BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c17957_g3_i1 len=652 path=[1712:0-651]

Length=652
                                                                      Score     E

ref|XP_009757279.1|  PREDICTED: nucleoside diphosphate kinase 3-like    213   2e-65   
ref|XP_009598982.1|  PREDICTED: nucleoside diphosphate kinase 3-like    213   3e-65   
gb|ADF45668.1|  nucleoside diphosphate kinase 1                         209   7e-64   
ref|XP_010325356.1|  PREDICTED: nucleoside diphosphate kinase 3-like    209   2e-63   
ref|NP_001274858.1|  nucleoside diphosphate kinase                      208   2e-63   
ref|XP_004244635.1|  PREDICTED: nucleoside diphosphate kinase 3-like    206   2e-62   
ref|XP_010541737.1|  PREDICTED: nucleoside diphosphate kinase IV,...    204   1e-61   
gb|KCW72421.1|  hypothetical protein EUGRSUZ_E00871                     204   1e-61   
ref|XP_007040537.1|  Nucleoside diphosphate kinase family protein       204   1e-61   
ref|XP_002299472.2|  nucleoside diphosphate kinase family protein       203   2e-61   Populus trichocarpa [western balsam poplar]
ref|XP_006439335.1|  hypothetical protein CICLE_v10021969mg             201   1e-60   
ref|XP_006476377.1|  PREDICTED: nucleoside diphosphate kinase III...    200   3e-60   
gb|KDP25291.1|  hypothetical protein JCGZ_20447                         200   4e-60   
ref|XP_006352246.1|  PREDICTED: nucleoside diphosphate kinase IV,...    200   4e-60   
ref|XP_009586926.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    208   4e-60   
ref|XP_011026886.1|  PREDICTED: nucleoside diphosphate kinase 3 i...    199   5e-60   
emb|CDP12163.1|  unnamed protein product                                199   5e-60   
ref|XP_006368778.1|  hypothetical protein POPTR_0001s10670g             199   7e-60   
gb|KDO76550.1|  hypothetical protein CISIN_1g026399mg                   199   7e-60   
ref|XP_011022501.1|  PREDICTED: nucleoside diphosphate kinase 3-like    197   4e-59   
emb|CAN83625.1|  hypothetical protein VITISV_041718                     197   6e-59   Vitis vinifera
ref|XP_010529641.1|  PREDICTED: nucleoside diphosphate kinase IV,...    197   8e-59   
ref|XP_002303650.1|  nucleoside diphosphate kinase family protein       196   8e-59   Populus trichocarpa [western balsam poplar]
ref|XP_002509969.1|  nucleoside diphosphate kinase, putative            195   2e-58   Ricinus communis
ref|XP_009341894.1|  PREDICTED: nucleoside diphosphate kinase III...    195   3e-58   
ref|XP_010455493.1|  PREDICTED: nucleoside diphosphate kinase III...    195   4e-58   
ref|XP_007209538.1|  hypothetical protein PRUPE_ppa010725mg             195   4e-58   
ref|XP_006284447.1|  hypothetical protein CARUB_v10005628mg             194   5e-58   
gb|EYU23340.1|  hypothetical protein MIMGU_mgv1a012962mg                194   5e-58   
ref|NP_567690.1|  nucleoside diphosphate kinase IV                      194   8e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008451953.1|  PREDICTED: nucleoside diphosphate kinase 3-like    194   9e-58   
ref|XP_009358610.1|  PREDICTED: nucleoside diphosphate kinase 3-like    194   9e-58   
gb|KDO76551.1|  hypothetical protein CISIN_1g026399mg                   193   1e-57   
ref|XP_010055873.1|  PREDICTED: uncharacterized protein LOC104443996    199   2e-57   
ref|XP_008341606.1|  PREDICTED: nucleoside diphosphate kinase III...    193   2e-57   
ref|XP_010435717.1|  PREDICTED: nucleoside diphosphate kinase III...    192   3e-57   
emb|CDY47613.1|  BnaA01g13520D                                          192   3e-57   
gb|KFK31881.1|  hypothetical protein AALP_AA6G170800                    192   5e-57   
ref|XP_004148997.1|  PREDICTED: nucleoside diphosphate kinase IV,...    192   6e-57   
ref|XP_006284448.1|  hypothetical protein CARUB_v10005628mg             191   7e-57   
ref|XP_009137500.1|  PREDICTED: nucleoside diphosphate kinase IV,...    191   9e-57   
emb|CDX94238.1|  BnaC02g28980D                                          191   1e-56   
ref|XP_010455492.1|  PREDICTED: nucleoside diphosphate kinase III...    191   1e-56   
dbj|BAH20188.1|  AT4G11010                                              191   1e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008799583.1|  PREDICTED: nucleoside diphosphate kinase 3-like    191   1e-56   
ref|NP_192839.1|  nucleoside diphosphate kinase 3                       191   1e-56   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65336.1|  nucleoside diphosphate kinase 3 (ndpk3)                 191   2e-56   Arabidopsis thaliana [mouse-ear cress]
emb|CDY25267.1|  BnaA02g21890D                                          190   2e-56   
ref|XP_010433842.1|  PREDICTED: nucleoside diphosphate kinase IV,...    190   2e-56   
gb|EYU23339.1|  hypothetical protein MIMGU_mgv1a012962mg                190   2e-56   
ref|XP_008374059.1|  PREDICTED: nucleoside diphosphate kinase III...    190   3e-56   
ref|XP_010448644.1|  PREDICTED: nucleoside diphosphate kinase IV,...    190   3e-56   
ref|XP_008239173.1|  PREDICTED: uncharacterized protein LOC103337781    197   4e-56   
ref|XP_006288481.1|  hypothetical protein CARUB_v10001740mg             190   4e-56   
ref|XP_008367908.1|  PREDICTED: nucleoside diphosphate kinase 3-like    189   5e-56   
ref|XP_010093431.1|  Nucleoside diphosphate kinase IV                   189   5e-56   
ref|XP_010435712.1|  PREDICTED: nucleoside diphosphate kinase III...    189   6e-56   
ref|XP_010422030.1|  PREDICTED: nucleoside diphosphate kinase III...    189   6e-56   
ref|XP_010267647.1|  PREDICTED: uncharacterized protein LOC104604801    195   7e-56   
ref|NP_001288978.1|  nucleoside diphosphate kinase III, chloropla...    189   8e-56   
ref|XP_010659305.1|  PREDICTED: uncharacterized protein LOC100263310    195   8e-56   
emb|CDY03508.1|  BnaC01g15740D                                          188   1e-55   
ref|XP_011074410.1|  PREDICTED: uncharacterized protein LOC105159148    194   1e-55   
ref|XP_011101052.1|  PREDICTED: uncharacterized protein LOC105179150    193   6e-55   
gb|AFK43052.1|  unknown                                                 186   7e-55   
ref|XP_009108206.1|  PREDICTED: nucleoside diphosphate kinase III...    186   1e-54   
ref|XP_009108207.1|  PREDICTED: nucleoside diphosphate kinase III...    186   1e-54   
ref|NP_001190817.1|  Pleckstrin homology (PH) domain-containing p...    192   2e-54   
dbj|BAA96460.1|  nucleoside diphosphate kinase 3                        184   3e-54   Brassica rapa
ref|XP_010918749.1|  PREDICTED: uncharacterized protein LOC105043039    191   4e-54   
ref|XP_002874662.1|  hypothetical protein ARALYDRAFT_489940             184   4e-54   
ref|XP_010439117.1|  PREDICTED: nucleoside diphosphate kinase IV,...    184   4e-54   
ref|XP_010439116.1|  PREDICTED: nucleoside diphosphate kinase IV,...    184   4e-54   
gb|AAY18431.1|  putative nucleoside diphosphate kinase III              183   1e-53   Noccaea caerulescens
ref|XP_006655662.1|  PREDICTED: nucleoside diphosphate kinase 4, ...    183   1e-53   
ref|XP_009405240.1|  PREDICTED: nucleoside diphosphate kinase 3-like    182   3e-53   
ref|XP_010676289.1|  PREDICTED: uncharacterized protein LOC104892148    188   5e-53   
ref|XP_009395043.1|  PREDICTED: nucleoside diphosphate kinase 3-like    181   6e-53   
sp|Q8RXA8.1|NDK4_SPIOL  RecName: Full=Nucleoside diphosphate kina...    181   9e-53   Spinacia oleracea
ref|XP_004503626.1|  PREDICTED: uncharacterized protein LOC101499802    186   2e-52   
gb|ABR18168.1|  unknown                                                 179   3e-52   Picea sitchensis
gb|AGK91196.1|  NDPK4                                                   179   5e-52   
emb|CAC84493.1|  putative nucleoside diphosphate kinase                 179   7e-52   Pinus pinaster [cluster pine]
gb|EEE64920.1|  hypothetical protein OsJ_19780                          178   2e-51   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001056515.1|  Os05g0595400                                       177   2e-51   Oryza sativa Japonica Group [Japonica rice]
gb|EPS58084.1|  nucleoside diphosphate kinase                           176   5e-51   
ref|XP_010924524.1|  PREDICTED: uncharacterized protein LOC105047333    183   5e-51   
ref|XP_008793170.1|  PREDICTED: uncharacterized protein LOC103709541    183   9e-51   
dbj|BAH37034.1|  nucleoside diphosphate kinase 3                        174   6e-50   Pisum sativum [garden pea]
dbj|BAH37033.1|  nucleoside diphosphate kinase 3                        173   7e-50   Pisum sativum [garden pea]
ref|XP_007160160.1|  hypothetical protein PHAVU_002G297900g             173   1e-49   
gb|KHN16744.1|  Nucleoside diphosphate kinase IV, chloroplastic/m...    172   1e-49   
ref|XP_004298905.1|  PREDICTED: nucleoside diphosphate kinase IV,...    178   2e-49   
ref|NP_001236561.1|  uncharacterized protein LOC100527475               172   2e-49   
ref|XP_004960972.1|  PREDICTED: nucleoside diphosphate kinase IV,...    172   3e-49   
gb|EMT04330.1|  Nucleoside diphosphate kinase 4, chloroplastic          175   3e-49   
gb|AAF08537.1|AF191098_1  nucleoside diphosphate kinase                 171   4e-49   Pisum sativum [garden pea]
ref|XP_003567773.2|  PREDICTED: uncharacterized protein LOC100837174    178   7e-49   
ref|NP_001150023.1|  LOC100283650                                       168   7e-48   Zea mays [maize]
gb|ACN31682.1|  unknown                                                 168   7e-48   Zea mays [maize]
gb|KCW72422.1|  hypothetical protein EUGRSUZ_E00871                     167   7e-48   
ref|XP_006852661.1|  hypothetical protein AMTR_s00021p00246310          167   9e-48   
ref|XP_011026887.1|  PREDICTED: nucleoside diphosphate kinase 4, ...    166   9e-48   
gb|AFK41131.1|  unknown                                                 166   4e-47   
gb|KEH21220.1|  nucleoside diphosphate kinase-like protein              166   4e-47   
ref|NP_001150225.1|  nucleoside diphosphate kinase 4                    166   4e-47   Zea mays [maize]
gb|AFW79436.1|  putative nucleoside diphosphate kinase family pro...    166   4e-47   
emb|CDY40857.1|  BnaC09g26080D                                          169   5e-47   
dbj|BAJ87594.1|  predicted protein                                      166   5e-47   
ref|XP_006584526.1|  PREDICTED: uncharacterized protein LOC100527...    172   6e-47   
ref|XP_008361295.1|  PREDICTED: nucleoside diphosphate kinase III...    163   1e-46   
gb|ACN35580.1|  unknown                                                 160   7e-46   Zea mays [maize]
gb|KHM99900.1|  Nucleoside diphosphate kinase IV, chloroplastic/m...    156   6e-44   
ref|XP_006396973.1|  hypothetical protein EUTSA_v10028863mg             159   7e-44   
ref|NP_001235503.1|  uncharacterized protein LOC100527141               153   5e-43   
pdb|1W7W|A  Chain A, Structure And Mutational Analysis Of A Plant...    150   2e-41   
ref|XP_002963221.1|  hypothetical protein SELMODRAFT_270355             148   5e-40   
ref|XP_002974524.1|  hypothetical protein SELMODRAFT_228272             147   6e-40   
gb|KCW72423.1|  hypothetical protein EUGRSUZ_E00871                     145   8e-40   
gb|AFW79438.1|  putative nucleoside diphosphate kinase family pro...    144   1e-39   
ref|XP_010433843.1|  PREDICTED: nucleoside diphosphate kinase IV,...    144   2e-38   
gb|EMS63054.1|  Nucleoside diphosphate kinase IV, chloroplastic/m...    147   2e-38   
ref|XP_001754760.1|  NDPK3a nucleotide diphosphate kinase 3 protein     137   9e-37   
ref|XP_001780320.1|  NDPK3a nucleotide diphosphate kinase 3protein      137   9e-37   
sp|P81766.1|NDK3_SPIOL  RecName: Full=Nucleoside diphosphate kina...    132   7e-35   Spinacia oleracea
ref|XP_003272315.1|  PREDICTED: nucleoside diphosphate kinase 2, ...    124   2e-31   
ref|WP_019477947.1|  MULTISPECIES: nucleoside diphosphate kinase        122   3e-31   
ref|WP_036916352.1|  MULTISPECIES: nucleoside diphosphate kinase        121   7e-31   
ref|WP_019477407.1|  nucleoside diphosphate kinase                      121   8e-31   
ref|WP_019475958.1|  nucleoside diphosphate kinase                      121   9e-31   
ref|WP_011822862.1|  nucleoside diphosphate kinase                      121   1e-30   
ref|WP_036906135.1|  nucleoside diphosphate kinase                      121   1e-30   
ref|WP_036901808.1|  nucleoside diphosphate kinase                      120   1e-30   
ref|WP_011294011.1|  nucleoside diphosphate kinase                      120   2e-30   
ref|WP_036892097.1|  MULTISPECIES: nucleoside diphosphate kinase        120   3e-30   
ref|XP_003272317.2|  PREDICTED: nucleoside diphosphate kinase 2, ...    124   3e-30   
ref|WP_036899223.1|  nucleoside diphosphate kinase                      120   3e-30   
gb|ELW63014.1|  Nucleoside diphosphate kinase B                         120   4e-30   
ref|WP_019475031.1|  nucleoside diphosphate kinase                      119   4e-30   
ref|WP_011365437.1|  nucleoside diphosphate kinase                      119   4e-30   
gb|AHF64904.1|  Nucleoside-diphosphate kinase                           119   5e-30   
gb|EFO63236.1|  Nucleoside diphosphate kinase                           119   5e-30   
ref|XP_006635154.1|  PREDICTED: nucleoside diphosphate kinase-like      119   5e-30   
ref|XP_007239713.1|  PREDICTED: nucleoside diphosphate kinase-lik...    119   5e-30   
ref|WP_038650506.1|  nucleoside diphosphate kinase                      119   5e-30   
ref|WP_011129211.1|  nucleoside diphosphate kinase                      119   6e-30   
gb|AIE73959.1|  Nucleoside diphosphate kinase                           119   7e-30   
ref|WP_012164102.1|  nucleoside diphosphate kinase                      119   7e-30   
ref|WP_011124205.1|  nucleoside diphosphate kinase                      119   7e-30   
gb|EWM29213.1|  nucleoside diphosphate kinase a                         118   8e-30   
ref|WP_028953069.1|  nucleoside diphosphate kinase                      119   8e-30   
ref|XP_007239712.1|  PREDICTED: nucleoside diphosphate kinase-lik...    119   8e-30   
gb|EES99236.1|  Nucleoside diphosphate kinase                           119   8e-30   Giardia intestinalis ATCC 50581
ref|WP_007101278.1|  nucleoside diphosphate kinase                      119   9e-30   
ref|XP_001706095.1|  Nucleoside diphosphate kinase                      119   9e-30   Giardia lamblia ATCC 50803
ref|XP_001567673.1|  nucleoside diphosphate kinase b                    119   9e-30   Leishmania braziliensis MHOM/BR/75/M2904
ref|XP_008836629.1|  PREDICTED: nucleoside diphosphate kinase B         119   9e-30   
ref|WP_006042870.1|  MULTISPECIES: nucleoside diphosphate kinase        119   1e-29   
pdb|3R9L|A  Chain A, Crystal Structure Of Nucleoside Diphosphate ...    119   1e-29   
pdb|3L7U|A  Chain A, Crystal Structure Of Human Nm23-H1                 119   1e-29   
ref|WP_015174722.1|  nucleoside diphosphate kinase                      118   1e-29   
ref|WP_038552400.1|  nucleoside diphosphate kinase                      119   1e-29   
ref|WP_032514112.1|  nucleoside diphosphate kinase                      118   1e-29   
ref|WP_032523032.1|  nucleoside diphosphate kinase                      118   1e-29   
ref|WP_012194609.1|  nucleoside diphosphate kinase                      118   1e-29   
ref|XP_005321668.1|  PREDICTED: nucleoside diphosphate kinase A i...    118   1e-29   
ref|WP_025973085.1|  nucleoside diphosphate kinase                      118   1e-29   
ref|WP_007099240.1|  nucleoside diphosphate kinase                      118   1e-29   
ref|XP_005321667.1|  PREDICTED: nucleoside diphosphate kinase A i...    119   1e-29   
ref|XP_006218470.1|  PREDICTED: nucleoside diphosphate kinase A 1...    118   1e-29   
ref|XP_007086749.1|  PREDICTED: nucleoside diphosphate kinase B-l...    118   2e-29   
ref|WP_011936789.1|  nucleoside diphosphate kinase                      119   2e-29   
pdb|4KPC|A  Chain A, Crystal Structure Of The Nucleoside Diphosph...    119   2e-29   
ref|XP_004395264.1|  PREDICTED: nucleoside diphosphate kinase B-l...    118   2e-29   
ref|XP_004363037.1|  nucleoside diphosphate kinase                      118   2e-29   
gb|EIE86357.1|  nucleoside diphosphate kinase                           120   2e-29   
ref|XP_006739379.1|  PREDICTED: nucleoside diphosphate kinase B i...    118   2e-29   
ref|WP_010873220.1|  nucleoside diphosphate kinase                      118   2e-29   
ref|WP_028051727.1|  nucleoside diphosphate kinase                      117   2e-29   
ref|XP_006177030.1|  PREDICTED: nucleoside diphosphate kinase A 1...    118   2e-29   
ref|WP_011343163.1|  nucleoside diphosphate kinase                      117   2e-29   
gb|EPY86739.1|  nucleoside diphosphate kinase A isoform a               118   2e-29   
ref|XP_005693696.1|  PREDICTED: nucleoside diphosphate kinase B i...    117   2e-29   
ref|XP_008726150.1|  nucleoside diphosphate kinase                      117   3e-29   
ref|NP_001127154.1|  nucleoside diphosphate kinase B                    117   3e-29   Pongo abelii [orang utan]
ref|XP_006940265.1|  PREDICTED: nucleoside diphosphate kinase A         117   3e-29   
ref|XP_007757280.1|  nucleoside diphosphate kinase                      117   3e-29   
ref|XP_308641.4|  AGAP007120-PA                                         118   3e-29   Anopheles gambiae str. PEST
emb|CBJ28342.1|  expressed unknown protein                              120   3e-29   
ref|WP_006854110.1|  nucleoside diphosphate kinase                      117   3e-29   
ref|WP_010467689.1|  nucleoside diphosphate kinase                      117   3e-29   
ref|WP_009788698.1|  MULTISPECIES: nucleoside diphosphate kinase        117   3e-29   
gb|AII46406.1|  nucleoside diphosphate kinase                           117   3e-29   
ref|XP_007525610.1|  PREDICTED: nucleoside diphosphate kinase B i...    117   3e-29   
ref|XP_005350593.1|  PREDICTED: nucleoside diphosphate kinase A i...    117   3e-29   
ref|WP_017653455.1|  nucleoside diphosphate kinase                      117   3e-29   
ref|XP_007176555.1|  PREDICTED: nucleoside diphosphate kinase A 1...    117   4e-29   
ref|WP_006173202.1|  nucleoside diphosphate kinase                      117   4e-29   
ref|XP_007086750.1|  PREDICTED: nucleoside diphosphate kinase B-l...    117   4e-29   
ref|XP_006972065.1|  PREDICTED: nucleoside diphosphate kinase B i...    117   4e-29   
ref|NP_001191678.1|  nucleoside diphosphate kinase A                    117   4e-29   
ref|NP_001191688.1|  nucleoside diphosphate kinase A                    117   4e-29   
ref|WP_011620633.1|  nucleoside diphosphate kinase                      117   4e-29   
ref|XP_007465059.1|  PREDICTED: nucleoside diphosphate kinase A 1...    117   4e-29   
ref|XP_008516172.1|  PREDICTED: nucleoside diphosphate kinase A 2...    118   4e-29   
ref|XP_004282598.1|  PREDICTED: nucleoside diphosphate kinase A 1...    117   4e-29   
ref|WP_025925747.1|  nucleoside diphosphate kinase                      117   4e-29   
ref|XP_007424650.1|  PREDICTED: nucleoside diphosphate kinase-like      117   4e-29   
ref|XP_007745646.1|  nucleoside diphosphate kinase                      117   4e-29   
ref|WP_025968927.1|  nucleoside diphosphate kinase                      117   4e-29   
ref|WP_025905759.1|  MULTISPECIES: nucleoside diphosphate kinase        117   4e-29   
ref|XP_003711050.1|  nucleoside diphosphate kinase                      119   4e-29   
ref|NP_001187018.1|  putative oncoprotein nm23                          117   5e-29   
ref|WP_025924018.1|  MULTISPECIES: nucleoside diphosphate kinase        117   5e-29   
ref|WP_025934186.1|  nucleoside diphosphate kinase                      116   5e-29   
ref|WP_025972755.1|  nucleoside diphosphate kinase                      117   5e-29   
ref|XP_004764912.1|  PREDICTED: nucleoside diphosphate kinase 2, ...    117   5e-29   
gb|EPY39770.1|  nucleoside diphosphate kinase B                         117   5e-29   
ref|WP_025935574.1|  nucleoside diphosphate kinase                      117   5e-29   
ref|WP_025932884.1|  MULTISPECIES: nucleoside diphosphate kinase        117   5e-29   
ref|WP_032523835.1|  nucleoside diphosphate kinase                      117   5e-29   
ref|XP_006177031.1|  PREDICTED: nucleoside diphosphate kinase A 1...    117   5e-29   
ref|WP_006909561.1|  nucleoside diphosphate kinase                      117   5e-29   
ref|WP_025915355.1|  nucleoside diphosphate kinase                      117   5e-29   
ref|WP_025893874.1|  MULTISPECIES: nucleoside diphosphate kinase        117   5e-29   
ref|NP_956264.1|  nucleoside diphosphate kinase B                       117   5e-29   Danio rerio [leopard danio]
ref|WP_032519846.1|  nucleoside diphosphate kinase                      117   5e-29   
ref|WP_025943157.1|  nucleoside diphosphate kinase                      117   5e-29   
ref|NP_001191447.1|  nucleoside diphosphate kinase B                    117   5e-29   
ref|WP_011862077.1|  nucleoside diphosphate kinase                      117   5e-29   
ref|WP_025942681.1|  nucleoside diphosphate kinase                      116   5e-29   
ref|XP_005350592.1|  PREDICTED: nucleoside diphosphate kinase B         117   5e-29   
pdb|3BBC|A  Chain A, Crystal Structure Of R88a Mutant Of The Nm23...    117   5e-29   
ref|WP_011375612.1|  nucleoside diphosphate kinase                      117   5e-29   
ref|XP_007062841.1|  PREDICTED: nucleoside diphosphate kinase A i...    117   5e-29   
gb|ABW04136.1|  nucleoside-diphosphate kinase                           117   5e-29   Epinephelus coioides [estuary cod]
ref|XP_010340228.1|  PREDICTED: nucleoside diphosphate kinase B         117   5e-29   
ref|XP_010384509.1|  PREDICTED: nucleoside diphosphate kinase B         117   5e-29   
ref|XP_006925199.1|  PREDICTED: nucleoside diphosphate kinase B         117   5e-29   
gb|AAP36444.1|  Homo sapiens non-metastatic cells 2, protein (NM2...    117   6e-29   
gb|EFQ34225.1|  nucleoside diphosphate kinase                           117   6e-29   
ref|NP_002503.1|  nucleoside diphosphate kinase B isoform a             117   6e-29   Homo sapiens [man]
ref|NP_001191806.1|  nucleoside diphosphate kinase B                    117   6e-29   
ref|XP_007579698.1|  putative nucleoside diphosphate kinase protein     118   6e-29   
ref|XP_010215431.1|  PREDICTED: nucleoside diphosphate kinase iso...    117   6e-29   
