPWNSFMR--------------  47

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
                      PIH R+VPAIKA H LG
Sbjct  48    --------TPIHYRVVPAIKAAHALG  65



>ref|NP_194682.1| pyridoxal phosphate phosphatase-related protein [Arabidopsis 
thaliana]
 sp|Q9SU92.1|PPSP3_ARATH RecName: Full=Inorganic pyrophosphatase 3; Short=AtPPsPase3; 
Short=PPi phosphatase 3; Short=Pyrophosphate-specific phosphatase 
3 [Arabidopsis thaliana]
 emb|CAB45313.1| putative protein [Arabidopsis thaliana]
 emb|CAB79711.1| putative protein [Arabidopsis thaliana]
 gb|AAP04140.1| unknown protein [Arabidopsis thaliana]
 gb|AAP40350.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF01374.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE85640.1| pyridoxal phosphate phosphatase-related protein [Arabidopsis 
thaliana]
Length=245

 Score =   171 bits (434),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 111/156 (71%), Gaps = 1/156 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDL+IVSDAN FFIE IL+H  + +CFSEI TNP  +D+ G LRILP+H     PH C  
Sbjct  88   CDLKIVSDANQFFIEKILEHHDLVDCFSEIYTNPTSLDDNGNLRILPYHSDALPPHSCNL  147

Query  658  CPPNMCKSKIIERIQASMGKEG-KKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWEL  482
            CP N+CK  +++ ++AS   +   +R IYLGDG GDFCP+LKL+  DF+MPR ++P+W+ 
Sbjct  148  CPSNLCKGLVMDHLRASSSNDQIPRRFIYLGDGGGDFCPTLKLRECDFVMPRTNYPLWKK  207

Query  481  IKENRSLLEAEIHEWSNGEDFERILFHLINRICIED  374
            I +N  L++AE+ EWS+ E+ +RIL  L++ I  E+
Sbjct  208  ISDNPLLIKAEVKEWSSAEEQQRILLQLVSTITKEE  243


 Score =   100 bits (248),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 61/86 (71%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             A  V++FDFD+T+ID DSDNWVV E+G T +F QL  T+PWN LMDRMM E+ + G++I 
Sbjct  2     AKIVILFDFDRTLIDGDSDNWVVTEMGLTEIFHQLRFTLPWNRLMDRMMMELQSQGRSID  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DI+  L+ +PI   I+ AIK+    G
Sbjct  62    DIKSCLKKMPIDSHIIEAIKSAKSSG  87



>emb|CDY06800.1| BnaC01g08990D [Brassica napus]
Length=401

 Score =   162 bits (409),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 107/156 (69%), Gaps = 7/156 (4%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSS----PH  671
            CDL+IVSDAN FFIE IL+   + +CFS+I TNP  VDE G+LRI P+H   ++    PH
Sbjct  90   CDLKIVSDANQFFIEKILEQHDLLDCFSDIYTNPTSVDEIGKLRISPYHGGGAAASTPPH  149

Query  670  GCARCPPNMCKSKIIERIQASMGKEGKK---RVIYLGDGIGDFCPSLKLKAGDFMMPRKD  500
             C  CPPN+CK  +++ I+AS      +   R IYLGDG GDFCP+LKL+  D +MPR +
Sbjct  150  SCNLCPPNLCKGLVMDHIRASSSSPKDQILTRFIYLGDGGGDFCPTLKLRECDCVMPRTN  209

Query  499  FPVWELIKENRSLLEAEIHEWSNGEDFERILFHLIN  392
            +P+W+ I +N SL++A++ EWS+ E+ +RIL  L  
Sbjct  210  YPLWKRISDNPSLIKADVKEWSSAEELQRILMQLFT  245


 Score =   109 bits (273),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 65/89 (73%), Gaps = 1/89 (1%)
 Frame = -1

Query  1184  MAAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKT  1005
             MA G V+VFDFD+T+ID DSDNWVV E+G T +F QL  T+PWN LMDRMM E+H+ G++
Sbjct  1     MAEGIVIVFDFDRTLIDGDSDNWVVTEMGLTEIFHQLRFTLPWNRLMDRMMTELHSQGRS  60

