BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c17975_g1_i2 len=234 path=[1:0-112 627:113-120 635:121-121
494:122-233]

Length=234
                                                                      Score     E

gb|EYU24087.1|  hypothetical protein MIMGU_mgv1a001258mg              75.9    1e-13   
gb|KHN36067.1|  Beta-galactosidase 3                                  75.5    1e-13   
ref|XP_003538867.1|  PREDICTED: beta-galactosidase 3-like             75.5    1e-13   
ref|XP_003517202.1|  PREDICTED: beta-galactosidase 3-like             75.5    1e-13   
gb|KHN41933.1|  Beta-galactosidase 3                                  75.5    1e-13   
ref|XP_011100972.1|  PREDICTED: beta-galactosidase 3-like             73.2    9e-13   
gb|KDP32675.1|  hypothetical protein JCGZ_13673                       72.0    2e-12   
gb|EPS70273.1|  beta-galactosidase                                    71.6    2e-12   
ref|XP_010679814.1|  PREDICTED: beta-galactosidase 3                  72.0    2e-12   
gb|KFK30264.1|  hypothetical protein AALP_AA7G238600                  71.6    3e-12   
ref|XP_006412011.1|  hypothetical protein EUTSA_v10024387mg           71.2    3e-12   
dbj|BAJ34544.1|  unnamed protein product                              71.2    3e-12   
emb|CDX69219.1|  BnaC01g02340D                                        71.2    3e-12   
ref|XP_010437358.1|  PREDICTED: beta-galactosidase 3-like             71.2    3e-12   
emb|CDX75569.1|  BnaA01g01330D                                        71.2    3e-12   
ref|XP_010432182.1|  PREDICTED: beta-galactosidase 3-like             71.2    3e-12   
emb|CDY59693.1|  BnaC07g51120D                                        71.2    3e-12   
ref|XP_010446807.1|  PREDICTED: beta-galactosidase 3                  71.2    4e-12   
ref|XP_010649088.1|  PREDICTED: beta-galactosidase 3                  71.2    4e-12   
ref|XP_009145073.1|  PREDICTED: beta-galactosidase 3                  71.2    4e-12   
ref|XP_006283101.1|  hypothetical protein CARUB_v10004117mg           71.2    4e-12   
gb|KHG20819.1|  Beta-galactosidase 3                                  70.5    4e-12   
ref|XP_003612092.1|  Beta-galactosidase                               71.2    4e-12   
gb|ADO34791.1|  beta-galactosidase STBG6                              70.9    4e-12   
ref|XP_008241765.1|  PREDICTED: beta-galactosidase 3                  70.9    4e-12   
ref|NP_001234317.1|  TBG6 protein precursor                           70.9    4e-12   
ref|XP_006340680.1|  PREDICTED: beta-galactosidase 3-like             70.9    4e-12   
ref|XP_007204246.1|  hypothetical protein PRUPE_ppa002271mg           70.9    5e-12   
gb|AAW47739.1|  beta-galactosidase                                    70.9    5e-12   Prunus persica
ref|XP_010531064.1|  PREDICTED: beta-galactosidase 3                  70.9    5e-12   
ref|XP_006283100.1|  hypothetical protein CARUB_v10004117mg           70.5    5e-12   
ref|XP_010672619.1|  PREDICTED: beta-galactosidase 5                  70.5    6e-12   
ref|XP_004158882.1|  PREDICTED: beta-galactosidase 3-like             70.5    6e-12   
ref|XP_008337843.1|  PREDICTED: beta-galactosidase 3                  70.5    7e-12   
ref|XP_008440778.1|  PREDICTED: beta-galactosidase 3                  70.5    7e-12   
ref|XP_009418404.1|  PREDICTED: beta-galactosidase 5-like isoform X1  70.1    8e-12   
ref|XP_009418405.1|  PREDICTED: beta-galactosidase 5-like isoform X2  70.1    8e-12   
gb|AEM72517.1|  beta-galactosidase                                    67.0    9e-12   
ref|XP_010029731.1|  PREDICTED: beta-galactosidase 3                  70.1    9e-12   
ref|XP_004287850.1|  PREDICTED: beta-galactosidase 3-like             70.1    1e-11   
gb|KHG20820.1|  Beta-galactosidase 3                                  69.7    1e-11   
emb|CDP01954.1|  unnamed protein product                              69.7    1e-11   
ref|XP_002867020.1|  hypothetical protein ARALYDRAFT_491000           69.7    1e-11   
ref|XP_006412010.1|  hypothetical protein EUTSA_v10024387mg           69.3    1e-11   
ref|NP_849506.1|  beta-galactosidase 3                                69.7    1e-11   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568001.1|  beta-galactosidase 3                                69.7    1e-11   Arabidopsis thaliana [mouse-ear cress]
emb|CAB16852.1|  beta-galactosidase like protein                      69.7    1e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007158612.1|  hypothetical protein PHAVU_002G1672000g          68.2    2e-11   
ref|XP_011025878.1|  PREDICTED: beta-galactosidase 3                  69.3    2e-11   
emb|CAA18137.1|  beta-galactosidase like protein                      69.3    2e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002310279.2|  beta-galactosidase family protein                68.9    2e-11   Populus trichocarpa [western balsam poplar]
ref|XP_009628690.1|  PREDICTED: beta-galactosidase 3                  68.9    2e-11   
gb|KDO71052.1|  hypothetical protein CISIN_1g003044mg                 68.9    2e-11   
ref|XP_006425593.1|  hypothetical protein CICLE_v10024881mg           68.9    2e-11   
ref|XP_008338023.1|  PREDICTED: beta-galactosidase 3-like             68.9    2e-11   
ref|XP_004149980.1|  PREDICTED: beta-galactosidase 3-like             68.6    3e-11   
gb|KGN48881.1|  hypothetical protein Csa_6G504610                     68.6    3e-11   
dbj|BAD91082.1|  beta-D-galactosidase                                 68.6    3e-11   Pyrus pyrifolia [sha li]
ref|XP_006380782.1|  hypothetical protein POPTR_0007s13540g           68.2    3e-11   
gb|KDO71053.1|  hypothetical protein CISIN_1g003044mg                 68.6    3e-11   
gb|KDO71054.1|  hypothetical protein CISIN_1g003044mg                 68.2    3e-11   
gb|KEH36209.1|  beta-galactosidase-like protein                       68.2    3e-11   
gb|KDP38567.1|  hypothetical protein JCGZ_04492                       68.2    4e-11   
ref|XP_011083163.1|  PREDICTED: beta-galactosidase 3                  68.2    4e-11   
ref|XP_002305449.1|  beta-galactosidase family protein                68.2    4e-11   Populus trichocarpa [western balsam poplar]
ref|XP_011037170.1|  PREDICTED: beta-galactosidase 5-like             68.2    4e-11   
gb|KHG23756.1|  Beta-galactosidase 5 -like protein                    68.2    4e-11   
ref|XP_002512959.1|  beta-galactosidase, putative                     67.8    5e-11   Ricinus communis
ref|XP_004146490.1|  PREDICTED: beta-galactosidase 3-like             68.2    5e-11   
gb|EYU42595.1|  hypothetical protein MIMGU_mgv1a001990mg              67.8    5e-11   
ref|XP_004166954.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...  67.8    5e-11   
ref|XP_004512085.1|  PREDICTED: beta-galactosidase 3-like             67.8    5e-11   
gb|KHG11061.1|  Beta-galactosidase 5 -like protein                    67.8    5e-11   
ref|XP_008452119.1|  PREDICTED: beta-galactosidase 3-like             67.8    6e-11   
ref|XP_009789452.1|  PREDICTED: beta-galactosidase 3                  67.8    6e-11   
ref|XP_003523710.1|  PREDICTED: beta-galactosidase 3-like isoform 1   67.4    7e-11   
gb|KHN45883.1|  Beta-galactosidase 5                                  67.4    7e-11   
ref|XP_010107841.1|  Beta-galactosidase 3                             67.4    8e-11   
dbj|BAF31234.1|  beta-D-galactosidase                                 67.0    9e-11   Persea americana
ref|XP_007046794.1|  Beta-galactosidase 3 isoform 1                   67.0    9e-11   
ref|XP_010113483.1|  Beta-galactosidase 3                             67.0    1e-10   
ref|XP_004150073.1|  PREDICTED: beta-galactosidase 3-like             67.0    1e-10   
ref|XP_007046795.1|  Beta-galactosidase 3 isoform 2                   66.6    1e-10   
ref|XP_002510455.1|  beta-galactosidase, putative                     67.0    1e-10   Ricinus communis
ref|XP_008382310.1|  PREDICTED: beta-galactosidase 5-like             66.6    1e-10   
ref|XP_004509327.1|  PREDICTED: beta-galactosidase 3-like             66.6    1e-10   
gb|AGR44464.1|  beta-D-galactosidase 5                                66.6    1e-10   
ref|XP_009372992.1|  PREDICTED: beta-galactosidase 3-like             66.6    1e-10   
emb|CDO97013.1|  unnamed protein product                              66.6    1e-10   
ref|XP_011092826.1|  PREDICTED: beta-galactosidase 3                  66.2    2e-10   
gb|AAF67342.1|  beta galactosidase                                    66.2    2e-10   Vigna radiata var. radiata [golden gram]
ref|XP_006423393.1|  hypothetical protein CICLE_v10030257mg           66.2    2e-10   
ref|XP_002306893.1|  beta-galactosidase family protein                66.6    2e-10   Populus trichocarpa [western balsam poplar]
gb|KHN27041.1|  Beta-galactosidase 3                                  66.2    2e-10   
ref|XP_003548865.1|  PREDICTED: beta-galactosidase 3-like             66.2    2e-10   
gb|AIZ46896.1|  beta-galactosidase                                    65.9    2e-10   
ref|XP_011048837.1|  PREDICTED: beta-galactosidase 5                  66.2    2e-10   
ref|XP_007042085.1|  Beta-galactosidase 3 isoform 3                   65.9    2e-10   
ref|XP_006435077.1|  hypothetical protein CICLE_v10000260mg           66.2    2e-10   
ref|XP_007042086.1|  Beta-galactosidase 3 isoform 4                   65.9    2e-10   
ref|XP_007136038.1|  hypothetical protein PHAVU_009G012700g           66.2    2e-10   
gb|KDO84694.1|  hypothetical protein CISIN_1g003076mg                 65.9    2e-10   
ref|XP_007160714.1|  hypothetical protein PHAVU_001G010900g           66.2    2e-10   
gb|KHN00504.1|  Beta-galactosidase 3                                  65.9    2e-10   
gb|KDP41747.1|  hypothetical protein JCGZ_26765                       65.9    2e-10   
ref|XP_006487343.1|  PREDICTED: beta-galactosidase 3-like             65.9    2e-10   
ref|XP_010254673.1|  PREDICTED: beta-galactosidase 3-like             65.9    2e-10   
gb|KHF97862.1|  Beta-galactosidase 3                                  65.5    2e-10   
gb|KDO84693.1|  hypothetical protein CISIN_1g003076mg                 65.9    2e-10   
ref|XP_011083609.1|  PREDICTED: beta-galactosidase 3-like             65.9    3e-10   
ref|XP_006435076.1|  hypothetical protein CICLE_v10000260mg           65.9    3e-10   
gb|KDO84688.1|  hypothetical protein CISIN_1g003076mg                 65.9    3e-10   
ref|XP_008377189.1|  PREDICTED: beta-galactosidase 5-like             65.9    3e-10   
gb|KDO84691.1|  hypothetical protein CISIN_1g003076mg                 65.5    3e-10   
ref|XP_010917686.1|  PREDICTED: beta-galactosidase 5-like             65.9    3e-10   
gb|KDO84690.1|  hypothetical protein CISIN_1g003076mg                 65.9    3e-10   
ref|XP_008236954.1|  PREDICTED: beta-galactosidase 3-like             65.9    3e-10   
gb|KDO84689.1|  hypothetical protein CISIN_1g003076mg                 65.5    3e-10   
ref|XP_006473573.1|  PREDICTED: beta-galactosidase 3-like             65.9    3e-10   
ref|XP_007042083.1|  Beta-galactosidase 3 isoform 1                   65.5    3e-10   
ref|XP_007199661.1|  hypothetical protein PRUPE_ppa001363mg           65.5    3e-10   
ref|XP_007042087.1|  Beta-galactosidase 3 isoform 5                   65.1    4e-10   
ref|XP_010275526.1|  PREDICTED: beta-galactosidase 3-like             65.5    4e-10   
ref|XP_007042084.1|  Beta-galactosidase 3 isoform 2                   65.1    4e-10   
dbj|BAD91085.1|  beta-D-galactosidase                                 65.5    4e-10   Pyrus pyrifolia [sha li]
ref|XP_008460995.1|  PREDICTED: beta-galactosidase 5-like             65.1    5e-10   
gb|EYU31167.1|  hypothetical protein MIMGU_mgv1a001956mg              65.1    5e-10   
gb|KDO84692.1|  hypothetical protein CISIN_1g003076mg                 64.7    5e-10   
ref|XP_007156097.1|  hypothetical protein PHAVU_003G258300g           65.1    5e-10   
ref|XP_006362025.1|  PREDICTED: beta-galactosidase 3-like             64.7    6e-10   
ref|XP_009395554.1|  PREDICTED: beta-galactosidase 5                  64.7    6e-10   
ref|XP_010552493.1|  PREDICTED: beta-galactosidase 5                  64.7    6e-10   
gb|KDO49473.1|  hypothetical protein CISIN_1g0051602mg                63.9    6e-10   
gb|ADD62393.1|  beta-galactosidase 3                                  64.7    6e-10   Prunus persica
ref|XP_003520277.1|  PREDICTED: beta-galactosidase 3-like             64.7    6e-10   
ref|XP_009777047.1|  PREDICTED: beta-galactosidase 3-like             64.7    7e-10   
ref|XP_010315322.1|  PREDICTED: beta-galactosidase 3-like             64.7    7e-10   
ref|XP_010110010.1|  Beta-galactosidase 3                             64.7    7e-10   
ref|NP_001265904.1|  beta-galactosidase 5-like precursor              64.3    7e-10   
gb|AEC33272.1|  beta-galactosidase                                    64.3    8e-10   
ref|XP_009614464.1|  PREDICTED: beta-galactosidase 3-like             64.3    8e-10   
ref|XP_007225291.1|  hypothetical protein PRUPE_ppa001334mg           64.3    9e-10   
ref|XP_008221339.1|  PREDICTED: beta-galactosidase 5                  64.3    1e-09   
ref|XP_009388558.1|  PREDICTED: beta-galactosidase-like               63.9    1e-09   
ref|XP_004500969.1|  PREDICTED: beta-galactosidase 5-like isoform X1  63.9    1e-09   
ref|XP_004501212.1|  PREDICTED: beta-galactosidase 5-like             63.2    1e-09   
ref|XP_009335672.1|  PREDICTED: beta-galactosidase 5                  63.9    1e-09   
ref|XP_007017651.1|  Beta-galactosidase 5 isoform 1                   63.9    1e-09   
ref|XP_007017652.1|  Beta-galactosidase 5 isoform 2                   63.5    1e-09   
ref|XP_010939579.1|  PREDICTED: beta-galactosidase 2-like             63.5    1e-09   
gb|KHN12675.1|  Beta-galactosidase 5                                  63.5    1e-09   
ref|XP_008388000.1|  PREDICTED: beta-galactosidase 5                  63.5    1e-09   
ref|XP_009409593.1|  PREDICTED: beta-galactosidase-like               63.5    1e-09   
ref|XP_004500970.1|  PREDICTED: beta-galactosidase 5-like isoform X2  63.5    1e-09   
gb|KHN20946.1|  Beta-galactosidase 5                                  63.5    1e-09   
ref|XP_010061261.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...  63.5    2e-09   
ref|XP_007017653.1|  Beta-galactosidase 5 isoform 3                   63.2    2e-09   
gb|KCW68186.1|  hypothetical protein EUGRSUZ_F01855                   63.2    2e-09   
gb|AGR44466.1|  beta-D-galactosidase 7                                63.2    2e-09   
emb|CAD44190.1|  putative beta-galactosidase                          61.6    2e-09   Mangifera indica
ref|XP_008775429.1|  PREDICTED: beta-galactosidase 2-like             63.2    2e-09   
gb|EYU32887.1|  hypothetical protein MIMGU_mgv1a001295mg              63.2    2e-09   
dbj|BAD91084.1|  beta-D-galactosidase                                 63.2    2e-09   Pyrus pyrifolia [sha li]
gb|KDO65276.1|  hypothetical protein CISIN_1g002867mg                 62.8    2e-09   
emb|CBI19767.3|  unnamed protein product                              63.2    2e-09   
emb|CAN78072.1|  hypothetical protein VITISV_013292                   63.2    2e-09   Vitis vinifera
ref|NP_001268162.1|  beta-galactosidase BG1-like precursor            63.2    2e-09   
ref|XP_006826783.1|  hypothetical protein AMTR_s00136p00108810        62.8    3e-09   
gb|KDO65275.1|  hypothetical protein CISIN_1g002867mg                 62.8    3e-09   
ref|XP_008799994.1|  PREDICTED: beta-galactosidase 5-like             62.8    3e-09   
ref|XP_010066194.1|  PREDICTED: beta-galactosidase 5-like isoform X3  62.8    3e-09   
ref|XP_008809207.1|  PREDICTED: beta-galactosidase 5-like             62.8    3e-09   
ref|XP_010066193.1|  PREDICTED: beta-galactosidase 5-like isoform X2  62.8    3e-09   
ref|XP_010066191.1|  PREDICTED: beta-galactosidase 5-like isoform X1  62.8    3e-09   
gb|KDO65274.1|  hypothetical protein CISIN_1g002867mg                 62.8    3e-09   
ref|XP_006466038.1|  PREDICTED: beta-galactosidase 1-like             62.8    3e-09   
ref|XP_009409594.1|  PREDICTED: beta-galactosidase-like               62.8    3e-09   
gb|KDO65278.1|  hypothetical protein CISIN_1g002867mg                 62.4    3e-09   
ref|XP_006426535.1|  hypothetical protein CICLE_v10024886mg           62.8    3e-09   
ref|XP_006426534.1|  hypothetical protein CICLE_v10024886mg           62.8    3e-09   
ref|XP_004292017.1|  PREDICTED: beta-galactosidase 3-like             62.4    3e-09   
gb|KDO65277.1|  hypothetical protein CISIN_1g002867mg                 62.4    3e-09   
ref|XP_002465807.1|  hypothetical protein SORBIDRAFT_01g046160        62.4    3e-09   Sorghum bicolor [broomcorn]
ref|XP_008643999.1|  PREDICTED: uncharacterized protein LOC100382...  62.4    4e-09   
ref|XP_008660537.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...  62.4    4e-09   
ref|XP_010915228.1|  PREDICTED: beta-galactosidase isoform X1         62.4    4e-09   
ref|XP_009402923.1|  PREDICTED: beta-galactosidase-like               62.4    4e-09   
gb|AFW89719.1|  hypothetical protein ZEAMMB73_400203                  62.4    4e-09   
ref|NP_001168664.1|  uncharacterized protein LOC100382452             62.4    4e-09   Zea mays [maize]
ref|XP_010915229.1|  PREDICTED: beta-galactosidase isoform X2         62.4    4e-09   
ref|XP_009407297.1|  PREDICTED: beta-galactosidase 2                  62.4    4e-09   
ref|XP_004985588.1|  PREDICTED: beta-galactosidase 5-like isoform X1  62.4    4e-09   
ref|XP_004147848.1|  PREDICTED: beta-galactosidase 3-like             62.4    4e-09   
gb|KEH40195.1|  beta-like galactosidase                               62.0    5e-09   
gb|EYU45851.1|  hypothetical protein MIMGU_mgv1a002308mg              62.0    5e-09   
ref|XP_003589339.1|  Beta-galactosidase                               62.0    5e-09   
tpg|DAA43551.1|  TPA: beta-galactosidase                              62.4    5e-09   
ref|XP_008466519.1|  PREDICTED: beta-galactosidase 5-like             62.0    5e-09   
ref|XP_010262131.1|  PREDICTED: beta-galactosidase isoform X1         62.0    5e-09   
ref|XP_004985589.1|  PREDICTED: beta-galactosidase 5-like isoform X2  62.0    5e-09   
ref|XP_010262132.1|  PREDICTED: beta-galactosidase isoform X2         62.0    5e-09   
ref|XP_009408846.1|  PREDICTED: beta-galactosidase-like               62.0    6e-09   
ref|XP_004486826.1|  PREDICTED: beta-galactosidase 1-like             62.0    6e-09   
ref|XP_011072510.1|  PREDICTED: beta-galactosidase-like               62.0    6e-09   
ref|XP_003543598.1|  PREDICTED: beta-galactosidase 1-like             62.0    6e-09   
ref|XP_006838689.1|  hypothetical protein AMTR_s00002p00246870        62.0    6e-09   
ref|XP_004291830.1|  PREDICTED: beta-galactosidase 5-like             61.6    6e-09   
gb|KHN30042.1|  Beta-galactosidase 1                                  61.6    6e-09   
ref|XP_008805774.1|  PREDICTED: beta-galactosidase-like isoform X2    61.6    6e-09   
ref|XP_008805772.1|  PREDICTED: beta-galactosidase-like isoform X1    61.6    6e-09   
ref|XP_009789773.1|  PREDICTED: beta-galactosidase-like               61.6    7e-09   
ref|XP_010911412.1|  PREDICTED: beta-galactosidase-like               61.6    7e-09   
ref|XP_010932916.1|  PREDICTED: beta-galactosidase 5-like             61.6    7e-09   
ref|XP_004966041.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...  61.6    7e-09   
ref|XP_003546676.1|  PREDICTED: beta-galactosidase 1-like             61.6    7e-09   
gb|ACC60981.1|  beta-galactosidase 1 precursor                        61.6    7e-09   Petunia x hybrida [garden petunia]
gb|EYU21377.1|  hypothetical protein MIMGU_mgv1a001631mg              61.6    7e-09   
ref|XP_009606115.1|  PREDICTED: beta-galactosidase-like               61.6    7e-09   
ref|XP_004241849.1|  PREDICTED: beta-galactosidase-like               61.6    8e-09   
ref|XP_010106660.1|  Beta-galactosidase 1                             61.6    8e-09   
gb|KGN59998.1|  hypothetical protein Csa_3G865330                     61.6    8e-09   
gb|KHN32687.1|  Beta-galactosidase 1                                  61.6    8e-09   
ref|XP_009603021.1|  PREDICTED: beta-galactosidase 5                  61.2    8e-09   
ref|XP_006357461.1|  PREDICTED: beta-galactosidase-like               61.6    8e-09   
ref|XP_002263382.2|  PREDICTED: beta-galactosidase 3                  61.2    9e-09   Vitis vinifera
dbj|BAK05933.1|  predicted protein                                    61.2    1e-08   
gb|KCW64027.1|  hypothetical protein EUGRSUZ_G01704                   60.8    1e-08   
dbj|BAK07157.1|  predicted protein                                    61.2    1e-08   
dbj|BAJ96054.1|  predicted protein                                    61.2    1e-08   
ref|XP_006342225.1|  PREDICTED: beta-galactosidase 3-like             61.2    1e-08   
ref|XP_004238611.1|  PREDICTED: beta-galactosidase 5                  61.2    1e-08   
ref|XP_006342989.1|  PREDICTED: beta-galactosidase-like               60.8    1e-08   
gb|ADV41669.1|  beta-D-galactosidase                                  60.8    1e-08   
gb|EMS60063.1|  Beta-galactosidase 5                                  60.8    1e-08   
ref|XP_009783993.1|  PREDICTED: beta-galactosidase                    60.8    1e-08   
gb|EEE58382.1|  hypothetical protein OsJ_09539                        60.8    2e-08   Oryza sativa Japonica Group [Japonica rice]
gb|EEC74580.1|  hypothetical protein OsI_10152                        60.8    2e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_009627536.1|  PREDICTED: beta-galactosidase                    60.8    2e-08   
gb|EMT10014.1|  Beta-galactosidase 5                                  60.5    2e-08   
ref|NP_001049068.1|  Os03g0165400                                     60.5    2e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007150529.1|  hypothetical protein PHAVU_005G160000g           60.5    2e-08   
gb|AAM22973.1|AF499737_1  beta-galactosidase                          60.5    2e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003597608.1|  Beta-galactosidase                               60.5    2e-08   
ref|XP_006649450.1|  PREDICTED: beta-galactosidase 5-like             60.5    2e-08   
ref|XP_003558743.1|  PREDICTED: beta-galactosidase 5                  60.5    2e-08   
gb|AGW47883.1|  beta-galactosidase precursor                          60.5    2e-08   