pdb|1NUE|A  Chain A, X-ray Structure Of Nm23 Human Nucleoside Dip...    117   6e-29   
ref|NP_114021.2|  nucleoside diphosphate kinase B                       117   6e-29   Rattus norvegicus [brown rat]
ref|XP_003501424.1|  PREDICTED: nucleoside diphosphate kinase A         117   6e-29   
tpg|DAA18578.1|  TPA: nucleoside diphosphate kinase A 1                 115   6e-29   
ref|WP_015162738.1|  nucleoside diphosphate kinase                      116   6e-29   
ref|XP_008566517.1|  PREDICTED: nucleoside diphosphate kinase B         117   6e-29   
ref|WP_025931213.1|  MULTISPECIES: nucleoside diphosphate kinase        117   6e-29   
ref|XP_007678643.1|  hypothetical protein BAUCODRAFT_36511              117   6e-29   
ref|XP_009485081.1|  PREDICTED: nucleoside diphosphate kinase-lik...    117   6e-29   
ref|NP_001133149.1|  non-metastatic cells 1 protein                     117   6e-29   Salmo salar
ref|XP_003272316.1|  PREDICTED: nucleoside diphosphate kinase 2, ...    117   6e-29   
ref|XP_005321669.1|  PREDICTED: nucleoside diphosphate kinase B         116   6e-29   
ref|XP_006019828.1|  PREDICTED: nucleoside diphosphate kinase-lik...    117   6e-29   
ref|XP_005075884.1|  PREDICTED: nucleoside diphosphate kinase B i...    116   6e-29   
ref|NP_032731.1|  nucleoside diphosphate kinase B                       116   6e-29   Mus musculus [mouse]
ref|XP_005494817.1|  PREDICTED: nucleoside diphosphate kinase B i...    117   6e-29   
ref|WP_025782606.1|  nucleoside diphosphate kinase                      116   6e-29   
ref|XP_001567672.1|  nucleoside diphosphate kinase b                    119   6e-29   Leishmania braziliensis MHOM/BR/75/M2904
ref|WP_025929093.1|  nucleoside diphosphate kinase                      116   6e-29   
gb|KFQ63197.1|  Nucleoside diphosphate kinase                           116   6e-29   
ref|XP_005305800.1|  PREDICTED: nucleoside diphosphate kinase           116   6e-29   
ref|XP_008102753.1|  PREDICTED: nucleoside diphosphate kinase A 2...    117   7e-29   
ref|WP_006633328.1|  nucleoside diphosphate kinase                      116   7e-29   
ref|XP_008313109.1|  PREDICTED: nucleoside diphosphate kinase-lik...    116   7e-29   
ref|WP_025978717.1|  nucleoside diphosphate kinase                      116   7e-29   
gb|AAA42017.1|  RBL-NDP kinase 18kDa subunit (p18)                      116   7e-29   Rattus norvegicus [brown rat]
ref|WP_025967751.1|  nucleoside diphosphate kinase                      116   7e-29   
tpg|DAA18668.1|  TPA: NME1-NME2 protein-like                            118   7e-29   
ref|WP_025887351.1|  MULTISPECIES: nucleoside diphosphate kinase        116   7e-29   
ref|NP_001191679.1|  nucleoside diphosphate kinase B                    116   7e-29   
emb|CDP25932.1|  Putative nucleoside diphosphate kinase                 116   7e-29   
ref|XP_005526769.1|  PREDICTED: nucleoside diphosphate kinase-like      116   7e-29   
gb|EDL15910.1|  mCG145251                                               116   7e-29   
ref|NP_032730.1|  nucleoside diphosphate kinase A                       116   8e-29   Mus musculus [mouse]
ref|XP_004591071.1|  PREDICTED: nucleoside diphosphate kinase B-l...    116   8e-29   
ref|WP_011131512.1|  nucleoside diphosphate kinase                      116   8e-29   
gb|EMS25563.1|  nucleoside-diphosphate kinase                           116   8e-29   
gb|ENN75817.1|  hypothetical protein YQE_07625                          117   8e-29   
ref|WP_025893736.1|  nucleoside diphosphate kinase                      116   8e-29   
ref|XP_009636169.1|  PREDICTED: nucleoside diphosphate kinase           116   8e-29   
ref|WP_025891305.1|  nucleoside diphosphate kinase                      116   8e-29   
ref|XP_007116616.1|  PREDICTED: nucleoside diphosphate kinase B         116   8e-29   
ref|XP_005185338.1|  PREDICTED: nucleoside diphosphate kinase-like      117   8e-29   
ref|WP_025920523.1|  MULTISPECIES: nucleoside diphosphate kinase        116   8e-29   
ref|WP_010313546.1|  nucleoside diphosphate kinase                      116   8e-29   
gb|KGG25291.1|  Nucleoside diphosphate kinase                           116   8e-29   
ref|XP_010701996.1|  nucleoside diphosphate kinase b                    116   8e-29   
ref|WP_036914763.1|  MULTISPECIES: nucleoside diphosphate kinase        116   8e-29   
ref|WP_010305500.1|  nucleoside diphosphate kinase                      116   8e-29   
ref|XP_005526770.1|  PREDICTED: nucleoside diphosphate kinase-lik...    116   8e-29   
ref|XP_009155763.1|  nucleoside diphosphate kinase                      116   8e-29   
sp|P52174.3|NDKA1_BOVIN  RecName: Full=Nucleoside diphosphate kin...    116   8e-29   
ref|WP_038547361.1|  nucleoside diphosphate kinase                      116   9e-29   
ref|XP_006972063.1|  PREDICTED: nucleoside diphosphate kinase A i...    116   9e-29   
ref|XP_006070237.1|  PREDICTED: nucleoside diphosphate kinase B         116   9e-29   
pdb|2HVE|A  Chain A, S120g Mutant Of Human Nucleoside Diphosphate...    116   9e-29   
gb|ELK01679.1|  Nucleoside diphosphate kinase B                         116   9e-29   
ref|XP_007465057.1|  PREDICTED: nucleoside diphosphate kinase B i...    116   9e-29   
ref|XP_009562226.1|  PREDICTED: nucleoside diphosphate kinase           116   9e-29   
ref|XP_008151897.1|  PREDICTED: nucleoside diphosphate kinase B i...    116   9e-29   
ref|NP_000260.1|  nucleoside diphosphate kinase A isoform b             116   9e-29   
ref|NP_001069844.1|  nucleoside diphosphate kinase B                    116   9e-29   
ref|XP_007230825.1|  PREDICTED: nucleoside diphosphate kinase A2-...    116   9e-29   
ref|XP_006258692.1|  PREDICTED: nucleoside diphosphate kinase A         116   9e-29   
gb|AAQ02459.1|  non-metastatic cells nucleoside-diphosphate kinase 1    116   9e-29   
ref|NP_001005140.1|  nucleoside diphosphate kinase B                    116   9e-29   
ref|NP_001191444.1|  nucleoside diphosphate kinase A                    116   9e-29   
ref|XP_006832480.1|  PREDICTED: nucleoside diphosphate kinase B i...    116   1e-28   
tpg|DAA30387.1|  TPA: nucleoside diphosphate kinase B                   116   1e-28   
ref|NP_001191440.1|  nucleoside diphosphate kinase A                    116   1e-28   
ref|XP_009092629.1|  PREDICTED: nucleoside diphosphate kinase-lik...    116   1e-28   
ref|WP_011817525.1|  nucleoside diphosphate kinase                      116   1e-28   
ref|NP_001191805.1|  nucleoside diphosphate kinase A                    116   1e-28   
ref|XP_008836625.1|  PREDICTED: nucleoside diphosphate kinase A i...    116   1e-28   
ref|WP_018133238.1|  nucleoside diphosphate kinase                      116   1e-28   
ref|XP_003649059.1|  hypothetical protein THITE_126586                  116   1e-28   
ref|XP_003796001.1|  PREDICTED: nucleoside diphosphate kinase B-like    116   1e-28   
gb|AAX36595.1|  non-metastatic cells 2                                  116   1e-28   
gb|KFB36023.1|  AGAP007120-PA-like protein                              116   1e-28   
ref|XP_005964675.1|  PREDICTED: nucleoside diphosphate kinase B i...    116   1e-28   
ref|XP_008009632.1|  PREDICTED: nucleoside diphosphate kinase A         116   1e-28   
ref|XP_006019827.1|  PREDICTED: nucleoside diphosphate kinase A         116   1e-28   
ref|XP_006889336.1|  PREDICTED: nucleoside diphosphate kinase B         116   1e-28   
ref|XP_008313108.1|  PREDICTED: nucleoside diphosphate kinase-lik...    116   1e-28   
ref|XP_008566518.1|  PREDICTED: nucleoside diphosphate kinase A         115   1e-28   
ref|XP_009991219.1|  PREDICTED: nucleoside diphosphate kinase A-l...    115   1e-28   
gb|AAA39826.1|  tumor metastatic process-associated protein NM23        116   1e-28   
emb|CDQ65588.1|  unnamed protein product                                115   1e-28   
ref|XP_008028584.1|  hypothetical protein SETTUDRAFT_164453             115   1e-28   
ref|XP_005016093.1|  PREDICTED: nucleoside diphosphate kinase-like      115   1e-28   
ref|XP_005160424.1|  PREDICTED: nucleoside diphosphate kinase B i...    116   1e-28   
ref|XP_009952630.1|  PREDICTED: nucleoside diphosphate kinase-like      115   1e-28   
ref|NP_990378.1|  nucleoside diphosphate kinase                         115   1e-28   
gb|KFU99166.1|  Nucleoside diphosphate kinase A                         115   1e-28   
ref|XP_004633642.1|  PREDICTED: nucleoside diphosphate kinase B-l...    115   1e-28   
gb|ETN67208.1|  abnormal wing disc                                      117   1e-28   
gb|KFP48751.1|  Nucleoside diphosphate kinase A 1                       114   1e-28   
ref|WP_025923798.1|  nucleoside diphosphate kinase                      115   1e-28   
ref|NP_001038075.1|  nucleoside diphosphate kinase B                    115   1e-28   
ref|NP_612557.1|  nucleoside diphosphate kinase A                       115   1e-28   
ref|XP_008836624.1|  PREDICTED: nucleoside diphosphate kinase A i...    117   1e-28   
dbj|BAF57896.1|  c-myc transcription factor                             115   1e-28   
ref|XP_009909785.1|  PREDICTED: nucleoside diphosphate kinase iso...    115   1e-28   
ref|WP_032516864.1|  nucleoside diphosphate kinase                      115   1e-28   
gb|AAI26770.1|  NME1 protein                                            115   1e-28   
ref|WP_024123948.1|  nucleoside diphosphate kinase Ndk                  115   1e-28   
gb|AIQ94088.1|  Nucleoside diphosphate kinase                           115   1e-28   
ref|XP_005890326.1|  PREDICTED: nucleoside diphosphate kinase A 2...    115   1e-28   
ref|WP_012006860.1|  nucleoside diphosphate kinase                      115   1e-28   
ref|XP_009069916.1|  PREDICTED: nucleoside diphosphate kinase           115   1e-28   
ref|NP_937818.1|  nucleoside diphosphate kinase A isoform a             116   2e-28   
ref|XP_009484012.1|  PREDICTED: nucleoside diphosphate kinase           115   2e-28   
ref|WP_011610889.1|  nucleoside diphosphate kinase                      115   2e-28   
ref|WP_032525754.1|  nucleoside diphosphate kinase                      115   2e-28   
ref|NP_001191671.1|  nucleoside diphosphate kinase A                    115   2e-28   
ref|WP_002806406.1|  nucleoside diphosphate kinase                      115   2e-28   
ref|NP_991387.2|  nucleoside diphosphate kinase A 1                     115   2e-28   
ref|XP_004041428.1|  PREDICTED: nucleoside diphosphate kinase A i...    116   2e-28   
pdb|1BE4|A  Chain A, Nucleoside Diphosphate Kinase Isoform B From...    115   2e-28   
gb|AAW82141.1|  NDP kinase NBR-A                                        115   2e-28   
ref|XP_007062842.1|  PREDICTED: nucleoside diphosphate kinase-like      115   2e-28   
ref|XP_006774279.1|  PREDICTED: nucleoside diphosphate kinase A 2...    115   2e-28   
ref|XP_007595041.1|  nucleoside diphosphate kinase                      118   2e-28   
ref|WP_011056122.1|  nucleoside diphosphate kinase                      115   2e-28   
ref|XP_009574996.1|  PREDICTED: nucleoside diphosphate kinase           115   2e-28   
ref|XP_005811740.1|  PREDICTED: nucleoside diphosphate kinase B-like    115   2e-28   
gb|EPB85454.1|  nucleoside-diphosphate kinase                           117   2e-28   
ref|XP_006153664.1|  PREDICTED: nucleoside diphosphate kinase B         115   2e-28   
gb|EJY73504.1|  Nucleoside diphosphate kinase                           115   2e-28   
ref|XP_005597091.1|  PREDICTED: nucleoside diphosphate kinase A i...    118   2e-28   
gb|EDL21398.1|  mCG113977                                               114   2e-28   
ref|XP_004012798.1|  PREDICTED: nucleoside diphosphate kinase A 1...    115   2e-28   
ref|XP_003501422.1|  PREDICTED: nucleoside diphosphate kinase B         115   2e-28   
ref|XP_010000980.1|  PREDICTED: nucleoside diphosphate kinase A-l...    115   2e-28   
ref|XP_006070234.1|  PREDICTED: nucleoside diphosphate kinase A 2...    115   2e-28   
ref|XP_004337223.1|  nucleoside diphosphate kinase 1, putative          117   2e-28   
emb|CDH54060.1|  nucleoside diphosphate                                 117   2e-28   
ref|XP_010012388.1|  PREDICTED: nucleoside diphosphate kinase 3 i...    115   2e-28   
emb|CDS13269.1|  hypothetical protein LRAMOSA05447                      117   2e-28   
ref|XP_003217333.1|  PREDICTED: nucleoside diphosphate kinase A i...    115   2e-28   
ref|XP_008492689.1|  PREDICTED: nucleoside diphosphate kinase           115   2e-28   
emb|CAA35621.1|  Nm23 protein                                           116   2e-28   
ref|XP_005394167.1|  PREDICTED: nucleoside diphosphate kinase B i...    115   2e-28   
ref|XP_005447324.1|  PREDICTED: nucleoside diphosphate kinase-lik...    115   2e-28   
ref|WP_011827402.1|  nucleoside diphosphate kinase                      115   2e-28   
ref|XP_003965066.1|  PREDICTED: nucleoside diphosphate kinase B-like    115   2e-28   
ref|XP_010079029.1|  PREDICTED: nucleoside diphosphate kinase-lik...    115   2e-28   
gb|KFU93438.1|  Nucleoside diphosphate kinase                           115   2e-28   
ref|XP_005243709.1|  PREDICTED: nucleoside diphosphate kinase-lik...    115   2e-28   
ref|XP_009092628.1|  PREDICTED: nucleoside diphosphate kinase           115   2e-28   
ref|XP_005016091.1|  PREDICTED: nucleoside diphosphate kinase-lik...    115   2e-28   
ref|XP_004684441.1|  PREDICTED: nucleoside diphosphate kinase A 1...    115   2e-28   
ref|XP_003414662.1|  PREDICTED: nucleoside diphosphate kinase A         115   2e-28   
ref|XP_008861194.1|  hypothetical protein H310_00264                    117   2e-28   
ref|NP_001191692.1|  nucleoside diphosphate kinase A                    115   2e-28   
ref|WP_025937844.1|  nucleoside diphosphate kinase                      115   2e-28   
pdb|3VVU|A  Chain A, Crystal Structure Of Reconstructed Bacterial...    115   2e-28   
ref|XP_004377971.1|  PREDICTED: nucleoside diphosphate kinase B-l...    115   2e-28   
ref|XP_009949333.1|  PREDICTED: nucleoside diphosphate kinase           115   2e-28   
ref|XP_005494816.1|  PREDICTED: nucleoside diphosphate kinase-like      115   2e-28   
ref|XP_004395267.1|  PREDICTED: nucleoside diphosphate kinase B-l...    118   2e-28   
ref|NP_001081044.1|  nucleoside diphosphate kinase A1                   115   2e-28   
gb|KFO78440.1|  Nucleoside diphosphate kinase B                         115   2e-28   
ref|XP_010179464.1|  PREDICTED: nucleoside diphosphate kinase-lik...    115   2e-28   
ref|XP_009939182.1|  PREDICTED: nucleoside diphosphate kinase iso...    115   2e-28   
ref|XP_004080787.1|  PREDICTED: nucleoside diphosphate kinase A-l...    115   3e-28   
ref|NP_001191682.1|  nucleoside diphosphate kinase B                    115   3e-28   
ref|XP_004480508.1|  PREDICTED: nucleoside diphosphate kinase B-l...    115   3e-28   
ref|XP_009677184.1|  PREDICTED: nucleoside diphosphate kinase           115   3e-28   
ref|XP_007558843.1|  PREDICTED: nucleoside diphosphate kinase B-like    115   3e-28   
ref|XP_010120123.1|  PREDICTED: nucleoside diphosphate kinase           115   3e-28   
gb|AEE63463.1|  unknown                                                 115   3e-28   
ref|XP_009322002.1|  PREDICTED: nucleoside diphosphate kinase-like      115   3e-28   
gb|EFX87654.1|  hypothetical protein DAPPUDRAFT_306467                  115   3e-28   
ref|WP_035833634.1|  nucleoside diphosphate kinase                      115   3e-28   
gb|ADG29125.1|  nucleoside diphosphate kinase B                         115   3e-28   
ref|XP_008436385.1|  PREDICTED: nucleoside diphosphate kinase B-like    115   3e-28   
gb|KFQ42458.1|  Nucleoside diphosphate kinase                           115   3e-28   
ref|XP_009913663.1|  PREDICTED: nucleoside diphosphate kinase iso...    115   3e-28   
ref|XP_009700176.1|  PREDICTED: nucleoside diphosphate kinase-lik...    115   3e-28   
ref|XP_009322001.1|  PREDICTED: nucleoside diphosphate kinase           115   3e-28   
ref|XP_008943703.1|  PREDICTED: nucleoside diphosphate kinase-like      115   3e-28   
ref|XP_005503166.1|  PREDICTED: nucleoside diphosphate kinase-like      115   3e-28   
gb|AAH55613.1|  Nme2 protein                                            115   3e-28   
ref|XP_006125185.1|  PREDICTED: nucleoside diphosphate kinase-lik...    115   3e-28   
ref|XP_008328657.1|  PREDICTED: nucleoside diphosphate kinase A-like    115   3e-28   
gb|KFZ46677.1|  Nucleoside diphosphate kinase A 1                       115   3e-28   
ref|XP_009078795.1|  PREDICTED: nucleoside diphosphate kinase A-l...    115   3e-28   
ref|XP_005243710.1|  PREDICTED: nucleoside diphosphate kinase-lik...    115   3e-28   
ref|XP_006870899.1|  PREDICTED: nucleoside diphosphate kinase B-l...    115   3e-28   
gb|KFU93439.1|  Nucleoside diphosphate kinase                           115   3e-28   
gb|EFX87672.1|  hypothetical protein DAPPUDRAFT_306455                  115   3e-28   
ref|XP_009819164.1|  PREDICTED: nucleoside diphosphate kinase-lik...    115   3e-28   
ref|XP_009581033.1|  PREDICTED: nucleoside diphosphate kinase-lik...    115   3e-28   
gb|KFQ80839.1|  Nucleoside diphosphate kinase                           115   3e-28   
ref|XP_009872897.1|  PREDICTED: nucleoside diphosphate kinase-like      115   3e-28   
ref|XP_007814206.1|  nucleoside diphosphate kinase A                    117   3e-28   
ref|XP_007176558.1|  PREDICTED: nucleoside diphosphate kinase B         115   3e-28   
gb|KFP36370.1|  Nucleoside diphosphate kinase                           114   3e-28   
gb|KFO05338.1|  Nucleoside diphosphate kinase                           114   3e-28   
gb|KFV94569.1|  Nucleoside diphosphate kinase                           114   3e-28   
gb|KFQ20157.1|  Nucleoside diphosphate kinase                           114   3e-28   
gb|KFP58942.1|  Nucleoside diphosphate kinase                           114   3e-28   
gb|KFW66892.1|  Nucleoside diphosphate kinase                           114   3e-28   
gb|KFP71109.1|  Nucleoside diphosphate kinase                           115   3e-28   
ref|XP_010140882.1|  PREDICTED: nucleoside diphosphate kinase           115   3e-28   
ref|XP_008925210.1|  PREDICTED: nucleoside diphosphate kinase           115   3e-28   
ref|XP_008713094.1|  nucleoside diphosphate kinase                      115   3e-28   
gb|KFP99711.1|  Nucleoside diphosphate kinase                           114   3e-28   
ref|XP_001999324.1|  GI24450                                            115   3e-28   
ref|XP_007728473.1|  nucleoside diphosphate kinase                      115   3e-28   
ref|XP_010752380.1|  PREDICTED: nucleoside diphosphate kinase B-like    114   3e-28   
ref|XP_009636168.1|  PREDICTED: nucleoside diphosphate kinase-like      114   3e-28   
ref|NP_001166344.1|  nucleoside diphosphate kinase A                    114   3e-28   
ref|XP_005056125.1|  PREDICTED: nucleoside diphosphate kinase-lik...    117   3e-28   
gb|ELR60269.1|  Nucleoside diphosphate kinase B                         117   3e-28   
ref|WP_025880067.1|  MULTISPECIES: nucleoside diphosphate kinase        114   4e-28   
emb|CAF90396.1|  unnamed protein product                                114   4e-28   
ref|XP_009562227.1|  PREDICTED: nucleoside diphosphate kinase-like      114   4e-28   
ref|XP_008492691.1|  PREDICTED: nucleoside diphosphate kinase-lik...    114   4e-28   
gb|KFP78498.1|  Nucleoside diphosphate kinase                           114   4e-28   
dbj|BAN89448.1|  nucleoside_diphosphate_kinase                          114   4e-28   
gb|KFV40211.1|  Nucleoside diphosphate kinase                           114   4e-28   
ref|XP_010215433.1|  PREDICTED: nucleoside diphosphate kinase iso...    114   4e-28   
ref|XP_008925208.1|  PREDICTED: nucleoside diphosphate kinase-lik...    114   4e-28   
ref|XP_003661539.1|  hypothetical protein MYCTH_2301051                 114   4e-28   
gb|KFP15127.1|  Nucleoside diphosphate kinase                           114   4e-28   
ref|XP_005868249.1|  PREDICTED: nucleoside diphosphate kinase A 2...    114   4e-28   
gb|KFW83503.1|  Nucleoside diphosphate kinase                           114   4e-28   
ref|XP_009511672.1|  PREDICTED: nucleoside diphosphate kinase A i...    114   4e-28   
ref|XP_004906185.1|  PREDICTED: nucleoside diphosphate kinase B-l...    114   4e-28   
ref|XP_010701995.1|  nucleoside diphosphate kinase b                    117   4e-28   
gb|KFP01345.1|  Nucleoside diphosphate kinase                           114   4e-28   
gb|ERT00467.1|  nucleoside diphosphate kinase                           117   4e-28   
ref|XP_007518135.1|  PREDICTED: nucleoside diphosphate kinase B-l...    114   4e-28   
ref|XP_004080785.1|  PREDICTED: nucleoside diphosphate kinase A-l...    114   4e-28   
ref|XP_010000982.1|  PREDICTED: nucleoside diphosphate kinase           114   4e-28   
ref|XP_008686066.1|  PREDICTED: nucleoside diphosphate kinase A         114   4e-28   
pdb|1UCN|A  Chain A, X-Ray Structure Of Human Nucleoside Diphosph...    114   4e-28   
ref|WP_011819379.1|  nucleoside diphosphate kinase                      114   4e-28   
gb|KFW97455.1|  Nucleoside diphosphate kinase A                         114   4e-28   
gb|KFO78441.1|  Nucleoside diphosphate kinase                           114   4e-28   
ref|XP_006774277.1|  PREDICTED: nucleoside diphosphate kinase A 2...    114   4e-28   
ref|XP_010544352.1|  PREDICTED: nucleoside diphosphate kinase 1         114   4e-28   
ref|XP_009533669.1|  hypothetical protein PHYSODRAFT_464988             116   4e-28   
gb|ETM31626.1|  hypothetical protein L914_20849                         116   4e-28   
gb|KFP77321.1|  Nucleoside diphosphate kinase                           114   4e-28   
ref|XP_008898584.1|  hypothetical protein PPTG_06420                    116   4e-28   
gb|KFQ21577.1|  Nucleoside diphosphate kinase                           114   4e-28   
ref|XP_001467985.1|  nucleoside diphosphate kinase b                    114   4e-28   
dbj|BAN89362.1|  nucleoside diphosphate kinase                          114   4e-28   
ref|XP_009677182.1|  PREDICTED: nucleoside diphosphate kinase-like      114   4e-28   
dbj|GAD93531.1|  nucleoside diphosphate kinase A                        114   4e-28   
ref|XP_007778277.1|  nucleoside diphosphate kinase                      114   4e-28   
ref|XP_009878071.1|  PREDICTED: nucleoside diphosphate kinase iso...    114   4e-28   