Query  1004  IGDIERVLQGV-PIHPRIVPAIKAVHGLG  921
             + DIE  LQ + PI   IV AIK+   LG
Sbjct  61    VQDIEACLQRIMPIDSHIVEAIKSAKSLG  89



>ref|XP_009385787.1| PREDICTED: inorganic pyrophosphatase 2-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=227

 Score =   218 bits (554),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 137/188 (73%), Gaps = 5/188 (3%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LRIVSDAN FFIETIL+H G+   FSEINTNPGYVDEEGRLRILP+HDF +S HGC  
Sbjct  39   CELRIVSDANRFFIETILEHHGLGSYFSEINTNPGYVDEEGRLRILPYHDFKTSSHGCGL  98

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCKS IIERIQAS   EG+KR IYLGDG GD+CP+L+L   D++MPRK+ P WELI
Sbjct  99   CPPNMCKSTIIERIQASASLEGRKRFIYLGDGKGDYCPALRLSEEDYVMPRKNHPAWELI  158

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLI-NRICIEDS---QFLAAESKFQ-AISMQPCEA  314
              N   L AEIH W + E+ E +L  LI + I    S   + ++A+ KFQ  + +   EA
Sbjct  159  LANPRALRAEIHGWGDAEELEEVLLRLIGDSISARGSDANRLISADCKFQTTMPLSSHEA  218

Query  313  LPKAIRVP  290
            LPK +RVP
Sbjct  219  LPKPLRVP  226



>ref|NP_001046344.1| Os02g0226200 [Oryza sativa Japonica Group]
 dbj|BAD25655.1| putative phosphatase, orphan 1 [Oryza sativa Japonica Group]
 dbj|BAF08258.1| Os02g0226200 [Oryza sativa Japonica Group]
 gb|EAY85074.1| hypothetical protein OsI_06430 [Oryza sativa Indica Group]
Length=296

 Score =   168 bits (426),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 85/190 (45%), Positives = 121/190 (64%), Gaps = 13/190 (7%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGC--  665
            C+LR++SDAN FF+  +L H G+  CFS ++TNP  VD +GRLRILP+H      HGC  
Sbjct  94   CELRVLSDANAFFVGAVLDHHGLAGCFSAVDTNPAAVDADGRLRILPYHGLPG--HGCPL  151

Query  664  ARCPPNMCKSKIIERI--QASMGKEG-----KKRVIYLGDGIGDFCPSLKLKAGDFMMPR  506
            A CPPNMCK K++ERI  + S G  G     ++RV+Y+GDG GD+CPSLKL   D++MPR
Sbjct  152  ATCPPNMCKGKVMERIIDELSCGCGGALAARRRRVVYVGDGRGDYCPSLKLTEMDYVMPR  211

Query  505  KDFPVWELIK-ENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFLAAESKFQAISM  329
            K +PVW+LI   +R+ + A++ EW++ ED E +L  ++   C+      A +   +A   
Sbjct  212  KGYPVWDLIAGGDRAAVRADVREWADFEDLEAVLLGIVAE-CLTSEHDDADDDGGEAAPP  270

Query  328  QPCEALPKAI  299
              C ALP  +
Sbjct  271  AECRALPATL  280


 Score =   100 bits (249),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = -1

Query  1160  FDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIERVL  981
             FDFDKTIID DSDNWVVD LG T  FD LL  +PWNS +D MM E+HA G+T+ ++   L
Sbjct  14    FDFDKTIIDCDSDNWVVDALGATARFDDLLCRLPWNSAIDAMMGELHAEGRTVEEVAASL  73

Query  980   QGVPIHPRIVPAIKAVHGLG  921
             +  P+ PR+  A++    LG
Sbjct  74    RAAPLSPRVAAAVETARALG  93



>ref|XP_010541049.1| PREDICTED: inorganic pyrophosphatase 3 [Tarenaya hassleriana]
Length=241