gb|EEC70956.1|  hypothetical protein OsI_02569                        59.7    2e-08   Oryza sativa Indica Group [Indian rice]
gb|ABF94150.1|  Beta-galactosidase precursor, putative, expressed     60.1    2e-08   Oryza sativa Japonica Group [Japonica rice]
gb|EMT02336.1|  Beta-galactosidase 2                                  60.1    2e-08   
ref|NP_001234465.1|  beta-galactosidase precursor                     60.1    3e-08   
ref|NP_001234303.1|  beta-galactosidase precursor                     59.7    3e-08   
gb|KEH39519.1|  beta-galactosidase                                    59.7    3e-08   
gb|ADO34788.1|  beta-galactosidase STBG3                              59.7    3e-08   
ref|XP_009769408.1|  PREDICTED: beta-galactosidase-like               59.7    3e-08   
ref|XP_010463222.1|  PREDICTED: beta-galactosidase 5-like             59.7    3e-08   
gb|AFW66041.1|  hypothetical protein ZEAMMB73_706783                  59.7    3e-08   
gb|EEC70952.1|  hypothetical protein OsI_02561                        59.7    3e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_004969419.1|  PREDICTED: beta-galactosidase 2-like             59.7    3e-08   
ref|XP_006646030.1|  PREDICTED: beta-galactosidase 2-like             59.7    3e-08   
ref|NP_001043405.1|  Os01g0580200                                     59.7    3e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003566806.1|  PREDICTED: beta-galactosidase 2                  59.7    3e-08   
gb|EEE54862.1|  hypothetical protein OsJ_02342                        59.7    3e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009761050.1|  PREDICTED: beta-galactosidase 5                  59.7    3e-08   
gb|EMS53990.1|  Beta-galactosidase 2                                  59.7    3e-08   
ref|XP_008679838.1|  PREDICTED: beta-galactosidase 4                  59.7    4e-08   
ref|XP_009409595.1|  PREDICTED: beta-galactosidase-like               59.7    4e-08   
ref|XP_004951447.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...  59.3    4e-08   
ref|XP_009622143.1|  PREDICTED: beta-galactosidase-like               59.7    4e-08   
emb|CDP07463.1|  unnamed protein product                              59.3    4e-08   
ref|XP_011080179.1|  PREDICTED: beta-galactosidase-like               59.3    4e-08   
gb|ABK96254.1|  unknown                                               59.3    4e-08   Populus trichocarpa x Populus deltoides
ref|XP_006385360.1|  beta-galactosidase 1 family protein              59.3    4e-08   
ref|XP_011000791.1|  PREDICTED: beta-galactosidase 1-like             59.3    4e-08   
ref|XP_002453540.1|  hypothetical protein SORBIDRAFT_04g007660        59.3    4e-08   Sorghum bicolor [broomcorn]
ref|XP_011010891.1|  PREDICTED: beta-galactosidase 1-like             59.3    5e-08   
dbj|BAF02242.1|  putative galactosidase                               58.9    5e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006369293.1|  beta-galactosidase 1 family protein              59.3    5e-08   
ref|XP_008450853.1|  PREDICTED: beta-galactosidase-like               59.3    5e-08   
ref|XP_010534899.1|  PREDICTED: beta-galactosidase 1                  59.3    5e-08   
dbj|BAH20412.1|  AT3G13750                                            58.9    5e-08   
ref|XP_008793242.1|  PREDICTED: beta-galactosidase                    58.9    5e-08   
gb|EAZ01416.1|  hypothetical protein OsI_23450                        58.9    5e-08   
ref|XP_002455836.1|  hypothetical protein SORBIDRAFT_03g025990        58.9    5e-08   
ref|NP_001057920.1|  Os06g0573600                                     58.9    5e-08   
ref|XP_004135819.1|  PREDICTED: beta-galactosidase-like               58.9    5e-08   
ref|NP_001046310.1|  Os02g0219200                                     58.5    5e-08   
ref|XP_006366152.1|  PREDICTED: beta-galactosidase-like               58.9    6e-08   
ref|XP_004158444.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...  58.9    6e-08   
emb|CDO97918.1|  unnamed protein product                              58.9    6e-08   
gb|KFK34528.1|  hypothetical protein AALP_AA5G157800                  58.9    6e-08   
ref|XP_008672351.1|  PREDICTED: hypothetical protein isoform X1       58.9    6e-08   
ref|XP_010542431.1|  PREDICTED: beta-galactosidase 1-like             58.9    6e-08   
dbj|BAF31233.1|  beta-D-galactosidase                                 58.9    7e-08   
ref|XP_010033786.1|  PREDICTED: beta-galactosidase 1-like             58.9    7e-08   
gb|KGN66238.1|  hypothetical protein Csa_1G587980                     58.5    7e-08   
gb|KCW53601.1|  hypothetical protein EUGRSUZ_J02867                   58.5    7e-08   
ref|XP_006306871.1|  hypothetical protein CARUB_v10008424mg           58.5    8e-08   
ref|XP_009396354.1|  PREDICTED: beta-galactosidase 5-like             58.5    8e-08   
ref|XP_010479073.1|  PREDICTED: beta-galactosidase 5                  58.5    8e-08   
gb|KEH18344.1|  beta-galactosidase                                    58.5    8e-08   
gb|EMS68743.1|  Beta-galactosidase 4                                  58.5    8e-08   
gb|AAB61470.1|  beta-D-galactosidase                                  58.5    8e-08   
gb|KCW53602.1|  hypothetical protein EUGRSUZ_J02867                   58.2    9e-08   
ref|XP_009148744.1|  PREDICTED: beta-galactosidase 2 isoform X2       58.2    9e-08   
gb|EEE65914.1|  hypothetical protein OsJ_21762                        58.2    9e-08   
ref|XP_010654522.1|  PREDICTED: beta-galactosidase 1                  58.5    1e-07   
gb|EAZ22260.1|  hypothetical protein OsJ_05915                        58.2    1e-07   
sp|A2X2H7.1|BGAL4_ORYSI  RecName: Full=Beta-galactosidase 4; Shor...  58.2    1e-07   
emb|CBI35944.3|  unnamed protein product                              58.2    1e-07   
ref|XP_010545348.1|  PREDICTED: beta-galactosidase 12-like isofor...  58.2    1e-07   
ref|NP_175127.1|  beta-galactosidase 5                                58.2    1e-07   
sp|Q6Z6K4.1|BGAL4_ORYSJ  RecName: Full=Beta-galactosidase 4; Shor...  58.2    1e-07   
emb|CAB64741.1|  putative beta-galactosidase                          58.2    1e-07   
gb|AAL24206.1|  At1g45130/F27F5_20                                    58.2    1e-07   
ref|XP_009146456.1|  PREDICTED: beta-galactosidase 1                  58.2    1e-07   
emb|CDY23637.1|  BnaC05g39570D                                        58.2    1e-07   
emb|CDX97513.1|  BnaA05g25660D                                        58.2    1e-07   
ref|XP_010465236.1|  PREDICTED: beta-galactosidase 1                  58.2    1e-07   
ref|XP_010501131.1|  PREDICTED: beta-galactosidase 1-like             58.2    1e-07   
ref|XP_006407174.1|  hypothetical protein EUTSA_v10020056mg           58.2    1e-07   
ref|XP_006300095.1|  hypothetical protein CARUB_v10016323mg           58.2    1e-07   
ref|XP_002882842.1|  hypothetical protein ARALYDRAFT_897617           58.2    1e-07   
gb|AAM13196.1|  galactosidase, putative                               58.2    1e-07   
ref|XP_010487145.1|  PREDICTED: beta-galactosidase 1-like             58.2    1e-07   
ref|NP_187988.1|  beta galactosidase 1                                58.2    1e-07   
ref|XP_009117469.1|  PREDICTED: beta-galactosidase 1-like             58.2    1e-07   
emb|CDY51738.1|  BnaA01g37210D                                        58.2    1e-07   
ref|XP_010686091.1|  PREDICTED: beta-galactosidase 1                  58.2    1e-07   
dbj|BAB83260.1|  beta-D-galactosidase                                 58.2    1e-07   
gb|AFW87014.1|  beta-galactosidase                                    57.8    1e-07   
ref|XP_002891311.1|  hypothetical protein ARALYDRAFT_473836           58.2    1e-07   
gb|EMS45022.1|  Beta-galactosidase 4                                  58.2    1e-07   
gb|KFK36177.1|  hypothetical protein AALP_AA4G088200                  58.2    1e-07   
ref|XP_010234045.1|  PREDICTED: beta-galactosidase 4                  58.2    1e-07   
emb|CDY37486.1|  BnaC01g37460D                                        58.2    1e-07   
ref|XP_006393673.1|  hypothetical protein EUTSA_v10011265mg           58.2    1e-07   
gb|KHN39301.1|  Beta-galactosidase 1                                  58.2    1e-07   
ref|XP_003531618.1|  PREDICTED: beta-galactosidase 1-like             58.2    1e-07   
ref|XP_003529875.1|  PREDICTED: beta-galactosidase 1-like             57.8    1e-07   
emb|CDX76254.1|  BnaA04g05180D                                        57.8    1e-07   
gb|EPS72701.1|  beta-galactosidase                                    57.0    1e-07   
ref|XP_006656180.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...  57.8    1e-07   
gb|AAQ21369.1|  beta-galactosidase                                    57.8    1e-07   
ref|XP_003563718.1|  PREDICTED: beta-galactosidase 9                  57.8    1e-07   
gb|EMT13456.1|  Beta-galactosidase 9                                  57.4    2e-07   
ref|XP_009148743.1|  PREDICTED: beta-galactosidase 2 isoform X1       57.4    2e-07   
ref|XP_010521771.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...  57.4    2e-07   
gb|AFW66042.1|  hypothetical protein ZEAMMB73_706783                  57.4    2e-07   
ref|XP_010545349.1|  PREDICTED: beta-galactosidase 12-like isofor...  57.0    2e-07   
ref|XP_008242341.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...  57.4    2e-07   
ref|XP_010090040.1|  hypothetical protein L484_027271                 57.4    2e-07   
ref|XP_007204656.1|  hypothetical protein PRUPE_ppa001412mg           57.4    2e-07   
gb|ABY71826.1|  beta-galactosidase                                    57.4    2e-07   
gb|ABV32546.1|  beta-galactosidase protein 1                          57.4    2e-07   
emb|CDX95380.1|  BnaC04g27780D                                        57.0    2e-07   
ref|XP_008228300.1|  PREDICTED: beta-galactosidase 1                  57.0    3e-07   
ref|XP_007217146.1|  hypothetical protein PRUPE_ppa001382mg           57.0    3e-07   
gb|ABV32545.1|  beta-galactosidase protein 2                          57.0    3e-07   
gb|ACR35908.1|  unknown                                               56.2    3e-07   
gb|KHF98342.1|  Beta-galactosidase 1 -like protein                    56.6    3e-07   
ref|XP_006451462.1|  hypothetical protein CICLE_v10007531mg           56.6    3e-07   
sp|P45582.1|BGAL_ASPOF  RecName: Full=Beta-galactosidase; Short=L...  56.6    3e-07   
ref|XP_007135555.1|  hypothetical protein PHAVU_010G139300g           56.6    3e-07   
ref|XP_010667155.1|  PREDICTED: putative beta-galactosidase           56.6    4e-07   
gb|EPS69033.1|  beta-galactosidase                                    56.6    4e-07   
ref|XP_010047575.1|  PREDICTED: beta-galactosidase-like               56.6    4e-07   
gb|AHL69742.1|  beta-galactosidase                                    56.6    4e-07   
emb|CDY53959.1|  BnaCnng25850D                                        56.2    4e-07   
tpg|DAA58690.1|  TPA: hypothetical protein ZEAMMB73_223728            55.5    4e-07   
emb|CAC44500.1|  beta-galactosidase                                   56.2    4e-07   
ref|NP_001140495.1|  hypothetical protein precursor                   55.5    4e-07   
ref|XP_010242207.1|  PREDICTED: beta-galactosidase                    56.2    5e-07   
ref|XP_006403764.1|  hypothetical protein EUTSA_v10010152mg           56.2    5e-07   
ref|XP_009129554.1|  PREDICTED: beta-galactosidase 5                  56.2    5e-07   
ref|XP_010062625.1|  PREDICTED: beta-galactosidase 1                  56.2    5e-07   
gb|EMT12095.1|  Beta-galactosidase 4                                  55.5    5e-07   
ref|XP_010093111.1|  Beta-galactosidase 10                            56.2    5e-07   
emb|CDY47949.1|  BnaA10g28210D                                        56.2    5e-07   
ref|XP_006293328.1|  hypothetical protein CARUB_v100167701mg          55.8    5e-07   
ref|XP_002876169.1|  AT3g52840/F8J2_10                                56.2    5e-07   
gb|ACP18874.1|  beta-galactosidase pBG(b)                             55.8    5e-07   
ref|XP_006451461.1|  hypothetical protein CICLE_v10007531mg           56.2    5e-07   
ref|NP_190852.2|  beta-galactosidase 2                                56.2    5e-07   
gb|KDO57763.1|  hypothetical protein CISIN_1g004219mg                 56.2    5e-07   
gb|AAQ21371.2|  beta-galactosidase                                    56.2    5e-07   
gb|KDO57771.1|  hypothetical protein CISIN_1g004219mg                 55.8    5e-07   
gb|AFW61988.1|  hypothetical protein ZEAMMB73_453254                  55.1    6e-07   
ref|XP_006648459.1|  PREDICTED: beta-galactosidase 4-like             55.8    6e-07   
gb|KDP40776.1|  hypothetical protein JCGZ_24775                       55.8    6e-07   
emb|CAB86888.1|  beta-galactosidase precursor-like protein            55.8    6e-07   
ref|XP_006451459.1|  hypothetical protein CICLE_v10007531mg           55.8    6e-07   
gb|KDO57764.1|  hypothetical protein CISIN_1g004219mg                 55.8    6e-07   
ref|NP_001275845.1|  beta-galactosidase                               55.8    6e-07   
ref|XP_002527409.1|  beta-galactosidase, putative                     55.8    6e-07   
gb|KDO57765.1|  hypothetical protein CISIN_1g004219mg                 55.8    6e-07   
gb|AEM72518.1|  beta-galactosidase                                    53.1    6e-07   
gb|ACP18875.1|  beta-galactosidase pBG(a)                             55.8    6e-07   
emb|CDX94367.1|  BnaC01g18170D                                        55.8    6e-07   
ref|XP_006451460.1|  hypothetical protein CICLE_v10007531mg           55.8    6e-07   
ref|XP_002864484.1|  predicted protein                                55.8    6e-07   
gb|KDO57762.1|  hypothetical protein CISIN_1g004219mg                 55.8    7e-07   
gb|KHG11296.1|  Beta-galactosidase                                    55.8    7e-07   
gb|KCW79522.1|  hypothetical protein EUGRSUZ_C00898                   55.8    7e-07   
gb|EPS62826.1|  beta-galactosidase                                    55.8    7e-07   
ref|XP_004287560.1|  PREDICTED: beta-galactosidase-like               55.8    7e-07   
ref|XP_008391326.1|  PREDICTED: beta-galactosidase 1                  55.8    7e-07   
ref|XP_010536861.1|  PREDICTED: beta-galactosidase 12                 55.8    7e-07   
ref|XP_009367552.1|  PREDICTED: beta-galactosidase 1                  55.8    7e-07   
ref|NP_001130532.1|  beta-galactosidase isoform 1 precursor           55.5    8e-07   
ref|XP_007012844.1|  Beta-galactosidase                               55.8    8e-07   
ref|XP_002437187.1|  hypothetical protein SORBIDRAFT_10g022620        55.5    8e-07   
gb|ACG30563.1|  beta-galactosidase precursor                          55.5    8e-07   
gb|EPS64494.1|  beta-galactosidase                                    55.5    8e-07   
ref|XP_007217046.1|  hypothetical protein PRUPE_ppa001415mg           55.8    8e-07   
gb|KDO57768.1|  hypothetical protein CISIN_1g004219mg                 55.5    8e-07   
ref|XP_010689565.1|  PREDICTED: beta-galactosidase 8                  55.5    8e-07   
dbj|BAD20774.2|  beta-galactosidase                                   55.5    8e-07   
gb|KDO57766.1|  hypothetical protein CISIN_1g004219mg                 55.5    8e-07   
gb|KDO57770.1|  hypothetical protein CISIN_1g004219mg                 55.5    8e-07   
ref|XP_009103690.1|  PREDICTED: beta-galactosidase 8                  55.5    9e-07   
emb|CDY04567.1|  BnaA07g13930D                                        55.5    9e-07   
ref|XP_010510620.1|  PREDICTED: beta-galactosidase 8-like             55.5    9e-07   
ref|XP_010470077.1|  PREDICTED: beta-galactosidase 8-like             55.5    9e-07   
ref|XP_010414520.1|  PREDICTED: beta-galactosidase 8                  55.5    9e-07   
ref|XP_006409871.1|  hypothetical protein EUTSA_v10016234mg           55.5    9e-07   
emb|CDY15749.1|  BnaC04g15750D                                        55.5    9e-07   
gb|KDO57767.1|  hypothetical protein CISIN_1g004219mg                 55.1    1e-06   
emb|CAB64744.1|  putative beta-galactosidase                          55.5    1e-06   
ref|XP_003550633.1|  PREDICTED: beta-galactosidase-like               55.5    1e-06   
ref|XP_006296187.1|  hypothetical protein CARUB_v10025350mg           55.5    1e-06   
ref|NP_001189624.1|  beta-galactosidase 8                             55.5    1e-06   
ref|NP_850121.1|  beta-galactosidase 8                                55.5    1e-06   
ref|XP_004287559.1|  PREDICTED: beta-galactosidase-like               55.1    1e-06   
gb|KHN17668.1|  Beta-galactosidase                                    55.1    1e-06   
ref|XP_002879094.1|  beta-glactosidase 8                              55.1    1e-06   
gb|KHF99404.1|  Beta-galactosidase 1 -like protein                    55.1    1e-06   
gb|AAD21482.1|  putative beta-galactosidase                           55.1    1e-06   
ref|XP_006478842.1|  PREDICTED: beta-galactosidase 3-like             55.5    1e-06   
ref|XP_006442891.1|  hypothetical protein CICLE_v10018839mg           55.1    1e-06   
gb|AAN60229.1|  unknown                                               55.1    1e-06   
emb|CAC44502.1|  beta-galactosidase                                   55.1    1e-06   
ref|XP_009139943.1|  PREDICTED: beta-galactosidase 12 isoform X1      55.1    1e-06   
ref|NP_001280755.1|  beta-galactosidase precursor                     55.1    1e-06   
ref|XP_009139949.1|  PREDICTED: beta-galactosidase 12 isoform X2      55.1    1e-06   
ref|XP_008450854.1|  PREDICTED: beta-galactosidase-like               55.1    1e-06   
ref|XP_004135712.1|  PREDICTED: beta-galactosidase-like               55.1    1e-06   
gb|KHN06610.1|  Beta-galactosidase                                    55.1    1e-06   
ref|XP_007154660.1|  hypothetical protein PHAVU_003G137000g           55.1    1e-06   
ref|XP_004158465.1|  PREDICTED: beta-galactosidase-like               55.1    1e-06   
ref|XP_007024475.1|  Beta galactosidase 1                             54.7    1e-06   
ref|XP_010515759.1|  PREDICTED: beta-galactosidase 2 isoform X2       54.7    2e-06   
ref|NP_001266102.1|  beta-galactosidase 1-like precursor              54.7    2e-06   
sp|Q00662.1|BGAL_DIACA  RecName: Full=Putative beta-galactosidase...  54.7    2e-06   
ref|XP_006853356.1|  hypothetical protein AMTR_s00032p00109160        54.7    2e-06   
gb|KGN66239.1|  hypothetical protein Csa_1G587990                     54.3    2e-06   
gb|AHG94611.1|  beta-galactosidase                                    54.7    2e-06   
gb|ACF22882.1|  beta-galactosidase                                    54.3    2e-06   
gb|KHG25378.1|  Beta-galactosidase 1 -like protein                    54.3    2e-06   
gb|KFK32294.1|  hypothetical protein AALP_AA6G223900                  54.3    2e-06   
gb|AAF67341.1|  beta galactosidase                                    54.3    2e-06   
gb|KHN24609.1|  Beta-galactosidase                                    54.3    2e-06   
ref|XP_002973160.1|  hypothetical protein SELMODRAFT_413650           54.3    2e-06   
gb|AAY18075.1|  beta-galactosidase                                    53.1    2e-06   
ref|XP_003546457.1|  PREDICTED: beta-galactosidase-like isoform X1    54.3    2e-06   
ref|XP_006401275.1|  hypothetical protein EUTSA_v10012847mg           54.3    2e-06   
ref|XP_008230925.1|  PREDICTED: beta-galactosidase-like               54.3    2e-06   
ref|XP_002514108.1|  beta-galactosidase, putative                     54.3    2e-06   
ref|XP_009762312.1|  PREDICTED: beta-galactosidase-like               53.9    3e-06   
ref|XP_010515757.1|  PREDICTED: beta-galactosidase 2 isoform X1       53.9    3e-06   
ref|XP_010504030.1|  PREDICTED: beta-galactosidase 2-like             53.9    3e-06   
gb|KCW69753.1|  hypothetical protein EUGRSUZ_F031302                  53.9    3e-06   
ref|XP_006587007.1|  PREDICTED: beta-galactosidase-like               53.9    3e-06   
ref|XP_009132166.1|  PREDICTED: beta-galactosidase 4                  53.9    3e-06   
ref|XP_009760187.1|  PREDICTED: beta-galactosidase-like isoform X4    53.9    3e-06   
emb|CDY11899.1|  BnaC03g13250D                                        53.9    3e-06   
ref|XP_009760186.1|  PREDICTED: beta-galactosidase-like isoform X3    53.9    3e-06   
ref|XP_009611028.1|  PREDICTED: beta-galactosidase-like isoform X2    53.9    3e-06   
gb|KDP33829.1|  hypothetical protein JCGZ_07400                       53.9    3e-06   
ref|XP_009760185.1|  PREDICTED: beta-galactosidase-like isoform X2    53.9    3e-06   
ref|XP_009611026.1|  PREDICTED: beta-galactosidase-like isoform X1    53.9    3e-06   
ref|XP_010426910.1|  PREDICTED: beta-galactosidase 2-like             53.9    3e-06   
gb|KCW69752.1|  hypothetical protein EUGRSUZ_F031302                  53.9    3e-06   
ref|XP_009760184.1|  PREDICTED: beta-galactosidase-like isoform X1    53.9    3e-06   
ref|XP_009757671.1|  PREDICTED: beta-galactosidase-like isoform X2    53.9    3e-06   
ref|XP_009757670.1|  PREDICTED: beta-galactosidase-like isoform X1    53.9    3e-06   
gb|ABR16628.1|  unknown                                               53.9    3e-06   
gb|KFK27244.1|  hypothetical protein AALP_AA8G356800                  53.9    3e-06   
gb|AIU34464.1|  putative beta-galactosidase 1 precursor               53.5    3e-06   
emb|CDY32919.1|  BnaC02g12030D                                        53.9    3e-06   
ref|XP_008358406.1|  PREDICTED: beta-galactosidase 8-like             53.9    3e-06   
emb|CDX89360.1|  BnaA01g15330D                                        53.5    3e-06   
ref|XP_008447606.1|  PREDICTED: beta-galactosidase 1                  53.9    4e-06   
ref|XP_004146823.1|  PREDICTED: beta-galactosidase 1-like             53.5    4e-06   
gb|ABY82047.1|  beta-galactosidase                                    50.8    4e-06   
dbj|BAD94489.1|  beta-galactosidase                                   50.8    4e-06   
emb|CDX88594.1|  BnaA03g10550D                                        52.4    4e-06   
ref|XP_011089316.1|  PREDICTED: beta-galactosidase 8-like             53.5    4e-06   
ref|XP_002308268.2|  hypothetical protein POPTR_0006s14680g           53.5    5e-06   
ref|XP_011045966.1|  PREDICTED: beta-galactosidase-like isoform X2    53.5    5e-06   
gb|KGN59822.1|  hypothetical protein Csa_3G848310                     53.1    5e-06   