>ref|XP_009757279.1| PREDICTED: nucleoside diphosphate kinase 3-like [Nicotiana sylvestris]
Length=238

 Score =   213 bits (543),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 135/163 (83%), Gaps = 2/163 (1%)
 Frame = +2

Query  170  MNSRISRSAHCAARFL-SAYSKHssra-fsggraagaasvvslrgvassllHGRAESANA  343
            MNS+I RSA  A + L S YSK SSRA   G   A AA+V     V S   +GR +S N+
Sbjct  1    MNSQICRSASRATKTLFSVYSKQSSRAFSGGRAVAAAATVSLRGVVPSLASYGRTDSGNS  60

Query  344  SRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLV  523
            SR+WISGILALPAAAYMIQE++AHAAEMERTFIAIKPDGVQRGL+SEIISRFERKGFKLV
Sbjct  61   SRSWISGILALPAAAYMIQEQEAHAAEMERTFIAIKPDGVQRGLISEIISRFERKGFKLV  120

Query  524  AIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            AIKI+VPSK FA +HYHDLK+RPFF+GLC+FLSSGPVVAMVWE
Sbjct  121  AIKIVVPSKDFAGKHYHDLKERPFFNGLCDFLSSGPVVAMVWE  163



>ref|XP_009598982.1| PREDICTED: nucleoside diphosphate kinase 3-like [Nicotiana tomentosiformis]
Length=238

 Score =   213 bits (542),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 119/163 (73%), Positives = 134/163 (82%), Gaps = 2/163 (1%)
 Frame = +2

Query  170  MNSRISRSAHCAARFL-SAYSKHssra-fsggraagaasvvslrgvassllHGRAESANA  343
            MNS+I RSA  A + L SAYSK  SRA   G   A AA+V     V S   +GR +S N+
Sbjct  1    MNSQICRSASRATKSLFSAYSKQRSRAFSGGRAVAAAATVSLRGVVPSLASYGRTDSGNS  60

Query  344  SRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLV  523
            SR WISGILALPAAAYMIQE++AHAAEMERTFIAIKPDGVQRGL+SEI+SRFERKGFKLV
Sbjct  61   SRAWISGILALPAAAYMIQEQEAHAAEMERTFIAIKPDGVQRGLISEIVSRFERKGFKLV  120

Query  524  AIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            AIKI+VPSK FA +HYHDLK+RPFF+GLC+FLSSGPVVAMVWE
Sbjct  121  AIKIVVPSKDFAGKHYHDLKERPFFNGLCDFLSSGPVVAMVWE  163



>gb|ADF45668.1| nucleoside diphosphate kinase 1 [Solanum tuberosum]
Length=238

 Score =   209 bits (533),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 137/163 (84%), Gaps = 2/163 (1%)
 Frame = +2

Query  170  MNSRISRSAHCAAR-FLSAYSKHssra-fsggraagaasvvslrgvassllHGRAESANA  343
            MNS+I RSA  AA+  LSA SK +SRA   G  AA AA+V     V S   +GR+ES NA
Sbjct  1    MNSQICRSASRAAKSLLSASSKQTSRAFSGGRAAAAAATVSLRGVVPSLASYGRSESGNA  60

Query  344  SRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLV  523
            SR WISG+LALPAAAYM+QE++AHAAEMERTFIAIKPDGVQRGL+SEI+SRFERKGFKLV
Sbjct  61   SRAWISGVLALPAAAYMLQEQEAHAAEMERTFIAIKPDGVQRGLISEIVSRFERKGFKLV  120

Query  524  AIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            AIK+++PSK FA++HYHDL +RPFF+GLC+FLSSGPV+AMVWE
Sbjct  121  AIKVVIPSKEFAKKHYHDLSERPFFNGLCDFLSSGPVLAMVWE  163



>ref|XP_010325356.1| PREDICTED: nucleoside diphosphate kinase 3-like [Solanum lycopersicum]
Length=238

 Score =   209 bits (531),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 136/163 (83%), Gaps = 2/163 (1%)
 Frame = +2

Query  170  MNSRISRSAHCAAR-FLSAYSKHssra-fsggraagaasvvslrgvassllHGRAESANA  343
            MNS+I RSA  AA+  LSA SK +SRA   G  AA AA+V     V S   +GR ES NA
Sbjct  1    MNSQICRSATRAAKSLLSASSKQTSRAFSGGRAAAAAATVSLRGVVPSLASYGRNESGNA  60

Query  344  SRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLV  523
            SR WISG+LALPAAAYM+QE++AHAAEMERTFIAIKPDGVQRGL+SEI+SRFERKGFKLV
Sbjct  61   SRAWISGVLALPAAAYMLQEQEAHAAEMERTFIAIKPDGVQRGLISEIVSRFERKGFKLV  120

Query  524  AIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            AIK+++PSK FA++HYHDL +RPFF+GLC+FLSSGPV+AMVWE
Sbjct  121  AIKVVIPSKEFAKKHYHDLSERPFFNGLCDFLSSGPVLAMVWE  163



>ref|NP_001274858.1| nucleoside diphosphate kinase [Solanum tuberosum]
 gb|ACV60545.1| nucleoside diphosphate kinase [Solanum tuberosum]
Length=238