 Score =   155 bits (393),  Expect(2) = 6e-62, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 102/152 (67%), Gaps = 4/152 (3%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDL+IVSDAN FFIE IL+   + + FSEI TN   VDE GRLRI P+H   + PHGC  
Sbjct  88   CDLKIVSDANQFFIEKILEQHSLLDYFSEIYTNQTSVDENGRLRIFPYH-HAAPPHGCDL  146

Query  658  CPPNMCKSKIIERIQASMGKEGK-KRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWEL  482
            CP N+CK  +++ ++AS    G   R IYLGDG GDFCP+LKL  GD +MPRK +P+W  
Sbjct  147  CPSNLCKGLVLDHLRASFPDTGNLTRFIYLGDGGGDFCPTLKLIEGDHVMPRKSYPLWNR  206

Query  481  IKENRSLLEAEIHEWSNGEDFERILFHLINRI  386
            + + R  + A I+ W +GE+ E IL HLI+ +
Sbjct  207  VSDLR--IRAAINGWRDGEELEGILLHLIHTM  236


 Score =   111 bits (278),  Expect(2) = 6e-62, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFD+T+ID DSDNWVV E+G T LF QL  T+PWN LMDRMM E+H+ G+++ 
Sbjct  2     AGIVVVFDFDRTLIDGDSDNWVVTEMGLTELFHQLRLTLPWNRLMDRMMMELHSRGRSVK  61

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG  921
             DIE  L+ +PI P +V AIK+   LG
Sbjct  62    DIEACLKKMPIDPHVVSAIKSAKSLG  87



>ref|XP_003571132.1| PREDICTED: inorganic pyrophosphatase 2-like [Brachypodium distachyon]
Length=306

 Score =   169 bits (429),  Expect(2) = 8e-62, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 105/158 (66%), Gaps = 12/158 (8%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCA-  662
            C+LRI+SDAN FFI+T+L H G+   FSEI++NP  VD  GRLRI P+HDF   PHGCA 
Sbjct  99   CELRILSDANAFFIDTVLAHHGLAGYFSEISSNPARVDAAGRLRISPYHDF---PHGCAL  155

Query  661  -RCPPNMCKSKIIERIQASMGKEGKKR-------VIYLGDGIGDFCPSLKLKAGDFMMPR  506
              CPPNMCK K++E I   +              V+YLGDG GD+CP+LKL   D+MMPR
Sbjct  156  PTCPPNMCKGKVMEEILQELSAAAAAAGKRRRKRVVYLGDGRGDYCPTLKLGERDYMMPR  215

Query  505  KDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLIN  392
            K +PVW+LI  +R  + A++ EW++  D ER+L  ++ 
Sbjct  216  KGYPVWDLIAGDRRAVRADVREWADAGDLERVLLSIVQ  253


 Score = 97.1 bits (240),  Expect(2) = 8e-62, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 59/88 (67%), Gaps = 1/88 (1%)
 Frame = -1

Query  1160  FDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIERVL  981
             FDFDKTIID DSDNWVVD LG T  FD+LL  +PWNS +D MM E+HA GK + +I   L
Sbjct  19    FDFDKTIIDCDSDNWVVDALGATRRFDELLLRLPWNSAIDTMMGELHAEGKQVSEIRGSL  78

Query  980   QGVPIHPRIVPAIKAVHGLG*CSFL*LS  897
             +  P+   +V A+++ H LG C    LS
Sbjct  79    RTAPLPASVVSAVESAHALG-CELRILS  105



>gb|EMS47058.1| Inorganic pyrophosphatase 2 [Triticum urartu]
Length=305

 Score =   162 bits (409),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 109/167 (65%), Gaps = 18/167 (11%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDF-HSS--PHG  668
            C+LRI+SDAN FFI+T+L H G+   FSEI+TNP  VD +GRLRI P HDF H S   HG
Sbjct  93   CELRILSDANAFFIDTVLAHHGLAGYFSEISTNPASVDADGRLRITPHHDFRHGSCNSHG  152