>gb|EYU24087.1| hypothetical protein MIMGU_mgv1a001258mg [Erythranthe guttata]
Length=851

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG PNHERPVQDLAFAVA+FIQKGGSF+NYYM
Sbjct  266  FTEFGGPNHERPVQDLAFAVARFIQKGGSFINYYM  300



>gb|KHN36067.1| Beta-galactosidase 3 [Glycine soja]
Length=849

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 32/35 (91%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            FSEFG PNHERPVQDLAF VA+FIQKGGSFVNYYM
Sbjct  263  FSEFGGPNHERPVQDLAFGVARFIQKGGSFVNYYM  297



>ref|XP_003538867.1| PREDICTED: beta-galactosidase 3-like [Glycine max]
Length=853

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 32/35 (91%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            FSEFG PNHERPVQDLAF VA+FIQKGGSFVNYYM
Sbjct  263  FSEFGGPNHERPVQDLAFGVARFIQKGGSFVNYYM  297



>ref|XP_003517202.1| PREDICTED: beta-galactosidase 3-like [Glycine max]
Length=849

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 32/35 (91%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            FSEFG PNHERPVQDLAF VA+FIQKGGSFVNYYM
Sbjct  263  FSEFGGPNHERPVQDLAFGVARFIQKGGSFVNYYM  297



>gb|KHN41933.1| Beta-galactosidase 3 [Glycine soja]
Length=862

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 32/35 (91%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            FSEFG PNHERPVQDLAF VA+FIQKGGSFVNYYM
Sbjct  272  FSEFGGPNHERPVQDLAFGVARFIQKGGSFVNYYM  306



>ref|XP_011100972.1| PREDICTED: beta-galactosidase 3-like [Sesamum indicum]
Length=848