 Score =   208 bits (530),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 137/163 (84%), Gaps = 2/163 (1%)
 Frame = +2

Query  170  MNSRISRSAHCAAR-FLSAYSKHssra-fsggraagaasvvslrgvassllHGRAESANA  343
            MNS+I RSA  AA+  LSA SK +SRA   G  AA AA+V     V S   +GR+ES NA
Sbjct  1    MNSQICRSASRAAKSLLSASSKQTSRAFSGGRAAAAAATVCLRGVVPSLASYGRSESGNA  60

Query  344  SRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLV  523
            SR WISG+LALPAAAYM+QE++AHAAEMERTFIAIKPDGVQRGL+SEI+SRFERKGFKLV
Sbjct  61   SRAWISGVLALPAAAYMLQEQEAHAAEMERTFIAIKPDGVQRGLISEIVSRFERKGFKLV  120

Query  524  AIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            AIK+++PSK FA++HYHDL +RPFF+GLC+FLSSGPV+AMVWE
Sbjct  121  AIKVVIPSKEFAKKHYHDLSERPFFNGLCDFLSSGPVLAMVWE  163



>ref|XP_004244635.1| PREDICTED: nucleoside diphosphate kinase 3-like [Solanum lycopersicum]
Length=234

 Score =   206 bits (523),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 129/161 (80%), Gaps = 2/161 (1%)
 Frame = +2

Query  170  MNSRISRSAHCAARFLSAYSKHssrafsggraagaasvvslrgvassllHGRAESANASR  349
            MNS+I RSA  A + L  ++  S     G  AA AA+V     V S   +GR +S N+S 
Sbjct  1    MNSQICRSASRATKSL--FTSSSRAFSGGRAAAAAATVSLRGVVPSLATYGRTKSRNSST  58

Query  350  NWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAI  529
             WISGILALPAAAYM+QE++AHAAEMERTFIAIKPDGVQRGL+SEI+SRFERKGFKLVAI
Sbjct  59   GWISGILALPAAAYMLQEQEAHAAEMERTFIAIKPDGVQRGLISEILSRFERKGFKLVAI  118

Query  530  KIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            KI+VPSK FAQ+HYHDLK+RPFF+GLC FLSSGPVVAMVWE
Sbjct  119  KIVVPSKDFAQKHYHDLKERPFFNGLCGFLSSGPVVAMVWE  159



>ref|XP_010541737.1| PREDICTED: nucleoside diphosphate kinase IV, chloroplastic/mitochondrial 
[Tarenaya hassleriana]
Length=237

 Score =   204 bits (518),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 127/162 (78%), Gaps = 1/162 (1%)
 Frame = +2

Query  170  MNSRISRSAHCAARFLSAYSKHssrafsggraagaasvvslrgvassllH-GRAESANAS  346
            MNS+I RSA  AAR L + +K++     G     AA V     V     + G + S NAS
Sbjct  1    MNSQICRSASRAARSLLSSAKNARSFSGGRAIGAAAVVSVGGKVPQFASNFGNSASGNAS  60

Query  347  RNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVA  526
            R+WISG++ALPAAA+M+Q+++ HAAEMERTFIAIKPDGVQRGL+SEIISRFERKGFKLV 
Sbjct  61   RSWISGLIALPAAAFMLQDQEVHAAEMERTFIAIKPDGVQRGLISEIISRFERKGFKLVG  120

Query  527  IKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            IKI+VPSK FAQ+HYHDLK+RPFF+GLC FLSSGPVVAMVWE
Sbjct  121  IKILVPSKDFAQKHYHDLKERPFFNGLCEFLSSGPVVAMVWE  162



>gb|KCW72421.1| hypothetical protein EUGRSUZ_E00871 [Eucalyptus grandis]
Length=237

 Score =   204 bits (518),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 108/162 (67%), Positives = 129/162 (80%), Gaps = 1/162 (1%)
 Frame = +2

Query  170  MNSRISRSAHCAAR-FLSAYSKHssrafsggraagaasvvslrgvassllHGRAESANAS  346
            M+S+I RSA  AAR  LSA  +    +     AA AA  ++ +    S    RA SANAS
Sbjct  1    MSSQICRSASRAARTLLSASKQARFYSEGRAAAAAAAVTIAGKSSILSSTFARAGSANAS  60

Query  347  RNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVA  526
            R WI+G LALPAA YM+QE++AHAAE+ER+FIAIKPDGVQRGL+SEIISRFERKGFKLVA
Sbjct  61   RGWITGALALPAAVYMLQEQEAHAAELERSFIAIKPDGVQRGLISEIISRFERKGFKLVA  120

Query  527  IKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            IK++VP+K FAQ+HYHDLK+RPFF+GLC+FLSSGPVVAMVWE
Sbjct  121  IKVVVPTKDFAQKHYHDLKERPFFNGLCDFLSSGPVVAMVWE  162



>ref|XP_007040537.1| Nucleoside diphosphate kinase family protein [Theobroma cacao]
 gb|EOY25038.1| Nucleoside diphosphate kinase family protein [Theobroma cacao]
Length=237

 Score =   204 bits (518),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 108/162 (67%), Positives = 124/162 (77%), Gaps = 1/162 (1%)
 Frame = +2

Query  170  MNSRISRSAHCAAR-FLSAYSKHssrafsggraagaasvvslrgvassllHGRAESANAS  346
            M+S+I RSA  AAR  LSA       +     AA AA  +  +    +  +GR    NAS
Sbjct  1    MSSQILRSASRAARSLLSASKSSRFYSEGRAVAAAAAVSLGGKVPLLASAYGRTGPTNAS  60

Query  347  RNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVA  526
            R W+SG+ ALP AAYM+QE++AHAAEMERTFIAIKPDGVQRGL+SEIISRFERKGFKLVA
Sbjct  61   RGWLSGVFALPVAAYMLQEQEAHAAEMERTFIAIKPDGVQRGLISEIISRFERKGFKLVA  120

Query  527  IKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            IKI+VPSK FAQ+HY DLK+RPFFSGLC FLSSGPVVAMVWE
Sbjct  121  IKILVPSKEFAQQHYDDLKERPFFSGLCEFLSSGPVVAMVWE  162



>ref|XP_002299472.2| nucleoside diphosphate kinase family protein [Populus trichocarpa]
 gb|EEE84277.2| nucleoside diphosphate kinase family protein [Populus trichocarpa]
Length=237

 Score =   203 bits (517),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 108/162 (67%), Positives = 125/162 (77%), Gaps = 1/162 (1%)
 Frame = +2

Query  170  MNSRISRSAHCAAR-FLSAYSKHssrafsggraagaasvvslrgvassllHGRAESANAS  346
            M+S+I RSA  AAR  LS+ SK S        AA  A  +  +    S  +GR  S+N +
Sbjct  1    MSSQICRSASRAARSLLSSASKTSRFYSGRAAAAVVAVSLGGKLPLLSSAYGRTGSSNLA  60

Query  347  RNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVA  526
            R WISG LA+PA  YM+QE++AHAAE+ERTFIAIKPDGVQRGL+SEIISRFERKGFKLVA
Sbjct  61   RQWISGALAIPAGVYMLQEQEAHAAELERTFIAIKPDGVQRGLISEIISRFERKGFKLVA  120

Query  527  IKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            IKI+VPSK FAQ+HYHDLK RPFF GLC+FLSSGPVVAMVWE
Sbjct  121  IKIVVPSKDFAQKHYHDLKTRPFFDGLCDFLSSGPVVAMVWE  162



>ref|XP_006439335.1| hypothetical protein CICLE_v10021969mg [Citrus clementina]
 gb|ESR52575.1| hypothetical protein CICLE_v10021969mg [Citrus clementina]
Length=239

 Score =   201 bits (512),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 105/111 (95%), Gaps = 0/111 (0%)
 Frame = +2

Query  320  GRAESANASRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRF  499
            GRA S+ ASR+W+SG +A+PAAAYM+QE++ HAAEMERTFIAIKPDGVQRGL+SEIISRF
Sbjct  54   GRAGSSTASRSWLSGAIAIPAAAYMLQEQEVHAAEMERTFIAIKPDGVQRGLISEIISRF  113

Query  500  ERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            ERKGFKLVAIKI+VPSK FAQ+HYHDLK+RPFF+GLC FLSSGPV+AMVWE
Sbjct  114  ERKGFKLVAIKIVVPSKEFAQKHYHDLKERPFFNGLCEFLSSGPVIAMVWE  164



>ref|XP_006476377.1| PREDICTED: nucleoside diphosphate kinase III, chloroplastic/mitochondrial-like 
[Citrus sinensis]
Length=237

 Score =   200 bits (509),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 124/162 (77%), Gaps = 1/162 (1%)
 Frame = +2

Query  170  MNSRISRSAHCAAR-FLSAYSKHssrafsggraagaasvvslrgvassllHGRAESANAS  346
            M+S+I RSA   AR  LSA       +     +A AA   S +        GRA S+ AS
Sbjct  1    MSSQIVRSASRTARSLLSASKNSRFYSEGRAVSAAAAVTFSGKLPYLVSSFGRAGSSTAS  60

Query  347  RNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVA  526
            R+W+SG +A+PAAAY +QE++ HAAEMERTFIAIKPDGVQRGL+SEIISRFERKGFKLVA
Sbjct  61   RSWLSGAIAIPAAAYTLQEQEVHAAEMERTFIAIKPDGVQRGLISEIISRFERKGFKLVA  120

Query  527  IKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            IKI+VPSK FAQ+HYHDLK+RPFF+GLC FLSSGPV+AMVWE
Sbjct  121  IKIVVPSKEFAQKHYHDLKERPFFNGLCEFLSSGPVIAMVWE  162



>gb|KDP25291.1| hypothetical protein JCGZ_20447 [Jatropha curcas]
Length=236

 Score =   200 bits (508),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 105/111 (95%), Gaps = 0/111 (0%)
 Frame = +2

Query  320  GRAESANASRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRF  499
            GR  S+NAS  WISG+LA+PAA YM+QE++AHAAE+ERTFIAIKPDGVQRGL++E+ISRF
Sbjct  52   GRTGSSNASAQWISGVLAIPAAVYMLQEQEAHAAELERTFIAIKPDGVQRGLIAEVISRF  111

Query  500  ERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            ERKGFKLVAIKI+VPSK FAQ+HYHDLK+RPFF+GLC+FLSSGPVVAMVWE
Sbjct  112  ERKGFKLVAIKIVVPSKDFAQKHYHDLKERPFFNGLCDFLSSGPVVAMVWE  162



>ref|XP_006352246.1| PREDICTED: nucleoside diphosphate kinase IV, chloroplastic/mitochondrial-like 
[Solanum tuberosum]
Length=232

 Score =   200 bits (508),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 127/161 (79%), Gaps = 4/161 (2%)
 Frame = +2

Query  170  MNSRISRSAHCAARFLSAYSKHssrafsggraagaasvvslrgvassllHGRAESANASR  349
            MNS+I RSA  A +  S +S  S     G  AA A +V     V S   +GR +S N+  
Sbjct  1    MNSQICRSASRATK--SLFSSSSRAFSGGRAAAAATTVSLRGVVPSLASYGRTKSQNSC-  57

Query  350  NWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAI  529
             WISGILALPAAAYM+QE++AHAAEMERTFIAIKPDGVQRGL+SEI+SRFERKGFKLVAI
Sbjct  58   -WISGILALPAAAYMLQEQEAHAAEMERTFIAIKPDGVQRGLISEILSRFERKGFKLVAI  116

Query  530  KIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            KI+VPSK FAQ+HYHDLK+RPFF+GLC FLSSGPVVAMVWE
Sbjct  117  KIVVPSKDFAQKHYHDLKERPFFNGLCGFLSSGPVVAMVWE  157



>ref|XP_009586926.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104084708 
[Nicotiana tomentosiformis]
Length=540

 Score =   208 bits (529),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 133/166 (80%), Gaps = 1/166 (1%)
 Frame = +2

Query  158  KVLTMNSRISRSAHCAAR-FLSAYSKHssrafsggraagaasvvslrgvassllHGRAES  334
            K   MNS+I RSA  AA+  +SA  + S     G  AA AA+V     V S   +GR ES
Sbjct  300  KAEEMNSQICRSASRAAKSLISASKQGSRAFSGGRAAAAAATVSLRGVVPSLASYGRTES  359

Query  335  ANASRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGF  514
             NASR WISG+LALPAAAYM+QE++AHAA+MERTFIAIKPDGVQRGL+SEII+RFERKGF
Sbjct  360  GNASRAWISGVLALPAAAYMLQEQEAHAAQMERTFIAIKPDGVQRGLISEIIARFERKGF  419

Query  515  KLVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            KLVAIK+++PSK FAQ+HYHDL +RPFF+GLC+FLSSGPV+AMVWE
Sbjct  420  KLVAIKVVIPSKEFAQKHYHDLSERPFFNGLCDFLSSGPVLAMVWE  465



>ref|XP_011026886.1| PREDICTED: nucleoside diphosphate kinase 3 isoform X1 [Populus 
euphratica]
Length=238

 Score =   199 bits (507),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 123/163 (75%), Gaps = 2/163 (1%)
 Frame = +2

Query  170  MNSRISRSAHCAARFL--SAYSKHssrafsggraagaasvvslrgvassllHGRAESANA  343
            M+S+I RSA  AAR L  SA       +     AA  A  +  +    +  +GR  S+N 
Sbjct  1    MSSQICRSASRAARSLLSSASKTSRFYSEGRAAAAVVAVSLGGKLPLLASAYGRTGSSNV  60

Query  344  SRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLV  523
            +R WISG LA+PA  YM+QE++AHAAE+ERTFIAIKPDGVQRGL+SEIISRFERKGFKLV
Sbjct  61   ARQWISGALAIPATVYMLQEQEAHAAELERTFIAIKPDGVQRGLISEIISRFERKGFKLV  120

Query  524  AIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            AIKI+VPSK FAQ+HYHDLK RPFF GLC+FLSSGPVVAMVWE
Sbjct  121  AIKIVVPSKDFAQKHYHDLKTRPFFDGLCDFLSSGPVVAMVWE  163



>emb|CDP12163.1| unnamed protein product [Coffea canephora]
Length=238

 Score =   199 bits (507),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 106/112 (95%), Gaps = 0/112 (0%)
 Frame = +2

Query  317  HGRAESANASRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISR  496
            H R +  +ASR+WISG+LALPAAAYM+ E++AHAAE+ERTFIAIKPDGVQRGL++EIISR
Sbjct  52   HSRVDPGHASRSWISGLLALPAAAYMLTEQEAHAAELERTFIAIKPDGVQRGLIAEIISR  111

Query  497  FERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            FERKGFKLVAIKI+VPSK FAQ+HYHDLK+RPFF+GLC+FLSSGPV+AMVWE
Sbjct  112  FERKGFKLVAIKIVVPSKDFAQKHYHDLKERPFFNGLCDFLSSGPVIAMVWE  163



>ref|XP_006368778.1| hypothetical protein POPTR_0001s10670g [Populus trichocarpa]
 gb|ERP65347.1| hypothetical protein POPTR_0001s10670g [Populus trichocarpa]
Length=238

 Score =   199 bits (506),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 106/163 (65%), Positives = 123/163 (75%), Gaps = 2/163 (1%)
 Frame = +2

Query  170  MNSRISRSAHCAARFL--SAYSKHssrafsggraagaasvvslrgvassllHGRAESANA  343
            M+S+I RSA  AAR L  SA       +     AA  A  +  +    S  +GR  S+N 
Sbjct  1    MSSQICRSASRAARSLLSSASKTSRFYSEGRAAAAVVAVSLGGKLPLLSSAYGRTGSSNL  60

Query  344  SRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLV  523
            +R WISG LA+PA  YM+QE++AHAAE+ERTFIAIKPDGVQRGL+SEIISRFERKGFKLV
Sbjct  61   ARQWISGALAIPAGVYMLQEQEAHAAELERTFIAIKPDGVQRGLISEIISRFERKGFKLV  120

Query  524  AIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            AIKI+VPSK FAQ+HYHDLK RPFF GLC+FLSSGPVVAMVWE
Sbjct  121  AIKIVVPSKDFAQKHYHDLKTRPFFDGLCDFLSSGPVVAMVWE  163



>gb|KDO76550.1| hypothetical protein CISIN_1g026399mg [Citrus sinensis]
Length=239

 Score =   199 bits (506),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 104/111 (94%), Gaps = 0/111 (0%)
 Frame = +2

Query  320  GRAESANASRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRF  499
            GRA S+ ASR+W+SG +A+PAAAY +QE++ HAAEMERTFIAIKPDGVQRGL+SEIISRF
Sbjct  54   GRAGSSTASRSWLSGAIAIPAAAYTLQEQEVHAAEMERTFIAIKPDGVQRGLISEIISRF  113

Query  500  ERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            ERKGFKLVAIKI+VPSK FAQ+HYHDLK+RPFF+GLC FLSSGPV+AMVWE
Sbjct  114  ERKGFKLVAIKIVVPSKEFAQKHYHDLKERPFFNGLCEFLSSGPVIAMVWE  164



>ref|XP_011022501.1| PREDICTED: nucleoside diphosphate kinase 3-like [Populus euphratica]
Length=236

 Score =   197 bits (501),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = +2

Query  317  HGRAESANASRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISR  496
            HGR  S+N++R WISG LA PAA YM+QE++AHAA+ME+TFIAIKPDGVQRGL+SEIISR
Sbjct  50   HGRTGSSNSARQWISGALAFPAAVYMLQEQEAHAAQMEQTFIAIKPDGVQRGLISEIISR  109

Query  497  FERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            FERKGFKLVAIK++VPSK  AQ+HYHDLK+RPFF+GLC+FLSSGPVVAMVWE
Sbjct  110  FERKGFKLVAIKVVVPSKEHAQKHYHDLKERPFFNGLCDFLSSGPVVAMVWE  161



>emb|CAN83625.1| hypothetical protein VITISV_041718 [Vitis vinifera]
 emb|CBI34488.3| unnamed protein product [Vitis vinifera]
Length=235

 Score =   197 bits (500),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 129/161 (80%), Gaps = 1/161 (1%)
 Frame = +2

Query  170  MNSRISRSAHCAARFLSAYSKHssrafsggraagaasvvslrgvassllHGRAESANASR  349
            M+S+I RSA  AAR L + SK SS   + GRA  A + +S RG       G A S NA R
Sbjct  1    MSSQICRSASRAARSLLSASK-SSNLLAEGRAVAAVAALSSRGKPFLSSFGNAGSGNAYR  59

