BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c17986_g1_i1 len=1576 path=[1:0-253 @255@!:254-836 838:837-1575]

Length=1576
                                                                      Score     E

emb|CDO97931.1|  unnamed protein product                                433   2e-146   
ref|XP_009765962.1|  PREDICTED: inorganic pyrophosphatase 1-like        422   8e-142   
gb|AIE54289.1|  psi14B protein                                          420   4e-141   
ref|XP_009607352.1|  PREDICTED: inorganic pyrophosphatase 1-like        419   6e-141   
ref|XP_009790004.1|  PREDICTED: inorganic pyrophosphatase 1-like        418   2e-140   
ref|XP_006357372.1|  PREDICTED: inorganic pyrophosphatase 1-like        417   5e-140   
ref|XP_009800756.1|  PREDICTED: inorganic pyrophosphatase 1-like        414   7e-139   
ref|XP_009631067.1|  PREDICTED: inorganic pyrophosphatase 1-like        412   4e-138   
ref|XP_006357373.1|  PREDICTED: inorganic pyrophosphatase 1-like        412   6e-138   
gb|KDP40798.1|  hypothetical protein JCGZ_24797                         412   9e-138   
ref|XP_011072482.1|  PREDICTED: inorganic pyrophosphatase 2             410   3e-137   
ref|XP_006357374.1|  PREDICTED: inorganic pyrophosphatase 1-like        407   3e-136   
ref|NP_001241414.1|  uncharacterized protein LOC100785878               406   8e-136   
ref|XP_006343006.1|  PREDICTED: inorganic pyrophosphatase 1-like        406   1e-135   
ref|NP_001234501.1|  psi14A protein                                     406   1e-135   
emb|CAD30864.1|  putative phosphatase                                   404   4e-135   Solanum lycopersicum
gb|ACU19181.1|  unknown                                                 404   7e-135   Glycine max [soybeans]
ref|NP_001234003.1|  psi14B protein                                     402   3e-134   
ref|XP_009367536.1|  PREDICTED: inorganic pyrophosphatase 1-like        402   4e-134   
ref|XP_004235613.1|  PREDICTED: inorganic pyrophosphatase 1-like        401   1e-133   
ref|NP_001266264.1|  inorganic pyrophosphatase 1-like                   400   2e-133   
ref|XP_008391309.1|  PREDICTED: inorganic pyrophosphatase 1-like        399   7e-133   
gb|KHN11303.1|  Inorganic pyrophosphatase 2                             397   4e-132   
ref|XP_003531628.1|  PREDICTED: inorganic pyrophosphatase 2-like        396   7e-132   
ref|XP_003529939.1|  PREDICTED: inorganic pyrophosphatase 2-like        395   4e-131   
ref|XP_002311810.1|  hypothetical protein POPTR_0008s20130g             394   6e-131   Populus trichocarpa [western balsam poplar]
ref|XP_011012806.1|  PREDICTED: inorganic pyrophosphatase 2-like        392   6e-130   
gb|KDO58635.1|  hypothetical protein CISIN_1g044553mg                   390   2e-129   
ref|XP_006343003.1|  PREDICTED: inorganic pyrophosphatase 1-like        390   3e-129   
ref|XP_004510353.1|  PREDICTED: inorganic pyrophosphatase 2-like        390   3e-129   
ref|XP_006426489.1|  hypothetical protein CICLE_v10026096mg             391   4e-129   
ref|XP_007024447.1|  Pyridoxal phosphate phosphatase-related protein    389   6e-129   
ref|XP_007135577.1|  hypothetical protein PHAVU_010G141100g             388   1e-128   
ref|XP_011034250.1|  PREDICTED: inorganic pyrophosphatase 2-like        388   2e-128   
ref|XP_006466070.1|  PREDICTED: inorganic pyrophosphatase 1-like        387   3e-128   
ref|XP_009371231.1|  PREDICTED: inorganic pyrophosphatase 1-like        386   6e-128   
ref|XP_007135578.1|  hypothetical protein PHAVU_010G141200g             389   7e-128   
ref|XP_007215797.1|  hypothetical protein PRUPE_ppa009904mg             385   2e-127   
ref|XP_003531627.1|  PREDICTED: inorganic pyrophosphatase 2             384   3e-127   
ref|XP_004297609.1|  PREDICTED: inorganic pyrophosphatase 1-like        384   4e-127   
ref|XP_007135575.1|  hypothetical protein PHAVU_010G140900g             384   5e-127   
gb|KEH18309.1|  2,3-diketo-5-methylthio-1-phosphopentane phosphatase    383   9e-127   
ref|XP_008228322.1|  PREDICTED: inorganic pyrophosphatase 1-like        383   9e-127   
ref|XP_007135574.1|  hypothetical protein PHAVU_010G140800g             382   2e-126   
ref|XP_007135576.1|  hypothetical protein PHAVU_010G141000g             382   3e-126   
ref|XP_006343004.1|  PREDICTED: inorganic pyrophosphatase 1-like        382   3e-126   
ref|XP_010062595.1|  PREDICTED: inorganic pyrophosphatase 2-like        382   4e-126   
gb|ADG23055.1|  haloacid dehalogenase                                   382   4e-126   
gb|KHN11302.1|  Inorganic pyrophosphatase 2                             381   5e-126   
ref|XP_006343002.1|  PREDICTED: inorganic pyrophosphatase 1-like        381   7e-126   
ref|XP_006385338.1|  hypothetical protein POPTR_0003s02940g             381   8e-126   
ref|XP_006343005.1|  PREDICTED: inorganic pyrophosphatase 1-like        380   1e-125   
gb|ABP52095.1|  putative phosphatase                                    380   1e-125   Phaseolus vulgaris [French bean]
ref|XP_008462365.1|  PREDICTED: inorganic pyrophosphatase 2-like        382   3e-125   
ref|XP_002527425.1|  Phosphoethanolamine/phosphocholine phosphata...    379   4e-125   Ricinus communis
ref|XP_002527424.1|  Phosphoethanolamine/phosphocholine phosphata...    378   1e-124   Ricinus communis
ref|XP_003597629.1|  Pyridoxal phosphate phosphatase PHOSPHO2           377   3e-124   
ref|XP_004141676.1|  PREDICTED: inorganic pyrophosphatase 2-like        377   3e-124   
gb|KHG07807.1|  hypothetical protein F383_35186                         375   8e-124   
ref|XP_003638651.1|  Pyridoxal phosphate phosphatase PHOSPHO2           374   3e-123   
ref|XP_004510357.1|  PREDICTED: inorganic pyrophosphatase 2-like        374   3e-123   
gb|EYU21393.1|  hypothetical protein MIMGU_mgv1a026205mg                374   3e-123   
ref|XP_010088372.1|  Inorganic pyrophosphatase 1                        373   1e-122   
ref|XP_007216440.1|  hypothetical protein PRUPE_ppa021956mg             373   1e-122   
gb|KHN32679.1|  Inorganic pyrophosphatase 2                             372   1e-122   
gb|AFK36724.1|  unknown                                                 372   2e-122   
ref|XP_002280889.1|  PREDICTED: inorganic pyrophosphatase 2             372   2e-122   Vitis vinifera
ref|XP_008228320.1|  PREDICTED: inorganic pyrophosphatase 2-like ...    372   3e-122   
ref|XP_009378232.1|  PREDICTED: inorganic pyrophosphatase 1-like        371   4e-122   
ref|XP_010267012.1|  PREDICTED: inorganic pyrophosphatase 1-like        371   5e-122   
ref|XP_008795471.1|  PREDICTED: inorganic pyrophosphatase 2             371   6e-122   
ref|XP_003595831.1|  hypothetical protein MTR_2g062320                  371   7e-122   
gb|KHG08585.1|  hypothetical protein F383_11849                         370   8e-122   
ref|XP_003546657.1|  PREDICTED: inorganic pyrophosphatase 2-like        370   2e-121   
gb|AFK41778.1|  unknown                                                 370   2e-121   
ref|XP_004510356.1|  PREDICTED: inorganic pyrophosphatase 1-like        367   2e-120   
gb|KEH18314.1|  2,3-diketo-5-methylthio-1-phosphopentane phosphatase    367   2e-120   
ref|XP_006416674.1|  hypothetical protein EUTSA_v10008386mg             368   2e-120   
emb|CDX96757.1|  BnaA08g23000D                                          367   3e-120   
ref|XP_008779500.1|  PREDICTED: LOW QUALITY PROTEIN: inorganic py...    366   4e-120   
ref|XP_010924488.1|  PREDICTED: inorganic pyrophosphatase 2-like        366   5e-120   
ref|XP_008462367.1|  PREDICTED: inorganic pyrophosphatase 2-like        366   7e-120   
ref|XP_010918519.1|  PREDICTED: inorganic pyrophosphatase 2-like        366   7e-120   
ref|XP_007024470.1|  Inorganic pyrophosphatase 2                        365   1e-119   
ref|XP_007150539.1|  hypothetical protein PHAVU_005G160900g             364   2e-119   
ref|XP_002892964.1|  phosphoric monoester hydrolase                     365   2e-119   
gb|KEH18312.1|  2,3-diketo-5-methylthio-1-phosphopentane phosphatase    363   4e-119   
ref|XP_009110395.1|  PREDICTED: inorganic pyrophosphatase 2-like        364   4e-119   
ref|XP_010459378.1|  PREDICTED: inorganic pyrophosphatase 2             364   5e-119   
emb|CDX83896.1|  BnaC08g17490D                                          363   8e-119   
emb|CDY59499.1|  BnaC05g50000D                                          362   3e-118   
emb|CDX81846.1|  BnaC08g37550D                                          362   4e-118   
ref|XP_010519214.1|  PREDICTED: inorganic pyrophosphatase 1-like        360   1e-117   
ref|XP_009117646.1|  PREDICTED: inorganic pyrophosphatase 2-like        360   1e-117   
ref|XP_002280867.1|  PREDICTED: inorganic pyrophosphatase 2             359   2e-117   Vitis vinifera
ref|XP_009149226.1|  PREDICTED: inorganic pyrophosphatase 2             359   3e-117   
gb|EYU18768.1|  hypothetical protein MIMGU_mgv1a011814mg                358   5e-117   
ref|XP_006303573.1|  hypothetical protein CARUB_v10011086mg             358   9e-117   
ref|XP_010262202.1|  PREDICTED: inorganic pyrophosphatase 1             357   1e-116   
emb|CDY21734.1|  BnaA09g44850D                                          358   2e-116   
ref|NP_173213.2|  phosphoethanolamine/phosphocholine phosphatase        357   2e-116   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010519215.1|  PREDICTED: inorganic pyrophosphatase 1-like        357   2e-116   
ref|XP_010690045.1|  PREDICTED: inorganic pyrophosphatase 2-like        355   6e-116   
ref|XP_010428203.1|  PREDICTED: inorganic pyrophosphatase 1             356   9e-116   
ref|XP_010519212.1|  PREDICTED: inorganic pyrophosphatase 2-like        355   1e-115   
gb|KFK41741.1|  hypothetical protein AALP_AA2G166400                    355   1e-115   
ref|XP_010519213.1|  PREDICTED: inorganic pyrophosphatase 2-like        355   2e-115   
ref|XP_010476932.1|  PREDICTED: inorganic pyrophosphatase 2-like        354   2e-115   
ref|XP_010690046.1|  PREDICTED: inorganic pyrophosphatase 2-like ...    356   3e-115   
gb|KHG13597.1|  hypothetical protein F383_05241                         353   9e-115   
ref|XP_006302457.1|  hypothetical protein CARUB_v10020549mg             355   1e-114   
ref|XP_009127965.1|  PREDICTED: inorganic pyrophosphatase 1             352   3e-114   
emb|CDX82118.1|  BnaC02g21720D                                          352   4e-114   
ref|NP_565052.1|  inorganic pyrophosphatase 1                           351   7e-114   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002888902.1|  hypothetical protein ARALYDRAFT_476431             351   7e-114   
ref|XP_006390603.1|  hypothetical protein EUTSA_v10018928mg             351   8e-114   
gb|AAM63155.1|  putative acid phosphatase                               350   1e-113   Arabidopsis thaliana [mouse-ear cress]
emb|CDY69464.1|  BnaAnng30500D                                          350   1e-113   
ref|XP_009409362.1|  PREDICTED: inorganic pyrophosphatase 2             346   3e-112   
ref|XP_002277629.1|  PREDICTED: inorganic pyrophosphatase 3             345   5e-112   Vitis vinifera
gb|EPS62373.1|  hypothetical protein M569_12416                         343   9e-112   
ref|XP_010062596.1|  PREDICTED: inorganic pyrophosphatase 2-like        345   1e-111   
gb|KCW69738.1|  hypothetical protein EUGRSUZ_F03120                     345   3e-111   
ref|XP_010416075.1|  PREDICTED: inorganic pyrophosphatase 1-like        343   1e-110   
ref|XP_010915327.1|  PREDICTED: inorganic pyrophosphatase 1-like        341   4e-110   
dbj|BAJ95704.1|  predicted protein                                      338   5e-109   
emb|CDY59927.1|  BnaC06g43820D                                          338   7e-109   
dbj|BAJ88911.1|  predicted protein                                      337   8e-109   
gb|KFK43955.1|  hypothetical protein AALP_AA1G196200                    339   1e-108   
ref|XP_009416458.1|  PREDICTED: inorganic pyrophosphatase 3-like        335   4e-108   
ref|XP_009105956.1|  PREDICTED: inorganic pyrophosphatase 1-like        335   7e-108   
ref|XP_010106679.1|  Inorganic pyrophosphatase 2                        333   1e-107   
ref|XP_006426490.1|  hypothetical protein CICLE_v10026265mg             334   1e-107   
emb|CDJ26592.1|  unnamed protein product                                333   3e-107   
ref|XP_010097079.1|  Inorganic pyrophosphatase 2                        333   4e-107   
ref|XP_010471347.1|  PREDICTED: inorganic pyrophosphatase 1-like        333   7e-107   
gb|EMT33032.1|  Putative phosphatase phospho1                           331   2e-106   
ref|XP_010540076.1|  PREDICTED: inorganic pyrophosphatase 2-like        330   6e-106   
ref|XP_004291030.1|  PREDICTED: inorganic pyrophosphatase 2-like        330   8e-106   
ref|XP_006466068.1|  PREDICTED: inorganic pyrophosphatase 1-like ...    327   1e-104   
ref|XP_009415365.1|  PREDICTED: inorganic pyrophosphatase 2-like        326   3e-104   
gb|ACU18702.1|  unknown                                                 322   5e-104   Glycine max [soybeans]
ref|XP_011009701.1|  PREDICTED: inorganic pyrophosphatase 3-like        326   8e-104   
ref|XP_009385786.1|  PREDICTED: inorganic pyrophosphatase 2-like ...    323   2e-103   
ref|NP_001242832.1|  uncharacterized protein LOC100789743               323   3e-103   
ref|XP_010924487.1|  PREDICTED: inorganic pyrophosphatase 2-like        322   5e-103   
ref|XP_002458417.1|  hypothetical protein SORBIDRAFT_03g033100          322   1e-102   Sorghum bicolor [broomcorn]
ref|XP_003531626.1|  PREDICTED: inorganic pyrophosphatase 2-like        322   1e-102   
ref|XP_003569699.1|  PREDICTED: inorganic pyrophosphatase 1-like        320   3e-102   
ref|XP_006644635.1|  PREDICTED: inorganic pyrophosphatase 1-like        320   6e-102   
ref|XP_006582843.1|  PREDICTED: uncharacterized protein LOC100306...    320   6e-102   
ref|XP_006426491.1|  hypothetical protein CICLE_v10026265mg             319   8e-102   
ref|XP_002324759.2|  hypothetical protein POPTR_0018s05070g             320   1e-101   Populus trichocarpa [western balsam poplar]
ref|XP_008360958.1|  PREDICTED: inorganic pyrophosphatase 2-like        319   2e-101   
gb|KDP33737.1|  hypothetical protein JCGZ_07308                         318   3e-101   
gb|KHN11301.1|  Inorganic pyrophosphatase 2                             318   4e-101   
gb|ACJ84435.1|  unknown                                                 317   5e-101   Medicago truncatula
gb|AFK38500.1|  unknown                                                 317   7e-101   
ref|NP_001235501.1|  uncharacterized protein LOC100306469               317   8e-101   
gb|KHN39291.1|  Inorganic pyrophosphatase 1                             316   1e-100   
ref|XP_002533762.1|  Phosphoethanolamine/phosphocholine phosphata...    316   1e-100   Ricinus communis
gb|AFK48095.1|  unknown                                                 317   1e-100   
ref|XP_007226633.1|  hypothetical protein PRUPE_ppa022611mg             315   2e-100   
gb|AFK36374.1|  unknown                                                 316   2e-100   
ref|XP_008220455.1|  PREDICTED: inorganic pyrophosphatase 2-like        315   6e-100   
ref|NP_001044089.1|  Os01g0720400                                       314   8e-100   Oryza sativa Japonica Group [Japonica rice]
gb|ABI95993.1|  acid phosphatase                                        314   8e-100   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009361749.1|  PREDICTED: inorganic pyrophosphatase 2-like        314   1e-99    
ref|XP_003597628.1|  hypothetical protein MTR_2g100340                  317   1e-99    
gb|EAY75640.1|  hypothetical protein OsI_03545                          313   1e-99    Oryza sativa Indica Group [Indian rice]
ref|XP_007012891.1|  Pyridoxal phosphate phosphatase-related protein    313   2e-99    
ref|XP_007012260.1|  Pyridoxal phosphate phosphatase-related protein    313   5e-99    
ref|XP_006466069.1|  PREDICTED: inorganic pyrophosphatase 1-like ...    311   6e-99    
ref|XP_009614749.1|  PREDICTED: inorganic pyrophosphatase 3-like        311   2e-98    
ref|XP_002514153.1|  Pyridoxal phosphate phosphatase PHOSPHO2, pu...    308   9e-98    Ricinus communis
emb|CDP03190.1|  unnamed protein product                                308   1e-97    
ref|XP_010049560.1|  PREDICTED: inorganic pyrophosphatase 3             308   1e-97    
ref|XP_009779867.1|  PREDICTED: inorganic pyrophosphatase 3-like ...    309   2e-97    
ref|XP_003569309.1|  PREDICTED: inorganic pyrophosphatase 3-like ...    307   3e-97    
ref|XP_010666530.1|  PREDICTED: inorganic pyrophosphatase 3             307   5e-97    
ref|XP_004486811.1|  PREDICTED: inorganic pyrophosphatase 1-like        306   1e-96    
ref|XP_004969781.1|  PREDICTED: inorganic pyrophosphatase 1-like        305   2e-96    
ref|XP_007135573.1|  hypothetical protein PHAVU_010G1407000g            303   4e-96    
gb|KDO59254.1|  hypothetical protein CISIN_1g044617mg                   304   7e-96    
ref|XP_007160240.1|  hypothetical protein PHAVU_002G304600g             302   2e-95    
ref|XP_006451424.1|  hypothetical protein CICLE_v10009204mg             302   2e-95    
ref|XP_007150538.1|  hypothetical protein PHAVU_005G160800g             302   5e-95    
ref|XP_010231985.1|  PREDICTED: inorganic pyrophosphatase 3-like ...    301   8e-95    
ref|XP_002282651.1|  PREDICTED: inorganic pyrophosphatase 3             300   2e-94    Vitis vinifera
gb|ACJ84372.1|  unknown                                                 297   4e-94    Medicago truncatula
emb|CAN67288.1|  hypothetical protein VITISV_021601                     298   5e-94    Vitis vinifera
ref|XP_008242421.1|  PREDICTED: inorganic pyrophosphatase 3             298   1e-93    
gb|ACG25081.1|  phosphatase phospho1                                    298   1e-93    Zea mays [maize]
ref|NP_001130133.1|  phosphatase phospho1                               297   5e-93    Zea mays [maize]
ref|XP_011093693.1|  PREDICTED: inorganic pyrophosphatase 3             295   5e-93    
ref|XP_010690044.1|  PREDICTED: inorganic pyrophosphatase 2-like        297   5e-93    
ref|NP_001151156.1|  LOC100284789                                       296   6e-93    Zea mays [maize]
ref|XP_007024448.1|  Inorganic pyrophosphatase 2                        294   1e-92    
ref|XP_009352621.1|  PREDICTED: inorganic pyrophosphatase 3             295   1e-92    
ref|XP_008337676.1|  PREDICTED: inorganic pyrophosphatase 3             294   2e-92    
gb|KHG05357.1|  hypothetical protein F383_31213                         294   2e-92    
ref|XP_004287531.1|  PREDICTED: inorganic pyrophosphatase 3-like        293   5e-92    
ref|XP_008228321.1|  PREDICTED: inorganic pyrophosphatase 2-like ...    291   1e-91    
ref|XP_006646071.1|  PREDICTED: inorganic pyrophosphatase 3-like        290   2e-90    
ref|XP_007202473.1|  hypothetical protein PRUPE_ppa010251mg             289   4e-90    
gb|EYU27314.1|  hypothetical protein MIMGU_mgv1a012849mg                288   4e-90    
gb|KDP34111.1|  hypothetical protein JCGZ_07682                         289   5e-90    
ref|XP_010047325.1|  PREDICTED: inorganic pyrophosphatase 2-like ...    290   8e-90    
ref|XP_010047326.1|  PREDICTED: inorganic pyrophosphatase 2-like ...    289   1e-89    
ref|XP_004168220.1|  PREDICTED: inorganic pyrophosphatase 3-like        286   3e-89    
gb|KHN16679.1|  Inorganic pyrophosphatase 3                             286   3e-89    
ref|XP_004135700.1|  PREDICTED: inorganic pyrophosphatase 3-like        285   4e-89    
ref|XP_008450832.1|  PREDICTED: inorganic pyrophosphatase 3 isofo...    285   6e-89    
ref|XP_010438289.1|  PREDICTED: inorganic pyrophosphatase 3             285   7e-89    
ref|NP_001235542.1|  uncharacterized protein LOC100306472               284   1e-88    
ref|XP_002458104.1|  hypothetical protein SORBIDRAFT_03g027020          285   2e-88    Sorghum bicolor [broomcorn]
ref|XP_006854012.1|  hypothetical protein AMTR_s00036p00240530          283   8e-88    
ref|XP_008672854.1|  PREDICTED: LOC100281893 isoform X1                 283   8e-88    
ref|XP_003630643.1|  Pyridoxal phosphate phosphatase PHOSPHO2           281   1e-87    
ref|XP_004503534.1|  PREDICTED: inorganic pyrophosphatase 3-like ...    281   2e-87    
gb|AGT16668.1|  inorganic pyrophosphatase                               282   3e-87    
ref|XP_006412831.1|  hypothetical protein EUTSA_v10026105mg             280   5e-87    
ref|XP_004969082.1|  PREDICTED: inorganic pyrophosphatase 3-like        282   6e-87    
ref|XP_010089256.1|  Inorganic pyrophosphatase 3                        282   6e-87    
ref|XP_010090022.1|  Inorganic pyrophosphatase 3                        283   9e-87    
ref|NP_001077556.1|  phosphoethanolamine/phosphocholine phosphatase     279   1e-86    Arabidopsis thaliana [mouse-ear cress]
gb|ABK21572.1|  unknown                                                 277   7e-86    Picea sitchensis
gb|KFK29508.1|  hypothetical protein AALP_AA7G143500                    276   2e-85    
ref|XP_009128612.1|  PREDICTED: inorganic pyrophosphatase 3 isofo...    276   3e-85    
ref|XP_010447843.1|  PREDICTED: inorganic pyrophosphatase 3-like        274   9e-85    
gb|EAY74825.1|  hypothetical protein OsI_02715                          275   1e-84    Oryza sativa Indica Group [Indian rice]
gb|EAZ12585.1|  hypothetical protein OsJ_02491                          275   2e-84    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006854013.1|  hypothetical protein AMTR_s00036p00240870          272   6e-84    
ref|XP_010433087.1|  PREDICTED: inorganic pyrophosphatase 3-like ...    271   1e-83    
ref|XP_007024471.1|  Pyridoxal phosphate phosphatase-related protein    270   2e-83    
ref|XP_006282700.1|  hypothetical protein CARUB_v10005618mg             270   6e-83    
ref|XP_002869428.1|  2,3-diketo-5-methylthio-1-phosphopentane pho...    269   1e-82    
gb|EMT25082.1|  Phosphoethanolamine/phosphocholine phosphatase          270   1e-82    
ref|NP_194682.1|  pyridoxal phosphate phosphatase-related protein       266   9e-82    Arabidopsis thaliana [mouse-ear cress]
emb|CDY43512.1|  BnaA01g07320D                                          270   7e-81    
ref|XP_010541049.1|  PREDICTED: inorganic pyrophosphatase 3             262   3e-80    
gb|EMS46703.1|  Inorganic pyrophosphatase 2                             268   6e-80    
emb|CDY06800.1|  BnaC01g08990D                                          266   1e-79    
ref|NP_001046344.1|  Os02g0226200                                       262   2e-79    Oryza sativa Japonica Group [Japonica rice]
gb|EAZ13360.1|  hypothetical protein OsJ_03281                          259   7e-79    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003571132.1|  PREDICTED: inorganic pyrophosphatase 2-like        261   9e-79    
gb|EMS47058.1|  Inorganic pyrophosphatase 2                             259   2e-78    
ref|XP_010519235.1|  PREDICTED: inorganic pyrophosphatase 2-like        252   4e-77    
ref|XP_003638610.1|  hypothetical protein MTR_138s0008                  251   2e-76    
ref|XP_008656629.1|  PREDICTED: inorganic pyrophosphatase 3-like        248   3e-75    
gb|KHN30036.1|  Inorganic pyrophosphatase 1                             248   1e-74    
ref|XP_009385787.1|  PREDICTED: inorganic pyrophosphatase 2-like ...    244   2e-73    
ref|NP_001183910.1|  hypothetical protein                               245   5e-73    
gb|KCW82243.1|  hypothetical protein EUGRSUZ_C03661                     241   2e-72    
gb|EMS63492.1|  Inorganic pyrophosphatase 3                             241   4e-72    
ref|XP_004951415.1|  PREDICTED: inorganic pyrophosphatase 1-like        242   2e-71    
ref|XP_002451806.1|  hypothetical protein SORBIDRAFT_04g008010          239   2e-70    Sorghum bicolor [broomcorn]
ref|XP_008810403.1|  PREDICTED: inorganic pyrophosphatase 2-like        235   2e-70    
gb|KDO58634.1|  hypothetical protein CISIN_1g044369mg                   228   2e-68    
ref|XP_008799622.1|  PREDICTED: inorganic pyrophosphatase 2-like        228   2e-68    
ref|XP_010480520.1|  PREDICTED: inorganic pyrophosphatase 2-like        228   3e-68    
ref|XP_008450833.1|  PREDICTED: inorganic pyrophosphatase 3 isofo...    222   2e-65    
ref|XP_001755323.1|  predicted protein                                  221   2e-64    
ref|XP_002976964.1|  hypothetical protein SELMODRAFT_105861             216   1e-62    
ref|XP_002980704.1|  hypothetical protein SELMODRAFT_113032             216   2e-62    
ref|XP_009128618.1|  PREDICTED: inorganic pyrophosphatase 3 isofo...    208   3e-60    
ref|XP_010433088.1|  PREDICTED: inorganic pyrophosphatase 3-like ...    207   2e-59    
ref|XP_006282699.1|  hypothetical protein CARUB_v10005618mg             204   8e-59    
gb|EYU18769.1|  hypothetical protein MIMGU_mgv1a0200772mg               201   2e-58    
ref|XP_003638612.1|  Phosphoethanolamine/phosphocholine phosphatase     200   2e-57    
gb|AAD55648.1|AC008017_21  Hypothetical protein                         196   1e-55    Arabidopsis thaliana [mouse-ear cress]
gb|EEE56590.1|  hypothetical protein OsJ_05950                          196   7e-55    Oryza sativa Japonica Group [Japonica rice]
tpg|DAA58849.1|  TPA: phosphoethanolamine/phosphocholine phosphatase    196   8e-55    
gb|KHN32680.1|  Inorganic pyrophosphatase 2                             194   3e-54    
ref|XP_004503535.1|  PREDICTED: inorganic pyrophosphatase 3-like ...    189   3e-53    
ref|XP_003638650.1|  Multidrug resistance protein ABC transporter...    205   7e-53    
ref|NP_001148285.1|  LOC100281893                                       172   2e-47    Zea mays [maize]
ref|XP_009779869.1|  PREDICTED: inorganic pyrophosphatase 3-like ...    172   1e-46    
gb|ABA27034.1|  TO66-1                                                  165   2e-45    Taraxacum officinale [dandelion]
ref|XP_005648341.1|  hypothetical protein COCSUDRAFT_41939              170   9e-45    
ref|XP_009035312.1|  hypothetical protein AURANDRAFT_22824              157   5e-40    
ref|XP_008290442.1|  PREDICTED: probable phosphatase phospho1           155   1e-39    
ref|XP_010450970.1|  PREDICTED: probable receptor protein kinase ...    164   2e-39    
gb|KFH71806.1|  hypothetical protein MVEG_02100                         155   2e-39    
ref|XP_005759479.1|  hypothetical protein EMIHUDRAFT_350751             152   2e-38    
emb|CAG00846.1|  unnamed protein product                                150   3e-38    
tpg|DAA58847.1|  TPA: hypothetical protein ZEAMMB73_786521              144   2e-36    
emb|CBN81463.1|  Probable phosphatase phospho1                          145   2e-36    
ref|XP_010744186.1|  PREDICTED: probable phosphatase phospho1           145   4e-36    
ref|XP_010738424.1|  PREDICTED: phosphoethanolamine/phosphocholin...    145   4e-36    
ref|XP_007558106.1|  PREDICTED: phosphoethanolamine/phosphocholin...    144   6e-36    
ref|XP_005796731.1|  PREDICTED: probable phosphatase phospho1-like      144   8e-36    
ref|XP_010738416.1|  PREDICTED: phosphoethanolamine/phosphocholin...    145   8e-36    
ref|XP_008415217.1|  PREDICTED: phosphoethanolamine/phosphocholin...    144   1e-35    
ref|XP_007558105.1|  PREDICTED: phosphoethanolamine/phosphocholin...    144   2e-35    
ref|XP_003961248.1|  PREDICTED: probable phosphatase phospho1-like      143   2e-35    
ref|XP_008415216.1|  PREDICTED: phosphoethanolamine/phosphocholin...    143   3e-35    
ref|XP_010773721.1|  PREDICTED: probable phosphatase phospho1 iso...    143   3e-35    
ref|XP_005532526.1|  PREDICTED: phosphoethanolamine/phosphocholin...    141   1e-34    
ref|XP_008312016.1|  PREDICTED: probable phosphatase phospho1           141   1e-34    
ref|XP_010773720.1|  PREDICTED: probable phosphatase phospho1 iso...    143   1e-34    
ref|XP_005471339.1|  PREDICTED: probable phosphatase phospho1-like      141   1e-34    
tpg|DAA58845.1|  TPA: hypothetical protein ZEAMMB73_786521              138   2e-34    
ref|XP_007428975.1|  PREDICTED: phosphoethanolamine/phosphocholin...    140   3e-34    
ref|XP_008780745.1|  PREDICTED: inorganic pyrophosphatase 1-like        135   3e-34    
ref|XP_003627930.1|  Pyridoxal phosphate phosphatase PHOSPHO2           135   3e-34    
ref|XP_008636694.1|  PREDICTED: phosphoethanolamine/phosphocholin...    139   5e-34    
ref|XP_004552403.1|  PREDICTED: probable phosphatase phospho1-lik...    139   6e-34    
ref|XP_004552402.1|  PREDICTED: probable phosphatase phospho1-lik...    139   1e-33    
ref|XP_008328216.1|  PREDICTED: phosphoethanolamine/phosphocholin...    138   1e-33    
ref|XP_003964948.1|  PREDICTED: probable phosphatase phospho1-like      138   1e-33    
ref|XP_006798353.1|  PREDICTED: probable phosphatase phospho1-lik...    137   2e-33    
ref|NP_001003461.1|  probable phosphatase phospho1                      138   2e-33    
gb|AFW71267.1|  hypothetical protein ZEAMMB73_742307                    134   2e-33    
ref|XP_005059878.1|  PREDICTED: phosphoethanolamine/phosphocholin...    137   2e-33    
ref|XP_010902774.1|  PREDICTED: probable phosphatase phospho1           137   2e-33    
ref|XP_006638204.1|  PREDICTED: probable phosphatase phospho1-like      137   2e-33    
gb|ETE67884.1|  Phosphoethanolamine/phosphocholine phosphatase          137   2e-33    
ref|XP_004080287.1|  PREDICTED: probable phosphatase phospho1-like      137   2e-33    
ref|XP_006798351.1|  PREDICTED: probable phosphatase phospho1-lik...    138   3e-33    
emb|CDQ66073.1|  unnamed protein product                                137   3e-33    
ref|XP_005468941.1|  PREDICTED: probable phosphatase phospho1-like      137   3e-33    
ref|XP_008328215.1|  PREDICTED: phosphoethanolamine/phosphocholin...    137   4e-33    
ref|XP_006636589.1|  PREDICTED: probable phosphatase phospho2-like      136   4e-33    
ref|XP_010129596.1|  PREDICTED: phosphoethanolamine/phosphocholin...    136   5e-33    
ref|XP_010873064.1|  PREDICTED: phosphoethanolamine/phosphocholin...    136   6e-33    
ref|XP_010195670.1|  PREDICTED: phosphoethanolamine/phosphocholin...    135   7e-33    
ref|XP_008328214.1|  PREDICTED: phosphoethanolamine/phosphocholin...    137   7e-33    
gb|KFO62841.1|  Phosphoethanolamine/phosphocholine phosphatase          135   8e-33    
ref|XP_010180385.1|  PREDICTED: phosphoethanolamine/phosphocholin...    136   9e-33    
ref|XP_010873062.1|  PREDICTED: phosphoethanolamine/phosphocholin...    136   9e-33    
ref|XP_007241822.1|  PREDICTED: probable phosphatase phospho1-like      135   1e-32    
ref|XP_009863376.1|  PREDICTED: phosphoethanolamine/phosphocholin...    134   2e-32    
ref|XP_008609221.1|  hypothetical protein SDRG_05286                    134   2e-32    
ref|XP_010195669.1|  PREDICTED: phosphoethanolamine/phosphocholin...    135   2e-32    
ref|XP_004071604.1|  PREDICTED: probable phosphatase phospho1-like      137   2e-32    
ref|XP_010180383.1|  PREDICTED: phosphoethanolamine/phosphocholin...    135   2e-32    
ref|XP_005236605.1|  PREDICTED: phosphoethanolamine/phosphocholin...    134   3e-32    
ref|XP_009998624.1|  PREDICTED: phosphoethanolamine/phosphocholin...    134   3e-32    
ref|XP_005846588.1|  hypothetical protein CHLNCDRAFT_135155             135   3e-32    
ref|XP_008295443.1|  PREDICTED: phosphoethanolamine/phosphocholin...    134   4e-32    
ref|XP_007256369.1|  PREDICTED: probable phosphatase phospho1-lik...    134   4e-32    
gb|EYU18770.1|  hypothetical protein MIMGU_mgv1a0200771mg               129   4e-32    
ref|XP_010295726.1|  PREDICTED: phosphoethanolamine/phosphocholin...    134   4e-32    
ref|XP_009984028.1|  PREDICTED: phosphoethanolamine/phosphocholin...    133   5e-32    
ref|XP_010304869.1|  PREDICTED: phosphoethanolamine/phosphocholin...    134   5e-32    
ref|XP_005928253.1|  PREDICTED: probable phosphatase phospho1-like      134   5e-32    
ref|XP_009476828.1|  PREDICTED: phosphoethanolamine/phosphocholin...    134   6e-32    
ref|XP_006791271.1|  PREDICTED: probable phosphatase phospho1-like      134   6e-32    
ref|XP_006003318.1|  PREDICTED: phosphoethanolamine/phosphocholin...    133   6e-32    
ref|XP_010795421.1|  PREDICTED: probable phosphatase phospho1           133   7e-32    
ref|XP_008111718.1|  PREDICTED: phosphoethanolamine/phosphocholin...    133   7e-32    
ref|XP_009098936.1|  PREDICTED: phosphoethanolamine/phosphocholin...    132   7e-32    
ref|XP_009520878.1|  hypothetical protein PHYSODRAFT_487342             139   8e-32    
ref|XP_008295437.1|  PREDICTED: phosphoethanolamine/phosphocholin...    134   8e-32    
ref|XP_009642684.1|  PREDICTED: LOW QUALITY PROTEIN: phosphoethan...    134   1e-31    
ref|XP_003222679.1|  PREDICTED: phosphoethanolamine/phosphocholin...    132   1e-31    
ref|XP_009569419.1|  PREDICTED: phosphoethanolamine/phosphocholin...    132   1e-31    
ref|XP_009964381.1|  PREDICTED: phosphoethanolamine/phosphocholin...    133   1e-31    
ref|XP_009476827.1|  PREDICTED: phosphoethanolamine/phosphocholin...    134   1e-31    
ref|XP_010222305.1|  PREDICTED: phosphoethanolamine/phosphocholin...    132   1e-31    
ref|XP_009462876.1|  PREDICTED: phosphoethanolamine/phosphocholin...    132   1e-31    
emb|CEG80674.1|  hypothetical protein RMATCC62417_14974                 132   1e-31    
ref|XP_002904854.1|  pyridoxal phosphate phosphatase, putative          138   1e-31    
emb|CDQ65126.1|  unnamed protein product                                132   1e-31    
ref|XP_010163988.1|  PREDICTED: phosphoethanolamine/phosphocholin...    132   1e-31    
ref|XP_005753199.1|  PREDICTED: probable phosphatase phospho1-lik...    132   2e-31    
gb|KFQ21953.1|  Phosphoethanolamine/phosphocholine phosphatase          131   2e-31    
ref|XP_009584019.1|  PREDICTED: phosphoethanolamine/phosphocholin...    132   2e-31    
gb|EGW01767.1|  Phosphoethanolamine/phosphocholine phosphatase          132   2e-31    
ref|XP_005753200.1|  PREDICTED: probable phosphatase phospho1-lik...    132   2e-31    
ref|XP_004567534.1|  PREDICTED: probable phosphatase phospho1-like      132   2e-31    
gb|ETI32383.1|  hypothetical protein F443_20809                         136   2e-31    
ref|XP_009833167.1|  hypothetical protein H257_08810                    131   2e-31    
gb|ETL79419.1|  hypothetical protein L917_19959                         136   2e-31    
ref|XP_009286038.1|  PREDICTED: phosphoethanolamine/phosphocholin...    131   2e-31    
ref|XP_003213110.1|  PREDICTED: phosphoethanolamine/phosphocholin...    132   2e-31    
gb|KFO86732.1|  Phosphoethanolamine/phosphocholine phosphatase          131   2e-31    
ref|XP_009890499.1|  PREDICTED: phosphoethanolamine/phosphocholin...    132   3e-31    
ref|NP_001133770.1|  Probable phosphatase phospho1                      132   3e-31    
ref|XP_009462875.1|  PREDICTED: phosphoethanolamine/phosphocholin...    132   3e-31    
ref|XP_009073243.1|  PREDICTED: phosphoethanolamine/phosphocholin...    131   3e-31    
ref|XP_009953030.1|  PREDICTED: phosphoethanolamine/phosphocholin...    131   3e-31    
ref|XP_002899142.1|  pyridoxal phosphate phosphatase, putative          138   3e-31    
gb|KFP29894.1|  Phosphoethanolamine/phosphocholine phosphatase          130   3e-31    
ref|XP_003504010.1|  PREDICTED: phosphoethanolamine/phosphocholin...    131   3e-31    
ref|XP_007899690.1|  PREDICTED: phosphoethanolamine/phosphocholin...    131   3e-31    
ref|XP_004455461.1|  PREDICTED: phosphoethanolamine/phosphocholin...    130   3e-31    
ref|XP_007642663.1|  PREDICTED: phosphoethanolamine/phosphocholin...    132   3e-31    
gb|ETP02238.1|  hypothetical protein F441_20671                         137   4e-31    
ref|XP_009812518.1|  PREDICTED: phosphoethanolamine/phosphocholin...    130   4e-31    
emb|CEG71714.1|  hypothetical protein RMATCC62417_07401                 130   4e-31    
ref|XP_004434709.1|  PREDICTED: phosphoethanolamine/phosphocholin...    131   4e-31    
gb|ETM32665.1|  hypothetical protein L914_19986                         136   4e-31    
ref|XP_009694891.1|  PREDICTED: phosphoethanolamine/phosphocholin...    131   4e-31    
emb|CDQ78961.1|  unnamed protein product                                131   4e-31    
ref|XP_008937888.1|  PREDICTED: phosphoethanolamine/phosphocholin...    131   4e-31    
gb|KFU91646.1|  Phosphoethanolamine/phosphocholine phosphatase          130   4e-31    
gb|ETO61116.1|  hypothetical protein F444_20828                         136   4e-31    
ref|XP_009286036.1|  PREDICTED: phosphoethanolamine/phosphocholin...    131   5e-31    
ref|XP_004434708.1|  PREDICTED: phosphoethanolamine/phosphocholin...    131   5e-31    
ref|XP_010163987.1|  PREDICTED: phosphoethanolamine/phosphocholin...    130   5e-31    
ref|XP_004455458.1|  PREDICTED: phosphoethanolamine/phosphocholin...    131   5e-31    
ref|XP_002681088.1|  phosphatase                                        130   6e-31    
ref|XP_005350683.1|  PREDICTED: phosphoethanolamine/phosphocholin...    130   6e-31    
ref|XP_005350682.1|  PREDICTED: phosphoethanolamine/phosphocholin...    131   6e-31    
ref|XP_009931848.1|  PREDICTED: phosphoethanolamine/phosphocholin...    130   7e-31    
gb|ETL26205.1|  hypothetical protein L916_20090                         136   7e-31    
ref|XP_010158734.1|  PREDICTED: phosphoethanolamine/phosphocholin...    130   7e-31    
ref|XP_004455456.1|  PREDICTED: phosphoethanolamine/phosphocholin...    131   7e-31    
gb|KFO05643.1|  Phosphoethanolamine/phosphocholine phosphatase          129   8e-31    
ref|XP_008898095.1|  hypothetical protein PPTG_06085                    137   9e-31    
gb|KFQ70791.1|  Phosphoethanolamine/phosphocholine phosphatase          129   9e-31    
ref|XP_009953029.1|  PREDICTED: phosphoethanolamine/phosphocholin...    130   9e-31    
ref|NP_001007942.1|  probable phosphatase phospho2                      129   9e-31    
gb|KGL99017.1|  Phosphoethanolamine/phosphocholine phosphatase          129   1e-30    
gb|ETP30358.1|  hypothetical protein F442_20606                         136   1e-30    
ref|XP_004434707.1|  PREDICTED: phosphoethanolamine/phosphocholin...    131   1e-30    
gb|KFP84709.1|  Phosphoethanolamine/phosphocholine phosphatase          129   1e-30    
gb|KFQ59155.1|  Phosphoethanolamine/phosphocholine phosphatase          129   1e-30    
ref|XP_006971985.1|  PREDICTED: phosphoethanolamine/phosphocholin...    130   1e-30    
gb|AAI69002.1|  Phosphatase, orphan 1                                   130   1e-30    
ref|XP_009286035.1|  PREDICTED: phosphoethanolamine/phosphocholin...    130   1e-30    
ref|XP_004455454.1|  PREDICTED: phosphoethanolamine/phosphocholin...    131   1e-30    
ref|XP_006971986.1|  PREDICTED: phosphoethanolamine/phosphocholin...    129   1e-30    
ref|XP_009694890.1|  PREDICTED: phosphoethanolamine/phosphocholin...    130   1e-30    
gb|EPB92493.1|  hypothetical protein HMPREF1544_00506                   129   1e-30    
gb|ETK72751.1|  hypothetical protein L915_20222                         135   1e-30    
ref|XP_004455455.1|  PREDICTED: phosphoethanolamine/phosphocholin...    131   2e-30    
gb|KFV49911.1|  Phosphoethanolamine/phosphocholine phosphatase          129   2e-30    
ref|XP_004591139.1|  PREDICTED: phosphoethanolamine/phosphocholin...    129   2e-30    
gb|ACO10126.1|  Probable phosphatase phospho2                           129   2e-30    
ref|XP_010583788.1|  PREDICTED: phosphoethanolamine/phosphocholin...    129   2e-30    
ref|NP_694744.1|  phosphoethanolamine/phosphocholine phosphatase        129   2e-30    
gb|KFO71330.1|  Phosphoethanolamine/phosphocholine phosphatase          128   2e-30    
ref|XP_004455449.1|  PREDICTED: phosphoethanolamine/phosphocholin...    130   2e-30    
ref|XP_006247246.1|  PREDICTED: phosphoethanolamine/phosphocholin...    129   2e-30    
gb|KFP50567.1|  Phosphoethanolamine/phosphocholine phosphatase          128   2e-30    
gb|EDL15994.1|  phosphatase, orphan 1, isoform CRA_b                    129   3e-30    
ref|NP_001099303.1|  phosphoethanolamine/phosphocholine phosphatase     129   3e-30    
gb|EMS45919.1|  Inorganic pyrophosphatase 1                             124   3e-30    
gb|KFQ96593.1|  Phosphoethanolamine/phosphocholine phosphatase          128   3e-30    
gb|KFW12074.1|  Phosphoethanolamine/phosphocholine phosphatase          128   3e-30    
gb|KDQ27696.1|  hypothetical protein PLEOSDRAFT_1112665                 128   3e-30    
gb|EDL15993.1|  phosphatase, orphan 1, isoform CRA_a                    129   3e-30    
gb|EXX60897.1|  hypothetical protein RirG_175750                        127   3e-30    
gb|KFP80297.1|  Phosphoethanolamine/phosphocholine phosphatase          127   3e-30    
ref|XP_004333915.1|  2,3diketo-5-methylthio-1-phosphopentane phos...    129   3e-30    
ref|XP_004591138.1|  PREDICTED: phosphoethanolamine/phosphocholin...    129   3e-30    
gb|KFV17765.1|  Phosphoethanolamine/phosphocholine phosphatase          127   4e-30    
ref|XP_008576600.1|  PREDICTED: phosphoethanolamine/phosphocholin...    129   4e-30    
ref|XP_004655601.1|  PREDICTED: phosphoethanolamine/phosphocholin...    128   4e-30    
ref|XP_004455448.1|  PREDICTED: phosphoethanolamine/phosphocholin...    131   4e-30    
ref|XP_004608745.1|  PREDICTED: phosphoethanolamine/phosphocholin...    127   4e-30    
gb|KDQ57794.1|  hypothetical protein JAAARDRAFT_178264                  127   4e-30    
ref|XP_008576601.1|  PREDICTED: phosphoethanolamine/phosphocholin...    128   4e-30    
ref|XP_005141932.1|  PREDICTED: phosphoethanolamine/phosphocholin...    128   4e-30    
ref|XP_004455443.1|  PREDICTED: phosphoethanolamine/phosphocholin...    131   4e-30    
ref|XP_010583786.1|  PREDICTED: phosphoethanolamine/phosphocholin...    128   5e-30    
gb|KFQ86635.1|  Phosphoethanolamine/phosphocholine phosphatase          127   5e-30    
ref|XP_008518591.1|  PREDICTED: phosphoethanolamine/phosphocholin...    127   5e-30    
ref|XP_005597530.1|  PREDICTED: phosphoethanolamine/phosphocholin...    128   5e-30    
ref|XP_010583785.1|  PREDICTED: phosphoethanolamine/phosphocholin...    128   6e-30    
ref|XP_007888165.1|  PREDICTED: pyridoxal phosphate phosphatase P...    127   6e-30    
ref|XP_010158733.1|  PREDICTED: phosphoethanolamine/phosphocholin...    129   6e-30    
ref|XP_006214238.1|  PREDICTED: phosphoethanolamine/phosphocholin...    127   6e-30    
ref|XP_004608744.1|  PREDICTED: phosphoethanolamine/phosphocholin...    127   6e-30    
ref|XP_001502392.1|  PREDICTED: phosphoethanolamine/phosphocholin...    127   6e-30    
ref|XP_002589017.1|  hypothetical protein BRAFLDRAFT_87490              127   7e-30    
ref|XP_008061841.1|  PREDICTED: phosphoethanolamine/phosphocholin...    128   7e-30    
ref|XP_005075925.1|  PREDICTED: phosphoethanolamine/phosphocholin...    127   7e-30    
gb|KFR09881.1|  Phosphoethanolamine/phosphocholine phosphatase          127   7e-30    
ref|XP_009673593.1|  PREDICTED: phosphoethanolamine/phosphocholin...    127   8e-30    
gb|EPT04996.1|  hypothetical protein FOMPIDRAFT_1045665                 127   8e-30    
ref|NP_990176.1|  phosphoethanolamine/phosphocholine phosphatase        127   8e-30    
gb|KFP63255.1|  Phosphoethanolamine/phosphocholine phosphatase          127   8e-30    
ref|XP_004655600.1|  PREDICTED: phosphoethanolamine/phosphocholin...    127   8e-30    
gb|KFH68866.1|  hypothetical protein MVEG_05670                         127   8e-30    
ref|XP_006166221.1|  PREDICTED: phosphoethanolamine/phosphocholin...    128   8e-30    
ref|XP_008061842.1|  PREDICTED: phosphoethanolamine/phosphocholin...    127   9e-30    
ref|XP_010583784.1|  PREDICTED: phosphoethanolamine/phosphocholin...    128   9e-30    
gb|KFM13248.1|  Phosphoethanolamine/phosphocholine phosphatase          126   9e-30    
gb|KFZ46680.1|  Phosphoethanolamine/phosphocholine phosphatase          126   1e-29    
ref|XP_003931294.1|  PREDICTED: phosphoethanolamine/phosphocholin...    127   1e-29    
emb|CDH60398.1|  acid phosphatase                                       126   1e-29    
gb|KFQ29082.1|  Phosphoethanolamine/phosphocholine phosphatase          126   1e-29    
ref|XP_008780616.1|  PREDICTED: inorganic pyrophosphatase 2-like        124   1e-29    
ref|XP_009547323.1|  hypothetical protein HETIRDRAFT_418592             126   1e-29    
ref|XP_511946.3|  PREDICTED: phosphoethanolamine/phosphocholine p...    127   1e-29    
ref|XP_003931295.1|  PREDICTED: phosphoethanolamine/phosphocholin...    127   1e-29    
ref|XP_004707131.1|  PREDICTED: phosphoethanolamine/phosphocholin...    127   1e-29    
ref|XP_001172566.1|  PREDICTED: phosphoethanolamine/phosphocholin...    127   1e-29    
ref|XP_010787839.1|  PREDICTED: pyridoxal phosphate phosphatase P...    126   1e-29    
ref|XP_008269552.1|  PREDICTED: phosphoethanolamine/phosphocholin...    126   1e-29    
ref|XP_003358139.1|  PREDICTED: phosphoethanolamine/phosphocholin...    127   1e-29    
ref|XP_008403104.1|  PREDICTED: pyridoxal phosphate phosphatase P...    126   1e-29    
ref|XP_005802585.1|  PREDICTED: pyridoxal phosphate phosphatase P...    126   1e-29    
ref|XP_003414702.1|  PREDICTED: phosphoethanolamine/phosphocholin...    127   1e-29    
gb|KFZ61498.1|  Phosphoethanolamine/phosphocholine phosphatase          126   1e-29    
ref|XP_003358137.1|  PREDICTED: phosphoethanolamine/phosphocholin...    127   2e-29    



>emb|CDO97931.1| unnamed protein product [Coffea canephora]
Length=275

 Score =   433 bits (1114),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 208/274 (76%), Positives = 233/274 (85%), Gaps = 3/274 (1%)
 Frame = -1

Query  1102  MAAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKT  923
             MAAG VVVFDFDKTIID+DSDNWV+DELGFT LF+QLL TMPWNSLMD MM E+HANGKT
Sbjct  1     MAAGIVVVFDFDKTIIDLDSDNWVLDELGFTDLFNQLLPTMPWNSLMDNMMGELHANGKT  60

Query  922   IGDIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINT  743
             I DIE VL+ VPIHPRIVPAIK+ H LGCDLRIVSDANLFFIETIL HLGIR CFSEINT
Sbjct  61    IQDIEEVLKRVPIHPRIVPAIKSAHALGCDLRIVSDANLFFIETILNHLGIRGCFSEINT  120

Query  742   NPGYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDG  563
             NPGYVDE GRLRILP+HDFHS+ HGC RCPPNMCK  ++ERIQAS+ KEGKKR IYLGDG
Sbjct  121   NPGYVDENGRLRILPYHDFHSASHGCDRCPPNMCKGMVMERIQASIAKEGKKRFIYLGDG  180

Query  562   IGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRIC  383
             IGDFCPSLKLK GD+MMPRK+FPVW+LI +NR LL+AEIHEW++GED ER+L  LIN I 
Sbjct  181   IGDFCPSLKLKEGDYMMPRKNFPVWDLICKNRMLLKAEIHEWNDGEDLERLLLQLINSIF  240

Query  382   IED---SQFLAAESKFQAISMQPCEALPKAIRVP  290
               +   SQ L+ + KFQ I M   +ALP+A+ VP
Sbjct  241   AAEESLSQLLSTDCKFQTIPMSVHQALPQALSVP  274



>ref|XP_009765962.1| PREDICTED: inorganic pyrophosphatase 1-like [Nicotiana sylvestris]
Length=271

 Score =   422 bits (1084),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 196/270 (73%), Positives = 229/270 (85%), Gaps = 0/270 (0%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VV+FDFDKTIID+DSDNWVVDELG   LF+QLL TMPWNSLMDRMMKE+HA GKTI 
Sbjct  2     AGIVVIFDFDKTIIDMDSDNWVVDELGANDLFNQLLSTMPWNSLMDRMMKELHAQGKTIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DIE VL+ VPIHPRIVPAIK+ + LGCDLR+VSDAN+FFIETILKHL IR+CFSEINTNP
Sbjct  62    DIEEVLKRVPIHPRIVPAIKSAYALGCDLRVVSDANVFFIETILKHLEIRDCFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
             GYVDEEGRL+ILP+ DF +SPHGC+ CPPNMCK  I+ERIQASM KEGKKR+IYLGDGIG
Sbjct  122   GYVDEEGRLQILPYVDFQTSPHGCSLCPPNMCKGLIVERIQASMAKEGKKRIIYLGDGIG  181

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             DFCPSLKL+ GDF+MPRKDFP W LIKEN++L++A++HEW++GE+ E IL  LIN I IE
Sbjct  182   DFCPSLKLREGDFVMPRKDFPAWNLIKENKTLVKADVHEWTDGEELEHILLQLINAITIE  241

Query  376   DSQFLAAESKFQAISMQPCEALPKAIRVPF  287
             +SQ L+ E KF  +S       P+ + VP+
Sbjct  242   ESQLLSVECKFHTMSKASHGPFPRPLPVPY  271



>gb|AIE54289.1| psi14B protein [Nicotiana tabacum]
Length=271

 Score =   420 bits (1080),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 198/270 (73%), Positives = 226/270 (84%), Gaps = 0/270 (0%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VV+FDFDKTIIDVDSDNWVVDELG   LF+QLL TMPWNSLMDR+MKE+H  GKTI 
Sbjct  2     AGIVVIFDFDKTIIDVDSDNWVVDELGANDLFNQLLPTMPWNSLMDRLMKELHTQGKTIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DIE VL+ VPIHPRIVPAIK+   LGCDLR+VSDAN+FFIETILKHLGIR CFSEINTNP
Sbjct  62    DIEEVLKRVPIHPRIVPAIKSAFALGCDLRVVSDANVFFIETILKHLGIRNCFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
             GYVDEEGRL+ILP+ DF +SPHGC  CPPNMCK  I+ERIQASM KEGKKR+IYLGDGIG
Sbjct  122   GYVDEEGRLKILPYVDFQTSPHGCNLCPPNMCKGLIVERIQASMVKEGKKRIIYLGDGIG  181

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             DFCPSLKL+ GDF+MPRKDFP W LIKENR+L++AE+HEW++GE+ E IL  LIN I IE
Sbjct  182   DFCPSLKLREGDFVMPRKDFPAWNLIKENRTLVKAEVHEWTDGEELEHILLQLINAITIE  241

Query  376   DSQFLAAESKFQAISMQPCEALPKAIRVPF  287
             +SQ L+ E KF  +S       P+ + VP+
Sbjct  242   ESQLLSVECKFHTMSKASHGPFPRPLPVPY  271



>ref|XP_009607352.1| PREDICTED: inorganic pyrophosphatase 1-like [Nicotiana tomentosiformis]
Length=271

 Score =   419 bits (1078),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 197/270 (73%), Positives = 226/270 (84%), Gaps = 0/270 (0%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VV+FDFDKTIIDVDSDNWVVDELG   LF+QLL TMPWNSLMDR+MKE+H  GKTI 
Sbjct  2     AGIVVIFDFDKTIIDVDSDNWVVDELGANDLFNQLLPTMPWNSLMDRLMKELHTQGKTIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DIE VL+ VPIHPRIVPAIK+   LGCDLR++SDAN+FFIETILKHLGIR CFSEINTNP
Sbjct  62    DIEEVLKRVPIHPRIVPAIKSAFALGCDLRVISDANVFFIETILKHLGIRNCFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
             GYVDEEGRL+ILP+ DF +SPHGC  CPPNMCK  I+ERIQASM KEGKKR+IYLGDGIG
Sbjct  122   GYVDEEGRLKILPYVDFQTSPHGCNLCPPNMCKGLIVERIQASMVKEGKKRIIYLGDGIG  181

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             DFCPSLKL+ GDF+MPRKDFP W LIKENR+L++AE+HEW++GE+ E IL  LIN I IE
Sbjct  182   DFCPSLKLREGDFVMPRKDFPAWNLIKENRTLVKAEVHEWTDGEELEHILLQLINAITIE  241

Query  376   DSQFLAAESKFQAISMQPCEALPKAIRVPF  287
             +SQ L+ E KF  +S       P+ + VP+
Sbjct  242   ESQLLSVECKFHTMSKASHGPFPRPLPVPY  271



>ref|XP_009790004.1| PREDICTED: inorganic pyrophosphatase 1-like [Nicotiana sylvestris]
Length=272