 Score = 73.2 bits (178),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P HERPVQDLAFAVA+FIQ+GGSFVNYYM
Sbjct  259  FTEFGGPTHERPVQDLAFAVARFIQRGGSFVNYYM  293



>gb|KDP32675.1| hypothetical protein JCGZ_13673 [Jatropha curcas]
Length=790

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            FSEFG P H+RPVQDLAFAVA+FIQKGGSFVNYYM
Sbjct  202  FSEFGGPIHQRPVQDLAFAVARFIQKGGSFVNYYM  236



>gb|EPS70273.1| beta-galactosidase, partial [Genlisea aurea]
Length=634

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P HERPVQDLAFAVA+FIQKGGSFVNYYM
Sbjct  248  FTEFGGPIHERPVQDLAFAVARFIQKGGSFVNYYM  282



>ref|XP_010679814.1| PREDICTED: beta-galactosidase 3 [Beta vulgaris subsp. vulgaris]
Length=853

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG PNH+RPVQDLAF+VA+FIQ GGSFVNYYM
Sbjct  254  FTEFGGPNHQRPVQDLAFSVARFIQTGGSFVNYYM  288



>gb|KFK30264.1| hypothetical protein AALP_AA7G238600 [Arabis alpina]
Length=849

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P H+RPVQDLAFAVA+FIQKGGSFVNYYM
Sbjct  257  FTEFGGPMHKRPVQDLAFAVARFIQKGGSFVNYYM  291



>ref|XP_006412011.1| hypothetical protein EUTSA_v10024387mg [Eutrema salsugineum]
 gb|ESQ53464.1| hypothetical protein EUTSA_v10024387mg [Eutrema salsugineum]
Length=856

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 30/35 (86%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P H RPVQDLAFAVA+FIQKGGSFVNYYM
Sbjct  264  FTEFGGPMHHRPVQDLAFAVARFIQKGGSFVNYYM  298



>dbj|BAJ34544.1| unnamed protein product [Thellungiella halophila]
Length=856

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 30/35 (86%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P H RPVQDLAFAVA+FIQKGGSFVNYYM
Sbjct  264  FTEFGGPMHHRPVQDLAFAVARFIQKGGSFVNYYM  298



>emb|CDX69219.1| BnaC01g02340D [Brassica napus]
Length=824

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 30/35 (86%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P H RPVQDLAFAVA+FIQKGGSFVNYYM
Sbjct  261  FTEFGGPMHHRPVQDLAFAVARFIQKGGSFVNYYM  295



>ref|XP_010437358.1| PREDICTED: beta-galactosidase 3-like [Camelina sativa]
Length=856

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 30/35 (86%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P H RPVQDLAFAVA+FIQKGGSFVNYYM
Sbjct  264  FTEFGGPMHRRPVQDLAFAVARFIQKGGSFVNYYM  298



>emb|CDX75569.1| BnaA01g01330D [Brassica napus]
Length=827

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 30/35 (86%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P H RPVQDLAFAVA+FIQKGGSFVNYYM
Sbjct  264  FTEFGGPMHHRPVQDLAFAVARFIQKGGSFVNYYM  298



>ref|XP_010432182.1| PREDICTED: beta-galactosidase 3-like [Camelina sativa]
Length=856

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 30/35 (86%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P H RPVQDLAFAVA+FIQKGGSFVNYYM
Sbjct  264  FTEFGGPMHRRPVQDLAFAVARFIQKGGSFVNYYM  298



>emb|CDY59693.1| BnaC07g51120D [Brassica napus]
Length=856

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 30/35 (86%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P H RPVQDLAFAVA+FIQKGGSFVNYYM
Sbjct  264  FTEFGGPMHHRPVQDLAFAVARFIQKGGSFVNYYM  298



>ref|XP_010446807.1| PREDICTED: beta-galactosidase 3 [Camelina sativa]
Length=856

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 30/35 (86%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P H RPVQDLAFAVA+FIQKGGSFVNYYM
Sbjct  264  FTEFGGPMHRRPVQDLAFAVARFIQKGGSFVNYYM  298



>ref|XP_010649088.1| PREDICTED: beta-galactosidase 3 [Vitis vinifera]
 emb|CBI17431.3| unnamed protein product [Vitis vinifera]
Length=845

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P H+RPVQDLAFAVA+FIQKGGSFVNYYM
Sbjct  259  FNEFGGPLHQRPVQDLAFAVARFIQKGGSFVNYYM  293



>ref|XP_009145073.1| PREDICTED: beta-galactosidase 3 [Brassica rapa]
Length=856

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 30/35 (86%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P H RPVQDLAFAVA+FIQKGGSFVNYYM
Sbjct  264  FTEFGGPMHHRPVQDLAFAVARFIQKGGSFVNYYM  298



>ref|XP_006283101.1| hypothetical protein CARUB_v10004117mg [Capsella rubella]
 gb|EOA15999.1| hypothetical protein CARUB_v10004117mg [Capsella rubella]
Length=856

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 30/35 (86%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P H RPVQDLAFAVA+FIQKGGSFVNYYM
Sbjct  264  FTEFGGPMHHRPVQDLAFAVARFIQKGGSFVNYYM  298



>gb|KHG20819.1| Beta-galactosidase 3 [Gossypium arboreum]
Length=526

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            FS+FG PN++RPV+DLAFAVA+FIQKGGSFVNYYM
Sbjct  54   FSDFGGPNYQRPVEDLAFAVARFIQKGGSFVNYYM  88



>ref|XP_003612092.1| Beta-galactosidase [Medicago truncatula]
 gb|AES95050.1| beta-galactosidase [Medicago truncatula]
Length=843

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            FSEFG P H+RPVQDLAFAVA+FIQKGGSFVNYYM
Sbjct  257  FSEFGGPIHKRPVQDLAFAVARFIQKGGSFVNYYM  291



>gb|ADO34791.1| beta-galactosidase STBG6 [Solanum lycopersicum]
Length=845

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            FSEFG P H+RPVQDLAFAVA+FIQ+GGSFVNYYM
Sbjct  259  FSEFGGPLHQRPVQDLAFAVAQFIQRGGSFVNYYM  293



>ref|XP_008241765.1| PREDICTED: beta-galactosidase 3 [Prunus mume]
Length=853

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            FSEFG P H+RPVQDLA+AVA+FIQKGGSFVNYYM
Sbjct  259  FSEFGGPIHQRPVQDLAYAVARFIQKGGSFVNYYM  293



>ref|NP_001234317.1| TBG6 protein precursor [Solanum lycopersicum]
 gb|AAF70825.1|AF154424_1 putative beta-galactosidase [Solanum lycopersicum]
Length=845

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            FSEFG P H+RPVQDLAFAVA+FIQ+GGSFVNYYM
Sbjct  259  FSEFGGPLHQRPVQDLAFAVAQFIQRGGSFVNYYM  293



>ref|XP_006340680.1| PREDICTED: beta-galactosidase 3-like [Solanum tuberosum]
Length=845

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            FSEFG P H+RPVQDLAFAVA+FIQ+GGSFVNYYM
Sbjct  259  FSEFGGPLHQRPVQDLAFAVAQFIQRGGSFVNYYM  293



>ref|XP_007204246.1| hypothetical protein PRUPE_ppa002271mg [Prunus persica]
 gb|EMJ05445.1| hypothetical protein PRUPE_ppa002271mg [Prunus persica]
Length=693

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            FSEFG P H+RPVQDLA+AVA+FIQKGGSFVNYYM
Sbjct  259  FSEFGGPIHQRPVQDLAYAVARFIQKGGSFVNYYM  293



>gb|AAW47739.1| beta-galactosidase [Prunus persica]
Length=853

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            FSEFG P H+RPVQDLA+AVA+FIQKGGSFVNYYM
Sbjct  259  FSEFGGPIHQRPVQDLAYAVARFIQKGGSFVNYYM  293



>ref|XP_010531064.1| PREDICTED: beta-galactosidase 3 [Tarenaya hassleriana]
Length=855

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P H+RPVQDLAFAVA+FIQKGGSFVNYYM
Sbjct  263  FTEFGGPIHQRPVQDLAFAVARFIQKGGSFVNYYM  297



>ref|XP_006283100.1| hypothetical protein CARUB_v10004117mg [Capsella rubella]
 gb|EOA15998.1| hypothetical protein CARUB_v10004117mg [Capsella rubella]
Length=813

 Score = 70.5 bits (171),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 30/35 (86%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P H RPVQDLAFAVA+FIQKGGSFVNYYM
Sbjct  264  FTEFGGPMHHRPVQDLAFAVARFIQKGGSFVNYYM  298



>ref|XP_010672619.1| PREDICTED: beta-galactosidase 5 [Beta vulgaris subsp. vulgaris]
Length=837

 Score = 70.5 bits (171),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            FSEFG PNHERPV+DLA AVA+FIQ GGS+VNYYM
Sbjct  260  FSEFGGPNHERPVEDLALAVARFIQTGGSYVNYYM  294



>ref|XP_004158882.1| PREDICTED: beta-galactosidase 3-like [Cucumis sativus]
Length=854

 Score = 70.5 bits (171),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P H+RPVQDLAFAVA+FIQKGGSF+NYYM
Sbjct  260  FNEFGGPIHQRPVQDLAFAVARFIQKGGSFINYYM  294



>ref|XP_008337843.1| PREDICTED: beta-galactosidase 3 [Malus domestica]
 ref|XP_008363095.1| PREDICTED: beta-galactosidase 3-like [Malus domestica]
Length=853

 Score = 70.5 bits (171),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P H+RPVQDLA+AVA+FIQKGGSFVNYYM
Sbjct  259  FTEFGGPIHQRPVQDLAYAVARFIQKGGSFVNYYM  293



>ref|XP_008440778.1| PREDICTED: beta-galactosidase 3 [Cucumis melo]
Length=854

 Score = 70.5 bits (171),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P H+RPVQDLAFAVA+FIQKGGSF+NYYM
Sbjct  260  FNEFGGPIHQRPVQDLAFAVARFIQKGGSFINYYM  294



>ref|XP_009418404.1| PREDICTED: beta-galactosidase 5-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=860

 Score = 70.1 bits (170),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFGSP H RPV+DLAFAVA+FIQKGGSF+NYYM
Sbjct  257  FTEFGSPIHHRPVEDLAFAVARFIQKGGSFINYYM  291



>ref|XP_009418405.1| PREDICTED: beta-galactosidase 5-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=847

 Score = 70.1 bits (170),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFGSP H RPV+DLAFAVA+FIQKGGSF+NYYM
Sbjct  257  FTEFGSPIHHRPVEDLAFAVARFIQKGGSFINYYM  291



>gb|AEM72517.1| beta-galactosidase [Diospyros kaki]
Length=172

 Score = 67.0 bits (162),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = -1

Query  129  AARFSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            +  F+EFG P HERPVQDLAFAVA+FIQKGGSF NYYM
Sbjct  130  SGWFTEFGGPIHERPVQDLAFAVARFIQKGGSFFNYYM  167



>ref|XP_010029731.1| PREDICTED: beta-galactosidase 3 [Eucalyptus grandis]
 gb|KCW56689.1| hypothetical protein EUGRSUZ_I02384 [Eucalyptus grandis]
Length=849

 Score = 70.1 bits (170),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG  +HERPVQDLAFA+A+FIQKGGSF+NYYM
Sbjct  261  FTEFGGTHHERPVQDLAFAIARFIQKGGSFINYYM  295



>ref|XP_004287850.1| PREDICTED: beta-galactosidase 3-like [Fragaria vesca subsp. vesca]
Length=853

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P H+RPVQDLA+AVA+FIQKGGSFVNYYM
Sbjct  259  FTEFGGPIHQRPVQDLAYAVARFIQKGGSFVNYYM  293



>gb|KHG20820.1| Beta-galactosidase 3 [Gossypium arboreum]
Length=660

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            FS+FG PN++RPV+DLAFAVA+FIQKGGSFVNYYM
Sbjct  188  FSDFGGPNYQRPVEDLAFAVARFIQKGGSFVNYYM  222



>emb|CDP01954.1| unnamed protein product [Coffea canephora]
Length=851

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P H+RPVQDLAFAVA+FIQKGGSF+NYYM
Sbjct  259  FTEFGGPVHQRPVQDLAFAVARFIQKGGSFLNYYM  293



>ref|XP_002867020.1| hypothetical protein ARALYDRAFT_491000 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43279.1| hypothetical protein ARALYDRAFT_491000 [Arabidopsis lyrata subsp. 
lyrata]
Length=853

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P H RPVQDLAF VA+FIQKGGSFVNYYM
Sbjct  261  FTEFGGPMHHRPVQDLAFGVARFIQKGGSFVNYYM  295



>ref|XP_006412010.1| hypothetical protein EUTSA_v10024387mg [Eutrema salsugineum]
 gb|ESQ53463.1| hypothetical protein EUTSA_v10024387mg [Eutrema salsugineum]
Length=626

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 30/35 (86%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P H RPVQDLAFAVA+FIQKGGSFVNYYM
Sbjct  264  FTEFGGPMHHRPVQDLAFAVARFIQKGGSFVNYYM  298



>ref|NP_849506.1| beta-galactosidase 3 [Arabidopsis thaliana]
 gb|AEE86647.1| beta-galactosidase 3 [Arabidopsis thaliana]
Length=855

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P H RPVQDLAF VA+FIQKGGSFVNYYM
Sbjct  264  FTEFGGPMHHRPVQDLAFGVARFIQKGGSFVNYYM  298



>ref|NP_568001.1| beta-galactosidase 3 [Arabidopsis thaliana]
 sp|Q9SCV9.1|BGAL3_ARATH RecName: Full=Beta-galactosidase 3; Short=Lactase 3; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAB64739.1| putative beta-galactosidase [Arabidopsis thaliana]
 gb|AAL07134.1| putative beta-galactosidase [Arabidopsis thaliana]
 gb|AAM14371.1| putative beta-galactosidase [Arabidopsis thaliana]
 gb|AEE86646.1| beta-galactosidase 3 [Arabidopsis thaliana]
Length=856

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P H RPVQDLAF VA+FIQKGGSFVNYYM
Sbjct  264  FTEFGGPMHHRPVQDLAFGVARFIQKGGSFVNYYM  298



>emb|CAB16852.1| beta-galactosidase like protein [Arabidopsis thaliana]
 emb|CAB80302.1| beta-galactosidase like protein [Arabidopsis thaliana]
Length=853

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P H RPVQDLAF VA+FIQKGGSFVNYYM
Sbjct  261  FTEFGGPMHHRPVQDLAFGVARFIQKGGSFVNYYM  295



>ref|XP_007158612.1| hypothetical protein PHAVU_002G1672000g, partial [Phaseolus vulgaris]
 gb|ESW30606.1| hypothetical protein PHAVU_002G1672000g, partial [Phaseolus vulgaris]
Length=365

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            FSEFG   HERPVQDLAFAVA+FIQKGGSFVNYYM
Sbjct  262  FSEFGGSIHERPVQDLAFAVARFIQKGGSFVNYYM  296



>ref|XP_011025878.1| PREDICTED: beta-galactosidase 3 [Populus euphratica]
Length=847

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/35 (86%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            FSEFG   H+RPVQDLAFAVAKFIQKGGSF+NYYM
Sbjct  260  FSEFGGTIHQRPVQDLAFAVAKFIQKGGSFINYYM  294



>emb|CAA18137.1| beta-galactosidase like protein [Arabidopsis thaliana]
Length=853

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P H RPVQDLAF VA+FIQKGGSFVNYYM
Sbjct  264  FTEFGGPMHHRPVQDLAFGVARFIQKGGSFVNYYM  298



>ref|XP_002310279.2| beta-galactosidase family protein [Populus trichocarpa]
 gb|EEE90729.2| beta-galactosidase family protein [Populus trichocarpa]
Length=847

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/35 (86%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            FSEFG   H+RPVQDLAFAVAKFIQKGGSF+NYYM
Sbjct  260  FSEFGGTIHQRPVQDLAFAVAKFIQKGGSFINYYM  294



>ref|XP_009628690.1| PREDICTED: beta-galactosidase 3 [Nicotiana tomentosiformis]
Length=844

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            FSEFGS  H+RPVQDLAFAVA+FIQ+GGSFVNYYM
Sbjct  259  FSEFGSTLHQRPVQDLAFAVAQFIQRGGSFVNYYM  293



>gb|KDO71052.1| hypothetical protein CISIN_1g003044mg [Citrus sinensis]
Length=854

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P H+RPVQDLAFA A+FIQKGGSF+NYYM
Sbjct  259  FTEFGGPIHQRPVQDLAFAAARFIQKGGSFINYYM  293



>ref|XP_006425593.1| hypothetical protein CICLE_v10024881mg [Citrus clementina]
 ref|XP_006466876.1| PREDICTED: beta-galactosidase 3-like [Citrus sinensis]
 gb|ESR38833.1| hypothetical protein CICLE_v10024881mg [Citrus clementina]
Length=854