Query  350  NWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAI  529
             W+S +LALPAAAYM+QE++ HA EMERTFIAIKPDGVQRGL++EI+SRFERKGFKLVAI
Sbjct  60   GWLSSVLALPAAAYMMQEQELHATEMERTFIAIKPDGVQRGLIAEILSRFERKGFKLVAI  119

Query  530  KIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            KI+VPSK FAQ+HYHDLK+RPFF+GLC+FLSSGPVVAMVWE
Sbjct  120  KIVVPSKDFAQKHYHDLKERPFFNGLCDFLSSGPVVAMVWE  160



>ref|XP_010529641.1| PREDICTED: nucleoside diphosphate kinase IV, chloroplastic/mitochondrial-like 
[Tarenaya hassleriana]
Length=237

 Score =   197 bits (500),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 125/162 (77%), Gaps = 1/162 (1%)
 Frame = +2

Query  170  MNSRISRSAHCAARFLSAYSKHssrafsggraagaasvvslrgvassllH-GRAESANAS  346
            M+S+I RSA  AAR L   +K++     G     AA V +   V     + G + + N S
Sbjct  1    MSSQICRSASRAARSLLPSAKNARFFSEGRAIGAAAVVSAGGKVPLFASNFGNSTAGNIS  60

Query  347  RNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVA  526
            R+WI G+LALPAAA+MIQ+++ HAAEMERTFIAIKPDGVQRGL+SEI+SRFERKGFKLV 
Sbjct  61   RSWICGLLALPAAAFMIQDQEVHAAEMERTFIAIKPDGVQRGLISEIVSRFERKGFKLVG  120

Query  527  IKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            IKI+VPSK FAQ+HYHDLK+RPFF+GLC FLSSGPVVAMVWE
Sbjct  121  IKILVPSKDFAQKHYHDLKERPFFNGLCEFLSSGPVVAMVWE  162



>ref|XP_002303650.1| nucleoside diphosphate kinase family protein [Populus trichocarpa]
 gb|ABK94942.1| unknown [Populus trichocarpa]
 gb|EEE78629.1| nucleoside diphosphate kinase family protein [Populus trichocarpa]
Length=236

 Score =   196 bits (499),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = +2

Query  317  HGRAESANASRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISR  496
            HGR  S+N +R WISG LA PAA YM+QE++AHAA+ME+TFIAIKPDGVQRGL+SEIISR
Sbjct  50   HGRTGSSNVARQWISGALAFPAAVYMLQEQEAHAAQMEQTFIAIKPDGVQRGLISEIISR  109

Query  497  FERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            FERKGFKLVAIK++VPSK  AQ+HYHDLK+RPFF+GLC+FLSSGPVVAMVWE
Sbjct  110  FERKGFKLVAIKVVVPSKEHAQKHYHDLKERPFFNGLCDFLSSGPVVAMVWE  161



>ref|XP_002509969.1| nucleoside diphosphate kinase, putative [Ricinus communis]
 gb|EEF51356.1| nucleoside diphosphate kinase, putative [Ricinus communis]
Length=236

 Score =   195 bits (496),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 105/161 (65%), Positives = 128/161 (80%), Gaps = 0/161 (0%)
 Frame = +2

Query  170  MNSRISRSAHCAARFLSAYSKHssrafsggraagaasvvslrgvassllHGRAESANASR  349
            M+S+I RSA  AAR L + SK SS  +S GRA  AA  +S +    +    +  S+  S 
Sbjct  1    MSSQIIRSASRAARSLLSASKTSSCFYSEGRAVAAAVSLSGKASFLASAFRKTGSSTVSA  60

Query  350  NWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAI  529
             WISG LA+PAA YM+QE++AHAAEMERTFIAIKPDGVQRGL++EI++RFERKGFKLV I
Sbjct  61   QWISGALAIPAAVYMLQEQEAHAAEMERTFIAIKPDGVQRGLIAEIVARFERKGFKLVGI  120

Query  530  KIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            K++VPSK FAQ+HYHDLK+RPFFSGLC+FLSSGPV+AMVWE
Sbjct  121  KVVVPSKEFAQKHYHDLKERPFFSGLCDFLSSGPVIAMVWE  161



>ref|XP_009341894.1| PREDICTED: nucleoside diphosphate kinase III, chloroplastic/mitochondrial-like 
[Pyrus x bretschneideri]
Length=238

 Score =   195 bits (495),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 88/111 (79%), Positives = 103/111 (93%), Gaps = 0/111 (0%)
 Frame = +2

Query  320  GRAESANASRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRF  499
            GRA S NASR WISG LA+PAAAYM+ +++ HAAE+ERTFIAIKPDGVQRGL++EIISRF
Sbjct  53   GRAGSDNASRRWISGALAIPAAAYMLVDQEVHAAELERTFIAIKPDGVQRGLIAEIISRF  112

Query  500  ERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            ERKGFKLV IK++VP+K FAQ+HYHDLK+RPFFSGLC+FLSSGPV+AMVWE
Sbjct  113  ERKGFKLVGIKVVVPTKDFAQKHYHDLKERPFFSGLCDFLSSGPVIAMVWE  163



>ref|XP_010455493.1| PREDICTED: nucleoside diphosphate kinase III, chloroplastic/mitochondrial-like 
isoform X2 [Camelina sativa]
Length=237

 Score =   195 bits (495),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 127/162 (78%), Gaps = 1/162 (1%)
 Frame = +2

Query  170  MNSRISRSAHCAARFLSAYSKHssrafsggraagaasvvslrgvassllHGRAE-SANAS  346
            M+S+ISRSA  AAR L + +K++         A AA   S +    +    RA  S  AS
Sbjct  1    MSSQISRSASKAARSLLSSAKNARFFSGRAIGAAAAVSASGKIPLYASNFARASGSGVAS  60

Query  347  RNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVA  526
            ++WI+G+LALPAAAYM+Q+++  AAEMERTFIAIKPDGVQRGL+SEI+SRFERKGFKLV 
Sbjct  61   KSWITGLLALPAAAYMLQDQEVLAAEMERTFIAIKPDGVQRGLISEIVSRFERKGFKLVG  120

Query  527  IKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            IK++VPSK FAQ+HYHDLK+RPFF+GLC+FLSSGPV+AMVWE
Sbjct  121  IKVVVPSKDFAQKHYHDLKERPFFNGLCDFLSSGPVIAMVWE  162



>ref|XP_007209538.1| hypothetical protein PRUPE_ppa010725mg [Prunus persica]
 gb|EMJ10737.1| hypothetical protein PRUPE_ppa010725mg [Prunus persica]
Length=238

 Score =   195 bits (495),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 107/163 (66%), Positives = 126/163 (77%), Gaps = 2/163 (1%)
 Frame = +2

Query  170  MNSRISRSAHCAAR-FLSAYSKHssrafsggraagaasvvslrgvassllH-GRAESANA  343
            M+S+I RSA  AAR FLSA  K S     G   A AA+V     V     + GRA S N 
Sbjct  1    MSSQICRSASRAARSFLSAAPKSSRFYSEGRAVAAAAAVTLSAKVPVFASNFGRAGSENV  60

Query  344  SRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLV  523
            SR WISG LALPAAAYM+ +++ HAAE+ERTFIAIKPDGVQRGL++EIISRFERKGFKLV
Sbjct  61   SRGWISGALALPAAAYMLVDQEVHAAELERTFIAIKPDGVQRGLIAEIISRFERKGFKLV  120

Query  524  AIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
             IK++VP+K FAQ+HYHDLK+RPFF+GLC+FLSSGPV+ MVWE
Sbjct  121  GIKVVVPTKDFAQKHYHDLKERPFFNGLCDFLSSGPVIGMVWE  163



>ref|XP_006284447.1| hypothetical protein CARUB_v10005628mg [Capsella rubella]
 gb|EOA17345.1| hypothetical protein CARUB_v10005628mg [Capsella rubella]
Length=236

 Score =   194 bits (494),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 125/161 (78%), Gaps = 0/161 (0%)
 Frame = +2

Query  170  MNSRISRSAHCAARFLSAYSKHssrafsggraagaasvvslrgvassllHGRAESANASR  349
            M+S+I RSA  AAR L + +K++         A      S +    +   G++ S  AS+
Sbjct  1    MSSQICRSASRAARSLLSSAKNARLFSGRAIGAATVVYASGKVPQYASSFGKSSSGFASK  60

Query  350  NWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAI  529
            +WI+G+LALPAAA+M+Q+++  AAEMERTFIAIKPDGVQRGL+SEIISRFERKG+KLV I
Sbjct  61   SWITGLLALPAAAFMLQDQEVLAAEMERTFIAIKPDGVQRGLISEIISRFERKGYKLVGI  120

Query  530  KIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            K+MVPSK FAQ+HYHDLK+RPFF+GLCNFLSSGPVVAMVWE
Sbjct  121  KVMVPSKGFAQKHYHDLKERPFFNGLCNFLSSGPVVAMVWE  161



>gb|EYU23340.1| hypothetical protein MIMGU_mgv1a012962mg [Erythranthe guttata]
Length=233

 Score =   194 bits (494),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 134/161 (83%), Gaps = 3/161 (2%)
 Frame = +2

Query  170  MNSRISRSAHCAARFLSAYSKHssrafsggraagaasvvslrgvassllHGRAESANASR  349
            M S+I+RSA     F+SA SK SSR+FSG  AA AA+V S   VAS    G +ES NA R
Sbjct  1    MRSQIARSARS---FISAASKQSSRSFSGRAAAAAAAVSSRGRVASLASFGASESGNAYR  57

Query  350  NWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAI  529
             WISG L L AAA+M++E++AHAAE+ERTFIAIKPDGVQRGL+SEII+RFERKGFKLVA+
Sbjct  58   GWISGALTLSAAAFMLREQEAHAAELERTFIAIKPDGVQRGLISEIIARFERKGFKLVAV  117

Query  530  KIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            KI++PSK FA++HYHDLK+RPFF+GLC+FLSSGPV+AMVWE
Sbjct  118  KIVIPSKGFAEKHYHDLKERPFFNGLCDFLSSGPVLAMVWE  158



>ref|NP_567690.1| nucleoside diphosphate kinase IV [Arabidopsis thaliana]
 sp|Q8LAH8.2|NDK4_ARATH RecName: Full=Nucleoside diphosphate kinase IV, chloroplastic/mitochondrial; 
Short=NDK IV; Short=NDP kinase IV; Short=NDPK 
IV; AltName: Full=Nucleoside diphosphate kinase 4; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAB43890.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB81308.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAB19789.1| nucleoside diphosphate kinase 4 [Arabidopsis thaliana]
 dbj|BAC42534.1| unknown protein [Arabidopsis thaliana]
 gb|ABF74700.1| At4g23900 [Arabidopsis thaliana]
 gb|AEE84824.1| nucleoside diphosphate kinase IV [Arabidopsis thaliana]
Length=237

 Score =   194 bits (493),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 127/162 (78%), Gaps = 1/162 (1%)
 Frame = +2

Query  170  MNSRISRSAHCAARFLSAYSKHssrafsggraagaasvvslrgvassllH-GRAESANAS  346
            M+S+I RSA  AAR L + +K++     G     A+ V +   V     + G++ S   S
Sbjct  1    MSSQICRSASRAARSLLSSAKNARFFSEGRAIGAASVVHATGKVPQYASNFGKSGSGFVS  60

Query  347  RNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVA  526
             +WI+G+LALPAAA+M+Q+++A AAEMERTFIAIKPDGVQRGL+SEII+RFERKG+KLV 
Sbjct  61   NSWITGLLALPAAAFMLQDQEALAAEMERTFIAIKPDGVQRGLISEIITRFERKGYKLVG  120

Query  527  IKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            IK+MVPSK FAQ+HYHDLK+RPFF+GLCNFLSSGPVVAMVWE
Sbjct  121  IKVMVPSKGFAQKHYHDLKERPFFNGLCNFLSSGPVVAMVWE  162



>ref|XP_008451953.1| PREDICTED: nucleoside diphosphate kinase 3-like [Cucumis melo]
Length=238

 Score =   194 bits (492),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +2

Query  326  AESANASRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFER  505
            A S  ASR WISG+LALPA  YM+QE++AHAAE ERTFIAIKPDGVQRGL+SEIISRFER
Sbjct  55   AGSGYASREWISGLLALPAGVYMLQEQEAHAAEFERTFIAIKPDGVQRGLISEIISRFER  114

Query  506  KGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            KGFKLV IK++VPSK FAQ+HYHDLK+RPFF+GLC FLSSGPV+AMVWE
Sbjct  115  KGFKLVGIKVVVPSKEFAQKHYHDLKERPFFNGLCEFLSSGPVIAMVWE  163



>ref|XP_009358610.1| PREDICTED: nucleoside diphosphate kinase 3-like [Pyrus x bretschneideri]
Length=238

 Score =   194 bits (492),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 125/163 (77%), Gaps = 2/163 (1%)
 Frame = +2

Query  170  MNSRISRSAHCAAR-FLSA-YSKHssrafsggraagaasvvslrgvassllHGRAESANA  343
            M SRI RSA  A R FLSA  +   S +     A  AA  +  +    +   GRA S NA
Sbjct  1    MTSRICRSASRATRSFLSAPKASSRSYSAGRTVATAAAVALGSKAPFFASSFGRAGSDNA  60

Query  344  SRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLV  523
            S+ WISG LA+PAAAYM+ +++ HAAE+ERTFIAIKPDGVQRGL++EIISRFERKGFKLV
Sbjct  61   SKGWISGALAVPAAAYMLVDQEVHAAELERTFIAIKPDGVQRGLIAEIISRFERKGFKLV  120

Query  524  AIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
             IK++VP+K FAQ+HYHDLK+RPFFSGLC+FLSSGPV+AMVWE
Sbjct  121  GIKVVVPTKDFAQKHYHDLKERPFFSGLCDFLSSGPVIAMVWE  163



>gb|KDO76551.1| hypothetical protein CISIN_1g026399mg [Citrus sinensis]
Length=230

 Score =   193 bits (491),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  320  GRAESANASRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRF  499
            GRA S+ ASR+W+SG +A+PAAAY +QE++ HAAEMERTFIAIKPDGVQRGL+SEIISRF
Sbjct  54   GRAGSSTASRSWLSGAIAIPAAAYTLQEQEVHAAEMERTFIAIKPDGVQRGLISEIISRF  113

Query  500  ERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMV  646
            ERKGFKLVAIKI+VPSK FAQ+HYHDLK+RPFF+GLC FLSSGPV+AMV
Sbjct  114  ERKGFKLVAIKIVVPSKEFAQKHYHDLKERPFFNGLCEFLSSGPVIAMV  162



>ref|XP_010055873.1| PREDICTED: uncharacterized protein LOC104443996 [Eucalyptus grandis]
Length=467

 Score =   199 bits (507),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = +2

Query  323  RAESANASRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFE  502
            RA SANASR WI+G LALPAA YM+QE++AHAAE+ER+FIAIKPDGVQRGL+SEIISRFE
Sbjct  283  RAGSANASRGWITGALALPAAVYMLQEQEAHAAELERSFIAIKPDGVQRGLISEIISRFE  342

Query  503  RKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            RKGFKLVAIK++VP+K FAQ+HYHDLK+RPFF+GLC+FLSSGPVVAMVWE
Sbjct  343  RKGFKLVAIKVVVPTKDFAQKHYHDLKERPFFNGLCDFLSSGPVVAMVWE  392



>ref|XP_008341606.1| PREDICTED: nucleoside diphosphate kinase III, chloroplastic/mitochondrial-like 
[Malus domestica]
Length=238

 Score =   193 bits (490),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 87/111 (78%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = +2

Query  320  GRAESANASRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRF  499
            GRA S NASR WISG LA+PAAAY++ +++ HAAE+ERTFIAIKPDGVQRGL++EIISRF
Sbjct  53   GRAGSDNASRGWISGALAIPAAAYILVDQEVHAAELERTFIAIKPDGVQRGLIAEIISRF  112

Query  500  ERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            ERKGFKLV IK++VP+K FAQ+HYHDLK+RPFFSGLC FLSSGPV+AMVWE
Sbjct  113  ERKGFKLVGIKVVVPTKDFAQKHYHDLKERPFFSGLCEFLSSGPVIAMVWE  163



>ref|XP_010435717.1| PREDICTED: nucleoside diphosphate kinase III, chloroplastic/mitochondrial 
isoform X2 [Camelina sativa]
Length=237

 Score =   192 bits (489),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 126/162 (78%), Gaps = 1/162 (1%)
 Frame = +2

Query  170  MNSRISRSAHCAARFLSAYSKHssrafsggraagaasvvslrgvassllHGRAE-SANAS  346
            M+S+I RSA  AAR L + +K++         A AA   S +    +    RA  S  AS
Sbjct  1    MSSQICRSASKAARSLLSSAKNARFFSGRAIGAAAAVSASGKIPLYASNFARASGSGVAS  60

Query  347  RNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVA  526
            ++WI+G+LALPAAAYM+Q+++  AAEMERTFIAIKPDGVQRGL+SEI+SRFERKGFKLV 
Sbjct  61   KSWITGLLALPAAAYMLQDQEVLAAEMERTFIAIKPDGVQRGLISEIVSRFERKGFKLVG  120

Query  527  IKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            IK++VPSK FAQ+HYHDLK+RPFF+GLC+FLSSGPV+AMVWE
Sbjct  121  IKVVVPSKDFAQKHYHDLKERPFFNGLCDFLSSGPVIAMVWE  162



>emb|CDY47613.1| BnaA01g13520D [Brassica napus]
Length=237

 Score =   192 bits (489),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 125/162 (77%), Gaps = 1/162 (1%)
 Frame = +2

Query  170  MNSRISRSAHCAARFLSAYSKHssrafsggraagaasvvslrgvassllHGR-AESANAS  346
            M+S+I RSA  AAR L + SK++     G     A  V +   V  +  + R + S  AS
Sbjct  1    MSSQICRSATRAARSLLSSSKNTRFFSEGRAIGAATVVYASGKVPQNASNFRQSRSGFAS  60

Query  347  RNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVA  526
            ++WI+G+LALP AA+M+Q+++ HAAEMERTFIAIKPDGVQRGL+SEII+RFERKGFKLV 
Sbjct  61   KSWITGLLALPTAAFMLQDQEVHAAEMERTFIAIKPDGVQRGLISEIITRFERKGFKLVG  120