 Score =   418 bits (1075),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 198/271 (73%), Positives = 228/271 (84%), Gaps = 1/271 (0%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VV+FDFDKTIIDVDSDNWVVDELG   LF+QLL TMPWNSLMDRMMKE+HA GKTI 
Sbjct  2     AGIVVIFDFDKTIIDVDSDNWVVDELGANDLFNQLLSTMPWNSLMDRMMKELHAQGKTIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DIE VL+ VPIHPRIVPAIK+ + LGCDLR+VSDAN+FFIETILKHLGIR+CFSEINTNP
Sbjct  62    DIEEVLKRVPIHPRIVPAIKSAYALGCDLRVVSDANVFFIETILKHLGIRDCFSEINTNP  121

Query  736   GYV-DEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGI  560
             GYV DEEGRL+ILP+ DF  SPHGC+ CPPNMCK  I+ERIQASM KEGKKR+IYLGDGI
Sbjct  122   GYVDDEEGRLQILPYVDFQKSPHGCSLCPPNMCKGLIVERIQASMAKEGKKRIIYLGDGI  181

Query  559   GDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICI  380
             GDFCPSLKL+ GDF+MPRKDFP W LIKEN++L++A++HEW +GE+ E IL  LIN I I
Sbjct  182   GDFCPSLKLREGDFVMPRKDFPAWNLIKENKTLVKADVHEWIDGEELEHILLQLINAITI  241

Query  379   EDSQFLAAESKFQAISMQPCEALPKAIRVPF  287
             E+SQ L+ E KF  +S       P+ + VP+
Sbjct  242   EESQLLSVECKFHTMSKASHGPFPRPLPVPY  272



>ref|XP_006357372.1| PREDICTED: inorganic pyrophosphatase 1-like [Solanum tuberosum]
Length=272

 Score =   417 bits (1072),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 197/271 (73%), Positives = 228/271 (84%), Gaps = 1/271 (0%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VV FDFDKTIIDVDSDNWVVDELG T LF+QLL TMPWNSLMDRMMKE+H  GKTI 
Sbjct  2     AGIVVFFDFDKTIIDVDSDNWVVDELGATDLFNQLLPTMPWNSLMDRMMKELHTQGKTIQ  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DIE VL+ VP HPRIVPAIK+ + LGCDLR++SDAN+FFIETILKH+GIR+CFSEINTNP
Sbjct  62    DIEEVLKRVPRHPRIVPAIKSAYALGCDLRVISDANVFFIETILKHVGIRDCFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
             GYVDEEGRLRILP+ DF +SPHGC  CPPNMCK  I+ERIQAS+ KE K+R+IYLGDGIG
Sbjct  122   GYVDEEGRLRILPYVDFQTSPHGCNLCPPNMCKGMIVERIQASIAKEAKRRMIYLGDGIG  181

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             DFCPSLKL+ GDF+MPRKDFP W LI +NR+L++A +HEW++GE+ ERIL  LIN I IE
Sbjct  182   DFCPSLKLREGDFVMPRKDFPAWNLINKNRTLVKAAVHEWTDGEELERILLQLINTINIE  241

Query  376   DSQFLAAE-SKFQAISMQPCEALPKAIRVPF  287
             +SQ L+ E  KFQ I      ALP+A+ VP+
Sbjct  242   ESQLLSVEFCKFQTIPKAAHGALPQALPVPY  272



>ref|XP_009800756.1| PREDICTED: inorganic pyrophosphatase 1-like [Nicotiana sylvestris]
Length=268

 Score =   414 bits (1064),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 193/270 (71%), Positives = 227/270 (84%), Gaps = 3/270 (1%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFDKTIID+DSDNWVVDELG T LF+QLL TMPWNS+MD+MMKE+HA GKTI 
Sbjct  2     AGIVVVFDFDKTIIDLDSDNWVVDELGATDLFNQLLPTMPWNSVMDKMMKELHAQGKTIA  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DIE VL+  PI PR+VPAIK  H LGCDLR+VSDAN+F+IETILKHLGI +CFSEIN+NP
Sbjct  62    DIEEVLKRAPIIPRVVPAIKEAHALGCDLRVVSDANIFYIETILKHLGIMDCFSEINSNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
             GY+DEEG+LRI P+HDFH+S HGC+ CPPNMCK  IIERIQAS+  EGKKR+IYLGDG G
Sbjct  122   GYIDEEGKLRIQPYHDFHTSSHGCSLCPPNMCKGLIIERIQASLATEGKKRMIYLGDGAG  181

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             DFCPSLKLK  DF+MPRKDFPVW+LI ENR L++AEIH W +GE++E IL  +I  I +E
Sbjct  182   DFCPSLKLKKEDFVMPRKDFPVWKLINENRELVKAEIHGWKDGEEYEHILLQIIKTITME  241

Query  376   DSQFLAAESKFQAISMQPCEALPKAIRVPF  287
             ++Q L+ + KFQ I   P EALPKA+ VP+
Sbjct  242   ENQLLSVDCKFQTI---PIEALPKAVPVPY  268



>ref|XP_009631067.1| PREDICTED: inorganic pyrophosphatase 1-like [Nicotiana tomentosiformis]
Length=268

 Score =   412 bits (1059),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 192/270 (71%), Positives = 226/270 (84%), Gaps = 3/270 (1%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFDKTIID+DSDNWVVDELG T LF+QLL TMPWNS+MD+MMKE+HA GKTI 
Sbjct  2     AGIVVVFDFDKTIIDLDSDNWVVDELGATNLFNQLLPTMPWNSVMDKMMKELHAQGKTIA  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DIE VL+  PI PR+VPAIKA H LGC+LR+VSDAN+F+IETILKHLGI +CFSEIN+NP
Sbjct  62    DIEEVLKRAPIIPRVVPAIKAAHALGCELRVVSDANIFYIETILKHLGIMDCFSEINSNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
             GYVDEEG+LRI P+HDFH+S HGC+ CPPNMCK  IIERIQAS+  EGKKR+IYLGDG G
Sbjct  122   GYVDEEGKLRIQPYHDFHTSSHGCSLCPPNMCKGLIIERIQASLAMEGKKRMIYLGDGAG  181

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             DFCPSLKLK  DF+MPRKDFPVW+LI ENR L+ AEIH W +GE++E IL  +I  + +E
Sbjct  182   DFCPSLKLKKEDFVMPRKDFPVWKLINENRELVRAEIHGWKDGEEYEHILLQIIKTLTME  241

Query  376   DSQFLAAESKFQAISMQPCEALPKAIRVPF  287
             ++Q L+ + KFQ I   P EALPK + VP+
Sbjct  242   ENQLLSVDCKFQTI---PIEALPKVVPVPY  268



>ref|XP_006357373.1| PREDICTED: inorganic pyrophosphatase 1-like [Solanum tuberosum]
Length=272

 Score =   412 bits (1059),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 196/271 (72%), Positives = 226/271 (83%), Gaps = 1/271 (0%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFDKTIIDVDSDNWVVDELG T LF+QLL TMPWNSLMDR+M E+H  G  I 
Sbjct  2     AGIVVVFDFDKTIIDVDSDNWVVDELGATDLFNQLLPTMPWNSLMDRIMNELHTQGIAIQ  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DIE VL+ VPIHPRIVPAIK+V+ LGCDLR+ SDAN+FFIETILKH+GIR+CFSEINTNP
Sbjct  62    DIEEVLKRVPIHPRIVPAIKSVYALGCDLRVTSDANVFFIETILKHVGIRDCFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
             GYVDEEGRLRILP+ DF +SPHGC  CPPNMCK  I+ERIQASM KEGKKR+IYLGDGIG
Sbjct  122   GYVDEEGRLRILPYVDFITSPHGCNLCPPNMCKGMIVERIQASMTKEGKKRMIYLGDGIG  181

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             DFCPSLKL   DF+MPRKDFP W LI +NR+L++A +HEW++GE+FE IL  LIN I +E
Sbjct  182   DFCPSLKLMEADFVMPRKDFPAWNLINKNRTLVKATVHEWADGEEFEHILLQLINTISVE  241

Query  376   DSQFLAAE-SKFQAISMQPCEALPKAIRVPF  287
             +S+ L+ E  KFQ +S     ALP A+ VP+
Sbjct  242   ESRLLSVEYCKFQTMSKATHGALPPALPVPY  272



>gb|KDP40798.1| hypothetical protein JCGZ_24797 [Jatropha curcas]
Length=276

 Score =   412 bits (1058),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 191/274 (70%), Positives = 230/274 (84%), Gaps = 5/274 (2%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VV+FDFDKTIIDVDSDNWV+DELGFT LF+QLL TMPWNSLMD+MMKE+H+ GKTI 
Sbjct  2     AGIVVIFDFDKTIIDVDSDNWVIDELGFTDLFNQLLPTMPWNSLMDKMMKELHSQGKTIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI +VL+ VPIHPRIVPAIK+ H LGC+LRIVSDAN+FFIETIL+HLG+R+CFSEINTNP
Sbjct  62    DIVQVLKRVPIHPRIVPAIKSAHALGCELRIVSDANMFFIETILEHLGVRDCFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
             GYVDEEGRLRI P+HDF  S HGC+RCPPNMCK+ I+ERIQ S+ KEG K+++YLGDGIG
Sbjct  122   GYVDEEGRLRIFPYHDFTQSSHGCSRCPPNMCKALILERIQTSIAKEGNKKIVYLGDGIG  181

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             D+CPSLKL   D++MPRK+FPVW+LI  N  L++AEIHEWS+GE+ E IL  +IN+I +E
Sbjct  182   DYCPSLKLTESDYLMPRKNFPVWDLICRNPMLIKAEIHEWSDGEELEHILLQIINKISME  241

Query  376   DS-----QFLAAESKFQAISMQPCEALPKAIRVP  290
             +S     Q  +A+ K Q IS+   E LPKA+ VP
Sbjct  242   ESNGISAQLFSADCKLQNISIAGHETLPKALSVP  275



>ref|XP_011072482.1| PREDICTED: inorganic pyrophosphatase 2 [Sesamum indicum]
Length=277

 Score =   410 bits (1054),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 193/274 (70%), Positives = 230/274 (84%), Gaps = 6/274 (2%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFDKTII++DSDNWVVDELG T LF+QLL TMPWNS+MDRMM+E+HA GKTI 
Sbjct  2     AGIVVVFDFDKTIIEIDSDNWVVDELGATDLFNQLLPTMPWNSMMDRMMREVHAQGKTIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI+ VL+  P+HPR+VPAIK  H LGCDLRIVSDAN+FFIETIL HLGI++CF+EINTNP
Sbjct  62    DIKEVLRRAPMHPRVVPAIKKAHALGCDLRIVSDANMFFIETILDHLGIKDCFTEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
              YVD++GRLRI P+ DFH+SPHGC  CPPNMCK  IIERIQAS+ KEGKKR+IYLGDG G
Sbjct  122   SYVDDQGRLRISPYVDFHTSPHGCNLCPPNMCKGMIIERIQASIAKEGKKRMIYLGDGSG  181

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             DFCPSLKLK GDFMMPRK++PVW+LI ENR+LL+AEIHEW+NG + ER+L  LI++I I+
Sbjct  182   DFCPSLKLKEGDFMMPRKNYPVWDLICENRALLKAEIHEWANGAELERVLLELIDKISIQ  241

Query  376   DS------QFLAAESKFQAISMQPCEALPKAIRV  293
             +S      Q L+ + KF++I M   EALP  +RV
Sbjct  242   ESNNSNLAQLLSVDCKFESIPMAGHEALPPPLRV  275



>ref|XP_006357374.1| PREDICTED: inorganic pyrophosphatase 1-like [Solanum tuberosum]
Length=269

 Score =   407 bits (1047),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 194/271 (72%), Positives = 225/271 (83%), Gaps = 4/271 (1%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VV FDFDKTIIDVDSDNWVVDELG T LF+QLL TMPWNSLMDRMM E+H    TI 
Sbjct  2     AGIVVFFDFDKTIIDVDSDNWVVDELGATDLFNQLLPTMPWNSLMDRMMNELHTQVITIQ  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DIE VL+ VPIHPRIVPAIK+ + LGCDLR++SDAN+FFIETILKH+GIR+CFSEINTNP
Sbjct  62    DIEEVLKRVPIHPRIVPAIKSAYALGCDLRVISDANVFFIETILKHVGIRDCFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
             GYV+EEGRLRILP+ DF +SPHGC  CPPNMCK  I+ERIQA + KEGKKR+IYLGDGIG
Sbjct  122   GYVNEEGRLRILPYVDFQTSPHGCNLCPPNMCKGMIVERIQAILAKEGKKRMIYLGDGIG  181

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             DFCPSLKL   DF+MPRKDFP W LI ENR+L++A +HEW++GE+FE IL  LIN I +E
Sbjct  182   DFCPSLKLMETDFVMPRKDFPAWNLINENRTLVKAAVHEWTDGEEFEHILLQLINTITVE  241

Query  376   DSQFLAAE-SKFQAISMQPCEALPKAIRVPF  287
             ++Q L+ E  KFQ +S    EALP A+ VP+
Sbjct  242   ENQLLSVEYCKFQTMSK---EALPLALPVPY  269



>ref|NP_001241414.1| uncharacterized protein LOC100785878 [Glycine max]
 gb|ACU20848.1| unknown [Glycine max]
 gb|KHN39289.1| Inorganic pyrophosphatase 2 [Glycine soja]
Length=272

 Score =   406 bits (1044),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 187/269 (70%), Positives = 233/269 (87%), Gaps = 1/269 (0%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             +GTV+VFDFDKTI+DVDSDNWV+DELGFT LF+QLL TMPWNSLMDRMM E+H+NGKTI 
Sbjct  2     SGTVIVFDFDKTIVDVDSDNWVIDELGFTDLFNQLLPTMPWNSLMDRMMMELHSNGKTIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DIE VL+ +P+HPR++PA++A H LGCDLRIVSDAN+FFIETILKHLGIRE FSEINTNP
Sbjct  62    DIEEVLRRIPLHPRVIPALQAAHALGCDLRIVSDANVFFIETILKHLGIREYFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
             GYV+EEGRLRILP+HDF+ + HGC  CPPNMCK  II+RIQ S+ +EGKKR+IYLGDG G
Sbjct  122   GYVNEEGRLRILPYHDFNKASHGCTLCPPNMCKGLIIDRIQDSISEEGKKRMIYLGDGSG  181

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICI-  380
             D+CPSL+LK  DFMMPRK+FPVW+LI ++  L++AEIH WS+GE+ E++L HLIN+I + 
Sbjct  182   DYCPSLRLKERDFMMPRKNFPVWDLICKDPLLVKAEIHGWSDGEELEQVLLHLINKISME  241

Query  379   EDSQFLAAESKFQAISMQPCEALPKAIRV  293
             E++QF++++ K Q +S+   E LPKA+ V
Sbjct  242   ENAQFISSDCKLQTLSVSALEGLPKALPV  270



>ref|XP_006343006.1| PREDICTED: inorganic pyrophosphatase 1-like [Solanum tuberosum]
Length=274

 Score =   406 bits (1044),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 193/273 (71%), Positives = 228/273 (84%), Gaps = 3/273 (1%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFDKTIID+DSDNWVVDELG T LF+QLL TMPWNS+MDRMMKE++  GKTI 
Sbjct  2     AGIVVVFDFDKTIIDLDSDNWVVDELGATDLFNQLLPTMPWNSVMDRMMKELYEQGKTIK  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DIE+VL+  P+ PR+VPAIKA H LGCDLRIVSDANLF+IETIL HLGI +CF+EINTNP
Sbjct  62    DIEQVLKRAPVIPRVVPAIKAAHALGCDLRIVSDANLFYIETILNHLGISDCFTEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCAR--CPPNMCKSKIIERIQASMGKEGKKRVIYLGDG  563
             GYVDEEG+LRI P HDFH+S HGC+   CPPNMCK  +IERIQAS+ KEGKKR+IYLGDG
Sbjct  122   GYVDEEGKLRIRPHHDFHTSSHGCSSNTCPPNMCKGLVIERIQASLAKEGKKRMIYLGDG  181

Query  562   IGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRIC  383
              GD+CPSLKLK  DF+MPRKDFPVW+LI ENR L++A+IH WS+GE+ E IL  +I  I 
Sbjct  182   AGDYCPSLKLKEQDFVMPRKDFPVWKLINENRDLVKADIHGWSDGEEQEHILLQIIKTIS  241

Query  382   IEDSQFLAAESKFQAISMQPC-EALPKAIRVPF  287
             +ED+QFL+ + KFQ I +    EA+PKA+ VP+
Sbjct  242   MEDNQFLSVDCKFQTIPINAVHEAMPKALPVPY  274



>ref|NP_001234501.1| psi14A protein [Solanum lycopersicum]
 emb|CAD30863.1| putative phosphatase [Solanum lycopersicum]
Length=269

 Score =   406 bits (1043),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 194/271 (72%), Positives = 223/271 (82%), Gaps = 4/271 (1%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFDKTIIDVDSDNWVVDELG T LF+QLL TMPWNSLMDRMMKE+H  GKTI 
Sbjct  2     AGIVVVFDFDKTIIDVDSDNWVVDELGATDLFNQLLPTMPWNSLMDRMMKELHTQGKTIQ  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DIE VL+ VPIHPRIVPAIK+ H LGCDLR++SDAN+FF+ETILKHLGIR+CFSEINTNP
Sbjct  62    DIEEVLKRVPIHPRIVPAIKSAHALGCDLRVISDANVFFLETILKHLGIRDCFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
             GYVD EGRLRILP+ DF  SPHGC  CPPNMCK  I+ERIQA   KEGKKR+IYLGDGIG
Sbjct  122   GYVDGEGRLRILPYVDFQKSPHGCNLCPPNMCKGMIVERIQA---KEGKKRMIYLGDGIG  178

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             DFCPSLKL   DF+MPRKDFP W LI +NR+L++A +HEW+NG++ E IL  LIN I +E
Sbjct  179   DFCPSLKLSEADFVMPRKDFPAWNLINKNRTLVKATVHEWTNGQELEHILLQLINTINME  238

Query  376   DSQFLAAE-SKFQAISMQPCEALPKAIRVPF  287
             +SQ L+ +  K   +S     ALP+A+ VP+
Sbjct  239   ESQLLSVDYCKLVTMSKAAHGALPQALPVPY  269



>emb|CAD30864.1| putative phosphatase [Solanum lycopersicum]
Length=269

 Score =   404 bits (1039),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 193/271 (71%), Positives = 223/271 (82%), Gaps = 4/271 (1%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFDKTIIDVDSDNWVVDELG T LF+QLL TMPWNSLM+RMMKE+H  GKTI 
Sbjct  2     AGIVVVFDFDKTIIDVDSDNWVVDELGATDLFNQLLPTMPWNSLMNRMMKELHTQGKTIQ  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DIE VL+ VPIHPRIVPAIK+ H LGCDLR++SDAN+FF+ETILKHLGIR+CFSEINTNP
Sbjct  62    DIEEVLKRVPIHPRIVPAIKSAHALGCDLRVISDANVFFLETILKHLGIRDCFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
             GYVD EGRLRILP+ DF  SPHGC  CPPNMCK  I+ERIQA   KEGKKR+IYLGDGIG
Sbjct  122   GYVDGEGRLRILPYVDFQKSPHGCNLCPPNMCKGMIVERIQA---KEGKKRMIYLGDGIG  178

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             DFCPSLKL   DF+MPRKDFP W LI +NR+L++A +HEW+NG++ E IL  LIN I +E
Sbjct  179   DFCPSLKLSEADFVMPRKDFPAWNLINKNRTLVKATVHEWTNGQELEHILLQLINTINME  238

Query  376   DSQFLAAE-SKFQAISMQPCEALPKAIRVPF  287
             +SQ L+ +  K   +S     ALP+A+ VP+
Sbjct  239   ESQLLSVDYCKLVTMSKAAHGALPQALPVPY  269



>gb|ACU19181.1| unknown [Glycine max]
Length=272

 Score =   404 bits (1038),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 186/269 (69%), Positives = 232/269 (86%), Gaps = 1/269 (0%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             +GTV+VFDFDKTI+DVDSDNWV+DELGFT LF+QLL TMPWNSLMDRMM E+H+NGKTI 
Sbjct  2     SGTVIVFDFDKTIVDVDSDNWVIDELGFTDLFNQLLPTMPWNSLMDRMMMELHSNGKTIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DIE VL+ +P+HPR++PA++A H LGCDLRIVSDAN+FFIETILKHLGIRE FSEINTNP
Sbjct  62    DIEEVLRRIPLHPRVIPALQAAHALGCDLRIVSDANVFFIETILKHLGIREYFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
             GYV+EEGRLRILP+HDF+ + HGC  CPPNMCK  II+RIQ S+ +EGKKR+IYLGDG G
Sbjct  122   GYVNEEGRLRILPYHDFNKASHGCTLCPPNMCKGLIIDRIQDSISEEGKKRMIYLGDGSG  181

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICI-  380
             D+CPSL+LK  DFMM RK+FPVW+LI ++  L++AEIH WS+GE+ E++L HLIN+I + 
Sbjct  182   DYCPSLRLKERDFMMSRKNFPVWDLICKDPLLVKAEIHGWSDGEELEQVLLHLINKISME  241

Query  379   EDSQFLAAESKFQAISMQPCEALPKAIRV  293
             E++QF++++ K Q +S+   E LPKA+ V
Sbjct  242   ENAQFISSDCKLQTLSVSALEGLPKALPV  270



>ref|NP_001234003.1| psi14B protein [Solanum lycopersicum]
 emb|CAD30862.1| putative phosphatase [Solanum lycopersicum]
 emb|CAD30865.1| putative phosphatase [Solanum lycopersicum]
Length=269

 Score =   402 bits (1033),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 196/271 (72%), Positives = 222/271 (82%), Gaps = 4/271 (1%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFDKTIIDVDSDNWVVDELG T LF+QLL TMPWNSLMDRMMKE+H  GKTI 
Sbjct  2     AGIVVVFDFDKTIIDVDSDNWVVDELGATDLFNQLLPTMPWNSLMDRMMKELHTQGKTIQ  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DIE VL+ VPIHPRIVPAIK+ H LGCDLR++SDAN+FFIETILKHLGIR+CFSEINTNP
Sbjct  62    DIEEVLKRVPIHPRIVPAIKSAHALGCDLRVISDANVFFIETILKHLGIRDCFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
             GYVD EGRLRILP+ DF  SPHGC  CPPNMCK  I+ERIQA   KEGKKR+IYLGDGIG
Sbjct  122   GYVDGEGRLRILPYVDFQKSPHGCNLCPPNMCKGMIVERIQA---KEGKKRMIYLGDGIG  178

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             DFCPSLKL+  DF+MPRKDFP W LI +NR+L++A +HEW+NG++ E IL   IN I IE
Sbjct  179   DFCPSLKLREADFVMPRKDFPAWNLINKNRTLVKAGVHEWTNGKELEHILLQWINTINIE  238

Query  376   DSQFLAAE-SKFQAISMQPCEALPKAIRVPF  287
             +SQ L+ E  KFQ        ALP+ + VP+
Sbjct  239   ESQLLSMEYCKFQTKPNADHGALPRPLPVPY  269



>ref|XP_009367536.1| PREDICTED: inorganic pyrophosphatase 1-like [Pyrus x bretschneideri]
Length=269

 Score =   402 bits (1033),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 195/269 (72%), Positives = 229/269 (85%), Gaps = 4/269 (1%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFDKTII+ DSDNWVVDELG T LF++LL TMPWNSLMDRMMKE+H+ GKTI 
Sbjct  2     AGIVVVFDFDKTIIECDSDNWVVDELGATDLFNELLPTMPWNSLMDRMMKELHSQGKTIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI  VLQ  PIHPR+VPAIKA H LGCDLRI+SDANLFFIETILKHLG+ E FSEINTNP
Sbjct  62    DIVEVLQRTPIHPRVVPAIKAAHALGCDLRILSDANLFFIETILKHLGLEEYFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
              YVDEEGRLRI P+ DF  SPHGC+RCPPNMCKS IIERIQAS+  +GKKR+IYLGDG G
Sbjct  122   SYVDEEGRLRISPYCDFTQSPHGCSRCPPNMCKSVIIERIQASVSTDGKKRLIYLGDGSG  181

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             D+CPSLKLK GDF+MPRK+FP+++LI +N  L++AEIHEW++GE+ E+IL +LIN I IE
Sbjct  182   DYCPSLKLKEGDFVMPRKNFPLYDLICKNPLLIKAEIHEWTDGEELEQILLNLINSISIE  241

Query  376   D-SQFLAAESKFQAISMQPCEALPKAIRV  293
             + +QFL+A+ K Q IS+   EALP+A+ V
Sbjct  242   EHAQFLSADCKLQTISV---EALPQALPV  267



>ref|XP_004235613.1| PREDICTED: inorganic pyrophosphatase 1-like [Solanum lycopersicum]
Length=274

 Score =   401 bits (1030),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 192/273 (70%), Positives = 225/273 (82%), Gaps = 3/273 (1%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFDKTIID+DSDNWVVDELG T LF+QLL TMPWNS+MDRMMKE+H  GKTI 
Sbjct  2     AGIVVVFDFDKTIIDLDSDNWVVDELGATDLFNQLLPTMPWNSVMDRMMKELHEQGKTIK  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DIE VL+  P  PR+VPAIKA H LGCDLRIVSDANLF+IETIL HLGI +CF+EI+TNP
Sbjct  62    DIEEVLKRAPAIPRVVPAIKAAHALGCDLRIVSDANLFYIETILNHLGISDCFTEIHTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCAR--CPPNMCKSKIIERIQASMGKEGKKRVIYLGDG  563
             GYVDEEGRLRI P HDFH+S HGC+   CPPNMCK  +IE+IQAS+ KEGKKR+IYLGDG
Sbjct  122   GYVDEEGRLRIRPHHDFHTSSHGCSSNTCPPNMCKGLVIEKIQASLAKEGKKRMIYLGDG  181

Query  562   IGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRIC  383
              GD+CPSLKLK  DF+MPRKDFPVW+LI EN  L++AEIH WS+GE+ E+IL  +I  I 
Sbjct  182   AGDYCPSLKLKEQDFVMPRKDFPVWKLINENHDLVKAEIHGWSDGEEQEQILLQIIKTIS  241

Query  382   IEDSQFLAAESKFQAISMQPC-EALPKAIRVPF  287
             +ED+QFL+ + KFQ I +    EA+ KA+ VP+
Sbjct  242   MEDNQFLSVDCKFQTIPINAVHEAITKALPVPY  274



>ref|NP_001266264.1| inorganic pyrophosphatase 1-like [Solanum lycopersicum]
 gb|AAG40473.1|AF305968_1 putative acid phosphatase [Solanum lycopersicum]
 emb|CAD30861.1| putative phosphatase [Solanum lycopersicum]
 emb|CAD30866.1| putative phosphatase [Solanum lycopersicum]
Length=269

 Score =   400 bits (1028),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 194/271 (72%), Positives = 222/271 (82%), Gaps = 4/271 (1%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFDKTII+VDSDNWVVDELG T LF+QLL TMPWNSLMDRMMKE+H  GKTI 
Sbjct  2     AGIVVVFDFDKTIIEVDSDNWVVDELGATDLFNQLLPTMPWNSLMDRMMKELHTQGKTIQ  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DIE VL+ VPIHPRIVPAIK+ H LGCDLR++SDAN+FFIETILKHLGIR+CFSEINTNP
Sbjct  62    DIEEVLKRVPIHPRIVPAIKSAHALGCDLRVISDANVFFIETILKHLGIRDCFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
             GYVD EGRLRILP+ DF  SPH C  CPPNMCK  I+ERIQA   KEGKKR+IYLGDGIG
Sbjct  122   GYVDGEGRLRILPYVDFQKSPHSCNLCPPNMCKGMIVERIQA---KEGKKRMIYLGDGIG  178

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             DFCPSLKL+  DF+MPRKDFP W LI +NR+L++A +HEW+NG++ E IL   IN I IE
Sbjct  179   DFCPSLKLREADFVMPRKDFPAWNLINKNRTLVKAGVHEWTNGKELEHILLQWINTINIE  238

Query  376   DSQFLAAES-KFQAISMQPCEALPKAIRVPF  287
             +SQ L+ E+ KFQ        ALP+ + VP+
Sbjct  239   ESQLLSMENCKFQTKHNAAHGALPRPLPVPY  269



>ref|XP_008391309.1| PREDICTED: inorganic pyrophosphatase 1-like [Malus domestica]
Length=269

 Score =   399 bits (1025),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 194/269 (72%), Positives = 228/269 (85%), Gaps = 4/269 (1%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFDKTII+ DSDNWVVDELG T LF++LL TMPWNSLMDRMMKE+H+ GKTI 
Sbjct  2     AGIVVVFDFDKTIIECDSDNWVVDELGATDLFNELLPTMPWNSLMDRMMKELHSQGKTIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI  VL+  PIHPR+VPAIKA H LGCDLRI+SDANLFFIETILKHLG+ E FSEINTNP
Sbjct  62    DIMEVLKRTPIHPRVVPAIKAAHALGCDLRILSDANLFFIETILKHLGLEEYFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
              YVDEEGRLRI P+ DF  SPHGC+RCPPNMCKS IIERIQAS+  +GKKR+IYLGDG G
Sbjct  122   SYVDEEGRLRISPYCDFTQSPHGCSRCPPNMCKSVIIERIQASVSTDGKKRLIYLGDGSG  181

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICI-  380
             D+CPSLKLK GDF+MPRK+FP+++LI +N  L++AEIHEW++GE+ E+IL +LIN I I 
Sbjct  182   DYCPSLKLKEGDFVMPRKNFPLYDLICKNPLLIKAEIHEWTDGEELEQILLNLINSISID  241

Query  379   EDSQFLAAESKFQAISMQPCEALPKAIRV  293
             E +QFL+A+ K Q IS+   EALP+A+ V
Sbjct  242   EHAQFLSADCKLQTISV---EALPQALPV  267



>gb|KHN11303.1| Inorganic pyrophosphatase 2 [Glycine soja]
Length=272

 Score =   397 bits (1020),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 183/269 (68%), Positives = 226/269 (84%), Gaps = 1/269 (0%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             +GTV+VFDFDKTI+DVDSDNWV+DELGFT LF+QLL TMPWNSLMDRMM E+H+ GKTI 
Sbjct  2     SGTVIVFDFDKTIVDVDSDNWVIDELGFTDLFNQLLPTMPWNSLMDRMMMELHSKGKTIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DIE VL  +P+HPR++PAI+A H  GCDLRIVSDAN+FFIETILKHLGIRE FSEINTNP
Sbjct  62    DIEEVLHRIPLHPRVIPAIQAAHAFGCDLRIVSDANMFFIETILKHLGIREYFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
             GYV+EEGRLRILP+HDF+ + HGC  CPPNMCK  II+RIQ S+ +EG KR+IYLGDG G
Sbjct  122   GYVNEEGRLRILPYHDFNKASHGCTLCPPNMCKGLIIDRIQDSISQEGNKRMIYLGDGSG  181

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICI-  380
             D+CPSL+LK  DFMMPRK+FP W+LI ++  L++AEIH WS+GE+ E++L HLI +I + 
Sbjct  182   DYCPSLRLKERDFMMPRKNFPAWDLICKDPLLVKAEIHGWSDGEELEQVLLHLIAKISME  241

Query  379   EDSQFLAAESKFQAISMQPCEALPKAIRV  293
             E+SQF++++ K Q +S+   E LPK + V
Sbjct  242   ENSQFISSDCKLQTLSVSALEGLPKVLPV  270



>ref|XP_003531628.1| PREDICTED: inorganic pyrophosphatase 2-like [Glycine max]
Length=272

 Score =   396 bits (1018),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 182/269 (68%), Positives = 226/269 (84%), Gaps = 1/269 (0%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             +GTV+VFDFDKTI+DVDSDNWV+DELGFT LF+QLL TMPWNSLMDRMM E+H+ GKTI 
Sbjct  2     SGTVIVFDFDKTIVDVDSDNWVIDELGFTDLFNQLLPTMPWNSLMDRMMMELHSKGKTIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DIE VL  +P+HPR++PAI+A H  GCDLRIVSDAN+FFIETILKHLGIRE FSEINTNP
Sbjct  62    DIEEVLHRIPLHPRVIPAIQAAHAFGCDLRIVSDANMFFIETILKHLGIREYFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
             GYV+EEGRLRILP+HDF+ + HGC  CPPNMCK  II+RIQ S+ +EG KR+IYLGDG G
Sbjct  122   GYVNEEGRLRILPYHDFNKASHGCTLCPPNMCKGLIIDRIQDSISQEGNKRMIYLGDGSG  181

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICI-  380
             D+CPSL+LK  D+MMPRK+FP W+LI ++  L++AEIH WS+GE+ E++L HLI +I + 
Sbjct  182   DYCPSLRLKERDYMMPRKNFPAWDLICKDPLLVKAEIHGWSDGEELEQVLLHLIAKISME  241

Query  379   EDSQFLAAESKFQAISMQPCEALPKAIRV  293
             E+SQF++++ K Q +S+   E LPK + V
Sbjct  242   ENSQFISSDCKLQTLSVSALEGLPKVLPV  270



>ref|XP_003529939.1| PREDICTED: inorganic pyrophosphatase 2-like [Glycine max]
 gb|KHN39290.1| Inorganic pyrophosphatase 2 [Glycine soja]
Length=272

 Score =   395 bits (1014),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 184/269 (68%), Positives = 230/269 (86%), Gaps = 1/269 (0%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             +G VVVFDFDKTI+DVDSDNWV+DELGFT LF+QLL TMPWNSLMD+MM E+H+NGKTI 
Sbjct  2     SGIVVVFDFDKTIVDVDSDNWVIDELGFTDLFNQLLPTMPWNSLMDKMMMELHSNGKTIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DIE VL  +P+HPR++PAI+A H LGCDLRIVSDAN+FFIETILKHLGIRE FSEI+TNP
Sbjct  62    DIEEVLHRIPLHPRVIPAIQAAHTLGCDLRIVSDANMFFIETILKHLGIREYFSEISTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
             GYV+EE RLRILP+HDF+ + HGC+ CPPNMCK  II+RIQ S+ +EGKKR+IYLGDG G
Sbjct  122   GYVNEEERLRILPYHDFNKASHGCSLCPPNMCKGLIIDRIQDSILEEGKKRMIYLGDGSG  181

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICI-  380
             D+CPSL+LK  DFMMPRK+FPVW+LI ++  L++AEIH WS+GE+ E++L HLIN+I + 
Sbjct  182   DYCPSLRLKERDFMMPRKNFPVWDLICKDPLLVKAEIHGWSDGEELEQVLLHLINKISME  241

Query  379   EDSQFLAAESKFQAISMQPCEALPKAIRV  293
             E++QF++++ K Q +S+   E LPK + V
Sbjct  242   ENAQFISSDCKLQTLSVSAHEDLPKVLPV  270



>ref|XP_002311810.1| hypothetical protein POPTR_0008s20130g [Populus trichocarpa]
 gb|EEE89177.1| hypothetical protein POPTR_0008s20130g [Populus trichocarpa]
Length=277

 Score =   394 bits (1013),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 182/275 (66%), Positives = 224/275 (81%), Gaps = 5/275 (2%)
 Frame = -1

Query  1102  MAAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKT  923
             MAA  VVVFDFDKTIIDVDSDNWV+DELGFT  F+QLL TM WNSLMDRMMKE+HANGKT
Sbjct  1     MAAAIVVVFDFDKTIIDVDSDNWVIDELGFTESFNQLLPTMSWNSLMDRMMKELHANGKT  60

Query  922   IGDIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINT  743
             + DI  VL+ +PIHP+++ AIKA H LGC+LRIVSDAN+FFIETILKHLG+++ FSEINT
Sbjct  61    MEDIAEVLKRIPIHPQVISAIKAAHALGCELRIVSDANMFFIETILKHLGLKDYFSEINT  120

Query  742   NPGYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDG  563
             NPG+VDEEGRLRI P+HDF  S HGC+ CPPNMCK  IIERIQAS+ KEG K++IYLGDG
Sbjct  121   NPGFVDEEGRLRISPYHDFTQSSHGCSLCPPNMCKGLIIERIQASISKEGSKKIIYLGDG  180

Query  562   IGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRIC  383
              GD+CPSLKL   D+MMPRK+FPVW+LI +N  L++AEIHEW++G + ER+L  +I RI 
Sbjct  181   AGDYCPSLKLTEADYMMPRKNFPVWDLISKNPKLIKAEIHEWNDGAEMERVLLQIIERIS  240

Query  382   IED-----SQFLAAESKFQAISMQPCEALPKAIRV  293
              E+     ++  +A+ K Q IS+   +A+P+A+ V
Sbjct  241   REEINSNSAKLFSADCKLQTISIAGHDAMPQALSV  275



>ref|XP_011012806.1| PREDICTED: inorganic pyrophosphatase 2-like [Populus euphratica]
Length=283

 Score =   392 bits (1006),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 182/273 (67%), Positives = 221/273 (81%), Gaps = 5/273 (2%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
              G VVVFDFDKTIIDVDSDNWV+DELGFT LF+QLLHTMPWNSLMDRMMKEIH++GKTI 
Sbjct  9     GGIVVVFDFDKTIIDVDSDNWVIDELGFTDLFNQLLHTMPWNSLMDRMMKEIHSHGKTIE  68

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI  VL+ +PIHPR++ AIKA H LGC+LRIVSDAN+FFIETIL HLG+++ FSEINTNP
Sbjct  69    DIAEVLRRIPIHPRVISAIKAAHALGCELRIVSDANMFFIETILNHLGLKDYFSEINTNP  128

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
             G+VDE+ RLRI P+HDF  S H C+ CPPNMCK  IIERIQAS+ K+G K++IYLGDG G
Sbjct  129   GFVDEQERLRISPYHDFTQSSHCCSLCPPNMCKGLIIERIQASISKDGSKKIIYLGDGAG  188

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             D+CPSLKL A D++MPRK+FPVW+LI EN  L++AEIHEW NG + ER+L  +I RI  +
Sbjct  189   DYCPSLKLTAADYVMPRKNFPVWDLISENPLLVKAEIHEWINGAELERVLLQIIERISTD  248

Query  376   D-----SQFLAAESKFQAISMQPCEALPKAIRV  293
             +     +Q L+A+ K Q IS+   E LP+ + V
Sbjct  249   EISSNSAQLLSADCKLQTISIAAHEGLPQPLSV  281



>gb|KDO58635.1| hypothetical protein CISIN_1g044553mg [Citrus sinensis]
Length=275

 Score =   390 bits (1002),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 184/272 (68%), Positives = 220/272 (81%), Gaps = 4/272 (1%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             +G VV+FDFDKTIID DSDN+VVDELG T LF+QLL TMPWNSLMDRMMKE+H+ GKTI 
Sbjct  2     SGIVVIFDFDKTIIDCDSDNFVVDELGATDLFNQLLPTMPWNSLMDRMMKELHSQGKTIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI  VL+ +PIHPR+VPAIK+ H LGC+LRIVSDANLFFIETIL+HLGIR+CFSEINTNP
Sbjct  62    DIVEVLKRIPIHPRVVPAIKSAHALGCELRIVSDANLFFIETILEHLGIRDCFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
             G+VDEEGRLRI PFHDF    HGC  CPPNMCK  +IERIQAS+ KEG K++IYLGDG G
Sbjct  122   GFVDEEGRLRIFPFHDFTKCSHGCNLCPPNMCKGVVIERIQASLSKEGNKKIIYLGDGSG  181

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             D+CPSLKL  GD +MPRK+FP+W+LI  N  L++AEIHEW++GE+ E+IL HL+N I   
Sbjct  182   DYCPSLKLSEGDHVMPRKNFPLWDLIIRNPMLIKAEIHEWTDGEELEQILLHLVNTIGST  241

Query  376   D----SQFLAAESKFQAISMQPCEALPKAIRV  293
             +    +Q L+A+ K Q IS    E LP+ + V
Sbjct  242   NNNNSAQLLSADCKLQTISAAAHETLPQVLSV  273



>ref|XP_006343003.1| PREDICTED: inorganic pyrophosphatase 1-like [Solanum tuberosum]
Length=271

 Score =   390 bits (1001),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 193/273 (71%), Positives = 225/273 (82%), Gaps = 7/273 (3%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFDKTIID+DSDNWV+DELG T LF++LL TMPWNSLMDRMMKE+H  GKTI 
Sbjct  2     AGIVVVFDFDKTIIDLDSDNWVIDELGATDLFNRLLPTMPWNSLMDRMMKELHDQGKTID  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DIE+VL+ VP+ PR+VPAIKA H LGCDLRIVSDAN+F+IETILKHLGI +CF+EINTNP
Sbjct  62    DIEQVLKRVPVIPRVVPAIKAAHALGCDLRIVSDANVFYIETILKHLGIYDCFTEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCA--RCPPNMCKSKIIERIQASMGKEGKKRVIYLGDG  563
             GYVDEEG+LRILP HDFH   HGC    CPPNMCK  IIERIQAS+ KEGKKR+IYLGDG
Sbjct  122   GYVDEEGKLRILPHHDFH---HGCTFNTCPPNMCKGLIIERIQASLAKEGKKRMIYLGDG  178

Query  562   IGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRIC  383
              GDFCPSLKLK  DF+MPRKDFPVW+LI +NR L+ A IH WS+GE+ ++IL  +I  I 
Sbjct  179   AGDFCPSLKLKEQDFVMPRKDFPVWKLINKNRHLIRARIHGWSDGEEQQQILLQIIKAIT  238

Query  382   IEDSQFLAAE-SKFQAISMQPC-EALPKAIRVP  290
             IE++Q L+ +  KFQ I +    EALPKA+ +P
Sbjct  239   IEENQILSTDCCKFQTIPINTVHEALPKALPLP  271



>ref|XP_004510353.1| PREDICTED: inorganic pyrophosphatase 2-like [Cicer arietinum]
Length=272

 Score =   390 bits (1001),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 183/269 (68%), Positives = 225/269 (84%), Gaps = 1/269 (0%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             + TV+VFDFDKTIID DSDNWVVDELGFT LF+QLL TMPWNSLMD+MM E+H+ G TI 
Sbjct  2     SNTVIVFDFDKTIIDCDSDNWVVDELGFTDLFNQLLPTMPWNSLMDKMMMELHSEGVTIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DIE+VL  +PIH RI+PAIK+ H LGCDLRIVSDAN+FFI+TILKHLGI ECFSEINTNP
Sbjct  62    DIEKVLHRIPIHNRIIPAIKSAHALGCDLRIVSDANVFFIQTILKHLGISECFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
             GYV+EEGRLRILP HDF+ + HGC  CPPNMCK  II+RIQ S+ ++  KR IYLGDG+G
Sbjct  122   GYVNEEGRLRILPHHDFNKASHGCTICPPNMCKGLIIDRIQNSISEDNNKRFIYLGDGVG  181

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICI-  380
             D+CPSL+LK  DFMMPRK+FPVW+LI ++ SL++AEIH W +GE+ E+IL  LIN+I I 
Sbjct  182   DYCPSLRLKERDFMMPRKNFPVWDLICKDPSLIKAEIHAWCDGEELEQILIQLINKILIE  241

Query  379   EDSQFLAAESKFQAISMQPCEALPKAIRV  293
             E++QF++++ K Q +S+   E+LPKA+ V
Sbjct  242   ENAQFISSDCKLQTLSIPVHESLPKALSV  270



>ref|XP_006426489.1| hypothetical protein CICLE_v10026096mg [Citrus clementina]
 gb|ESR39729.1| hypothetical protein CICLE_v10026096mg [Citrus clementina]
Length=321

 Score =   391 bits (1005),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 184/274 (67%), Positives = 221/274 (81%), Gaps = 4/274 (1%)
 Frame = -1

Query  1102  MAAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKT  923
             + +G VV+FDFDKTIID DSDN+VVDELG T LF+QLL TMPWNSLMDRMMKE+H+ GKT
Sbjct  46    IMSGIVVIFDFDKTIIDCDSDNFVVDELGATDLFNQLLPTMPWNSLMDRMMKELHSQGKT  105

Query  922   IGDIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINT  743
             I DI  VL+ +PIHPR+VPAIK+ H LGC+LRIVSDANLFFIETIL+HLGIR+CFSEINT
Sbjct  106   IEDILEVLKRIPIHPRVVPAIKSAHALGCELRIVSDANLFFIETILEHLGIRDCFSEINT  165

Query  742   NPGYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDG  563
             NPG+VDEEGRLRI PFHDF    HGC  CPPNMCK  +IERIQAS+ KEG K++IYLGDG
Sbjct  166   NPGFVDEEGRLRIFPFHDFTKCSHGCNLCPPNMCKGVVIERIQASLSKEGNKKIIYLGDG  225

Query  562   IGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRIC  383
              GD+CPSLKL  GD +MPRK+FP+W+LI  N  L++AEIHEW++GE+ E+IL HL+N I 
Sbjct  226   SGDYCPSLKLSEGDHVMPRKNFPLWDLIIRNPMLIKAEIHEWTDGEELEQILLHLVNTIG  285

Query  382   IED----SQFLAAESKFQAISMQPCEALPKAIRV  293
               +    +Q L+A+ K Q IS    E LP+ + V
Sbjct  286   STNNNNSAQLLSADCKLQTISAAAHETLPQVLSV  319



>ref|XP_007024447.1| Pyridoxal phosphate phosphatase-related protein [Theobroma cacao]
 gb|EOY27069.1| Pyridoxal phosphate phosphatase-related protein [Theobroma cacao]
Length=274

 Score =   389 bits (999),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 188/274 (69%), Positives = 221/274 (81%), Gaps = 7/274 (3%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFDKTIID DSDNWVVDELGFT LF+QLL TMPWNSLMDRMMKE+HA GKTI 
Sbjct  2     AGIVVVFDFDKTIIDCDSDNWVVDELGFTDLFNQLLPTMPWNSLMDRMMKELHARGKTID  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI  VL+  P+HPRIVPAIKA + LGC+LRIVSDANLFFIETIL+HLG++E FSEINTNP
Sbjct  62    DIAEVLKRTPLHPRIVPAIKAANALGCELRIVSDANLFFIETILEHLGLKEYFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
             G+VD EGRLRI P+HDF    HGC  CPPNMCK  +IERIQAS+  EGKK++IYLGDG G
Sbjct  122   GFVDGEGRLRIFPYHDFTKCSHGCNLCPPNMCKGMVIERIQASL--EGKKKIIYLGDGSG  179

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             D+CPSLKL   D+MMPRK+FPVW+LI  N  L++AEIHEWS+GE+ ER+L  +IN I +E
Sbjct  180   DYCPSLKLGEADYMMPRKNFPVWDLICRNPMLIKAEIHEWSDGEELERLLLQIINIISVE  239

Query  376   D-----SQFLAAESKFQAISMQPCEALPKAIRVP  290
             +     +Q ++ + K Q IS    EALP+A+ VP
Sbjct  240   ENNGSSAQLISVDCKLQTISASTHEALPQALPVP  273



>ref|XP_007135577.1| hypothetical protein PHAVU_010G141100g [Phaseolus vulgaris]
 gb|ESW07571.1| hypothetical protein PHAVU_010G141100g [Phaseolus vulgaris]
Length=271

 Score =   388 bits (997),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 180/267 (67%), Positives = 225/267 (84%), Gaps = 2/267 (1%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             +G VVVFDFDKTI+DVDSDNWVVDELGFT LF+QLL TMPWN+LMD MMKE+H++GKTI 
Sbjct  2     SGIVVVFDFDKTIVDVDSDNWVVDELGFTDLFNQLLPTMPWNTLMDTMMKELHSHGKTIN  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DIE VL  +P+HPR++PAIKA H LGCDL+I+SDAN FFIETILKHLGIRE FSEINTNP
Sbjct  62    DIEEVLHKIPLHPRVIPAIKAAHALGCDLKILSDANTFFIETILKHLGIREYFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
             GYV+EEGRLRILP+HDF+ + HGC  CPPNMCK  +I+R+Q S+ +E  KR+IYLGDG G
Sbjct  122   GYVNEEGRLRILPYHDFNKASHGCTLCPPNMCKGLVIKRMQDSISEE-DKRLIYLGDGSG  180

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             D+CPSL+LK  DFMMPRK+FPVW+LI  + SL++AEIH WS+GE+ E++L HLI+++ +E
Sbjct  181   DYCPSLRLKEKDFMMPRKNFPVWDLICRDPSLVKAEIHGWSDGEELEQVLLHLISKVSME  240

Query  376   -DSQFLAAESKFQAISMQPCEALPKAI  299
              +S F+ ++ K Q +S+   EALPK +
Sbjct  241   NNSPFITSDCKLQTLSLSGLEALPKVL  267



>ref|XP_011034250.1| PREDICTED: inorganic pyrophosphatase 2-like [Populus euphratica]
Length=277

 Score =   388 bits (996),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 179/275 (65%), Positives = 222/275 (81%), Gaps = 5/275 (2%)
 Frame = -1

Query  1102  MAAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKT  923
             MAA  VVVFDFDKTIIDVDSDNWV+DELGFT  F+QLL TMPWNSLMDRMMKE+H+NG T
Sbjct  1     MAAAIVVVFDFDKTIIDVDSDNWVIDELGFTESFNQLLPTMPWNSLMDRMMKELHSNGIT  60

Query  922   IGDIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINT  743
             + DI  VL+ +PIHP+++ AIKA H LGC+LRIVSDAN+FFIETILKHLG+++ FSEINT
Sbjct  61    VKDIAEVLKRIPIHPQVISAIKAAHALGCELRIVSDANMFFIETILKHLGLKDYFSEINT  120

Query  742   NPGYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDG  563
             NPG+VDEEGRLRI P HDF  S HGC+ CPPNMCK  +IERIQASM KEG K++IYLGDG
Sbjct  121   NPGFVDEEGRLRISPHHDFTQSSHGCSLCPPNMCKGLVIERIQASMSKEGSKKIIYLGDG  180

Query  562   IGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRIC  383
              GD+CPSLKL   D+MMPRK+FPVW+LI +N  L++AEIHEW +G + ER+L  +I+RI 
Sbjct  181   AGDYCPSLKLTEVDYMMPRKNFPVWDLISKNPLLIKAEIHEWKDGAEMERVLLQIIDRIS  240

Query  382   IED-----SQFLAAESKFQAISMQPCEALPKAIRV  293
              E+     ++  +A+ K Q +S+   + +P+A+ V
Sbjct  241   REEINSNSAKLFSADCKLQTMSIAGHDTMPQALSV  275



>ref|XP_006466070.1| PREDICTED: inorganic pyrophosphatase 1-like [Citrus sinensis]
Length=275

 Score =   387 bits (994),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 183/272 (67%), Positives = 219/272 (81%), Gaps = 4/272 (1%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             +G VV+FDFDKTIID DSDN+VVDELG T LF+QLL TMPWNSLMDRMMKE+H+ GKTI 
Sbjct  2     SGIVVIFDFDKTIIDCDSDNFVVDELGATDLFNQLLPTMPWNSLMDRMMKELHSQGKTIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI  VL+ +PIHPR+VPAIK+ H LGC+LRIVSDANLFFIETIL+HLGIR+CFSEINTNP
Sbjct  62    DIVEVLKRIPIHPRVVPAIKSAHALGCELRIVSDANLFFIETILEHLGIRDCFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
             G+VDEEGRLRI PFHDF    HGC  CPPNMCK  +IERIQAS+ KEG K++IYLGDG G
Sbjct  122   GFVDEEGRLRIFPFHDFTKCSHGCNLCPPNMCKGVVIERIQASLSKEGNKKIIYLGDGSG  181

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             D+CPSLKL  GD +MPRK+FP+W+LI  N  L++AEI EW++GE+ E+IL HL+N I   
Sbjct  182   DYCPSLKLSEGDHVMPRKNFPLWDLIIRNPMLIKAEIREWTDGEELEQILLHLVNTIGST  241

Query  376   D----SQFLAAESKFQAISMQPCEALPKAIRV  293
             +    +Q L+A+ K Q IS    E LP+ + V
Sbjct  242   NNNNSAQLLSADCKLQTISAAAHETLPQVLSV  273



>ref|XP_009371231.1| PREDICTED: inorganic pyrophosphatase 1-like [Pyrus x bretschneideri]
Length=269

 Score =   386 bits (992),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 188/269 (70%), Positives = 223/269 (83%), Gaps = 4/269 (1%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFDKTII+ DSDNWVVDEL  T LF+QLL TMPWNSLMDRMMKE+ + GKTI 
Sbjct  2     AGIVVVFDFDKTIIECDSDNWVVDELCATDLFNQLLPTMPWNSLMDRMMKELRSQGKTIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             D   VL+  PIHPR+VPAIKA H LGCDLRI+SDANLFFIETILKHLG+ E FSEINTNP
Sbjct  62    DTVEVLKRTPIHPRVVPAIKAAHALGCDLRILSDANLFFIETILKHLGLEEYFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
              YVDEEG LRI P+ DF +SPHGC+ CPPNMCKS IIERIQ S+  EGKKR+IYLGDG G
Sbjct  122   SYVDEEGSLRISPYCDFTNSPHGCSLCPPNMCKSVIIERIQTSVSTEGKKRLIYLGDGSG  181

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICI-  380
             D+CPSLKLK GDF+MPRK+FP+++LI +N  L++A IHEW++GE+ E+IL +LIN I I 
Sbjct  182   DYCPSLKLKEGDFVMPRKNFPLFDLIYKNPLLIKAGIHEWTDGEELEQILLNLINSISIE  241

Query  379   EDSQFLAAESKFQAISMQPCEALPKAIRV  293
             E++QF++A+ K Q IS+   EALP+A+ V
Sbjct  242   ENAQFISADCKLQTISV---EALPQALPV  267



>ref|XP_007135578.1| hypothetical protein PHAVU_010G141200g [Phaseolus vulgaris]
 gb|ESW07572.1| hypothetical protein PHAVU_010G141200g [Phaseolus vulgaris]
Length=343

 Score =   389 bits (999),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 179/269 (67%), Positives = 227/269 (84%), Gaps = 2/269 (1%)
 Frame = -1

Query  1102  MAAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKT  923
             + +G VVVFDFDKTI+DVDSDNWVVDELGFT LF+QLL TMPWN+LMD MMKE+H++GK+
Sbjct  72    IMSGIVVVFDFDKTIVDVDSDNWVVDELGFTDLFNQLLPTMPWNTLMDTMMKELHSHGKS  131

Query  922   IGDIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINT  743
             I DIE VL  +P+HPR++PAIKA H LGCDLRIVSDAN +FIETILKHLGIRE FSE+NT
Sbjct  132   IKDIEEVLHKIPLHPRVIPAIKAAHALGCDLRIVSDANTYFIETILKHLGIREYFSEMNT  191

Query  742   NPGYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDG  563
             NPGYV+EEGRLRILP+HDF+ + HGC  CPPNMCK  +I+RIQ S+ +E  KR+IYLGDG
Sbjct  192   NPGYVNEEGRLRILPYHDFNKASHGCTLCPPNMCKGLVIKRIQDSISEED-KRLIYLGDG  250

Query  562   IGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRIC  383
              GD+CPSL+LK  DFMMPRK+FPVW+LI ++ S+++AEIH WS+GE+ E++L  LI+++ 
Sbjct  251   SGDYCPSLRLKEKDFMMPRKNFPVWDLICKDPSVVKAEIHGWSDGEELEQVLLQLISKVS  310

Query  382   IE-DSQFLAAESKFQAISMQPCEALPKAI  299
             +E +S F+ ++ K Q +S+   EALPKA+
Sbjct  311   MEHNSPFITSDCKLQTLSLSVLEALPKAL  339



>ref|XP_007215797.1| hypothetical protein PRUPE_ppa009904mg [Prunus persica]
 gb|EMJ16996.1| hypothetical protein PRUPE_ppa009904mg [Prunus persica]
Length=272

 Score =   385 bits (988),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 184/269 (68%), Positives = 219/269 (81%), Gaps = 1/269 (0%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFDKTII+ DSDNWVVDELG T LF+QLL TMPWNSLMDRMM+E+H+ GKTI 
Sbjct  2     AGIVVVFDFDKTIIECDSDNWVVDELGATDLFNQLLPTMPWNSLMDRMMEELHSQGKTIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI  VL+  PIHPR+VPAIKA H LGCDLRIVSDANLFFIETIL HLG+ E FSEINTNP
Sbjct  62    DIAEVLKRTPIHPRVVPAIKAAHALGCDLRIVSDANLFFIETILNHLGLEEYFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
              YVDE+GRLRI P HDF    HGC+ CPPNMCK  +IERIQ S+  EGKK++IYLGDG G
Sbjct  122   SYVDEQGRLRISPHHDFTKFSHGCSLCPPNMCKGVVIERIQTSVSTEGKKKIIYLGDGSG  181

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICI-  380
             D+CPSLKLK GDF+MPRK+FP+++LI ++  L++A IHEW++GE+ E+IL  LIN I + 
Sbjct  182   DYCPSLKLKEGDFVMPRKNFPLFDLICKDPLLIKAGIHEWTDGEELEQILLSLINTISME  241

Query  379   EDSQFLAAESKFQAISMQPCEALPKAIRV  293
             E++QF++A+ K Q IS    EA PKA+ V
Sbjct  242   ENAQFISADCKLQTISASAHEAFPKALPV  270



>ref|XP_003531627.1| PREDICTED: inorganic pyrophosphatase 2 [Glycine max]
Length=262

 Score =   384 bits (986),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 179/260 (69%), Positives = 221/260 (85%), Gaps = 3/260 (1%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             +G VVVFDFDKTI+DVDSDNWVVD+LGFT LF+QLL TMPWNSLMDRMM E+H+NGKTI 
Sbjct  2     SGIVVVFDFDKTIVDVDSDNWVVDDLGFTDLFNQLLPTMPWNSLMDRMMMELHSNGKTIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DIE VL  +P+HPR++PAI+A H LGCDLRIVSDAN+FFIETILKHLGIRE FSEINTNP
Sbjct  62    DIEEVLHRIPLHPRVIPAIQAAHALGCDLRIVSDANVFFIETILKHLGIREYFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
             GYV+EEGRLRI P HDF+ + HGC+ CPPNMCK  II+RIQ S+ +EG KR+IYLGDG G
Sbjct  122   GYVNEEGRLRIQPCHDFNKASHGCSLCPPNMCKGLIIDRIQDSISQEGNKRMIYLGDGSG  181

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             D+CPSL+LK  +FMMPRK+FPVW+LI ++  L++AEIH WS+GE+ E++L HLIN+I +E
Sbjct  182   DYCPSLRLKERNFMMPRKNFPVWDLICKDPLLVKAEIHGWSDGEELEQVLLHLINKISME  241

Query  376   DS---QFLAAESKFQAISMQ  326
             ++   Q +A++ K Q +S+ 
Sbjct  242   ENVHEQLIASDCKLQTLSVS  261



>ref|XP_004297609.1| PREDICTED: inorganic pyrophosphatase 1-like [Fragaria vesca subsp. 
vesca]
Length=272