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P H+RPVQDLAFA A+FIQKGGSF+NYYM
Sbjct  259  FTEFGGPIHQRPVQDLAFAAARFIQKGGSFINYYM  293



>ref|XP_008338023.1| PREDICTED: beta-galactosidase 3-like [Malus domestica]
 ref|XP_008367947.1| PREDICTED: beta-galactosidase 3-like [Malus domestica]
Length=853

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P H+RPVQDLA+AVA FIQKGGSFVNYYM
Sbjct  259  FTEFGGPIHQRPVQDLAYAVATFIQKGGSFVNYYM  293



>ref|XP_004149980.1| PREDICTED: beta-galactosidase 3-like [Cucumis sativus]
Length=854

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P H+RPVQDLAFAVA FIQKGGSF+NYYM
Sbjct  260  FNEFGGPIHQRPVQDLAFAVALFIQKGGSFINYYM  294



>gb|KGN48881.1| hypothetical protein Csa_6G504610 [Cucumis sativus]
Length=750

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P H+RPVQDLAFAVA FIQKGGSF+NYYM
Sbjct  212  FNEFGGPIHQRPVQDLAFAVALFIQKGGSFINYYM  246



>dbj|BAD91082.1| beta-D-galactosidase [Pyrus pyrifolia]
Length=854

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P H+RPVQDLA+AVA FIQKGGSFVNYYM
Sbjct  259  FTEFGGPIHQRPVQDLAYAVATFIQKGGSFVNYYM  293



>ref|XP_006380782.1| hypothetical protein POPTR_0007s13540g [Populus trichocarpa]
 gb|ERP58579.1| hypothetical protein POPTR_0007s13540g [Populus trichocarpa]
Length=626

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 30/35 (86%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            FSEFG   H+RPVQDLAFAVAKFIQKGGSF+NYYM
Sbjct  260  FSEFGGTIHQRPVQDLAFAVAKFIQKGGSFINYYM  294



>gb|KDO71053.1| hypothetical protein CISIN_1g003044mg [Citrus sinensis]
Length=816

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P H+RPVQDLAFA A+FIQKGGSF+NYYM
Sbjct  259  FTEFGGPIHQRPVQDLAFAAARFIQKGGSFINYYM  293



>gb|KDO71054.1| hypothetical protein CISIN_1g003044mg [Citrus sinensis]
Length=626

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P H+RPVQDLAFA A+FIQKGGSF+NYYM
Sbjct  259  FTEFGGPIHQRPVQDLAFAAARFIQKGGSFINYYM  293



>gb|KEH36209.1| beta-galactosidase-like protein [Medicago truncatula]
Length=733

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F++FG P H+RPVQDLAFAVA+FIQKGGS+VNYYM
Sbjct  259  FTDFGGPIHQRPVQDLAFAVARFIQKGGSYVNYYM  293



>gb|KDP38567.1| hypothetical protein JCGZ_04492 [Jatropha curcas]
Length=853

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P H+RPVQDLAFAVA+FIQ GGS+VNYYM
Sbjct  259  FTEFGGPIHQRPVQDLAFAVARFIQNGGSYVNYYM  293



>ref|XP_011083163.1| PREDICTED: beta-galactosidase 3 [Sesamum indicum]
Length=845

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P H+RPV+DLAF+VA+F+QKGGSFVNYYM
Sbjct  260  FTEFGGPVHQRPVEDLAFSVARFLQKGGSFVNYYM  294



>ref|XP_002305449.1| beta-galactosidase family protein [Populus trichocarpa]
 gb|EEE85960.1| beta-galactosidase family protein [Populus trichocarpa]
Length=731

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F++FG PNH+RP +DLAFAVA+FIQKGGS VNYYM
Sbjct  259  FTDFGGPNHQRPAEDLAFAVARFIQKGGSLVNYYM  293



>ref|XP_011037170.1| PREDICTED: beta-galactosidase 5-like [Populus euphratica]
Length=789

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F++FG PNH+RP +DLAFAVA+FIQKGGS VNYYM
Sbjct  317  FTDFGGPNHQRPAEDLAFAVARFIQKGGSLVNYYM  351



>gb|KHG23756.1| Beta-galactosidase 5 -like protein [Gossypium arboreum]
Length=741

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P H+RPVQDLAF VA+FIQKGGS+VNYYM
Sbjct  259  FTEFGGPIHQRPVQDLAFGVARFIQKGGSYVNYYM  293



>ref|XP_002512959.1| beta-galactosidase, putative [Ricinus communis]
 gb|EEF49462.1| beta-galactosidase, putative [Ricinus communis]
Length=732

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F++FG P H+RPV+DLAFAVA+FIQKGGSFVNYYM
Sbjct  259  FTDFGGPIHQRPVEDLAFAVARFIQKGGSFVNYYM  293



>ref|XP_004146490.1| PREDICTED: beta-galactosidase 3-like [Cucumis sativus]
 ref|XP_004160975.1| PREDICTED: beta-galactosidase 3-like [Cucumis sativus]
Length=846

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            FSEFG P H+RPVQDLAFAVA+FIQ+GGS VNYYM
Sbjct  258  FSEFGGPLHQRPVQDLAFAVARFIQRGGSLVNYYM  292



>gb|EYU42595.1| hypothetical protein MIMGU_mgv1a001990mg [Erythranthe guttata]
Length=729

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F EFG P H RPV+DLAFAVA+FIQKGGSFVNYYM
Sbjct  257  FEEFGGPIHHRPVEDLAFAVARFIQKGGSFVNYYM  291



>ref|XP_004166954.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase 3-like, partial 
[Cucumis sativus]
Length=635

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 28/37 (76%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -1

Query  126  ARFSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            A F+ FG PNH+RPV+DLAF VA+FIQKGGS VNYYM
Sbjct  46   AWFNNFGGPNHKRPVEDLAFGVARFIQKGGSLVNYYM  82



>ref|XP_004512085.1| PREDICTED: beta-galactosidase 3-like [Cicer arietinum]
Length=847

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = -1

Query  129  AARFSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            +  FSEFG P H+RPVQDLAFAV +FIQKGGSFVNYYM
Sbjct  254  SGWFSEFGGPIHQRPVQDLAFAVGRFIQKGGSFVNYYM  291



>gb|KHG11061.1| Beta-galactosidase 5 -like protein [Gossypium arboreum]
Length=734

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P H RPVQDLAFAVA+FIQKGG+F+NYYM
Sbjct  259  FTEFGGPIHRRPVQDLAFAVARFIQKGGTFINYYM  293



>ref|XP_008452119.1| PREDICTED: beta-galactosidase 3-like [Cucumis melo]
Length=846

 Score = 67.8 bits (164),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            FSEFG P H+RPVQDLAFAVA+FIQ+GGS VNYYM
Sbjct  258  FSEFGGPLHQRPVQDLAFAVARFIQRGGSLVNYYM  292



>ref|XP_009789452.1| PREDICTED: beta-galactosidase 3 [Nicotiana sylvestris]
Length=844

 Score = 67.8 bits (164),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            FSEFG   H+RPVQDLAFAVA+FIQ+GGSFVNYYM
Sbjct  259  FSEFGGTLHQRPVQDLAFAVAQFIQRGGSFVNYYM  293



>ref|XP_003523710.1| PREDICTED: beta-galactosidase 3-like isoform 1 [Glycine max]
Length=736

 Score = 67.4 bits (163),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P H+RPV+DL+FAVA+FIQKGGS+VNYYM
Sbjct  259  FTEFGGPIHQRPVEDLSFAVARFIQKGGSYVNYYM  293



>gb|KHN45883.1| Beta-galactosidase 5 [Glycine soja]
Length=727

 Score = 67.4 bits (163),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P H+RPV+DL+FAVA+FIQKGGS+VNYYM
Sbjct  259  FTEFGGPIHQRPVEDLSFAVARFIQKGGSYVNYYM  293



>ref|XP_010107841.1| Beta-galactosidase 3 [Morus notabilis]
 gb|EXC17241.1| Beta-galactosidase 3 [Morus notabilis]
Length=860

 Score = 67.4 bits (163),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+E+G P ++RPVQDLAFAVA+FIQKGGSFVNYYM
Sbjct  260  FTEYGGPIYQRPVQDLAFAVARFIQKGGSFVNYYM  294



>dbj|BAF31234.1| beta-D-galactosidase [Persea americana]
Length=849

 Score = 67.0 bits (162),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG   HERPV+DLAFAVA+FIQKGGSF+NYYM
Sbjct  261  FTEFGGTVHERPVEDLAFAVARFIQKGGSFINYYM  295



>ref|XP_007046794.1| Beta-galactosidase 3 isoform 1 [Theobroma cacao]
 gb|EOX90951.1| Beta-galactosidase 3 isoform 1 [Theobroma cacao]
Length=854

 Score = 67.0 bits (162),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P H RP +DLAFAVA+FIQKGGSFVNYYM
Sbjct  259  FTEFGGPLHHRPAEDLAFAVARFIQKGGSFVNYYM  293



>ref|XP_010113483.1| Beta-galactosidase 3 [Morus notabilis]
 gb|EXC35510.1| Beta-galactosidase 3 [Morus notabilis]
Length=847

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P H RPVQDLAFAV +FIQ+GGSFVNYYM
Sbjct  258  FNEFGGPLHHRPVQDLAFAVTRFIQRGGSFVNYYM  292



>ref|XP_004150073.1| PREDICTED: beta-galactosidase 3-like [Cucumis sativus]
 gb|KGN61834.1| hypothetical protein Csa_2G249880 [Cucumis sativus]
Length=848

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/37 (76%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -1

Query  126  ARFSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            A F+ FG PNH+RPV+DLAF VA+FIQKGGS VNYYM
Sbjct  259  AWFNNFGGPNHKRPVEDLAFGVARFIQKGGSLVNYYM  295



>ref|XP_007046795.1| Beta-galactosidase 3 isoform 2 [Theobroma cacao]
 gb|EOX90952.1| Beta-galactosidase 3 isoform 2 [Theobroma cacao]
Length=702

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P H RP +DLAFAVA+FIQKGGSFVNYYM
Sbjct  259  FTEFGGPLHHRPAEDLAFAVARFIQKGGSFVNYYM  293



>ref|XP_002510455.1| beta-galactosidase, putative [Ricinus communis]
 gb|EEF52642.1| beta-galactosidase, putative [Ricinus communis]
Length=846

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P H+RPV+DLAFAVA+FIQKGGS+ NYYM
Sbjct  259  FTEFGGPIHQRPVEDLAFAVARFIQKGGSYFNYYM  293



>ref|XP_008382310.1| PREDICTED: beta-galactosidase 5-like [Malus domestica]
Length=848

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P ++RPV+DLAFAVA+FIQKGGSF+NYYM
Sbjct  262  FTEFGGPIYQRPVEDLAFAVARFIQKGGSFINYYM  296



>ref|XP_004509327.1| PREDICTED: beta-galactosidase 3-like [Cicer arietinum]
Length=851

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P H+RPVQDLAFAVA+F+ +GGSFVNYYM
Sbjct  259  FTEFGGPIHKRPVQDLAFAVARFVTRGGSFVNYYM  293



>gb|AGR44464.1| beta-D-galactosidase 5, partial [Pyrus x bretschneideri]
Length=697

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  117  SEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            +EFG P H+RPVQDLA+AVA FIQKGGSFVNYYM
Sbjct  103  TEFGGPIHQRPVQDLAYAVATFIQKGGSFVNYYM  136



>ref|XP_009372992.1| PREDICTED: beta-galactosidase 3-like [Pyrus x bretschneideri]
Length=788

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P ++RPV+DLAFAVA+FIQKGGSF+NYYM
Sbjct  202  FTEFGGPIYQRPVEDLAFAVARFIQKGGSFINYYM  236



>emb|CDO97013.1| unnamed protein product [Coffea canephora]
Length=730

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F +FG P H RPV+DLAFAVA+FIQKGGSFVNYYM
Sbjct  259  FEDFGGPVHHRPVEDLAFAVARFIQKGGSFVNYYM  293



>ref|XP_011092826.1| PREDICTED: beta-galactosidase 3 [Sesamum indicum]
Length=732

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F EFG P H RPV+DLAFAVA+F+QKGGSF+NYYM
Sbjct  260  FEEFGGPIHHRPVEDLAFAVARFVQKGGSFINYYM  294



>gb|AAF67342.1| beta galactosidase [Vigna radiata]
Length=739

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P ++RPVQDLAFAVA+FIQKGGS++NYYM
Sbjct  259  FTEFGGPIYQRPVQDLAFAVARFIQKGGSYINYYM  293



>ref|XP_006423393.1| hypothetical protein CICLE_v10030257mg, partial [Citrus clementina]
 gb|ESR36633.1| hypothetical protein CICLE_v10030257mg, partial [Citrus clementina]
Length=728

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            FS+FG  N++RPV+DLAFAVA+FIQKGGSFVNYYM
Sbjct  258  FSDFGGQNYQRPVEDLAFAVARFIQKGGSFVNYYM  292



>ref|XP_002306893.1| beta-galactosidase family protein [Populus trichocarpa]
 gb|EEE93889.1| beta-galactosidase family protein [Populus trichocarpa]
Length=853

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG   H RPVQDLAFAVA+FIQKGGSFVNYYM
Sbjct  259  FTEFGGAFHHRPVQDLAFAVARFIQKGGSFVNYYM  293



>gb|KHN27041.1| Beta-galactosidase 3 [Glycine soja]
Length=848

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P H+RPVQDLAFAVA+FI +GGSFVNYYM
Sbjct  258  FTEFGGPIHKRPVQDLAFAVARFIIRGGSFVNYYM  292



>ref|XP_003548865.1| PREDICTED: beta-galactosidase 3-like [Glycine max]
Length=848

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P H+RPVQDLAFAVA+FI +GGSFVNYYM
Sbjct  258  FTEFGGPIHKRPVQDLAFAVARFIIRGGSFVNYYM  292



>gb|AIZ46896.1| beta-galactosidase, partial [Dendrobium hybrid cultivar]
Length=473

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG   H+RPV+DLAFAVA+FIQKGGSFVNYYM
Sbjct  81   FTEFGGTVHQRPVEDLAFAVARFIQKGGSFVNYYM  115



>ref|XP_011048837.1| PREDICTED: beta-galactosidase 5 [Populus euphratica]
Length=853

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG   H RPVQDLAFAVA+FIQKGGSFVNYYM
Sbjct  259  FTEFGGAFHHRPVQDLAFAVARFIQKGGSFVNYYM  293



>ref|XP_007042085.1| Beta-galactosidase 3 isoform 3 [Theobroma cacao]
 gb|EOX97916.1| Beta-galactosidase 3 isoform 3 [Theobroma cacao]
Length=580

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            FS+FG PN+ RPV+DLA AVA+FIQKGGSFVNYYM
Sbjct  108  FSDFGGPNYLRPVEDLALAVARFIQKGGSFVNYYM  142



>ref|XP_006435077.1| hypothetical protein CICLE_v10000260mg [Citrus clementina]
 gb|ESR48317.1| hypothetical protein CICLE_v10000260mg [Citrus clementina]
Length=644

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG   H RPVQDLAFAVA+FIQKGGSF NYYM
Sbjct  54   FTEFGGAVHRRPVQDLAFAVARFIQKGGSFFNYYM  88



>ref|XP_007042086.1| Beta-galactosidase 3 isoform 4 [Theobroma cacao]
 gb|EOX97917.1| Beta-galactosidase 3 isoform 4 [Theobroma cacao]
Length=548

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            FS+FG PN+ RPV+DLA AVA+FIQKGGSFVNYYM
Sbjct  108  FSDFGGPNYLRPVEDLALAVARFIQKGGSFVNYYM  142



>ref|XP_007136038.1| hypothetical protein PHAVU_009G012700g [Phaseolus vulgaris]
 gb|ESW08032.1| hypothetical protein PHAVU_009G012700g [Phaseolus vulgaris]
Length=738

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F++FG P H+RPVQDL+FAVA+FIQ+GGS+VNYYM
Sbjct  261  FTDFGGPIHQRPVQDLSFAVARFIQQGGSYVNYYM  295



>gb|KDO84694.1| hypothetical protein CISIN_1g003076mg [Citrus sinensis]
Length=644

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG   H RPVQDLAFAVA+FIQKGGSF NYYM
Sbjct  54   FTEFGGAVHRRPVQDLAFAVARFIQKGGSFFNYYM  88



>ref|XP_007160714.1| hypothetical protein PHAVU_001G010900g [Phaseolus vulgaris]
 gb|ESW32708.1| hypothetical protein PHAVU_001G010900g [Phaseolus vulgaris]
Length=739

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P ++RPVQDLAFAVA+FIQKGGS++NYYM
Sbjct  259  FTEFGGPIYQRPVQDLAFAVARFIQKGGSYINYYM  293