Query  527  IKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            +KIMVPSK FAQ+HYH  K+RPFF+GLCNFLSSGPVVAMVWE
Sbjct  121  LKIMVPSKGFAQQHYHGAKERPFFNGLCNFLSSGPVVAMVWE  162



>gb|KFK31881.1| hypothetical protein AALP_AA6G170800 [Arabis alpina]
Length=237

 Score =   192 bits (488),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 125/162 (77%), Gaps = 1/162 (1%)
 Frame = +2

Query  170  MNSRISRSAHCAARFLSAYSKHssrafsggraagaasvvslrgvassl-lHGRAESANAS  346
            M+S+I RSA  AAR L + +K++     G     A S      + +S  + G   S  AS
Sbjct  1    MSSQICRSASKAARSLLSSAKNARLFSEGRAIGAAVSASGKIPLYASNFVRGSTSSGVAS  60

Query  347  RNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVA  526
            ++WI+GILA+PAAA+M+Q++D  AAEMERTFIAIKPDGVQRGL+SEIISRFERKGFKLV 
Sbjct  61   KSWITGILAVPAAAFMLQDQDVLAAEMERTFIAIKPDGVQRGLISEIISRFERKGFKLVG  120

Query  527  IKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            IK++ PSK FAQ+HYHDLK+RPFF+GLC+FLSSGPV+AMVWE
Sbjct  121  IKVVAPSKDFAQKHYHDLKERPFFNGLCDFLSSGPVIAMVWE  162



>ref|XP_004148997.1| PREDICTED: nucleoside diphosphate kinase IV, chloroplastic/mitochondrial-like 
[Cucumis sativus]
 ref|XP_004162672.1| PREDICTED: nucleoside diphosphate kinase IV, chloroplastic/mitochondrial-like 
[Cucumis sativus]
 gb|KGN53409.1| Nucleoside diphosphate kinase [Cucumis sativus]
Length=238

 Score =   192 bits (487),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +2

Query  326  AESANASRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFER  505
            A S  ASR WISG+LALPA  +M+QE++AHAAE ERTFIAIKPDGVQRGL+SEIISRFER
Sbjct  55   AGSGYASREWISGLLALPAGVFMLQEQEAHAAEFERTFIAIKPDGVQRGLISEIISRFER  114

Query  506  KGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            KGFKLV IK++VPSK FAQ+HYHDLK+RPFF+GLC FLSSGPV+AMVWE
Sbjct  115  KGFKLVGIKVIVPSKEFAQKHYHDLKERPFFNGLCEFLSSGPVIAMVWE  163



>ref|XP_006284448.1| hypothetical protein CARUB_v10005628mg [Capsella rubella]
 gb|EOA17346.1| hypothetical protein CARUB_v10005628mg [Capsella rubella]
Length=237

 Score =   191 bits (486),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +2

Query  341  ASRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKL  520
            AS++WI+G+LALPAAA+M+Q+++  AAEMERTFIAIKPDGVQRGL+SEIISRFERKG+KL
Sbjct  59   ASKSWITGLLALPAAAFMLQDQEVLAAEMERTFIAIKPDGVQRGLISEIISRFERKGYKL  118

Query  521  VAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            V IK+MVPSK FAQ+HYHDLK+RPFF+GLCNFLSSGPVVAMVWE
Sbjct  119  VGIKVMVPSKGFAQKHYHDLKERPFFNGLCNFLSSGPVVAMVWE  162



>ref|XP_009137500.1| PREDICTED: nucleoside diphosphate kinase IV, chloroplastic/mitochondrial 
[Brassica rapa]
Length=237

 Score =   191 bits (486),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 125/162 (77%), Gaps = 1/162 (1%)
 Frame = +2

Query  170  MNSRISRSAHCAARFLSAYSKHssrafsggraagaasvvslrgvassllHGR-AESANAS  346
            M+S+I RSA  AAR L + SK++     G     A  V +   V  +  + R + S  AS
Sbjct  1    MSSQICRSATRAARSLLSSSKNTRFFSEGRAIGAATVVYASGKVPQNASNFRQSRSGFAS  60

Query  347  RNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVA  526
            ++W++G+LALP AA+M+Q+++ HAAEMERTFIAIKPDGVQRGL+SEII+RFERKGFKLV 
Sbjct  61   KSWMTGLLALPTAAFMLQDQEVHAAEMERTFIAIKPDGVQRGLISEIITRFERKGFKLVG  120

Query  527  IKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            +KIMVPSK FAQ+HYH  K+RPFF+GLCNFLSSGPVVAMVWE
Sbjct  121  LKIMVPSKGFAQQHYHGAKERPFFNGLCNFLSSGPVVAMVWE  162



>emb|CDX94238.1| BnaC02g28980D [Brassica napus]
Length=235

 Score =   191 bits (485),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 127/161 (79%), Gaps = 1/161 (1%)
 Frame = +2

Query  170  MNSRISRSAHCAARFLSAYSKHssrafsggraagaasvvslrgvassllHGRAESANASR  349
            M+S+I RSA  AAR L + +K++     G     A +V +   +     +  A S+ +S+
Sbjct  1    MSSQICRSASKAARSLLSSAKNARFFSEGRAIGAAGAVTASGKLPLYASN-FARSSGSSK  59

Query  350  NWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAI  529
            +WI+G+LALPAAA+M+Q+++  AAEMERTFIAIKPDGVQRGL+SEIISRFERKGFKLV I
Sbjct  60   SWITGLLALPAAAFMVQDQEVFAAEMERTFIAIKPDGVQRGLISEIISRFERKGFKLVGI  119

Query  530  KIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            K++VPSK FAQ+HYHDLK+RPFF+GLC+FLSSGPV+AMVWE
Sbjct  120  KVVVPSKDFAQKHYHDLKERPFFNGLCDFLSSGPVIAMVWE  160



>ref|XP_010455492.1| PREDICTED: nucleoside diphosphate kinase III, chloroplastic/mitochondrial-like 
isoform X1 [Camelina sativa]
Length=238

 Score =   191 bits (485),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 102/163 (63%), Positives = 129/163 (79%), Gaps = 2/163 (1%)
 Frame = +2

Query  170  MNSRISRSAHCAARFLSAYSKHssrafsggraagaasvvslrgvassllH-GRAE-SANA  343
            M+S+ISRSA  AAR L + +K++     G     AA+V +   +     +  RA  S  A
Sbjct  1    MSSQISRSASKAARSLLSSAKNARFFSEGRAIGAAAAVSASGKIPLYASNFARASGSGVA  60

Query  344  SRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLV  523
            S++WI+G+LALPAAAYM+Q+++  AAEMERTFIAIKPDGVQRGL+SEI+SRFERKGFKLV
Sbjct  61   SKSWITGLLALPAAAYMLQDQEVLAAEMERTFIAIKPDGVQRGLISEIVSRFERKGFKLV  120

Query  524  AIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
             IK++VPSK FAQ+HYHDLK+RPFF+GLC+FLSSGPV+AMVWE
Sbjct  121  GIKVVVPSKDFAQKHYHDLKERPFFNGLCDFLSSGPVIAMVWE  163



>dbj|BAH20188.1| AT4G11010 [Arabidopsis thaliana]
Length=238

 Score =   191 bits (485),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +2

Query  332  SANASRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKG  511
            S  AS++WI+G+LALPAAAYMIQ+++  AAEMERTFIAIKPDGVQRGL+SEIISRFERKG
Sbjct  57   SGVASKSWITGLLALPAAAYMIQDQEVLAAEMERTFIAIKPDGVQRGLISEIISRFERKG  116

Query  512  FKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            FKLV IK++VPSK FAQ+HYHDLK+RPFF+GLC+FLSSGPV+AMVWE
Sbjct  117  FKLVGIKVIVPSKDFAQKHYHDLKERPFFNGLCDFLSSGPVIAMVWE  163



>ref|XP_008799583.1| PREDICTED: nucleoside diphosphate kinase 3-like [Phoenix dactylifera]
Length=237

 Score =   191 bits (485),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 122/162 (75%), Gaps = 1/162 (1%)
 Frame = +2

Query  170  MNSRISRSAHCAARFLSAYSKHssrafsggraagaasvvslrgvassll-HGRAESANAS  346
            MNSR+ RSA    R L A S+ S     G  AA A          S    + +A+  N  
Sbjct  1    MNSRVYRSAPRTVRALLAASRSSPLLSEGRTAAAATITTLGGKPLSVSSFYEKADRRNTP  60

Query  347  RNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVA  526
            R W+SG++++PAAAYM Q+++AHAAE+ERTFIAIKPDGVQRGL++EIISRFERKG+KLVA
Sbjct  61   RGWVSGLISIPAAAYMFQDQEAHAAELERTFIAIKPDGVQRGLIAEIISRFERKGYKLVA  120

Query  527  IKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            IK++VPSK FAQ HYHDLKDRPFF+GLC+FLSSGPV+AMVWE
Sbjct  121  IKLIVPSKEFAQTHYHDLKDRPFFNGLCDFLSSGPVLAMVWE  162



>ref|NP_192839.1| nucleoside diphosphate kinase 3 [Arabidopsis thaliana]
 sp|O49203.1|NDK3_ARATH RecName: Full=Nucleoside diphosphate kinase III, chloroplastic/mitochondrial; 
Short=NDK III; Short=NDP kinase III; Short=NDPK 
III; Flags: Precursor [Arabidopsis thaliana]
 gb|AAC00512.1| nucleoside diphosphate kinase 3 [Arabidopsis thaliana]
 gb|AAC33956.1| contains similarity to nucleoside diphosphate kinases (Pfam: 
NDK.hmm, score: 301.12) [Arabidopsis thaliana]
 emb|CAB40069.1| nucleoside diphosphate kinase 3 (ndpk3) [Arabidopsis thaliana]
 emb|CAB81202.1| nucleoside diphosphate kinase 3 (ndpk3) [Arabidopsis thaliana]
 gb|AAK59688.1| putative nucleoside diphosphate kinase ndpk3 [Arabidopsis thaliana]
 gb|AAL33810.1| putative nucleoside diphosphate kinase 3 [Arabidopsis thaliana]
 gb|AEE82961.1| nucleoside diphosphate kinase 3 [Arabidopsis thaliana]
Length=238

 Score =   191 bits (485),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +2

Query  332  SANASRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKG  511
            S  AS++WI+G+LALPAAAYMIQ+++  AAEMERTFIAIKPDGVQRGL+SEIISRFERKG
Sbjct  57   SGVASKSWITGLLALPAAAYMIQDQEVLAAEMERTFIAIKPDGVQRGLISEIISRFERKG  116

Query  512  FKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            FKLV IK++VPSK FAQ+HYHDLK+RPFF+GLC+FLSSGPV+AMVWE
Sbjct  117  FKLVGIKVIVPSKDFAQKHYHDLKERPFFNGLCDFLSSGPVIAMVWE  163



>gb|AAM65336.1| nucleoside diphosphate kinase 3 (ndpk3) [Arabidopsis thaliana]
Length=237

 Score =   191 bits (484),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 125/162 (77%), Gaps = 1/162 (1%)
 Frame = +2

Query  170  MNSRISRSAHCAARFLSAYSKHssrafsggraagaasvvslrgvassllH-GRAESANAS  346
            M+S+I RSA  AAR L + +K++     G     A  V +   V     + G++ S   S
Sbjct  1    MSSQICRSASRAARSLLSSAKNARFFSEGRAIGAATVVHATGKVPQYASNFGKSGSGFVS  60

Query  347  RNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVA  526
             +WI+ +LALPAAA+M+Q+++A AAEMERTFIAIKPDGVQRGL+SEII+RFERKG+KLV 
Sbjct  61   NSWITRLLALPAAAFMLQDQEALAAEMERTFIAIKPDGVQRGLISEIITRFERKGYKLVG  120

Query  527  IKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            IK+MVPSK FAQ+HYHDLK+RPFF+GLCNFLSSGPVVAMVWE
Sbjct  121  IKVMVPSKGFAQKHYHDLKERPFFNGLCNFLSSGPVVAMVWE  162



>emb|CDY25267.1| BnaA02g21890D [Brassica napus]
Length=235

 Score =   190 bits (483),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 128/161 (80%), Gaps = 1/161 (1%)
 Frame = +2

Query  170  MNSRISRSAHCAARFLSAYSKHssrafsggraagaasvvslrgvassllHGRAESANASR  349
            M+S+I RSA  AAR L + +K++     G     AA+V +   +     +  A S+ +S+
Sbjct  1    MSSQICRSASKAARSLLSSAKNARFFSEGRAIGAAAAVTASGKMPLYASN-FARSSGSSK  59

Query  350  NWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAI  529
            +WI+G+LALPAAA+M+Q+++  AAEMERTFIAIKPDGVQRGL+SEIISRFERKGFKLV I
Sbjct  60   SWITGLLALPAAAFMVQDQEVFAAEMERTFIAIKPDGVQRGLISEIISRFERKGFKLVGI  119

Query  530  KIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            K++VPSK FAQ+HYHDLK+RPFF+GLC+FLSSGPV+AMVWE
Sbjct  120  KVVVPSKDFAQKHYHDLKERPFFNGLCDFLSSGPVIAMVWE  160



>ref|XP_010433842.1| PREDICTED: nucleoside diphosphate kinase IV, chloroplastic/mitochondrial 
isoform X1 [Camelina sativa]
Length=237

 Score =   190 bits (483),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 123/162 (76%), Gaps = 1/162 (1%)
 Frame = +2

Query  170  MNSRISRSAHCAARFLSAYSKHssrafsggraagaasvvslrgvassllHGRAESANA-S  346
            MNS+I RSA  AAR L + +K++     G     A  V +   V          S+   S
Sbjct  1    MNSQICRSASRAARSLLSSAKNARFLSEGRAVGAATVVHASGKVPQYASSFGKSSSGFNS  60

Query  347  RNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVA  526
            ++WI+G+LALPAAA+M+Q+++  AAEMERTFIAIKPDGVQRGLVSEI+SRFERKG+KLV 
Sbjct  61   KSWITGLLALPAAAFMLQDQEVLAAEMERTFIAIKPDGVQRGLVSEIVSRFERKGYKLVG  120

Query  527  IKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            IK+MVPSK FAQ+HYHDLK+RPFF+GLCNFLSSGPVVAMVWE
Sbjct  121  IKVMVPSKGFAQKHYHDLKERPFFNGLCNFLSSGPVVAMVWE  162



>gb|EYU23339.1| hypothetical protein MIMGU_mgv1a012962mg [Erythranthe guttata]
Length=234

 Score =   190 bits (482),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 103/111 (93%), Gaps = 0/111 (0%)
 Frame = +2

Query  320  GRAESANASRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRF  499
            G +ES NA R WISG L L AAA+M++E++AHAAE+ERTFIAIKPDGVQRGL+SEII+RF
Sbjct  49   GASESGNAYRGWISGALTLSAAAFMLREQEAHAAELERTFIAIKPDGVQRGLISEIIARF  108

Query  500  ERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            ERKGFKLVA+KI++PSK FA++HYHDLK+RPFF+GLC+FLSSGPV+AMVWE
Sbjct  109  ERKGFKLVAVKIVIPSKGFAEKHYHDLKERPFFNGLCDFLSSGPVLAMVWE  159



>ref|XP_008374059.1| PREDICTED: nucleoside diphosphate kinase III, chloroplastic/mitochondrial-like 
[Malus domestica]
 ref|XP_008346639.1| PREDICTED: nucleoside diphosphate kinase III, chloroplastic/mitochondrial-like 
[Malus domestica]
Length=238

 Score =   190 bits (483),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 86/111 (77%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = +2

Query  320  GRAESANASRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRF  499
            GRA S  AS+ WISG LA+PAAAYM+ +++ HAAE+ERTFIAIKPDGVQRGL++EIISRF
Sbjct  53   GRAGSDXASKXWISGALAVPAAAYMLVDQEVHAAELERTFIAIKPDGVQRGLIAEIISRF  112

Query  500  ERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            ERKGFKLV IK++VP+K FAQ+HYHDLK+RPFFSGLC+FLSSGPV+AMVWE
Sbjct  113  ERKGFKLVGIKVVVPTKDFAQKHYHDLKERPFFSGLCDFLSSGPVIAMVWE  163



>ref|XP_010448644.1| PREDICTED: nucleoside diphosphate kinase IV, chloroplastic/mitochondrial-like 
[Camelina sativa]
Length=237

 Score =   190 bits (482),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = +2

Query  323  RAESANASRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFE  502
            ++ S   S++WI+G+LALPAAA+M+Q+++  AAEMERTFIAIKPDGVQRGL+SEIISRFE
Sbjct  53   KSSSGFESKSWITGLLALPAAAFMLQDQEVLAAEMERTFIAIKPDGVQRGLISEIISRFE  112

Query  503  RKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            RKG+KLV IK+MVPSK FAQ+HYHDLK+RPFF+GLCNFLSSGPV+AMVWE
Sbjct  113  RKGYKLVGIKVMVPSKGFAQKHYHDLKERPFFNGLCNFLSSGPVIAMVWE  162



>ref|XP_008239173.1| PREDICTED: uncharacterized protein LOC103337781 [Prunus mume]
Length=509

 Score =   197 bits (500),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 129/167 (77%), Gaps = 2/167 (1%)
 Frame = +2

Query  158  KVLTMNSRISRSAHCAAR-FLSAYSKHssrafsggraagaasvvslrgvassllH-GRAE  331
            ++L M+S+I RSA  AAR FLSA  K S     G   A AA+V     V     + GRA 
Sbjct  268  QLLKMSSQICRSASRAARSFLSAAPKSSRFYSEGRAVAAAAAVTLSSKVPVFASNFGRAG  327

Query  332  SANASRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKG  511
            S N SR WISG LALPAAAYM+ +++ HAAE+ERTFIAIKPDGVQRGL++EIISRFERKG
Sbjct  328  SENVSRGWISGALALPAAAYMLVDQEVHAAELERTFIAIKPDGVQRGLIAEIISRFERKG  387

Query  512  FKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            FKLV IK+++P+K FAQ+HYHDLK+RPFF+GLC+FLSSGPV+ MVWE
Sbjct  388  FKLVGIKVVIPTKDFAQKHYHDLKERPFFNGLCDFLSSGPVIGMVWE  434