 Score =   384 bits (986),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 190/271 (70%), Positives = 220/271 (81%), Gaps = 5/271 (2%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFDKTIID DSDNWVVD LG T LF+QLL TMPWNSLMD MMKE+H+ GKTI 
Sbjct  2     AGVVVVFDFDKTIIDCDSDNWVVDGLGATDLFNQLLPTMPWNSLMDEMMKELHSQGKTID  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI  VL+  PIHPRIVPAIKA H  GC+LRIVSDANLFFIETILKHLG+ E FSEINTNP
Sbjct  62    DIVEVLKRTPIHPRIVPAIKAAHASGCELRIVSDANLFFIETILKHLGLEEYFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
             GYVDEEGR+RI PF DF +S HGC+ CPPNMCKS IIERIQAS   EG+KR+IYLGDG+G
Sbjct  122   GYVDEEGRVRISPFCDFTNSSHGCSLCPPNMCKSVIIERIQAS--TEGRKRMIYLGDGVG  179

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             D+CPSLKLK GDF+MPRK+FP+++ I +N   L+AEIHEW++GE+ E IL +LIN I IE
Sbjct  180   DYCPSLKLKEGDFVMPRKNFPLFDKICQNPLALKAEIHEWTDGEELEHILLNLINTIAIE  239

Query  376   D---SQFLAAESKFQAISMQPCEALPKAIRV  293
             +   +QF+  + K Q IS+   EA PKA+ V
Sbjct  240   ENTAAQFITTDCKLQTISVSGHEAFPKALPV  270



>ref|XP_007135575.1| hypothetical protein PHAVU_010G140900g [Phaseolus vulgaris]
 gb|ESW07569.1| hypothetical protein PHAVU_010G140900g [Phaseolus vulgaris]
Length=271

 Score =   384 bits (986),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 177/267 (66%), Positives = 225/267 (84%), Gaps = 2/267 (1%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             +G VVVFDFDKTI+DVDSDNWVVDELGFT LF+QLL TMPWN+LMD MMKE+H++GK++ 
Sbjct  2     SGIVVVFDFDKTIVDVDSDNWVVDELGFTDLFNQLLPTMPWNTLMDTMMKELHSHGKSMK  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DIE VL  +P+HPR++PAIKA H LGCDLRI+SDAN +FIETILKHLGIRE FSEINTNP
Sbjct  62    DIEEVLHKIPLHPRVIPAIKAAHALGCDLRILSDANTYFIETILKHLGIREYFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
             GYV+EEGRLRILP+HDF+ + HGC  CPPNMCK  +I+R+Q S+ +E  KR+IYLGDG G
Sbjct  122   GYVNEEGRLRILPYHDFNKASHGCTLCPPNMCKGLVIKRMQDSISEE-DKRLIYLGDGSG  180

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             D+CPSL+LK  DFMMPRK+FPVW+LI ++ S+++AEIH WS+GE+ E++L  LI+++ +E
Sbjct  181   DYCPSLRLKEKDFMMPRKNFPVWDLICKDPSVVKAEIHGWSDGEELEQVLLQLISKVSME  240

Query  376   -DSQFLAAESKFQAISMQPCEALPKAI  299
               S F+ ++ K Q +S+   EALPKA+
Sbjct  241   HKSPFITSDCKLQTLSLSVLEALPKAL  267



>gb|KEH18309.1| 2,3-diketo-5-methylthio-1-phosphopentane phosphatase [Medicago 
truncatula]
Length=273

 Score =   383 bits (984),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 182/271 (67%), Positives = 223/271 (82%), Gaps = 1/271 (0%)
 Frame = -1

Query  1102  MAAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKT  923
             M+   VVVFDFDKTIID DSDNWV+DELGFT LF+QLL TMPWNSLMDRMM EIH+NGKT
Sbjct  1     MSNNIVVVFDFDKTIIDCDSDNWVIDELGFTDLFNQLLPTMPWNSLMDRMMMEIHSNGKT  60

Query  922   IGDIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINT  743
             I +IE+VLQ +PIH RI+PAIK+ H LGCDLRIVSDAN FFIETILK+LGI E F+EINT
Sbjct  61    IEEIEKVLQRIPIHHRIIPAIKSAHALGCDLRIVSDANTFFIETILKNLGISEYFTEINT  120

Query  742   NPGYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDG  563
             NPGYV+++GRLRILP+HDF+   HGC  CPPNMCK  II+RIQ +  +   KR IYLGDG
Sbjct  121   NPGYVNQQGRLRILPYHDFNKDSHGCILCPPNMCKGLIIDRIQNTFSEGENKRFIYLGDG  180

Query  562   IGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRIC  383
             IGD+CPSL+L+  DFMMPRK+FPVW+LI ++ SL++AEIH W +GE+ E+IL  LIN+I 
Sbjct  181   IGDYCPSLRLREKDFMMPRKNFPVWDLICKDPSLVKAEIHGWCDGEELEQILIQLINKII  240

Query  382   I-EDSQFLAAESKFQAISMQPCEALPKAIRV  293
             I E++QF++++ K Q +S+   E LPKA+ V
Sbjct  241   IEENAQFISSDCKLQTLSIPVHETLPKALSV  271



>ref|XP_008228322.1| PREDICTED: inorganic pyrophosphatase 1-like [Prunus mume]
Length=273

 Score =   383 bits (984),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 186/270 (69%), Positives = 219/270 (81%), Gaps = 2/270 (1%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFDKTII+ DSDNWVVDELG T LF+QLL TMPWNSLMDRMMKE+H+ GKTI 
Sbjct  2     AGIVVVFDFDKTIIECDSDNWVVDELGATDLFNQLLPTMPWNSLMDRMMKELHSQGKTIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI  VL+  PIHPR+VPAIK  H LGCDLRIVSDANLFFIETILKHLG+ E FSEINTNP
Sbjct  62    DIAEVLKRTPIHPRVVPAIKTAHALGCDLRIVSDANLFFIETILKHLGLEEYFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCAR-CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGI  560
              YVDEEGRLRI P HDF    HGC+  CPPNMCK  +IERIQ S+  EGKK++IYLGDG 
Sbjct  122   SYVDEEGRLRIFPHHDFTKFSHGCSSPCPPNMCKGAVIERIQTSVCTEGKKKIIYLGDGS  181

Query  559   GDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICI  380
             GD+CPSLKLK GDF+MPRK+FP+++LI ++  L++A IHEW++GE+ E+IL  LIN I +
Sbjct  182   GDYCPSLKLKEGDFVMPRKNFPLFDLICKDPLLIKAGIHEWTDGEELEQILLSLINTISM  241

Query  379   -EDSQFLAAESKFQAISMQPCEALPKAIRV  293
              E++QF++A+ K Q IS    EA PKA+ V
Sbjct  242   EENAQFISADCKLQTISASAHEAFPKALPV  271



>ref|XP_007135574.1| hypothetical protein PHAVU_010G140800g [Phaseolus vulgaris]
 gb|ESW07568.1| hypothetical protein PHAVU_010G140800g [Phaseolus vulgaris]
Length=271

 Score =   382 bits (982),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 179/266 (67%), Positives = 225/266 (85%), Gaps = 2/266 (1%)
 Frame = -1

Query  1087  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  908
             VVVFDFDKTI+DVDSDNWV+DELGFT LF+QLL TMPWN+LMD+MM E+H+ GKTI DIE
Sbjct  5     VVVFDFDKTIVDVDSDNWVIDELGFTDLFNQLLPTMPWNTLMDKMMMELHSQGKTIKDIE  64

Query  907   RVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYV  728
              VL  +P+HPR++PA+KA H  GCDLRIVSDANLFFIE+ILKHLGIRE FSEINTNPGYV
Sbjct  65    EVLHKIPLHPRVIPAVKAAHASGCDLRIVSDANLFFIESILKHLGIREYFSEINTNPGYV  124

Query  727   DEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFC  548
             +EEGRLRILP HDF+ SPHGC+ CPPNMCK  +I+R+Q S+ +E  KR+IYLGDG GD+C
Sbjct  125   NEEGRLRILPCHDFNRSPHGCSLCPPNMCKGLVIKRMQDSISEE-DKRLIYLGDGSGDYC  183

Query  547   PSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE-DS  371
             PSL+LK  DFMMPRK+FPVW+LI  + S ++AEIH WS+GE+ E++L HLI+++ +E +S
Sbjct  184   PSLRLKEKDFMMPRKNFPVWDLICRDPSAVKAEIHGWSDGEELEQVLLHLISKVSMEHNS  243

Query  370   QFLAAESKFQAISMQPCEALPKAIRV  293
              F++++ K Q +S+   EA+PKA+ V
Sbjct  244   PFISSDCKLQILSVSAHEAIPKALPV  269



>ref|XP_007135576.1| hypothetical protein PHAVU_010G141000g [Phaseolus vulgaris]
 gb|ESW07570.1| hypothetical protein PHAVU_010G141000g [Phaseolus vulgaris]
Length=271

 Score =   382 bits (981),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 177/267 (66%), Positives = 223/267 (84%), Gaps = 2/267 (1%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             +G VVVFDFDKTI+DVDSDNWVVDELGFT LF+QLL TMPWN+LMD MMKE+H++GK++ 
Sbjct  2     SGIVVVFDFDKTIVDVDSDNWVVDELGFTDLFNQLLPTMPWNTLMDTMMKELHSHGKSMK  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DIE VL  +P+HPR++PAIK  H LGCDLRIVSDAN +FIETILKHLGIRE FSE+NTNP
Sbjct  62    DIEEVLHKIPLHPRVIPAIKVAHALGCDLRIVSDANTYFIETILKHLGIREYFSEMNTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
             GYV+EEGRLRILP+HDF+ + HGC  CPPNMCK  +I+RIQ S+ +E  KR+IYLGDG G
Sbjct  122   GYVNEEGRLRILPYHDFNKASHGCTLCPPNMCKGLVIKRIQDSISEE-DKRMIYLGDGSG  180

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             D+CPSL+LK  DFMMPRK+FPVW+LI ++ S+++AEIH WS+ E+ E++L  LIN+I +E
Sbjct  181   DYCPSLRLKEKDFMMPRKNFPVWDLICKDPSVVKAEIHGWSDAEELEQVLLQLINKISME  240

Query  376   -DSQFLAAESKFQAISMQPCEALPKAI  299
              +S F++++ K Q +S    EALPK +
Sbjct  241   HNSPFVSSDCKLQTLSASVLEALPKGL  267



>ref|XP_006343004.1| PREDICTED: inorganic pyrophosphatase 1-like [Solanum tuberosum]
Length=272

 Score =   382 bits (981),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 189/274 (69%), Positives = 225/274 (82%), Gaps = 8/274 (3%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFDKTIID+DSDNWV+DELG T LF++LL TMPWNSLMDRMMKE+H  GKTI 
Sbjct  2     AGIVVVFDFDKTIIDLDSDNWVIDELGATDLFNRLLPTMPWNSLMDRMMKELHDQGKTID  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DIE+VL+ VP+ PR+VPAIKA H LGCDLRIVSDAN+F+IETILKHLGI +CF+EINTNP
Sbjct  62    DIEQVLKRVPVIPRVVPAIKAAHALGCDLRIVSDANVFYIETILKHLGIHDCFTEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCA--RCPPNMCKSKIIERIQASMGKEG-KKRVIYLGD  566
             GYVDE+G+LRILP+HD +   HGC+   CPPNMCK  +IERIQAS+ KE  KKR+IYLGD
Sbjct  122   GYVDEQGKLRILPYHDVY---HGCSFNTCPPNMCKGLVIERIQASLAKEDRKKRIIYLGD  178

Query  565   GIGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRI  386
             G GDFCPSLKLK  DF+MPRKDFPVW+LI ENR L+ A IH WS+GE+ ++IL  +I  I
Sbjct  179   GAGDFCPSLKLKEQDFVMPRKDFPVWKLINENRHLIRARIHGWSDGEEQQQILLQIITAI  238

Query  385   CIEDSQFLAAE-SKFQAISMQPC-EALPKAIRVP  290
              IE++Q L+ +  KFQ I +    EALPKA+ +P
Sbjct  239   TIEENQILSTDCCKFQTIPINTVHEALPKALPLP  272



>ref|XP_010062595.1| PREDICTED: inorganic pyrophosphatase 2-like [Eucalyptus grandis]
 gb|KCW69736.1| hypothetical protein EUGRSUZ_F03119 [Eucalyptus grandis]
 gb|KCW69737.1| hypothetical protein EUGRSUZ_F03119 [Eucalyptus grandis]
Length=276

 Score =   382 bits (981),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 184/274 (67%), Positives = 219/274 (80%), Gaps = 5/274 (2%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             A  VV+FDFDKTIID DSDNWVVDELGFT +F++LL TMPWN+LMD+MM E+HA G TI 
Sbjct  2     ADIVVLFDFDKTIIDCDSDNWVVDELGFTDMFNELLPTMPWNTLMDKMMGELHARGITIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
              I  VL+  PIHPRIVPAIK++H LGCDLR+VSDANLF+IETIL HLGIRECFSEINTNP
Sbjct  62    QIADVLKRAPIHPRIVPAIKSIHALGCDLRVVSDANLFYIETILNHLGIRECFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEG-KKRVIYLGDGI  560
             G+VDE+GRLRI PFHDF SS HGC  CPPNMCK  +IERIQA++  EG KKR IYLGDG 
Sbjct  122   GFVDEQGRLRISPFHDFKSSSHGCGLCPPNMCKGVVIERIQAAVSAEGKKKRFIYLGDGN  181

Query  559   GDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRIC-  383
             GD+CPSLKL  GDFMMPRK++PVW+LI  N  LL+AEIHEW++GE+ ER+L  L+N I  
Sbjct  182   GDYCPSLKLSEGDFMMPRKNYPVWDLICRNPMLLKAEIHEWTDGEELERVLLQLVNAIIT  241

Query  382   ---IEDSQFLAAESKFQAISMQPCEALPKAIRVP  290
                I+  Q ++++ K Q I++   EAL  A+ VP
Sbjct  242   GEEIKSGQLISSDCKMQNIALSAHEALLPALPVP  275



>gb|ADG23055.1| haloacid dehalogenase [Phaseolus vulgaris]
Length=271

 Score =   382 bits (980),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 179/266 (67%), Positives = 224/266 (84%), Gaps = 2/266 (1%)
 Frame = -1

Query  1087  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  908
             VVVFDFDKTI+DVDSDNWV+DELGFT LF+QLL TMPWN+LMD+MM E+H+ GKTI DIE
Sbjct  5     VVVFDFDKTIVDVDSDNWVIDELGFTDLFNQLLPTMPWNTLMDKMMMELHSQGKTIKDIE  64

Query  907   RVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYV  728
              VL  +P+HPR++PA+KA H  GCDLRIVSDANLFFIE+ILKHLGIRE FSEINTNPGYV
Sbjct  65    EVLHKIPLHPRVIPAVKAAHASGCDLRIVSDANLFFIESILKHLGIREYFSEINTNPGYV  124

Query  727   DEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFC  548
             +EEGRLRILP HDF+ SPHGC+ CPPNMCK  +I+R+Q S+ +E  KR+IYLGDG GD+C
Sbjct  125   NEEGRLRILPCHDFNRSPHGCSLCPPNMCKGLVIKRMQDSISEE-DKRLIYLGDGSGDYC  183

Query  547   PSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE-DS  371
             PSL+LK  DFMMPRK+FPVW LI  + S ++AEIH WS+GE+ E++L HLI+++ +E +S
Sbjct  184   PSLRLKEKDFMMPRKNFPVWALICRDPSAVKAEIHGWSDGEELEQVLVHLISKVSMEHNS  243

Query  370   QFLAAESKFQAISMQPCEALPKAIRV  293
              F++++ K Q +S+   EA+PKA+ V
Sbjct  244   PFISSDCKLQILSVSAHEAIPKALPV  269



>gb|KHN11302.1| Inorganic pyrophosphatase 2 [Glycine soja]
Length=262

 Score =   381 bits (979),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 177/260 (68%), Positives = 220/260 (85%), Gaps = 3/260 (1%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             +G VVVFDFDKTI+DVDSDNWVVD+LGFT LF+QLL TMPWNSLMDRMM E+H+NGKTI 
Sbjct  2     SGIVVVFDFDKTIVDVDSDNWVVDDLGFTDLFNQLLPTMPWNSLMDRMMMELHSNGKTIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DIE VL  +P+HPR++PAI+A H LGCDLRIVSDAN+FFIETILKHLGIRE FSEINTNP
Sbjct  62    DIEEVLHRIPLHPRVIPAIQAAHALGCDLRIVSDANVFFIETILKHLGIREYFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
             GYV+EEGRLRI P HDF+ + HGC+ CPPNMCK  II+RIQ S+ +E  +R+IYLGDG G
Sbjct  122   GYVNEEGRLRIQPCHDFNKASHGCSLCPPNMCKGLIIDRIQDSISQESNRRMIYLGDGSG  181

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             D+CPSL+LK  +FMMPRK+FPVW+LI ++  L++AEIH WS+GE+ E++L HLIN+I +E
Sbjct  182   DYCPSLRLKERNFMMPRKNFPVWDLICKDPLLVKAEIHGWSDGEELEQVLLHLINKISME  241

Query  376   DS---QFLAAESKFQAISMQ  326
             ++   Q +A++ K Q +S+ 
Sbjct  242   ENVHEQLIASDCKLQTLSVS  261



>ref|XP_006343002.1| PREDICTED: inorganic pyrophosphatase 1-like [Solanum tuberosum]
Length=275

 Score =   381 bits (979),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 189/274 (69%), Positives = 225/274 (82%), Gaps = 8/274 (3%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFDKTII +DSDNWV+DELG T LF++LL TMPWNSLMDRMMKE+H   KTI 
Sbjct  2     AGIVVVFDFDKTIIGLDSDNWVIDELGATDLFNRLLPTMPWNSLMDRMMKELHDQRKTID  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DIE+VL+ VP+ PR+VPAIKA H  GCDLRIVSDAN+F+IETILKHLGI +CF+EINTNP
Sbjct  62    DIEQVLKRVPVIPRVVPAIKAAHASGCDLRIVSDANVFYIETILKHLGIHDCFTEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCA--RCPPNMCKSKIIERIQASMGKEG-KKRVIYLGD  566
             GYVDE+G+LRILP+HD H   HGC+   CPPNMCK  +IERIQAS+ KE  KKR+IYLGD
Sbjct  122   GYVDEQGKLRILPYHDVH---HGCSFNTCPPNMCKGLVIERIQASLAKEDRKKRIIYLGD  178

Query  565   GIGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRI  386
             G GDFCPSLKLK  DF+MPRKDFPVW+LI +NR+L+ AEIH WS+GE+ + IL  +I  I
Sbjct  179   GAGDFCPSLKLKEQDFVMPRKDFPVWKLINDNRNLIRAEIHGWSDGEEQQHILLQIIKAI  238

Query  385   CIEDSQFLAAESKFQ-AISMQPC-EALPKAIRVP  290
              IE++QFL+ ESKFQ  I +    EA+PKA+ +P
Sbjct  239   TIEENQFLSDESKFQTTIPINAVHEAMPKALPLP  272



>ref|XP_006385338.1| hypothetical protein POPTR_0003s02940g [Populus trichocarpa]
 gb|ERP63135.1| hypothetical protein POPTR_0003s02940g [Populus trichocarpa]
Length=283

 Score =   381 bits (979),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 176/267 (66%), Positives = 216/267 (81%), Gaps = 5/267 (2%)
 Frame = -1

Query  1078  FDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIERVL  899
             FDFDKTIIDVDSDNWV+DELGFT LF+QLLHTMPWNSLMDRMMKEIH++GKTI DI  VL
Sbjct  15    FDFDKTIIDVDSDNWVIDELGFTDLFNQLLHTMPWNSLMDRMMKEIHSHGKTIEDIAEVL  74

Query  898   QGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEE  719
             + +PIHP+++ AIKA H LGC+LRIVSDAN+FFIETIL HLG+++ FSEINTNPG+VDE+
Sbjct  75    RRIPIHPQVISAIKAAHALGCELRIVSDANMFFIETILNHLGLKDYFSEINTNPGFVDEQ  134

Query  718   GRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSL  539
              RLRI P+HDF  S H C+ CPPNMCK  IIERIQAS+ K+G K++IYLGDG GD+CPSL
Sbjct  135   ERLRISPYHDFTQSSHCCSLCPPNMCKGLIIERIQASISKDGSKKIIYLGDGAGDYCPSL  194

Query  538   KLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIED-----  374
             KL   D++MPRK+FPVW+LI EN  L++AEIHEW NG + ER+L  +I RI  ++     
Sbjct  195   KLTEADYVMPRKNFPVWDLISENPLLVKAEIHEWINGAELERVLLQIIERISTDEISSNS  254

Query  373   SQFLAAESKFQAISMQPCEALPKAIRV  293
             +Q L+A+ K Q IS+   E LP+ + V
Sbjct  255   AQLLSADCKLQTISIAAHEGLPQPLSV  281



>ref|XP_006343005.1| PREDICTED: inorganic pyrophosphatase 1-like [Solanum tuberosum]
Length=272

 Score =   380 bits (976),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 190/274 (69%), Positives = 223/274 (81%), Gaps = 8/274 (3%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFDKTIID+DSDNWV+DELG T LF++LL TMPWNSLMDRMMKE+H  GKTI 
Sbjct  2     AGIVVVFDFDKTIIDLDSDNWVIDELGATDLFNRLLPTMPWNSLMDRMMKELHDQGKTID  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DIE+VL+ VP+ PR+VPAIKA H LGCDLRIVSDAN+F+IETILKH+GI +CF+EINTNP
Sbjct  62    DIEQVLKRVPVIPRVVPAIKAAHALGCDLRIVSDANVFYIETILKHIGIYDCFTEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCA--RCPPNMCKSKIIERIQASMGKEG-KKRVIYLGD  566
             GYVDEE +LRILP HD H   HGC    CPPNMCK  IIERIQAS+ KE  KKR+IYLGD
Sbjct  122   GYVDEEKKLRILPHHDLH---HGCTLNTCPPNMCKGLIIERIQASLAKEDRKKRIIYLGD  178

Query  565   GIGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRI  386
             G GDFCPSLKLK  DF+MPRKDFPVW+LI +NR+L+ AEIH WS+GE+ + IL  +I  I
Sbjct  179   GAGDFCPSLKLKEQDFVMPRKDFPVWKLINDNRNLIRAEIHGWSDGEEQQHILLQIIKAI  238

Query  385   CIEDSQFLAAE-SKFQAISMQPC-EALPKAIRVP  290
              IE++Q L+ +  KFQ I +    EALPKA+ +P
Sbjct  239   TIEENQILSVDCCKFQTIPINTVHEALPKALPLP  272



>gb|ABP52095.1| putative phosphatase [Phaseolus vulgaris]
Length=271

 Score =   380 bits (976),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 176/267 (66%), Positives = 224/267 (84%), Gaps = 2/267 (1%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             +G VVVFDFDKTI+DVDSDNWVVDELGFT LF+QLL TMPWN+LMD MMKE+H++GK+I 
Sbjct  2     SGIVVVFDFDKTIVDVDSDNWVVDELGFTDLFNQLLPTMPWNTLMDTMMKELHSHGKSIK  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DIE VL  +P+HPR++PAIKA H LGCDLRIVSDAN +FIETILKHLGI+E FSE+NTNP
Sbjct  62    DIEEVLHKIPLHPRVIPAIKAAHALGCDLRIVSDANTYFIETILKHLGIKEYFSEMNTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
             GYV+EEGRLRILP+HDF+ + HGC  CPPNMCK  +I+RIQ S+ +E  KR+IYLGDG G
Sbjct  122   GYVNEEGRLRILPYHDFNKASHGCTLCPPNMCKGLVIKRIQDSISEE-DKRLIYLGDGSG  180

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             D+CPSL+L   DFMMPRK+FPVW+LI ++ S+++AE H WS+GE+ E++L  LI+++ +E
Sbjct  181   DYCPSLRLIEKDFMMPRKNFPVWDLICKDPSVVKAENHGWSDGEELEQVLLQLISKVSME  240

Query  376   -DSQFLAAESKFQAISMQPCEALPKAI  299
              +S F+ ++ K Q +S+   EALPKA+
Sbjct  241   HNSPFITSDCKLQTLSLSVLEALPKAL  267



>ref|XP_008462365.1| PREDICTED: inorganic pyrophosphatase 2-like [Cucumis melo]
Length=353

 Score =   382 bits (982),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 188/271 (69%), Positives = 216/271 (80%), Gaps = 6/271 (2%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFDKTIID+DSDNWVVDELG T LF++LL TMPWNSLMDRMM E+HA GKTI 
Sbjct  82    AGIVVVFDFDKTIIDLDSDNWVVDELGATDLFNELLPTMPWNSLMDRMMAELHAQGKTID  141

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI  VL+  PIHP +VPAI+A H LGCDLRIVSDAN+FFIETIL HLGIRECFSEINTNP
Sbjct  142   DIVEVLKRAPIHPDVVPAIRAAHALGCDLRIVSDANMFFIETILDHLGIRECFSEINTNP  201

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEG-KKRVIYLGDGI  560
             GYVDEEGRLRI P HDFH S HGC  CPPNMCK  ++ERIQAS+  EG KKR IYLGDG 
Sbjct  202   GYVDEEGRLRIFPIHDFHKSSHGCNLCPPNMCKGLVMERIQASLMAEGKKKRFIYLGDGS  261

Query  559   GDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICI  380
             GD+CPSLKL  GDF+MPRK+FP+W+LI +N  +++AEIHEWS+GE+  RIL +LI  I +
Sbjct  262   GDYCPSLKLGEGDFLMPRKNFPLWDLISQNPLVIKAEIHEWSDGEELARILLNLIKTISM  321

Query  379   -EDSQFLAAESKFQAISMQPCEALPKAIRVP  290
              E++QFLA     Q + +   EALP     P
Sbjct  322   AENAQFLAP----QDMGVPVYEALPSPTPKP  348



>ref|XP_002527425.1| Phosphoethanolamine/phosphocholine phosphatase, putative [Ricinus 
communis]
 gb|EEF34991.1| Phosphoethanolamine/phosphocholine phosphatase, putative [Ricinus 
communis]
Length=274

 Score =   379 bits (974),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 177/275 (64%), Positives = 223/275 (81%), Gaps = 9/275 (3%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG +VVFDFDKTI+DVDSDNWV+DELGFT LF++LL TMPWNSLMDRMMKE+H+ GKTI 
Sbjct  2     AGILVVFDFDKTIVDVDSDNWVIDELGFTDLFNELLPTMPWNSLMDRMMKELHSQGKTIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             D+  VL+ +PIHPR++PAIK+ H LGC+LRIVSDANLFFIE ILKHLG+R+ FSEINTNP
Sbjct  62    DMVEVLKRIPIHPRVIPAIKSAHALGCELRIVSDANLFFIEAILKHLGLRDYFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGK-KRVIYLGDGI  560
             G+VD+EG+LRI P+HDF  S HGC+ CPPNMCK  IIERIQ+S+ KE K K++IYLGDG 
Sbjct  122   GFVDDEGKLRIFPYHDFTQSSHGCSLCPPNMCKGHIIERIQSSISKEDKSKKIIYLGDGA  181

Query  559   GDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICI  380
             GD+CPSLKL   D++MPRK+FPVW+LI  N  +++AEIHEW +GE+ ER+L  +I+ IC+
Sbjct  182   GDYCPSLKLTEADYLMPRKNFPVWDLICSNPMVIKAEIHEWIDGEELERVLIEIIDGICL  241

Query  379   ED-----SQFLAAESKFQAISMQPCEALPKAIRVP  290
             E+      Q  +++ K Q +   P  ALP+A+ VP
Sbjct  242   EEINGSSDQLFSSDCKLQTV---PIAALPQAVPVP  273



>ref|XP_002527424.1| Phosphoethanolamine/phosphocholine phosphatase, putative [Ricinus 
communis]
 gb|EEF34990.1| Phosphoethanolamine/phosphocholine phosphatase, putative [Ricinus 
communis]
Length=274

 Score =   378 bits (970),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 178/275 (65%), Positives = 223/275 (81%), Gaps = 9/275 (3%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG +VVFDFD TIIDVDSDNWV+DELGFT LF+QLL TMPWNSLMDRMMKE+H+ GKTI 
Sbjct  2     AGVLVVFDFDNTIIDVDSDNWVIDELGFTDLFNQLLPTMPWNSLMDRMMKELHSQGKTIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             D+  VL+ +PIHPR+V AIK+ H LGC+LRIVSDAN+FFIETILKHLG+R+ FSEINTNP
Sbjct  62    DMVEVLKRIPIHPRVVHAIKSAHALGCELRIVSDANVFFIETILKHLGLRDYFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGK-KRVIYLGDGI  560
             G+VD+EG+LRI P++DF  S HGC+ C PNMCK  IIERIQASM KE K K++IYLGDG 
Sbjct  122   GFVDDEGKLRIFPYYDFTQSSHGCSLCQPNMCKGHIIERIQASMSKEDKSKKIIYLGDGA  181

Query  559   GDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICI  380
             GD+CPSLKL   D++MPRK+FPVW+LI  N  +++AEIHEW++GE+  R+L  +I+RIC+
Sbjct  182   GDYCPSLKLTEADYLMPRKNFPVWDLICSNPMVIKAEIHEWTDGEELGRVLIEIIDRICL  241

Query  379   ED-----SQFLAAESKFQAISMQPCEALPKAIRVP  290
             E+      Q  +++ K Q +S+    ALP+A+ VP
Sbjct  242   EERNGSSDQLFSSDCKLQTVSIA---ALPQAVPVP  273



>ref|XP_003597629.1| Pyridoxal phosphate phosphatase PHOSPHO2 [Medicago truncatula]
 ref|XP_003636428.1| Pyridoxal phosphate phosphatase PHOSPHO2 [Medicago truncatula]
 gb|AES67880.1| inorganic pyrophosphatase [Medicago truncatula]
Length=271

 Score =   377 bits (968),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 181/269 (67%), Positives = 221/269 (82%), Gaps = 2/269 (1%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             A  VVVFDFDKTI++ DSDNWVVDELGFT LF++L+ TMPWN+LMDRMM E+++NGKTI 
Sbjct  2     ANIVVVFDFDKTIVECDSDNWVVDELGFTDLFNELVPTMPWNNLMDRMMMELNSNGKTIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI +VL+ +PIHPRI+P+IKA + LGCDLRIVSDAN FFIETILKH GIRECFSEINTNP
Sbjct  62    DIVQVLKRIPIHPRIIPSIKAAYTLGCDLRIVSDANTFFIETILKHFGIRECFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
             GYVD EGRLRILP+HD +  PH C  CPPNMCK  II RIQ S+  E  KR IYLGDG G
Sbjct  122   GYVD-EGRLRILPYHDLNKPPHKCNLCPPNMCKGLIINRIQESISCEENKRFIYLGDGSG  180

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             D+CPSL+LK  DF+MPRK+FPVW+LI ++ SL++A+I+EWS+GED ER+L  LIN+I +E
Sbjct  181   DYCPSLRLKEKDFVMPRKNFPVWDLICKDPSLVKAKIYEWSDGEDQERVLHQLINKISME  240

Query  376   DS-QFLAAESKFQAISMQPCEALPKAIRV  293
             ++ +F++ E K Q  S    EA+PKA+RV
Sbjct  241   ETAEFISTEFKLQTPSFSTHEAMPKALRV  269



>ref|XP_004141676.1| PREDICTED: inorganic pyrophosphatase 2-like [Cucumis sativus]
 ref|XP_004155938.1| PREDICTED: inorganic pyrophosphatase 2-like [Cucumis sativus]
 gb|KGN45537.1| hypothetical protein Csa_7G451920 [Cucumis sativus]
Length=273

 Score =   377 bits (967),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 185/271 (68%), Positives = 214/271 (79%), Gaps = 6/271 (2%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFDKTIID+DSDNWVVDELG T LF+QLL TMPWNSLMDRMM E+HA GKTI 
Sbjct  2     AGIVVVFDFDKTIIDLDSDNWVVDELGATDLFNQLLPTMPWNSLMDRMMTELHAQGKTID  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI  VL+  PIHP +VPAI+A H LGCDLRIVSDAN+FFIETIL HLGIRECFSEINTNP
Sbjct  62    DIVEVLKRAPIHPDVVPAIRAAHALGCDLRIVSDANMFFIETILDHLGIRECFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEG-KKRVIYLGDGI  560
             GYVDEEGRLRI P HDF  S HGC  CPPNMCK  ++ERIQAS+  EG KK+ IYLGDG 
Sbjct  122   GYVDEEGRLRIFPIHDFQKSSHGCNLCPPNMCKGLVMERIQASLMSEGKKKKFIYLGDGS  181

Query  559   GDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICI  380
             GD+CPSLKL  GDF+MPRK+FP+W+LI +N  +++AEIHEWS+GE+  RIL +LI  I +
Sbjct  182   GDYCPSLKLGEGDFLMPRKNFPLWDLISQNPLVIKAEIHEWSDGEELARILLNLIKTISM  241

Query  379   -EDSQFLAAESKFQAISMQPCEALPKAIRVP  290
              E++Q L+     Q + +   EALP     P
Sbjct  242   AENAQLLSP----QNMGVPVYEALPSPTPKP  268



>gb|KHG07807.1| hypothetical protein F383_35186 [Gossypium arboreum]
Length=270

 Score =   375 bits (964),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 180/271 (66%), Positives = 215/271 (79%), Gaps = 5/271 (2%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFDKTIID DSDNWVVDELGFT LF+QLL TMPWN+LMD MMKE+HA G TI 
Sbjct  2     AGIVVVFDFDKTIIDRDSDNWVVDELGFTDLFNQLLPTMPWNTLMDTMMKEMHAQGTTID  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI  VL+  PIHPRIVPAIK+ H LGC+LRIVSDAN+FFIETIL+HLG++ECFSE+N+NP
Sbjct  62    DIVEVLKRSPIHPRIVPAIKSAHALGCELRIVSDANMFFIETILEHLGVKECFSELNSNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
              +VDEEGRLRI P+HDF  + HGC  CPPNMCK  IIERIQA +  EGKK++IYLGDG G
Sbjct  122   SFVDEEGRLRIFPYHDFTKTSHGCNLCPPNMCKGVIIERIQACL--EGKKKIIYLGDGSG  179

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             D+CPSL+L   D++MPRK+FPVWELI  N  L++A+IHEWS+GED ER+L  +IN + +E
Sbjct  180   DYCPSLRLGESDYVMPRKNFPVWELICRNPMLIKADIHEWSDGEDLERVLLDIINMVSVE  239

Query  376   --DSQFLAAESKFQAISMQPCEALPKAIRVP  290
                +Q  + + K Q IS     ALP  + VP
Sbjct  240   HNSAQLFSVDCKLQTISTSN-HALPHVLPVP  269



>ref|XP_003638651.1| Pyridoxal phosphate phosphatase PHOSPHO2 [Medicago truncatula]
Length=273

 Score =   374 bits (961),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 175/271 (65%), Positives = 221/271 (82%), Gaps = 1/271 (0%)
 Frame = -1

Query  1102  MAAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKT  923
             M+   V++FDFDKTIID DSDNW++DELGFT LF+QLL TMPWNS+MD+MM E H+NG T
Sbjct  1     MSNNIVIIFDFDKTIIDCDSDNWLIDELGFTDLFNQLLPTMPWNSVMDKMMMEFHSNGVT  60

Query  922   IGDIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINT  743
             I +IE+VLQ +PIH RI+PAIK+ H LGCDLRIVSDAN FFIETILK+LGI E F+EINT
Sbjct  61    IEEIEKVLQRIPIHHRIIPAIKSAHALGCDLRIVSDANTFFIETILKNLGISEYFTEINT  120

Query  742   NPGYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDG  563
             NPGYV+++GRLRILP+HDF+   HGC  CPPNMCK  II+RIQ +  +   KR IYLGDG
Sbjct  121   NPGYVNQQGRLRILPYHDFNKDSHGCILCPPNMCKGLIIDRIQNTFSEGENKRFIYLGDG  180

Query  562   IGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRIC  383
             IGD+CPSL+L+  DFMMPRK+FPVW+LI ++ SL++AEIH W +GE+ E+IL  LIN+I 
Sbjct  181   IGDYCPSLRLREKDFMMPRKNFPVWDLICKDPSLVKAEIHGWCDGEELEQILIQLINKII  240

Query  382   I-EDSQFLAAESKFQAISMQPCEALPKAIRV  293
             I E++QF++++ K Q +S+   E LPKA+ V
Sbjct  241   IEENAQFISSDCKLQTLSIPVHETLPKALSV  271



>ref|XP_004510357.1| PREDICTED: inorganic pyrophosphatase 2-like [Cicer arietinum]
Length=272

 Score =   374 bits (961),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 173/269 (64%), Positives = 221/269 (82%), Gaps = 1/269 (0%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             +  V+VFDFDKTIID DSDNWV+DELGFT LF+QLL TMPWNSLMD+MM E+H+ G TI 
Sbjct  2     SNIVIVFDFDKTIIDCDSDNWVIDELGFTDLFNQLLPTMPWNSLMDKMMMELHSEGVTIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DIE+VL  +PIH RI+PAIK+ H LGCDLRIVSDAN+FFI+TILKHL I + FSEINTNP
Sbjct  62    DIEKVLHRIPIHNRIIPAIKSAHALGCDLRIVSDANMFFIQTILKHLEISQYFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
             GYV++EGRLRILP+HDF+++ HGC  CPPNMCK  I++RIQ+S+     KR IYLGDG G
Sbjct  122   GYVNQEGRLRILPYHDFNNASHGCTLCPPNMCKGIIVDRIQSSISVLENKRFIYLGDGAG  181

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICI-  380
             D+CP+L+LK  DFMMPRK+FPVW+LI ++ SL++AEIH W +GE+ E++L  LIN+I I 
Sbjct  182   DYCPTLRLKERDFMMPRKNFPVWDLICKDPSLIKAEIHGWCDGEELEQVLIQLINKITIE  241

Query  379   EDSQFLAAESKFQAISMQPCEALPKAIRV  293
             E++QF++++ K Q +S+   E+LPK + V
Sbjct  242   ENAQFISSDCKLQNLSISVLESLPKVLPV  270



>gb|EYU21393.1| hypothetical protein MIMGU_mgv1a026205mg [Erythranthe guttata]
Length=273

 Score =   374 bits (961),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 188/273 (69%), Positives = 219/273 (80%), Gaps = 8/273 (3%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG +VVFDFDKTII+VDSDNWVVDELG T LF++LL TMPWNSLM+RMMKE+HA GKTI 
Sbjct  2     AGIMVVFDFDKTIIEVDSDNWVVDELGATDLFNELLPTMPWNSLMERMMKEMHAKGKTIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             +I+ VL+ VPIHPR+VPAIK  H LGCDLRIVSDAN+FFIETIL HLGIR CFSEIN+NP
Sbjct  62    EIKDVLKKVPIHPRVVPAIKTAHSLGCDLRIVSDANMFFIETILDHLGIRNCFSEINSNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
              YV+ EGRL I P+ DF +SPHGC  CPPNMCK  IIERI+A+   EGKK++IYLGDG+G
Sbjct  122   SYVNGEGRLIISPYVDFLTSPHGCNLCPPNMCKGMIIERIRAN---EGKKKMIYLGDGVG  178

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             DFCPSLKLK GDFMMPRKDFP W+LI ENR+LL+AEI EW  G   E+IL  LI +I IE
Sbjct  179   DFCPSLKLKEGDFMMPRKDFPAWKLICENRTLLKAEIFEWIGGTKLEQILIGLIEKIKIE  238

Query  376   DS----QFLAA-ESKFQAISMQPCEALPKAIRV  293
             ++    Q L+A + KF+ I M   EA P  +RV
Sbjct  239   EANNGVQLLSAVDCKFEKIPMVAHEAFPPPLRV  271



>ref|XP_010088372.1| Inorganic pyrophosphatase 1 [Morus notabilis]
 gb|EXB34846.1| Inorganic pyrophosphatase 1 [Morus notabilis]
Length=270

 Score =   373 bits (957),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 181/271 (67%), Positives = 217/271 (80%), Gaps = 7/271 (3%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             A  +VVFDFDKTII+ DSDNWVV+ELG+T LF+QLL TMPWNSLMDRMMKE+H  GKTI 
Sbjct  2     ADIIVVFDFDKTIIECDSDNWVVEELGYTDLFNQLLPTMPWNSLMDRMMKELHELGKTIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI  VL+  PIHPR+VPAI A H LGCDLRIVSDANLFFIETIL+HLG+R+CFSEINTNP
Sbjct  62    DIVEVLKRTPIHPRVVPAITAAHALGCDLRIVSDANLFFIETILEHLGLRDCFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGC-ARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGI  560
             G+VDEEGRLRILPFHDF+   HGC   CPPNMCK  I+ERIQAS+  EG KR+IYLGDG+
Sbjct  122   GFVDEEGRLRILPFHDFNKGSHGCPGLCPPNMCKGVILERIQASLA-EGNKRLIYLGDGV  180

Query  559   GDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICI  380
             GD+CPSL+LK  DF+MPRK+FPVW+LI +N  L++A+IHEW++GE+ E+IL  LI  I  
Sbjct  181   GDYCPSLRLKEADFVMPRKNFPVWDLISKNPLLIKAKIHEWTDGEELEKILLSLIETISF  240

Query  379   ED--SQFLAAESKFQAISMQPCEALPKAIRV  293
             E   + F++ + +   I   P  ALPK + V
Sbjct  241   EKNAAAFISTDYRLPTI---PVSALPKVLPV  268



>ref|XP_007216440.1| hypothetical protein PRUPE_ppa021956mg [Prunus persica]
 gb|EMJ17639.1| hypothetical protein PRUPE_ppa021956mg [Prunus persica]
Length=271

 Score =   373 bits (957),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 181/270 (67%), Positives = 219/270 (81%), Gaps = 4/270 (1%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFDKTII+ DSDNWVVDELG T LF+QLL TMPWNSLMDRMMKE+H+ GKTI 
Sbjct  2     AGIVVVFDFDKTIIECDSDNWVVDELGATDLFNQLLPTMPWNSLMDRMMKELHSQGKTIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI  VL+  PIHPR+VPAIKA H LGCDL+IVSDANLFFIETILKHLG+ E FSEINTNP
Sbjct  62    DIVEVLKRTPIHPRVVPAIKAAHALGCDLKIVSDANLFFIETILKHLGLEEYFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
              YVDE+GR+RI P HDF    HGC+ CPPNMCK  +IER+Q S+  EGKK++IYLGDG G
Sbjct  122   SYVDEQGRVRISPHHDFIKCSHGCSLCPPNMCKGVVIERVQTSLSSEGKKKIIYLGDGSG  181

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICI-  380
             D+CPSLKLK  DF+MPRK+FP+++LI ++  L++A+IHEW++GE+ E IL +LIN I   
Sbjct  182   DYCPSLKLKEVDFVMPRKNFPLFDLICKDPLLIKADIHEWTDGEELEHILLNLINTIATE  241

Query  379   EDSQFL-AAESKFQAISMQPCEALPKAIRV  293
             E++QF+ AA+   Q +S    EALP+A+ V
Sbjct  242   ENAQFISAADCNLQTMSAH--EALPQALPV  269



>gb|KHN32679.1| Inorganic pyrophosphatase 2 [Glycine soja]
Length=268

 Score =   372 bits (956),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 177/255 (69%), Positives = 214/255 (84%), Gaps = 1/255 (0%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFDKTI+D DSDNWVVDELGF  LF++LL TMPWN+LMD+MM E+H++GKTI 
Sbjct  2     AGIVVVFDFDKTIVDCDSDNWVVDELGFNELFNRLLPTMPWNTLMDKMMMELHSHGKTIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI +VLQ +PIHPRI+ AIKA H LGCDLRIVSDAN FFIETILKHL I+ECFSEINTNP
Sbjct  62    DIVQVLQRIPIHPRIIHAIKAAHALGCDLRIVSDANTFFIETILKHLKIKECFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
             GY++ E RLRILP+HDF++SPHGC  CPPNMCK +IIE+IQ S+    KKRVIYLGDG G
Sbjct  122   GYINGEERLRILPYHDFNNSPHGCTLCPPNMCKGEIIEKIQDSISSGEKKRVIYLGDGSG  181

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICI-  380
             D+CPSL+LK  DF+MPRK+FPVWELI ++  L++AEIHEWS+GE+ ERI   LIN+I + 
Sbjct  182   DYCPSLRLKDKDFVMPRKNFPVWELICKDPLLIKAEIHEWSDGEELERISLQLINKISLG  241

Query  379   EDSQFLAAESKFQAI  335
             E +Q ++A+ K + I
Sbjct  242   ESAQNISADCKLETI  256



>gb|AFK36724.1| unknown [Lotus japonicus]
Length=272

 Score =   372 bits (956),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 178/270 (66%), Positives = 222/270 (82%), Gaps = 3/270 (1%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             +G VVVFDFDKTIID+DSDNWVVDELGFT LF+QLL TMPWNSLMD+MM E+H+ G TI 
Sbjct  2     SGIVVVFDFDKTIIDIDSDNWVVDELGFTDLFNQLLPTMPWNSLMDKMMMELHSKGVTIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             +IE VL  +PIHPR++PAIKA H LGCDLRIVSDAN+FFIETIL+HL I+E FSEINTNP
Sbjct  62    EIEEVLHRIPIHPRVIPAIKAAHALGCDLRIVSDANMFFIETILEHLKIKEYFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHG-CARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGI  560
             GYV EEGRLRILP+HDF+ +PHG C  CPPNMCK  II+RIQ S  ++  K++IYLGDG 
Sbjct  122   GYV-EEGRLRILPYHDFNKAPHGCCGLCPPNMCKGLIIDRIQDSFSQDDDKKIIYLGDGA  180

Query  559   GDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICI  380
             GD+CPSL+LK  DFMMPRK+FPVW+LI ++ SLL+AEIH W++GE+ E++L  LI++I +
Sbjct  181   GDYCPSLRLKQRDFMMPRKNFPVWDLICKDPSLLKAEIHGWTDGEELEQVLLQLISQISM  240

Query  379   E-DSQFLAAESKFQAISMQPCEALPKAIRV  293
             E D+ F++++ K Q + +   E LPK + V
Sbjct  241   EKDALFMSSDCKTQTLLISAHEPLPKVLHV  270



>ref|XP_002280889.1| PREDICTED: inorganic pyrophosphatase 2 [Vitis vinifera]
 emb|CBI35974.3| unnamed protein product [Vitis vinifera]
Length=273

 Score =   372 bits (956),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 182/277 (66%), Positives = 219/277 (79%), Gaps = 14/277 (5%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFDKTIIDVDSDNWVVDELG T LF+QLL TMPWNSLMDRMMKE+H+ GKTI 
Sbjct  2     AGIVVVFDFDKTIIDVDSDNWVVDELGATDLFNQLLPTMPWNSLMDRMMKELHSQGKTID  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI  VL+ +PIHPR+VPAIK+ H LGCDL+IVSDANLFFIETILKHLG+ +CFSEINTNP
Sbjct  62    DIAEVLKRIPIHPRVVPAIKSAHALGCDLKIVSDANLFFIETILKHLGVMDCFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
              +VDEEGRLRI P HDF SS HGC+ CPPNMCK  +I+RIQAS+  E   + IYLGDG G
Sbjct  122   SFVDEEGRLRIFPHHDFTSSSHGCSLCPPNMCKGMVIKRIQASISTE---KFIYLGDGSG  178

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRI---  386
             DFCPSLKL  GD++MPRK+FP+W+LI  N +L++AE+HEWS+GE+ E  L HLI +I   
Sbjct  179   DFCPSLKLGDGDYVMPRKNFPLWDLICRNPNLIKAEVHEWSDGEELEHGLLHLIKKISEE  238

Query  385   -----CIEDSQFLAAESKFQAISMQPCEALPKAIRVP  290
                      +Q ++ + KF+ ++ Q   ALP+A+ VP
Sbjct  239   NNANNNSAAAQLISVDCKFETMAAQ---ALPQALPVP  272



>ref|XP_008228320.1| PREDICTED: inorganic pyrophosphatase 2-like isoform X1 [Prunus 
mume]
Length=271

 Score =   372 bits (954),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 181/270 (67%), Positives = 218/270 (81%), Gaps = 4/270 (1%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFDKTII+ DSDNWVVDELG T LF+QLL TMPWNSLMDRMMKE+H+ GKT  
Sbjct  2     AGIVVVFDFDKTIIECDSDNWVVDELGATDLFNQLLPTMPWNSLMDRMMKELHSQGKTAE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI  VL+  PIHPR+VPAIKA H LGCDL+IVSDANLFFIETILKHLG+ E FSEINTNP
Sbjct  62    DIVEVLKRTPIHPRVVPAIKAAHALGCDLKIVSDANLFFIETILKHLGLEEYFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
              YVDE+GRLRI P HDF    HGC+ CPPNMCK  +IER+Q  +  EGKK++IYLGDG G
Sbjct  122   SYVDEQGRLRISPHHDFIKCSHGCSLCPPNMCKGVVIERVQTYLSSEGKKKIIYLGDGSG  181

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICI-  380
             D+CPSLKLK  DF+MPRK+FP+++LI ++  L++A+IHEW++GE+ E IL +LIN I   
Sbjct  182   DYCPSLKLKEVDFVMPRKNFPLFDLICKDPLLIKADIHEWTDGEELEHILLNLINTIATE  241

Query  379   EDSQFL-AAESKFQAISMQPCEALPKAIRV  293
             E++QF+ AA+ K Q +S    EALP+A+ V
Sbjct  242   ENAQFISAADCKLQTMSAH--EALPQALPV  269



>ref|XP_009378232.1| PREDICTED: inorganic pyrophosphatase 1-like [Pyrus x bretschneideri]
Length=267

 Score =   371 bits (953),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 184/269 (68%), Positives = 220/269 (82%), Gaps = 6/269 (2%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFDKTII+ DSDNWVVDEL  T LF+QLL TMPWNSLMDRMMKE+ + GKTI 
Sbjct  2     AGIVVVFDFDKTIIECDSDNWVVDELCATDLFNQLLPTMPWNSLMDRMMKELRSQGKTIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             D   VL+  PIHPR+VPA KA   + CDLRI+SDANLFFIETILKHLG+ E FSEINTNP
Sbjct  62    DTVEVLKRTPIHPRVVPASKA--AVWCDLRILSDANLFFIETILKHLGLEEYFSEINTNP  119

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
              YVDEEG LRI P+ DF +SPHGC+ CPPNMCKS IIERIQ S+  EGKKR+IYLGDG G
Sbjct  120   SYVDEEGSLRISPYCDFTNSPHGCSLCPPNMCKSVIIERIQTSVSTEGKKRLIYLGDGSG  179

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICI-  380
             D+CPSLKLK GDF+MPRK+FP+++LI +N  L++A IHEW++GE+ E+IL +LIN I I 
Sbjct  180   DYCPSLKLKEGDFVMPRKNFPLFDLIYKNPLLIKAGIHEWTDGEELEQILLNLINSISIE  239

Query  379   EDSQFLAAESKFQAISMQPCEALPKAIRV  293
             E++QF++A+ K Q IS+   EALP+A+ V
Sbjct  240   ENAQFISADCKLQTISV---EALPQALPV  265



>ref|XP_010267012.1| PREDICTED: inorganic pyrophosphatase 1-like [Nelumbo nucifera]
Length=270

 Score =   371 bits (953),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 176/270 (65%), Positives = 213/270 (79%), Gaps = 3/270 (1%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VV+FDFDKTIID DSDNWVVDE+G T LFD+LL TMPWN LMDRMM+E+H+ GKTI 
Sbjct  2     AGIVVIFDFDKTIIDYDSDNWVVDEMGATQLFDELLPTMPWNPLMDRMMRELHSRGKTIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI   L+  P+HPRI+ AIK+ H LGC+LRIVSDAN+FFIETILKH G+ + F+EINTNP
Sbjct  62    DIVECLKRAPLHPRIITAIKSAHALGCELRIVSDANIFFIETILKHHGLMDYFTEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
              YVDEEG+LRI P+HD  SSPH  + CPPNMCK  +IERIQ ++  EGKKR IYLGDG G
Sbjct  122   SYVDEEGKLRIFPYHDLTSSPH--SSCPPNMCKGLVIERIQETLAAEGKKRFIYLGDGKG  179

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRIC-I  380
             DFCP+LKL+ GD++MPRK+FP+WELI  N  L++AEIHEWS+GED ER+L  LIN I   
Sbjct  180   DFCPTLKLREGDYVMPRKNFPLWELISSNPLLVKAEIHEWSDGEDLERVLLQLINNILDQ  239

Query  379   EDSQFLAAESKFQAISMQPCEALPKAIRVP  290
             E++Q +  + KF  I +   E LPKA+ VP
Sbjct  240   EEAQMIPVDYKFHTIPISTHEPLPKALPVP  269



>ref|XP_008795471.1| PREDICTED: inorganic pyrophosphatase 2 [Phoenix dactylifera]
Length=275

 Score =   371 bits (952),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 175/273 (64%), Positives = 213/273 (78%), Gaps = 4/273 (1%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG +VVFDFDKTIID DSDNWVVD+LG T LF++LL TMPWNSLMDRMMKE+H+ GKT+ 
Sbjct  2     AGIIVVFDFDKTIIDCDSDNWVVDQLGATELFERLLPTMPWNSLMDRMMKELHSQGKTVE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             +I   L+  P+ P ++ AIK+ +  GC+LR+VSDANLFFIETILKH G+ E FSE+NTNP
Sbjct  62    EIADCLKKAPLDPHVIAAIKSAYAHGCELRVVSDANLFFIETILKHHGLLEYFSEVNTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
              YVDEEGRLRI P+HDF +S HGC+ CPPNMCK KIIERIQA    EGKKR IYLGDG G
Sbjct  122   SYVDEEGRLRIFPYHDFSTSSHGCSLCPPNMCKGKIIERIQAQASVEGKKRFIYLGDGKG  181

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             D+CPSL+L   D++MPRK++P+W+LI +N   L+AEIHEWSNGE+ ERIL  LINR+   
Sbjct  182   DYCPSLRLSEEDYVMPRKEYPLWQLICDNPQQLKAEIHEWSNGEELERILLQLINRLIAV  241

Query  376   D----SQFLAAESKFQAISMQPCEALPKAIRVP  290
             D    +Q  + + KF+ I M P EALP  +RVP
Sbjct  242   DRKNAAQVFSVDCKFETIPMPPNEALPLPLRVP  274



>ref|XP_003595831.1| hypothetical protein MTR_2g062320 [Medicago truncatula]
 gb|ABN08118.1| HAD-superfamily subfamily IB hydrolase, hypothetical 1 [Medicago 
truncatula]
 gb|AES66082.1| 2,3-diketo-5-methylthio-1-phosphopentane phosphatase [Medicago 
truncatula]
Length=272

 Score =   371 bits (952),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 180/269 (67%), Positives = 212/269 (79%), Gaps = 1/269 (0%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             A  VVVFDFDKTII+ DSDNWVVDELGF  LF+QL  TMP N LMDRMM E+H+NGKTI 
Sbjct  2     ASIVVVFDFDKTIIECDSDNWVVDELGFNDLFNQLFPTMPLNYLMDRMMMELHSNGKTIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI +VL+ +PIHPR + AIKA + LGCDLRIVSDAN FFIETILKH GIRECFSEINTNP
Sbjct  62    DIVQVLKMIPIHPRTIHAIKAANALGCDLRIVSDANTFFIETILKHFGIRECFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
             GYVDEEGRLRILPF+D +  PH C  CPPNMCK  II+RIQ S+  E  KR IYLGDG G
Sbjct  122   GYVDEEGRLRILPFYDLNKPPHTCNLCPPNMCKGLIIKRIQDSISSEKNKRFIYLGDGSG  181

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             D+CPSL LK  DF+MPRK+FPVW+LI ++ SL++A+I+EWS+GE+ ER+L  LIN+I +E
Sbjct  182   DYCPSLSLKEKDFVMPRKNFPVWDLICKDPSLVKAKIYEWSDGEEQERVLHQLINKISME  241

Query  376   DS-QFLAAESKFQAISMQPCEALPKAIRV  293
             +S QF++ E      S    E LPKA+ V
Sbjct  242   ESAQFISTEFNMHTPSFSAHETLPKALHV  270



>gb|KHG08585.1| hypothetical protein F383_11849 [Gossypium arboreum]
 gb|KHG23426.1| hypothetical protein F383_00324 [Gossypium arboreum]
Length=273

 Score =   370 bits (951),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 176/274 (64%), Positives = 217/274 (79%), Gaps = 8/274 (3%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VV+FDFDKTIID DSDNWV+DELGFT LF+QLL TMPWN LMD+MMKE+HA GKTI 
Sbjct  2     AGIVVIFDFDKTIIDCDSDNWVLDELGFTDLFNQLLPTMPWNPLMDKMMKELHAQGKTID  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI  VL+  PIHPRIVPAIKA H LGC+LR+VSDAN+FFIETIL+HLG+RE FSEI++NP
Sbjct  62    DIVEVLKRAPIHPRIVPAIKAAHALGCELRVVSDANMFFIETILEHLGLREYFSEIDSNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
              +VDEE +LRI P+HDF  S HGC  CPPNMCK ++IERIQAS+  EGKK++IYLGDG G
Sbjct  122   SFVDEEEKLRIFPYHDFTESSHGCNLCPPNMCKGRVIERIQASL--EGKKKIIYLGDGSG  179

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             D+CP LKL   D+MMPRK++PVW+LI  N  L++AEI+EW++GE+ E++L  LIN I +E
Sbjct  180   DYCPGLKLGEADYMMPRKNYPVWDLICRNPMLIKAEIYEWTDGEELEKVLLQLINMISLE  239

Query  376   D-----SQFLAAESKFQAISMQPCEALPKAIRVP  290
             +     SQ ++ + K Q +S     A P A+ VP
Sbjct  240   EDDANSSQLISVDCKLQTMSASK-NAFPHALPVP  272



>ref|XP_003546657.1| PREDICTED: inorganic pyrophosphatase 2-like [Glycine max]
Length=268