>gb|KHN00504.1| Beta-galactosidase 3 [Glycine soja]
Length=848

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P H+RPVQDLAFAVA+FI +GGSFVNYYM
Sbjct  258  FTEFGGPIHKRPVQDLAFAVARFIIRGGSFVNYYM  292



>gb|KDP41747.1| hypothetical protein JCGZ_26765 [Jatropha curcas]
Length=673

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F++FG P H+RP +DLAFAVA+FIQKGGSFVNYYM
Sbjct  202  FNDFGGPVHQRPAEDLAFAVARFIQKGGSFVNYYM  236



>ref|XP_006487343.1| PREDICTED: beta-galactosidase 3-like [Citrus sinensis]
Length=719

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            FS+FG  N++RPV+DLAFAVA+FIQKGGSFVNYYM
Sbjct  258  FSDFGGQNYQRPVEDLAFAVARFIQKGGSFVNYYM  292



>ref|XP_010254673.1| PREDICTED: beta-galactosidase 3-like [Nelumbo nucifera]
Length=853

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG   H+RPVQDLA AVA+FIQKGGSFVNYYM
Sbjct  258  FTEFGGTVHQRPVQDLALAVARFIQKGGSFVNYYM  292



>gb|KHF97862.1| Beta-galactosidase 3 [Gossypium arboreum]
 gb|KHF97863.1| Beta-galactosidase 3 [Gossypium arboreum]
Length=515

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            FSEFG P H RP +DLAFAVA+FIQKGGSFVNYYM
Sbjct  259  FSEFGGPLHHRPAEDLAFAVARFIQKGGSFVNYYM  293



>gb|KDO84693.1| hypothetical protein CISIN_1g003076mg [Citrus sinensis]
Length=698

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG   H RPVQDLAFAVA+FIQKGGSF NYYM
Sbjct  108  FTEFGGAVHRRPVQDLAFAVARFIQKGGSFFNYYM  142



>ref|XP_011083609.1| PREDICTED: beta-galactosidase 3-like [Sesamum indicum]
Length=845

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P  +RPVQDLAFAVA+FIQKGGSF+NYYM
Sbjct  259  FTEFGGPILQRPVQDLAFAVARFIQKGGSFINYYM  293



>ref|XP_006435076.1| hypothetical protein CICLE_v10000260mg [Citrus clementina]
 gb|ESR48316.1| hypothetical protein CICLE_v10000260mg [Citrus clementina]
Length=850

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG   H RPVQDLAFAVA+FIQKGGSF NYYM
Sbjct  260  FTEFGGAVHRRPVQDLAFAVARFIQKGGSFFNYYM  294



>gb|KDO84688.1| hypothetical protein CISIN_1g003076mg [Citrus sinensis]
Length=850

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG   H RPVQDLAFAVA+FIQKGGSF NYYM
Sbjct  260  FTEFGGAVHRRPVQDLAFAVARFIQKGGSFFNYYM  294



>ref|XP_008377189.1| PREDICTED: beta-galactosidase 5-like [Malus domestica]
Length=852

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG   H RPVQDLAFAVA+FIQ+GGSFVNYYM
Sbjct  261  FTEFGGTIHHRPVQDLAFAVARFIQRGGSFVNYYM  295



>gb|KDO84691.1| hypothetical protein CISIN_1g003076mg [Citrus sinensis]
Length=731

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG   H RPVQDLAFAVA+FIQKGGSF NYYM
Sbjct  260  FTEFGGAVHRRPVQDLAFAVARFIQKGGSFFNYYM  294



>ref|XP_010917686.1| PREDICTED: beta-galactosidase 5-like [Elaeis guineensis]
Length=849

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG   H+RPV+DLAFAVA+FIQKGGSF+NYYM
Sbjct  259  FTEFGGTVHQRPVEDLAFAVARFIQKGGSFINYYM  293



>gb|KDO84690.1| hypothetical protein CISIN_1g003076mg [Citrus sinensis]
Length=809

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG   H RPVQDLAFAVA+FIQKGGSF NYYM
Sbjct  260  FTEFGGAVHRRPVQDLAFAVARFIQKGGSFFNYYM  294



>ref|XP_008236954.1| PREDICTED: beta-galactosidase 3-like [Prunus mume]
Length=844

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P ++RPV+DLAFAVA FIQKGGSFVNYYM
Sbjct  260  FTEFGGPVYQRPVEDLAFAVAGFIQKGGSFVNYYM  294



>gb|KDO84689.1| hypothetical protein CISIN_1g003076mg [Citrus sinensis]
Length=805

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG   H RPVQDLAFAVA+FIQKGGSF NYYM
Sbjct  260  FTEFGGAVHRRPVQDLAFAVARFIQKGGSFFNYYM  294



>ref|XP_006473573.1| PREDICTED: beta-galactosidase 3-like [Citrus sinensis]
Length=850

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG   H RPVQDLAFAVA+FIQKGGSF NYYM
Sbjct  260  FTEFGGTVHRRPVQDLAFAVARFIQKGGSFFNYYM  294



>ref|XP_007042083.1| Beta-galactosidase 3 isoform 1 [Theobroma cacao]
 gb|EOX97914.1| Beta-galactosidase 3 isoform 1 [Theobroma cacao]
Length=730

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            FS+FG PN+ RPV+DLA AVA+FIQKGGSFVNYYM
Sbjct  258  FSDFGGPNYLRPVEDLALAVARFIQKGGSFVNYYM  292



>ref|XP_007199661.1| hypothetical protein PRUPE_ppa001363mg [Prunus persica]
 gb|EMJ00860.1| hypothetical protein PRUPE_ppa001363mg [Prunus persica]
Length=844

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P ++RPV+DLAFAVA FIQKGGSFVNYYM
Sbjct  260  FTEFGGPVYQRPVEDLAFAVAGFIQKGGSFVNYYM  294



>ref|XP_007042087.1| Beta-galactosidase 3 isoform 5, partial [Theobroma cacao]
 gb|EOX97918.1| Beta-galactosidase 3 isoform 5, partial [Theobroma cacao]
Length=592

 Score = 65.1 bits (157),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            FS+FG PN+ RPV+DLA AVA+FIQKGGSFVNYYM
Sbjct  231  FSDFGGPNYLRPVEDLALAVARFIQKGGSFVNYYM  265



>ref|XP_010275526.1| PREDICTED: beta-galactosidase 3-like [Nelumbo nucifera]
Length=853

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG   H+RPVQDLAFAVA+FIQ GGSFVNYYM
Sbjct  258  FTEFGGTVHQRPVQDLAFAVARFIQNGGSFVNYYM  292



>ref|XP_007042084.1| Beta-galactosidase 3 isoform 2 [Theobroma cacao]
 gb|EOX97915.1| Beta-galactosidase 3 isoform 2 [Theobroma cacao]
Length=627

 Score = 65.1 bits (157),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            FS+FG PN+ RPV+DLA AVA+FIQKGGSFVNYYM
Sbjct  258  FSDFGGPNYLRPVEDLALAVARFIQKGGSFVNYYM  292



>dbj|BAD91085.1| beta-D-galactosidase [Pyrus pyrifolia]
Length=848

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P ++RPV+DL FAVA+FIQKGGSF+NYYM
Sbjct  262  FTEFGGPIYQRPVEDLTFAVARFIQKGGSFINYYM  296



>ref|XP_008460995.1| PREDICTED: beta-galactosidase 5-like [Cucumis melo]
Length=845

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  126  ARFSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            A F+ FG PNH+RPV+DLAF VA+FIQ GGS VNYYM
Sbjct  256  AWFNTFGGPNHKRPVEDLAFGVARFIQTGGSLVNYYM  292



>gb|EYU31167.1| hypothetical protein MIMGU_mgv1a001956mg [Erythranthe guttata]
Length=734

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P H+RPV+DLAF+VAKF++ GGSFVNYYM
Sbjct  261  FTEFGGPIHQRPVEDLAFSVAKFVRNGGSFVNYYM  295



>gb|KDO84692.1| hypothetical protein CISIN_1g003076mg [Citrus sinensis]
Length=637

 Score = 64.7 bits (156),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG   H RPVQDLAFAVA+FIQKGGSF NYYM
Sbjct  260  FTEFGGAVHRRPVQDLAFAVARFIQKGGSFFNYYM  294



>ref|XP_007156097.1| hypothetical protein PHAVU_003G258300g [Phaseolus vulgaris]
 gb|ESW28091.1| hypothetical protein PHAVU_003G258300g [Phaseolus vulgaris]
Length=847

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P H+RPVQDLAFA A+FI +GGSFVNYYM
Sbjct  257  FTEFGGPIHQRPVQDLAFAAARFIIRGGSFVNYYM  291



>ref|XP_006362025.1| PREDICTED: beta-galactosidase 3-like [Solanum tuberosum]
Length=727

 Score = 64.7 bits (156),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F +FG P H RPV+DLAFAVA+FIQKGGS VNYYM
Sbjct  256  FDDFGGPVHHRPVEDLAFAVARFIQKGGSLVNYYM  290



>ref|XP_009395554.1| PREDICTED: beta-galactosidase 5 [Musa acuminata subsp. malaccensis]
Length=842

 Score = 64.7 bits (156),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG   H RPV+DLAFAVA+FIQKGGSF+NYYM
Sbjct  252  FTEFGGTIHHRPVEDLAFAVARFIQKGGSFINYYM  286



>ref|XP_010552493.1| PREDICTED: beta-galactosidase 5 [Tarenaya hassleriana]
Length=731

 Score = 64.7 bits (156),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P  +RPV+DLAFAVA+FIQKGGS+VNYYM
Sbjct  259  FTEFGGPKVKRPVEDLAFAVARFIQKGGSYVNYYM  293



>gb|KDO49473.1| hypothetical protein CISIN_1g0051602mg, partial [Citrus sinensis]
Length=416

 Score = 63.9 bits (154),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            FS+FG  N++RPV+DLAFAVA+FIQKGGSFVNYYM
Sbjct  258  FSDFGGQNYQRPVEDLAFAVARFIQKGGSFVNYYM  292



>gb|ADD62393.1| beta-galactosidase 3 [Prunus persica]
Length=683

 Score = 64.7 bits (156),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG   H RPVQDLAF+VA+FIQKGGS++NYYM
Sbjct  92   FTEFGGTIHHRPVQDLAFSVARFIQKGGSYINYYM  126



>ref|XP_003520277.1| PREDICTED: beta-galactosidase 3-like [Glycine max]
Length=848

 Score = 64.7 bits (156),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P H+RPVQDLAFA A+FI +GGSFVNYYM
Sbjct  258  FTEFGGPIHKRPVQDLAFAAARFIIRGGSFVNYYM  292



>ref|XP_009777047.1| PREDICTED: beta-galactosidase 3-like [Nicotiana sylvestris]
Length=726

 Score = 64.7 bits (156),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F +FG P H RPV+DLAFAVA+FIQKGGS VNYYM
Sbjct  254  FDDFGGPVHHRPVEDLAFAVARFIQKGGSLVNYYM  288



>ref|XP_010315322.1| PREDICTED: beta-galactosidase 3-like [Solanum lycopersicum]
Length=727

 Score = 64.7 bits (156),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F +FG P H RPV+DLAFAVA+FIQKGGS VNYYM
Sbjct  256  FDDFGGPVHHRPVEDLAFAVARFIQKGGSLVNYYM  290



>ref|XP_010110010.1| Beta-galactosidase 3 [Morus notabilis]
 gb|EXC25028.1| Beta-galactosidase 3 [Morus notabilis]
Length=821

 Score = 64.7 bits (156),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            FSEFG  N +RPV+DLAF+VA+FIQKGGSF+NYYM
Sbjct  259  FSEFGGANPQRPVEDLAFSVARFIQKGGSFINYYM  293



>ref|NP_001265904.1| beta-galactosidase 5-like precursor [Cicer arietinum]
 emb|CAA10128.1| beta-galactosidase [Cicer arietinum]
Length=745

 Score = 64.3 bits (155),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            FSEFG P  +RP QDLAFAVA+FIQKGGSF NYYM
Sbjct  259  FSEFGGPVPQRPAQDLAFAVARFIQKGGSFFNYYM  293



>gb|AEC33272.1| beta-galactosidase [Ziziphus jujuba]
Length=730

 Score = 64.3 bits (155),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG   H+RPVQDLAFAVA+FIQKGGS+ NYYM
Sbjct  133  FTEFGGTVHQRPVQDLAFAVARFIQKGGSYFNYYM  167



>ref|XP_009614464.1| PREDICTED: beta-galactosidase 3-like [Nicotiana tomentosiformis]
Length=727

 Score = 64.3 bits (155),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F +FG P H RPV+DLAFAVA+F+QKGGS VNYYM
Sbjct  255  FDDFGGPVHHRPVEDLAFAVARFVQKGGSLVNYYM  289



>ref|XP_007225291.1| hypothetical protein PRUPE_ppa001334mg [Prunus persica]
 gb|EMJ26490.1| hypothetical protein PRUPE_ppa001334mg [Prunus persica]
Length=851

 Score = 64.3 bits (155),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG   H RPVQDLAF+VA+FIQKGGS++NYYM
Sbjct  260  FTEFGGTIHHRPVQDLAFSVARFIQKGGSYINYYM  294



>ref|XP_008221339.1| PREDICTED: beta-galactosidase 5 [Prunus mume]
Length=851

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG   H RPVQDLAF+VA+FIQKGGS++NYYM
Sbjct  260  FTEFGGTIHHRPVQDLAFSVARFIQKGGSYINYYM  294



>ref|XP_009388558.1| PREDICTED: beta-galactosidase-like [Musa acuminata subsp. malaccensis]
Length=738

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 28/37 (76%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -1

Query  126  ARFSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            A ++ FG P  ERPV+DLAFAVA+FIQKGGSFVNYYM
Sbjct  272  AWYTAFGGPVPERPVEDLAFAVARFIQKGGSFVNYYM  308



>ref|XP_004500969.1| PREDICTED: beta-galactosidase 5-like isoform X1 [Cicer arietinum]
Length=732

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F++FG P  +RPVQDLAFAVA+F+QKGGS+VNYYM
Sbjct  257  FTDFGGPIPQRPVQDLAFAVARFVQKGGSYVNYYM  291



>ref|XP_004501212.1| PREDICTED: beta-galactosidase 5-like [Cicer arietinum]
Length=428

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F++FG P  +RPVQDLAFAVA+F+QKGGS+VNYYM
Sbjct  225  FTDFGGPIPQRPVQDLAFAVARFVQKGGSYVNYYM  259



>ref|XP_009335672.1| PREDICTED: beta-galactosidase 5 [Pyrus x bretschneideri]
Length=852

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG   H RPVQDLAFAV +FIQKGGS+VNYYM
Sbjct  261  FTEFGGTIHHRPVQDLAFAVGRFIQKGGSYVNYYM  295



>ref|XP_007017651.1| Beta-galactosidase 5 isoform 1 [Theobroma cacao]
 gb|EOY14876.1| Beta-galactosidase 5 isoform 1 [Theobroma cacao]
Length=760

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG   H+RPVQDLAFAVA+FIQ GGS++NYYM
Sbjct  291  FTEFGGTIHQRPVQDLAFAVARFIQNGGSYINYYM  325



>ref|XP_007017652.1| Beta-galactosidase 5 isoform 2 [Theobroma cacao]
 gb|EOY14877.1| Beta-galactosidase 5 isoform 2 [Theobroma cacao]
Length=671

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG   H+RPVQDLAFAVA+FIQ GGS++NYYM
Sbjct  202  FTEFGGTIHQRPVQDLAFAVARFIQNGGSYINYYM  236



>ref|XP_010939579.1| PREDICTED: beta-galactosidase 2-like [Elaeis guineensis]
Length=833

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 28/37 (76%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -1

Query  126  ARFSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            A ++ FGSP   RPV+DLAFAVA+FIQKGGSFVNYYM
Sbjct  261  AWYTAFGSPVPHRPVEDLAFAVARFIQKGGSFVNYYM  297



>gb|KHN12675.1| Beta-galactosidase 5 [Glycine soja]
Length=732

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P ++RPVQDLAFAVA+F+QKGGS  NYYM
Sbjct  259  FTEFGGPIYQRPVQDLAFAVARFVQKGGSLFNYYM  293



>ref|XP_008388000.1| PREDICTED: beta-galactosidase 5 [Malus domestica]
Length=852

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG   H RPVQDLAFAV +FIQKGGS+VNYYM
Sbjct  261  FTEFGGTIHHRPVQDLAFAVGRFIQKGGSYVNYYM  295



>ref|XP_009409593.1| PREDICTED: beta-galactosidase-like [Musa acuminata subsp. malaccensis]
Length=712

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            FS FG+P   RPV+DLAFAVA+FIQKGGSFVNYYM
Sbjct  247  FSAFGAPVPHRPVEDLAFAVARFIQKGGSFVNYYM  281



>ref|XP_004500970.1| PREDICTED: beta-galactosidase 5-like isoform X2 [Cicer arietinum]
Length=627