>ref|XP_006288481.1| hypothetical protein CARUB_v10001740mg, partial [Capsella rubella]
 gb|EOA21379.1| hypothetical protein CARUB_v10001740mg, partial [Capsella rubella]
Length=263

 Score =   190 bits (483),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +2

Query  332  SANASRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKG  511
            S  AS++WI+G+LALPAAAYMIQ+++  AAEMERTFIAIKPDGVQRGL+SEI+SRFERKG
Sbjct  82   SGVASKSWITGLLALPAAAYMIQDQEVLAAEMERTFIAIKPDGVQRGLISEIVSRFERKG  141

Query  512  FKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            FKLV IK++VPSK FAQ+HYHDLK+RPFF+GLC+FLSSGPV+AMVWE
Sbjct  142  FKLVGIKVIVPSKDFAQKHYHDLKERPFFNGLCDFLSSGPVIAMVWE  188



>ref|XP_008367908.1| PREDICTED: nucleoside diphosphate kinase 3-like, partial [Malus 
domestica]
Length=230

 Score =   189 bits (480),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 86/111 (77%), Positives = 103/111 (93%), Gaps = 0/111 (0%)
 Frame = +2

Query  320  GRAESANASRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRF  499
            GRA S +AS+ WISG LA+PAAAYM+ +++ HAAE+ERTFIAIKPDGVQRGL++EIISRF
Sbjct  45   GRAGSDSASKXWISGALAVPAAAYMLVDQEVHAAELERTFIAIKPDGVQRGLIAEIISRF  104

Query  500  ERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            ERKGFKLV IK++VP+K FAQ+HYHDLK+RPFFSGLC+FLSSGPV+AMVWE
Sbjct  105  ERKGFKLVGIKVVVPTKDFAQKHYHDLKERPFFSGLCDFLSSGPVIAMVWE  155



>ref|XP_010093431.1| Nucleoside diphosphate kinase IV [Morus notabilis]
 gb|EXB54041.1| Nucleoside diphosphate kinase IV [Morus notabilis]
Length=233

 Score =   189 bits (480),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 87/111 (78%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = +2

Query  320  GRAESANASRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRF  499
            GRA S NA + WISG LALPAAAYM  +++ HAAE E TFIAIKPDGVQRGL++EIISRF
Sbjct  48   GRAGSDNAFKTWISGALALPAAAYMFLDQEVHAAEFEHTFIAIKPDGVQRGLIAEIISRF  107

Query  500  ERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            ERKGFKLVAIK+++PSK FAQ+HYHDLK+RPFF+GLC+FLSSGPVVAMVWE
Sbjct  108  ERKGFKLVAIKVVIPSKEFAQKHYHDLKERPFFNGLCDFLSSGPVVAMVWE  158



>ref|XP_010435712.1| PREDICTED: nucleoside diphosphate kinase III, chloroplastic/mitochondrial 
isoform X1 [Camelina sativa]
Length=238

 Score =   189 bits (480),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +2

Query  332  SANASRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKG  511
            S  AS++WI+G+LALPAAAYM+Q+++  AAEMERTFIAIKPDGVQRGL+SEI+SRFERKG
Sbjct  57   SGVASKSWITGLLALPAAAYMLQDQEVLAAEMERTFIAIKPDGVQRGLISEIVSRFERKG  116

Query  512  FKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            FKLV IK++VPSK FAQ+HYHDLK+RPFF+GLC+FLSSGPV+AMVWE
Sbjct  117  FKLVGIKVVVPSKDFAQKHYHDLKERPFFNGLCDFLSSGPVIAMVWE  163



>ref|XP_010422030.1| PREDICTED: nucleoside diphosphate kinase III, chloroplastic/mitochondrial-like 
[Camelina sativa]
Length=238

 Score =   189 bits (480),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +2

Query  332  SANASRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKG  511
            S  AS++WI+G+LALPAAAYM+Q+++  AAEMERTFIAIKPDGVQRGL+SEI+SRFERKG
Sbjct  57   SGVASKSWITGLLALPAAAYMLQDQEVLAAEMERTFIAIKPDGVQRGLISEIVSRFERKG  116

Query  512  FKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            FKLV IK++VPSK FAQ+HYHDLK+RPFF+GLC+FLSSGPV+AMVWE
Sbjct  117  FKLVGIKVVVPSKDFAQKHYHDLKERPFFNGLCDFLSSGPVIAMVWE  163



>ref|XP_010267647.1| PREDICTED: uncharacterized protein LOC104604801 [Nelumbo nucifera]
Length=465

 Score =   195 bits (496),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = +2

Query  317  HGRAESANASRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISR  496
            +GRA S ++SR WISG LALPAA  M+QE++AHAAEMERTFIAIKPDGVQRGL++EIISR
Sbjct  279  YGRAGSRSSSRGWISGALALPAAVCMLQEQEAHAAEMERTFIAIKPDGVQRGLIAEIISR  338

Query  497  FERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            FERKGFKLVAIK++ PSK FAQ+HYHDLKDRPFF+GLC+FLSSGPV+AMVWE
Sbjct  339  FERKGFKLVAIKLIAPSKEFAQKHYHDLKDRPFFNGLCDFLSSGPVLAMVWE  390



>ref|NP_001288978.1| nucleoside diphosphate kinase III, chloroplastic/mitochondrial 
[Brassica rapa]
 dbj|BAB86842.1| NDPK III [Brassica rapa]
Length=235

 Score =   189 bits (479),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 127/161 (79%), Gaps = 1/161 (1%)
 Frame = +2

Query  170  MNSRISRSAHCAARFLSAYSKHssrafsggraagaasvvslrgvassllHGRAESANASR  349
            M+S+I RSA  AAR L + +K++     G     AA+V +   +     +  A S+ +S+
Sbjct  1    MSSQICRSASKAARSLLSSAKNARFFSEGRAIGAAAAVTASGKMPLYASN-FARSSGSSK  59

Query  350  NWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAI  529
            +WI+G+LALPAAA+M+Q++   AAEMERTFIAIKPDGVQRGL+SEIISRFERKGFKLV I
Sbjct  60   SWITGLLALPAAAFMVQDQKVFAAEMERTFIAIKPDGVQRGLISEIISRFERKGFKLVGI  119

Query  530  KIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            K++VPSK FAQ+HYHDLK+RPFF+GLC+FLSSGPV+AMVWE
Sbjct  120  KVVVPSKDFAQKHYHDLKERPFFNGLCDFLSSGPVIAMVWE  160



>ref|XP_010659305.1| PREDICTED: uncharacterized protein LOC100263310 [Vitis vinifera]
Length=466

 Score =   195 bits (496),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = +2

Query  320  GRAESANASRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRF  499
            G A S NA R W+S +LALPAAAYM+QE++ HA EMERTFIAIKPDGVQRGL++EI+SRF
Sbjct  281  GNAGSGNAYRGWLSSVLALPAAAYMMQEQELHATEMERTFIAIKPDGVQRGLIAEILSRF  340

Query  500  ERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            ERKGFKLVAIKI+VPSK FAQ+HYHDLK+RPFF+GLC+FLSSGPVVAMVWE
Sbjct  341  ERKGFKLVAIKIVVPSKDFAQKHYHDLKERPFFNGLCDFLSSGPVVAMVWE  391



>emb|CDY03508.1| BnaC01g15740D [Brassica napus]
Length=237

 Score =   188 bits (478),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 123/162 (76%), Gaps = 1/162 (1%)
 Frame = +2

Query  170  MNSRISRSAHCAARFLSAYSKHssrafsggraagaasvvslrgvassllHGRAESAN-AS  346
            M+S+I RSA  AAR L + SK++     G     A  V +   V     + R   +  AS
Sbjct  1    MSSQICRSATRAARSLLSSSKNTHFFSEGRAIGAATLVYASGKVPQYASNFRQSGSTFAS  60

Query  347  RNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVA  526
            ++WI+G+LALP AA+M+Q+++ HAAEMERTFIAIKPDGVQRGL+SEII+RFERKGFKLV 
Sbjct  61   KSWITGLLALPTAAFMLQDQEVHAAEMERTFIAIKPDGVQRGLISEIITRFERKGFKLVG  120

Query  527  IKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            +KIMVPSK FAQ+HYH  K+RPFF+GLC+F+SSGPVVAMVWE
Sbjct  121  LKIMVPSKGFAQQHYHGAKERPFFNGLCDFISSGPVVAMVWE  162



>ref|XP_011074410.1| PREDICTED: uncharacterized protein LOC105159148 [Sesamum indicum]
Length=461

 Score =   194 bits (494),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +2

Query  332  SANASRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKG  511
            S NA + WISG+LALPAA +M+QE++AHAAEMERTFIAIKPDGVQRGL+SEIISRFERKG
Sbjct  282  SGNAYKGWISGVLALPAAVFMLQEQEAHAAEMERTFIAIKPDGVQRGLISEIISRFERKG  341

Query  512  FKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            FKLVAIK++VPSK FA++HYHDLK+RPFF+GLC+FLSSGPV+AMVWE
Sbjct  342  FKLVAIKVVVPSKDFAKKHYHDLKERPFFNGLCDFLSSGPVIAMVWE  388



>ref|XP_011101052.1| PREDICTED: uncharacterized protein LOC105179150 [Sesamum indicum]
Length=471

 Score =   193 bits (490),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 87/111 (78%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = +2

Query  320  GRAESANASRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRF  499
            G +ES NA R+WI G L LP AA M+Q+++AHAAEMERTFIAIKPDGVQRGL+SEI+SRF
Sbjct  286  GTSESGNAYRSWIYGALVLPTAAIMLQDQEAHAAEMERTFIAIKPDGVQRGLISEIVSRF  345

Query  500  ERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            ERKGFKLVAIKI++PSK FA++HYHDLK+RPFF+GLC+FLSSGPVVAMVWE
Sbjct  346  ERKGFKLVAIKIVIPSKDFAEKHYHDLKERPFFNGLCDFLSSGPVVAMVWE  396



>gb|AFK43052.1| unknown [Lotus japonicus]
Length=235

 Score =   186 bits (473),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  350  NWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAI  529
             W+SG LALPAAAYM+Q+++ HAAE+ERTFIAIKPDGVQRGL+SEIISRFERKGFKLV I
Sbjct  60   TWVSGALALPAAAYMLQDQEVHAAELERTFIAIKPDGVQRGLISEIISRFERKGFKLVGI  119

Query  530  KIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            K+++PSK FAQ+HYHDLK+RPFF+GLC FLSSGPV+AMVWE
Sbjct  120  KVLIPSKEFAQKHYHDLKERPFFNGLCEFLSSGPVIAMVWE  160



>ref|XP_009108206.1| PREDICTED: nucleoside diphosphate kinase III, chloroplastic/mitochondrial 
isoform X1 [Brassica rapa]
 emb|CDX86826.1| BnaA09g22160D [Brassica napus]
Length=236

 Score =   186 bits (471),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 96/100 (96%), Gaps = 0/100 (0%)
 Frame = +2

Query  353  WISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIK  532
            WI+G+LALPAAAYM+QE++  AAEMERTFIAIKPDGVQRGL+SEI++RFERKGFKLV IK
Sbjct  62   WITGLLALPAAAYMVQEQEVLAAEMERTFIAIKPDGVQRGLISEIVARFERKGFKLVGIK  121

Query  533  IMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            ++VPSK FAQ+HYHDLK+RPFF+GLC+FLSSGPV+AMVWE
Sbjct  122  VVVPSKDFAQKHYHDLKERPFFNGLCDFLSSGPVIAMVWE  161



>ref|XP_009108207.1| PREDICTED: nucleoside diphosphate kinase III, chloroplastic/mitochondrial 
isoform X2 [Brassica rapa]
Length=235

 Score =   186 bits (471),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 96/100 (96%), Gaps = 0/100 (0%)
 Frame = +2

Query  353  WISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIK  532
            WI+G+LALPAAAYM+QE++  AAEMERTFIAIKPDGVQRGL+SEI++RFERKGFKLV IK
Sbjct  61   WITGLLALPAAAYMVQEQEVLAAEMERTFIAIKPDGVQRGLISEIVARFERKGFKLVGIK  120

Query  533  IMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            ++VPSK FAQ+HYHDLK+RPFF+GLC+FLSSGPV+AMVWE
Sbjct  121  VVVPSKDFAQKHYHDLKERPFFNGLCDFLSSGPVIAMVWE  160



>ref|NP_001190817.1| Pleckstrin homology (PH) domain-containing protein [Arabidopsis 
thaliana]
 gb|AEE84823.1| Pleckstrin homology (PH) domain-containing protein [Arabidopsis 
thaliana]
Length=467

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/111 (77%), Positives = 103/111 (93%), Gaps = 0/111 (0%)
 Frame = +2

Query  320  GRAESANASRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRF  499
            G++ S   S +WI+G+LALPAAA+M+Q+++A AAEMERTFIAIKPDGVQRGL+SEII+RF
Sbjct  282  GKSGSGFVSNSWITGLLALPAAAFMLQDQEALAAEMERTFIAIKPDGVQRGLISEIITRF  341

Query  500  ERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            ERKG+KLV IK+MVPSK FAQ+HYHDLK+RPFF+GLCNFLSSGPVVAMVWE
Sbjct  342  ERKGYKLVGIKVMVPSKGFAQKHYHDLKERPFFNGLCNFLSSGPVVAMVWE  392



>dbj|BAA96460.1| nucleoside diphosphate kinase 3 [Brassica rapa]
Length=194

 Score =   184 bits (466),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 96/100 (96%), Gaps = 0/100 (0%)
 Frame = +2

Query  353  WISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIK  532
            WI+G+LALPAAAYM+QE++  AAEMERTFIAIKPDGVQRGL+SEI++RFERKGFKLV IK
Sbjct  20   WITGLLALPAAAYMVQEQEVLAAEMERTFIAIKPDGVQRGLISEIVARFERKGFKLVGIK  79

Query  533  IMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            ++VPSK FAQ+HYHDLK+RPFF+GLC+FLSSGPV+AMVWE
Sbjct  80   VVVPSKDFAQKHYHDLKERPFFNGLCDFLSSGPVIAMVWE  119



>ref|XP_010918749.1| PREDICTED: uncharacterized protein LOC105043039 [Elaeis guineensis]
Length=477

 Score =   191 bits (485),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = +2

Query  317  HGRAESANASRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISR  496
            + RA+  N    W+SG+LA+PAAAYM+Q+++AHAAE+ERTFIAIKPDGVQRGL++EIISR
Sbjct  291  YERADFRNTPSGWVSGLLAIPAAAYMLQDQEAHAAELERTFIAIKPDGVQRGLIAEIISR  350

Query  497  FERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            FERKG+KLVAIK++VPSK FAQ+HY+DLKDRPFF+GLC+FLSSGPV+AMVWE
Sbjct  351  FERKGYKLVAIKLIVPSKEFAQKHYYDLKDRPFFNGLCDFLSSGPVLAMVWE  402



>ref|XP_002874662.1| hypothetical protein ARALYDRAFT_489940 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50921.1| hypothetical protein ARALYDRAFT_489940 [Arabidopsis lyrata subsp. 
lyrata]
Length=238

 Score =   184 bits (468),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 95/100 (95%), Gaps = 0/100 (0%)
 Frame = +2

Query  353  WISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIK  532
            WI+G+LALPAA YMIQ+++  AAEMERTFIAIKPDGVQRGL+SEIISRFERKGFKLV IK
Sbjct  64   WITGLLALPAAGYMIQDQEVLAAEMERTFIAIKPDGVQRGLISEIISRFERKGFKLVGIK  123

Query  533  IMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            ++VPSK FAQ+HYHDLK+RPFF+GLC+FLSSGPV+AMVWE
Sbjct  124  VIVPSKDFAQKHYHDLKERPFFNGLCDFLSSGPVIAMVWE  163



>ref|XP_010439117.1| PREDICTED: nucleoside diphosphate kinase IV, chloroplastic/mitochondrial-like 
isoform X2 [Camelina sativa]
Length=244

 Score =   184 bits (468),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 83/103 (81%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = +2

Query  344  SRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLV  523
            S++ I+G+LALPAAA+M+Q+++  AAEMERTFIAIKPDGVQRGL+SEIISRFERKG+KLV
Sbjct  67   SKSCITGLLALPAAAFMLQDQEVLAAEMERTFIAIKPDGVQRGLISEIISRFERKGYKLV  126

Query  524  AIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
             IK+MVPSK FAQ+HYHDLK+RPFF+GLCNFLSSGPVVAMVWE
Sbjct  127  GIKVMVPSKGFAQKHYHDLKERPFFNGLCNFLSSGPVVAMVWE  169



>ref|XP_010439116.1| PREDICTED: nucleoside diphosphate kinase IV, chloroplastic/mitochondrial-like 
isoform X1 [Camelina sativa]
Length=245

 Score =   184 bits (468),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 83/103 (81%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = +2

Query  344  SRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLV  523
            S++ I+G+LALPAAA+M+Q+++  AAEMERTFIAIKPDGVQRGL+SEIISRFERKG+KLV
Sbjct  68   SKSCITGLLALPAAAFMLQDQEVLAAEMERTFIAIKPDGVQRGLISEIISRFERKGYKLV  127

Query  524  AIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
             IK+MVPSK FAQ+HYHDLK+RPFF+GLCNFLSSGPVVAMVWE
Sbjct  128  GIKVMVPSKGFAQKHYHDLKERPFFNGLCNFLSSGPVVAMVWE  170



>gb|AAY18431.1| putative nucleoside diphosphate kinase III [Noccaea caerulescens]
Length=238

 Score =   183 bits (465),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  332  SANASRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKG  511
            S  AS+NW++G++ALPAAA M+Q+++  AAEMERTFIAIKPDGVQRGL+SEI+SRFERKG
Sbjct  57   SGAASKNWLTGLIALPAAALMLQDQEVLAAEMERTFIAIKPDGVQRGLISEIVSRFERKG  116

Query  512  FKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            FKLV IK++VPSK FAQ+HYHDLK+R FF+GLC+FLSSGPV+AMVWE
Sbjct  117  FKLVGIKVVVPSKDFAQKHYHDLKERTFFNGLCDFLSSGPVIAMVWE  163



>ref|XP_006655662.1| PREDICTED: nucleoside diphosphate kinase 4, chloroplastic-like 
[Oryza brachyantha]
Length=239