 Score =   370 bits (949),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 176/255 (69%), Positives = 213/255 (84%), Gaps = 1/255 (0%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             A  VVVFDFDKTI+D DSDNWVVDELGF  LF++LL TMPWN+LMD+MM E+H++GKTI 
Sbjct  2     AEIVVVFDFDKTIVDCDSDNWVVDELGFNELFNRLLPTMPWNTLMDKMMMELHSHGKTIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI +VLQ +PIHPRI+ AIKA H LGCDLRIVSDAN FFIETILKHL I+ECFSEINTNP
Sbjct  62    DIVQVLQRIPIHPRIIHAIKAAHALGCDLRIVSDANTFFIETILKHLKIKECFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
             GY++ E RLRILP+HDF++SPHGC  CPPNMCK +IIE+IQ S+    KKRVIYLGDG G
Sbjct  122   GYINGEERLRILPYHDFNNSPHGCTLCPPNMCKGEIIEKIQDSISSGEKKRVIYLGDGSG  181

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICI-  380
             D+CPSL+LK  DF+MPRK+FPVWELI ++  L++AEIHEWS+GE+ ERI   LIN+I + 
Sbjct  182   DYCPSLRLKDKDFVMPRKNFPVWELICKDPLLIKAEIHEWSDGEELERISLQLINKISLG  241

Query  379   EDSQFLAAESKFQAI  335
             E +Q ++A+ K + I
Sbjct  242   ESAQNISADCKLETI  256



>gb|AFK41778.1| unknown [Medicago truncatula]
 gb|KEH18313.1| 2,3-diketo-5-methylthio-1-phosphopentane phosphatase [Medicago 
truncatula]
Length=274

 Score =   370 bits (949),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 173/272 (64%), Positives = 221/272 (81%), Gaps = 2/272 (1%)
 Frame = -1

Query  1102  MAAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKT  923
             M+   V++FDFDKTIID DSDNW++DELGFT LF+QLL TMPWNS+MD+MM E H+NG T
Sbjct  1     MSNNIVIIFDFDKTIIDCDSDNWLIDELGFTDLFNQLLPTMPWNSVMDKMMMEFHSNGVT  60

Query  922   IGDIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINT  743
             I +IE+VLQ +PIH RI+PAIK+ H LGCDLRIVSDAN+F+IETILKHLGI ECFSEIN+
Sbjct  61    IEEIEKVLQRIPIHHRIIPAIKSAHALGCDLRIVSDANMFYIETILKHLGISECFSEINS  120

Query  742   NPGYVDEEGRLRILPFHDFHSSPHGCAR-CPPNMCKSKIIERIQASMGKEGKKRVIYLGD  566
             NPGYV++EGR+RI P+HDF+ + HGC   CPPNMCK  II++I+ ++     KR IYLGD
Sbjct  121   NPGYVNQEGRVRISPYHDFNKASHGCNNVCPPNMCKGLIIDKIKNTIYDGDNKRFIYLGD  180

Query  565   GIGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRI  386
             G GD+CPSL+ K  DF+MPRK+FPVW+LI ++ SL++AEIH W +GE+ E+IL  LIN+I
Sbjct  181   GAGDYCPSLRFKERDFVMPRKNFPVWDLICKDPSLVKAEIHGWCDGEELEQILIQLINKI  240

Query  385   CIEDS-QFLAAESKFQAISMQPCEALPKAIRV  293
              IED+ QF+A + K Q +S+   E+LPKA+ V
Sbjct  241   IIEDNVQFIATDCKLQTLSIHVLESLPKALPV  272



>ref|XP_004510356.1| PREDICTED: inorganic pyrophosphatase 1-like [Cicer arietinum]
Length=272

 Score =   367 bits (943),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 170/269 (63%), Positives = 218/269 (81%), Gaps = 1/269 (0%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             +  V+VFDFDKTIID DSDNWV+DELGFT LF+QLL TMPWNSLMD+MM E+H+ G TIG
Sbjct  2     SNIVIVFDFDKTIIDCDSDNWVIDELGFTDLFNQLLPTMPWNSLMDKMMMELHSEGVTIG  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DIE+VL  +PIH RI+PAIK+ H LGCDLRIVSDAN+FFI+TILKHL I + FSEINTNP
Sbjct  62    DIEKVLHRIPIHNRIIPAIKSAHALGCDLRIVSDANMFFIQTILKHLEISDYFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
             GYV++EGRLRILP+HDF+ +PHGC  CPPNMCK  +I+RI  S+ ++  KR IYLGDG G
Sbjct  122   GYVNQEGRLRILPYHDFNKAPHGCTLCPPNMCKGLVIDRIHNSISEDNNKRFIYLGDGAG  181

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             D+CPSL+L   DFMMPRK+FPVW+L+ ++ SL++AEIH W +G++ E  L  LI +I IE
Sbjct  182   DYCPSLRLTERDFMMPRKNFPVWDLMCKDPSLIKAEIHAWCDGKELEHTLMKLIKKIIIE  241

Query  376   D-SQFLAAESKFQAISMQPCEALPKAIRV  293
             + +QF+++E + Q +S+   E+LPK + +
Sbjct  242   EHAQFISSECRPQNLSIPMLESLPKVLPI  270



>gb|KEH18314.1| 2,3-diketo-5-methylthio-1-phosphopentane phosphatase [Medicago 
truncatula]
Length=274

 Score =   367 bits (943),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 172/272 (63%), Positives = 222/272 (82%), Gaps = 2/272 (1%)
 Frame = -1

Query  1102  MAAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKT  923
             M    V+VFDFDKTIID DSDNW++DELGFT LF+QLL TMPWNS+MD+MM E H+NG T
Sbjct  1     MTNNIVIVFDFDKTIIDCDSDNWLIDELGFTDLFNQLLPTMPWNSVMDKMMMEFHSNGIT  60

Query  922   IGDIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINT  743
             I +IE+VLQ +PIH RI+PAIK+ H LGCDLRIVSDAN+F+IETILKHLGI E F+EINT
Sbjct  61    IEEIEKVLQRIPIHHRIIPAIKSAHALGCDLRIVSDANMFYIETILKHLGISEYFTEINT  120

Query  742   NPGYVDEEGRLRILPFHDFHSSPHGCAR-CPPNMCKSKIIERIQASMGKEGKKRVIYLGD  566
             NPGYV++EGR+RI P+HDF+ + HGC   CPPNMCK  II++IQ S+ +E  KR IYLGD
Sbjct  121   NPGYVNQEGRVRISPYHDFNKASHGCNNVCPPNMCKGLIIDKIQNSIFEEDSKRFIYLGD  180

Query  565   GIGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRI  386
             G GD+CPSL+L+  DF+MPRK+FPVW+LI ++ SL++AEIH WS+GE+ E++L +LIN+I
Sbjct  181   GAGDYCPSLRLRERDFVMPRKNFPVWDLICKDPSLVKAEIHGWSDGEELEQVLMNLINKI  240

Query  385   CIEDS-QFLAAESKFQAISMQPCEALPKAIRV  293
              +E+  QF++++ K Q +S     +LPKA+ V
Sbjct  241   MMEEHVQFISSDCKLQTLSSPVLVSLPKAVSV  272



>ref|XP_006416674.1| hypothetical protein EUTSA_v10008386mg [Eutrema salsugineum]
 gb|ESQ35027.1| hypothetical protein EUTSA_v10008386mg [Eutrema salsugineum]
Length=288

 Score =   368 bits (944),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 183/286 (64%), Positives = 220/286 (77%), Gaps = 16/286 (6%)
 Frame = -1

Query  1102  MAAGT----VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHA  935
             MAA T    VVVFDFDKTIIDVDSDNWVVDELGFT LFDQLL TMPWNSLMD MMKE+H 
Sbjct  1     MAAKTNNNIVVVFDFDKTIIDVDSDNWVVDELGFTALFDQLLPTMPWNSLMDLMMKELHD  60

Query  934   NGKTIGDIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFS  755
             +GKTI +I++VL+ +PIHPR++PAIK+ H LGC+LRIVSDAN FFIETI++HLGI E FS
Sbjct  61    HGKTIEEIKQVLRRIPIHPRVIPAIKSAHALGCELRIVSDANTFFIETIVEHLGISEYFS  120

Query  754   EINTNPGYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKK-RVI  578
             EINTNPG VDE+GRL+I P+HDF  S HGC+RCPPNMCK  IIERIQAS  KEG K R+I
Sbjct  121   EINTNPGLVDEQGRLKISPYHDFTKSSHGCSRCPPNMCKGLIIERIQASFSKEGSKTRMI  180

Query  577   YLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHL  398
             YLGDG GD+CPSLKLKA D+MMPRKDFPVW+LI +N +L++A + +W++GE  E IL  +
Sbjct  181   YLGDGAGDYCPSLKLKAQDYMMPRKDFPVWDLISQNPTLVKAAVRDWTDGEAMESILMGI  240

Query  397   INRICIEDSQFLAAESKFQA---------ISMQPCEALPKAIRVPF  287
             IN +   D +    + K  +         I+ +P   LP A +VP 
Sbjct  241   INDVISSDEEEEEEKDKILSSDHCKISVGIAHEPL--LPLARQVPL  284



>emb|CDX96757.1| BnaA08g23000D [Brassica napus]
Length=278

 Score =   367 bits (942),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 174/268 (65%), Positives = 221/268 (82%), Gaps = 2/268 (1%)
 Frame = -1

Query  1087  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  908
             V+VFDFDKTIIDVDSDNWVVDELGFT LF+QLL TMPWNSLMDRMMKE++ +GKTI +I+
Sbjct  8     VIVFDFDKTIIDVDSDNWVVDELGFTELFEQLLPTMPWNSLMDRMMKELYDHGKTIEEIK  67

Query  907   RVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYV  728
             +VL+ +PIHPR++PAIK+ H LGC+LRIVSDAN FFIETI++HLGI E FSEINTNPG V
Sbjct  68    QVLRRIPIHPRVIPAIKSAHALGCELRIVSDANTFFIETIVEHLGISEYFSEINTNPGLV  127

Query  727   DEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKK-RVIYLGDGIGDF  551
             DE+GRLRI P+HDF  S HGC+RCPPNMCKS IIERIQAS  KEG K ++IYLGDG GD+
Sbjct  128   DEQGRLRISPYHDFTKSSHGCSRCPPNMCKSLIIERIQASFTKEGNKMKMIYLGDGAGDY  187

Query  550   CPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIEDS  371
             CPSL+LKA D+MMPRK+FPVW+LI +N +L++A + +W++GE  ERIL  LIN I +E  
Sbjct  188   CPSLRLKAEDYMMPRKNFPVWDLISQNPALVKATVRDWTDGEAMERILMGLINEI-MEME  246

Query  370   QFLAAESKFQAISMQPCEALPKAIRVPF  287
             + ++++ +  ++ +     LP ++ +P 
Sbjct  247   KMVSSDHRKISVGIVHEPLLPISLPIPL  274



>ref|XP_008779500.1| PREDICTED: LOW QUALITY PROTEIN: inorganic pyrophosphatase 2-like 
[Phoenix dactylifera]
Length=272

 Score =   366 bits (940),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 172/270 (64%), Positives = 213/270 (79%), Gaps = 1/270 (0%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG +VVFDFDKTIID DSDNWVVD+LG T LF++LL TMPWNSLMDRMMKE+H+ GKT+ 
Sbjct  2     AGIIVVFDFDKTIIDCDSDNWVVDQLGATELFERLLPTMPWNSLMDRMMKELHSQGKTVE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             +I   L+  P+ P ++ AIK+ +  GC+LR+VSDANLFFIETILKH G+ E FSE+NTNP
Sbjct  62    EIADCLKKAPLDPHVIAAIKSAYAHGCELRVVSDANLFFIETILKHHGLLEYFSEVNTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
              YVDEEGRLRI P+HDF +S HGC+ CPPNMCK KIIERIQA    EGKKR IYLGDG G
Sbjct  122   SYVDEEGRLRIFPYHDFSTSSHGCSLCPPNMCKGKIIERIQAQASVEGKKRFIYLGDGKG  181

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             D+CPSL+L   D++MPRK++P+W+LI +N   L+AEIHEWSNGE+ ERIL  LI+ +  +
Sbjct  182   DYCPSLRLSEEDYVMPRKEYPLWQLICDNPQQLKAEIHEWSNGEELERILLQLIDXVNRK  241

Query  376   D-SQFLAAESKFQAISMQPCEALPKAIRVP  290
             + +Q  + + KF+ I M P EALP  +RVP
Sbjct  242   NAAQVFSVDCKFKTIPMPPNEALPLPLRVP  271



>ref|XP_010924488.1| PREDICTED: inorganic pyrophosphatase 2-like [Elaeis guineensis]
Length=275

 Score =   366 bits (940),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 174/273 (64%), Positives = 212/273 (78%), Gaps = 4/273 (1%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             A  +VVFDFDKTIID DSDNWVVDELG T LF++LL TMPWNSLMDRMM+E+H+ GKTI 
Sbjct  2     ARIIVVFDFDKTIIDCDSDNWVVDELGATELFERLLPTMPWNSLMDRMMRELHSQGKTIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             +I   L+  P+ P ++ AIK+ +  GC+LR+VSDANLFFIETILKH G+ E FSEINTNP
Sbjct  62    EIADCLKRAPLDPHVIAAIKSAYAHGCELRVVSDANLFFIETILKHHGLLEYFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
              YVDEEGRLRI P+HDF +S HGC+ CPPNMCK KII+RIQA    EGKKR IYLGDG G
Sbjct  122   SYVDEEGRLRIFPYHDFTTSSHGCSLCPPNMCKGKIIKRIQAQASVEGKKRFIYLGDGKG  181

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             D+CPSL+L   D++MPRK++P+W+LI +N   L+AE+HEWSNGE+ ERIL  LI+R    
Sbjct  182   DYCPSLRLSEEDYVMPRKNYPLWQLICDNPQQLKAEVHEWSNGEELERILLQLIDRSIAV  241

Query  376   D----SQFLAAESKFQAISMQPCEALPKAIRVP  290
             D    +Q  + + KF+ I M P EALP A+RVP
Sbjct  242   DRKNAAQVFSVDCKFETIPMSPKEALPLALRVP  274



>ref|XP_008462367.1| PREDICTED: inorganic pyrophosphatase 2-like [Cucumis melo]
Length=274

 Score =   366 bits (939),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 176/268 (66%), Positives = 211/268 (79%), Gaps = 7/268 (3%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG +++FDFDKTIID+DSDNWVVDELG T +F +LL TMPWN+LMDRMM E+HA GKTI 
Sbjct  2     AGILMIFDFDKTIIDLDSDNWVVDELGATDIFKELLPTMPWNTLMDRMMTELHAQGKTID  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI  VL+ VPIHP +VPAI A H LGCDLRIVSDAN FFIETIL HLGIRECFSEI+TNP
Sbjct  62    DIAEVLKRVPIHPDVVPAIGAAHALGCDLRIVSDANTFFIETILDHLGIRECFSEIHTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQAS-MGKEGKKRVIYLGDGI  560
              YV+EEGRLRI P HDFH S HGC  CPPNMCK  ++ERIQAS M +E  K+ IYLGDG 
Sbjct  122   SYVEEEGRLRIFPIHDFHKSSHGCNLCPPNMCKGLVVERIQASLMSEEKNKKFIYLGDGS  181

Query  559   GDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICI  380
             GD+CPSLKL  GDF+MPRK+FP+W+L+ +N  +++AEIHEWS+GE+  RIL  LIN I  
Sbjct  182   GDYCPSLKLGEGDFLMPRKNFPLWDLVSQNPHVVKAEIHEWSDGEELGRILLRLINTIST  241

Query  379   EDS--QFLAAESKFQAISMQPCEALPKA  302
              ++  QFL      Q++++   EALP +
Sbjct  242   AENADQFLPP----QSMAIPVYEALPSS  265



>ref|XP_010918519.1| PREDICTED: inorganic pyrophosphatase 2-like [Elaeis guineensis]
Length=275

 Score =   366 bits (939),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 175/273 (64%), Positives = 209/273 (77%), Gaps = 4/273 (1%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFDKTIID DSDNWVVD+LG T LF+ LL +MPWNSLMDRMMKE+H  GKTI 
Sbjct  2     AGIVVVFDFDKTIIDCDSDNWVVDQLGATELFELLLPSMPWNSLMDRMMKELHLQGKTIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             +I   L+  P+ P ++ AIK+ + LGCDLR+VSDANLFFIET+LKH G+ E FSEINTNP
Sbjct  62    EIADCLKRAPLDPHVITAIKSAYDLGCDLRVVSDANLFFIETVLKHHGLLEYFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
              YVDEEGRLRI P+HDF +S HGC+ CPPNMCKS+I+ERIQA    EGKKR IYLGDG G
Sbjct  122   SYVDEEGRLRIFPYHDFTTSSHGCSLCPPNMCKSEIVERIQAQATAEGKKRFIYLGDGKG  181

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             D+CPSLKL   D +MPRK++P+W+LI +N   L+A +HEWSNGE+ ER L  LIN     
Sbjct  182   DYCPSLKLSEEDCVMPRKNYPLWQLICDNPQQLKAGVHEWSNGEELERTLLQLINMSNAA  241

Query  376   D----SQFLAAESKFQAISMQPCEALPKAIRVP  290
             D    +Q  + + KF+ I M P EALP A+RVP
Sbjct  242   DHNHAAQLFSVDCKFETIPMSPNEALPLALRVP  274



>ref|XP_007024470.1| Inorganic pyrophosphatase 2 [Theobroma cacao]
 gb|EOY27092.1| Inorganic pyrophosphatase 2 [Theobroma cacao]
Length=279

 Score =   365 bits (938),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 180/274 (66%), Positives = 213/274 (78%), Gaps = 8/274 (3%)
 Frame = -1

Query  1087  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  908
             VV+FDFDKTIID DSDNWV+DELG T LF+QLL TMPWN LMDRMMKE+H+ G  I DI+
Sbjct  5     VVIFDFDKTIIDCDSDNWVLDELGATKLFNQLLPTMPWNPLMDRMMKELHSQGTKIEDIK  64

Query  907   RVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYV  728
              VL+  PIHPRI+ AIK+ + LGCDL+IVSDAN FFIETILKH G+RE FSEINTNPG+V
Sbjct  65    AVLKRTPIHPRIIQAIKSAYALGCDLKIVSDANAFFIETILKHHGLREYFSEINTNPGFV  124

Query  727   DEEGRLRILPFHDFHSSPHGCAR-CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDF  551
             DEEGRLRI P HDF  SPHGC   CPPNMCK  +IERIQASM  +GKK +IYLGDG+GDF
Sbjct  125   DEEGRLRIFPHHDFTQSPHGCHHPCPPNMCKGTVIERIQASMSMKGKKTIIYLGDGVGDF  184

Query  550   CPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE--  377
             CPSLKL  GD++MPRK+FPVW+LI ENR L++AEI EWSNGE+FE +L H+INRI I+  
Sbjct  185   CPSLKLGDGDYVMPRKNFPVWDLICENRRLIKAEICEWSNGEEFEHVLLHVINRISIDRN  244

Query  376   ----DSQFLAAESKFQAISMQPCE-ALPKAIRVP  290
                  ++  + + K Q +     E A   A+ VP
Sbjct  245   NSDNTARLYSIDCKLQTLPGAAQEKAFSHALYVP  278



>ref|XP_007150539.1| hypothetical protein PHAVU_005G160900g [Phaseolus vulgaris]
 gb|ESW22533.1| hypothetical protein PHAVU_005G160900g [Phaseolus vulgaris]
Length=259

 Score =   364 bits (934),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 175/257 (68%), Positives = 214/257 (83%), Gaps = 4/257 (2%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFDKTI+D DSDNWVVDELGF  LF++LL TMPWN+LMDRMM E+H++GKTI 
Sbjct  2     AGIVVVFDFDKTIVDCDSDNWVVDELGFNVLFNRLLPTMPWNTLMDRMMMELHSHGKTID  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI +VLQ +PIHPRI+PAIKAVH LGCDLRIVSDAN FFIETILKHL IRECFS+INTNP
Sbjct  62    DIVQVLQRIPIHPRIIPAIKAVHSLGCDLRIVSDANTFFIETILKHLKIRECFSDINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
              Y++E+GRL+ILP+HDF++  HGC  CPP MCK  IIE+IQ S+G+  KKR+IYLGDG G
Sbjct  122   SYINEDGRLQILPYHDFNNFSHGCTLCPP-MCKGGIIEKIQESLGE--KKRLIYLGDGSG  178

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICI-  380
             D+CPSL+LK  DFMMPRK+FPVWELI ++  L++A+IHEW+NGE+ ERI   LIN+IC  
Sbjct  179   DYCPSLRLKEQDFMMPRKNFPVWELICKDPLLVKAQIHEWTNGEELERISLQLINKICSG  238

Query  379   EDSQFLAAESKFQAISM  329
             E  +F+++  K   + +
Sbjct  239   ESDEFISSNCKLHIMCV  255



>ref|XP_002892964.1| phosphoric monoester hydrolase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69223.1| phosphoric monoester hydrolase [Arabidopsis lyrata subsp. lyrata]
Length=284

 Score =   365 bits (936),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 173/273 (63%), Positives = 219/273 (80%), Gaps = 6/273 (2%)
 Frame = -1

Query  1087  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  908
             V+VFDFDKTIIDVDSDNWVVDELGFT LF+QLL TMPWNSLM+RMMKE+H  GKTI +I+
Sbjct  8     VIVFDFDKTIIDVDSDNWVVDELGFTELFNQLLPTMPWNSLMNRMMKELHDQGKTIEEIK  67

Query  907   RVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYV  728
             +VL+ +PIHPR++PAIK+ H LGC+LRIVSDAN  FIETI++HLGIRE FSEINTNPG V
Sbjct  68    QVLRRIPIHPRVIPAIKSAHALGCELRIVSDANTLFIETIIEHLGIREFFSEINTNPGLV  127

Query  727   DEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKK-RVIYLGDGIGDF  551
             DE+GRL + P+HDF  S HGC+RCPPNMCK  IIERIQAS+ KEG+K ++IYLGDG GD+
Sbjct  128   DEQGRLIVSPYHDFTKSSHGCSRCPPNMCKGLIIERIQASLTKEGRKTKMIYLGDGAGDY  187

Query  550   CPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICI---  380
             CPSL LKA D+MMPRK+FPVW+LI +N  L++A + +W++GED ERIL  +IN I     
Sbjct  188   CPSLGLKAEDYMMPRKNFPVWDLISQNPMLVKATVRDWTDGEDMERILMEIINEIMSLEE  247

Query  379   --EDSQFLAAESKFQAISMQPCEALPKAIRVPF  287
               +  + L++E+   ++ +     +P A++VP 
Sbjct  248   EEDQDKMLSSENCKISVGIVHEPMVPLALQVPL  280



>gb|KEH18312.1| 2,3-diketo-5-methylthio-1-phosphopentane phosphatase [Medicago 
truncatula]
Length=267

 Score =   363 bits (933),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 169/259 (65%), Positives = 216/259 (83%), Gaps = 1/259 (0%)
 Frame = -1

Query  1102  MAAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKT  923
             M+   V+VFDFDKTIID DSDNWVVDELGFT LF+QLL TMP+NSLMDRMM E+H+NGK+
Sbjct  1     MSNNIVIVFDFDKTIIDCDSDNWVVDELGFTDLFNQLLPTMPFNSLMDRMMMELHSNGKS  60

Query  922   IGDIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINT  743
             I DIE+VLQ +PI+ RI+ AIK+ + LGCDLRIVSDAN  FI+TILKHLGI ECFSEINT
Sbjct  61    IEDIEKVLQRIPINHRIISAIKSAYALGCDLRIVSDANTIFIDTILKHLGISECFSEINT  120

Query  742   NPGYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDG  563
             NPGYV++EGRL+++P+HDF+ + HGC  CPPNMCK  II+RIQ S+ +  KKR IYLGDG
Sbjct  121   NPGYVNQEGRLKVMPYHDFNKASHGCTLCPPNMCKGLIIDRIQKSISEVEKKRFIYLGDG  180

Query  562   IGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRIC  383
              GD+CPSL+L+  DF+MPRK+FPVW+LI ++ SL++AEIH WS+GE+ E++L +LIN+I 
Sbjct  181   AGDYCPSLRLRERDFVMPRKNFPVWDLICKDPSLVKAEIHGWSDGEELEQVLMNLINKIM  240

Query  382   IEDS-QFLAAESKFQAISM  329
             +E+  QF+A++ K    S+
Sbjct  241   MEEHVQFIASDCKLATNSI  259



>ref|XP_009110395.1| PREDICTED: inorganic pyrophosphatase 2-like [Brassica rapa]
Length=278

 Score =   364 bits (934),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 174/268 (65%), Positives = 220/268 (82%), Gaps = 2/268 (1%)
 Frame = -1

Query  1087  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  908
             V+VFDFDKTIIDVDSDNWVVDELGFT LF+QLL TMPWNSLMDRMMKE++ +GK I +I+
Sbjct  8     VIVFDFDKTIIDVDSDNWVVDELGFTELFEQLLPTMPWNSLMDRMMKELYDHGKIIEEIK  67

Query  907   RVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYV  728
             +VL+ +PIHPR++PAIK+ H LGC+LRIVSDAN FFIETI++HLGI E FSEINTNPG V
Sbjct  68    QVLRRIPIHPRVIPAIKSAHALGCELRIVSDANTFFIETIVEHLGISEYFSEINTNPGLV  127

Query  727   DEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKK-RVIYLGDGIGDF  551
             DE+GRLRI P+HDF  S HGC+RCPPNMCKS IIERIQAS  KEG K ++IYLGDG GD+
Sbjct  128   DEQGRLRISPYHDFTKSSHGCSRCPPNMCKSLIIERIQASFTKEGNKMKMIYLGDGAGDY  187

Query  550   CPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIEDS  371
             CPSL+LKA D+MMPRK+FPVW+LI +N +L++A + +W++GE  ERIL  LIN I +E  
Sbjct  188   CPSLRLKAEDYMMPRKNFPVWDLISQNPALVKATVRDWTDGEAMERILMGLINEI-MEME  246

Query  370   QFLAAESKFQAISMQPCEALPKAIRVPF  287
             + +++++   ++ +     LP ++ VP 
Sbjct  247   KMVSSDNCKISVGIVHEPLLPISLPVPL  274



>ref|XP_010459378.1| PREDICTED: inorganic pyrophosphatase 2 [Camelina sativa]
Length=285

 Score =   364 bits (934),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 169/235 (72%), Positives = 202/235 (86%), Gaps = 1/235 (0%)
 Frame = -1

Query  1087  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  908
             V+VFDFDKTIIDVDSDNWVVDELGFT LF+QLL TMPWNSLMDRMMKE+H +GKTI +I+
Sbjct  9     VIVFDFDKTIIDVDSDNWVVDELGFTDLFNQLLPTMPWNSLMDRMMKELHDHGKTIEEIK  68

Query  907   RVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYV  728
             +VL+ +PIHPR++PAIKA H LGC+LRIVSDAN  FIETI++HLGIRE FSEINTNPG V
Sbjct  69    QVLRRIPIHPRVIPAIKAAHALGCELRIVSDANTLFIETIIEHLGIREFFSEINTNPGVV  128

Query  727   DEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKK-RVIYLGDGIGDF  551
             D++GRL I P+HDF  SPH C RCPPNMCK  IIERIQAS+ KEGKK ++IYLGDG GD+
Sbjct  129   DDQGRLIISPYHDFTKSPHDCTRCPPNMCKGLIIERIQASLTKEGKKMKMIYLGDGAGDY  188

Query  550   CPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRI  386
             CPSL LKA D+MMPRK+FPVW+LI +N  L++A + +W++GED ERIL  +IN +
Sbjct  189   CPSLGLKAEDYMMPRKNFPVWDLISQNPMLVKATVRDWTDGEDMERILMEIINEV  243



>emb|CDX83896.1| BnaC08g17490D [Brassica napus]
Length=278

 Score =   363 bits (932),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 169/235 (72%), Positives = 204/235 (87%), Gaps = 1/235 (0%)
 Frame = -1

Query  1087  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  908
             V+VFDFDKTIIDVDSDNWVVDELGFT LF+QLL TMPWNSLMDRMMKE+H +GKTI +I+
Sbjct  8     VIVFDFDKTIIDVDSDNWVVDELGFTELFEQLLPTMPWNSLMDRMMKELHDHGKTIEEIK  67

Query  907   RVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYV  728
             +VL+ +PIHPR++PAIK+ H LGC+LRIVSDAN FFIETI++HLGI E FSEINTNPG V
Sbjct  68    QVLRRIPIHPRVIPAIKSAHALGCELRIVSDANTFFIETIVEHLGISEYFSEINTNPGLV  127

Query  727   DEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKK-RVIYLGDGIGDF  551
             DE+GRLRI P++DF  S HGC+RCPPNMCKS IIERIQAS  +EGK  ++IYLGDG GD+
Sbjct  128   DEQGRLRISPYNDFTKSSHGCSRCPPNMCKSLIIERIQASFTQEGKNMKMIYLGDGAGDY  187

Query  550   CPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRI  386
             CPSL+LKA D+MMPRK+FPVW+LI +N +L++A + +W++GE  ERIL  LIN I
Sbjct  188   CPSLRLKAEDYMMPRKNFPVWDLISQNPALVKATVRDWTDGEAMERILMGLINEI  242



>emb|CDY59499.1| BnaC05g50000D [Brassica napus]
Length=283

 Score =   362 bits (929),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 172/272 (63%), Positives = 218/272 (80%), Gaps = 5/272 (2%)
 Frame = -1

Query  1087  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  908
             V+VFDFDKTIIDVDSDNWVVD+LGFT LFDQLL TMP+NSLM RMMKE+H +GKTI +I+
Sbjct  8     VIVFDFDKTIIDVDSDNWVVDQLGFTDLFDQLLPTMPFNSLMARMMKELHDHGKTIEEIK  67

Query  907   RVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYV  728
             +VL+ +PIHPR++PAIK+ H LGC+LRIVSDAN  FIET+L+HLGIRE FSEINTNPG V
Sbjct  68    QVLRRIPIHPRVIPAIKSAHALGCELRIVSDANTLFIETVLEHLGIREYFSEINTNPGLV  127

Query  727   DEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKK-RVIYLGDGIGDF  551
             DE+GRL + P+HDF  S HGC+RCPPNMCK  IIERIQAS  KEG K ++IYLGDG GD+
Sbjct  128   DEQGRLIVSPYHDFTKSSHGCSRCPPNMCKGLIIERIQASFTKEGNKMKMIYLGDGAGDY  187

Query  550   CPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIEDS  371
             CPSL+LKA D+MMPRK+FPVW+LI +NR+L++A + +W++GE  ERIL  +IN I   D 
Sbjct  188   CPSLRLKAEDYMMPRKNFPVWDLISQNRTLVKATVRDWTDGEAMERILMGIINEIISSDE  247

Query  370   Q----FLAAESKFQAISMQPCEALPKAIRVPF  287
             +     L+++    ++ +     +P A++VP 
Sbjct  248   EEMEKMLSSDHCKISVGIVHEPLVPLALQVPL  279



>emb|CDX81846.1| BnaC08g37550D [Brassica napus]
Length=287

 Score =   362 bits (929),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 175/275 (64%), Positives = 215/275 (78%), Gaps = 8/275 (3%)
 Frame = -1

Query  1087  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  908
             VVVFDFDKTIIDVDSDNWVVDELGFT LFDQLL TMPWNSLMDRMMKE+H +GKTI +I+
Sbjct  9     VVVFDFDKTIIDVDSDNWVVDELGFTELFDQLLPTMPWNSLMDRMMKELHDHGKTIEEIK  68

Query  907   RVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYV  728
             +VL+ +PIHPR++PAIK+ H LGC+LRIVSDAN FFIETI++HLGIR+ FSEINTNPG V
Sbjct  69    QVLRRIPIHPRVIPAIKSAHALGCELRIVSDANTFFIETIVEHLGIRKYFSEINTNPGLV  128

Query  727   DEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKK-RVIYLGDGIGDF  551
             DE+GRLRI P+HDF+ S HGC RCPP+MCK  IIE IQAS  KEG K ++IYLGDG GD+
Sbjct  129   DEQGRLRISPYHDFNKSSHGCPRCPPHMCKGLIIESIQASFTKEGSKMKMIYLGDGAGDY  188

Query  550   CPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIEDS  371
             CPSL LKA D+MMPRK FPVW+LI +N++L++A I +W++GE  E+IL   +N I + D 
Sbjct  189   CPSLSLKAEDYMMPRKYFPVWDLISQNQTLVKAMIRDWTDGEAMEKILVGTVNEIILSDE  248

Query  370   Q-------FLAAESKFQAISMQPCEALPKAIRVPF  287
             +         A   K   + +     LP +++VP 
Sbjct  249   EEEKEKMLSSADHCKISVVGIVHEPLLPLSLQVPL  283



>ref|XP_010519214.1| PREDICTED: inorganic pyrophosphatase 1-like [Tarenaya hassleriana]
Length=284

 Score =   360 bits (925),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 169/254 (67%), Positives = 205/254 (81%), Gaps = 1/254 (0%)
 Frame = -1

Query  1087  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  908
             V +FDFDKTIIDVDSDNWVVDELGFT LF+QLL TMPWNSLMDRMMKE+H  G TI DI+
Sbjct  12    VAIFDFDKTIIDVDSDNWVVDELGFTDLFNQLLPTMPWNSLMDRMMKELHEQGITIHDIK  71

Query  907   RVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYV  728
             RVL+ +PIHPR+VPA+++ H LGC+LRIVSDAN FFIETIL+HL I++ FSEINTNPG+V
Sbjct  72    RVLETIPIHPRVVPALRSAHALGCELRIVSDANTFFIETILEHLEIKDLFSEINTNPGFV  131

Query  727   DEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFC  548
             D+ GRLRI P+HDF  S HGC+RCPPNMCK+ IIERIQAS+ KEGKK++IYLGDG GD+C
Sbjct  132   DQHGRLRISPYHDFTESSHGCSRCPPNMCKALIIERIQASLTKEGKKKIIYLGDGAGDYC  191

Query  547   PSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICI-EDS  371
             PSLKL   D++MPRK +PVW+LI +N  L+ A I EW++GE  ER L  +I  I   +D 
Sbjct  192   PSLKLGDEDYVMPRKSYPVWDLICQNPMLIRANIREWTDGEALERTLSEIIEEIGYGDDK  251

Query  370   QFLAAESKFQAISM  329
             + +    K Q IS+
Sbjct  252   EKILDSCKMQTISV  265



>ref|XP_009117646.1| PREDICTED: inorganic pyrophosphatase 2-like [Brassica rapa]
Length=286

 Score =   360 bits (925),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 174/274 (64%), Positives = 212/274 (77%), Gaps = 7/274 (3%)
 Frame = -1

Query  1087  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  908
             VVVFDFDKTIIDVDSDNWVVDELGFT LFDQLL TMPWNSLMDRMMKE+H +GKTI +I+
Sbjct  9     VVVFDFDKTIIDVDSDNWVVDELGFTELFDQLLPTMPWNSLMDRMMKELHDHGKTIEEIK  68

Query  907   RVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYV  728
             +VL+ +PIHPR++PAIK+ H LGC+LRIVSDAN FFIETI++HLGIR+ FSEINTNPG V
Sbjct  69    QVLRRIPIHPRVIPAIKSAHALGCELRIVSDANTFFIETIVEHLGIRKYFSEINTNPGLV  128

Query  727   DEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKK-RVIYLGDGIGDF  551
             DE+GRLRI P+HDF+ S HGC RCPPNMCK  IIERIQAS  KEG K ++IYLGDG+GD+
Sbjct  129   DEQGRLRISPYHDFNKSSHGCPRCPPNMCKGLIIERIQASFSKEGNKMKMIYLGDGVGDY  188

Query  550   CPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIED-  374
             CPSL LKA D+MMPRK+FP W+LI +N +L++A + +W +GE  E+IL    N I   D 
Sbjct  189   CPSLGLKAEDYMMPRKNFPAWDLISQNPTLVKATVRDWIDGEAMEKILMGTANEIMSSDE  248

Query  373   -----SQFLAAESKFQAISMQPCEALPKAIRVPF  287
                      +   K   + +     LP +++VP 
Sbjct  249   EEEKEKMLCSDHCKISVVGIVHEPMLPLSLQVPL  282



>ref|XP_002280867.1| PREDICTED: inorganic pyrophosphatase 2 [Vitis vinifera]
 emb|CBI35973.3| unnamed protein product [Vitis vinifera]
Length=273

 Score =   359 bits (922),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 184/277 (66%), Positives = 221/277 (80%), Gaps = 14/277 (5%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFDKTIIDVDSDNWVVDELG T LF+QLL TMPWNSLMDRMM+E+H+ GKTI 
Sbjct  2     AGIVVVFDFDKTIIDVDSDNWVVDELGATDLFNQLLPTMPWNSLMDRMMRELHSQGKTID  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI  VL+ VPIHPR VPAIK+ H LGCDL+IVSDANLFFIETILKHLG+ +CFSEINTNP
Sbjct  62    DIAEVLKRVPIHPRAVPAIKSAHALGCDLKIVSDANLFFIETILKHLGLEDCFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
              +VDEEGRLRI P HDF SS HGC+ CPPNMCKS +I+RIQAS+  E   ++IYLGDG G
Sbjct  122   SFVDEEGRLRIFPHHDFTSSSHGCSLCPPNMCKSMVIKRIQASISTE---KLIYLGDGSG  178

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             DFCPS KL AGD++MPRK+FP+W+LI  N +L++AEIHEWS+GE+ E +L HLI +I  E
Sbjct  179   DFCPSSKLGAGDYVMPRKNFPLWDLICRNPNLIKAEIHEWSDGEELELVLLHLIKKIPEE  238

Query  376   D--------SQFLAAESKFQAISMQPCEALPKAIRVP  290
             +        +Q +  + KF+ ++ Q    LP+A+ VP
Sbjct  239   NNPNNNSAAAQLIPVDCKFETMAAQ---VLPQALPVP  272



>ref|XP_009149226.1| PREDICTED: inorganic pyrophosphatase 2 [Brassica rapa]
Length=281

 Score =   359 bits (922),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 171/270 (63%), Positives = 218/270 (81%), Gaps = 3/270 (1%)
 Frame = -1

Query  1087  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  908
             V+VF FDKTIIDVDSDNWVVDELGFT LFDQLL TMP+NSLM RMMKE+H +GKTI +I+
Sbjct  8     VIVFHFDKTIIDVDSDNWVVDELGFTDLFDQLLPTMPFNSLMARMMKELHDHGKTIEEIK  67

Query  907   RVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYV  728
             +VL+ +PIHPR++PAIK+ H LGC+LRIVSDAN  FIET+L+HLGIRE FSEINTNPG V
Sbjct  68    QVLRRIPIHPRVIPAIKSAHALGCELRIVSDANTLFIETVLEHLGIREYFSEINTNPGLV  127

Query  727   DEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKK-RVIYLGDGIGDF  551
             DE+GRL + P+HDF  S HGC+RCPPNMCK  IIERIQAS  KEG K ++IYLGDG GD+
Sbjct  128   DEQGRLIVSPYHDFTKSSHGCSRCPPNMCKGLIIERIQASFTKEGNKMKMIYLGDGAGDY  187

Query  550   CPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICI--E  377
             CPSL+LKA D+MMPRK+FPVW+LI +N +L++A + +W++GE  ERIL  +IN I +  E
Sbjct  188   CPSLRLKAEDYMMPRKNFPVWDLISQNPTLVKATVRDWTDGEAMERILMGIINEIILSPE  247

Query  376   DSQFLAAESKFQAISMQPCEALPKAIRVPF  287
             + + L+++    ++ +     +P A++VP 
Sbjct  248   EEKMLSSDHCKISVGIVHEPLVPLALQVPL  277



>gb|EYU18768.1| hypothetical protein MIMGU_mgv1a011814mg [Erythranthe guttata]
Length=270

 Score =   358 bits (919),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 180/273 (66%), Positives = 217/273 (79%), Gaps = 11/273 (4%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG +V+ DFDKTII+VDSDNWVVDELG T LF++LL TMPWNSLM+RMMKE+HANGKTI 
Sbjct  2     AGIMVILDFDKTIIEVDSDNWVVDELGATDLFNELLPTMPWNSLMERMMKEMHANGKTIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             +I+ VL+ VPIH R+VPAIK  H LGCDLRIVSDAN+FFIE IL HLGIR CFSEIN+NP
Sbjct  62    EIKDVLKRVPIHHRVVPAIKTAHALGCDLRIVSDANMFFIEMILDHLGIRNCFSEINSNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
              +++ EG L I P   + +SPHGC  CPPNMCK  IIERIQA+   EGKK++IYLGDG+G
Sbjct  122   SFINGEGTLIISP---YVTSPHGCNLCPPNMCKGMIIERIQAN---EGKKKIIYLGDGVG  175

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             DFCPSLKLK GDFMMPRK+FPVW+LI ENR +L+AEI EW +G++ ERIL  LI +I IE
Sbjct  176   DFCPSLKLKEGDFMMPRKNFPVWKLICENREILKAEIFEWIDGKELERILIGLIEKITIE  235

Query  376   DS----QFLAA-ESKFQAISMQPCEALPKAIRV  293
             ++    Q L+A + KF+ I +   EA P  +RV
Sbjct  236   EANNEVQLLSAVDCKFETIPIVAHEAFPPPLRV  268



>ref|XP_006303573.1| hypothetical protein CARUB_v10011086mg [Capsella rubella]
 gb|EOA36471.1| hypothetical protein CARUB_v10011086mg [Capsella rubella]
Length=285

 Score =   358 bits (919),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 172/274 (63%), Positives = 216/274 (79%), Gaps = 7/274 (3%)
 Frame = -1

Query  1087  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  908
             V+VFDFDKTIIDVDSDNWVVDELGFT LF+QLL TMPWNSLM+RMMKE+H +GKTI +I+
Sbjct  8     VIVFDFDKTIIDVDSDNWVVDELGFTDLFNQLLPTMPWNSLMNRMMKELHEHGKTIEEIK  67

Query  907   RVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYV  728
              VL+ +PIHPR++PAIKA H LGC+LRIVSDAN  FIETI++HLGIRE FSE+NTNPG V
Sbjct  68    HVLRRIPIHPRVIPAIKAAHALGCELRIVSDANTLFIETIIEHLGIREFFSEVNTNPGLV  127

Query  727   DEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKK-RVIYLGDGIGDF  551
             D++ RL I P+HDF  SPHGC RCPPNMCK  IIERIQAS+ KEGKK ++IYLGDG GD+
Sbjct  128   DDQCRLIISPYHDFTKSPHGCTRCPPNMCKGLIIERIQASLTKEGKKTKMIYLGDGAGDY  187

Query  550   CPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIED-  374
             CPSL LK+ D+MMPRKDFPVW+LI +N  L++A + +W++GE  E+IL  +IN I   D 
Sbjct  188   CPSLGLKSMDYMMPRKDFPVWDLISQNPMLVKATVRDWTDGEAMEKILMEIINEIISLDE  247

Query  373   -----SQFLAAESKFQAISMQPCEALPKAIRVPF  287
                   + L+++ +  ++ +     +P A +VP 
Sbjct  248   EEEEKEKMLSSDIRKISVGIVHEPMVPLAFQVPL  281



>ref|XP_010262202.1| PREDICTED: inorganic pyrophosphatase 1 [Nelumbo nucifera]
Length=270

 Score =   357 bits (917),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 170/269 (63%), Positives = 208/269 (77%), Gaps = 3/269 (1%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             A  VVVFDFDKTIID DSDNWV+DE+G T LFDQLL TMPWN LMDRMM E H+ GKTI 
Sbjct  2     AAVVVVFDFDKTIIDCDSDNWVIDEMGATQLFDQLLPTMPWNPLMDRMMSEFHSQGKTIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI   L+  P+HP I+ AIK+ H LGCDLRIVSDAN FFI+TILKH G+ +CF+EINTNP
Sbjct  62    DIADCLRRAPLHPNIITAIKSAHALGCDLRIVSDANSFFIDTILKHHGLMDCFTEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
              YVD+EG+LRI PFHDF SSPH  + CPPNMCK  +IERI+ S+  EGKKR +YLGDG G
Sbjct  122   SYVDDEGKLRIFPFHDFTSSPH--SPCPPNMCKGLVIERIRESVSAEGKKRFVYLGDGKG  179

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             DFCP+L+L  G+++MPRK+FP+WELI  N  L++AE+HEWS+GE+ ERIL  LIN I +E
Sbjct  180   DFCPALRLGEGEYVMPRKNFPLWELIHNNPLLVKAEVHEWSDGEELERILLQLINTILVE  239

Query  376   DSQ-FLAAESKFQAISMQPCEALPKAIRV  293
             ++   ++ +  F  I +   E LPKA+ V
Sbjct  240   ENNSLISVDCNFHTIPISTHEPLPKALPV  268



>emb|CDY21734.1| BnaA09g44850D [Brassica napus]
Length=286

 Score =   358 bits (918),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 173/274 (63%), Positives = 211/274 (77%), Gaps = 7/274 (3%)
 Frame = -1

Query  1087  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  908
             VVVFDFDKTIIDVDSDNWVVDELGFT LFDQLL TMPWNSLMDRMMKE+H +GKTI +I+
Sbjct  9     VVVFDFDKTIIDVDSDNWVVDELGFTELFDQLLPTMPWNSLMDRMMKELHDHGKTIEEIK  68

Query  907   RVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYV  728
             +VL+ +PIHPR++PAIK+   LGC+LRIVSDAN FFIETI++HLGIR+ FSEINTNPG V
Sbjct  69    QVLRRIPIHPRVIPAIKSARALGCELRIVSDANTFFIETIVEHLGIRKYFSEINTNPGLV  128

Query  727   DEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKK-RVIYLGDGIGDF  551
             DE+GRLRI P+HDF+ S HGC RCPPNMCK  IIERIQAS  KEG K ++IYLGDG+GD+
Sbjct  129   DEQGRLRISPYHDFNKSSHGCPRCPPNMCKGLIIERIQASFSKEGNKMKMIYLGDGVGDY  188

Query  550   CPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIED-  374
             CPSL LKA D+MMPRK+FP W+LI +N +L++A + +W +GE  E+IL    N I   D 
Sbjct  189   CPSLGLKAEDYMMPRKNFPAWDLISQNPTLVKATVRDWIDGEAMEKILMGTANEIMSSDE  248

Query  373   -----SQFLAAESKFQAISMQPCEALPKAIRVPF  287
                      +   K   + +     LP +++VP 
Sbjct  249   EEEKEKMLCSDHCKISVVGIVHEPMLPLSLQVPL  282



>ref|NP_173213.2| phosphoethanolamine/phosphocholine phosphatase [Arabidopsis thaliana]
 sp|Q9FZ62.1|PPSP2_ARATH RecName: Full=Inorganic pyrophosphatase 2; Short=AtPPsPase2; 
Short=PPi phosphatase 2; Short=Pyrophosphate-specific phosphatase 
2 [Arabidopsis thaliana]
 gb|AAF99814.1|AC034257_6 Hypothetical protein [Arabidopsis thaliana]
 gb|AAU05495.1| At1g17710 [Arabidopsis thaliana]
 gb|AAU15169.1| At1g17710 [Arabidopsis thaliana]
 gb|AEE29624.1| pyridoxal phosphate phosphatase-related protein [Arabidopsis 
thaliana]
Length=279

 Score =   357 bits (916),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 168/252 (67%), Positives = 209/252 (83%), Gaps = 6/252 (2%)
 Frame = -1

Query  1087  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  908
             V+VFDFDKTIIDVDSDNWVVDELGFT LF+QLL TMPWNSLM+RMMKE+H +GKTI +I+
Sbjct  8     VIVFDFDKTIIDVDSDNWVVDELGFTDLFNQLLPTMPWNSLMNRMMKELHDHGKTIEEIK  67

Query  907   RVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYV  728
             +VL+ +PIHPR++PAIK+ H LGC+LRIVSDAN  FIETI++HLGI E FSEINTNPG V
Sbjct  68    QVLRRIPIHPRVIPAIKSAHALGCELRIVSDANTLFIETIIEHLGIGEFFSEINTNPGLV  127

Query  727   DEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGK-KRVIYLGDGIGDF  551
             DE+GRL + P+HDF  S HGC+RCPPNMCK  II+RIQAS+ KEGK  ++IYLGDG GD+
Sbjct  128   DEQGRLIVSPYHDFTKSSHGCSRCPPNMCKGLIIDRIQASLTKEGKTSKMIYLGDGAGDY  187

Query  550   CPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICI---  380
             CPSL LKA D+MMPRK+FPVW+LI +N  L++A + +W++GED ERIL  +IN I     
Sbjct  188   CPSLGLKAEDYMMPRKNFPVWDLISQNPMLVKATVRDWTDGEDMERILMEIINEIMSSEE  247

Query  379   --EDSQFLAAES  350
               E+ + L++E+
Sbjct  248   GEENDKMLSSEN  259



>ref|XP_010519215.1| PREDICTED: inorganic pyrophosphatase 1-like [Tarenaya hassleriana]
Length=284

 Score =   357 bits (917),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 168/254 (66%), Positives = 203/254 (80%), Gaps = 1/254 (0%)
 Frame = -1

Query  1087  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  908
             V +FDFDKTIIDVDSDNWVVDELGFT LF+QLL TMPWNSLMDRMMKE+H  G TI DI+
Sbjct  12    VAIFDFDKTIIDVDSDNWVVDELGFTDLFNQLLPTMPWNSLMDRMMKELHEQGITIHDIK  71

Query  907   RVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYV  728
             RVL+ +PIHPR+VPA+++ H LGC+LRIVSDAN FFIETIL+HL I++ FSEINTNPG+V
Sbjct  72    RVLETIPIHPRVVPALRSAHALGCELRIVSDANTFFIETILEHLEIKDLFSEINTNPGFV  131

Query  727   DEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFC  548
             D+ GRLRI P+HDF  S HGC+RCPPNMCK+ IIERIQAS+ KEGKK++IYLGDG GD+C
Sbjct  132   DQHGRLRISPYHDFTESSHGCSRCPPNMCKALIIERIQASLTKEGKKKIIYLGDGAGDYC  191

Query  547   PSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICI-EDS  371
             PSLKL   D++MPRK +PVW L+ +N  L+ A I EW++GE  ER L  +I  I    D 
Sbjct  192   PSLKLGDEDYVMPRKSYPVWALLCQNPMLIRANIREWTDGEALERTLSEIIEEIGYGGDK  251

Query  370   QFLAAESKFQAISM  329
             + +    K Q IS+
Sbjct  252   EKILDSCKMQTISV  265



>ref|XP_010690045.1| PREDICTED: inorganic pyrophosphatase 2-like [Beta vulgaris subsp. 
vulgaris]
Length=274

 Score =   355 bits (912),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 174/275 (63%), Positives = 210/275 (76%), Gaps = 9/275 (3%)
 Frame = -1

Query  1093  GTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGD  914
             G VVVFDFDKTIID DSDNWVVDELGFT LF+QLL+TMPWNS+MD +MK +H  G TI +
Sbjct  3     GIVVVFDFDKTIIDCDSDNWVVDELGFTDLFNQLLNTMPWNSMMDVLMKRMHEKGITINE  62

Query  913   IERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPG  734
             I  VL+ +PIHPRIVPAI+  H  GCDLRIVSDANLFFIETIL+HLG+ +CFSEINTNPG
Sbjct  63    IAEVLKRIPIHPRIVPAIRDAHAAGCDLRIVSDANLFFIETILEHLGLSDCFSEINTNPG  122

Query  733   YVDEEGRLRILPFHDFHSSPHGCAR-CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
             YVDEEGRLRILP HDF  S HGC   CPPNMCK  +I+R+   + + G K+ IYLGDG+G
Sbjct  123   YVDEEGRLRILPHHDFTKSLHGCTNPCPPNMCKGSVIKRL---LCEHGNKKFIYLGDGLG  179

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICI-  380
             D+CPSLKL+ GD +MPRK+FPVW+LI  N   + ++IHEWS+GEDFERIL  LI  I   
Sbjct  180   DYCPSLKLREGDHVMPRKNFPVWDLISNNPERMTSKIHEWSDGEDFERILLSLIQAIISN  239

Query  379   ----EDSQFLAAESKFQAISMQPCEALPKAIRVPF  287
                   +Q L  + KF++  +   + LP+A+ VPF
Sbjct  240   ADDNNAAQLLNLDWKFKSFPIASHKTLPQALGVPF  274



>ref|XP_010428203.1| PREDICTED: inorganic pyrophosphatase 1 [Camelina sativa]
Length=295

 Score =   356 bits (913),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 163/229 (71%), Positives = 196/229 (86%), Gaps = 2/229 (1%)
 Frame = -1

Query  1087  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  908
             VVVFDFDKTIIDVDSDNWV+DELGFT LF+QLL TMPWN+LMDRMMKE+H  GKTI +I+
Sbjct  13    VVVFDFDKTIIDVDSDNWVIDELGFTDLFNQLLPTMPWNTLMDRMMKELHDQGKTIEEIK  72

Query  907   RVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYV  728
             + L+ +PIHPR+VPAIK+ H LGC+LRIVSDAN+FFIETI++HLGI E FSEIN+NPGYV
Sbjct  73    QALRTIPIHPRVVPAIKSAHELGCELRIVSDANMFFIETIVEHLGISEFFSEINSNPGYV  132

Query  727   DEEGRLRILPFHDFHSSPHGCAR--CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGD  554
             DE G LRI P+HDF  +PHGC+   CPPNMCK  IIERIQ S+ KEGKK++IYLGDG GD
Sbjct  133   DERGTLRISPYHDFTKTPHGCSNSTCPPNMCKGLIIERIQQSLAKEGKKKMIYLGDGAGD  192

Query  553   FCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERIL  407
             +CPSLKLKA D++MPRK+FPVW+LI +N  L++A I EW++G+  E IL
Sbjct  193   YCPSLKLKAEDYVMPRKNFPVWDLISQNPMLIKAAIREWTDGQSLEMIL  241



>ref|XP_010519212.1| PREDICTED: inorganic pyrophosphatase 2-like [Tarenaya hassleriana]
Length=287

 Score =   355 bits (912),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 171/256 (67%), Positives = 207/256 (81%), Gaps = 4/256 (2%)
 Frame = -1

Query  1087  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  908
             V +FDFDKTIIDVDSDNWVVDELGFT LF+QLL TMPWNSLMDRMMKE+H  G TI DI+
Sbjct  12    VAIFDFDKTIIDVDSDNWVVDELGFTDLFNQLLPTMPWNSLMDRMMKELHEQGITIHDIK  71

Query  907   RVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYV  728
             RVL+ +PIHPR+VPA+++ H LGC+LRIVSDAN FFIETIL+HL I++ FSEINTNPG+V
Sbjct  72    RVLETIPIHPRVVPALRSAHALGCELRIVSDANTFFIETILEHLEIKDLFSEINTNPGFV  131

Query  727   DEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEG-KKRVIYLGDGIGDF  551
             D+ GRLRI P+HDF  S HGC+RCPPNMCK+ IIERIQAS+ KEG KK++IYLGDG GD+
Sbjct  132   DQHGRLRISPYHDFTESSHGCSRCPPNMCKALIIERIQASLTKEGKKKKIIYLGDGAGDY  191

Query  550   CPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE--  377
             CPSLKL   D++MPRK +PVW+LI +N  L+ A I EW++GE  ER L  +I  I  E  
Sbjct  192   CPSLKLGDEDYVMPRKSYPVWDLICQNPMLIRANIREWTDGEALERTLSEIIEEIGYEGD  251

Query  376   DSQFLAAES-KFQAIS  332
               + +AA+S K + IS
Sbjct  252   KEKIMAADSCKTRTIS  267



>gb|KFK41741.1| hypothetical protein AALP_AA2G166400 [Arabis alpina]
Length=289

 Score =   355 bits (912),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 174/274 (64%), Positives = 216/274 (79%), Gaps = 9/274 (3%)
 Frame = -1

Query  1087  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  908
             VVVFDFDKTIIDVDSDNWV+DELGFT LF+QLL TMPWN+LMDRMMKE+H  GKTI +I+
Sbjct  12    VVVFDFDKTIIDVDSDNWVIDELGFTDLFNQLLPTMPWNTLMDRMMKELHDQGKTIEEIK  71

Query  907   RVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYV  728
             +VL+ +PIHPR+VPAIK+ H LGC+LRIVSDAN+FFIET+++HLGI E FSEIN+NPG+V
Sbjct  72    QVLRTIPIHPRVVPAIKSAHALGCELRIVSDANMFFIETLVEHLGISEYFSEINSNPGFV  131

Query  727   DEEGRLRILPFHDFHSSPHGCAR--CPPNMCKSKIIERIQASMGKEG-KKRVIYLGDGIG  557
             DE   LRI P+HDF  S HGC+R  CPPNMCK  IIERIQ S+ KEG KK+VIYLGDG G
Sbjct  132   DEHDTLRISPYHDFTKSSHGCSRSTCPPNMCKGLIIERIQESLAKEGKKKKVIYLGDGAG  191

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             D+CPSL LKA D++MPRK+FPVW+LI +N  L+ A I EW++GE  E +L  +I  I +E
Sbjct  192   DYCPSLNLKAEDYVMPRKNFPVWDLISQNPMLVNAAIREWTDGESLEMVLMGVIEEIRLE  251

Query  376   DSQ---FLAAES--KFQAISMQ-PCEALPKAIRV  293
             D +    ++AE+  K   I +      +P+A+RV
Sbjct  252   DEKEKLLISAENTCKMHTIPVGINVPIMPRALRV  285



>ref|XP_010519213.1| PREDICTED: inorganic pyrophosphatase 2-like [Tarenaya hassleriana]
Length=287

 Score =   355 bits (910),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 170/257 (66%), Positives = 207/257 (81%), Gaps = 4/257 (2%)
 Frame = -1

Query  1087  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  908
             V +FDFDKTIIDVDSDNWVVDELGFT LF+QLL TMPWNSLMDRMMKE+H  G TI DI+
Sbjct  12    VAIFDFDKTIIDVDSDNWVVDELGFTDLFNQLLPTMPWNSLMDRMMKELHEQGITIHDIK  71

Query  907   RVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYV  728
             RVL+ +PIHPR+VPA+++ H LGC+LRIVSDAN FFIETIL+HL I++ FSEINTNPG+V
Sbjct  72    RVLETIPIHPRVVPALRSAHALGCELRIVSDANTFFIETILEHLEIKDLFSEINTNPGFV  131

Query  727   DEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEG-KKRVIYLGDGIGDF  551
             D+ GRLRI P+HDF  S HGC+RCPPNMCK+ IIERIQAS+ KEG KK++IYLGDG GD+
Sbjct  132   DQHGRLRISPYHDFTESSHGCSRCPPNMCKALIIERIQASLTKEGKKKKIIYLGDGAGDY  191