Query  667  CA--RCPPNMCK-------SKIIERI------QASMGKEGKKRVIYLGDGIGDFCPSLKL  533
            CA   CPPNMCK        K++E +       A+ G     RV+YLGDG GD+CP+LKL
Sbjct  153  CALATCPPNMCKILVYKIQGKVMEGMLQELSAAAATGMRRPSRVVYLGDGRGDYCPTLKL  212

Query  532  KAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLIN  392
               D+MMPRK +PVW+LI  +R  + A++  W++ +D + +L  +I+
Sbjct  213  AERDYMMPRKGYPVWDLIAGDRRAVRADVRGWADFKDLKTVLLDIIH  259


 Score =   103 bits (258),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 63/94 (67%), Gaps = 1/94 (1%)
 Frame = -1

Query  1178  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  999
             AG VVVFDFDKTIID DSDNWVVD LG T  FD+LL  +PWNS +D MM E+H+ GKTI 
Sbjct  7     AGVVVVFDFDKTIIDCDSDNWVVDALGATQRFDELLLHLPWNSAIDAMMGELHSQGKTID  66

Query  998   DIERVLQGVPIHPRIVPAIKAVHGLG*CSFL*LS  897
             +I   ++  P+   +V AIK    LG C    LS
Sbjct  67    EIAGSIRTAPLSLHVVAAIKTAQALG-CELRILS  99



>gb|EAZ13360.1| hypothetical protein OsJ_03281 [Oryza sativa Japonica Group]
Length=235

 Score =   198 bits (504),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 135/194 (70%), Gaps = 9/194 (5%)
 Frame = -2

Query  856  SC*IFRCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDE-EGRLRILPFHDFHS  680
            +C    CDLRI+SDAN FFI+TIL H G+   FSEINTNP  VD   GRLRI P+HDFH+
Sbjct  43   ACYGLGCDLRILSDANRFFIDTILDHHGLTGYFSEINTNPSAVDAATGRLRIAPYHDFHA  102

Query  679  SPHGCAR--CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPR  506
             PHGC    CPPNMCK ++++RI+AS G  GK RVIYLGDG GD+CPSL+L   DFMMPR
Sbjct  103  GPHGCGLGICPPNMCKGQVLDRIRASAGAAGK-RVIYLGDGRGDYCPSLRLGRDDFMMPR  161

Query  505  KDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFLAAESKFQ---AI  335
            + FPVWELI E+ SLL AE+H W++G + E  L  L+ R+ +E+      + K +   A+
Sbjct  162  RGFPVWELICEDPSLLHAEVHSWADGAEMEETLLRLVGRVLLEERNLPPLDCKLESLPAV  221

Query  334  SMQPCEALPKAIRV  293
            ++Q  + +P  +R+
Sbjct  222  AVQ--DGMPMTLRI  233


 Score = 66.6 bits (161),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -1

Query  1064  MPWNSLMDRMMKEIHANGKTIGDIERVLQGVPIHPRIVPAIKAVHGLG  921
             MPWN+LMD MM E+HA+GK++ D+  VL+  P+ PR+V AIKA +GLG
Sbjct  1     MPWNTLMDTMMGELHASGKSLADVAGVLRSAPLDPRVVAAIKACYGLG  48



>gb|EMS63492.1| Inorganic pyrophosphatase 3 [Triticum urartu]
Length=239

 Score =   207 bits (527),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 121/157 (77%), Gaps = 1/157 (1%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDL++VSDAN FFIET+L+H G+  CFSEINTNP  VD +GRLRI PFHD  SSPHGC+ 
Sbjct  56   CDLKVVSDANSFFIETVLEHHGVLGCFSEINTNPARVDAQGRLRISPFHDPTSSPHGCSL  115

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CP NMCK KII+RIQ +   +  K  IY+GDG GD+CPSLKL  GD++MP++++P+W LI
Sbjct  116  CPDNMCKGKIIQRIQGTDSAK-NKHFIYIGDGKGDYCPSLKLGEGDYVMPKENYPLWSLI  174