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F++FG P  +RPVQDLAFAVA+F+QKGGS+VNYYM
Sbjct  257  FTDFGGPIPQRPVQDLAFAVARFVQKGGSYVNYYM  291



>gb|KHN20946.1| Beta-galactosidase 5 [Glycine soja]
Length=732

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P ++RPVQDLAFAVA+F+QKGGS  NYYM
Sbjct  259  FTEFGGPIYQRPVQDLAFAVARFVQKGGSLFNYYM  293



>ref|XP_010061261.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase 5 [Eucalyptus 
grandis]
Length=730

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG    ERPV+DLAFAVA+FIQKGGSFVNYYM
Sbjct  260  FTEFGGTIPERPVEDLAFAVARFIQKGGSFVNYYM  294



>ref|XP_007017653.1| Beta-galactosidase 5 isoform 3 [Theobroma cacao]
 gb|EOY14878.1| Beta-galactosidase 5 isoform 3 [Theobroma cacao]
Length=551

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG   H+RPVQDLAFAVA+FIQ GGS++NYYM
Sbjct  202  FTEFGGTIHQRPVQDLAFAVARFIQNGGSYINYYM  236



>gb|KCW68186.1| hypothetical protein EUGRSUZ_F01855 [Eucalyptus grandis]
Length=692

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG    ERPV+DLAFAVA+FIQKGGSFVNYYM
Sbjct  222  FTEFGGTIPERPVEDLAFAVARFIQKGGSFVNYYM  256



>gb|AGR44466.1| beta-D-galactosidase 7 [Pyrus x bretschneideri]
Length=852

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG   H RPVQDLAFAVA+FI++GGS+VNYYM
Sbjct  261  FTEFGGTIHHRPVQDLAFAVARFIERGGSYVNYYM  295



>emb|CAD44190.1| putative beta-galactosidase [Mangifera indica]
 emb|CAD44191.1| putative beta-galactosidase [Mangifera indica]
Length=286

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P ++RPV+DLAFAVA+FIQ GGSFVNYYM
Sbjct  137  FTEFGGPIYQRPVEDLAFAVARFIQAGGSFVNYYM  171



>ref|XP_008775429.1| PREDICTED: beta-galactosidase 2-like [Phoenix dactylifera]
Length=832

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/37 (76%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  126  ARFSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            A ++ FG P   RPVQDLAFAVA+FIQKGGSFVNYYM
Sbjct  261  AWYTAFGGPVPHRPVQDLAFAVARFIQKGGSFVNYYM  297



>gb|EYU32887.1| hypothetical protein MIMGU_mgv1a001295mg [Erythranthe guttata]
Length=845

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG   H+RPVQDLAFAVA+FIQ GGS++NYYM
Sbjct  260  FNEFGGTVHQRPVQDLAFAVARFIQIGGSYINYYM  294



>dbj|BAD91084.1| beta-D-galactosidase [Pyrus pyrifolia]
Length=852

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F EFG   H RPVQDLAFAVA+FIQ+GGS+VNYYM
Sbjct  261  FLEFGGTIHHRPVQDLAFAVARFIQRGGSYVNYYM  295



>gb|KDO65276.1| hypothetical protein CISIN_1g002867mg [Citrus sinensis]
Length=618

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            ++EFG P   RPV+DLAF+VAKFIQKGGSF+NYYM
Sbjct  37   YTEFGGPVPHRPVEDLAFSVAKFIQKGGSFINYYM  71



>emb|CBI19767.3| unnamed protein product [Vitis vinifera]
Length=854

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG   H RPVQDLAF VA+FIQ GGSFVNYYM
Sbjct  260  FTEFGGTIHRRPVQDLAFGVARFIQNGGSFVNYYM  294



>emb|CAN78072.1| hypothetical protein VITISV_013292 [Vitis vinifera]
Length=854

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG   H RPVQDLAF VA+FIQ GGSFVNYYM
Sbjct  260  FTEFGGTIHRRPVQDLAFGVARFIQNGGSFVNYYM  294



>ref|NP_001268162.1| beta-galactosidase BG1-like precursor [Vitis vinifera]
 gb|AAK81874.1| putative beta-galactosidase BG1 [Vitis vinifera]
Length=854

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG   H RPVQDLAF VA+FIQ GGSFVNYYM
Sbjct  260  FTEFGGTIHRRPVQDLAFGVARFIQNGGSFVNYYM  294



>ref|XP_006826783.1| hypothetical protein AMTR_s00136p00108810 [Amborella trichopoda]
 gb|ERM94020.1| hypothetical protein AMTR_s00136p00108810 [Amborella trichopoda]
Length=755

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            ++EFG P   RP QD+AFAVA+FIQKGGSFVNYYM
Sbjct  174  YTEFGGPVPHRPAQDMAFAVARFIQKGGSFVNYYM  208



>gb|KDO65275.1| hypothetical protein CISIN_1g002867mg [Citrus sinensis]
Length=872

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            ++EFG P   RPV+DLAF+VAKFIQKGGSF+NYYM
Sbjct  264  YTEFGGPVPHRPVEDLAFSVAKFIQKGGSFINYYM  298



>ref|XP_008799994.1| PREDICTED: beta-galactosidase 5-like [Phoenix dactylifera]
Length=845

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG    +RPV+DLAFAVA+FIQKGGSF+NYYM
Sbjct  255  FTEFGGTVRQRPVEDLAFAVARFIQKGGSFINYYM  289



>ref|XP_010066194.1| PREDICTED: beta-galactosidase 5-like isoform X3 [Eucalyptus grandis]
Length=699

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F++FG P ++RPV+DLAFAVA+FIQKGGS +NYYM
Sbjct  260  FTDFGGPVYQRPVEDLAFAVARFIQKGGSLINYYM  294



>ref|XP_008809207.1| PREDICTED: beta-galactosidase 5-like [Phoenix dactylifera]
Length=852

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG    +RPV+DLAFAVA+FIQKGGSF+NYYM
Sbjct  262  FTEFGGTVRQRPVEDLAFAVARFIQKGGSFINYYM  296



>ref|XP_010066193.1| PREDICTED: beta-galactosidase 5-like isoform X2 [Eucalyptus grandis]
 gb|KCW64026.1| hypothetical protein EUGRSUZ_G01704 [Eucalyptus grandis]
Length=733

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F++FG P ++RPV+DLAFAVA+FIQKGGS +NYYM
Sbjct  260  FTDFGGPVYQRPVEDLAFAVARFIQKGGSLINYYM  294



>ref|XP_010066191.1| PREDICTED: beta-galactosidase 5-like isoform X1 [Eucalyptus grandis]
 ref|XP_010066192.1| PREDICTED: beta-galactosidase 5-like isoform X1 [Eucalyptus grandis]
Length=737

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F++FG P ++RPV+DLAFAVA+FIQKGGS +NYYM
Sbjct  260  FTDFGGPVYQRPVEDLAFAVARFIQKGGSLINYYM  294



>gb|KDO65274.1| hypothetical protein CISIN_1g002867mg [Citrus sinensis]
Length=845

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            ++EFG P   RPV+DLAF+VAKFIQKGGSF+NYYM
Sbjct  264  YTEFGGPVPHRPVEDLAFSVAKFIQKGGSFINYYM  298



>ref|XP_006466038.1| PREDICTED: beta-galactosidase 1-like [Citrus sinensis]
Length=845

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            ++EFG P   RPV+DLAF+VAKFIQKGGSF+NYYM
Sbjct  264  YTEFGGPVPHRPVEDLAFSVAKFIQKGGSFINYYM  298



>ref|XP_009409594.1| PREDICTED: beta-galactosidase-like [Musa acuminata subsp. malaccensis]
Length=735

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+ FG P   RPVQDLAFAVA+FIQKGGSFVNYYM
Sbjct  271  FTGFGGPVPHRPVQDLAFAVARFIQKGGSFVNYYM  305



>gb|KDO65278.1| hypothetical protein CISIN_1g002867mg [Citrus sinensis]
Length=697

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            ++EFG P   RPV+DLAF+VAKFIQKGGSF+NYYM
Sbjct  264  YTEFGGPVPHRPVEDLAFSVAKFIQKGGSFINYYM  298



>ref|XP_006426535.1| hypothetical protein CICLE_v10024886mg [Citrus clementina]
 gb|ESR39775.1| hypothetical protein CICLE_v10024886mg [Citrus clementina]
Length=845

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            ++EFG P   RPV+DLAF+VAKFIQKGGSF+NYYM
Sbjct  264  YTEFGGPVPHRPVEDLAFSVAKFIQKGGSFINYYM  298



>ref|XP_006426534.1| hypothetical protein CICLE_v10024886mg [Citrus clementina]
 gb|ESR39774.1| hypothetical protein CICLE_v10024886mg [Citrus clementina]
Length=846

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            ++EFG P   RPV+DLAF+VAKFIQKGGSF+NYYM
Sbjct  264  YTEFGGPVPHRPVEDLAFSVAKFIQKGGSFINYYM  298



>ref|XP_004292017.1| PREDICTED: beta-galactosidase 3-like [Fragaria vesca subsp. vesca]
Length=829

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P ++RPV+DLAF VA+FIQ GGSF+NYYM
Sbjct  245  FTEFGGPIYKRPVEDLAFGVARFIQNGGSFINYYM  279



>gb|KDO65277.1| hypothetical protein CISIN_1g002867mg [Citrus sinensis]
Length=815

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            ++EFG P   RPV+DLAF+VAKFIQKGGSF+NYYM
Sbjct  264  YTEFGGPVPHRPVEDLAFSVAKFIQKGGSFINYYM  298



>ref|XP_002465807.1| hypothetical protein SORBIDRAFT_01g046160 [Sorghum bicolor]
 gb|EER92805.1| hypothetical protein SORBIDRAFT_01g046160 [Sorghum bicolor]
Length=842

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG    +RPV+DLAFAVA+F+QKGGSF+NYYM
Sbjct  258  FTEFGGTIRQRPVEDLAFAVARFVQKGGSFINYYM  292



>ref|XP_008643999.1| PREDICTED: uncharacterized protein LOC100382452 isoform X1 [Zea 
mays]
 tpg|DAA43552.1| TPA: hypothetical protein ZEAMMB73_935084 [Zea mays]
Length=845

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG    +RPV+DLAFAVA+F+QKGGSF+NYYM
Sbjct  260  FTEFGGTIRQRPVEDLAFAVARFVQKGGSFINYYM  294



>ref|XP_008660537.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase 5-like [Zea 
mays]
Length=842

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG    +RPV+DLAFAVA+F+QKGGSF+NYYM
Sbjct  258  FTEFGGTIRQRPVEDLAFAVARFVQKGGSFINYYM  292



>ref|XP_010915228.1| PREDICTED: beta-galactosidase isoform X1 [Elaeis guineensis]
Length=841

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+ FG P   RPV+DLAFAVA+FIQKGGSFVNYYM
Sbjct  266  FTAFGGPVPRRPVEDLAFAVARFIQKGGSFVNYYM  300



>ref|XP_009402923.1| PREDICTED: beta-galactosidase-like [Musa acuminata subsp. malaccensis]
Length=733

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+ FGSP   RPV+DL FAVA+FIQKGGSFVNYYM
Sbjct  269  FTAFGSPVPHRPVEDLTFAVARFIQKGGSFVNYYM  303



>gb|AFW89719.1| hypothetical protein ZEAMMB73_400203 [Zea mays]
Length=809

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG    +RPV+DLAFAVA+F+QKGGSF+NYYM
Sbjct  272  FTEFGGTIRQRPVEDLAFAVARFVQKGGSFINYYM  306



>ref|NP_001168664.1| uncharacterized protein LOC100382452 [Zea mays]
 gb|ACN29095.1| unknown [Zea mays]
Length=815

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG    +RPV+DLAFAVA+F+QKGGSF+NYYM
Sbjct  230  FTEFGGTIRQRPVEDLAFAVARFVQKGGSFINYYM  264



>ref|XP_010915229.1| PREDICTED: beta-galactosidase isoform X2 [Elaeis guineensis]
Length=836

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+ FG P   RPV+DLAFAVA+FIQKGGSFVNYYM
Sbjct  266  FTAFGGPVPRRPVEDLAFAVARFIQKGGSFVNYYM  300



>ref|XP_009407297.1| PREDICTED: beta-galactosidase 2 [Musa acuminata subsp. malaccensis]
Length=836

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 28/37 (76%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -1

Query  126  ARFSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            A F+ FG P   RPV+DLAFAV KFIQKGGSFVNYYM
Sbjct  264  AWFTGFGGPVPHRPVEDLAFAVTKFIQKGGSFVNYYM  300



>ref|XP_004985588.1| PREDICTED: beta-galactosidase 5-like isoform X1 [Setaria italica]
Length=841

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG    +RPV+DLAFAVA+F+QKGGSF+NYYM
Sbjct  258  FTEFGGTIRQRPVEDLAFAVARFVQKGGSFINYYM  292



>ref|XP_004147848.1| PREDICTED: beta-galactosidase 3-like [Cucumis sativus]
 ref|XP_004154857.1| PREDICTED: beta-galactosidase 3-like [Cucumis sativus]
Length=844

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P + RPVQDLAFAVA+F+QKGGS  NYYM
Sbjct  260  FTEFGGPVYGRPVQDLAFAVARFVQKGGSLFNYYM  294



>gb|KEH40195.1| beta-like galactosidase [Medicago truncatula]
Length=687

 Score = 62.0 bits (149),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 36/46 (78%), Gaps = 2/46 (4%)
 Frame = -1

Query  153  LYNSSFVDAARFSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            L+  S+  +  FSEFG  N +RPV+DLAFAVA+FIQKGGSF NYYM
Sbjct  193  LWTESW--SGWFSEFGGSNPQRPVEDLAFAVARFIQKGGSFFNYYM  236



>gb|EYU45851.1| hypothetical protein MIMGU_mgv1a002308mg [Erythranthe guttata]
Length=689

 Score = 62.0 bits (149),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P   RP +DLAF+VAKFIQKGGSF+NYYM
Sbjct  108  FTEFGGPVPYRPAEDLAFSVAKFIQKGGSFINYYM  142



>ref|XP_003589339.1| Beta-galactosidase [Medicago truncatula]
 gb|AES59590.1| beta-like galactosidase [Medicago truncatula]
Length=745

 Score = 62.0 bits (149),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 36/46 (78%), Gaps = 2/46 (4%)
 Frame = -1

Query  153  LYNSSFVDAARFSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            L+  S+  +  FSEFG  N +RPV+DLAFAVA+FIQKGGSF NYYM
Sbjct  251  LWTESW--SGWFSEFGGSNPQRPVEDLAFAVARFIQKGGSFFNYYM  294



>tpg|DAA43551.1| TPA: beta-galactosidase [Zea mays]
Length=897

 Score = 62.4 bits (150),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG    +RPV+DLAFAVA+F+QKGGSF+NYYM
Sbjct  312  FTEFGGTIRQRPVEDLAFAVARFVQKGGSFINYYM  346



>ref|XP_008466519.1| PREDICTED: beta-galactosidase 5-like [Cucumis melo]
Length=844

 Score = 62.0 bits (149),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P + RPVQDLAFAVA+F+QKGGS  NYYM
Sbjct  260  FTEFGGPVYGRPVQDLAFAVARFVQKGGSLFNYYM  294



>ref|XP_010262131.1| PREDICTED: beta-galactosidase isoform X1 [Nelumbo nucifera]
Length=847

 Score = 62.0 bits (149),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            ++EFG P   RP +DLAF+VAKFIQKGGSFVNYYM
Sbjct  263  YTEFGGPVPHRPAEDLAFSVAKFIQKGGSFVNYYM  297



>ref|XP_004985589.1| PREDICTED: beta-galactosidase 5-like isoform X2 [Setaria italica]
Length=743

 Score = 62.0 bits (149),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG    +RPV+DLAFAVA+F+QKGGSF+NYYM
Sbjct  160  FTEFGGTIRQRPVEDLAFAVARFVQKGGSFINYYM  194



>ref|XP_010262132.1| PREDICTED: beta-galactosidase isoform X2 [Nelumbo nucifera]
Length=842

 Score = 62.0 bits (149),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            ++EFG P   RP +DLAF+VAKFIQKGGSFVNYYM
Sbjct  263  YTEFGGPVPHRPAEDLAFSVAKFIQKGGSFVNYYM  297



>ref|XP_009408846.1| PREDICTED: beta-galactosidase-like [Musa acuminata subsp. malaccensis]
Length=730

 Score = 62.0 bits (149),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+ FG P   RPV+DLAFAVA+FIQKGGSFVNYYM
Sbjct  266  FTAFGGPVPHRPVEDLAFAVARFIQKGGSFVNYYM  300



>ref|XP_004486826.1| PREDICTED: beta-galactosidase 1-like [Cicer arietinum]
Length=847