Query  550   CPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICI--E  377
             CPSLKL   D++MPRK +PVW+LI +N  L+ A I EW++GE  ER L  +I  I    +
Sbjct  192   CPSLKLGDEDYVMPRKSYPVWDLICQNPMLIRANIREWTDGEALERTLSEIIEEIGYGGD  251

Query  376   DSQFLAAES-KFQAISM  329
               + LA +S K Q +S+
Sbjct  252   TEKILAPDSCKMQTLSV  268



>ref|XP_010476932.1| PREDICTED: inorganic pyrophosphatase 2-like [Camelina sativa]
Length=284

 Score =   354 bits (909),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 165/229 (72%), Positives = 197/229 (86%), Gaps = 1/229 (0%)
 Frame = -1

Query  1087  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  908
             V+VFDFDKTIIDVDSDNWVVDELGFT LF+QLL TMPWNSLM+ MMKE+H +GKTI +I+
Sbjct  8     VIVFDFDKTIIDVDSDNWVVDELGFTDLFNQLLRTMPWNSLMNGMMKELHDHGKTIEEIK  67

Query  907   RVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYV  728
             +VL+ +PIHPR++PAIKA H LGC+LRIVSDAN  FIETI++HLGIRE FSEINTNPG V
Sbjct  68    QVLRRIPIHPRVIPAIKAAHALGCELRIVSDANTLFIETIIEHLGIREFFSEINTNPGIV  127

Query  727   DEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKK-RVIYLGDGIGDF  551
             D++GRL I P+HDF  SPHGC RCPPNMCK  IIERIQAS+ KEGKK ++IYLGDG GD+
Sbjct  128   DDQGRLVISPYHDFTKSPHGCTRCPPNMCKGLIIERIQASLTKEGKKMKMIYLGDGAGDY  187

Query  550   CPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILF  404
             CPSL LKA D+MMPRK+FPVW+LI +N  L++A + +W++GE  ERIL 
Sbjct  188   CPSLGLKAEDYMMPRKNFPVWDLISQNPMLVKATVRDWTDGEAMERILM  236



>ref|XP_010690046.1| PREDICTED: inorganic pyrophosphatase 2-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010690047.1| PREDICTED: inorganic pyrophosphatase 2-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010690048.1| PREDICTED: inorganic pyrophosphatase 2-like isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=331

 Score =   356 bits (913),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 172/273 (63%), Positives = 211/273 (77%), Gaps = 9/273 (3%)
 Frame = -1

Query  1093  GTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGD  914
             G VVVFDFDKTIID DSDNWVVDELGFT LF+QLL+TMPWNS+MD +MKE+H  G TI D
Sbjct  3     GIVVVFDFDKTIIDCDSDNWVVDELGFTDLFNQLLNTMPWNSMMDVLMKEMHEEGITIDD  62

Query  913   IERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPG  734
             I  VL+ +PIHPRIVPAI+A H  GCDLRIVSDANLFFIETIL+HLG+ + FSEINTNPG
Sbjct  63    IADVLKRIPIHPRIVPAIRAAHAAGCDLRIVSDANLFFIETILEHLGLSDYFSEINTNPG  122

Query  733   YVDEEGRLRILPFHDFHSSPHGCAR-CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
             YVDEEGRLRILP HDF  S HGC   CPPNMCK  +I+R+   + K G K+ IYLGDG+G
Sbjct  123   YVDEEGRLRILPHHDFTKSSHGCTNPCPPNMCKGMVIKRL---LCKHGNKKFIYLGDGLG  179

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICI-  380
             D+CPSL+L+ GD +MPRK+FPVW+LI  N  L+ ++IHEW++GEDFER+L  LI  I   
Sbjct  180   DYCPSLRLREGDHVMPRKNFPVWDLISNNPELITSKIHEWTDGEDFERVLLSLIQAIISN  239

Query  379   ----EDSQFLAAESKFQAISMQPCEALPKAIRV  293
                 + + F   + KF+++ +   + LP+A+ V
Sbjct  240   ADDNDAAHFFNRDCKFESLPISSPDTLPQALGV  272



>gb|KHG13597.1| hypothetical protein F383_05241 [Gossypium arboreum]
Length=287

 Score =   353 bits (906),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 171/252 (68%), Positives = 202/252 (80%), Gaps = 3/252 (1%)
 Frame = -1

Query  1099  AAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTI  920
             AAG VV++DFDKTIID DSDNWVVDELG T LF+QLL TMPWNSLMDR+MKE+H+ G  I
Sbjct  3     AAGIVVIYDFDKTIIDCDSDNWVVDELGATELFNQLLPTMPWNSLMDRIMKELHSQGIRI  62

Query  919   GDIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTN  740
              DI  VL+  PIHPRI+ AIK+ H LGCDL+IVSDAN FFIETIL+H G++ECFSEINTN
Sbjct  63    EDIATVLKRSPIHPRIIEAIKSAHALGCDLKIVSDANTFFIETILEHHGLKECFSEINTN  122

Query  739   PGYVDEEGRLRILPFHDFHSSPHGC--ARCPPNMCKSKIIERIQASMGKEG-KKRVIYLG  569
             PG+VDE+GRLRI P HDF  S HGC  + CPPNMCK  +IERIQAS+  E  KK +IYLG
Sbjct  123   PGFVDEQGRLRIFPHHDFTKSSHGCQHSSCPPNMCKGVVIERIQASLSMEDQKKTIIYLG  182

Query  568   DGIGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINR  389
             DG+GDFCP+LKL  GD++MPRK FPVW+LI  NR L+ AEI EWS+GE+FE +L HLI+R
Sbjct  183   DGLGDFCPTLKLGDGDYVMPRKGFPVWDLICNNRKLVNAEICEWSDGEEFENVLLHLISR  242

Query  388   ICIEDSQFLAAE  353
             I   D    +A+
Sbjct  243   IISIDRNNTSAK  254



>ref|XP_006302457.1| hypothetical protein CARUB_v10020549mg [Capsella rubella]
 gb|EOA35355.1| hypothetical protein CARUB_v10020549mg [Capsella rubella]
Length=354

 Score =   355 bits (911),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 160/229 (70%), Positives = 198/229 (86%), Gaps = 2/229 (1%)
 Frame = -1

Query  1087  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  908
             VVVFDFDKTIIDVDSDNWV+DELGFT LF+QLL TMPWN+LMDRMMKE+H +GKTI +I+
Sbjct  73    VVVFDFDKTIIDVDSDNWVIDELGFTDLFNQLLPTMPWNTLMDRMMKELHDHGKTIEEIK  132

Query  907   RVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYV  728
             +VL  +PIHPR+VPAIK+ + LGC+LRIVSDAN+FFIET+++HLGI E FSEIN+NPG+V
Sbjct  133   QVLTTIPIHPRVVPAIKSAYALGCELRIVSDANMFFIETLVEHLGISELFSEINSNPGFV  192

Query  727   DEEGRLRILPFHDFHSSPHGCAR--CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGD  554
             DE G LRI P+HDF ++PHGC+   CPPNMCK  IIERIQ S+ KEGKK++IYLGDG GD
Sbjct  193   DERGTLRISPYHDFTTTPHGCSNSTCPPNMCKGLIIERIQQSLAKEGKKKMIYLGDGAGD  252

Query  553   FCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERIL  407
             +CPSLKLKA D++MPRK+FPVW+LI +N  L++A I EW++G+  E +L
Sbjct  253   YCPSLKLKAEDYVMPRKNFPVWDLISQNPMLIKAAIREWTDGQSLEMVL  301



>ref|XP_009127965.1| PREDICTED: inorganic pyrophosphatase 1 [Brassica rapa]
Length=292

 Score =   352 bits (903),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 164/230 (71%), Positives = 194/230 (84%), Gaps = 2/230 (1%)
 Frame = -1

Query  1087  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  908
             VVVFDFDKTIIDVDSDNWVVD LGFT LF+QLL TMPWNSLMDRMMK+IH  GKTI +I+
Sbjct  12    VVVFDFDKTIIDVDSDNWVVDGLGFTDLFNQLLPTMPWNSLMDRMMKDIHDQGKTIEEIK  71

Query  907   RVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYV  728
              VL+ +PIHPR+VPAIK+ H LGC+LRIVSDAN+FFIETI++HLGI E FSEIN+NPG+V
Sbjct  72    EVLKTIPIHPRVVPAIKSAHALGCELRIVSDANMFFIETIVEHLGISEYFSEINSNPGFV  131

Query  727   DEEGRLRILPFHDFHSSPHGCAR--CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGD  554
             DE   LRI P+HDF +S HGC+   CPPNMCK  IIERIQ S+ KEGKK+++YLGDG GD
Sbjct  132   DEHDTLRISPYHDFTNSSHGCSHRTCPPNMCKGLIIERIQESLAKEGKKKMVYLGDGAGD  191

Query  553   FCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILF  404
             +CPSLKLKA D+ MPRK+FPVW+LI +N  L++A I EW++GE  ERIL 
Sbjct  192   YCPSLKLKAEDYAMPRKNFPVWDLISQNPMLVKAAIREWTDGESLERILL  241



>emb|CDX82118.1| BnaC02g21720D [Brassica napus]
Length=291

 Score =   352 bits (902),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 164/230 (71%), Positives = 194/230 (84%), Gaps = 2/230 (1%)
 Frame = -1

Query  1087  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  908
             VVVFDFDKTIIDVDSDNWVVD LGFT LF+QLL TMPWN+LMDRMMK+IH  GKTI +I+
Sbjct  12    VVVFDFDKTIIDVDSDNWVVDGLGFTDLFNQLLPTMPWNTLMDRMMKDIHDQGKTIEEIK  71

Query  907   RVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYV  728
              VL+ +PIHPR+VPAIK+ H LGC+LRIVSDAN+FFIETI++HLGI E FSEIN+NPG+V
Sbjct  72    EVLKTIPIHPRVVPAIKSAHALGCELRIVSDANMFFIETIVEHLGISEYFSEINSNPGFV  131

Query  727   DEEGRLRILPFHDFHSSPHGCAR--CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGD  554
             DE   LRI P+HDF +S HGC+   CPPNMCK  IIERIQ S+ KEGKK++IYLGDG GD
Sbjct  132   DEHDTLRISPYHDFTNSSHGCSHRTCPPNMCKGLIIERIQESLAKEGKKKMIYLGDGAGD  191

Query  553   FCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILF  404
             +CPSLKLKA D+ MPRK+FPVW+LI +N  L++A I EW++GE  ERIL 
Sbjct  192   YCPSLKLKAEDYAMPRKNFPVWDLISQNPMLVKAAIKEWTDGESLERILL  241



>ref|NP_565052.1| inorganic pyrophosphatase 1 [Arabidopsis thaliana]
 sp|Q67YC0.1|PPSP1_ARATH RecName: Full=Inorganic pyrophosphatase 1; Short=AtPPsPase1; 
Short=PPi phosphatase 1; Short=Pyrophosphate-specific phosphatase 
1; AltName: Full=Protein PHOSPHATE STARVATION-INDUCED 
GENE 2; Short=AtPS2 [Arabidopsis thaliana]
 dbj|BAD44311.1| unknown protein [Arabidopsis thaliana]
 gb|ABO38747.1| At1g73010 [Arabidopsis thaliana]
 gb|AEE35403.1| inorganic pyrophosphatase 1 [Arabidopsis thaliana]
Length=295

 Score =   351 bits (901),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 161/230 (70%), Positives = 194/230 (84%), Gaps = 2/230 (1%)
 Frame = -1

Query  1087  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  908
             VVVFDFDKTIIDVDSDNWV+DELGFT LF+QLL TMPWN+LMDRMMKE+H  GKTI +I+
Sbjct  15    VVVFDFDKTIIDVDSDNWVIDELGFTDLFNQLLPTMPWNTLMDRMMKELHDQGKTIEEIK  74

Query  907   RVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYV  728
             +VL+ +PIHPR+VPAIK+ H LGC+LRIVSDAN+FFIETI++HLGI E FSEIN+NPGYV
Sbjct  75    QVLRTIPIHPRVVPAIKSAHDLGCELRIVSDANMFFIETIVEHLGISELFSEINSNPGYV  134

Query  727   DEEGRLRILPFHDFHSSPHGCA--RCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGD  554
             DE G L+I P+HDF  SPH C+   CPPNMCK  IIERIQ S+ KEGKK++IYLGDG GD
Sbjct  135   DERGTLKISPYHDFTKSPHSCSCGTCPPNMCKGLIIERIQQSLAKEGKKKMIYLGDGAGD  194

Query  553   FCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILF  404
             +CPSLKL   D++MPRK+FPVW+LI +N  L++A I EW++G+  E IL 
Sbjct  195   YCPSLKLNTEDYVMPRKNFPVWDLISQNPMLIKAAIREWTDGQSMEMILI  244



>ref|XP_002888902.1| hypothetical protein ARALYDRAFT_476431 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65161.1| hypothetical protein ARALYDRAFT_476431 [Arabidopsis lyrata subsp. 
lyrata]
Length=294

 Score =   351 bits (901),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 161/230 (70%), Positives = 194/230 (84%), Gaps = 2/230 (1%)
 Frame = -1

Query  1087  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  908
             VVVFDFDKTIIDVDSDNWV+DELG+T LF+QLL TMPWN+LMDRMMKE+H  GKTI +I+
Sbjct  14    VVVFDFDKTIIDVDSDNWVIDELGYTDLFNQLLPTMPWNTLMDRMMKELHDQGKTIEEIK  73

Query  907   RVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYV  728
             +VL+ +PIHPR+VPAIK+ H LGC+LRIVSDAN+FFIETI++HLGI E FSEIN+NPGYV
Sbjct  74    QVLRTIPIHPRVVPAIKSAHDLGCELRIVSDANMFFIETIVEHLGISELFSEINSNPGYV  133

Query  727   DEEGRLRILPFHDFHSSPHGCA--RCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGD  554
             DE G LRI P+HDF  S HGC+   CPPNMCK  IIERIQ S+ KEGKK++IYLGDG GD
Sbjct  134   DERGTLRISPYHDFTKSSHGCSCGTCPPNMCKGLIIERIQQSLAKEGKKKMIYLGDGAGD  193

Query  553   FCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILF  404
             +CPSLKL   D++MPRK+FPVW+LI +N  L++A I EW++G+  E IL 
Sbjct  194   YCPSLKLNTEDYVMPRKNFPVWDLISQNPMLIKATIREWTDGQSLEMILI  243



>ref|XP_006390603.1| hypothetical protein EUTSA_v10018928mg [Eutrema salsugineum]
 gb|ESQ27889.1| hypothetical protein EUTSA_v10018928mg [Eutrema salsugineum]
Length=303

 Score =   351 bits (901),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 163/231 (71%), Positives = 197/231 (85%), Gaps = 3/231 (1%)
 Frame = -1

Query  1087  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  908
             VVVFDFDKTI+DVDSDNWV+DELGFT LF+QLL TMPWN+LMDRMMKE+H  GKTI +I+
Sbjct  21    VVVFDFDKTIVDVDSDNWVIDELGFTDLFNQLLPTMPWNTLMDRMMKELHDQGKTIEEIK  80

Query  907   RVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYV  728
             +VL+ +PIHPR+VPAIKA H LGC+LRIVSDAN+FFIETI++HLGI E FSEIN+NPG+V
Sbjct  81    QVLRTIPIHPRVVPAIKAAHDLGCELRIVSDANMFFIETIVEHLGITEFFSEINSNPGFV  140

Query  727   DE-EGRLRILPFHDFHSSPHGCAR--CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
             DE E  LRI P+HDF  S HGC+   CPPNMCK  IIERIQ S+ KEGKK++IYLGDG G
Sbjct  141   DEHEDTLRISPYHDFTKSSHGCSHSTCPPNMCKGLIIERIQESLAKEGKKKMIYLGDGAG  200

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILF  404
             D+CPSLKLKAGD++MPRK+FPVW+LI +N  L++  I EW++GE  E++L 
Sbjct  201   DYCPSLKLKAGDYVMPRKNFPVWDLISQNPMLIKGAIREWTDGESLEKVLM  251



>gb|AAM63155.1| putative acid phosphatase [Arabidopsis thaliana]
Length=293

 Score =   350 bits (899),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 161/230 (70%), Positives = 194/230 (84%), Gaps = 2/230 (1%)
 Frame = -1

Query  1087  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  908
             VVVFDFDKTIIDVDSDNWV+DELGFT LF+QLL TMPWN+LMDRMMKE+H  GKTI +I+
Sbjct  13    VVVFDFDKTIIDVDSDNWVIDELGFTDLFNQLLPTMPWNTLMDRMMKELHDQGKTIEEIK  72

Query  907   RVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYV  728
             +VL+ +PIHPR+VPAIK+ H LGC+LRIVSDAN+FFIETI++HLGI E FSEIN+NPGYV
Sbjct  73    QVLRTIPIHPRVVPAIKSAHDLGCELRIVSDANMFFIETIVEHLGISELFSEINSNPGYV  132

Query  727   DEEGRLRILPFHDFHSSPHGCA--RCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGD  554
             DE G L+I P+HDF  SPH C+   CPPNMCK  IIERIQ S+ KEGKK++IYLGDG GD
Sbjct  133   DERGTLKISPYHDFTKSPHSCSCGTCPPNMCKGLIIERIQQSLAKEGKKKMIYLGDGAGD  192

Query  553   FCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILF  404
             +CPSLKL   D++MPRK+FPVW+LI +N  L++A I EW++G+  E IL 
Sbjct  193   YCPSLKLNTEDYVMPRKNFPVWDLISQNPMLIKAVIREWTDGQSMEMILI  242



>emb|CDY69464.1| BnaAnng30500D [Brassica napus]
Length=292

 Score =   350 bits (899),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 162/230 (70%), Positives = 194/230 (84%), Gaps = 2/230 (1%)
 Frame = -1

Query  1087  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  908
             VVVFDFDKTIIDVDSDNWVVD LGFT LF+QLL TMPWNSLMDRMMK+IH  GKTI +I+
Sbjct  12    VVVFDFDKTIIDVDSDNWVVDGLGFTDLFNQLLPTMPWNSLMDRMMKDIHDQGKTIEEIK  71

Query  907   RVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYV  728
              VL+ +PIHPR+VPAIK+ H LGC+LRIVSDAN+FFIET+++HLGI E FSEIN+NPG+V
Sbjct  72    EVLKTIPIHPRVVPAIKSAHALGCELRIVSDANMFFIETLVEHLGISEYFSEINSNPGFV  131

Query  727   DEEGRLRILPFHDFHSSPHGCAR--CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGD  554
             DE   LRI P+HDF +S HGC+   CPPNMCK  IIERIQ S+ KEGKK+++YLGDG GD
Sbjct  132   DEHDTLRISPYHDFTNSSHGCSHRTCPPNMCKGLIIERIQESLAKEGKKKMVYLGDGAGD  191

Query  553   FCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILF  404
             +CPSLKLKA D+ MPRK+FP+W+LI +N  L++A I EW++GE  ERIL 
Sbjct  192   YCPSLKLKAEDYAMPRKNFPIWDLISQNPMLVKAAIREWTDGESLERILL  241



>ref|XP_009409362.1| PREDICTED: inorganic pyrophosphatase 2 [Musa acuminata subsp. 
malaccensis]
Length=275

 Score =   346 bits (888),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 168/273 (62%), Positives = 202/273 (74%), Gaps = 4/273 (1%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             A  VVVFDFDKTIID DSDNWV+D+LG T LFD+LL  MPWNS MDR+M+E+H+ G+TI 
Sbjct  2     ADVVVVFDFDKTIIDCDSDNWVIDDLGGTQLFDELLKAMPWNSAMDRVMEELHSQGRTIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             +I   L+  P+    V AIK+ + LGC+LRIVSDAN FFIETILKH G+   FSEI+TNP
Sbjct  62    EISENLKRAPLPANAVAAIKSAYALGCELRIVSDANRFFIETILKHHGLMAYFSEIHTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
             GYVDEEGRLRI P HDF SS HGC  CPPNMCKS IIERIQAS   EG+KR IYLGDG G
Sbjct  122   GYVDEEGRLRIFPHHDFKSSSHGCCLCPPNMCKSAIIERIQASAFLEGRKRFIYLGDGKG  181

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             D+CPSL+L  GD +MPRK++P+W+LI +N   L AEIHEWSN E+ ER+L  LI+     
Sbjct  182   DYCPSLRLNEGDCVMPRKNYPLWQLIVDNPQALRAEIHEWSNAEELERVLLRLISESASA  241

Query  376   D----SQFLAAESKFQAISMQPCEALPKAIRVP  290
             D    SQ ++ + KFQ +     EA PK++ VP
Sbjct  242   DRSSPSQLISVDCKFQTLPPSSIEAFPKSLPVP  274



>ref|XP_002277629.1| PREDICTED: inorganic pyrophosphatase 3 [Vitis vinifera]
 emb|CBI20628.3| unnamed protein product [Vitis vinifera]
Length=269

 Score =   345 bits (886),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 163/268 (61%), Positives = 200/268 (75%), Gaps = 1/268 (0%)
 Frame = -1

Query  1093  GTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGD  914
               VVVFDFDKTIID DSDNWVVDELG T LF QLL TMPWNSLMDRM  E+H+ GKT+ +
Sbjct  2     AVVVVFDFDKTIIDCDSDNWVVDELGLTPLFTQLLPTMPWNSLMDRMFMELHSQGKTMEE  61

Query  913   IERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPG  734
             I   L+  P+HPRI+ AIK+ H  GCDLRIVSDAN FFIET+LKH G+ +CFSEI TNP 
Sbjct  62    IAECLKRAPLHPRIISAIKSAHASGCDLRIVSDANAFFIETVLKHHGLMDCFSEIKTNPS  121

Query  733   YVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGD  554
             +VD EGRLRILP+HD  SS HGC  CPPNMCK  ++ER++ S+  EGKKR IYLGDG  D
Sbjct  122   FVDGEGRLRILPYHDLKSSSHGCNFCPPNMCKGLVMERVRTSVSAEGKKRFIYLGDGSAD  181

Query  553   FCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIED  374
             FC  LKL  GD++MPRK++P+WE+I  N  L++++I+EWSNGE+ E+IL HLI  I IE+
Sbjct  182   FCSGLKLGEGDYLMPRKNYPIWEIICSNPKLIKSKINEWSNGEELEKILLHLITTISIEE  241

Query  373   SQFLAAESKFQAISMQPCEALPKAIRVP  290
                + ++ K QA SM   +     + VP
Sbjct  242   KCNMRSD-KCQASSMDSHKTFQSVLPVP  268



>gb|EPS62373.1| hypothetical protein M569_12416, partial [Genlisea aurea]
Length=241

 Score =   343 bits (881),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 159/234 (68%), Positives = 191/234 (82%), Gaps = 3/234 (1%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AGTVV+FDFDKTIID DSDNWVVDELG T LF++LLHTMPWN++MD +M E+H+ G++  
Sbjct  2     AGTVVIFDFDKTIIDADSDNWVVDELGATDLFNRLLHTMPWNTMMDTIMGELHSRGRSSE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI  VL+ +PIH R+VPAI+  H LGCDLRIVSDAN FFIETI++HLGI++CFSEINTNP
Sbjct  62    DIRGVLRRIPIHSRVVPAIRRAHSLGCDLRIVSDANSFFIETIIQHLGIKDCFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
                DEEGRLRI P+ DFH++PHGC RCPPNMCK  II RIQ  +   G KR++YLGDG G
Sbjct  122   SRFDEEGRLRISPYVDFHTNPHGCPRCPPNMCKGSIIGRIQDQI---GAKRIVYLGDGAG  178

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLI  395
             DFCP LKLK  DFMMPRKDFPVW+LI ENR  + A+IHEWS+G+  E++L  +I
Sbjct  179   DFCPCLKLKEEDFMMPRKDFPVWDLICENRDAVRAQIHEWSDGDQLEKVLLKII  232



>ref|XP_010062596.1| PREDICTED: inorganic pyrophosphatase 2-like [Eucalyptus grandis]
 ref|XP_010062597.1| PREDICTED: inorganic pyrophosphatase 2-like [Eucalyptus grandis]
 ref|XP_010062598.1| PREDICTED: inorganic pyrophosphatase 2-like [Eucalyptus grandis]
Length=269

 Score =   345 bits (884),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 162/265 (61%), Positives = 208/265 (78%), Gaps = 6/265 (2%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             A  +VVFDFDKTI+D + D+W+V E G   L ++LL T PWNSLMD+MM E+H+ GKTI 
Sbjct  2     ADIMVVFDFDKTIMDWECDDWIVHEFGLIDLVNELLPTTPWNSLMDKMMGELHSRGKTIA  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI  VL+   +HPRIVPAIK++H LGC+LRI+SDA+LF+IETIL HLGIRECFS+I TNP
Sbjct  62    DIADVLKRATMHPRIVPAIKSIHALGCELRILSDADLFYIETILNHLGIRECFSQITTNP  121

Query  736   GYVDEE-GRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEG-KKRVIYLGDG  563
              +VDEE GRLRILPFHDF SSPHGC  CPPN+CK  +IER+QAS+  EG KKR IY+GDG
Sbjct  122   SFVDEEKGRLRILPFHDFRSSPHGCGLCPPNLCKGAVIERVQASVSAEGKKKRFIYVGDG  181

Query  562   IGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRIC  383
             +GD+CPSLKL  GDFMMPRKD+P W+LI +N +LL+AEIHEW++GE+ ER++  LI+ I 
Sbjct  182   VGDYCPSLKLSEGDFMMPRKDYPAWDLICQNPALLKAEIHEWTDGEELERVVLRLIDAII  241

Query  382   IED----SQFLAAESKFQAISMQPC  320
              E+     + ++++ + Q I+   C
Sbjct  242   TEEEIKSGRSISSDREMQNIADHRC  266



>gb|KCW69738.1| hypothetical protein EUGRSUZ_F03120 [Eucalyptus grandis]
Length=314

 Score =   345 bits (885),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 162/265 (61%), Positives = 208/265 (78%), Gaps = 6/265 (2%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             A  +VVFDFDKTI+D + D+W+V E G   L ++LL T PWNSLMD+MM E+H+ GKTI 
Sbjct  47    ADIMVVFDFDKTIMDWECDDWIVHEFGLIDLVNELLPTTPWNSLMDKMMGELHSRGKTIA  106

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI  VL+   +HPRIVPAIK++H LGC+LRI+SDA+LF+IETIL HLGIRECFS+I TNP
Sbjct  107   DIADVLKRATMHPRIVPAIKSIHALGCELRILSDADLFYIETILNHLGIRECFSQITTNP  166

Query  736   GYVDEE-GRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEG-KKRVIYLGDG  563
              +VDEE GRLRILPFHDF SSPHGC  CPPN+CK  +IER+QAS+  EG KKR IY+GDG
Sbjct  167   SFVDEEKGRLRILPFHDFRSSPHGCGLCPPNLCKGAVIERVQASVSAEGKKKRFIYVGDG  226

Query  562   IGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRIC  383
             +GD+CPSLKL  GDFMMPRKD+P W+LI +N +LL+AEIHEW++GE+ ER++  LI+ I 
Sbjct  227   VGDYCPSLKLSEGDFMMPRKDYPAWDLICQNPALLKAEIHEWTDGEELERVVLRLIDAII  286

Query  382   IED----SQFLAAESKFQAISMQPC  320
              E+     + ++++ + Q I+   C
Sbjct  287   TEEEIKSGRSISSDREMQNIADHRC  311



>ref|XP_010416075.1| PREDICTED: inorganic pyrophosphatase 1-like [Camelina sativa]
Length=296

 Score =   343 bits (879),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 155/220 (70%), Positives = 186/220 (85%), Gaps = 2/220 (1%)
 Frame = -1

Query  1078  FDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIERVL  899
             FDFDKTIIDVDSDNWV+DELGFT LF QLL TMPWN+LMDRMM E+H  GKTI +I++ L
Sbjct  16    FDFDKTIIDVDSDNWVIDELGFTDLFTQLLPTMPWNTLMDRMMTELHDQGKTIEEIKQAL  75

Query  898   QGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEE  719
             + +PIHPR+VPAIK+ H LGC+LRIVSDAN+FFIETI++HLGI E FSEIN+NPGY DE 
Sbjct  76    KTIPIHPRVVPAIKSAHELGCELRIVSDANMFFIETIVEHLGISEFFSEINSNPGYADER  135

Query  718   GRLRILPFHDFHSSPHGCAR--CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCP  545
             G LRI P+HDF  +PHGC+   CPPNMCK  IIERIQ S+ KEGKK++IYLGDG GD+CP
Sbjct  136   GTLRISPYHDFTKTPHGCSNSTCPPNMCKGLIIERIQQSLAKEGKKKMIYLGDGAGDYCP  195

Query  544   SLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGE  425
             SLKL A D++MPRK+FPVW+LI +N  L++A I EW+NG+
Sbjct  196   SLKLNAEDYVMPRKNFPVWDLISQNPMLIKAAIREWTNGQ  235



>ref|XP_010915327.1| PREDICTED: inorganic pyrophosphatase 1-like [Elaeis guineensis]
Length=275

 Score =   341 bits (874),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 163/273 (60%), Positives = 201/273 (74%), Gaps = 4/273 (1%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFDKTIID DSDNWVVD+LG T  FD+LL ++PWNS +DRMM E+H+ GKTI 
Sbjct  2     AGIVVVFDFDKTIIDCDSDNWVVDDLGATRRFDELLESLPWNSAIDRMMGELHSQGKTIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             +I   L+  P+ P  + AIK+ H LGC+LRIVSDANLFFIETIL H G+   FSEINTNP
Sbjct  62    EISNSLKKAPLSPHTIAAIKSAHSLGCELRIVSDANLFFIETILNHHGLVGYFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
             GYVDE+GRLRI P+HDF +S HGC  CPPNMCK K+IERI+ S     K R IYLGDG G
Sbjct  122   GYVDEKGRLRIFPYHDFTTSSHGCCLCPPNMCKGKVIERIRTSAFAVEKNRFIYLGDGKG  181

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             D+CPSL+L  GD++MPRK++P+WELI  +   L+A IHEWS+ E+ + +L  LIN     
Sbjct  182   DYCPSLELNEGDYVMPRKNYPLWELICNDPQALKAAIHEWSDAEELKTVLLRLINDSVSA  241

Query  376   D----SQFLAAESKFQAISMQPCEALPKAIRVP  290
             D    ++ L+A+ K Q I + P E LPKA+ VP
Sbjct  242   DLNNAARLLSADCKLQTIPLSPHEPLPKALPVP  274



>dbj|BAJ95704.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=274

 Score =   338 bits (866),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 161/271 (59%), Positives = 202/271 (75%), Gaps = 3/271 (1%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFDKTIIDVDSDNWVVD LG T LFD+LL TMPWN+L+D +M E+HA GKT+ 
Sbjct  2     AGVVVVFDFDKTIIDVDSDNWVVDGLGATELFDRLLPTMPWNTLIDTVMGELHAQGKTLR  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             D+  VL+  PI P +V AI+A + LGCDLR++SDAN FFIE +L H G+R  FSEINTNP
Sbjct  62    DVADVLRAAPIDPHVVAAIRAAYSLGCDLRVLSDANRFFIEAVLDHHGLRGYFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGC--ARCPPNMCKSKIIERIQASMGK-EGKKRVIYLGD  566
               VD +GRLRI P HDFH+ PHGC    CPPNMCK ++++RI+AS    +G KR IYLGD
Sbjct  122   SRVDADGRLRIAPHHDFHAGPHGCGLGTCPPNMCKGQVLDRIRASSATADGTKRFIYLGD  181

Query  565   GIGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRI  386
             G GD+CPSL+L   DFMMPRK FPVWELI EN  LL+AE+H WS+G+D E  L  LI+R+
Sbjct  182   GRGDYCPSLRLAREDFMMPRKGFPVWELICENPGLLQAEVHPWSDGKDMEETLLRLISRV  241

Query  385   CIEDSQFLAAESKFQAISMQPCEALPKAIRV  293
              +E+SQ L  + K +++ +   + +P  + V
Sbjct  242   LVEESQLLPLDCKLESLPVAVQDGMPMPLGV  272



>emb|CDY59927.1| BnaC06g43820D [Brassica napus]
Length=292

 Score =   338 bits (867),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 159/230 (69%), Positives = 193/230 (84%), Gaps = 3/230 (1%)
 Frame = -1

Query  1087  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  908
             VVVFDFDKTIIDVDSDNWV+DELGFT LF+QLL TMPWN++MD MMKE+H  GKTI +I+
Sbjct  12    VVVFDFDKTIIDVDSDNWVIDELGFTDLFNQLLPTMPWNTVMDCMMKELHDQGKTIEEIK  71

Query  907   RVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYV  728
             + L+ +PIHPRIVPAIKA H LGC+LRIVSDAN+FFIET+++HLGI E FSEIN+NPG+V
Sbjct  72    QALRTIPIHPRIVPAIKAAHALGCELRIVSDANMFFIETMVEHLGISELFSEINSNPGFV  131

Query  727   DEEGRLRILPFHDFHSSPHGCAR--CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGD  554
             DE+  LRI P+HDF +S HGC    CP NMCK  +IERIQ S+ KEGKK +IYLGDG GD
Sbjct  132   DEKDTLRISPYHDFTNSSHGCTHGSCPLNMCKGLVIERIQESLAKEGKK-MIYLGDGAGD  190

Query  553   FCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILF  404
             +CPSLKLKA D++MPRK+FPVW+LI +N  L++A I EW++GE  E+IL 
Sbjct  191   YCPSLKLKAEDYVMPRKNFPVWDLISQNPLLVKATIREWTDGESLEKILM  240



>dbj|BAJ88911.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=274

 Score =   337 bits (865),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 161/271 (59%), Positives = 202/271 (75%), Gaps = 3/271 (1%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFDKTIIDVDSDNWVVD LG T LFD+LL TMPWN+L+D +M E+HA GKT+ 
Sbjct  2     AGVVVVFDFDKTIIDVDSDNWVVDGLGATELFDRLLPTMPWNTLIDTVMGELHAQGKTLR  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             D+  VL+  PI P +V AI+A + LGCDLR++SDAN FFIE +L H G+R  FSEINTNP
Sbjct  62    DVADVLRAAPIDPHVVAAIRAAYSLGCDLRVLSDANRFFIEAVLDHHGLRGYFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGC--ARCPPNMCKSKIIERIQASMGK-EGKKRVIYLGD  566
               VD +GRLRI P HDFH+ PHGC    CPPNMCK ++++RI+AS    +G KR IYLGD
Sbjct  122   SRVDADGRLRIAPHHDFHAGPHGCGLGTCPPNMCKGQVLDRIRASSATADGTKRFIYLGD  181

Query  565   GIGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRI  386
             G GD+CPSL+L   DFMMPRK FPVWELI EN  LL+AE+H WS+G+D E  L  LI+R+
Sbjct  182   GRGDYCPSLRLAREDFMMPRKGFPVWELICENPGLLQAEVHPWSDGKDMEETLLRLISRV  241

Query  385   CIEDSQFLAAESKFQAISMQPCEALPKAIRV  293
              +E+SQ L  + K +++ +   + +P  + V
Sbjct  242   LVEESQLLPLDCKLESLPVAVQDGVPMPLGV  272



>gb|KFK43955.1| hypothetical protein AALP_AA1G196200 [Arabis alpina]
Length=329

 Score =   339 bits (869),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 163/250 (65%), Positives = 197/250 (79%), Gaps = 16/250 (6%)
 Frame = -1

Query  1093  GTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGD  914
               V+VFDFDKTIIDVDSDNWVVDELGFT LFD+LL TMPWNSLMDRMMKE+H +GKTI +
Sbjct  6     NVVIVFDFDKTIIDVDSDNWVVDELGFTDLFDKLLPTMPWNSLMDRMMKELHDHGKTIDE  65

Query  913   IERVLQGVPIHPRIVPAIKAVHGLG---------------CDLRIVSDANLFFIETILKH  779
             I++VL+ VPIHPR++ AIK+ H LG               C+LRIVSDAN  FIETI++ 
Sbjct  66    IKQVLRRVPIHPRVITAIKSAHALGGKDNRVLNHPTLILRCELRIVSDANTLFIETIVED  125

Query  778   LGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGK  599
             LGI E FSEINTNP  VDE+GRL+I P+HDF  S HGC+RCPPNMCK  IIERIQAS+ K
Sbjct  126   LGISEFFSEINTNPVLVDEQGRLKIFPYHDFTKSSHGCSRCPPNMCKGLIIERIQASLTK  185

Query  598   EGKK-RVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGED  422
             EG K +++YLGDG GD+CPSLKLK  D+MMPRK+FPVW+LI +N +L++A + +W++GE 
Sbjct  186   EGNKMKMVYLGDGAGDYCPSLKLKIEDYMMPRKNFPVWDLISQNPNLVKATVRDWTDGEA  245

Query  421   FERILFHLIN  392
              ERIL   IN
Sbjct  246   MERILMGTIN  255



>ref|XP_009416458.1| PREDICTED: inorganic pyrophosphatase 3-like [Musa acuminata subsp. 
malaccensis]
Length=275

 Score =   335 bits (860),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 160/273 (59%), Positives = 198/273 (73%), Gaps = 4/273 (1%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFDKTIID DSDNWVVD LG   +F++L+ TMPWNSLMDRMM+E+HA G++I 
Sbjct  2     AGIVVVFDFDKTIIDCDSDNWVVDRLGVADVFERLIPTMPWNSLMDRMMRELHAGGRSIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI   L+  P+ P +V AIK  + LGCDLR+VSDAN FFI+TIL+H G+ ECF EINTNP
Sbjct  62    DIAACLRTAPLDPHVVEAIKTAYALGCDLRVVSDANQFFIDTILRHHGLLECFKEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
               VDEEGRLRI P HDF +  HGC+ CPPNMCK KII+RI+A+   EGKKR IYLGDG G
Sbjct  122   SIVDEEGRLRIFPCHDFTTRSHGCSICPPNMCKGKIIDRIRAAAFVEGKKRFIYLGDGQG  181

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             D+CPSL L   D++MPRK +P+W LI  +   L AE+HEWS GE+ E++L  L++R    
Sbjct  182   DYCPSLGLSEEDYVMPRKHYPLWSLICNSPQPLRAEVHEWSTGEELEKVLLQLVDRSIDA  241

Query  376   D----SQFLAAESKFQAISMQPCEALPKAIRVP  290
             D    SQ  + + K + +   P E LP  +RVP
Sbjct  242   DRNCPSQMFSVDCKPKMVPASPTETLPLPLRVP  274



>ref|XP_009105956.1| PREDICTED: inorganic pyrophosphatase 1-like [Brassica rapa]
 emb|CDX96443.1| BnaA07g30540D [Brassica napus]
Length=291

 Score =   335 bits (860),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 161/239 (67%), Positives = 195/239 (82%), Gaps = 3/239 (1%)
 Frame = -1

Query  1114  VCSPMAAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHA  935
              C+      VVVFDFDKTIIDVDSDNWV+DELGFT LF+QLL TMPWN++MD MMKE+H 
Sbjct  2     ACNNNKNNIVVVFDFDKTIIDVDSDNWVIDELGFTDLFNQLLPTMPWNTVMDCMMKELHD  61

Query  934   NGKTIGDIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFS  755
              GKTI +I++ L+ +PIHPRIVPAIKA H LGC+LRIVSDAN+FFIET+++HLGI E FS
Sbjct  62    QGKTIEEIKQALRTIPIHPRIVPAIKAAHALGCELRIVSDANMFFIETMVEHLGISELFS  121

Query  754   EINTNPGYVDEEGRLRILPFHDFHSSPHGC--ARCPPNMCKSKIIERIQASMGKEGKKRV  581
             EIN+NPG+VDE   LRI P+HDF +S HGC    CPPNMCK  +IERIQ S+ KEGKK+ 
Sbjct  122   EINSNPGFVDEHDTLRISPYHDFTNSSHGCTLGTCPPNMCKGLVIERIQDSLAKEGKKK-  180

Query  580   IYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILF  404
             IYLGDG GD+CPSLKLKA D++MPRK+FPVW+LI +N  L++A I EW++GE  E+IL 
Sbjct  181   IYLGDGAGDYCPSLKLKAEDYVMPRKNFPVWDLISQNPLLVKATIREWTDGESLEKILM  239



>ref|XP_010106679.1| Inorganic pyrophosphatase 2 [Morus notabilis]
 gb|EXC11128.1| Inorganic pyrophosphatase 2 [Morus notabilis]
Length=252

 Score =   333 bits (855),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 162/242 (67%), Positives = 190/242 (79%), Gaps = 1/242 (0%)
 Frame = -1

Query  1087  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  908
             VVVFDFDKTII+ D +N VVDELG T LF+QLL TM WNSLM+RMMKE+H  GKTI DI 
Sbjct  5     VVVFDFDKTIIECDCENLVVDELGATDLFNQLLPTMTWNSLMNRMMKELHEQGKTIEDIV  64

Query  907   RVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYV  728
              VL+  PIHPR+V AIKA H LGCDLRIVSDAN FFIETIL+HLG+ ECF+EI TNP +V
Sbjct  65    EVLKQTPIHPRVVAAIKAAHALGCDLRIVSDANAFFIETILEHLGLMECFTEIYTNPSFV  124

Query  727   DEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFC  548
             DEEGRLRI PFH  +  P G   CPPNMCK  I+ERI+ASM  EG KR IYLGDG+GD+C
Sbjct  125   DEEGRLRIFPFH-VNKCPLGWNLCPPNMCKGLILERIRASMAAEGNKRFIYLGDGVGDYC  183

Query  547   PSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQ  368
             PSLKLK  DF+MPRK+FPVWELI +N  L++A I  W++GE+ E+ L  LI+ I IE++ 
Sbjct  184   PSLKLKGRDFVMPRKNFPVWELISKNPQLIKANIQAWTDGEELEKTLLSLIDTIFIEENA  243

Query  367   FL  362
              L
Sbjct  244   SL  245



>ref|XP_006426490.1| hypothetical protein CICLE_v10026265mg [Citrus clementina]
 gb|ESR39730.1| hypothetical protein CICLE_v10026265mg [Citrus clementina]
Length=272

 Score =   334 bits (857),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 161/237 (68%), Positives = 188/237 (79%), Gaps = 4/237 (2%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             A  VVVFDFDKTIID DSDNWVVDEL  T LF+QLL TMPWNSLM RMM+E+HA GKTI 
Sbjct  2     ADIVVVFDFDKTIIDCDSDNWVVDELHATELFNQLLPTMPWNSLMGRMMEELHAQGKTIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI  VL+  PIHP I+ AIKA H LGCDL+IVSDAN+FFIETILKH GI E FSEINTN 
Sbjct  62    DIAEVLKRAPIHPSIISAIKAAHDLGCDLKIVSDANVFFIETILKHHGIWELFSEINTNS  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCAR--CPPNMCKSKIIERIQASMGKEGKKRVIYLGDG  563
              +VDEEGRLRI P HDF  S H C+   CPPNMCK  +IE+IQ SM KE  K++IY+GDG
Sbjct  122   SFVDEEGRLRIFPHHDFTKSSHACSTKICPPNMCKGVVIEKIQESMSKE--KKIIYIGDG  179

Query  562   IGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLIN  392
              GDFCPSLKLK  D++MPRK+FPVW+LI +N  L++A+IHEW +G++ + +L  LIN
Sbjct  180   TGDFCPSLKLKQTDYIMPRKNFPVWDLICQNHKLIKADIHEWYDGQELQHVLLQLIN  236



>emb|CDJ26592.1| unnamed protein product [Triticum aestivum]
Length=275

 Score =   333 bits (855),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 159/272 (58%), Positives = 205/272 (75%), Gaps = 4/272 (1%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFDKTIIDVDSDNWVVD LG T LFD+LL TMPWN+L+D +M E+HA G+T+ 
Sbjct  2     AGVVVVFDFDKTIIDVDSDNWVVDGLGATELFDRLLPTMPWNTLIDTVMGELHAQGRTLR  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             D+  VL+  PI P++V AI+A + LGCDLRI+SDAN FFIET+L H G+R CFSEINTNP
Sbjct  62    DVADVLRAAPIDPQVVAAIRAAYSLGCDLRILSDANRFFIETVLDHHGLRGCFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGC--ARCPPNMCKSKIIERIQ--ASMGKEGKKRVIYLG  569
               VD +GRLRI P HDFH++PHGC    CPPNMCK ++++RI+  A+     +KR IYLG
Sbjct  122   SRVDADGRLRIAPHHDFHAAPHGCGLGTCPPNMCKGQVLDRIRASAAAADGARKRFIYLG  181

Query  568   DGIGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINR  389
             DG GD+CPSL+L   DFMMPRK +PVW+LI EN  LL+AE+H WS+G+D E  L  LI+R
Sbjct  182   DGRGDYCPSLRLAREDFMMPRKGYPVWDLICENPGLLQAEVHLWSDGKDMEETLLRLISR  241

Query  388   ICIEDSQFLAAESKFQAISMQPCEALPKAIRV  293
             + +E+SQ L  + K +++ +   + +P  + V
Sbjct  242   VLVEESQLLPLDCKLESLPVAVQDGMPMPLGV  273



>ref|XP_010097079.1| Inorganic pyrophosphatase 2 [Morus notabilis]
 gb|EXB66880.1| Inorganic pyrophosphatase 2 [Morus notabilis]
Length=277

 Score =   333 bits (854),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 164/279 (59%), Positives = 197/279 (71%), Gaps = 11/279 (4%)
 Frame = -1

Query  1102  MAAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKT  923
             MA   V VFDFDKTIID DSDNWVV+ELGF  LF QLL TMPWNSLMDRMM EIH+ GKT
Sbjct  1     MANDVVFVFDFDKTIIDCDSDNWVVEELGFNDLFTQLLPTMPWNSLMDRMMMEIHSQGKT  60

Query  922   IGDIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINT  743
             I DI   L+  PI P I+ AIK+ H  GCDLRI+SDAN FFIET+LKH GI +CF EI T
Sbjct  61    IHDIAECLKRAPIDPTIISAIKSAHAFGCDLRILSDANAFFIETVLKHHGILDCFKEIKT  120

Query  742   NPGYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDG  563
             NP ++D EGRLRI P+HDF+SS HGC  CPPNMCK  I+ER++AS+  EGKKR ++ GDG
Sbjct  121   NPSHIDGEGRLRISPYHDFNSSSHGCKICPPNMCKGAILERMRASLSAEGKKRFVHAGDG  180

Query  562   IGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRIC  383
               DFC  LKL+ G++++PRKDFPVW++I +N  L++A I EWSN E+FE +L   IN   
Sbjct  181   TADFCAGLKLEEGEYLLPRKDFPVWDVICKNPMLIKANIREWSNWEEFEAVLLDTINGFL  240

Query  382   IEDSQFLAAES--------KFQAISMQPCEALPKAIRVP  290
               D    AA +        KFQ  S+    A   A+RVP
Sbjct  241   FADDSSTAARADQVIPVDCKFQQSSIS---ARQSALRVP  276



>ref|XP_010471347.1| PREDICTED: inorganic pyrophosphatase 1-like [Camelina sativa]
Length=291

 Score =   333 bits (854),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 153/226 (68%), Positives = 187/226 (83%), Gaps = 6/226 (3%)
 Frame = -1

Query  1078  FDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIERVL  899
             FDFD    +VDSDNWV+DELGFT LF+QLL TMPWN+LMDRMMKE+H  GKTI +I++ L
Sbjct  16    FDFD----NVDSDNWVIDELGFTDLFNQLLPTMPWNTLMDRMMKELHDQGKTIEEIKQAL  71

Query  898   QGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEE  719
             + +PIHPR+VPAIK+ H LGC+LRIVSDAN+FFIETI++HLGI E FSEIN+NPGYVDE 
Sbjct  72    RTIPIHPRVVPAIKSAHELGCELRIVSDANMFFIETIVEHLGISEFFSEINSNPGYVDER  131

Query  718   GRLRILPFHDFHSSPHGCAR--CPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCP  545
             G LRI P+HDF  +PHGC+   CPPNMCK  IIERIQ S+ KEGK ++IYLGDG GD+CP
Sbjct  132   GTLRISPYHDFTKTPHGCSNSTCPPNMCKGLIIERIQQSLAKEGKNKMIYLGDGAGDYCP  191

Query  544   SLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERIL  407
             SLKL A D++MPRK+FPVW+LI +N  L++A I EW++G+  E IL
Sbjct  192   SLKLTAEDYVMPRKNFPVWDLISQNPMLIKAAIREWTDGQSLEMIL  237



>gb|EMT33032.1| Putative phosphatase phospho1 [Aegilops tauschii]
Length=271

 Score =   331 bits (848),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 156/269 (58%), Positives = 199/269 (74%), Gaps = 4/269 (1%)
 Frame = -1

Query  1093  GTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGD  914
             G VVVFDFDKTIIDVDSDNWVVD LG T LFD+LL TMPWN+L+D +M E+HA G+ + D
Sbjct  3     GVVVVFDFDKTIIDVDSDNWVVDGLGATELFDRLLPTMPWNTLIDTVMGELHAQGRPLRD  62

Query  913   IERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPG  734
             +  VL+  PI P +V AI+A H LGCDLR++SDAN FFIE +L H G+R CFSEINTNP 
Sbjct  63    VADVLRAAPIDPHVVAAIRAAHSLGCDLRVLSDANRFFIEAVLDHHGLRGCFSEINTNPS  122

Query  733   YVDEEGRLRILPFHDFHSSPHGC--ARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGI  560
              VD +GRLRI P HDFH+ PHGC    CPPNMCK ++++RI+AS   + +KR IYLGDG 
Sbjct  123   RVDADGRLRIAPHHDFHAGPHGCGLGTCPPNMCKGQVLDRIRAS--ADARKRFIYLGDGR  180

Query  559   GDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICI  380
             GD+CPSL+L   DFMMPRK FPVW+LI EN  LL+AE+H WS+G+D +  L  LI+R+ +
Sbjct  181   GDYCPSLRLAREDFMMPRKGFPVWDLICENPGLLQAEVHPWSDGKDMQETLLRLISRVLV  240

Query  379   EDSQFLAAESKFQAISMQPCEALPKAIRV  293
             E+S  L  + K +++     + +P  + V
Sbjct  241   EESTLLPLDCKLESLPAAVQDGMPMPLGV  269



>ref|XP_010540076.1| PREDICTED: inorganic pyrophosphatase 2-like [Tarenaya hassleriana]
Length=285

 Score =   330 bits (847),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 154/229 (67%), Positives = 193/229 (84%), Gaps = 2/229 (1%)
 Frame = -1

Query  1087  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  908
             VV+FDFDKTIIDVDSDNWV+DELGFT LF+QLL +MPWNSLMDRMM+E+     TI D++
Sbjct  12    VVIFDFDKTIIDVDSDNWVLDELGFTDLFNQLLPSMPWNSLMDRMMEELRDEDVTIDDVK  71

Query  907   RVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYV  728
             RVL+ +PIHPR+VPAIK+ H LGC+LRIVSDAN+FFIET+L+HLGI++ FSEINTNPG++
Sbjct  72    RVLRTIPIHPRVVPAIKSAHALGCELRIVSDANMFFIETVLEHLGIKDLFSEINTNPGFI  131

Query  727   DEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMG--KEGKKRVIYLGDGIGD  554
             DE GRLRI P+HDF  S HGC+RCPPNMCK+ +IE+IQ S+    E KK++IYLGDG GD
Sbjct  132   DEHGRLRISPYHDFTKSSHGCSRCPPNMCKALVIEKIQDSLSKEAEKKKKIIYLGDGAGD  191

Query  553   FCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERIL  407
             +CP+LKL   D+MMPRK++PVW+LI EN  L+ A+I EW +GE  E++L
Sbjct  192   YCPALKLDDVDYMMPRKNYPVWDLISENTMLISAKIREWIDGETLEKVL  240



>ref|XP_004291030.1| PREDICTED: inorganic pyrophosphatase 2-like [Fragaria vesca subsp. 
vesca]
Length=278

 Score =   330 bits (845),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 161/273 (59%), Positives = 203/273 (74%), Gaps = 5/273 (2%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             A  VV+FDFDKTIID DSDNWVV+ELG   LF QLLH  PWN++MDRMM E+H  GKTI 
Sbjct  2     ARLVVIFDFDKTIIDCDSDNWVVEELGINHLFTQLLHNFPWNAIMDRMMTELHHRGKTIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DIE  L+ VP+HP I  AI++VH LGCDLRIVSDAN+FFIETILKH G+ + FSEINTNP
Sbjct  62    DIEECLKKVPLHPSIASAIESVHALGCDLRIVSDANVFFIETILKHHGLLDYFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
             G+VDE+GRLRILP++DF SS HGC  CP NMCK  ++E+I+AS+  +GKK+++Y+GDG  
Sbjct  122   GFVDEQGRLRILPYYDFSSSSHGCNICPSNMCKGLVMEKIRASVSADGKKQLVYVGDGTP  181

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             DFC  LKL+ GD +MPRKDFP+ +LI  N  L++A+IHEWSN ++    L   +N   I+
Sbjct  182   DFCAGLKLEEGDVLMPRKDFPICDLISANPLLIKAKIHEWSNWDELSTNLLSTVNNALID  241

Query  376   DS---QFLAAESKFQ--AISMQPCEALPKAIRV  293
             +S     L    K+Q  +IS+   EAL KA+ V
Sbjct  242   ESAKTDQLVPLCKYQNSSISVTAHEALQKALPV  274



>ref|XP_006466068.1| PREDICTED: inorganic pyrophosphatase 1-like isoform X1 [Citrus 
sinensis]
Length=272

 Score =   327 bits (837),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 157/234 (67%), Positives = 185/234 (79%), Gaps = 4/234 (2%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             A  VVVFDFDKTIID DSDNWVVDEL  T LF+QLL TMPWNSLM RMM+E+HA GKTI 
Sbjct  2     ADIVVVFDFDKTIIDCDSDNWVVDELHATELFNQLLPTMPWNSLMGRMMEELHAQGKTIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI  VL+  PIHP I+ A+KA H LGCDL+IVSDANLFFIETILKH GI E FSEINTN 
Sbjct  62    DIVEVLKRAPIHPSIISAVKAAHDLGCDLKIVSDANLFFIETILKHHGIWELFSEINTNS  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCAR--CPPNMCKSKIIERIQASMGKEGKKRVIYLGDG  563
              +VDEEGRL+I P HDF  S H C+   CPPNMCK  +IE+IQ SM KE  K++IY+GDG
Sbjct  122   SFVDEEGRLKIFPHHDFTKSSHACSTNICPPNMCKGVVIEKIQESMSKE--KKIIYIGDG  179

Query  562   IGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFH  401
              GDFCPSLKLK  D++MPRK+FPVW+LI +N  L++A+IHEW +G++ + +L  
Sbjct  180   TGDFCPSLKLKQTDYIMPRKNFPVWDLICQNHKLIKADIHEWYDGQELQHVLLQ  233



>ref|XP_009415365.1| PREDICTED: inorganic pyrophosphatase 2-like [Musa acuminata subsp. 
malaccensis]
Length=279

 Score =   326 bits (835),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 162/277 (58%), Positives = 195/277 (70%), Gaps = 8/277 (3%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             A  VVVFDFDKTIID DSDNWVVD LG T LFD+LL TMPWNS MDRMM E H+ G+TI 
Sbjct  2     ANVVVVFDFDKTIIDCDSDNWVVDHLGGTQLFDELLKTMPWNSAMDRMMGEFHSQGRTIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             +IE  L+  P+    + AIK+ + L C+LRIVSDAN FFI TIL+H  +   FSEINTNP
Sbjct  62    EIEESLRRAPLPANTIAAIKSAYSLECELRIVSDANRFFINTILEHHKLMSYFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
             GYVDE GRLRI P HDF +SPHGC+ CPPNMCKS IIER+QAS   EG+KR IYLGDG G
Sbjct  122   GYVDEVGRLRIFPHHDFETSPHGCSLCPPNMCKSTIIERMQASPLVEGRKRFIYLGDGKG  181

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKEN--RSLLEAEIHEWSNGEDFERILFHLINRIC  383
             D+CPSL+L   D++MPRK +P+WELI +N     L A IHEWS+ E+ E++L  LIN   
Sbjct  182   DYCPSLRLNKEDYVMPRKKYPLWELIVDNPPEGALRASIHEWSDAEELEKVLLRLINESV  241

Query  382   IE-----DSQFLAAESKFQAISMQPCE-ALPKAIRVP  290
                    D+Q ++ + KFQ   +   E  LP  + VP
Sbjct  242   TADRGNVDNQLVSVDCKFQTTPLSSHEDNLPNPLPVP  278



>gb|ACU18702.1| unknown [Glycine max]
Length=198

 Score =   322 bits (826),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 150/197 (76%), Positives = 173/197 (88%), Gaps = 0/197 (0%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             +G VVVFDFDKTI+DVDSDNWVVD+LGFT LF+QLL TMPWNSLMDRMM E+H+NGKTI 
Sbjct  2     SGIVVVFDFDKTIVDVDSDNWVVDDLGFTDLFNQLLPTMPWNSLMDRMMMELHSNGKTIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DIE VL  +P+HPR++PAI+A H LGCDLRIVSDAN+FFIETILKHLGIRE FSEINTNP
Sbjct  62    DIEEVLHRIPLHPRVIPAIQAAHALGCDLRIVSDANVFFIETILKHLGIREYFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
             GYV+EEGRLRI P HDF+ + HGC+ CPPNMCK  II+RIQ S+ +EG KR+IYLGDG G
Sbjct  122   GYVNEEGRLRIQPCHDFNKASHGCSLCPPNMCKGLIIDRIQDSISQEGNKRMIYLGDGSG  181

Query  556   DFCPSLKLKAGDFMMPR  506
             D+CPSL+LK  +FMMPR
Sbjct  182   DYCPSLRLKERNFMMPR  198



>ref|XP_011009701.1| PREDICTED: inorganic pyrophosphatase 3-like [Populus euphratica]
Length=313

 Score =   326 bits (835),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 156/273 (57%), Positives = 197/273 (72%), Gaps = 7/273 (3%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             A  VVVFDFDKTIID DSDNWVV+EL   GLF QLL ++PWN LMD+MM E+H+ GKTI 
Sbjct  36    AKVVVVFDFDKTIIDCDSDNWVVEELDVHGLFAQLLPSLPWNRLMDKMMMELHSRGKTIQ  95