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQ  368
              +  L++AE+H WS+GE+FERIL  L+N++    +Q
Sbjct  175  SSDPQLIKAEVHPWSSGEEFERILLKLVNKLITSHAQ  211



>ref|XP_010519235.1| PREDICTED: inorganic pyrophosphatase 2-like [Tarenaya hassleriana]
Length=179

 Score =   138 bits (347),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -1

Query  1169  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  990
             V +FDFDKTIIDVDSDNWVVDELGFT LF+QLL TMPWNSLMDRMMKE+H  G TI DI+
Sbjct  12    VAIFDFDKTIIDVDSDNWVVDELGFTDLFNQLLPTMPWNSLMDRMMKELHEQGITIHDIK  71

Query  989   RVLQGVPIHPRIVPAIKAVHGLG  921
             RVL+ +PIHPR+VPA+++ H LG
Sbjct  72    RVLETIPIHPRVVPALRSAHALG  94


 Score =   117 bits (293),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            C+LRIVSDAN FFIETIL+HL I++ FSEINTNPG+VD+ GRLRI P+HDF  S HGC+R
Sbjct  95   CELRIVSDANTFFIETILEHLEIKDLFSEINTNPGFVDQHGRLRISPYHDFTESSHGCSR  154

Query  658  CPPNMCKSKII  626
            CPPNMCK + +
Sbjct  155  CPPNMCKVQFV  165



>gb|KCW82243.1| hypothetical protein EUGRSUZ_C03661 [Eucalyptus grandis]
 gb|KCW82244.1| hypothetical protein EUGRSUZ_C03661 [Eucalyptus grandis]
Length=216

 Score =   202 bits (515),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 122/157 (78%), Gaps = 0/157 (0%)
 Frame = -2

Query  838  CDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR  659
            CDLRI+SDAN FFIETILKH G+ +CF+EI TNP +VD EGRL I+PFHD   SPHGC+ 
Sbjct  40   CDLRIISDANRFFIETILKHHGLLDCFTEIVTNPAFVDAEGRLNIVPFHDSADSPHGCSL  99

Query  658  CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELI  479
            CPPNMCK  +++RIQA+  +   +R IYLGDG GD+CP LKL   DF++PRK FP+W+LI
Sbjct  100  CPPNMCKGLVLKRIQAADSEIRNRRYIYLGDGKGDYCPCLKLGTRDFVVPRKSFPLWKLI  159

Query  478  KENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQ  368
              +++L++A IHEWS+GE+   IL  +I+RI ++++ 
Sbjct  160  FNDQTLIKAVIHEWSDGEELAAILLDIIDRILMDENT  196



>ref|XP_003638612.1| Phosphoethanolamine/phosphocholine phosphatase, partial [Medicago 
truncatula]
Length=165

 Score =   200 bits (509),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/163 (58%), Positives = 126/163 (77%), Gaps = 2/163 (1%)
 Frame = -2

Query  775  GIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR-CPPNMCKSKIIERIQASMGK  599
            GI ECFSEIN+NPGYV++EGR+RI P+HDF+ + HGC   CPPNMCK  II++I+ ++  
Sbjct  1    GISECFSEINSNPGYVNQEGRVRISPYHDFNKASHGCNNVCPPNMCKGLIIDKIKNTIYD  60

Query  598  EGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDF  419
               KR IYLGDG GD+CPSL+ K  DF+MPRK+FPVW+LI ++ SL++AEIH W +GE+ 
Sbjct  61   GDNKRFIYLGDGAGDYCPSLRFKERDFVMPRKNFPVWDLICKDPSLVKAEIHGWCDGEEL  120

Query  418  ERILFHLINRICIEDS-QFLAAESKFQAISMQPCEALPKAIRV  293
            E+IL  LIN+I IED+ QF+A + K Q +S+   E+LPKA+ V
Sbjct  121  EQILIQLINKIIIEDNVQFIATDCKLQTLSIHVLESLPKALPV  163



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4708716422032