 Score = 62.0 bits (149),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P   RP +DLAF+VA+FIQKGGSFVNYYM
Sbjct  265  FTEFGGPVPHRPAEDLAFSVARFIQKGGSFVNYYM  299



>ref|XP_011072510.1| PREDICTED: beta-galactosidase-like [Sesamum indicum]
Length=842

 Score = 62.0 bits (149),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P   RPV+DLAF+VAKFIQKGGS++NYYM
Sbjct  262  FTEFGGPVPYRPVEDLAFSVAKFIQKGGSYINYYM  296



>ref|XP_003543598.1| PREDICTED: beta-galactosidase 1-like [Glycine max]
Length=841

 Score = 62.0 bits (149),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P   RP +DLAF+VA+FIQKGGSF+NYYM
Sbjct  261  FTEFGGPVPHRPAEDLAFSVARFIQKGGSFINYYM  295



>ref|XP_006838689.1| hypothetical protein AMTR_s00002p00246870 [Amborella trichopoda]
 gb|ERN01258.1| hypothetical protein AMTR_s00002p00246870 [Amborella trichopoda]
Length=843

 Score = 62.0 bits (149),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG    ERPVQDLA++VA+F+QKGGSFVNYYM
Sbjct  255  FTEFGGSVPERPVQDLAYSVARFVQKGGSFVNYYM  289



>ref|XP_004291830.1| PREDICTED: beta-galactosidase 5-like [Fragaria vesca subsp. vesca]
Length=730

 Score = 61.6 bits (148),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            FSEFG     RPVQDLAFAVA+FIQKGGS++NYYM
Sbjct  261  FSEFGGTVPHRPVQDLAFAVARFIQKGGSYINYYM  295



>gb|KHN30042.1| Beta-galactosidase 1 [Glycine soja]
Length=831

 Score = 61.6 bits (148),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P   RP +DLAF+VA+FIQKGGSF+NYYM
Sbjct  251  FTEFGGPVPHRPAEDLAFSVARFIQKGGSFINYYM  285



>ref|XP_008805774.1| PREDICTED: beta-galactosidase-like isoform X2 [Phoenix dactylifera]
Length=841

 Score = 61.6 bits (148),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+ FG P   RPV+DLAFAVA+FIQKGGSF+NYYM
Sbjct  265  FTAFGGPVPHRPVEDLAFAVARFIQKGGSFINYYM  299



>ref|XP_008805772.1| PREDICTED: beta-galactosidase-like isoform X1 [Phoenix dactylifera]
Length=846

 Score = 61.6 bits (148),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+ FG P   RPV+DLAFAVA+FIQKGGSF+NYYM
Sbjct  265  FTAFGGPVPHRPVEDLAFAVARFIQKGGSFINYYM  299



>ref|XP_009789773.1| PREDICTED: beta-galactosidase-like [Nicotiana sylvestris]
Length=842

 Score = 61.6 bits (148),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -1

Query  126  ARFSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            A F+EFG P   RPV+DLAF VAKFIQ GGSF+NYYM
Sbjct  260  AWFTEFGGPVPYRPVEDLAFGVAKFIQTGGSFINYYM  296



>ref|XP_010911412.1| PREDICTED: beta-galactosidase-like, partial [Elaeis guineensis]
Length=585

 Score = 61.6 bits (148),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+ FG P   RPV+DLAFAVA+FIQKGGSFVNYYM
Sbjct  271  FTAFGGPVPRRPVEDLAFAVARFIQKGGSFVNYYM  305



>ref|XP_010932916.1| PREDICTED: beta-galactosidase 5-like [Elaeis guineensis]
Length=845

 Score = 61.6 bits (148),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG    +RPV+DLAFAVA+F+QKGGSF+NYYM
Sbjct  255  FTEFGGTVRQRPVEDLAFAVARFLQKGGSFINYYM  289



>ref|XP_004966041.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase 9-like [Setaria 
italica]
Length=724

 Score = 61.6 bits (148),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+ FG P   RPV+DLAFAVA+FIQKGGSFVNYYM
Sbjct  260  FTAFGKPVPHRPVEDLAFAVARFIQKGGSFVNYYM  294



>ref|XP_003546676.1| PREDICTED: beta-galactosidase 1-like [Glycine max]
Length=840

 Score = 61.6 bits (148),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P   RP +DLAF+VA+FIQKGGSF+NYYM
Sbjct  260  FTEFGGPVPHRPAEDLAFSVARFIQKGGSFINYYM  294



>gb|ACC60981.1| beta-galactosidase 1 precursor [Petunia x hybrida]
Length=842

 Score = 61.6 bits (148),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -1

Query  126  ARFSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            A F+EFGSP   RPV+DLAF VA FIQ GGSF+NYYM
Sbjct  260  AWFTEFGSPVPYRPVEDLAFGVANFIQTGGSFINYYM  296



>gb|EYU21377.1| hypothetical protein MIMGU_mgv1a001631mg [Erythranthe guttata]
Length=782

 Score = 61.6 bits (148),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P   RP +DLAF+VAKFIQKGGSF+NYYM
Sbjct  202  FTEFGGPVPYRPAEDLAFSVAKFIQKGGSFINYYM  236



>ref|XP_009606115.1| PREDICTED: beta-galactosidase-like [Nicotiana tomentosiformis]
Length=844

 Score = 61.6 bits (148),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -1

Query  126  ARFSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            A F+EFG P   RPV+DLAF VAKFIQ GGSF+NYYM
Sbjct  262  AWFTEFGGPVPYRPVEDLAFGVAKFIQTGGSFINYYM  298



>ref|XP_004241849.1| PREDICTED: beta-galactosidase-like [Solanum lycopersicum]
Length=841

 Score = 61.6 bits (148),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -1

Query  126  ARFSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            A F+EFG P   RPV+DLAF VAKFIQ GGSF+NYYM
Sbjct  259  AWFTEFGGPIPYRPVEDLAFGVAKFIQNGGSFINYYM  295



>ref|XP_010106660.1| Beta-galactosidase 1 [Morus notabilis]
 gb|EXC11109.1| Beta-galactosidase 1 [Morus notabilis]
Length=845

 Score = 61.6 bits (148),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -1

Query  126  ARFSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            A ++EFG P  +RP +DLAFAVA+FIQKGG+F+NYYM
Sbjct  261  AWYTEFGGPVPKRPAEDLAFAVARFIQKGGAFINYYM  297



>gb|KGN59998.1| hypothetical protein Csa_3G865330 [Cucumis sativus]
Length=756

 Score = 61.6 bits (148),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P + RPVQDLAFAVA+F+QKGGS  NYYM
Sbjct  212  FTEFGGPVYGRPVQDLAFAVARFVQKGGSLFNYYM  246



>gb|KHN32687.1| Beta-galactosidase 1 [Glycine soja]
Length=831

 Score = 61.6 bits (148),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P   RP +DLAF+VA+FIQKGGSF+NYYM
Sbjct  251  FTEFGGPVPHRPAEDLAFSVARFIQKGGSFINYYM  285



>ref|XP_009603021.1| PREDICTED: beta-galactosidase 5 [Nicotiana tomentosiformis]
Length=729

 Score = 61.2 bits (147),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG     RPVQDLAFAVA+FIQKGGSFVNYYM
Sbjct  259  FTEFGGTIPMRPVQDLAFAVARFIQKGGSFVNYYM  293



>ref|XP_006357461.1| PREDICTED: beta-galactosidase-like, partial [Solanum tuberosum]
Length=866

 Score = 61.6 bits (148),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -1

Query  126  ARFSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            A F+EFG P   RPV+DLAF VAKFIQ GGSF+NYYM
Sbjct  284  AWFTEFGGPIPYRPVEDLAFGVAKFIQNGGSFINYYM  320



>ref|XP_002263382.2| PREDICTED: beta-galactosidase 3 [Vitis vinifera]
 emb|CBI38026.3| unnamed protein product [Vitis vinifera]
Length=846

 Score = 61.2 bits (147),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EF  P  +RPV+DL+FAV +FIQKGGSFVNYYM
Sbjct  258  FTEFAGPIQQRPVEDLSFAVTRFIQKGGSFVNYYM  292



>dbj|BAK05933.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=716

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+ FG P   RPV+D+AFAVA+FIQKGGSFVNYYM
Sbjct  254  FTAFGGPVPHRPVEDMAFAVARFIQKGGSFVNYYM  288



>gb|KCW64027.1| hypothetical protein EUGRSUZ_G01704 [Eucalyptus grandis]
Length=558

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F++FG P ++RPV+DLAFAVA+FIQKGGS +NYYM
Sbjct  260  FTDFGGPVYQRPVEDLAFAVARFIQKGGSLINYYM  294



>dbj|BAK07157.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=847

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG    +RPV+DL+FAVA+F+QKGGSF+NYYM
Sbjct  263  FTEFGGTIRKRPVEDLSFAVARFVQKGGSFINYYM  297



>dbj|BAJ96054.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=847

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG    +RPV+DL+FAVA+F+QKGGSF+NYYM
Sbjct  263  FTEFGGTIRKRPVEDLSFAVARFVQKGGSFINYYM  297



>ref|XP_006342225.1| PREDICTED: beta-galactosidase 3-like [Solanum tuberosum]
Length=729

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG     RPVQDLAFAVA+FIQKGGSFVNYYM
Sbjct  259  FTEFGGTIPMRPVQDLAFAVARFIQKGGSFVNYYM  293



>ref|XP_004238611.1| PREDICTED: beta-galactosidase 5 [Solanum lycopersicum]
Length=729

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFGS    RPVQDLAFAVA+FIQKGGSFVNYYM
Sbjct  259  FTEFGSTIPMRPVQDLAFAVARFIQKGGSFVNYYM  293



>ref|XP_006342989.1| PREDICTED: beta-galactosidase-like [Solanum tuberosum]
Length=838

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  126  ARFSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            A F+ FG+P   RP +DLAFAVAKFIQKGGSF+NYYM
Sbjct  256  AWFTGFGNPVPYRPAEDLAFAVAKFIQKGGSFINYYM  292



>gb|ADV41669.1| beta-D-galactosidase [Actinidia deliciosa var. deliciosa]
Length=728

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            ++EFG P H RPV+DLA++VA+FIQ  GSFVNYYM
Sbjct  260  YTEFGGPIHNRPVEDLAYSVARFIQNNGSFVNYYM  294



>gb|EMS60063.1| Beta-galactosidase 5 [Triticum urartu]
Length=860

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG    +RPV+DL+FAVA+F+QKGGSF+NYYM
Sbjct  227  FTEFGGTIRKRPVEDLSFAVARFVQKGGSFINYYM  261



>ref|XP_009783993.1| PREDICTED: beta-galactosidase [Nicotiana sylvestris]
Length=844

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -1

Query  126  ARFSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            A F+EFG P   RP +D+AFAVA+FIQ GGSFVNYYM
Sbjct  263  AWFTEFGGPVPYRPAEDMAFAVARFIQTGGSFVNYYM  299



>gb|EEE58382.1| hypothetical protein OsJ_09539 [Oryza sativa Japonica Group]
Length=851

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG    +RPV+DLAF VA+F+QKGGSF+NYYM
Sbjct  268  FTEFGGTIRQRPVEDLAFGVARFVQKGGSFINYYM  302



>gb|EEC74580.1| hypothetical protein OsI_10152 [Oryza sativa Indica Group]
Length=851

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG    +RPV+DLAF VA+F+QKGGSF+NYYM
Sbjct  268  FTEFGGTIRQRPVEDLAFGVARFVQKGGSFINYYM  302



>ref|XP_009627536.1| PREDICTED: beta-galactosidase [Nicotiana tomentosiformis]
Length=845

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -1

Query  126  ARFSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            A F+EFG P   RP +D+AFAVA+FIQ GGSFVNYYM
Sbjct  263  AWFTEFGGPVPYRPAEDMAFAVARFIQTGGSFVNYYM  299



>gb|EMT10014.1| Beta-galactosidase 5 [Aegilops tauschii]
Length=851

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG    +RPV+DL+FAVA+F+QKGGSF+NYYM
Sbjct  267  FTEFGGTIRKRPVEDLSFAVARFVQKGGSFINYYM  301



>ref|NP_001049068.1| Os03g0165400 [Oryza sativa Japonica Group]
 sp|Q10RB4.1|BGAL5_ORYSJ RecName: Full=Beta-galactosidase 5; Short=Lactase 5; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|ABF94149.1| Beta-galactosidase precursor, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF10982.1| Os03g0165400 [Oryza sativa Japonica Group]
 dbj|BAG95436.1| unnamed protein product [Oryza sativa Japonica Group]
Length=841

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG    +RPV+DLAF VA+F+QKGGSF+NYYM
Sbjct  258  FTEFGGTIRQRPVEDLAFGVARFVQKGGSFINYYM  292



>ref|XP_007150529.1| hypothetical protein PHAVU_005G160000g [Phaseolus vulgaris]
 gb|ESW22523.1| hypothetical protein PHAVU_005G160000g [Phaseolus vulgaris]
Length=837

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P   RP +DLAF+VA+F+QKGGSF+NYYM
Sbjct  257  FTEFGGPVPHRPAEDLAFSVARFLQKGGSFINYYM  291



>gb|AAM22973.1|AF499737_1 beta-galactosidase [Oryza sativa Japonica Group]
 gb|AAM34271.1|AF508799_1 beta-galactosidase [Oryza sativa Japonica Group]
Length=843

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG    +RPV+DLAF VA+F+QKGGSF+NYYM
Sbjct  258  FTEFGGTIRQRPVEDLAFGVARFVQKGGSFINYYM  292



>ref|XP_003597608.1| Beta-galactosidase [Medicago truncatula]
 gb|ABN08398.1| D-galactoside/L-rhamnose binding SUEL lectin; Galactose-binding 
like [Medicago truncatula]
 gb|AES67859.1| beta-galactosidase [Medicago truncatula]
Length=841

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG P   RP +D+AF+VA+FIQKGGSF+NYYM
Sbjct  259  FTEFGGPVPHRPAEDMAFSVARFIQKGGSFINYYM  293



>ref|XP_006649450.1| PREDICTED: beta-galactosidase 5-like [Oryza brachyantha]
Length=841

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG    +RPV+DLAF VA+F+QKGGSF+NYYM
Sbjct  258  FTEFGGTIRQRPVEDLAFGVARFVQKGGSFINYYM  292



>ref|XP_003558743.1| PREDICTED: beta-galactosidase 5 [Brachypodium distachyon]
Length=839

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG    +RPV+DL+FAVA+F+QKGGSF+NYYM
Sbjct  258  FTEFGGTIRKRPVEDLSFAVARFVQKGGSFINYYM  292



>gb|AGW47883.1| beta-galactosidase precursor [Nicotiana tabacum]
Length=841

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -1

Query  126  ARFSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            A F+EFG P   RP +D+AFAVA+FIQ GGSFVNYYM
Sbjct  259  AWFTEFGGPVPYRPAEDMAFAVARFIQTGGSFVNYYM  295



>gb|EEC70956.1| hypothetical protein OsI_02569 [Oryza sativa Indica Group]
Length=480

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -1

Query  126  ARFSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            A ++ FG P   RPV+DLA+ VAKFIQKGGSFVNYYM
Sbjct  106  AWYTGFGIPVPHRPVEDLAYGVAKFIQKGGSFVNYYM  142



>gb|ABF94150.1| Beta-galactosidase precursor, putative, expressed [Oryza sativa 
Japonica Group]
Length=819

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  120  FSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            F+EFG    +RPV+DLAF VA+F+QKGGSF+NYYM
Sbjct  258  FTEFGGTIRQRPVEDLAFGVARFVQKGGSFINYYM  292



>gb|EMT02336.1| Beta-galactosidase 2 [Aegilops tauschii]
Length=813

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -1

Query  126  ARFSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            A ++ FG P   RPV+DLA+ VAKFIQKGGSFVNYYM
Sbjct  240  AWYTGFGVPVPHRPVEDLAYGVAKFIQKGGSFVNYYM  276



>ref|NP_001234465.1| beta-galactosidase precursor [Solanum lycopersicum]
 sp|P48980.1|BGAL_SOLLC RecName: Full=Beta-galactosidase; AltName: Full=Acid beta-galactosidase; 
Short=Lactase; AltName: Full=Exo-(1-->4)-beta-D-galactanase; 
Flags: Precursor [Solanum lycopersicum]
 gb|AAF21626.1|AF023847_1 beta-galactosidase precursor [Solanum lycopersicum]
 emb|CAA58734.1| putative beta-galactosidase/galactanase [Solanum lycopersicum]
 emb|CAA10174.1| ss-galactosidase [Solanum lycopersicum]
Length=835

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -1

Query  126  ARFSEFGSPNHERPVQDLAFAVAKFIQKGGSFVNYYM  16
            A F+EFG P   RP +D+AFAVA+FIQ GGSF+NYYM
Sbjct  253  AWFTEFGGPVPYRPAEDMAFAVARFIQTGGSFINYYM  289



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 519253874986