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI   L+ VP+HPRI+  IK+ H  GCDLR+VSD+N FFIET+LKH G+ +CFSEINTNP
Sbjct  96    DIAECLKKVPLHPRIISTIKSAHASGCDLRVVSDSNYFFIETVLKHNGLMDCFSEINTNP  155

Query  736   GYVDEEGRLRILPFHDFHSSP-HGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGI  560
              YVD EGRLRIL +HD +  P HGC  CPPNMCK  +++RIQAS+  EG+K+ IY+GDG 
Sbjct  156   SYVDAEGRLRILQYHDVNKFPSHGCTSCPPNMCKGLVMKRIQASVSAEGEKQFIYVGDGK  215

Query  559   GDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICI  380
              DFCP+L LK  D +MPRK+FP+WELI  N+ L+EA I EWS+ E+ E  L +L N I I
Sbjct  216   NDFCPALTLKETDALMPRKNFPLWELICNNKMLVEANIQEWSDWEELETKLHNLTNTIFI  275

Query  379   EDS------QFLAAESKFQAISMQPCEALPKAI  299
             E+       Q +  + KF+  S+    A+ + +
Sbjct  276   EEKCSVRSDQLVPVDCKFETSSISAPAAVNRNV  308



>ref|XP_009385786.1| PREDICTED: inorganic pyrophosphatase 2-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=277

 Score =   323 bits (829),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 164/276 (59%), Positives = 201/276 (73%), Gaps = 5/276 (2%)
 Frame = -1

Query  1102  MAAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKT  923
             MA   +VVFDFDKTIID DSDNWV+D+LG T LFDQ+L TMPWNS MDR+M  +H+ G+T
Sbjct  1     MADNVIVVFDFDKTIIDCDSDNWVIDDLGGTQLFDQMLQTMPWNSAMDRVMGALHSQGRT  60

Query  922   IGDIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINT  743
             + +I   L+  P+    V A+KA + LGC+LRIVSDAN FFIETIL+H G+   FSEINT
Sbjct  61    VDEITASLRRAPLPAHTVAAVKAAYALGCELRIVSDANRFFIETILEHHGLGSYFSEINT  120

Query  742   NPGYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDG  563
             NPGYVDEEGRLRILP+HDF +S HGC  CPPNMCKS IIERIQAS   EG+KR IYLGDG
Sbjct  121   NPGYVDEEGRLRILPYHDFKTSSHGCGLCPPNMCKSTIIERIQASASLEGRKRFIYLGDG  180

Query  562   IGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLI-NRI  386
              GD+CP+L+L   D++MPRK+ P WELI  N   L AEIH W + E+ E +L  LI + I
Sbjct  181   KGDYCPALRLSEEDYVMPRKNHPAWELILANPRALRAEIHGWGDAEELEEVLLRLIGDSI  240

Query  385   CIEDS---QFLAAESKFQ-AISMQPCEALPKAIRVP  290
                 S   + ++A+ KFQ  + +   EALPK +RVP
Sbjct  241   SARGSDANRLISADCKFQTTMPLSSHEALPKPLRVP  276



>ref|NP_001242832.1| uncharacterized protein LOC100789743 [Glycine max]
 gb|ACU21395.1| unknown [Glycine max]
Length=277

 Score =   323 bits (829),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 157/276 (57%), Positives = 197/276 (71%), Gaps = 8/276 (3%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VV+FDFD TII+ DSDNWV+DE G T  F QLL  M WN LMD+MM E+H+ GKTI 
Sbjct  2     AGIVVIFDFDSTIIECDSDNWVLDEFGLTEKFYQLLPNMLWNPLMDKMMNELHSQGKTIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI +VL   P+HPRIVPAIKA + LGC+L+IVSDAN+FFIETILKH G+  CFSE+  NP
Sbjct  62    DIVQVLNRTPMHPRIVPAIKAAYSLGCELKIVSDANIFFIETILKHHGVWNCFSEVTANP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
              YV+EEGRLRI P+HD+    HGC  CPPNMCK  I ERIQ S+   GKK  IYLGDG G
Sbjct  122   SYVNEEGRLRISPYHDYLKCSHGCNLCPPNMCKGMITERIQNSVDAAGKK-FIYLGDGSG  180

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLI------  395
             DFCPSLKLK  D++MPRK+FP+ +L+ EN   ++AE+H W +GE+   +L H I      
Sbjct  181   DFCPSLKLKDRDYLMPRKNFPLCDLVSENSKHIKAEVHAWRDGEELYDVLLHFIDKAIGE  240

Query  394   -NRICIEDSQFLAAESKFQAISMQPCEALPKAIRVP  290
              N+  I  +  ++ + K  +IS++  + LP+AI VP
Sbjct  241   GNKNIISSTPIVSVDCKLGSISIEAHKPLPRAIPVP  276



>ref|XP_010924487.1| PREDICTED: inorganic pyrophosphatase 2-like [Elaeis guineensis]
Length=248

 Score =   322 bits (824),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 150/246 (61%), Positives = 186/246 (76%), Gaps = 0/246 (0%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG +VVFDFD+T+ID DSD+WVV+ELG T LF  L   M WNSLM+RMM+E+H+ GKTI 
Sbjct  2     AGIIVVFDFDRTMIDCDSDSWVVNELGATELFQSLRPAMSWNSLMERMMRELHSQGKTIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             +I   L+ +P  P ++ AIK+ +  GC+LR+VSDANLFFIETILKH G+ E FSEINTNP
Sbjct  62    EIADCLKRIPFDPHVIAAIKSAYAHGCELRVVSDANLFFIETILKHHGLLEYFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
              YVDEEGRLRI P+HDF +S HGC+ C PNMCK KIIERIQA    E KKR IYLGDG G
Sbjct  122   SYVDEEGRLRIFPYHDFTTSLHGCSLCLPNMCKGKIIERIQAQASAERKKRFIYLGDGRG  181

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             D+CPSL+L   D +MPRK++P+W+LI +N    +AE+HEWSN E+ +RIL  LI+R    
Sbjct  182   DYCPSLRLSEEDHVMPRKNYPLWKLIGDNPQQFKAEVHEWSNAEELQRILLQLIDRSITV  241

Query  376   DSQFLA  359
             D +  A
Sbjct  242   DRKNAA  247



>ref|XP_002458417.1| hypothetical protein SORBIDRAFT_03g033100 [Sorghum bicolor]
 gb|EES03537.1| hypothetical protein SORBIDRAFT_03g033100 [Sorghum bicolor]
Length=278

 Score =   322 bits (824),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 151/250 (60%), Positives = 193/250 (77%), Gaps = 9/250 (4%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFDKTIIDVDSDNWVVD LGFT LF++LL TMPWN+LMD MM E+HA GKT+G
Sbjct  2     AGIVVVFDFDKTIIDVDSDNWVVDNLGFTELFERLLPTMPWNTLMDTMMGELHAAGKTLG  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             D+  VL+  PI PR+  AIKA + LGCDLR++SDAN FFIET+L+H GIR CFS+INTNP
Sbjct  62    DVAEVLRAAPIDPRVPAAIKAAYALGCDLRVLSDANAFFIETVLEHHGIRGCFSQINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGC--ARCPPNMCKSKIIERI--QASMGKEGK--KRVIY  575
              +VD +GRLRI P   +H++PHGC    CPPNMCK  +++RI  +A+ G  G+  KRVIY
Sbjct  122   SHVDADGRLRIGP---YHAAPHGCGVGTCPPNMCKGLVLDRILREAAAGTTGRSTKRVIY  178

Query  574   LGDGIGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLI  395
             LGDG GD+CPSL+L   DFMMPR+ +PVW+LI+E+ + ++AE+H W++G D E  L  L+
Sbjct  179   LGDGRGDYCPSLRLAREDFMMPRRGYPVWDLIREDPARVQAEVHPWADGADLEETLLRLV  238

Query  394   NRICIEDSQF  365
              R  +E++  
Sbjct  239   GRALVEEAAL  248



>ref|XP_003531626.1| PREDICTED: inorganic pyrophosphatase 2-like [Glycine max]
Length=276

 Score =   322 bits (824),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 152/275 (55%), Positives = 198/275 (72%), Gaps = 7/275 (3%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VV+FDFD TII+ DSDNWV+DE G T  F QLL +M WN LMD+MM E+H+ GKTI 
Sbjct  2     AGIVVIFDFDSTIIECDSDNWVLDETGLTEKFYQLLPSMAWNPLMDKMMNELHSQGKTIQ  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI  +L   P+HPR VPAI+A + LGC L+IVSDAN+FFIETILKH G+  CFSE+  NP
Sbjct  62    DIVEILNRTPMHPRTVPAIEAAYSLGCHLKIVSDANIFFIETILKHHGVWNCFSEVIANP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
              +V+ EGRL I P+HD+  S HGC  CPPNMCK  +IERIQ S+   GKK++IYLGDG G
Sbjct  122   SHVN-EGRLNICPYHDYLKSSHGCNLCPPNMCKGLVIERIQNSLAAAGKKKIIYLGDGNG  180

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             DFCPSL+LK  D++MPRKDFP+ +L+ +N + ++AE+H W +G++ E +L H+IN+   E
Sbjct  181   DFCPSLRLKDSDYLMPRKDFPLCDLVSKNSNKIKAEVHGWRDGKELEHVLLHVINKAIGE  240

Query  376   DS------QFLAAESKFQAISMQPCEALPKAIRVP  290
              S      Q ++ + K   I +   + LPKA+ VP
Sbjct  241   GSNINNSTQKVSVDCKMGPIPIDTLQPLPKALSVP  275



>ref|XP_003569699.1| PREDICTED: inorganic pyrophosphatase 1-like [Brachypodium distachyon]
Length=270

 Score =   320 bits (821),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 159/273 (58%), Positives = 201/273 (74%), Gaps = 12/273 (4%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFDKTIIDVDSDNWVVD LG T LFD+LL TMPWN+L+D MM E+HA GKT+ 
Sbjct  2     AGVVVVFDFDKTIIDVDSDNWVVDSLGATELFDRLLPTMPWNALIDTMMGELHARGKTVH  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             D+  VL+  PI PR+  AIKA +GLGCDLR++SDAN FFIETIL H G+R CFSEINTNP
Sbjct  62    DVAEVLRSAPIDPRVGAAIKAAYGLGCDLRVLSDANGFFIETILDHHGLRGCFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGC--ARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDG  563
               VD +GRLRI P   +H++PHGC    CPPNMCK ++++RI+AS      KRVIYLGDG
Sbjct  122   SLVDADGRLRIGP---YHATPHGCGVGTCPPNMCKGQVLDRIRAS---SVGKRVIYLGDG  175

Query  562   IGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRIC  383
              GD+CPSL+L   DF+MPR+ FPVW+LI EN  LL+AE+H WS+G D E  L  L+ ++ 
Sbjct  176   RGDYCPSLRLGRDDFVMPRRGFPVWDLICENPGLLQAEVHPWSDGGDMEETLLRLVRKVL  235

Query  382   IEDSQFLAAE-SKFQAISMQPCEALPKAIRVPF  287
             +E+S+ L  +  K +++   P  A+   + +P 
Sbjct  236   VEESRLLPLDCCKLESL---PVAAVQDGMPMPL  265



>ref|XP_006644635.1| PREDICTED: inorganic pyrophosphatase 1-like [Oryza brachyantha]
Length=278

 Score =   320 bits (820),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 154/229 (67%), Positives = 185/229 (81%), Gaps = 4/229 (2%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFDKTIIDVDSDNWVVD LG T  F++LL TMPWN+LMD MM E+HA GKT G
Sbjct  2     AGIVVVFDFDKTIIDVDSDNWVVDGLGATEEFERLLPTMPWNTLMDTMMGELHARGKTAG  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             D+  VL+  P+ P +V AIKA +GLGCDLRI+SDAN FFIETIL H G+   FSEINTNP
Sbjct  62    DVAAVLRAAPLDPCVVDAIKACYGLGCDLRILSDANRFFIETILDHHGLGGYFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCAR--CPPNMCKSKIIERIQASMGKEGKKRVIYLGDG  563
             G VD +GRLRI P+HDFH++PHGC    CPPNMCK ++++RI+AS G +  KRVIYLGDG
Sbjct  122   GAVDGDGRLRIAPYHDFHAAPHGCGLGICPPNMCKGQVLDRIRASAGAD--KRVIYLGDG  179

Query  562   IGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFE  416
              GD+CPSL+L  GDFMMPRK FPVW+LI E+ SLL+AE+H W++G++ E
Sbjct  180   RGDYCPSLRLGRGDFMMPRKGFPVWDLICEDPSLLQAEVHPWTDGQEME  228



>ref|XP_006582843.1| PREDICTED: uncharacterized protein LOC100306469 isoform X1 [Glycine 
max]
Length=276

 Score =   320 bits (819),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 152/275 (55%), Positives = 202/275 (73%), Gaps = 7/275 (3%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VV+FDFD TII+ DSDNWV+DE G T  F QLL +  WN LMD+MM E+H+ GKTI 
Sbjct  2     AGIVVIFDFDSTIIECDSDNWVLDETGLTEKFYQLLPSTHWNPLMDKMMNELHSQGKTIQ  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI ++L   P+HPRIVPAI+A + LGCDL+IVSDAN+FFIETILKH G+  CFS++  NP
Sbjct  62    DIVQILSRTPMHPRIVPAIEAAYSLGCDLKIVSDANIFFIETILKHHGVWNCFSDVIANP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
              +V+ EGRL I P+HD+  S HGC  CPPNMCK  +IERIQ S+   GKK++IYLGDG G
Sbjct  122   IHVN-EGRLNICPYHDYLKSSHGCNLCPPNMCKGLVIERIQNSLAAAGKKKLIYLGDGNG  180

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             DFCPSL+LK GD++MPRKDFP+ +L+ +N + ++AE+H W +G++ E +L H+IN+   E
Sbjct  181   DFCPSLRLKDGDYVMPRKDFPLCDLVSKNSNKIKAEVHGWRDGKELEHVLLHVINKEIGE  240

Query  376   ------DSQFLAAESKFQAISMQPCEALPKAIRVP  290
                    +Q ++ + K   I++   + LPKA+ VP
Sbjct  241   GNNINNSTQKVSVDCKMGPIAIDTRQPLPKALSVP  275



>ref|XP_006426491.1| hypothetical protein CICLE_v10026265mg [Citrus clementina]
 gb|ESR39731.1| hypothetical protein CICLE_v10026265mg [Citrus clementina]
Length=264

 Score =   319 bits (817),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 158/245 (64%), Positives = 184/245 (75%), Gaps = 12/245 (5%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             A  VVVFDFDKTIID DSDNWVVDEL  T LF+QLL TMPWNSLM RMM+E+HA GKTI 
Sbjct  2     ADIVVVFDFDKTIIDCDSDNWVVDELHATELFNQLLPTMPWNSLMGRMMEELHAQGKTIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI  VL+  PIHP I+ AIKA H LGCDL+IVSDAN+FFIETILKH GI E FSEINTN 
Sbjct  62    DIAEVLKRAPIHPSIISAIKAAHDLGCDLKIVSDANVFFIETILKHHGIWELFSEINTNS  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCAR--CPPNMCKSKIIERIQASMGKEGKKRVIYLGDG  563
              +VDEEGRLRI P HDF  S H C+   CPPNMCK         SM KE  K++IY+GDG
Sbjct  122   SFVDEEGRLRIFPHHDFTKSSHACSTKICPPNMCKE--------SMSKE--KKIIYIGDG  171

Query  562   IGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRIC  383
              GDFCPSLKLK  D++MPRK+FPVW+LI +N  L++A+IHEW +G++ + +L  LIN   
Sbjct  172   TGDFCPSLKLKQTDYIMPRKNFPVWDLICQNHKLIKADIHEWYDGQELQHVLLQLINSNI  231

Query  382   IEDSQ  368
             I   +
Sbjct  232   ISSKE  236



>ref|XP_002324759.2| hypothetical protein POPTR_0018s05070g [Populus trichocarpa]
 gb|EEF03324.2| hypothetical protein POPTR_0018s05070g [Populus trichocarpa]
Length=287

 Score =   320 bits (819),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/273 (56%), Positives = 198/273 (73%), Gaps = 7/273 (3%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             A  VVVFDFDKTIID DSDNWVV++L    LF QLL ++PWN LMD+MM E+H+ GKTI 
Sbjct  10    AKVVVVFDFDKTIIDCDSDNWVVEKLDVHDLFAQLLPSLPWNRLMDKMMMELHSRGKTIQ  69

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI   L+ VP++PR++ AIK+ +  GCDLRIVSD+N FFIET+LKH G+ +CFSEINTNP
Sbjct  70    DIAECLKKVPLNPRMISAIKSAYASGCDLRIVSDSNYFFIETVLKHNGLMDCFSEINTNP  129

Query  736   GYVDEEGRLRILPFHDFHSSP-HGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGI  560
              YVD EGRLRIL +HD +  P HGC  CPPNMCK  +++RIQAS+  EG+K+ IY+GDG 
Sbjct  130   SYVDGEGRLRILQYHDVNKFPSHGCTSCPPNMCKGLVMKRIQASVSAEGEKQFIYVGDGK  189

Query  559   GDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICI  380
              DFCP+L LK  D +MPRK+FP+WELI  N+ L+EA I EWS+ E+ E  L +L N I I
Sbjct  190   NDFCPALTLKETDALMPRKNFPLWELICNNKMLVEANIQEWSDWEELESKLHNLTNTIFI  249

Query  379   EDS------QFLAAESKFQAISMQPCEALPKAI  299
             E+       Q +  + KFQ  S+   +A+ + +
Sbjct  250   EEKCSVRADQLVPVDCKFQTSSISAPDAVNRNV  282



>ref|XP_008360958.1| PREDICTED: inorganic pyrophosphatase 2-like [Malus domestica]
Length=284

 Score =   319 bits (817),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 151/245 (62%), Positives = 182/245 (74%), Gaps = 0/245 (0%)
 Frame = -1

Query  1102  MAAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKT  923
             MAAG VVVFDFDKTIID DSDNWVVDELG   LF QLL TMPWN LMDRMM  +HA  KT
Sbjct  1     MAAGMVVVFDFDKTIIDCDSDNWVVDELGVDDLFTQLLPTMPWNPLMDRMMTALHARRKT  60

Query  922   IGDIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINT  743
             I DI   L+ VPIHP IV AIK+ H  GCDLR++SDAN FFI+ ILKH GI +CFSEI T
Sbjct  61    IQDISECLKRVPIHPNIVSAIKSAHAFGCDLRVLSDANDFFIDAILKHHGIMDCFSEIKT  120

Query  742   NPGYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDG  563
             NP ++DE+ RLRILPFHDF SS HGC  CPPNMCK  ++E+I+AS+  +GKK  IY+GDG
Sbjct  121   NPSFIDEQRRLRILPFHDFISSSHGCTLCPPNMCKGLVMEKIRASVSADGKKHFIYVGDG  180

Query  562   IGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRIC  383
               DFC  LKL+ GDF++PRK++P+W+LI  N  L +A+IHEW+  ++   IL + +    
Sbjct  181   APDFCAGLKLEEGDFLLPRKNYPIWDLISANPLLTKAKIHEWNECDELGTILLNTVKAFF  240

Query  382   IEDSQ  368
             I D  
Sbjct  241   IGDKS  245



>gb|KDP33737.1| hypothetical protein JCGZ_07308 [Jatropha curcas]
Length=273

 Score =   318 bits (814),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 144/268 (54%), Positives = 193/268 (72%), Gaps = 2/268 (1%)
 Frame = -1

Query  1087  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  908
             VV+FDFD+T+ID DSD+WVV ++G T LF++L  T+PWNSLMDRMMKE+H+ G+T+GDI 
Sbjct  5     VVIFDFDRTLIDGDSDSWVVTQMGLTPLFNRLRSTLPWNSLMDRMMKELHSQGRTVGDIT  64

Query  907   RVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYV  728
               L   P+ P ++ AIKA H LGCDLRI+SDAN FFIE IL H G+  CFS+I TNP   
Sbjct  65    ECLNQTPLQPPVIAAIKAAHALGCDLRIISDANQFFIEKILDHHGLLGCFSQITTNPSLE  124

Query  727   DEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFC  548
             D EGRLRI P+HD  S  HGC  CP N+CK  ++E+I AS+ +  + R IYLGDG GDFC
Sbjct  125   DGEGRLRIFPYHDLSSPTHGCNLCPSNLCKGLVLEQIHASISRNERTRFIYLGDGSGDFC  184

Query  547   PSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQ  368
             PSLKL  GD++MPRK +P+W  I+ N SL++AE+HEWS+GE+ E+IL HLIN I  +++ 
Sbjct  185   PSLKLGEGDYVMPRKKYPLWNRIRSNPSLIKAEVHEWSSGEELEKILLHLINTISSKENI  244

Query  367   FLAAESKFQAI--SMQPCEALPKAIRVP  290
               +  ++  +    +   +A P+ + VP
Sbjct  245   RSSNSNQLNSTECKISTHKAQPQTLYVP  272



>gb|KHN11301.1| Inorganic pyrophosphatase 2 [Glycine soja]
Length=277

 Score =   318 bits (814),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 152/276 (55%), Positives = 199/276 (72%), Gaps = 8/276 (3%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VV+FDFD TII+ DSDNWV+DE G T  F QLL +M WN LMD+MM E+H+ GKTI 
Sbjct  2     AGIVVIFDFDSTIIECDSDNWVLDETGLTEKFYQLLPSMAWNPLMDKMMNELHSQGKTIQ  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI  +L   P+HPR VPAI+A + LGC L+IVSDAN+FFIETILKH G+  CFSE+  NP
Sbjct  62    DIVEILNRTPMHPRTVPAIEAAYSLGCHLKIVSDANIFFIETILKHHGVWNCFSEVIANP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSK-IIERIQASMGKEGKKRVIYLGDGI  560
              +V+ EGRL I P+HD+  S HGC  CPPNMCK+  +IERIQ S+   GKK++IYLGDG 
Sbjct  122   SHVN-EGRLNICPYHDYLKSSHGCNLCPPNMCKAGLVIERIQNSLAAAGKKKIIYLGDGN  180

Query  559   GDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICI  380
             GDFCPSL+LK  D++MPRKDFP+ +L+ +N + ++AE+H W +G++ E +L H+IN+   
Sbjct  181   GDFCPSLRLKDSDYLMPRKDFPLCDLVSKNSNKIKAEVHGWRDGKELEHVLLHVINKAIG  240

Query  379   EDS------QFLAAESKFQAISMQPCEALPKAIRVP  290
             E S      Q ++ + K   I +   + LPKA+ VP
Sbjct  241   EGSNINNSTQKVSVDCKMGPIPIDTLQPLPKALSVP  276



>gb|ACJ84435.1| unknown [Medicago truncatula]
 gb|AFK35188.1| unknown [Medicago truncatula]
 gb|AES67879.2| 2,3-diketo-5-methylthio-1-phosphopentane phosphatase [Medicago 
truncatula]
Length=276

 Score =   317 bits (813),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 148/274 (54%), Positives = 196/274 (72%), Gaps = 5/274 (2%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VV+FDFD TII+ DSDNWV+DE G T  F QLL +M WN LMD++M E+HA GKT+ 
Sbjct  2     AGVVVIFDFDSTIIECDSDNWVLDEFGLTEKFYQLLPSMLWNPLMDKIMNELHAQGKTME  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             +I  VL   PIHPRI+PAI+A + LGC+LRIVSDAN+FFIETILKH G+  CFS+I  NP
Sbjct  62    EIVEVLNRTPIHPRIIPAIEAAYSLGCELRIVSDANIFFIETILKHHGVLNCFSKITANP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
              YV+ EGRL I P+HD+  S HGC  CPPNMCK K++E  Q S+  EGKK++IYLGDG G
Sbjct  122   SYVNGEGRLIICPYHDYLKSSHGCNLCPPNMCKGKVMEMFQNSLDDEGKKKIIYLGDGSG  181

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             DFCPSLKLK  D++MPR +F + +L+ +N + ++A +H W +GE+ E +L H+IN+  I 
Sbjct  182   DFCPSLKLKESDYLMPRMNFALSDLVSKNSNDIKAHVHGWRDGEELENVLLHIINKANIG  241

Query  376   DS-----QFLAAESKFQAISMQPCEALPKAIRVP  290
                    + ++ + K   IS+   +  P+A+ VP
Sbjct  242   KGNIVGPKIISVDCKMGNISIDAHKHFPEALSVP  275



>gb|AFK38500.1| unknown [Lotus japonicus]
Length=282

 Score =   317 bits (813),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 157/280 (56%), Positives = 200/280 (71%), Gaps = 11/280 (4%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPW--NSLMDRMMKEIHANGKT  923
             AG VVVFDFD TII+ DSDNW++DE G T  F QLL T PW  N LMD+MM E+H  GKT
Sbjct  2     AGIVVVFDFDSTIIECDSDNWLLDEFGLTEKFYQLLPTTPWGWNPLMDKMMNELHPQGKT  61

Query  922   IGDIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINT  743
             I DI  VL+  PIHP IVPAIKA H LGC+L+IVSDAN+FFIETILKH G+R CFSEI  
Sbjct  62    IEDIVEVLKRTPIHPCIVPAIKAAHSLGCELKIVSDANIFFIETILKHHGVRHCFSEITA  121

Query  742   NPGYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKR-VIYLGD  566
             NP +V+EEGRLRI P++D+  S HGC+ CPPNMCK  +++RIQ S+   GKK+ +IYLGD
Sbjct  122   NPSFVNEEGRLRIGPYYDYLKSSHGCSLCPPNMCKGLVMDRIQNSLDAAGKKKFMIYLGD  181

Query  565   GIGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINR-  389
             G GDFCPSLKLK  D++MPR +F + +L+ +N + ++AE+H W +G + E +L H+IN+ 
Sbjct  182   GSGDFCPSLKLKDSDYLMPRTNFRLCDLVSKNSNAIKAEVHAWRDGAELENVLLHIINKT  241

Query  388   ICIEDSQ-------FLAAESKFQAISMQPCEALPKAIRVP  290
             I  E S         ++ + KF  IS+      PKA+ VP
Sbjct  242   INGEGSNGTSGSTPIISVDCKFGTISIDGHNPFPKALSVP  281



>ref|NP_001235501.1| uncharacterized protein LOC100306469 [Glycine max]
 gb|ACU14664.1| unknown [Glycine max]
Length=276

 Score =   317 bits (812),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 150/276 (54%), Positives = 202/276 (73%), Gaps = 7/276 (3%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VV+FDFD TII+ DSDNWV+DE G T  F QLL +  WN LMD+MM E+H+ GKTI 
Sbjct  2     AGIVVIFDFDSTIIECDSDNWVLDETGLTEKFYQLLPSTHWNPLMDKMMNELHSQGKTIQ  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI ++L   P+HPRIVPAI+A + LGCDL+IVSDAN+FFIETILKH G+  CFS++  NP
Sbjct  62    DIVQILSRTPMHPRIVPAIEAAYSLGCDLKIVSDANIFFIETILKHHGVWNCFSDVIANP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
              +V+ EGRL I P+HD+  S HGC  CPPNMCK  +IERIQ S+   GKK++IYLGDG G
Sbjct  122   IHVN-EGRLNICPYHDYLKSSHGCNLCPPNMCKGLVIERIQNSLAAAGKKKLIYLGDGNG  180

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             DFCPSL+LK GD++MPRKDFP+ +L+ +N + ++AE+H W +G++ E +L H+I++   E
Sbjct  181   DFCPSLRLKDGDYVMPRKDFPLCDLVSKNSNKIKAEVHGWRDGKELEHVLLHVIDKEIGE  240

Query  376   ------DSQFLAAESKFQAISMQPCEALPKAIRVPF  287
                    +Q ++ + K   I++   + LPKA+ V +
Sbjct  241   RNNINNSTQKVSVDCKMGPIAIDTRQPLPKALSVSY  276



>gb|KHN39291.1| Inorganic pyrophosphatase 1 [Glycine soja]
Length=277

 Score =   316 bits (810),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/276 (55%), Positives = 203/276 (74%), Gaps = 8/276 (3%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VV+FDFD TII+ DSDNWV+DE G T  F QLL +  WN LMD+MM E+H+ GKTI 
Sbjct  2     AGIVVIFDFDSTIIECDSDNWVLDETGLTEKFYQLLPSTHWNPLMDKMMNELHSQGKTIQ  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI ++L   P+HPRIVPAI+A + LGCDL+IVSDAN+FFIETILKH G+  CFS++  NP
Sbjct  62    DIVQILSRTPMHPRIVPAIEAAYSLGCDLKIVSDANIFFIETILKHHGVWNCFSDVIANP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSK-IIERIQASMGKEGKKRVIYLGDGI  560
              +V+ EGRL I P+HD+  S HGC  CPPNMCK+  +IERIQ S+   GKK++IYLGDG 
Sbjct  122   IHVN-EGRLNICPYHDYLKSSHGCNLCPPNMCKAGLVIERIQNSLAAAGKKKLIYLGDGN  180

Query  559   GDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICI  380
             GDFCPSL+LK GD++MPRKDFP+ +L+ +N + ++AE+H W +G++ E +L H+IN+   
Sbjct  181   GDFCPSLRLKDGDYVMPRKDFPLCDLVSKNSNKIKAEVHGWRDGKELEHVLLHVINKEIG  240

Query  379   E------DSQFLAAESKFQAISMQPCEALPKAIRVP  290
             E       +Q ++ + K   I++   + LPKA+ VP
Sbjct  241   EGNNINNSTQKVSVDCKMGPIAIDTRQPLPKALSVP  276



>ref|XP_002533762.1| Phosphoethanolamine/phosphocholine phosphatase, putative [Ricinus 
communis]
 gb|EEF28621.1| Phosphoethanolamine/phosphocholine phosphatase, putative [Ricinus 
communis]
Length=263

 Score =   316 bits (809),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 155/263 (59%), Positives = 195/263 (74%), Gaps = 5/263 (2%)
 Frame = -1

Query  1093  GTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGD  914
             G VV+ DF KTIIDVDSD WVV ELG T  F QLL TMP NS M  MMKE+++ GKTI  
Sbjct  5     GIVVILDFYKTIIDVDSDYWVVKELGLTDFFYQLLPTMPLNSAMAEMMKELYSRGKTIKQ  64

Query  913   IERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPG  734
             I +VL+ VPIHPRIV A+K+   LGC+LRIVSDAN FFI+TIL+H+G+R+CFSEINTNPG
Sbjct  65    IVQVLERVPIHPRIVHALKSARALGCELRIVSDANTFFIDTILEHVGLRDCFSEINTNPG  124

Query  733   YVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGD  554
             +VDEEGRL I PFHD       C+ CPPNMCK +IIE     + + G++R+IYLGDG GD
Sbjct  125   FVDEEGRLNIFPFHDSGC----CSLCPPNMCKGRIIENPNIFI-QGGEQRIIYLGDGAGD  179

Query  553   FCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIED  374
             +CP LKL   D+MMPRK+FPVW+LI  N + + A+IHEW+NGE+FER+L  +I+ I + +
Sbjct  180   YCPGLKLTHADYMMPRKNFPVWDLICGNPTPIRADIHEWTNGEEFERVLLRIIDSISMNE  239

Query  373   SQFLAAESKFQAISMQPCEALPK  305
             S   + +SK   I +   EALP+
Sbjct  240   SAQFSTDSKLMPIPIPAHEALPR  262



>gb|AFK48095.1| unknown [Lotus japonicus]
Length=282

 Score =   317 bits (811),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 156/280 (56%), Positives = 200/280 (71%), Gaps = 11/280 (4%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPW--NSLMDRMMKEIHANGKT  923
             AG VVVFDFD TII+ DSDNW++DE G T  F QLL T PW  N LMD+MM E+H+ GKT
Sbjct  2     AGIVVVFDFDSTIIECDSDNWLLDEFGLTEKFYQLLPTTPWGWNPLMDKMMNELHSQGKT  61

Query  922   IGDIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINT  743
             I DI  VL+  PIHP IVPAIKA H LGC+L+IVSDAN+FFIETILKH G+R CFSEI  
Sbjct  62    IEDIVEVLKRTPIHPCIVPAIKAAHSLGCELKIVSDANIFFIETILKHHGVRHCFSEITA  121

Query  742   NPGYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKR-VIYLGD  566
             NP +V+EEGRLRI P++D+  S HGC+ CPPNMCK  +++RIQ S+   GKK+ +IYLGD
Sbjct  122   NPSFVNEEGRLRIGPYYDYLKSSHGCSLCPPNMCKGLVMDRIQNSLDAAGKKKFMIYLGD  181

Query  565   GIGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINR-  389
             G GDFCPSLKLK  D++ PR +F + +L+ +N + ++AE+H W +G + E +L H+IN+ 
Sbjct  182   GSGDFCPSLKLKDSDYLTPRTNFRLCDLVSKNSNAIKAEVHAWRDGAELENVLLHIINKT  241

Query  388   ICIEDSQ-------FLAAESKFQAISMQPCEALPKAIRVP  290
             I  E S         ++ + KF  IS+      PKA+ VP
Sbjct  242   INGEGSNGTSGSTPIISVDCKFGTISIDGHNPFPKALSVP  281



>ref|XP_007226633.1| hypothetical protein PRUPE_ppa022611mg, partial [Prunus persica]
 gb|EMJ27832.1| hypothetical protein PRUPE_ppa022611mg, partial [Prunus persica]
Length=246

 Score =   315 bits (807),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 146/245 (60%), Positives = 184/245 (75%), Gaps = 2/245 (1%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFDKTIID DSDNWVV+ELG   LF QLL TMPWNSLMDRMM+E+H+ G TI 
Sbjct  2     AGLVVVFDFDKTIIDWDSDNWVVEELGVKDLFTQLLPTMPWNSLMDRMMRELHSRGMTIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI   L+ +P+HP I  AIK+ H  GCDLR++S AN FFI+TILKH G+ +CFSEINTNP
Sbjct  62    DIAECLKKIPLHPNIASAIKSAHAFGCDLRVLSAANEFFIDTILKHHGLMDCFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGK--KRVIYLGDG  563
               +DE+GRLRI P+HDFHSS HGC  CPP+MCK  I+E+IQAS+  +GK  K+ IY+GDG
Sbjct  122   SIIDEQGRLRIFPYHDFHSSSHGCTICPPSMCKGLIMEKIQASVAADGKKHKQFIYVGDG  181

Query  562   IGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRIC  383
               DFC  LKL+ GDF+MPR+DFP+W+LI  N    +A+I+EW+  ++   +L + +N   
Sbjct  182   APDFCAGLKLEEGDFLMPRRDFPIWDLISANPLFTKAKIYEWNECDELGAVLLNTVNAFF  241

Query  382   IEDSQ  368
              E+  
Sbjct  242   TENKS  246



>gb|AFK36374.1| unknown [Medicago truncatula]
Length=276

 Score =   316 bits (810),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 147/274 (54%), Positives = 196/274 (72%), Gaps = 5/274 (2%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VV+FDFD TII+ DSDNWV+DE G T  F QLL +M WN LMD++M E+HA GKT+ 
Sbjct  2     AGVVVIFDFDSTIIECDSDNWVLDEFGLTEKFYQLLPSMLWNPLMDKIMNELHAQGKTME  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             +I  VL   PIHPRI+PAI+A + LGC+LRIVSDAN+FFIETILKH G+  CFS+I  NP
Sbjct  62    EIVEVLNRTPIHPRIIPAIEAAYSLGCELRIVSDANIFFIETILKHHGVLNCFSKITANP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
              YV+ EGRL I P+HD+  S HGC  CPPNMCK K++E  Q S+  EGKK++IYLGDG G
Sbjct  122   SYVNGEGRLIICPYHDYLKSSHGCNLCPPNMCKGKVMEMFQNSLDDEGKKKIIYLGDGSG  181

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             DFCPSLKLK  D++MP+ +F + +L+ +N + ++A +H W +GE+ E +L H+IN+  I 
Sbjct  182   DFCPSLKLKESDYLMPKMNFALSDLVSKNSNDIKAHVHGWRDGEELENVLLHIINKANIG  241

Query  376   DS-----QFLAAESKFQAISMQPCEALPKAIRVP  290
                    + ++ + K   IS+   +  P+A+ VP
Sbjct  242   KGNIVGPKIISVDCKMGNISIDAHKHFPEALSVP  275



>ref|XP_008220455.1| PREDICTED: inorganic pyrophosphatase 2-like [Prunus mume]
Length=283

 Score =   315 bits (806),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 154/279 (55%), Positives = 197/279 (71%), Gaps = 9/279 (3%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFDKTIID DSDNWVV+ELG   LF +LL TMPWNSLMDRMM+E+H+ GKTI 
Sbjct  2     AGLVVVFDFDKTIIDWDSDNWVVEELGVKDLFTRLLPTMPWNSLMDRMMRELHSRGKTIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI   L+ +P+HP I  AIK+ H  GCDLR++S AN FFI+TILKH G+ + FSEINTNP
Sbjct  62    DIAECLKKIPLHPNIASAIKSAHAFGCDLRVLSAANEFFIDTILKHHGLMDFFSEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGK--KRVIYLGDG  563
               +DE+GRLRILP+HDFHSS HGC  CPP+MCK  I+E+IQAS+  +GK  K+ IY+GDG
Sbjct  122   SIIDEQGRLRILPYHDFHSSSHGCTICPPSMCKGLIMEKIQASVAADGKKHKQFIYVGDG  181

Query  562   IGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRIC  383
               DFC  LKL+ GDF+MPR+DFP+W+LI  N    +A+I+EW+  ++   +L + +N   
Sbjct  182   APDFCAGLKLEEGDFLMPRRDFPIWDLISANPLFTKAKIYEWNECDELGAVLLNTVNAFF  241

Query  382   IED-----SQFLAAESKFQAIS--MQPCEALPKAIRVPF  287
               +      Q +  + K Q  S  +   EA   A+ VP 
Sbjct  242   TANKSRSTDQLVPVDCKSQNSSTCLTAHEAFQNALPVPL  280



>ref|NP_001044089.1| Os01g0720400 [Oryza sativa Japonica Group]
 dbj|BAB84416.1| phosphatase-like [Oryza sativa Japonica Group]
 dbj|BAF06003.1| Os01g0720400 [Oryza sativa Japonica Group]
Length=274

 Score =   314 bits (805),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 160/274 (58%), Positives = 203/274 (74%), Gaps = 9/274 (3%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFDKTIIDVDSDNWVVD LG T  F++LL TMPWN+LMD MM E+HA+GK++ 
Sbjct  2     AGIVVVFDFDKTIIDVDSDNWVVDGLGATEEFERLLPTMPWNTLMDTMMGELHASGKSLA  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             D+  VL+  P+ PR+V AIKA +GLGCDLRI+SDAN FFI+TIL H G+   FSEINTNP
Sbjct  62    DVAGVLRSAPLDPRVVAAIKACYGLGCDLRILSDANRFFIDTILDHHGLTGYFSEINTNP  121

Query  736   GYVD-EEGRLRILPFHDFHSSPHGCAR--CPPNMCKSKIIERIQASMGKEGKKRVIYLGD  566
               VD   GRLRI P+HDFH+ PHGC    CPPNMCK ++++RI+AS G  G KRVIYLGD
Sbjct  122   SAVDAATGRLRIAPYHDFHAGPHGCGLGICPPNMCKGQVLDRIRASAGAAG-KRVIYLGD  180

Query  565   GIGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRI  386
             G GD+CPSL+L   DFMMPR+ FPVWELI E+ SLL AE+H W++G + E  L  L+ R+
Sbjct  181   GRGDYCPSLRLGRDDFMMPRRGFPVWELICEDPSLLHAEVHSWADGAEMEETLLRLVGRV  240

Query  385   CIEDSQFLAAESKFQ---AISMQPCEALPKAIRV  293
              +E+      + K +   A+++Q  + +P  +R+
Sbjct  241   LLEERNLPPLDCKLESLPAVAVQ--DGMPMTLRI  272



>gb|ABI95993.1| acid phosphatase [Oryza sativa Japonica Group]
Length=274

 Score =   314 bits (805),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 160/274 (58%), Positives = 203/274 (74%), Gaps = 9/274 (3%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFDKTIIDVDSDNWVVD LG T  F++LL TMPWN+LMD MM E+HA+GK++ 
Sbjct  2     AGIVVVFDFDKTIIDVDSDNWVVDGLGTTEEFERLLPTMPWNTLMDTMMGELHASGKSLA  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             D+  VL+  P+ PR+V AIKA +GLGCDLRI+SDAN FFI+TIL H G+   FSEINTNP
Sbjct  62    DVAGVLRSAPLDPRVVAAIKACYGLGCDLRILSDANRFFIDTILDHHGLTGYFSEINTNP  121

Query  736   GYVD-EEGRLRILPFHDFHSSPHGCAR--CPPNMCKSKIIERIQASMGKEGKKRVIYLGD  566
               VD   GRLRI P+HDFH+ PHGC    CPPNMCK ++++RI+AS G  G KRVIYLGD
Sbjct  122   SAVDAATGRLRIAPYHDFHAGPHGCGLGICPPNMCKGQVLDRIRASAGAAG-KRVIYLGD  180

Query  565   GIGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRI  386
             G GD+CPSL+L   DFMMPR+ FPVWELI E+ SLL AE+H W++G + E  L  L+ R+
Sbjct  181   GRGDYCPSLRLGRDDFMMPRRGFPVWELICEDPSLLHAEVHSWADGAEMEETLLRLVGRV  240

Query  385   CIEDSQFLAAESKFQ---AISMQPCEALPKAIRV  293
              +E+      + K +   A+++Q  + +P  +R+
Sbjct  241   LLEERNLPPLDCKLESLPAVAVQ--DGMPMTLRI  272



>ref|XP_009361749.1| PREDICTED: inorganic pyrophosphatase 2-like [Pyrus x bretschneideri]
Length=284

 Score =   314 bits (805),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 148/245 (60%), Positives = 183/245 (75%), Gaps = 0/245 (0%)
 Frame = -1

Query  1102  MAAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKT  923
             MAA  VVVFDFDKTII+ DSDNW+VDELG   LF QLL TM WN LMDRMM E+HA  KT
Sbjct  1     MAARMVVVFDFDKTIINCDSDNWIVDELGVKDLFTQLLPTMTWNPLMDRMMTELHARRKT  60

Query  922   IGDIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINT  743
             I DI   L+ VPIHP IV AIK+ H  GCDLR++SDAN FFI+ ILKH GIR+CFSEI T
Sbjct  61    IQDISECLKRVPIHPNIVSAIKSAHAFGCDLRVLSDANDFFIDAILKHHGIRDCFSEIKT  120

Query  742   NPGYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDG  563
             NP ++DE+GRLRILPFHDF SS HGC  CPPNMCK  ++ +I+AS+  +GKK +IY+GDG
Sbjct  121   NPSFIDEQGRLRILPFHDFISSSHGCTLCPPNMCKGLMMGKIRASVSADGKKHLIYVGDG  180

Query  562   IGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRIC  383
               DFC  LKL+ GDF++PRK++P+W+LI  N  L +A+I+EW+  ++   IL + +    
Sbjct  181   APDFCAGLKLEEGDFLLPRKNYPIWDLISANPLLTKAKIYEWNECDELGTILLNTVKAFF  240

Query  382   IEDSQ  368
             I D  
Sbjct  241   IGDKS  245



>ref|XP_003597628.1| hypothetical protein MTR_2g100340 [Medicago truncatula]
 ref|XP_003636427.1| hypothetical protein MTR_040s0060 [Medicago truncatula]
Length=368

 Score =   317 bits (812),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 150/281 (53%), Positives = 200/281 (71%), Gaps = 7/281 (2%)
 Frame = -1

Query  1111  CSPMAAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHAN  932
             CS + AG VV+FDFD TII+ DSDNWV+DE G T  F QLL +M WN LMD++M E+HA 
Sbjct  87    CSFIMAGVVVIFDFDSTIIECDSDNWVLDEFGLTEKFYQLLPSMLWNPLMDKIMNELHAQ  146

Query  931   GKTIGDIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSE  752
             GKT+ +I  VL   PIHPRI+PAI+A + LGC+LRIVSDAN+FFIETILKH G+  CFS+
Sbjct  147   GKTMEEIVEVLNRTPIHPRIIPAIEAAYSLGCELRIVSDANIFFIETILKHHGVLNCFSK  206

Query  751   INTNPGYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKS--KIIERIQASMGKEGKKRVI  578
             I  NP YV+ EGRL I P+HD+  S HGC  CPPNMCK+  K++E  Q S+  EGKK++I
Sbjct  207   ITANPSYVNGEGRLIICPYHDYLKSSHGCNLCPPNMCKAIGKVMEMFQNSLDDEGKKKII  266

Query  577   YLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHL  398
             YLGDG GDFCPSLKLK  D++MPR +F + +L+ +N + ++A +H W +GE+ E +L H+
Sbjct  267   YLGDGSGDFCPSLKLKESDYLMPRMNFALSDLVSKNSNDIKAHVHGWRDGEELENVLLHI  326

Query  397   INRICIEDS-----QFLAAESKFQAISMQPCEALPKAIRVP  290
             IN+  I        + ++ + K   IS+   +  P+A+ VP
Sbjct  327   INKANIGKGNIVGPKIISVDCKMGNISIDAHKHFPEALSVP  367



>gb|EAY75640.1| hypothetical protein OsI_03545 [Oryza sativa Indica Group]
Length=274

 Score =   313 bits (803),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 160/274 (58%), Positives = 203/274 (74%), Gaps = 9/274 (3%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFDKTIIDVDSDNWVVD LG T  F++LL TMPWN+LMD MM E+HA GK++ 
Sbjct  2     AGIVVVFDFDKTIIDVDSDNWVVDGLGATEEFERLLPTMPWNTLMDTMMGELHARGKSLS  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             D+  VL+  P+ PR+V AIKA +GLGCDLRI+SDAN FFI+TIL H G+   FSEINTNP
Sbjct  62    DVAGVLRSAPLDPRVVAAIKACYGLGCDLRILSDANRFFIDTILDHHGLTGYFSEINTNP  121

Query  736   GYVD-EEGRLRILPFHDFHSSPHGCAR--CPPNMCKSKIIERIQASMGKEGKKRVIYLGD  566
               VD   GRLRI P+HDFH+ PHGC    CPPNMCK ++++RI+AS G  G KRVIYLGD
Sbjct  122   SAVDAATGRLRIAPYHDFHAGPHGCGLGICPPNMCKGQVLDRIRASAGAAG-KRVIYLGD  180

Query  565   GIGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRI  386
             G GD+CPSL+L   DFMMPR+ FPVWELI E+ SLL+AE+H W++G + E  L  L+ R+
Sbjct  181   GRGDYCPSLRLGRDDFMMPRRGFPVWELICEDPSLLQAEVHPWADGAEMEETLLRLVGRV  240

Query  385   CIEDSQFLAAESKFQ---AISMQPCEALPKAIRV  293
              +E+      + K +   A+++Q  + +P  +R+
Sbjct  241   LLEERNLPPLDCKLESLPAVAVQ--DGMPMTLRI  272



>ref|XP_007012891.1| Pyridoxal phosphate phosphatase-related protein [Theobroma cacao]
 gb|EOY30510.1| Pyridoxal phosphate phosphatase-related protein [Theobroma cacao]
Length=278

 Score =   313 bits (803),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 150/277 (54%), Positives = 201/277 (73%), Gaps = 9/277 (3%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFD+TIID DSD+WVV E+G + LF +L  T+PWNSLMDRMMKE+H+ G+T  
Sbjct  2     AGIVVVFDFDRTIIDGDSDSWVVAEMGLSDLFHRLRSTLPWNSLMDRMMKELHSQGRTAE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             +I   L+  P+HPRI  AIK+ + LGCDLRIVSDAN FFIE IL++ G+  CFS+I TNP
Sbjct  62    EIAACLKRTPLHPRIAAAIKSAYALGCDLRIVSDANQFFIEKILEYQGLLGCFSKIYTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
              +VDEEGRLRI P+HD   SPHGC+ CP N+CK  ++E I AS  + G++  IYLGDG G
Sbjct  122   SFVDEEGRLRIFPYHDSTLSPHGCSLCPSNLCKGLVLEHIYASAPEGGRQNFIYLGDGRG  181

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             D+CP+L+L+  D++MPRK +P+W+ I    +L++AE+HEWSNGE+ E+IL HLI++I  E
Sbjct  182   DYCPTLRLQGSDYVMPRKKYPLWDRIFREPALVKAEVHEWSNGEELEKILLHLIDKIPAE  241

Query  376   DS--------QFLAAESKFQAISMQPCEALPKAIRVP  290
              S        Q  +++ K   IS+   E+  + +RVP
Sbjct  242   QSISGSNPSSQSNSSDCKLH-ISVSSPESFTQTLRVP  277



>ref|XP_007012260.1| Pyridoxal phosphate phosphatase-related protein [Theobroma cacao]
 gb|EOY29879.1| Pyridoxal phosphate phosphatase-related protein [Theobroma cacao]
Length=290

 Score =   313 bits (801),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 155/283 (55%), Positives = 191/283 (67%), Gaps = 27/283 (10%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMD--------------  959
             AG V+VFDFDKTII+ DSD+WVV+  G + LF QL  T P N+LMD              
Sbjct  2     AGVVLVFDFDKTIIECDSDDWVVEGFGVSELFTQLRPTFPLNTLMDFHHDNYQRFTLDAF  61

Query  958   -------RMMKEIHANGKTIGDIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFF  800
                    RM+ E+ + G +  DI   L+ VP+HPRIV  IKA H  GCDLR++SDAN+FF
Sbjct  62    SRLFFQDRMIMEVQSRGNSTADIAACLRQVPLHPRIVSVIKAAHASGCDLRLISDANVFF  121

Query  799   IETILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIER  620
             IETILK+ G+ +CFSEINTNP YVD EGRLRI P+HDF SS HGC  CPPNMCK  I+ER
Sbjct  122   IETILKNHGLLDCFSEINTNPSYVDGEGRLRISPYHDFESSSHGCNICPPNMCKGLIMER  181

Query  619   IQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHE  440
             +QAS+   GKKR IYLGDG  DFCP LKL   DF+MPRK+FPVWELI  N  L+ A IHE
Sbjct  182   VQASVSATGKKRFIYLGDGTADFCPGLKLGEDDFLMPRKNFPVWELICSNPKLIRANIHE  241

Query  439   WSNGEDFERILFHLINRICIEDS------QFLAAESKFQAISM  329
             W++GE+   +L HL+N+I IE++      Q +    KF+  S+
Sbjct  242   WNDGEELGDVLSHLVNKISIEENYAVGVDQMVPVHCKFKTSSV  284



>ref|XP_006466069.1| PREDICTED: inorganic pyrophosphatase 1-like isoform X2 [Citrus 
sinensis]
Length=264

 Score =   311 bits (798),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 153/233 (66%), Positives = 179/233 (77%), Gaps = 12/233 (5%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             A  VVVFDFDKTIID DSDNWVVDEL  T LF+QLL TMPWNSLM RMM+E+HA GKTI 
Sbjct  2     ADIVVVFDFDKTIIDCDSDNWVVDELHATELFNQLLPTMPWNSLMGRMMEELHAQGKTIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI  VL+  PIHP I+ A+KA H LGCDL+IVSDANLFFIETILKH GI E FSEINTN 
Sbjct  62    DIVEVLKRAPIHPSIISAVKAAHDLGCDLKIVSDANLFFIETILKHHGIWELFSEINTNS  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCAR--CPPNMCKSKIIERIQASMGKEGKKRVIYLGDG  563
              +VDEEGRL+I P HDF  S H C+   CPPNMCK         SM KE  K++IY+GDG
Sbjct  122   SFVDEEGRLKIFPHHDFTKSSHACSTNICPPNMCKE--------SMSKE--KKIIYIGDG  171

Query  562   IGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILF  404
              GDFCPSLKLK  D++MPRK+FPVW+LI +N  L++A+IHEW +G++ + +L 
Sbjct  172   TGDFCPSLKLKQTDYIMPRKNFPVWDLICQNHKLIKADIHEWYDGQELQHVLL  224



>ref|XP_009614749.1| PREDICTED: inorganic pyrophosphatase 3-like [Nicotiana tomentosiformis]
Length=280

 Score =   311 bits (796),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 141/240 (59%), Positives = 184/240 (77%), Gaps = 1/240 (0%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             A  V++FDFD+T+ID DSD WVV+ +G T LF+QL  T+PWN+LMDRMM+E+H+ GKT+ 
Sbjct  42    AKMVIIFDFDRTLIDDDSDRWVVENMGLTHLFNQLRPTLPWNALMDRMMEELHSQGKTVE  101

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
              I   L+ VP+HP+ + AI++ H LGCDL+++SDAN F+IETILKH G+  CFSEI TNP
Sbjct  102   QIAECLKHVPLHPQTISAIESAHALGCDLKVLSDANQFYIETILKHHGLYRCFSEIITNP  161

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
               VD EGRLRI P+HD  +S HGC  CPPN+CK  +IE+IQASM ++GK R IYLGDG G
Sbjct  162   TTVDGEGRLRIFPYHDL-ASFHGCNLCPPNLCKGLVIEQIQASMSEKGKSRFIYLGDGRG  220

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             D+CP+LKL  GD +MPRK FP+W+ +  N SLL+A+ HEWSNGE+   IL  L+ ++C E
Sbjct  221   DYCPTLKLDRGDHVMPRKGFPLWDRLLSNPSLLKADCHEWSNGEELASILLKLVEKVCKE  280



>ref|XP_002514153.1| Pyridoxal phosphate phosphatase PHOSPHO2, putative [Ricinus communis]
 gb|EEF48107.1| Pyridoxal phosphate phosphatase PHOSPHO2, putative [Ricinus communis]
Length=253

 Score =   308 bits (789),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 136/237 (57%), Positives = 180/237 (76%), Gaps = 0/237 (0%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             A  VVVFDFD+T+ID DSD WVV ++G + LF+QL  T+PWNSLMDRMM+E+H+ GKT+ 
Sbjct  2     AQIVVVFDFDRTLIDGDSDRWVVTQMGLSSLFNQLRSTLPWNSLMDRMMRELHSQGKTVD  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI   L   P+HP+++ AI++ H LGC+LRI+SDAN FFIE IL H G+  CFS+I TNP
Sbjct  62    DITECLSRSPLHPQVIAAIQSAHALGCELRIISDANQFFIEKILDHHGLLGCFSQITTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
               VD+EGR+RI P+H   + PHGC  CPPN+CK  +I +I AS  +  K+R IYLGDG G
Sbjct  122   SLVDDEGRVRIFPYHALGTPPHGCHLCPPNLCKGLVINQICASTAEIEKRRFIYLGDGSG  181

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRI  386
             DFCP+LKL+ GD++MPR+D+P+W  I  N +L++AE+H+WS+GE+   IL HLIN I
Sbjct  182   DFCPTLKLREGDYVMPRRDYPLWNRICSNPTLVKAEVHDWSSGEELGEILLHLINTI  238



>emb|CDP03190.1| unnamed protein product [Coffea canephora]
Length=252

 Score =   308 bits (789),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 142/243 (58%), Positives = 183/243 (75%), Gaps = 1/243 (0%)
 Frame = -1

Query  1102  MAAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKT  923
             MA+  V++FDFD+T+ID DSD WV+  +G T LF+QL   + W SLMDRM+KE+H+ G+T
Sbjct  1     MASEIVIIFDFDRTLIDDDSDRWVIKGMGLTHLFNQLRPILSWTSLMDRMVKELHSQGRT  60

Query  922   IGDIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINT  743
             + DI   L+GVP+H R   AIK+ H LGCDL++VSDAN F+IETILKH G+ +CFSEI T
Sbjct  61    VKDIAECLKGVPLHQRTAAAIKSAHALGCDLKVVSDANKFYIETILKHHGLYDCFSEIIT  120

Query  742   NPGYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDG  563
             NP  VDE GRL+I P++D  +SPHGC  CP NMCK  +I+RIQ S+G   + + IYLGDG
Sbjct  121   NPTLVDEHGRLQIFPYNDL-ASPHGCHLCPSNMCKGIVIKRIQTSIGPRREAKFIYLGDG  179

Query  562   IGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRIC  383
              GDFCP LKL  GD  +PRKD+P+WELI+ N+  +EAE+HEW NGE+ E+IL  LI+RI 
Sbjct  180   NGDFCPILKLGKGDHALPRKDYPLWELIRSNQEFVEAEVHEWCNGEELEQILLALIDRIS  239

Query  382   IED  374
              ED
Sbjct  240   GED  242



>ref|XP_010049560.1| PREDICTED: inorganic pyrophosphatase 3 [Eucalyptus grandis]
 gb|KCW82242.1| hypothetical protein EUGRSUZ_C03661 [Eucalyptus grandis]
Length=265

 Score =   308 bits (790),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 141/244 (58%), Positives = 185/244 (76%), Gaps = 0/244 (0%)
 Frame = -1

Query  1102  MAAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKT  923
             MA    VVFDFD+T+ID DSDNWVV E+G T LF +L  TMPW SLM+RMM E+H  GK 
Sbjct  1     MADTAAVVFDFDRTLIDGDSDNWVVTEMGLTQLFRELYSTMPWTSLMNRMMVELHTQGKA  60

Query  922   IGDIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINT  743
               DIE  L+ +P+HPR++ +I+A H  GCDLRI+SDAN FFIETILKH G+ +CF+EI T
Sbjct  61    AEDIEECLKRMPLHPRVIESIRAAHRNGCDLRIISDANRFFIETILKHHGLLDCFTEIVT  120

Query  742   NPGYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDG  563
             NP +VD EGRL I+PFHD   SPHGC+ CPPNMCK  +++RIQA+  +   +R IYLGDG
Sbjct  121   NPAFVDAEGRLNIVPFHDSADSPHGCSLCPPNMCKGLVLKRIQAADSEIRNRRYIYLGDG  180

Query  562   IGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRIC  383
              GD+CP LKL   DF++PRK FP+W+LI  +++L++A IHEWS+GE+   IL  +I+RI 
Sbjct  181   KGDYCPCLKLGTRDFVVPRKSFPLWKLIFNDQTLIKAVIHEWSDGEELAAILLDIIDRIL  240

Query  382   IEDS  371
             ++++
Sbjct  241   MDEN  244



>ref|XP_009779867.1| PREDICTED: inorganic pyrophosphatase 3-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009779868.1| PREDICTED: inorganic pyrophosphatase 3-like isoform X1 [Nicotiana 
sylvestris]
Length=306

 Score =   309 bits (792),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 140/241 (58%), Positives = 183/241 (76%), Gaps = 1/241 (0%)
 Frame = -1

Query  1099  AAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTI  920
              A TV++FDFD+T+ID DSD WVV+ +G T LF+QL  T+PWN+LMDRMM+E+H+ GKT+
Sbjct  67    GAKTVIIFDFDRTLIDDDSDRWVVENMGLTYLFNQLRPTLPWNALMDRMMEELHSQGKTV  126

Query  919   GDIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTN  740
               I   L+ VP+HP+ + AI++ H LGCDL+++SDAN F+IETILKH G+  CFSEI TN
Sbjct  127   EQIAECLKHVPLHPQTISAIESAHALGCDLKVLSDANQFYIETILKHHGLYRCFSEIITN  186

Query  739   PGYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGI  560
             P  VD EGRLRI P+H+  +S HGC  CPPN+CK  +IE+IQASM  + K R IYLGDG 
Sbjct  187   PTMVDAEGRLRIFPYHEL-ASFHGCNLCPPNLCKGLVIEQIQASMSDKRKSRFIYLGDGR  245

Query  559   GDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICI  380
             GD+CP+LKL  GD +MPRK FP+W+ +  N SLL+A+ HEWSNGE+   IL  L+ ++C 
Sbjct  246   GDYCPTLKLDRGDHVMPRKGFPLWDRLLSNPSLLKADCHEWSNGEELASILLQLVEKVCE  305

Query  379   E  377
             E
Sbjct  306   E  306



>ref|XP_003569309.1| PREDICTED: inorganic pyrophosphatase 3-like isoform X2 [Brachypodium 
distachyon]
Length=272

 Score =   307 bits (787),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 143/254 (56%), Positives = 183/254 (72%), Gaps = 1/254 (0%)
 Frame = -1

Query  1102  MAAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKT  923
             MAA  VVVFDFDKTII+ DSDNWVV +LG T  F++L  TM W  LMDRMM E+H  GK+
Sbjct  1     MAAALVVVFDFDKTIIEWDSDNWVVTKLGATDAFNRLRPTMSWTPLMDRMMGELHEQGKS  60

Query  922   IGDIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINT  743
               DI + L+  P+   ++ AI+    LGCDL++VSDAN FFIET+L+H GI  CFSEINT
Sbjct  61    AEDIRQCLRSAPLDAHVISAIRTASALGCDLKVVSDANAFFIETVLEHHGILGCFSEINT  120

Query  742   NPGYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDG  563
             NP  VD +GRLRI PFHD  SSPHGC+ CP NMCK KIIERIQA+   +  K  IY+GDG
Sbjct  121   NPARVDSDGRLRISPFHDPASSPHGCSLCPENMCKGKIIERIQATDSAK-NKHFIYIGDG  179

Query  562   IGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRIC  383
              GD+CPSLKL+ GD++MP++++P+W LI  N+ LL+AE+H W+ GE  ERIL  L+N++ 
Sbjct  180   KGDYCPSLKLREGDYVMPKENYPLWNLITSNKQLLKAEVHAWNTGEGLERILLQLVNKLI  239

Query  382   IEDSQFLAAESKFQ  341
                +Q    + K +
Sbjct  240   TPPAQVTQVDYKCE  253



>ref|XP_010666530.1| PREDICTED: inorganic pyrophosphatase 3 [Beta vulgaris subsp. 
vulgaris]
Length=272

 Score =   307 bits (786),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 145/252 (58%), Positives = 182/252 (72%), Gaps = 0/252 (0%)
 Frame = -1

Query  1087  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  908
             VV+FDFD+TIID DSDNWVV ++G T LFDQL  TMPWNSLM+RMM+E+H   KTI DI 
Sbjct  5     VVIFDFDRTIIDGDSDNWVVTQMGLTHLFDQLFSTMPWNSLMNRMMEELHLQQKTIEDIG  64

Query  907   RVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYV  728
               L+ +P+HP+I+ AIK+ H +GCDLRIVSDAN FFI+TIL+   +   F+EI TNP  V
Sbjct  65    ECLKQIPLHPKIISAIKSAHSMGCDLRIVSDANQFFIKTILEQHQLFGFFTEIITNPTSV  124

Query  727   DEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFC  548
             D++GRLRI+P+HDF  SPHGC  CP +MCK  I+ERIQA   + GK   IY+GDG GD+C
Sbjct  125   DDDGRLRIVPYHDFKLSPHGCTLCPSHMCKGMILERIQAFSRQNGKNITIYIGDGGGDYC  184

Query  547   PSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQ  368
             PSLKL   D +MPRK FP+WE I  N SL++A +HEWSNGE+ E  L HLI    I+ +Q
Sbjct  185   PSLKLGENDHVMPRKKFPLWERIHRNPSLVKATVHEWSNGEELETTLLHLITCSAIDGNQ  244

Query  367   FLAAESKFQAIS  332
              +   +     S
Sbjct  245   CVYTSTGSDTTS  256



>ref|XP_004486811.1| PREDICTED: inorganic pyrophosphatase 1-like [Cicer arietinum]
Length=275

 Score =   306 bits (784),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/273 (53%), Positives = 195/273 (71%), Gaps = 6/273 (2%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VV+FDFD TII+ DSDNWV+DE G T  F QLL  M WN LMD+MM E+H+ GKTI 
Sbjct  2     AGVVVIFDFDSTIIECDSDNWVLDEFGLTEKFYQLLPNMHWNPLMDKMMDELHSQGKTIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             +I  VL   PIHP IVPAI+A + LGC+LRI+SDAN+FFIETILKH G+  CFSEI  NP
Sbjct  62    EIVEVLNKTPIHPHIVPAIEAAYSLGCELRILSDANIFFIETILKHHGVLNCFSEITANP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
              YV+EEGRLRI P+HD+  S HGC  CPPNMCK  +IER Q S+   GKK+ IYLGDG G
Sbjct  122   SYVNEEGRLRIWPYHDYLKSSHGCNLCPPNMCKGLVIERFQNSL-DTGKKKFIYLGDGSG  180

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             DFCPSLKLK  D++MPR +F + +L+ +N + ++A +H W +GE+ + +L  +IN+   +
Sbjct  181   DFCPSLKLKESDYVMPRINFALCDLVSKNSNDIKAHVHGWIDGEELKHVLLDIINKTIGK  240

Query  376   DS-----QFLAAESKFQAISMQPCEALPKAIRV  293
             ++     + ++ + K   IS++  +  P+A+ +
Sbjct  241   ENNIIGPKIISIDCKLGTISIETHKPFPEALPI  273



>ref|XP_004969781.1| PREDICTED: inorganic pyrophosphatase 1-like [Setaria italica]
Length=275

 Score =   305 bits (782),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 144/249 (58%), Positives = 189/249 (76%), Gaps = 8/249 (3%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG +VVFDFDKTIIDVDSDNWVVD LGFT  F++LL TMPWN LMD MM +IHA G+T+ 
Sbjct  2     AGIIVVFDFDKTIIDVDSDNWVVDSLGFTEEFERLLPTMPWNDLMDAMMGKIHAAGRTLD  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             D+   L+ VPI PR+  AI+A   LGCDLR++SDAN FFI+T+L H G+R CF+E+NTNP
Sbjct  62    DVAAALRAVPIDPRVPAAIRAACALGCDLRVLSDANAFFIDTVLDHHGLRGCFTEVNTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGC--ARCPPNMCKSKIIERI--QASMGKEGKKRVIYLG  569
               VD +GRLRI P   +H++PHGC    CPPNMCK ++++RI  +A+ G  G+KRVIYLG
Sbjct  122   SRVDADGRLRIGP---YHAAPHGCGVGTCPPNMCKGQVLDRILREAAAGG-GRKRVIYLG  177

Query  568   DGIGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINR  389
             DG GD+CPSL+L   DF+MPR+ FPVW+LI E+ + ++AE+H W++G + E  L  L+ R
Sbjct  178   DGRGDYCPSLRLAREDFVMPRRGFPVWDLICEDPARVQAEVHPWADGAEMEATLLGLVRR  237

Query  388   ICIEDSQFL  362
             + +ED+  L
Sbjct  238   VLVEDAAAL  246



>ref|XP_007135573.1| hypothetical protein PHAVU_010G1407000g, partial [Phaseolus vulgaris]
 gb|ESW07567.1| hypothetical protein PHAVU_010G1407000g, partial [Phaseolus vulgaris]
Length=237

 Score =   303 bits (777),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 142/236 (60%), Positives = 179/236 (76%), Gaps = 1/236 (0%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             A  +V+FDFD TII+ DSDNWV+D+   T  F QLL TM WN LMDRMMKE+H+ GKTI 
Sbjct  2     AEIMVIFDFDSTIIECDSDNWVLDDTALTQNFYQLLPTMHWNPLMDRMMKELHSQGKTIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI  +L+  P+HP IVPAI+A + LGCDL+IVSDAN+FFIETILKH G+  CFSEI  NP
Sbjct  62    DIVEILKRTPMHPCIVPAIEAAYSLGCDLKIVSDANIFFIETILKHHGVWNCFSEIICNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
              +V +EG L I P+HD+  S HGC  CPPNMCK  +IERIQ SM   GKK+VIYLGDG G
Sbjct  122   SHV-KEGSLNICPYHDYLKSSHGCNLCPPNMCKGVVIERIQNSMAGAGKKKVIYLGDGNG  180

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINR  389
             DFCPSLKLK  D++MPR  FP+ +L+ +N + ++AE+H W +G++ + +L HLIN+
Sbjct  181   DFCPSLKLKENDYLMPRTGFPLCDLVSKNSTKIKAEVHGWRDGKELQHVLLHLINK  236



>gb|KDO59254.1| hypothetical protein CISIN_1g044617mg [Citrus sinensis]
Length=265

 Score =   304 bits (778),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 145/269 (54%), Positives = 192/269 (71%), Gaps = 8/269 (3%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             A  VVVFDFD+T+ID DSDNWVV ++G T LF+QL  T+PWNSLMDRMMKE+H+ GKT+ 
Sbjct  2     ADVVVVFDFDRTLIDDDSDNWVVTQMGLTHLFNQLRSTLPWNSLMDRMMKELHSQGKTVE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI   L+  P+   +  AIK+ H LGCDL+IVSDAN F+IETI++H G+  CFSEI TNP
Sbjct  62    DIANCLRQCPLDSHVAAAIKSAHSLGCDLKIVSDANQFYIETIMEHHGLLGCFSEIYTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
              YVDE+GRLRILP+HD   S HGC  CP N+CK  +++ +  S G  GK+R IYLGDG G
Sbjct  122   TYVDEQGRLRILPYHDSTLSHHGCNLCPSNLCKGFVLDHVCTSFGC-GKQRFIYLGDGRG  180

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             DFCP+LKL+  DF+MPRK++P+W+ I  N  L++A++HEWS+ E+ ++IL HLI  I I+
Sbjct  181   DFCPTLKLRDCDFVMPRKNYPLWDRICSNPMLIKAKVHEWSSAEELKKILLHLIGAISIK  240

Query  376   DSQFLAAESKFQAISMQPCEALPKAIRVP  290
                    E     +S QP  +  ++  +P
Sbjct  241   -------EDVDSTVSSQPNSSECRSQTMP  262



>ref|XP_007160240.1| hypothetical protein PHAVU_002G304600g [Phaseolus vulgaris]
 gb|ESW32234.1| hypothetical protein PHAVU_002G304600g [Phaseolus vulgaris]
Length=254

 Score =   302 bits (773),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 142/239 (59%), Positives = 180/239 (75%), Gaps = 3/239 (1%)
 Frame = -1

Query  1099  AAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTI  920
             +    VVFDFD+TIID DSD W+V ELG T LF+QL HTMPW SLMDR+M+E+H++G TI
Sbjct  4     SVAATVVFDFDRTIIDDDSDRWIVTELGLTHLFNQLRHTMPWTSLMDRIMEELHSHGITI  63

Query  919   GDIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTN  740
               I   L   P+HP IV AIK+ H LGCDLRI+SDAN FFI TIL+H G+  CFS+I TN
Sbjct  64    DHIAECLIRTPLHPNIVSAIKSAHALGCDLRIISDANEFFIRTILEHHGLLGCFSQIYTN  123

Query  739   PGYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASM-GKEGKKRVIYLGDG  563
              G+VD+EGRL + PFHD   SPH C+ CPPNMCK  +I++I+ S+ G E  ++ IYLGDG
Sbjct  124   RGFVDDEGRLHVTPFHDSTLSPHACSLCPPNMCKGLVIDQIRGSLPGNE--RKFIYLGDG  181

Query  562   IGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRI  386
              GD+CP+LKLK GDF+MPRK++P+W  I  +  L+ AE+H+WSNGE+ E IL  LIN+I
Sbjct  182   SGDYCPTLKLKEGDFVMPRKNYPLWNRIHSDPKLVAAEVHDWSNGEELESILLKLINKI  240



>ref|XP_006451424.1| hypothetical protein CICLE_v10009204mg [Citrus clementina]
 ref|XP_006475406.1| PREDICTED: inorganic pyrophosphatase 3-like [Citrus sinensis]
 gb|ESR64664.1| hypothetical protein CICLE_v10009204mg [Citrus clementina]
Length=265

 Score =   302 bits (774),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/269 (54%), Positives = 192/269 (71%), Gaps = 8/269 (3%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             A  VVVFDFD+T+ID DSDNWVV ++G T LF+QL  T+PWNSLMDRMMKE+H+ GKT+ 
Sbjct  2     ADVVVVFDFDRTLIDDDSDNWVVTQMGLTHLFNQLRSTLPWNSLMDRMMKELHSQGKTVE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI   L+  P+   +  AIK+ H LGCDL+IVSDAN F+IETI++H G+  CFSEI TNP
Sbjct  62    DIANCLRQCPLDSHVAAAIKSAHSLGCDLKIVSDANQFYIETIMEHHGLLGCFSEIYTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
              YVDE+GRLRILP+HD   S +GC  CP N+CK  +++ +  S G  GK+R IYLGDG G
Sbjct  122   TYVDEQGRLRILPYHDSTLSHYGCNLCPSNLCKGFVLDHVCTSFGC-GKRRFIYLGDGRG  180

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             DFCP+LKL+  DF+MPRK++P+W+ I  N  L++A++HEWS+ E+ ++IL HLI  I I+
Sbjct  181   DFCPTLKLQDCDFVMPRKNYPLWDRICSNPMLIKAKVHEWSSAEELKKILLHLIGAISIK  240

Query  376   DSQFLAAESKFQAISMQPCEALPKAIRVP  290
                    E     +S QP  +  ++  +P
Sbjct  241   -------EDVDSTVSSQPNSSECRSQTMP  262



>ref|XP_007150538.1| hypothetical protein PHAVU_005G160800g [Phaseolus vulgaris]
 gb|ADQ85984.1| acid phosphatase [Phaseolus vulgaris]
 gb|ESW22532.1| hypothetical protein PHAVU_005G160800g [Phaseolus vulgaris]
Length=279

 Score =   302 bits (773),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 150/279 (54%), Positives = 195/279 (70%), Gaps = 12/279 (4%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFD TII+ DSDNWV+DE G T  F +LL    WN LMD+MM E+H+ GKTI 
Sbjct  2     AGIVVVFDFDSTIIECDSDNWVLDEFGLTQKFYELLPNTLWNPLMDKMMDELHSQGKTIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI +VL   P+HP IVPAI+A + LGC+L+IVSDAN FFIE ILKH G+  CFS+I  NP
Sbjct  62    DIVQVLNRTPMHPSIVPAIQAAYSLGCELKIVSDANSFFIERILKHHGVWNCFSDITANP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
              YV+EEGRLRI P+HD+  S HGC  CPPNMCK  +IERIQ    +E  K+ IYLGDG G
Sbjct  122   SYVNEEGRLRICPYHDYVKSSHGCNLCPPNMCKGLVIERIQNDGAEE--KKYIYLGDGNG  179

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             DFCPSLKLK  D++MPR++FP+ +L+ +N + ++ E+H W NGE+   ++ H+IN+I  E
Sbjct  180   DFCPSLKLKEKDYLMPRRNFPLCDLVSKNPNHIKPEVHAWRNGEELYDVMLHIINKIIGE  239

Query  376   DSQ---------FLAAESKFQAISMQ-PCEALPKAIRVP  290
             + +          ++ + K  +IS+      LPKA+ VP
Sbjct  240   EGKNSVSSSSTPTISIDCKLGSISIDLHNNPLPKALPVP  278



>ref|XP_010231985.1| PREDICTED: inorganic pyrophosphatase 3-like isoform X1 [Brachypodium 
distachyon]
Length=276

 Score =   301 bits (772),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 143/258 (55%), Positives = 183/258 (71%), Gaps = 5/258 (2%)
 Frame = -1

Query  1102  MAAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLM----DRMMKEIHA  935
             MAA  VVVFDFDKTII+ DSDNWVV +LG T  F++L  TM W  LM    DRMM E+H 
Sbjct  1     MAAALVVVFDFDKTIIEWDSDNWVVTKLGATDAFNRLRPTMSWTPLMVCMYDRMMGELHE  60

Query  934   NGKTIGDIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFS  755
              GK+  DI + L+  P+   ++ AI+    LGCDL++VSDAN FFIET+L+H GI  CFS
Sbjct  61    QGKSAEDIRQCLRSAPLDAHVISAIRTASALGCDLKVVSDANAFFIETVLEHHGILGCFS  120

Query  754   EINTNPGYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIY  575
             EINTNP  VD +GRLRI PFHD  SSPHGC+ CP NMCK KIIERIQA+   +  K  IY
Sbjct  121   EINTNPARVDSDGRLRISPFHDPASSPHGCSLCPENMCKGKIIERIQATDSAK-NKHFIY  179

Query  574   LGDGIGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLI  395
             +GDG GD+CPSLKL+ GD++MP++++P+W LI  N+ LL+AE+H W+ GE  ERIL  L+
Sbjct  180   IGDGKGDYCPSLKLREGDYVMPKENYPLWNLITSNKQLLKAEVHAWNTGEGLERILLQLV  239

Query  394   NRICIEDSQFLAAESKFQ  341
             N++    +Q    + K +
Sbjct  240   NKLITPPAQVTQVDYKCE  257



>ref|XP_002282651.1| PREDICTED: inorganic pyrophosphatase 3 [Vitis vinifera]
 emb|CBI27937.3| unnamed protein product [Vitis vinifera]
Length=267

 Score =   300 bits (769),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/242 (58%), Positives = 184/242 (76%), Gaps = 0/242 (0%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
              G VV+FDFD+TIID DSD WVV E+G T  F QL   +PWN+LMDRM+ E+H+ G+TI 
Sbjct  2     TGIVVLFDFDRTIIDGDSDKWVVVEMGLTQSFQQLRSILPWNTLMDRMLHELHSQGRTIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             +IE+ L+ VP++PRI  AIKA H  GCDL++VSDAN F+IETILKH G+   FSEI TNP
Sbjct  62    EIEKCLKRVPMNPRIAAAIKAAHDFGCDLKVVSDANNFYIETILKHHGLLGFFSEIYTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
               VDE GRLRI P+ DF  +PHGC+ C  NMCK  +IE+I+A+  + GKKR IY+GDG G
Sbjct  122   TSVDEVGRLRIFPYRDFTLAPHGCSLCSYNMCKGLVIEQIRAAASENGKKRFIYVGDGKG  181

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             DFCPSLKL  GD++MPRK++P+W LI  +   ++A++ EWS+GE+ E++L HLI+ I IE
Sbjct  182   DFCPSLKLGHGDYVMPRKNYPLWNLICGDPMHIKAQVLEWSDGEELEKVLLHLIDTISIE  241

Query  376   DS  371
             ++
Sbjct  242   EN  243



>gb|ACJ84372.1| unknown [Medicago truncatula]
Length=207

 Score =   297 bits (760),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 136/203 (67%), Positives = 169/203 (83%), Gaps = 1/203 (0%)
 Frame = -1

Query  1102  MAAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKT  923
             M+   V++FDFDKTIID DSDNW++DELGFT LF+QLL TMPWNS+MD+MM E H+NG T
Sbjct  1     MSNNIVIIFDFDKTIIDCDSDNWLIDELGFTDLFNQLLPTMPWNSVMDKMMMEFHSNGVT  60

Query  922   IGDIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINT  743
             I +IE+VLQ +PIH RI+PAIK+ H LGCDLRIVSDAN+F+IETILKHLGI ECFSEIN+
Sbjct  61    IEEIEKVLQRIPIHHRIIPAIKSAHALGCDLRIVSDANMFYIETILKHLGISECFSEINS  120

Query  742   NPGYVDEEGRLRILPFHDFHSSPHGCAR-CPPNMCKSKIIERIQASMGKEGKKRVIYLGD  566
             NPGYV++EGR+RI P+HDF+ + HGC   CPPNMCK  II++I+ ++     KR+IYLGD
Sbjct  121   NPGYVNQEGRVRISPYHDFNKASHGCNNVCPPNMCKGLIIDKIKNTIYDGDNKRLIYLGD  180

Query  565   GIGDFCPSLKLKAGDFMMPRKDF  497
             G GD+CPSL+ K  DF+MPR+ F
Sbjct  181   GAGDYCPSLRFKERDFVMPRRIF  203



>emb|CAN67288.1| hypothetical protein VITISV_021601 [Vitis vinifera]
Length=256

 Score =   298 bits (764),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 153/268 (57%), Positives = 181/268 (68%), Gaps = 14/268 (5%)
 Frame = -1

Query  1093  GTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGD  914
               VVVFDFDKTIID DSDNWVVDELG T LF QLL TMPWNSLMDRM  E+H+ GKT+ +
Sbjct  2     AVVVVFDFDKTIIDCDSDNWVVDELGLTPLFTQLLPTMPWNSLMDRMFMELHSQGKTMEE  61

Query  913   IERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPG  734
             I   L+  P+HPRI+ AIK+ H  GCDLRIVSDAN FFIET+LKH G+ +CFSEI TNP 
Sbjct  62    IAECLKRAPLHPRIISAIKSAHASGCDLRIVSDANAFFIETVLKHHGLMDCFSEIKTNPS  121

Query  733   YVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGD  554
             +VD EGRLRILP+HD  SS HGC  CPPNMCK  ++ER++ S+  EGKKR IYLGDG  D
Sbjct  122   FVDGEGRLRILPYHDLKSSSHGCNICPPNMCKGLVMERVRTSVSAEGKKRFIYLGDGSAD  181

Query  553   FCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIED  374
             FC  LKL  G     +K+ P           L   +H   NGE+ E+IL HLI  I IE+
Sbjct  182   FCSGLKLGEGGLPDAQKELP----------HLGDYLH---NGEELEKILLHLITTISIEE  228

Query  373   SQFLAAESKFQAISMQPCEALPKAIRVP  290
                + +E K QA SM   +     + VP
Sbjct  229   KCNMRSE-KCQASSMDSHKTFQSVLPVP  255



>ref|XP_008242421.1| PREDICTED: inorganic pyrophosphatase 3 [Prunus mume]
Length=257

 Score =   298 bits (762),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 137/241 (57%), Positives = 183/241 (76%), Gaps = 0/241 (0%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFD+T+ID DSD+WVV E+G T LF++L  T+PWN LMDRMMKE+H  GK+  
Sbjct  2     AGIVVVFDFDRTLIDGDSDSWVVAEMGLTQLFNELRSTLPWNKLMDRMMKELHLQGKSSV  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI+  L+ +P+HP ++ AIK+ H  GCDLRI+SDAN FFIETIL+  G+  CFS+I TNP
Sbjct  62    DIKECLKIIPMHPGVIAAIKSAHASGCDLRIISDANQFFIETILECHGLLGCFSQIVTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
              +VD +GRLRI P+ D  S  HGC  CPPN+CK  +I++I+AS+   G+KR IYLGDG  
Sbjct  122   SFVDGDGRLRIFPYRDVGSPSHGCNLCPPNLCKGVVIDQIRASVSANGRKRYIYLGDGRN  181

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             DFCP+L+L  GD +MPRKD+ + + I  N+ L++A+IHEWS+GE+  +IL HLI+RI  +
Sbjct  182   DFCPTLRLVEGDHVMPRKDYALSKRIYSNQMLIKADIHEWSDGEELGKILLHLIHRISTK  241

Query  376   D  374
             +
Sbjct  242   E  242



>gb|ACG25081.1| phosphatase phospho1 [Zea mays]
Length=283

 Score =   298 bits (764),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/250 (56%), Positives = 180/250 (72%), Gaps = 6/250 (2%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFDKTIIDVDSDNWVVD LG T LF++LL T PWN+LMD MM E+HA G+T+ 
Sbjct  2     AGIVVVFDFDKTIIDVDSDNWVVDSLGLTDLFERLLPTTPWNTLMDTMMGELHARGRTLA  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             ++   L+  PI PR+  A++A H LGCDLR++SDAN FFI T+L H G+ +CFS+INTNP
Sbjct  62    EVTEALRAAPIDPRVPAAVRAAHALGCDLRVLSDANAFFIHTVLDHHGLLDCFSQINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGC--ARCPPNMCKSKIIERI----QASMGKEGKKRVIY  575
               VD  GRLRI P HD  ++PHGC    CPPNMCK  +++RI    +A      K RVIY
Sbjct  122   SRVDAHGRLRIGPCHDPRAAPHGCGVGTCPPNMCKGLVLDRILREAEAEAASSAKPRVIY  181

Query  574   LGDGIGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLI  395
             LGDG GD+CP+L+L   DF+MPR+ +PVW+LI E+ + L+AE+H W++G + E  L  L+
Sbjct  182   LGDGRGDYCPALRLARTDFVMPRRGYPVWDLICEDPARLQAEVHPWTDGAELEETLLRLV  241

Query  394   NRICIEDSQF  365
              R  +ED+  
Sbjct  242   RRALVEDAAL  251



>ref|NP_001130133.1| phosphatase phospho1 [Zea mays]
 gb|ACF78268.1| unknown [Zea mays]
 gb|ACG25041.1| phosphatase phospho1 [Zea mays]
 gb|ACG25244.1| phosphatase phospho1 [Zea mays]
 gb|AFW83764.1| phosphatase phospho1 [Zea mays]
Length=285

 Score =   297 bits (761),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 138/252 (55%), Positives = 179/252 (71%), Gaps = 8/252 (3%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFDKTIIDVDSDNWVVD LG T LF++LL T PWN+LMD MM E+HA G+T+ 
Sbjct  2     AGIVVVFDFDKTIIDVDSDNWVVDSLGLTDLFERLLPTTPWNTLMDTMMGELHARGRTLA  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             ++   L+  PI PR+  A++A H LGCDLR++SDAN FFI T+L H G+  CFS++NTNP
Sbjct  62    EVTEALRAAPIDPRVPAAVRAAHALGCDLRVLSDANAFFIHTVLDHHGLLACFSQVNTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGC--ARCPPNMCKSKIIERI------QASMGKEGKKRV  581
               VD  GRLRI P HD  ++PHGC    CPPNMCK  +++RI      +A      K RV
Sbjct  122   SRVDAHGRLRIGPCHDPRAAPHGCGVGTCPPNMCKGLVLDRILREAEAEAETASSAKPRV  181

Query  580   IYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFH  401
             IYLGDG GD+CP+L+L   DF+MPR+ +PVW+LI E+ + L+AE+H W++G + E  L  
Sbjct  182   IYLGDGRGDYCPALRLARTDFVMPRRGYPVWDLICEDPARLQAEVHPWTDGAELEETLLR  241

Query  400   LINRICIEDSQF  365
             L+ R  +ED+  
Sbjct  242   LVRRAVVEDAAL  253



>ref|XP_011093693.1| PREDICTED: inorganic pyrophosphatase 3 [Sesamum indicum]
Length=241

 Score =   295 bits (756),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 133/243 (55%), Positives = 183/243 (75%), Gaps = 2/243 (1%)
 Frame = -1

Query  1102  MAAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKT  923
             MA   V++FDFD+T+I+ DSD WV+  LG   LF QLLH +PWNSLMDRM++E++  GKT
Sbjct  1     MAGSVVILFDFDRTLIEDDSDRWVITNLGLNELFHQLLHALPWNSLMDRMLEELYTQGKT  60

Query  922   IGDIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINT  743
             + DI   L+G+P++P ++  IK+ H LGCDL++VSD+NLF+I+TIL+H G+  CFSEI T
Sbjct  61    VDDIVECLKGIPLNPHVIAVIKSAHALGCDLKVVSDSNLFYIKTILEHNGVYNCFSEITT  120

Query  742   NPGYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDG  563
             NP  VD  GRLRI P+HD  SS HGC  CPPN+CK ++I++I++S+ +   K++IY+GDG
Sbjct  121   NPALVD-GGRLRIFPYHDAASS-HGCDLCPPNLCKGRVIQQIRSSISENESKKIIYVGDG  178

Query  562   IGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRIC  383
             + DFCP+LKL AGD +MPRK+FP+W  I +N  L++A ++EW + ED  RIL  LIN   
Sbjct  179   MNDFCPTLKLVAGDCVMPRKNFPLWGRIWKNFQLVKAIVYEWDDSEDLARILLELINSKS  238

Query  382   IED  374
             IED
Sbjct  239   IED  241



>ref|XP_010690044.1| PREDICTED: inorganic pyrophosphatase 2-like [Beta vulgaris subsp. 
vulgaris]
Length=290

 Score =   297 bits (761),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 147/284 (52%), Positives = 192/284 (68%), Gaps = 19/284 (7%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             A  +VVFDFDKTI+D D+DNWV+DEL FT +F+QLL TMPWN LMD MMKE+H  G T  
Sbjct  8     ANIMVVFDFDKTIVDCDTDNWVLDELNFTEMFEQLLPTMPWNPLMDLMMKEMHEKGVTTN  67

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI  VL   PIH RI+PAIK+ +  GCDLRI+SDAN FFIETIL H GI++ F+EI+TN 
Sbjct  68    DIVEVLNRTPIHARIIPAIKSAYDAGCDLRILSDANRFFIETILDHHGIKDYFTEIHTNS  127

Query  736   GYVDEEGRLRILPFHDFHSSPHGCAR--CPPNMCKSKIIERIQASMGKEGKKRVIYLGDG  563
             G+VDE GR+RI P HDF ++PHGC    CPPNMCK  +++++ A    EG    IYLGDG
Sbjct  128   GFVDENGRVRIFPHHDFTTTPHGCDNILCPPNMCKGSVMKKLLA---HEGDNTFIYLGDG  184

Query  562   IGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRIC  383
              GD CPS KL+  D+ MPR ++P+W +I  N  ++ AEIH W++G+D ER+L  LI+ I 
Sbjct  185   NGDHCPSTKLRERDYCMPRINYPLWGVITSNPKVITAEIHGWTDGQDLERVLLSLIHSII  244

Query  382   IEDSQ-------------FLAAESKFQAISMQPC-EALPKAIRV  293
               D++                 ++KF     +P  E+LP A++V
Sbjct  245   SNDNKNKQEKNVGGSFQSLTGIKNKFNKNMPRPSRESLPPALKV  288



>ref|NP_001151156.1| LOC100284789 [Zea mays]
 gb|ACG41811.1| phosphatase phospho1 [Zea mays]
 tpg|DAA57843.1| TPA: phosphatase phospho1 [Zea mays]
Length=276

 Score =   296 bits (759),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 138/249 (55%), Positives = 183/249 (73%), Gaps = 6/249 (2%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFDKTIIDVDSDNWVVD LGFT  F++LL TMPWN+LMD MM E+HA+G+T+ 
Sbjct  2     AGVVVVFDFDKTIIDVDSDNWVVDSLGFTEPFERLLPTMPWNTLMDTMMGELHAHGRTLD  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             D+   L+  P+   +  AIKA + LGCDLR++SDAN FFI+T+L H G+  CFS+INTNP
Sbjct  62    DVAEALRAAPVVAGVPAAIKAAYALGCDLRVLSDANAFFIDTVLAHHGLLGCFSQINTNP  121

Query  736   GY--VDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERI--QASMGKEGKKRVIYLG  569
              +   D +GRLRI P+HD H    G   CPPNMCK ++++RI  +AS    G+KRV+YLG
Sbjct  122   SHPDADADGRLRIGPYHDLHGC--GVGTCPPNMCKGQVLDRILREASSSAAGRKRVVYLG  179

Query  568   DGIGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINR  389
             DG GD+CP+L+L   DF+MPR+ FPVW+LI E+ + L+AE+H W++G + E  L  L+ R
Sbjct  180   DGRGDYCPALRLAREDFVMPRRGFPVWDLICEDPARLQAEVHPWADGAELEETLLRLVGR  239

Query  388   ICIEDSQFL  362
               +E++  L
Sbjct  240   ARVEEAALL  248



>ref|XP_007024448.1| Inorganic pyrophosphatase 2 [Theobroma cacao]
 gb|EOY27070.1| Inorganic pyrophosphatase 2 [Theobroma cacao]
Length=232

 Score =   294 bits (753),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 139/219 (63%), Positives = 173/219 (79%), Gaps = 2/219 (1%)
 Frame = -1

Query  955  MMKEIHANGKTIGDIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHL  776
            MMKE+H+ G  I DI+ VL+  PIHPRI+ AIK+ + LGCDL+IVSDAN FFIETILKH 
Sbjct  1    MMKELHSQGTKIEDIKAVLKRTPIHPRIIQAIKSAYALGCDLKIVSDANAFFIETILKHH  60

Query  775  GIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCAR-CPPNMCKSKIIERIQASMGK  599
            G+RE FSEINTNPG+VDEEGRLRI P HDF  SPHGC   CPPNMCK  +IERIQASM  
Sbjct  61   GLREYFSEINTNPGFVDEEGRLRIFPHHDFTQSPHGCHHPCPPNMCKGTVIERIQASMST  120

Query  598  EGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDF  419
            EGKK +IYLGDG+GDFCPSLKL  GD++MPRK+FPVW+LI ENR L++AE+ EWSNG++F
Sbjct  121  EGKKTIIYLGDGVGDFCPSLKLGDGDYVMPRKNFPVWDLICENRRLIKAEVCEWSNGDEF  180

Query  418  ERILFHLINRICIEDSQFLAAESKFQAISMQPCEALPKA  302
            E +L HLI+RI I+ +    + ++  ++  +P + +P A
Sbjct  181  EHVLLHLISRISIDRNNSGNSTAQLYSVDCKP-QTMPGA  218



>ref|XP_009352621.1| PREDICTED: inorganic pyrophosphatase 3 [Pyrus x bretschneideri]
Length=245

 Score =   295 bits (754),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 137/244 (56%), Positives = 182/244 (75%), Gaps = 0/244 (0%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFD+T+ID DSD+WVV E+G T LF+++  T+PWNSLMDRM +E+H  GKT  
Sbjct  2     AGIVVVFDFDRTLIDGDSDSWVVTEMGLTQLFNEIRSTLPWNSLMDRMTEELHLQGKTSE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI+  L+ +P+HP +  AIK+ H  GCDLRIVSDAN FFIE IL+  G+  CFS+I TNP
Sbjct  62    DIKECLKRIPMHPGVTAAIKSAHASGCDLRIVSDANRFFIEAILECHGLLGCFSQIVTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
               V+++GRLRI P  D  SS HGC  CPPN+CK  +I++I+AS+   G+KR +YLGDG  
Sbjct  122   TSVEQDGRLRIFPHCDLGSSFHGCNLCPPNLCKGVVIDQIRASVSANGRKRFVYLGDGRN  181

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             D+CPSL+L  GD +MPRKD+ +W+ I  N  L++A+IHEWS+GE+  + L HLI+RI  E
Sbjct  182   DYCPSLRLVEGDHVMPRKDYALWKRICSNPVLIKADIHEWSDGEELGKTLLHLIHRISSE  241

Query  376   DSQF  365
             ++Q 
Sbjct  242   ENQM  245



>ref|XP_008337676.1| PREDICTED: inorganic pyrophosphatase 3 [Malus domestica]
Length=247

 Score =   294 bits (753),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/243 (56%), Positives = 180/243 (74%), Gaps = 0/243 (0%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFD+T+ID DSD WVV E+G T LF++L  T+PWNSLMDRM KE+H  GKT  
Sbjct  2     AGIVVVFDFDRTLIDGDSDRWVVTEMGLTQLFNELRSTLPWNSLMDRMTKELHLQGKTSE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI+  L+ +P+HP +  AIK+ H  GCDLRIVSDAN FFIE IL+  G+  CFS+I TNP
Sbjct  62    DIKECLKRIPMHPGVTAAIKSAHXSGCDLRIVSDANQFFIEAILECHGLLGCFSQIVTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
               V+++GRLRI P  D  SS HGC  CPPN+CK  +I++I+AS+   G+KR +YLGDG  
Sbjct  122   TSVEQDGRLRIFPHCDLGSSSHGCNLCPPNLCKGVVIDQIRASVSANGRKRFVYLGDGRN  181

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             D+CPSL+L  GD +MPR+D+ +W+ I  N  L++A+IHEWS+GE+  + L H I+RI  E
Sbjct  182   DYCPSLRLVEGDHVMPRRDYALWKRICSNPVLIKADIHEWSDGEELGKTLLHXIHRISSE  241

Query  376   DSQ  368
             ++Q
Sbjct  242   ENQ  244



>gb|KHG05357.1| hypothetical protein F383_31213 [Gossypium arboreum]
Length=245

 Score =   294 bits (752),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 142/242 (59%), Positives = 180/242 (74%), Gaps = 0/242 (0%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             A  VVVFDFD+T+ID DSD+WVV E+G + LF QL  T+PWNSLMDRMMKE+H+ G+T  
Sbjct  2     AAIVVVFDFDRTLIDGDSDSWVVTEMGLSDLFHQLRSTLPWNSLMDRMMKELHSRGETAD  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI   L+  P+HPRI  AIKA H  GCDLRI+SDAN FFIE IL+H  +  CFS+I TNP
Sbjct  62    DIAECLKKTPVHPRIAAAIKAAHAFGCDLRILSDANQFFIEKILEHHDLLGCFSKIYTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
              +VDEEGRLRI P+HD   SPHGC+ CP N+CK +++   QAS  +  ++  IYLGDG G
Sbjct  122   TFVDEEGRLRIFPYHDSTLSPHGCSLCPSNLCKGQVLNNNQASAPESERQNFIYLGDGSG  181

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             D+CP+LKL   D++MPRK++P+W  I  +R+ ++AE+ EWSNGE+ E IL HLINRI  E
Sbjct  182   DYCPTLKLGDKDYVMPRKNYPLWNCIFSDRAFVKAEVREWSNGEELEGILLHLINRISSE  241

Query  376   DS  371
              S
Sbjct  242   RS  243



>ref|XP_004287531.1| PREDICTED: inorganic pyrophosphatase 3-like [Fragaria vesca subsp. 
vesca]
Length=236

 Score =   293 bits (749),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 135/235 (57%), Positives = 175/235 (74%), Gaps = 0/235 (0%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
              GTVVVFDFD+T+I+ DSD WVV E+G   +F++L  T+PWNSLMDRMM E+H  GKT  
Sbjct  2     TGTVVVFDFDRTLINDDSDRWVVTEMGLKQVFNELRSTLPWNSLMDRMMMELHLQGKTTE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI+  L+  P+HP +V AIK+ H LGCDL+I+SDAN FFIE+IL+  G+  CFS+I TNP
Sbjct  62    DIKECLKRTPMHPLVVAAIKSAHALGCDLKIISDANQFFIESILECHGLLGCFSQIVTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
               VD +GRLRI P+HD  SS HGC  CP NMCK ++I++  AS  + G+KR IYLGDG  
Sbjct  122   TSVDGDGRLRISPYHDPVSSSHGCNFCPSNMCKGQVIDQFLASASENGRKRYIYLGDGRN  181

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLIN  392
             DFCP+LKL  GD +MPRK++P+W+ I  NR L+ A+IHEW++GE+  +IL  LI 
Sbjct  182   DFCPTLKLVEGDHVMPRKEYPLWDRICSNRMLINADIHEWTDGEELAKILLQLIQ  236



>ref|XP_008228321.1| PREDICTED: inorganic pyrophosphatase 2-like isoform X2 [Prunus 
mume]
Length=223

 Score =   291 bits (745),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 141/223 (63%), Positives = 176/223 (79%), Gaps = 4/223 (2%)
 Frame = -1

Query  955  MMKEIHANGKTIGDIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHL  776
            MMKE+H+ GKT  DI  VL+  PIHPR+VPAIKA H LGCDL+IVSDANLFFIETILKHL
Sbjct  1    MMKELHSQGKTAEDIVEVLKRTPIHPRVVPAIKAAHALGCDLKIVSDANLFFIETILKHL  60

Query  775  GIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKE  596
            G+ E FSEINTNP YVDE+GRLRI P HDF    HGC+ CPPNMCK  +IER+Q  +  E
Sbjct  61   GLEEYFSEINTNPSYVDEQGRLRISPHHDFIKCSHGCSLCPPNMCKGVVIERVQTYLSSE  120

Query  595  GKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFE  416
            GKK++IYLGDG GD+CPSLKLK  DF+MPRK+FP+++LI ++  L++A+IHEW++GE+ E
Sbjct  121  GKKKIIYLGDGSGDYCPSLKLKEVDFVMPRKNFPLFDLICKDPLLIKADIHEWTDGEELE  180

Query  415  RILFHLINRICI-EDSQFL-AAESKFQAISMQPCEALPKAIRV  293
             IL +LIN I   E++QF+ AA+ K Q +S    EALP+A+ V
Sbjct  181  HILLNLINTIATEENAQFISAADCKLQTMSAH--EALPQALPV  221



>ref|XP_006646071.1| PREDICTED: inorganic pyrophosphatase 3-like, partial [Oryza brachyantha]
Length=273

 Score =   290 bits (742),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 141/264 (53%), Positives = 181/264 (69%), Gaps = 3/264 (1%)
 Frame = -1

Query  1078  FDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIERVL  899
             FDFDKTII+ DSD+WV+ ELG    F +L  TM WN LMDRMM E+HA G++  DI   L
Sbjct  11    FDFDKTIIEWDSDHWVITELGAADAFSRLRPTMRWNPLMDRMMAELHAQGRSADDIRECL  70

Query  898   QGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEE  719
             +  P+   ++ AI+    LGCDLR+VSDAN FFIET+L+H G+  CFSEI+TNP  VD +
Sbjct  71    RSAPLDAHVLSAIRTASALGCDLRVVSDANAFFIETVLEHHGVLGCFSEISTNPARVDGD  130

Query  718   GRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSL  539
             GRLRI PFHD  SSPHGC+ CP NMCK KIIERIQA+    GK+  IY+GDG GD+CPSL
Sbjct  131   GRLRISPFHDPDSSPHGCSLCPDNMCKGKIIERIQAT--ANGKRHFIYIGDGRGDYCPSL  188

Query  538   KLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFLA  359
             KL  GD++MP+++ P+W LI  N  LL+AE+H W NGE+ E+ L  L+N++    +Q   
Sbjct  189   KLGEGDYVMPKENHPLWNLISSNTQLLKAEVHPWKNGEELEKTLLKLVNKVINPPAQASQ  248

Query  358   AESKFQAISMQPCE-ALPKAIRVP  290
              E K    +    E    +A+RVP
Sbjct  249   FECKCDMSNPVSTEVGHHQALRVP  272



>ref|XP_007202473.1| hypothetical protein PRUPE_ppa010251mg [Prunus persica]
 gb|EMJ03672.1| hypothetical protein PRUPE_ppa010251mg [Prunus persica]
Length=257

 Score =   289 bits (739),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 135/241 (56%), Positives = 179/241 (74%), Gaps = 0/241 (0%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFD+T+ID DSD+WVV E+G T LF++L  T+PWN LMDRMM+E+H  GK+  
Sbjct  2     AGIVVVFDFDRTLIDGDSDSWVVAEMGLTQLFNELRSTLPWNKLMDRMMEELHLQGKSSV  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI+  L+ +P+H  ++ AIK+ H  GCDLRI+SDAN FFIETIL+  G+   FS+I TNP
Sbjct  62    DIKECLKRIPMHLGVIAAIKSAHASGCDLRIISDANQFFIETILECHGLLGSFSQIVTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
               VD +GRLRI P+HD  S  HGC  CP N+CK  +I++I+AS+   G+K  IYLGDG  
Sbjct  122   SIVDGDGRLRIFPYHDVGSPSHGCNLCPSNLCKGVVIDQIRASVSANGRKIYIYLGDGRN  181

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             DFCP+L+L  GD +MPRKD+ + + I  NR L++A+IHEWS+GE+  +IL HLI+RI  E
Sbjct  182   DFCPTLRLVEGDHVMPRKDYALSKRIYSNRMLIKADIHEWSDGEELGKILLHLIHRISTE  241

Query  376   D  374
             +
Sbjct  242   E  242



>gb|EYU27314.1| hypothetical protein MIMGU_mgv1a012849mg [Erythranthe guttata]
Length=238

 Score =   288 bits (736),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 136/238 (57%), Positives = 177/238 (74%), Gaps = 5/238 (2%)
 Frame = -1

Query  1102  MAAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKT  923
             MA   VV+FDFD+T+I+ DSD WVV  +G T LF+QL  T+PWNSLMDRM++E+H  GKT
Sbjct  1     MAGEIVVIFDFDRTLIEDDSDRWVVTNMGLTQLFNQLRPTLPWNSLMDRMLEELHIRGKT  60

Query  922   IGDIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINT  743
             I +I   L+ +P+HP ++ AIK+ H LGCDL+IVSD+N+F+I+TIL+H GI ECFSEI T
Sbjct  61    IEEISDCLKSMPLHPHVIEAIKSAHALGCDLKIVSDSNMFYIKTILEHHGIYECFSEITT  120

Query  742   NPGYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKR-VIYLGD  566
             NP  VD   RLRI P   F  SPHGC  CPPN+CK ++++RIQAS  + G+KR +IY+GD
Sbjct  121   NPSVVDNR-RLRISP---FSPSPHGCDLCPPNLCKGRVLDRIQASTTESGRKRQLIYVGD  176

Query  565   GIGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLIN  392
             G+ DFCP+LKL   D +MPRK+FP+W  I +N  L+ A+IHEW  GED  RI+  LI 
Sbjct  177   GMNDFCPTLKLVERDCVMPRKNFPLWNRIMKNPQLVRAKIHEWGKGEDLARIMLELIT  234



>gb|KDP34111.1| hypothetical protein JCGZ_07682 [Jatropha curcas]
Length=281

 Score =   289 bits (740),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 145/266 (55%), Positives = 186/266 (70%), Gaps = 9/266 (3%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             A  +VVFDFD+T+ID DSD WVV++LG    F QLL T+P NS+MD+MM E+H+  KTI 
Sbjct  2     AKALVVFDFDETLIDCDSDYWVVEQLGVNDTFLQLLPTLPLNSIMDQMMTELHSRKKTIQ  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI   L  VP H +I+ AIK+ +  G DLRIVSDAN FFIETIL+  GI  CFSEI+TNP
Sbjct  62    DIAECLIQVPFHSKILSAIKSAYASGGDLRIVSDANTFFIETILEKHGIIGCFSEIHTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
              YVDEEGRL+IL +HD  SS HGC+ CPPNMCK  ++ERI+ S+  EGKKR IY+GDG  
Sbjct  122   SYVDEEGRLKILQYHDSKSSSHGCSICPPNMCKGLVMERIRTSVRSEGKKRFIYVGDGTP  181

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELI--KENRSLLEAEIHEWSNGEDFERILFHLINRIC  383
             DFC +LKL+ GDF+MPRK+FP+ + I    N++L++A I EWS+GE+    L + IN I 
Sbjct  182   DFCATLKLEEGDFVMPRKNFPLCDFIYGNGNKNLIKANIQEWSDGEELSTNLLNAINTII  241

Query  382   IE-------DSQFLAAESKFQAISMQ  326
             I+       D   +  + KFQ  S+ 
Sbjct  242   IQEDYNVRPDDPLVPLDCKFQTSSIS  267



>ref|XP_010047325.1| PREDICTED: inorganic pyrophosphatase 2-like isoform X1 [Eucalyptus 
grandis]
Length=317

 Score =   290 bits (742),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 137/282 (49%), Positives = 194/282 (69%), Gaps = 7/282 (2%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             A  V+VFDFDKTI+D DSD+WVVD+LG +  FD+L  T+P+NSLMDRMM E+H+ GKT+ 
Sbjct  34    AEIVLVFDFDKTILDCDSDDWVVDKLGLSEAFDRLRPTLPYNSLMDRMMMELHSRGKTME  93

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             +I   L+  P+HP+IV AIK+ +  GCDLRI+SD+N+FFIETIL+H G+ ECFS+INTNP
Sbjct  94    EIADCLKEAPLHPKIVSAIKSANASGCDLRILSDSNVFFIETILRHHGLMECFSQINTNP  153

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
             G VD EGRL I P+HDF    HGC  CPPNMCK  ++++I++    +GK+R +Y+GDG  
Sbjct  154   GSVDAEGRLNISPYHDFSRLLHGCKICPPNMCKGIVMDKIRSPAFAKGKRRFVYVGDGAA  213

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRIC--  383
             DFC  +KL+  D ++PRKDFPVW+LI  + +L++A + EW++  + E +L   ++ +   
Sbjct  214   DFCAGMKLEEEDVLLPRKDFPVWDLICRSPTLIKARVLEWTDAAELETVLLSSVDTLGRT  273

Query  382   -----IEDSQFLAAESKFQAISMQPCEALPKAIRVPF*FCSS  272
                  ++ ++ + A  KFQ   +      P A R     CSS
Sbjct  274   GNGSNVKAARVVPAACKFQTSLLDAAPESPAARRDLEPCCSS  315



>ref|XP_010047326.1| PREDICTED: inorganic pyrophosphatase 2-like isoform X2 [Eucalyptus 
grandis]
 gb|KCW79212.1| hypothetical protein EUGRSUZ_C00640 [Eucalyptus grandis]
Length=309

 Score =   289 bits (740),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 137/282 (49%), Positives = 194/282 (69%), Gaps = 7/282 (2%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             A  V+VFDFDKTI+D DSD+WVVD+LG +  FD+L  T+P+NSLMDRMM E+H+ GKT+ 
Sbjct  26    AEIVLVFDFDKTILDCDSDDWVVDKLGLSEAFDRLRPTLPYNSLMDRMMMELHSRGKTME  85

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             +I   L+  P+HP+IV AIK+ +  GCDLRI+SD+N+FFIETIL+H G+ ECFS+INTNP
Sbjct  86    EIADCLKEAPLHPKIVSAIKSANASGCDLRILSDSNVFFIETILRHHGLMECFSQINTNP  145

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
             G VD EGRL I P+HDF    HGC  CPPNMCK  ++++I++    +GK+R +Y+GDG  
Sbjct  146   GSVDAEGRLNISPYHDFSRLLHGCKICPPNMCKGIVMDKIRSPAFAKGKRRFVYVGDGAA  205

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRIC--  383
             DFC  +KL+  D ++PRKDFPVW+LI  + +L++A + EW++  + E +L   ++ +   
Sbjct  206   DFCAGMKLEEEDVLLPRKDFPVWDLICRSPTLIKARVLEWTDAAELETVLLSSVDTLGRT  265

Query  382   -----IEDSQFLAAESKFQAISMQPCEALPKAIRVPF*FCSS  272
                  ++ ++ + A  KFQ   +      P A R     CSS
Sbjct  266   GNGSNVKAARVVPAACKFQTSLLDAAPESPAARRDLEPCCSS  307



>ref|XP_004168220.1| PREDICTED: inorganic pyrophosphatase 3-like [Cucumis sativus]
Length=243

 Score =   286 bits (731),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 127/235 (54%), Positives = 182/235 (77%), Gaps = 3/235 (1%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG  +VFDFD+TIID DSDN VV ++G T LF++L  ++ WNSLMD ++ E+ + G+T+G
Sbjct  2     AGITIVFDFDRTIIDGDSDNLVVTQMGLTNLFNKLYSSLAWNSLMDTLIVELQSQGRTMG  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI + L+G  +HPRI+ AI++ H  GCDLRI+SDAN FFIETIL+H G+  CFS INTNP
Sbjct  62    DIAKCLEGAALHPRIIAAIRSAHDAGCDLRIISDANQFFIETILEHHGVLGCFSTINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
              +VD +GRLRI P+HD  SSPHGC  CP NMCK  ++++I+AS G+  K   IY+GDG G
Sbjct  122   TFVDGKGRLRISPYHD-ESSPHGCNLCPSNMCKGLVVDQIRASKGE--KNEFIYIGDGGG  178

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLIN  392
             D+CP+L+L+ GD +MPRK +P+ + I  N+++++A+IHEWS+G++ E+IL ++++
Sbjct  179   DYCPTLRLQEGDHVMPRKLYPLSDRINSNQTIVKAKIHEWSDGKELEKILLNILD  233



>gb|KHN16679.1| Inorganic pyrophosphatase 3 [Glycine soja]
Length=246

 Score =   286 bits (731),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 130/237 (55%), Positives = 174/237 (73%), Gaps = 4/237 (2%)
 Frame = -1

Query  1078  FDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIERVL  899
              DFD+TIID DSD W+V ELG T LF +L H+MPW SLMDR+M ++H+NG T+  I   L
Sbjct  10    LDFDRTIIDDDSDRWIVAELGLTELFKELRHSMPWISLMDRIMAQLHSNGVTVDHIADCL  69

Query  898   QGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEE  719
             + +P  P IV AIK+ H LGCDLRI+SDAN F I TIL+H  +  CFS+I+TNP ++D +
Sbjct  70    KRLPFPPPIVSAIKSAHALGCDLRIISDANTFSIRTILQHHALFHCFSQIHTNPAFLDNQ  129

Query  718   GRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASM----GKEGKKRVIYLGDGIGDF  551
             GRLR+ PFH    SPH C  CPPNMCK  +I++I++S+    G E ++R IY+GDG GD+
Sbjct  130   GRLRVTPFHHSTHSPHSCPLCPPNMCKGLVIDQIRSSLLSGTGNEEERRFIYIGDGAGDY  189

Query  550   CPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICI  380
             CP+LKLK GDF+MPRK++P+W  I  +  L+ A++H+WS GED E IL +LIN+I +
Sbjct  190   CPTLKLKGGDFVMPRKNYPLWNKIHSDPKLVAAQLHDWSTGEDLETILLNLINKISL  246



>ref|XP_004135700.1| PREDICTED: inorganic pyrophosphatase 3-like [Cucumis sativus]
 gb|KGN66218.1| hypothetical protein Csa_1G586800 [Cucumis sativus]
Length=245

 Score =   285 bits (730),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 127/235 (54%), Positives = 182/235 (77%), Gaps = 3/235 (1%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG  +VFDFD+TIID DSDN VV ++G T LF++L  ++ WNSLMD ++ E+ + G+T+G
Sbjct  2     AGITIVFDFDRTIIDGDSDNLVVTQMGLTNLFNKLYSSLAWNSLMDTLIVELQSQGRTMG  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI + L+G  +HPRI+ AI++ H  GCDLRI+SDAN FFIETIL+H G+  CFS INTNP
Sbjct  62    DIAKCLEGAALHPRIIAAIRSAHDAGCDLRIISDANQFFIETILEHHGVLGCFSTINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
              +VD +GRLRI P+HD  SSPHGC  CP NMCK  ++++I+AS G+  K   IY+GDG G
Sbjct  122   TFVDGKGRLRISPYHD-ESSPHGCNLCPSNMCKGLVVDQIRASKGE--KNEFIYIGDGGG  178

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLIN  392
             D+CP+L+L+ GD +MPRK +P+ + I  N+++++A+IHEWS+G++ E+IL ++++
Sbjct  179   DYCPTLRLQEGDHVMPRKLYPLSDRINSNQTIVKAKIHEWSDGKELEKILLNILD  233



>ref|XP_008450832.1| PREDICTED: inorganic pyrophosphatase 3 isoform X1 [Cucumis melo]
Length=237

 Score =   285 bits (729),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 128/235 (54%), Positives = 181/235 (77%), Gaps = 3/235 (1%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG  +VFDFD+TIID DSDN VV ++G T LF++L  ++ WNSLMD +M E+ + G+T+ 
Sbjct  2     AGITIVFDFDRTIIDGDSDNLVVTQMGLTNLFNKLYSSLAWNSLMDTLMVELQSQGRTMR  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI + L+G  +HPRI+ AI++ H  GCDLRI+SDAN FFIETIL+H G+  CFS INTNP
Sbjct  62    DIAKCLEGAALHPRIIAAIRSAHDAGCDLRIISDANQFFIETILEHHGVLGCFSTINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
              +VD +GRLRI P+HD  SSPHGC  CP NMCK  +I++I+AS G+  K   IY+GDG G
Sbjct  122   TFVDGKGRLRISPYHD-ESSPHGCNLCPSNMCKGLVIDQIRASKGE--KNEFIYIGDGRG  178

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLIN  392
             D+CP+L+L+ GD +MPRK +P+ + I  N+++++A+IHEWS+G++ E+IL ++++
Sbjct  179   DYCPTLRLQEGDHVMPRKLYPLSDRINSNQTIVKAKIHEWSDGKELEKILLNILD  233



>ref|XP_010438289.1| PREDICTED: inorganic pyrophosphatase 3 [Camelina sativa]
Length=244

 Score =   285 bits (729),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 132/244 (54%), Positives = 176/244 (72%), Gaps = 1/244 (0%)
 Frame = -1

Query  1102  MAAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKT  923
             M A  V+VFDFD+T+ID DSDNWVV E+G T +F QL  T+PWN LMDRMM E+H+ G++
Sbjct  1     MMAKIVIVFDFDRTLIDGDSDNWVVTEMGLTEIFHQLRFTLPWNRLMDRMMMELHSQGRS  60

Query  922   IGDIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINT  743
             I DIE  L+ +PI  +++ AIK+   LGCDL+IVSDAN FFIE IL+   + +CFSEI T
Sbjct  61    IEDIEACLKKMPIDSQVIEAIKSAKSLGCDLKIVSDANQFFIEKILEQHDLLDCFSEIYT  120

Query  742   NPGYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEG-KKRVIYLGD  566
             NP  VDE G LRILP+H    +PH C  CP N+CK  +++ I+AS   +    R IYLGD
Sbjct  121   NPSSVDENGNLRILPYHSDALAPHSCNLCPTNLCKGLVMDHIRASSANDQIPTRFIYLGD  180

Query  565   GIGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRI  386
             G GDFCP+LKL+  DF+MPR ++P+W+ I +N SL++AE+ EWSN E+ +RIL  L++ I
Sbjct  181   GGGDFCPTLKLRECDFVMPRTNYPLWKKISDNSSLIKAEVKEWSNAEELQRILLQLVSTI  240

Query  385   CIED  374
               E+
Sbjct  241   TKEE  244



>ref|NP_001235542.1| uncharacterized protein LOC100306472 [Glycine max]
 gb|ACU14672.1| unknown [Glycine max]
Length=246

 Score =   284 bits (727),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 129/237 (54%), Positives = 173/237 (73%), Gaps = 4/237 (2%)
 Frame = -1

Query  1078  FDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIERVL  899
              DFD+TIID DSD W+V ELG T LF +L H+MPW SLMDR+M ++H+NG T+  I   L
Sbjct  10    LDFDRTIIDDDSDRWIVAELGLTELFKELRHSMPWISLMDRIMAQLHSNGVTVDHIADCL  69

Query  898   QGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEE  719
             + +P  P IV AIK+ H LGCDLRI+SD N F I TIL+H  +  CFS+I+TNP ++D +
Sbjct  70    KRLPFPPPIVSAIKSAHALGCDLRIISDTNTFSIRTILQHHALFHCFSQIHTNPAFLDNQ  129

Query  718   GRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASM----GKEGKKRVIYLGDGIGDF  551
             GRLR+ PFH    SPH C  CPPNMCK  +I++I++S+    G E ++R IY+GDG GD+
Sbjct  130   GRLRVTPFHHSTHSPHSCPLCPPNMCKGLVIDQIRSSLLSGTGNEEERRFIYIGDGAGDY  189

Query  550   CPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICI  380
             CP+LKLK GDF+MPRK++P+W  I  +  L+ A++H+WS GED E IL +LIN+I +
Sbjct  190   CPTLKLKGGDFVMPRKNYPLWNKIHSDPKLVAAQLHDWSTGEDLETILLNLINKISL  246



>ref|XP_002458104.1| hypothetical protein SORBIDRAFT_03g027020 [Sorghum bicolor]
 gb|EES03224.1| hypothetical protein SORBIDRAFT_03g027020 [Sorghum bicolor]
Length=276

 Score =   285 bits (729),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 138/264 (52%), Positives = 181/264 (69%), Gaps = 9/264 (3%)
 Frame = -1

Query  1078  FDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIERVL  899
             FDFD+TIID DSD+WV+ +LG    F +L  TM WN LMDRMM E+HA GKT  DI   L
Sbjct  15    FDFDRTIIDWDSDDWVITKLGAADAFRRLRPTMRWNPLMDRMMAELHARGKTPEDIRDCL  74

Query  898   QGVPIHPRIVPAIK-AVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDE  722
             +  P+   +V A+K A   LGCDL++VSDAN FFIET+L H G+  CFSEI TNP  VD 
Sbjct  75    RSAPLDAHVVSAVKTAAAALGCDLKVVSDANTFFIETVLAHHGVLGCFSEIVTNPATVDA  134

Query  721   EGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPS  542
             +GRLRI PFHD  ++PHGC+ CP NMCK KIIERIQA+   + K+  IY+GDG GD+CPS
Sbjct  135   DGRLRISPFHDSAAAPHGCSLCPDNMCKGKIIERIQAT-ASDKKQHFIYIGDGKGDYCPS  193

Query  541   LKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFL  362
             LKL  GD++MP++++P+W LI  N+ LL+AE+H W++GE+ E+ L  L+       S+ +
Sbjct  194   LKLGEGDYVMPKENYPLWNLICNNKQLLKAEVHPWNSGEELEKTLLKLV-------SKMI  246

Query  361   AAESKFQAISMQPCEALPKAIRVP  290
             AA ++        CE    AI+ P
Sbjct  247   AAPAQASQFDYSKCEMSNPAIQHP  270



>ref|XP_006854012.1| hypothetical protein AMTR_s00036p00240530 [Amborella trichopoda]
 gb|ERN15479.1| hypothetical protein AMTR_s00036p00240530 [Amborella trichopoda]
Length=284

 Score =   283 bits (725),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 135/235 (57%), Positives = 175/235 (74%), Gaps = 7/235 (3%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             A TVVVFDFDKTIID DSDNWV++E+G   LF +LL TMPWN  MDRMM E+H+ GKT  
Sbjct  2     AKTVVVFDFDKTIIDCDSDNWVIEEMGVDDLFKELLRTMPWNPTMDRMMGELHSMGKTTD  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             +I  V++G P+ PR++ AIKA +  GCD+RIVSDANLFFI TIL+H G+  CF+EINTNP
Sbjct  62    EIADVMKGAPLDPRVISAIKAAYAFGCDVRIVSDANLFFIVTILEHHGLLHCFTEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKR-VIYLGDGI  560
              +VDE GRL I P+H+ H+    C  CPPNMCK  IIERIQ+ +   G  R ++YLGDG 
Sbjct  122   SFVDENGRLNIRPYHNTHN----CPLCPPNMCKGLIIERIQSEIA--GNDRCIVYLGDGK  175

Query  559   GDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLI  395
             GD+CPSL+L  GD +MPRK +P+W+LI+ + SLL+A +HEW +  + E  L +++
Sbjct  176   GDYCPSLRLGHGDHVMPRKLYPLWDLIQVDPSLLKATLHEWRDAGELEAKLLNIL  230



>ref|XP_008672854.1| PREDICTED: LOC100281893 isoform X1 [Zea mays]
 tpg|DAA58848.1| TPA: phosphoethanolamine/phosphocholine phosphatase [Zea mays]
Length=284

 Score =   283 bits (725),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 134/244 (55%), Positives = 173/244 (71%), Gaps = 1/244 (0%)
 Frame = -1

Query  1114  VCSPMAAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHA  935
             + S  A   VVVFDFD+TIID DSD+WV+ +LG    F +L  TM WN LMDRMM E+HA
Sbjct  1     MASASAPEVVVVFDFDRTIIDWDSDDWVITKLGAADAFQRLRPTMRWNPLMDRMMAELHA  60

Query  934   NGKTIGDIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFS  755
              GKT  DI   L+  P+   +V A+K    LGCDL++VSDAN FFIET+L H G+  CFS
Sbjct  61    RGKTPEDIRDCLRSAPLDTHVVSAVKTAAALGCDLKVVSDANTFFIETVLAHHGVLGCFS  120

Query  754   EINTNPGYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMG-KEGKKRVI  578
             EI TNP  VD +GRLRI PFHD  S+PHGC+ CP NMCK KI+ RIQA+   K+ ++R I
Sbjct  121   EIVTNPASVDADGRLRISPFHDPASAPHGCSLCPDNMCKGKILGRIQATGSDKKRRRRFI  180

Query  577   YLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHL  398
             Y+GDG GD+CPSLKL  GD +M R+++P+W LI +N+ LL+AE+H W++GE+ E+ L  L
Sbjct  181   YIGDGKGDYCPSLKLGEGDHVMARENYPLWHLICDNKQLLKAEVHPWNSGEELEKTLLKL  240

Query  397   INRI  386
                +
Sbjct  241   AGEV  244



>ref|XP_003630643.1| Pyridoxal phosphate phosphatase PHOSPHO2 [Medicago truncatula]
 gb|AET05119.1| 2,3-diketo-5-methylthio-1-phosphopentane phosphatase [Medicago 
truncatula]
Length=238

 Score =   281 bits (720),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/235 (56%), Positives = 175/235 (74%), Gaps = 3/235 (1%)
 Frame = -1

Query  1087  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMP-WNSLMDRMMKEIHANGKTIGDI  911
             +VV DFD+TIID DSD WV++++G + LF+QL  TMP W SLMDRMM+E+H+ G T   I
Sbjct  3     IVVLDFDRTIIDDDSDRWVINQMGLSDLFNQLRATMPSWTSLMDRMMEELHSKGITTDKI  62

Query  910   ERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGY  731
                L+   + P IV AIK+ H LGCDLRI+SDANLF+I+TIL+H  I  CFS+INTNP +
Sbjct  63    ANCLKTAFLSPNIVSAIKSAHSLGCDLRIISDANLFYIQTILEHHNILGCFSQINTNPTF  122

Query  730   VDEEGRLRILPFHDFHS-SPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGD  554
             VDE+GRL I PFHD  +  PH C  CP NMCK  +I+RI+ S+  E K R IY+GDG GD
Sbjct  123   VDEKGRLCITPFHDSKTLPPHDCQLCPSNMCKGLVIDRIRGSL-PESKTRFIYVGDGAGD  181

Query  553   FCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINR  389
             +CP+LKL+ GDF+MPRK++P+W  I  +  L+ A++H+WSNGE+ E IL +L+N+
Sbjct  182   YCPTLKLEGGDFVMPRKNYPLWNRICSDPKLVHAKVHDWSNGEELESILLNLVNK  236



>ref|XP_004503534.1| PREDICTED: inorganic pyrophosphatase 3-like isoform X1 [Cicer 
arietinum]
Length=238

 Score =   281 bits (719),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 126/235 (54%), Positives = 178/235 (76%), Gaps = 2/235 (1%)
 Frame = -1

Query  1087  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  908
             +V+ DFD+TIID DSD+WV+ E+G T +F++L  +MPW SLM+RMM+E+H+ G +I  I 
Sbjct  3     MVLLDFDRTIIDDDSDSWVISEMGLTEVFNELRSSMPWTSLMNRMMEELHSKGISINTIA  62

Query  907   RVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYV  728
               L    +HP I+ AI++ H LGCDLRI+SDAN F I+TIL+H  +  CFS+INTNP +V
Sbjct  63    HCLHSAFLHPNILSAIQSAHSLGCDLRIISDANFFSIQTILEHHNLLGCFSQINTNPAFV  122

Query  727   DEEGRLRILPFHDFHS-SPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDF  551
             D++G L I PFHD  +  PH C  CPPNMCK  +I++I+ S+G E K R IY+GDG+GD+
Sbjct  123   DDKGCLCITPFHDSTTLPPHACHLCPPNMCKGLVIDQIRGSLG-ESKTRFIYVGDGMGDY  181

Query  550   CPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRI  386
             CP+LKL+ GDF+MPRK++P+W  I  +  L+ AE+H+WS+GE+FE IL +L+N++
Sbjct  182   CPTLKLEGGDFVMPRKNYPLWNKICSDPKLVHAEVHDWSSGEEFENILLNLVNKL  236



>gb|AGT16668.1| inorganic pyrophosphatase [Saccharum hybrid cultivar R570]
Length=279

 Score =   282 bits (721),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 136/272 (50%), Positives = 180/272 (66%), Gaps = 17/272 (6%)
 Frame = -1

Query  1078  FDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIERVL  899
             FDFD+TIID DSD+WV+ +LG    F +L  TM WN LMDRMM E+HA G T  DI   L
Sbjct  15    FDFDRTIIDWDSDDWVITKLGAADAFQRLRPTMRWNPLMDRMMAELHARGTTPEDIRDCL  74

Query  898   QGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEE  719
             +  P+   +V A+K    LGCDL++VSDAN FFIET+L H G+  CFSEI  NP  VD +
Sbjct  75    RSAPLDAHVVSAVKTAAALGCDLKVVSDANTFFIETVLAHHGVLGCFSEIVANPASVDAD  134

Query  718   GRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSL  539
             GRLRI PFHD  ++PHGC+ CP NMCK KIIERIQA+   + K+  IY+GDG GD+CPSL
Sbjct  135   GRLRISPFHDSAAAPHGCSLCPDNMCKGKIIERIQAT-ASDTKQHFIYIGDGKGDYCPSL  193

Query  538   KLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFLA  359
             KL  GD++MP++++P+W LI  N+ L++AE+H W++GE+ E+ L  L        S+ +A
Sbjct  194   KLGEGDYVMPKENYPLWNLICNNKQLVKAEVHPWNSGEELEKTLLKLT-------SKMIA  246

Query  358   AESKFQAISMQPCE---------ALPKAIRVP  290
             A ++        CE         A  +A+RVP
Sbjct  247   APAQASQFDYSKCEMSNPASTEVAHHQALRVP  278



>ref|XP_006412831.1| hypothetical protein EUTSA_v10026105mg [Eutrema salsugineum]
 gb|ESQ54284.1| hypothetical protein EUTSA_v10026105mg [Eutrema salsugineum]
Length=244

 Score =   280 bits (716),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 130/243 (53%), Positives = 177/243 (73%), Gaps = 1/243 (0%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG V++FDFD+T+ID DSDNWVV ++G + +F QL  T+PWN LMDRMM E+H+ G++I 
Sbjct  2     AGIVIIFDFDRTLIDGDSDNWVVTQMGLSEIFHQLRFTLPWNRLMDRMMTELHSQGRSIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DIE  L+ +PI  +I+ AIK+   LGCDL+IVSDAN FFIE IL+   + +CFSEI TNP
Sbjct  62    DIEACLRKMPIDSQIIEAIKSAKSLGCDLKIVSDANQFFIEKILEQHKLLDCFSEIYTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASM-GKEGKKRVIYLGDGI  560
               VDE G+L+ILP+H   S PH C  CP N+CK  +++ I+AS    +  +R IYLGDG 
Sbjct  122   ISVDENGKLQILPYHGAASPPHNCNLCPSNLCKGLVMDHIRASSPNDQITRRFIYLGDGG  181

Query  559   GDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICI  380
             GDFCP+LKL+  D +MPR ++P+W+ I +N SL++AE+ EWSN E+ +RIL  L++    
Sbjct  182   GDFCPTLKLRECDCVMPRTNYPLWKRISDNSSLIKAEVMEWSNAEELQRILMQLVSTTTK  241

Query  379   EDS  371
             EDS
Sbjct  242   EDS  244



>ref|XP_004969082.1| PREDICTED: inorganic pyrophosphatase 3-like [Setaria italica]
Length=318

 Score =   282 bits (722),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 137/242 (57%), Positives = 178/242 (74%), Gaps = 1/242 (0%)
 Frame = -1

Query  1093  GTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGD  914
             G VVVFDFD+TIID DSD+WVV +LG    F +L  TM WN LMDRMM+E+HA GKT+ D
Sbjct  49    GVVVVFDFDRTIIDWDSDDWVVTKLGAADAFQRLRPTMRWNPLMDRMMEELHARGKTVED  108

Query  913   IERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPG  734
             I   L+  P+   ++ AIK    LGCDL++VSDAN FFIET+L H G+  CFSEI+TNP 
Sbjct  109   IRDCLRSAPLDAHVISAIKTAASLGCDLKVVSDANTFFIETVLAHHGVLGCFSEISTNPA  168

Query  733   YVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGD  554
              VD +GRLRI PFHD  S+PHGC+ CP NMCK KIIE+IQA +     +  IY+GDG GD
Sbjct  169   RVDADGRLRISPFHDSASAPHGCSLCPDNMCKGKIIEKIQA-IASTKDQHFIYIGDGKGD  227

Query  553   FCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIED  374
             +CPSLKL  GD++MP++++P+W LI  N+ LL+AE+H W++GE+ E+IL  L+NR+    
Sbjct  228   YCPSLKLGEGDYVMPKENYPLWNLICSNKHLLKAEVHPWNSGEELEKILLELVNRMITPP  287

Query  373   SQ  368
             +Q
Sbjct  288   AQ  289



>ref|XP_010089256.1| Inorganic pyrophosphatase 3 [Morus notabilis]
 gb|EXB37581.1| Inorganic pyrophosphatase 3 [Morus notabilis]
Length=317

 Score =   282 bits (722),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 138/242 (57%), Positives = 170/242 (70%), Gaps = 23/242 (10%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AGTVVVFDFD+TI+D DSDNWVV E+G   LF +L  TMPWNSLMDRMM E+H+ GKT  
Sbjct  92    AGTVVVFDFDRTILDGDSDNWVVTEMGLAQLFSELRSTMPWNSLMDRMMMELHSQGKTPS  151

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI R                      CDLRI+SDAN FFIE IL+   +  CFS I TNP
Sbjct  152   DIAR----------------------CDLRIISDANKFFIEKILERHDVSGCFSHITTNP  189

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
              +VDE+ RLRI+P+HD  SSPHGC  CPPNMCK  +I++I+AS  + G++R IYLGDG G
Sbjct  190   TFVDEDRRLRIVPYHDL-SSPHGCNLCPPNMCKGLVIDQIRASDSENGRRRFIYLGDGGG  248

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             DFCP+L+L  GD +MPRK++P+W+ I  N++ + AEIHEWSNGE+ E+IL HLIN    E
Sbjct  249   DFCPTLRLAEGDHVMPRKNYPLWKRICSNQTPINAEIHEWSNGEELEKILLHLINTTAEE  308

Query  376   DS  371
              S
Sbjct  309   IS  310



>ref|XP_010090022.1| Inorganic pyrophosphatase 3 [Morus notabilis]
 gb|EXB38819.1| Inorganic pyrophosphatase 3 [Morus notabilis]
Length=356

 Score =   283 bits (725),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 138/242 (57%), Positives = 170/242 (70%), Gaps = 23/242 (10%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AGTVVVFDFD+TI+D DSDNWVV E+G   LF +L  TMPWNSLMDRMM E+H+ GKT  
Sbjct  92    AGTVVVFDFDRTILDGDSDNWVVTEMGLAQLFSELRSTMPWNSLMDRMMMELHSQGKTPS  151

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI R                      CDLRI+SDAN FFIE IL+   +  CFS I TNP
Sbjct  152   DIAR----------------------CDLRIISDANKFFIEKILERHDVSGCFSHITTNP  189

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
              +VDE+ RLRI+P+HD  SSPHGC  CPPNMCK  +I++I+AS  + G++R IYLGDG G
Sbjct  190   TFVDEDRRLRIVPYHDL-SSPHGCNLCPPNMCKGLVIDQIRASDSENGRRRFIYLGDGGG  248

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             DFCP+L+L  GD +MPRK++P+W+ I  N++ + AEIHEWSNGE+ E+IL HLIN    E
Sbjct  249   DFCPTLRLAEGDHVMPRKNYPLWKRICSNQTPINAEIHEWSNGEELEKILLHLINTTAEE  308

Query  376   DS  371
              S
Sbjct  309   IS  310



>ref|NP_001077556.1| phosphoethanolamine/phosphocholine phosphatase [Arabidopsis thaliana]
 gb|AEE29625.1| pyridoxal phosphate phosphatase-related protein [Arabidopsis 
thaliana]
Length=247

 Score =   279 bits (714),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/213 (62%), Positives = 170/213 (80%), Gaps = 6/213 (3%)
 Frame = -1

Query  970  SLMDRMMKEIHANGKTIGDIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIET  791
            S  +RMMKE+H +GKTI +I++VL+ +PIHPR++PAIK+ H LGC+LRIVSDAN  FIET
Sbjct  15   SKQNRMMKELHDHGKTIEEIKQVLRRIPIHPRVIPAIKSAHALGCELRIVSDANTLFIET  74

Query  790  ILKHLGIRECFSEINTNPGYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQA  611
            I++HLGI E FSEINTNPG VDE+GRL + P+HDF  S HGC+RCPPNMCK  II+RIQA
Sbjct  75   IIEHLGIGEFFSEINTNPGLVDEQGRLIVSPYHDFTKSSHGCSRCPPNMCKGLIIDRIQA  134

Query  610  SMGKEGK-KRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWS  434
            S+ KEGK  ++IYLGDG GD+CPSL LKA D+MMPRK+FPVW+LI +N  L++A + +W+
Sbjct  135  SLTKEGKTSKMIYLGDGAGDYCPSLGLKAEDYMMPRKNFPVWDLISQNPMLVKATVRDWT  194

Query  433  NGEDFERILFHLINRICI-----EDSQFLAAES  350
            +GED ERIL  +IN I       E+ + L++E+
Sbjct  195  DGEDMERILMEIINEIMSSEEGEENDKMLSSEN  227



>gb|ABK21572.1| unknown [Picea sitchensis]
Length=236

 Score =   277 bits (708),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 126/232 (54%), Positives = 169/232 (73%), Gaps = 0/232 (0%)
 Frame = -1

Query  1090  TVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDI  911
             TV++FDFD T+ID +SD WVV++LG T L D L+  +PW SLMDRMM E+H  GKT+ DI
Sbjct  3     TVIMFDFDHTLIDCNSDPWVVNQLGATQLMDSLIKVLPWTSLMDRMMSELHQQGKTVSDI  62

Query  910   ERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGY  731
             E+ L+ VPI   ++ AIK+ H LGCDLRIVSDAN F+I+TILK+  + + FSEI+TNP  
Sbjct  63    EQSLKTVPICLEMIRAIKSAHSLGCDLRIVSDANSFYIKTILKNYDLLQYFSEIHTNPAS  122

Query  730   VDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDF  551
             VD +GRLRI P+H +  + HGC  CPPNMCK  I++ IQ     E  KR IYLGDG GDF
Sbjct  123   VDNDGRLRIFPYHSYTVASHGCELCPPNMCKGAIVDGIQRCFPPESNKRFIYLGDGRGDF  182

Query  550   CPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLI  395
             CPSLKL + D ++ R+++P+W+L+ +N  L++A++H WSN +D E  L  L+
Sbjct  183   CPSLKLGSEDHVLARQEYPLWKLLGQNPDLVKAQVHSWSNAKDVEDCLCKLL  234



>gb|KFK29508.1| hypothetical protein AALP_AA7G143500 [Arabis alpina]
Length=244

 Score =   276 bits (705),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/243 (53%), Positives = 175/243 (72%), Gaps = 1/243 (0%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG V++FDFD+T+ID DSDNWVV E+G T +F QL  T+PWN LMDRMM E+H+ G++I 
Sbjct  2     AGIVIIFDFDRTLIDGDSDNWVVTEMGLTEIFHQLRFTLPWNRLMDRMMMELHSQGRSID  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DIE  L+ +PI   I+ AIK+   LGCDL+IVSDAN FFIE IL+   + +CFSEI TNP
Sbjct  62    DIEACLRKMPIDSHIIEAIKSAKSLGCDLKIVSDANQFFIEKILEQHILLDCFSEIYTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQA-SMGKEGKKRVIYLGDGI  560
               VD+ G+L I P+H   S PH C  CP N+CK  +++ I+  S   +  +RVIYLGDG 
Sbjct  122   SSVDKNGKLHIFPYHGDASLPHSCNLCPSNLCKGLVMDHIRGLSPNDQIPRRVIYLGDGG  181

Query  559   GDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICI  380
             GDFCP+LKLK  D +MPR ++P+W+ I +N SL++A++ EWSN E+ ++IL  L+N I  
Sbjct  182   GDFCPTLKLKETDCVMPRTNYPLWKRISDNSSLIKAQVKEWSNAEELQKILMQLVNTITK  241

Query  379   EDS  371
             ++S
Sbjct  242   DNS  244



>ref|XP_009128612.1| PREDICTED: inorganic pyrophosphatase 3 isoform X1 [Brassica rapa]
Length=247

 Score =   276 bits (705),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 132/246 (54%), Positives = 178/246 (72%), Gaps = 4/246 (2%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG V+VFDFD+T+ID DSDNWVV E+G T +F QL  T+PWN LMDRMM E+H+ G++I 
Sbjct  2     AGIVIVFDFDRTLIDGDSDNWVVTEMGLTEIFHQLRFTLPWNRLMDRMMTELHSQGRSIQ  61

Query  916   DIERVLQGV-PIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTN  740
             DIE  LQ + PI   IV AIK+   LGCDL+IVSDAN FFIE IL+   + +CFS+I TN
Sbjct  62    DIEACLQRIMPIDSHIVDAIKSAKSLGCDLKIVSDANQFFIEKILEQHDLLDCFSDIYTN  121

Query  739   PGYVDEEGRLRILPFH-DFHSSPHGCARCPPNMCKSKIIERIQASMGKEGK--KRVIYLG  569
             P  VDE G+LRI P+H    S+PH C  CPPN+CK  +++ I+AS  ++ +   R IYLG
Sbjct  122   PTSVDENGKLRISPYHGGAASTPHSCNLCPPNLCKGLVMDHIRASSSRKDQVLTRFIYLG  181

Query  568   DGIGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINR  389
             DG GDFCP+LKL+  D +MPR ++P+W+ I +  SL++A++ EWS+ E+ +RIL  L++ 
Sbjct  182   DGGGDFCPTLKLRECDCVMPRTNYPLWKRISDKSSLIKADVKEWSSAEELQRILMQLVST  241

Query  388   ICIEDS  371
             +  EDS
Sbjct  242   MTKEDS  247



>ref|XP_010447843.1| PREDICTED: inorganic pyrophosphatase 3-like [Camelina sativa]
Length=245

 Score =   274 bits (701),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 125/237 (53%), Positives = 169/237 (71%), Gaps = 2/237 (1%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             A  V+VFDFD+T+ID DSDNWVV ++G   +F QL  T+PWN LMDRMM E+H+ G+++ 
Sbjct  2     AKIVIVFDFDRTLIDGDSDNWVVTKMGLAEIFHQLRFTLPWNRLMDRMMMELHSQGRSVE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DIE  L+ +PI  +++ AIK+   LGCDL+IVSDAN FFIE IL+   + +CFSEI TNP
Sbjct  62    DIEACLKKMPIDSQVIEAIKSAKSLGCDLKIVSDANQFFIEKILEQHDLLDCFSEIYTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGK--KRVIYLGDG  563
               VD+ G LRILP+H     PH C  CP N+CK  +++ I++S         R IYLGDG
Sbjct  122   SSVDDNGNLRILPYHSDALPPHSCNLCPSNLCKGLVMDHIRSSSSSNDHIPTRFIYLGDG  181

Query  562   IGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLIN  392
              GDFCP+LKL+  DF+MPR ++P+W+ I +N SL++AE+ EWSN E+ +RIL  L+N
Sbjct  182   GGDFCPTLKLRECDFVMPRTNYPLWKKISDNSSLIKAEVKEWSNAEELQRILLQLVN  238



>gb|EAY74825.1| hypothetical protein OsI_02715 [Oryza sativa Indica Group]
Length=284

 Score =   275 bits (704),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 134/260 (52%), Positives = 179/260 (69%), Gaps = 4/260 (2%)
 Frame = -1

Query  1066  KTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIERVLQGVP  887
             +TII+ DSD+WV+ +LG +  F +L  TM WN LMDRMM E+HA G++  DI   L+  P
Sbjct  27    RTIIEWDSDDWVITKLGASDAFRRLRPTMRWNPLMDRMMVELHAQGRSADDIRDCLKSAP  86

Query  886   IHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLR  707
             +   ++ AI     LGCDLR+ SDAN FFIET+L+H G+  CFSEI+TNP  VD  GRLR
Sbjct  87    LDAHVLSAITTASALGCDLRVASDANAFFIETVLEHHGVLGCFSEISTNPARVDGNGRLR  146

Query  706   ILPFHD-FHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLK  530
             I PFHD   SSPHGC+ CP NMCK KIIERIQA+    GK+  IY+GDG GD+CPSLKL 
Sbjct  147   ISPFHDPDDSSPHGCSLCPENMCKGKIIERIQAT--ANGKRHFIYIGDGRGDYCPSLKLG  204

Query  529   AGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFLAAES  350
              GD++MP++++P+W LI  N+ LL+AE+H W+NGE+ E+ L  L+N++    +Q    E 
Sbjct  205   EGDYVMPKENYPLWNLISSNKQLLKAEVHPWNNGEELEQTLLKLVNKLITPPAQPSQFEY  264

Query  349   KFQAISMQPCEALPKAIRVP  290
             K   +S      + +A+RVP
Sbjct  265   KCD-MSNPVSTEVGQALRVP  283



>gb|EAZ12585.1| hypothetical protein OsJ_02491 [Oryza sativa Japonica Group]
Length=284

 Score =   275 bits (702),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 134/260 (52%), Positives = 178/260 (68%), Gaps = 4/260 (2%)
 Frame = -1

Query  1066  KTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIERVLQGVP  887
             +TII+ DSD+WV+ +LG +  F +L  TM WN LMDRMM E+HA G++  DI   L+  P
Sbjct  27    RTIIEWDSDDWVITKLGASDAFRRLRPTMRWNPLMDRMMVELHAQGRSADDIRDCLKSAP  86

Query  886   IHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLR  707
             +   ++ AI     LGCDLR+ SDAN FFIET+L+H G+  CFSEI+TNP  VD  GRLR
Sbjct  87    LDAHVLSAITTASALGCDLRVASDANAFFIETVLEHHGVLGCFSEISTNPARVDGNGRLR  146

Query  706   ILPFHD-FHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLK  530
             I PFHD   SSPHGC+ CP NMCK KIIERIQA+    GK+  IY+GDG GD+CPSLKL 
Sbjct  147   ISPFHDPDDSSPHGCSLCPENMCKGKIIERIQAT--ANGKRHFIYIGDGRGDYCPSLKLG  204

Query  529   AGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIEDSQFLAAES  350
              GD++MP++ +P+W LI  N+ LL+AE+H W+NGE+ E+ L  L+N++    +Q    E 
Sbjct  205   EGDYVMPKEKYPLWNLISSNKQLLKAEVHPWNNGEELEQTLLKLVNKLITPPAQPSQFEY  264

Query  349   KFQAISMQPCEALPKAIRVP  290
             K   +S      + +A+RVP
Sbjct  265   KCD-MSNPVSTEVGQALRVP  283



>ref|XP_006854013.1| hypothetical protein AMTR_s00036p00240870 [Amborella trichopoda]
 gb|ERN15480.1| hypothetical protein AMTR_s00036p00240870 [Amborella trichopoda]
Length=247

 Score =   272 bits (696),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 132/237 (56%), Positives = 169/237 (71%), Gaps = 7/237 (3%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             A  VVVFDFD+TI+D DSDNWVV+E+G   LF +LL TMP N  MDRMM E+H+ GKTI 
Sbjct  2     AKAVVVFDFDETILDCDSDNWVVEEMGVDDLFKELLRTMPLNPTMDRMMGELHSRGKTIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             +I  +L+  P  PR++ AIKA H LGCD+RIVSDAN FFI +IL+H G+  CF+EINTNP
Sbjct  62    EIAEILKRAPFDPRVISAIKAAHALGCDVRIVSDANTFFIVSILEHHGLLHCFTEINTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKR-VIYLGDGI  560
              ++D+ GRL I P H      H C  CPPNMCK  +IERIQ+ +   G  R ++YLGDG 
Sbjct  122   AFIDDNGRLNIRPCH----KSHNCPICPPNMCKGLVIERIQSEI--VGSDRCIVYLGDGK  175

Query  559   GDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINR  389
             GD+CPSLKL  GD +MPRK +P W+L++ N SL++A IHEWS+  + E  L + I +
Sbjct  176   GDYCPSLKLGHGDHVMPRKLYPFWDLLQSNPSLIKATIHEWSDAGELEAKLLNFIRK  232



>ref|XP_010433087.1| PREDICTED: inorganic pyrophosphatase 3-like isoform X1 [Camelina 
sativa]
Length=247

 Score =   271 bits (694),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/246 (52%), Positives = 172/246 (70%), Gaps = 5/246 (2%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             A  V+VFDFD+T+ID DSDNWVV E+G   +F QL  T+PWN LMDRMM E+H+ G++I 
Sbjct  2     AKIVIVFDFDRTLIDGDSDNWVVTEMGLAEIFHQLRFTLPWNRLMDRMMMELHSQGRSIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DIE  L+ +PI  +++ AIK+   LGCDL+IVSDAN FFIE IL+   + +CFSEI TNP
Sbjct  62    DIEACLKKMPIDSQVIEAIKSAKSLGCDLKIVSDANQFFIEKILEQHDLLDCFSEIYTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQ-----ASMGKEGKKRVIYL  572
               VDE G LRILP+H    +PH C  CP N+CK  +++ I+     +S   +   R IYL
Sbjct  122   TSVDENGNLRILPYHSDALAPHSCNLCPTNLCKGIVMDHIRSSSSSSSSNDQIPTRFIYL  181

Query  571   GDGIGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLIN  392
             GDG GDFCP++KL+  DF+MPR ++P+W+ I +N SL+ A++ EW N E+ +RIL  L+N
Sbjct  182   GDGGGDFCPTMKLRECDFVMPRTNYPLWKKISDNSSLINADVKEWGNAEELQRILLQLVN  241

Query  391   RICIED  374
              I  E+
Sbjct  242   TITKEE  247



>ref|XP_007024471.1| Pyridoxal phosphate phosphatase-related protein [Theobroma cacao]
 gb|EOY27093.1| Pyridoxal phosphate phosphatase-related protein [Theobroma cacao]
Length=219

 Score =   270 bits (689),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 144/268 (54%), Positives = 168/268 (63%), Gaps = 52/268 (19%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFDKTIID DSDNWVVDELGF+ LF+Q L TMPWNS M               
Sbjct  2     AGIVVVFDFDKTIIDYDSDNWVVDELGFSDLFNQFLPTMPWNSFMR--------------  47

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
                      PIH R+VPAIKA H LGC+LRIVSDANLFFIE IL++LG++E FSEINTNP
Sbjct  48    --------TPIHYRVVPAIKAAHALGCELRIVSDANLFFIEKILEYLGLKEYFSEINTNP  99

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
             G+VDEEGRLRI  +HDF+   HGC   P NMCK  IIERIQAS+  EGKK++IYLG G G
Sbjct  100   GFVDEEGRLRIFSYHDFNKCSHGCNLSPLNMCKGMIIERIQASL--EGKKKIIYLGYGSG  157

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             D+CPSL+L   D MMPRK+FPV   ++EN                               
Sbjct  158   DYCPSLRLGEADCMMPRKNFPVMISVEENND----------------------------N  189

Query  376   DSQFLAAESKFQAISMQPCEALPKAIRV  293
               Q ++ + K Q IS    EALP+A+ V
Sbjct  190   SVQLISIDGKLQTISASTHEALPQALPV  217



>ref|XP_006282700.1| hypothetical protein CARUB_v10005618mg [Capsella rubella]
 gb|EOA15598.1| hypothetical protein CARUB_v10005618mg [Capsella rubella]
Length=242

 Score =   270 bits (689),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 128/241 (53%), Positives = 173/241 (72%), Gaps = 2/241 (1%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             A  V++FDFD+T+ID DSDNWVV E+G T +F QL  T+PWN LMDRMM E+H+ G++I 
Sbjct  2     AKIVIIFDFDRTLIDGDSDNWVVTEMGLTEIFHQLRFTLPWNRLMDRMMMELHSQGRSIE  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DIE  L+ +PI  +I+ AIK+   LGCDL+IVSDAN FFIE IL+   + +CFSEI TN 
Sbjct  62    DIEACLKKMPIDSQIIEAIKSAKSLGCDLKIVSDANHFFIEKILEQHDLLDCFSEIYTNQ  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIG  557
               VDE G+LRILP+H     PH C  CP N+CK  +++ I+AS   +  +  IYLGDG G
Sbjct  122   SSVDEIGKLRILPYHSDALPPHSCNFCPSNLCKGLVMDHIRASCPSD--QIFIYLGDGGG  179

Query  556   DFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             DFCP+LKL+  DF+MPR ++P+W+ I +N  L++AE+ EWSN E+ +RIL  L++ I  E
Sbjct  180   DFCPTLKLRECDFVMPRTNYPLWKKISDNSLLIKAEVKEWSNAEEQQRILMQLVSTITQE  239

Query  376   D  374
             +
Sbjct  240   E  240



>ref|XP_002869428.1| 2,3-diketo-5-methylthio-1-phosphopentane phosphatase family [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH45687.1| 2,3-diketo-5-methylthio-1-phosphopentane phosphatase family [Arabidopsis 
lyrata subsp. lyrata]
Length=242

 Score =   269 bits (687),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/238 (53%), Positives = 169/238 (71%), Gaps = 1/238 (0%)
 Frame = -1

Query  1087  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  908
             V++FDFD+T+ID DSD WVV E+G T +F QL  T+PWN LMDRMM EI + G++I DIE
Sbjct  5     VIIFDFDRTLIDGDSDRWVVTEMGLTEIFHQLRFTLPWNRLMDRMMMEIQSQGRSIDDIE  64

Query  907   RVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYV  728
               L+ +PI   I+ AIK+   LGCDL+IVSDAN F+IE IL+   + +CFSEI TNP  +
Sbjct  65    SCLKKMPIDSHIIEAIKSTKSLGCDLKIVSDANQFYIEKILEQHDLLDCFSEIYTNPTSL  124

Query  727   DEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEG-KKRVIYLGDGIGDF  551
             DE G LRILP+H     PH C  CP N+CK  +++ I+AS   +   +R IYLGDG GDF
Sbjct  125   DENGNLRILPYHSDALPPHSCNLCPSNLCKGLVMDHIRASSSNDQIPRRFIYLGDGGGDF  184

Query  550   CPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIE  377
             CP+LKL+  DF+MPR ++P+W+ I +N  L++AE+ EWS+ E+ +RIL  L++ I  E
Sbjct  185   CPTLKLRECDFVMPRTNYPLWKKISDNALLIKAEVKEWSSAEELQRILLQLVSTITKE  242



>gb|EMT25082.1| Phosphoethanolamine/phosphocholine phosphatase [Aegilops tauschii]
Length=298

 Score =   270 bits (691),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 132/246 (54%), Positives = 168/246 (68%), Gaps = 11/246 (4%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFDKTIID DSDNWVVD LG T  FD+LL  +PWNS +D MM E+H+ GKTI 
Sbjct  7     AGVVVVFDFDKTIIDCDSDNWVVDALGATQRFDELLLHLPWNSAIDAMMGELHSQGKTID  66

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             +I   ++  P+   +V AIKA   LGC+LRI+SDAN FFI+T+L H G+   FSEI+TNP
Sbjct  67    EIAGSIRTAPLSHHVVAAIKAAQALGCELRILSDANAFFIDTVLAHHGLAGYFSEISTNP  126

Query  736   GYVDEEGRLRILPFHDFH---SSPHGC--ARCPPNMCKSKIIERI------QASMGKEGK  590
               VD  GRLRI P HDF     S HGC  A CPPNMCK K++E +       A+ G    
Sbjct  127   ASVDAGGRLRITPHHDFRHGSCSSHGCALATCPPNMCKGKVMEAMLQELSAAAAAGTRRP  186

Query  589   KRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERI  410
              RV+YLGDG GD+CP+LKL   D+MMPRK +PVW+LI  +R  + A++  W++ +D E +
Sbjct  187   SRVVYLGDGRGDYCPTLKLAERDYMMPRKGYPVWDLIAGDRRAVRADVRGWADFKDLETV  246

Query  409   LFHLIN  392
             L  +I+
Sbjct  247   LLDIIH  252



>ref|NP_194682.1| pyridoxal phosphate phosphatase-related protein [Arabidopsis 
thaliana]
 sp|Q9SU92.1|PPSP3_ARATH RecName: Full=Inorganic pyrophosphatase 3; Short=AtPPsPase3; 
Short=PPi phosphatase 3; Short=Pyrophosphate-specific phosphatase 
3 [Arabidopsis thaliana]
 emb|CAB45313.1| putative protein [Arabidopsis thaliana]
 emb|CAB79711.1| putative protein [Arabidopsis thaliana]
 gb|AAP04140.1| unknown protein [Arabidopsis thaliana]
 gb|AAP40350.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF01374.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE85640.1| pyridoxal phosphate phosphatase-related protein [Arabidopsis 
thaliana]
Length=245

 Score =   266 bits (681),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 124/242 (51%), Positives = 172/242 (71%), Gaps = 1/242 (0%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             A  V++FDFD+T+ID DSDNWVV E+G T +F QL  T+PWN LMDRMM E+ + G++I 
Sbjct  2     AKIVILFDFDRTLIDGDSDNWVVTEMGLTEIFHQLRFTLPWNRLMDRMMMELQSQGRSID  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DI+  L+ +PI   I+ AIK+    GCDL+IVSDAN FFIE IL+H  + +CFSEI TNP
Sbjct  62    DIKSCLKKMPIDSHIIEAIKSAKSSGCDLKIVSDANQFFIEKILEHHDLVDCFSEIYTNP  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEG-KKRVIYLGDGI  560
               +D+ G LRILP+H     PH C  CP N+CK  +++ ++AS   +   +R IYLGDG 
Sbjct  122   TSLDDNGNLRILPYHSDALPPHSCNLCPSNLCKGLVMDHLRASSSNDQIPRRFIYLGDGG  181

Query  559   GDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICI  380
             GDFCP+LKL+  DF+MPR ++P+W+ I +N  L++AE+ EWS+ E+ +RIL  L++ I  
Sbjct  182   GDFCPTLKLRECDFVMPRTNYPLWKKISDNPLLIKAEVKEWSSAEEQQRILLQLVSTITK  241

Query  379   ED  374
             E+
Sbjct  242   EE  243



>emb|CDY43512.1| BnaA01g07320D [Brassica napus]
Length=432

 Score =   270 bits (691),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 130/239 (54%), Positives = 173/239 (72%), Gaps = 4/239 (2%)
 Frame = -1

Query  1102  MAAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKT  923
             MA G V+VFDFD+T+ID DSDNWVV E+G T +F QL  T+PWN LMDRMM E+H+ G++
Sbjct  1     MAEGIVIVFDFDRTLIDGDSDNWVVTEMGLTEIFHQLRFTLPWNRLMDRMMTELHSQGRS  60

Query  922   IGDIERVLQGV-PIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEIN  746
             I DIE  LQ + PI   IV AIK+   LGCDL+IVSDAN FFIE IL+   + +CFS+I 
Sbjct  61    IQDIEACLQRIMPIDSHIVDAIKSAKSLGCDLKIVSDANQFFIEKILEQHDLLDCFSDIY  120

Query  745   TNPGYVDEEGRLRILPFH-DFHSSPHGCARCPPNMCKSKIIERIQASMGKEGK--KRVIY  575
             TNP  VDE G+LRI P+H    S+PH C  CPPN+CK  +++ I+AS  ++ +   R IY
Sbjct  121   TNPTSVDENGKLRISPYHGGAASTPHSCNLCPPNLCKGLVMDHIRASSSRKDQVLTRFIY  180

Query  574   LGDGIGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHL  398
             LGDG GDFCP+LKL+  D +MPR ++P+W+ I +  SL++A++ EWS+ E+ +RIL  L
Sbjct  181   LGDGGGDFCPTLKLRECDCVMPRTNYPLWKRISDKSSLIKADVKEWSSAEELQRILMQL  239



>ref|XP_010541049.1| PREDICTED: inorganic pyrophosphatase 3 [Tarenaya hassleriana]
Length=241

 Score =   262 bits (670),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 130/238 (55%), Positives = 167/238 (70%), Gaps = 4/238 (2%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFD+T+ID DSDNWVV E+G T LF QL  T+PWN LMDRMM E+H+ G+++ 
Sbjct  2     AGIVVVFDFDRTLIDGDSDNWVVTEMGLTELFHQLRLTLPWNRLMDRMMMELHSRGRSVK  61

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             DIE  L+ +PI P +V AIK+   LGCDL+IVSDAN FFIE IL+   + + FSEI TN 
Sbjct  62    DIEACLKKMPIDPHVVSAIKSAKSLGCDLKIVSDANQFFIEKILEQHSLLDYFSEIYTNQ  121

Query  736   GYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGK-KRVIYLGDGI  560
               VDE GRLRI P+H   + PHGC  CP N+CK  +++ ++AS    G   R IYLGDG 
Sbjct  122   TSVDENGRLRIFPYH-HAAPPHGCDLCPSNLCKGLVLDHLRASFPDTGNLTRFIYLGDGG  180

Query  559   GDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRI  386
             GDFCP+LKL  GD +MPRK +P+W  + + R  + A I+ W +GE+ E IL HLI+ +
Sbjct  181   GDFCPTLKLIEGDHVMPRKSYPLWNRVSDLR--IRAAINGWRDGEELEGILLHLIHTM  236



>gb|EMS46703.1| Inorganic pyrophosphatase 2 [Triticum urartu]
Length=412

 Score =   268 bits (684),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 129/250 (52%), Positives = 169/250 (68%), Gaps = 11/250 (4%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFDKTIID DSDNWVVD LG +  FD+LL  +PWNS +D MM E+H+ GK++ 
Sbjct  7     AGVVVVFDFDKTIIDCDSDNWVVDALGASQRFDELLLHLPWNSAIDAMMGELHSQGKSMD  66

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             +I   ++  P+   +V AIK  H LGC+LRI+SDAN FFI+T+L H G+   FSEI+TNP
Sbjct  67    EIAGSIRTAPLSRHVVAAIKTAHALGCELRILSDANAFFIDTVLAHHGLAGYFSEISTNP  126

Query  736   GYVDEEGRLRILPFHDFHS---SPHGC--ARCPPNMCKSKIIER------IQASMGKEGK  590
               VD  GRLRI P HDF     S HGC  A CPPNMCK K++E       + A+ G    
Sbjct  127   ASVDAGGRLRITPHHDFRHGSCSSHGCALATCPPNMCKGKVMEEMLQELSVAAAAGMRRP  186

Query  589   KRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERI  410
              RV+YLGDG GD+CP+LKL   D+MMPRK +PVW+LI  +R  + A++  W++ +D E +
Sbjct  187   SRVVYLGDGRGDYCPTLKLAERDYMMPRKGYPVWDLIAGDRRAVRADVRGWADFKDLETV  246

Query  409   LFHLINRICI  380
             L  +I+   +
Sbjct  247   LLDIIHECAV  256



>emb|CDY06800.1| BnaC01g08990D [Brassica napus]
Length=401

 Score =   266 bits (681),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 129/245 (53%), Positives = 172/245 (70%), Gaps = 8/245 (3%)
 Frame = -1

Query  1102  MAAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKT  923
             MA G V+VFDFD+T+ID DSDNWVV E+G T +F QL  T+PWN LMDRMM E+H+ G++
Sbjct  1     MAEGIVIVFDFDRTLIDGDSDNWVVTEMGLTEIFHQLRFTLPWNRLMDRMMTELHSQGRS  60

Query  922   IGDIERVLQGV-PIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEIN  746
             + DIE  LQ + PI   IV AIK+   LGCDL+IVSDAN FFIE IL+   + +CFS+I 
Sbjct  61    VQDIEACLQRIMPIDSHIVEAIKSAKSLGCDLKIVSDANQFFIEKILEQHDLLDCFSDIY  120

Query  745   TNPGYVDEEGRLRILPFHDFHSS----PHGCARCPPNMCKSKIIERIQASMGKEGKK---  587
             TNP  VDE G+LRI P+H   ++    PH C  CPPN+CK  +++ I+AS      +   
Sbjct  121   TNPTSVDEIGKLRISPYHGGGAAASTPPHSCNLCPPNLCKGLVMDHIRASSSSPKDQILT  180

Query  586   RVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERIL  407
             R IYLGDG GDFCP+LKL+  D +MPR ++P+W+ I +N SL++A++ EWS+ E+ +RIL
Sbjct  181   RFIYLGDGGGDFCPTLKLRECDCVMPRTNYPLWKRISDNPSLIKADVKEWSSAEELQRIL  240

Query  406   FHLIN  392
               L  
Sbjct  241   MQLFT  245



>ref|NP_001046344.1| Os02g0226200 [Oryza sativa Japonica Group]
 dbj|BAD25655.1| putative phosphatase, orphan 1 [Oryza sativa Japonica Group]
 dbj|BAF08258.1| Os02g0226200 [Oryza sativa Japonica Group]
 gb|EAY85074.1| hypothetical protein OsI_06430 [Oryza sativa Indica Group]
Length=296

 Score =   262 bits (670),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 128/270 (47%), Positives = 176/270 (65%), Gaps = 13/270 (5%)
 Frame = -1

Query  1078  FDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIERVL  899
             FDFDKTIID DSDNWVVD LG T  FD LL  +PWNS +D MM E+HA G+T+ ++   L
Sbjct  14    FDFDKTIIDCDSDNWVVDALGATARFDDLLCRLPWNSAIDAMMGELHAEGRTVEEVAASL  73

Query  898   QGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEE  719
             +  P+ PR+  A++    LGC+LR++SDAN FF+  +L H G+  CFS ++TNP  VD +
Sbjct  74    RAAPLSPRVAAAVETARALGCELRVLSDANAFFVGAVLDHHGLAGCFSAVDTNPAAVDAD  133

Query  718   GRLRILPFHDFHSSPHGC--ARCPPNMCKSKIIERI--QASMGKEG-----KKRVIYLGD  566
             GRLRILP+H      HGC  A CPPNMCK K++ERI  + S G  G     ++RV+Y+GD
Sbjct  134   GRLRILPYHGLPG--HGCPLATCPPNMCKGKVMERIIDELSCGCGGALAARRRRVVYVGD  191

Query  565   GIGDFCPSLKLKAGDFMMPRKDFPVWELIK-ENRSLLEAEIHEWSNGEDFERILFHLINR  389
             G GD+CPSLKL   D++MPRK +PVW+LI   +R+ + A++ EW++ ED E +L  ++  
Sbjct  192   GRGDYCPSLKLTEMDYVMPRKGYPVWDLIAGGDRAAVRADVREWADFEDLEAVLLGIVAE  251

Query  388   ICIEDSQFLAAESKFQAISMQPCEALPKAI  299
              C+      A +   +A     C ALP  +
Sbjct  252   -CLTSEHDDADDDGGEAAPPAECRALPATL  280



>gb|EAZ13360.1| hypothetical protein OsJ_03281 [Oryza sativa Japonica Group]
Length=235

 Score =   259 bits (661),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 130/236 (55%), Positives = 171/236 (72%), Gaps = 9/236 (4%)
 Frame = -1

Query  982  MPWNSLMDRMMKEIHANGKTIGDIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLF  803
            MPWN+LMD MM E+HA+GK++ D+  VL+  P+ PR+V AIKA +GLGCDLRI+SDAN F
Sbjct  1    MPWNTLMDTMMGELHASGKSLADVAGVLRSAPLDPRVVAAIKACYGLGCDLRILSDANRF  60

Query  802  FIETILKHLGIRECFSEINTNPGYVD-EEGRLRILPFHDFHSSPHGCAR--CPPNMCKSK  632
            FI+TIL H G+   FSEINTNP  VD   GRLRI P+HDFH+ PHGC    CPPNMCK +
Sbjct  61   FIDTILDHHGLTGYFSEINTNPSAVDAATGRLRIAPYHDFHAGPHGCGLGICPPNMCKGQ  120

Query  631  IIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEA  452
            +++RI+AS G  G KRVIYLGDG GD+CPSL+L   DFMMPR+ FPVWELI E+ SLL A
Sbjct  121  VLDRIRASAGAAG-KRVIYLGDGRGDYCPSLRLGRDDFMMPRRGFPVWELICEDPSLLHA  179

Query  451  EIHEWSNGEDFERILFHLINRICIEDSQFLAAESKFQ---AISMQPCEALPKAIRV  293
            E+H W++G + E  L  L+ R+ +E+      + K +   A+++Q  + +P  +R+
Sbjct  180  EVHSWADGAEMEETLLRLVGRVLLEERNLPPLDCKLESLPAVAVQ--DGMPMTLRI  233



>ref|XP_003571132.1| PREDICTED: inorganic pyrophosphatase 2-like [Brachypodium distachyon]
Length=306

 Score =   261 bits (666),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 126/238 (53%), Positives = 165/238 (69%), Gaps = 12/238 (5%)
 Frame = -1

Query  1078  FDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIERVL  899
             FDFDKTIID DSDNWVVD LG T  FD+LL  +PWNS +D MM E+HA GK + +I   L
Sbjct  19    FDFDKTIIDCDSDNWVVDALGATRRFDELLLRLPWNSAIDTMMGELHAEGKQVSEIRGSL  78

Query  898   QGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEE  719
             +  P+   +V A+++ H LGC+LRI+SDAN FFI+T+L H G+   FSEI++NP  VD  
Sbjct  79    RTAPLPASVVSAVESAHALGCELRILSDANAFFIDTVLAHHGLAGYFSEISSNPARVDAA  138

Query  718   GRLRILPFHDFHSSPHGCA--RCPPNMCKSKIIERIQASMG-------KEGKKRVIYLGD  566
             GRLRI P+HDF   PHGCA   CPPNMCK K++E I   +        K  +KRV+YLGD
Sbjct  139   GRLRISPYHDF---PHGCALPTCPPNMCKGKVMEEILQELSAAAAAAGKRRRKRVVYLGD  195

Query  565   GIGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLIN  392
             G GD+CP+LKL   D+MMPRK +PVW+LI  +R  + A++ EW++  D ER+L  ++ 
Sbjct  196   GRGDYCPTLKLGERDYMMPRKGYPVWDLIAGDRRAVRADVREWADAGDLERVLLSIVQ  253



>gb|EMS47058.1| Inorganic pyrophosphatase 2 [Triticum urartu]
Length=305

 Score =   259 bits (663),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 131/253 (52%), Positives = 169/253 (67%), Gaps = 18/253 (7%)
 Frame = -1

Query  1096  AGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIG  917
             AG VVVFDFDKTIID DSDNWVVD LG T  FD+LL  +PWNS +D MM E+H+ GKTI 
Sbjct  7     AGVVVVFDFDKTIIDCDSDNWVVDALGATQRFDELLLHLPWNSAIDAMMGELHSQGKTID  66

Query  916   DIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNP  737
             +I   ++  P+   +V AIK    LGC+LRI+SDAN FFI+T+L H G+   FSEI+TNP
Sbjct  67    EIAGSIRTAPLSLHVVAAIKTAQALGCELRILSDANAFFIDTVLAHHGLAGYFSEISTNP  126

Query  736   GYVDEEGRLRILPFHDF-HSS--PHGC--ARCPPNMCK-------SKIIERI------QA  611
               VD +GRLRI P HDF H S   HGC  A CPPNMCK        K++E +       A
Sbjct  127   ASVDADGRLRITPHHDFRHGSCNSHGCALATCPPNMCKILVYKIQGKVMEGMLQELSAAA  186

Query  610   SMGKEGKKRVIYLGDGIGDFCPSLKLKAGDFMMPRKDFPVWELIKENRSLLEAEIHEWSN  431
             + G     RV+YLGDG GD+CP+LKL   D+MMPRK +PVW+LI  +R  + A++  W++
Sbjct  187   ATGMRRPSRVVYLGDGRGDYCPTLKLAERDYMMPRKGYPVWDLIAGDRRAVRADVRGWAD  246

Query  430   GEDFERILFHLIN  392
              +D + +L  +I+
Sbjct  247   FKDLKTVLLDIIH  259



>ref|XP_010519235.1| PREDICTED: inorganic pyrophosphatase 2-like [Tarenaya hassleriana]
Length=179

 Score =   252 bits (643),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 134/154 (87%), Gaps = 0/154 (0%)
 Frame = -1

Query  1087  VVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHANGKTIGDIE  908
             V +FDFDKTIIDVDSDNWVVDELGFT LF+QLL TMPWNSLMDRMMKE+H  G TI DI+
Sbjct  12    VAIFDFDKTIIDVDSDNWVVDELGFTDLFNQLLPTMPWNSLMDRMMKELHEQGITIHDIK  71

Query  907   RVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYV  728
             RVL+ +PIHPR+VPA+++ H LGC+LRIVSDAN FFIETIL+HL I++ FSEINTNPG+V
Sbjct  72    RVLETIPIHPRVVPALRSAHALGCELRIVSDANTFFIETILEHLEIKDLFSEINTNPGFV  131

Query  727   DEEGRLRILPFHDFHSSPHGCARCPPNMCKSKII  626
             D+ GRLRI P+HDF  S HGC+RCPPNMCK + +
Sbjct  132   DQHGRLRISPYHDFTESSHGCSRCPPNMCKVQFV  165



>ref|XP_003638610.1| hypothetical protein MTR_138s0008, partial [Medicago truncatula]
Length=194

 Score =   251 bits (640),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 151/184 (82%), Gaps = 1/184 (1%)
 Frame = -1

Query  877  RIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFSEINTNPGYVDEEGRLRILP  698
            RI+ AIK+ + LGCDLRIVSDAN  FI+TILKHLGI ECFSEINTNPGYV++EGRL+++P
Sbjct  3    RIISAIKSAYALGCDLRIVSDANTIFIDTILKHLGISECFSEINTNPGYVNQEGRLKVMP  62

Query  697  FHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIYLGDGIGDFCPSLKLKAGDF  518
            +HDF+ + HGC  CPPNMCK  II+RIQ S+ +  KKR IYLGDG GD+CPSL+L+  DF
Sbjct  63   YHDFNKASHGCTLCPPNMCKGLIIDRIQKSISEVEKKRFIYLGDGAGDYCPSLRLRERDF  122

Query  517  MMPRKDFPVWELIKENRSLLEAEIHEWSNGEDFERILFHLINRICIEDS-QFLAAESKFQ  341
            +MPRK+FPVW+LI ++ SL++AEIH WS+GE+ E++L +LIN+I +E+  QF+A++ K  
Sbjct  123  VMPRKNFPVWDLICKDPSLVKAEIHGWSDGEELEQVLMNLINKIMMEEHVQFIASDCKLA  182

Query  340  AISM  329
              S+
Sbjct  183  TNSI  186



>ref|XP_008656629.1| PREDICTED: inorganic pyrophosphatase 3-like [Zea mays]
 gb|AFW83180.1| hypothetical protein ZEAMMB73_441347 [Zea mays]
Length=203

 Score =   248 bits (633),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/203 (58%), Positives = 143/203 (70%), Gaps = 0/203 (0%)
 Frame = -1

Query  1114  VCSPMAAGTVVVFDFDKTIIDVDSDNWVVDELGFTGLFDQLLHTMPWNSLMDRMMKEIHA  935
             + S  A   VVVFDFD+TIID DSD WV+ +LG    F +LL TM WN LMDRMM E+HA
Sbjct  1     MASAPAPAVVVVFDFDRTIIDWDSDEWVITKLGAADAFQRLLPTMRWNPLMDRMMAELHA  60

Query  934   NGKTIGDIERVLQGVPIHPRIVPAIKAVHGLGCDLRIVSDANLFFIETILKHLGIRECFS  755
              GKT  DI   L+  P+   +V AIK    LGCDL++VSDAN FFIET+L H G   CFS
Sbjct  61    RGKTPEDIRDCLRSAPLDTHVVSAIKRAAALGCDLKVVSDANTFFIETVLAHHGALGCFS  120

Query  754   EINTNPGYVDEEGRLRILPFHDFHSSPHGCARCPPNMCKSKIIERIQASMGKEGKKRVIY  575
             EI TNP  VD +GRLRI P+HD  ++PHGC+ CP NMCK KI+ERIQA+   + K+  IY
Sbjct  121   EIATNPASVDADGRLRISPYHDSAAAPHGCSLCPDNMCKGKIMERIQATAASDKKQHFIY  180

Query  574   LGDGIGDFCPSLKLKAGDFMMPR  506
             +GDG GD+CPSLKL  GD +MP+
Sbjct  181   IGDGKGDYCPSLKLGEGDHVMPK  203



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4389280885864