 Score =   183 bits (465),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  350  NWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAI  529
             W+  I A+PAA YM+Q+++AHAAEMERTFIAIKPDGVQRGL+SEI+SRFERKGFKLVA+
Sbjct  64   GWLPTIAAIPAAVYMLQDQEAHAAEMERTFIAIKPDGVQRGLISEILSRFERKGFKLVAV  123

Query  530  KIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            K++VPSK FAQ+HYHDLKDRPFF+GLC+FLSSGPV+AMVWE
Sbjct  124  KLVVPSKEFAQKHYHDLKDRPFFNGLCDFLSSGPVLAMVWE  164



>ref|XP_009405240.1| PREDICTED: nucleoside diphosphate kinase 3-like [Musa acuminata 
subsp. malaccensis]
Length=237

 Score =   182 bits (462),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = +2

Query  323  RAESANASRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFE  502
            RA+  + SR W+ G L++PAA YM+Q+   HAAE+ERTFIAIKPDGVQRGL++EIISRFE
Sbjct  53   RADYKSTSRGWVYGALSIPAAVYMLQDHQLHAAELERTFIAIKPDGVQRGLIAEIISRFE  112

Query  503  RKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            RKGFKLVAIKI+VPSK FA++HY+DLK+RPFF+GLC+FLSSGPV+AMVWE
Sbjct  113  RKGFKLVAIKIVVPSKEFAEKHYYDLKERPFFNGLCDFLSSGPVIAMVWE  162



>ref|XP_010676289.1| PREDICTED: uncharacterized protein LOC104892148 [Beta vulgaris 
subsp. vulgaris]
Length=489

 Score =   188 bits (478),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 100/106 (94%), Gaps = 0/106 (0%)
 Frame = +2

Query  335  ANASRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGF  514
            ANA+  W+S  LA+PAA YM+Q+++AHAAEMER+FIAIKPDGVQRGL+SEII+RFERKGF
Sbjct  309  ANATGTWLSAALAIPAAVYMLQDQEAHAAEMERSFIAIKPDGVQRGLISEIIARFERKGF  368

Query  515  KLVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            KLVAIK++VPSK FAQ+HYHDLK+RPFF+GLC+FLSSGPVVAMVWE
Sbjct  369  KLVAIKVVVPSKEFAQKHYHDLKERPFFNGLCDFLSSGPVVAMVWE  414



>ref|XP_009395043.1| PREDICTED: nucleoside diphosphate kinase 3-like [Musa acuminata 
subsp. malaccensis]
Length=238

 Score =   181 bits (460),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +2

Query  338  NASRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFK  517
              SR W+ G LA PAA Y++Q+   HAAE+ERTFIAIKPDGVQRGL++EI+SRFERKGFK
Sbjct  59   TTSRGWLYGTLAFPAAVYLLQDHQLHAAELERTFIAIKPDGVQRGLIAEIVSRFERKGFK  118

Query  518  LVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            LVAIKI+VPSK FAQ+HYHDLK+RPFF+GLC+FLSSGPVVAMVWE
Sbjct  119  LVAIKIVVPSKEFAQKHYHDLKERPFFNGLCDFLSSGPVVAMVWE  163



>sp|Q8RXA8.1|NDK4_SPIOL RecName: Full=Nucleoside diphosphate kinase 4, chloroplastic; 
AltName: Full=Nucleoside diphosphate kinase III; AltName: Full=Nucleoside 
diphosphate kinase IV; Short=NDK IV; Short=NDP 
kinase IV; Short=NDPK IV; Flags: Precursor [Spinacia oleracea]
 gb|AAL91136.1| nucleoside diphosphate kinase III [Spinacia oleracea]
Length=235

 Score =   181 bits (459),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +2

Query  335  ANASRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGF  514
            ANAS  W+S  LA+PAAAY++Q+++A AAE ERTFIAIKPDGVQRGL+SEI++RFERKGF
Sbjct  55   ANASGTWMSTALAIPAAAYLLQDQEACAAEFERTFIAIKPDGVQRGLISEIVARFERKGF  114

Query  515  KLVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            KLVAIK+++PSK FAQ+HYHDL +RPFF+GLC+FLSSGPVVAMVWE
Sbjct  115  KLVAIKVVIPSKDFAQKHYHDLSERPFFNGLCDFLSSGPVVAMVWE  160



>ref|XP_004503626.1| PREDICTED: uncharacterized protein LOC101499802 [Cicer arietinum]
Length=475

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 101/113 (89%), Gaps = 1/113 (1%)
 Frame = +2

Query  317  HGRAESANASR-NWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIIS  493
            +GR  S N S  +WISG LALPAAAYM+Q+++ HAAE+ERTFIAIKPDGVQRGL+SEIIS
Sbjct  288  YGRTGSGNGSTASWISGALALPAAAYMLQDQEVHAAELERTFIAIKPDGVQRGLISEIIS  347

Query  494  RFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            RFERKG+KLV IK++ P+K FA +HYHDLK+RPFF+GLC+FLSSGPVVAMVWE
Sbjct  348  RFERKGYKLVGIKVLTPTKEFAAQHYHDLKERPFFNGLCDFLSSGPVVAMVWE  400



>gb|ABR18168.1| unknown [Picea sitchensis]
Length=235

 Score =   179 bits (455),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 98/112 (88%), Gaps = 2/112 (2%)
 Frame = +2

Query  317  HGRAESANASRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISR  496
            HG  +SA   R WISG L LPAA YM+Q+  A AAE+ERTFIAIKPDGVQRGL+SEI+SR
Sbjct  52   HGDYQSA--YRQWISGALVLPAAVYMLQDPSAEAAELERTFIAIKPDGVQRGLISEIVSR  109

Query  497  FERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            FERKG+KLVAIK++VPSK FA++HY+DLK+RPFF+GLC FLSSGPV+AMVWE
Sbjct  110  FERKGYKLVAIKLVVPSKEFAEQHYYDLKERPFFNGLCEFLSSGPVLAMVWE  161



>gb|AGK91196.1| NDPK4 [Brachypodium distachyon]
Length=243

 Score =   179 bits (455),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +2

Query  365  ILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVP  544
            + A+PAAAYM+Q+++AHAAEMERTFIAIKPDGVQRGL+SEI+SRFERKGFKLVAIK++VP
Sbjct  73   LAAVPAAAYMLQDQEAHAAEMERTFIAIKPDGVQRGLISEIVSRFERKGFKLVAIKLVVP  132

Query  545  SKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            SK FAQ+HYHDLK+RPFFSGLC+FLSSGPV+AMVWE
Sbjct  133  SKEFAQKHYHDLKERPFFSGLCDFLSSGPVLAMVWE  168



>emb|CAC84493.1| putative nucleoside diphosphate kinase [Pinus pinaster]
Length=235

 Score =   179 bits (453),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 98/112 (88%), Gaps = 2/112 (2%)
 Frame = +2

Query  317  HGRAESANASRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISR  496
            HG  +SA   R WISG LALPAA YM+Q+  A AAE+ERTFIAIKPDGVQRGL+SEI+SR
Sbjct  52   HGDYQSA--YRQWISGALALPAAVYMLQDPSAEAAELERTFIAIKPDGVQRGLISEIVSR  109

Query  497  FERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            FERKG+KLVAIK++VPSK FA++HY DLK+RPFF+GLC FLSSGPV+AMVWE
Sbjct  110  FERKGYKLVAIKLVVPSKQFAEQHYEDLKERPFFNGLCEFLSSGPVLAMVWE  161



>gb|EEE64920.1| hypothetical protein OsJ_19780 [Oryza sativa Japonica Group]
Length=239

 Score =   178 bits (451),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +2

Query  338  NASRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFK  517
            N+S      + A+PAA YM+Q+++AHAAEMERTFIAIKPDGVQRGL+SEI+SRFERKGFK
Sbjct  60   NSSAAAAGWLAAIPAAVYMLQDQEAHAAEMERTFIAIKPDGVQRGLISEILSRFERKGFK  119

Query  518  LVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            LVAIK++VPSK FAQ+HYHDLKDRPFF+GLC+FLSSGPV+AMVWE
Sbjct  120  LVAIKLVVPSKEFAQKHYHDLKDRPFFNGLCDFLSSGPVLAMVWE  164



>ref|NP_001056515.1| Os05g0595400 [Oryza sativa Japonica Group]
 gb|AAV59386.1| putative nucleoside diphosphate kinase [Oryza sativa Japonica 
Group]
 gb|AAW57792.1| putative nucleoside diphosphate kinase [Oryza sativa Japonica 
Group]
 dbj|BAF18429.1| Os05g0595400 [Oryza sativa Japonica Group]
 dbj|BAG88151.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89946.1| unnamed protein product [Oryza sativa Japonica Group]
Length=239

 Score =   177 bits (450),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +2

Query  338  NASRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFK  517
            N+S      + A+PAA YM+Q+++AHAAEMERTFIAIKPDGVQRGL+SEI+SRFERKGFK
Sbjct  60   NSSAAAAGWLAAIPAAVYMLQDQEAHAAEMERTFIAIKPDGVQRGLISEILSRFERKGFK  119

Query  518  LVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            LVAIK++VPSK FAQ+HYHDLKDRPFF+GLC+FLSSGPV+AMVWE
Sbjct  120  LVAIKLVVPSKEFAQKHYHDLKDRPFFNGLCDFLSSGPVLAMVWE  164



>gb|EPS58084.1| nucleoside diphosphate kinase [Genlisea aurea]
Length=236

 Score =   176 bits (447),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 100/113 (88%), Gaps = 2/113 (2%)
 Frame = +2

Query  320  GRAESANASRNW-ISGILA-LPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIIS  493
            G +ES NA   W ++G LA LP A  M+QE++A+AAE+ERTFIAIKPDGVQRGL+SEIIS
Sbjct  49   GASESQNAHNGWGVTGALATLPVAGLMLQEQEAYAAELERTFIAIKPDGVQRGLISEIIS  108

Query  494  RFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            RFERKG+KLVAIKI++PSK FA++HYHDLK+RPFF+GLC+FLSS PVVAMVWE
Sbjct  109  RFERKGYKLVAIKILIPSKDFAEKHYHDLKERPFFNGLCDFLSSAPVVAMVWE  161



>ref|XP_010924524.1| PREDICTED: uncharacterized protein LOC105047333 [Elaeis guineensis]
Length=478

 Score =   183 bits (464),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 81/112 (72%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +2

Query  317  HGRAESANASRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISR  496
            + R +  N++  WISG+LA+PAAAYM+Q ++  AAE ERTFIAIKPDGVQRGL++EI+SR
Sbjct  292  YERVDYKNSAGGWISGVLAVPAAAYMLQGQEVSAAEPERTFIAIKPDGVQRGLIAEILSR  351

Query  497  FERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            FERKG+KLVAIK+++PSK FAQ+HYHDLKDRPFF GLC+FLSSGPV+AMVWE
Sbjct  352  FERKGYKLVAIKLVLPSKEFAQKHYHDLKDRPFFDGLCDFLSSGPVLAMVWE  403



>ref|XP_008793170.1| PREDICTED: uncharacterized protein LOC103709541 [Phoenix dactylifera]
Length=538

 Score =   183 bits (465),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = +2

Query  317  HGRAESANASRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISR  496
            + +A+  N++R  ISG+LA+PAAAYM+Q ++A AAE ERTFIAIKPDGVQRGL++EIISR
Sbjct  352  YEKADYKNSTRGRISGVLAVPAAAYMLQGQEASAAEPERTFIAIKPDGVQRGLIAEIISR  411

Query  497  FERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            FERKG+KLVA+K++VPSK FAQ+HYHDLKDRPFF GLC+FLSSGPV+AMVWE
Sbjct  412  FERKGYKLVAVKLVVPSKEFAQKHYHDLKDRPFFDGLCDFLSSGPVLAMVWE  463



>dbj|BAH37034.1| nucleoside diphosphate kinase 3 [Pisum sativum]
Length=233

 Score =   174 bits (440),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +2

Query  323  RAESANASRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFE  502
            R  S N S +WI+G LALPAAAYM+Q+++ HAAE+ERTFIAIKPDGVQRGL+SEIISRFE
Sbjct  49   RTGSGNGSSSWIAGALALPAAAYMLQDQEVHAAELERTFIAIKPDGVQRGLISEIISRFE  108

Query  503  RKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            RKGFKLV IK+++P+K FAQ+HYHDLK+RPFF+GLC+FLSSGPV+AMVWE
Sbjct  109  RKGFKLVGIKVLIPTKQFAQQHYHDLKERPFFNGLCDFLSSGPVIAMVWE  158



>dbj|BAH37033.1| nucleoside diphosphate kinase 3 [Pisum sativum]
Length=233

 Score =   173 bits (439),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +2

Query  323  RAESANASRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFE  502
            R  S N S +WI+G LALPAAAYM+Q+++ HAAE+ERTFIAIKPDGVQRGL+SEIISRFE
Sbjct  49   RTGSGNGSSSWIAGALALPAAAYMLQDQEVHAAELERTFIAIKPDGVQRGLISEIISRFE  108

Query  503  RKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            RKGFKLV IK+++P+K FAQ+HYHDLK+RPFF+GLC+FLSSGPV+AMVWE
Sbjct  109  RKGFKLVGIKVLIPTKQFAQQHYHDLKERPFFNGLCDFLSSGPVIAMVWE  158



>ref|XP_007160160.1| hypothetical protein PHAVU_002G297900g [Phaseolus vulgaris]
 gb|ESW32154.1| hypothetical protein PHAVU_002G297900g [Phaseolus vulgaris]
Length=238

 Score =   173 bits (438),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +2

Query  368  LALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPS  547
            LALPAAAYM Q+++ HAAE+ERTFIAIKPDGVQRGL+SEIISRFERKG+KLV IK+++PS
Sbjct  69   LALPAAAYMFQDQEVHAAELERTFIAIKPDGVQRGLISEIISRFERKGYKLVGIKVVIPS  128

Query  548  KVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            K FA++HYHDLK+RPFF GLC+FLSSGPV+AMVWE
Sbjct  129  KEFAKQHYHDLKERPFFDGLCDFLSSGPVIAMVWE  163



>gb|KHN16744.1| Nucleoside diphosphate kinase IV, chloroplastic/mitochondrial 
[Glycine soja]
Length=236

 Score =   172 bits (437),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +2

Query  368  LALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPS  547
            LALPAAAYM Q+++  AAE+ERTFIAIKPDGVQRGL+SEIISRFERKG+KLV IK+++P 
Sbjct  67   LALPAAAYMFQDQEVQAAELERTFIAIKPDGVQRGLISEIISRFERKGYKLVGIKVVIPK  126

Query  548  KVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            K FAQRHYHDLK+RPFF GLC+FLSSGPV+AMVWE
Sbjct  127  KEFAQRHYHDLKERPFFDGLCDFLSSGPVIAMVWE  161



>ref|XP_004298905.1| PREDICTED: nucleoside diphosphate kinase IV, chloroplastic/mitochondrial-like 
[Fragaria vesca subsp. vesca]
Length=468

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 97/110 (88%), Gaps = 2/110 (2%)
 Frame = +2

Query  323  RAESANASRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFE  502
            RA S NAS  WIS  L +PAAAYM+ +++ HAAE ERTFIAIKPDGVQRGL+SEII+RFE
Sbjct  286  RAGSENAS--WISAALVVPAAAYMLLDQEVHAAEFERTFIAIKPDGVQRGLISEIIARFE  343

Query  503  RKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            RKGFKLV IK++VPSK FAQ+HYHDL +RPFF+GLC+FLSSGPV+AMVWE
Sbjct  344  RKGFKLVGIKVVVPSKDFAQKHYHDLSERPFFNGLCDFLSSGPVIAMVWE  393



>ref|NP_001236561.1| uncharacterized protein LOC100527475 [Glycine max]
 gb|ACU16569.1| unknown [Glycine max]
Length=235

 Score =   172 bits (436),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +2

Query  368  LALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPS  547
            LALPAAAYM Q+++  AAE+ERTFIAIKPDGVQRGL+SEIISRFERKG+KLV IK+++PS
Sbjct  66   LALPAAAYMFQDQEVRAAELERTFIAIKPDGVQRGLISEIISRFERKGYKLVGIKVVIPS  125

Query  548  KVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            K FAQ+HYHDLK+RPFF GLC+FLSSGPV+AMVWE
Sbjct  126  KEFAQKHYHDLKERPFFDGLCDFLSSGPVIAMVWE  160



>ref|XP_004960972.1| PREDICTED: nucleoside diphosphate kinase IV, chloroplastic/mitochondrial-like 
[Setaria italica]
Length=240

 Score =   172 bits (436),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +2

Query  332  SANASRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKG  511
            S +AS  W +   A+PAA YM+Q+++AHAAEMERTFIAIKPDGVQRGL+SEI+SRFERKG
Sbjct  59   SHHASSGWGAFAAAVPAAVYMLQDQEAHAAEMERTFIAIKPDGVQRGLISEIVSRFERKG  118

Query  512  FKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            +KLVAIK++VPSK FAQ+HYHDLKDRPFF+GLC+FLSSGPV+AMVWE
Sbjct  119  YKLVAIKLIVPSKEFAQKHYHDLKDRPFFNGLCDFLSSGPVLAMVWE  165



>gb|EMT04330.1| Nucleoside diphosphate kinase 4, chloroplastic [Aegilops tauschii]
Length=361

 Score =   175 bits (444),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +2

Query  332  SANASRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKG  511
            +A AS +  + I A+PAA YM+Q+++ HAAEMERTFIAIKPDGVQRGL+SEI+SRFERKG
Sbjct  180  NAAASSHGYAWIAAIPAAVYMLQDQEVHAAEMERTFIAIKPDGVQRGLISEIVSRFERKG  239

Query  512  FKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            +KLVAIK++VPSK FA++HYHDLK+RPFFSGLC+FLSSGPV+AMVWE
Sbjct  240  YKLVAIKLVVPSKQFAEKHYHDLKERPFFSGLCDFLSSGPVLAMVWE  286



>gb|AAF08537.1|AF191098_1 nucleoside diphosphate kinase [Pisum sativum]
Length=233

 Score =   171 bits (434),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +2

Query  323  RAESANASRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFE  502
            R  S N   +WI+G LALPAAAYM+Q+++ HAAE+ERTFIAIKPDGVQRGL+SEIISRFE
Sbjct  49   RTGSGNGPSSWIAGALALPAAAYMLQDQEVHAAELERTFIAIKPDGVQRGLISEIISRFE  108

Query  503  RKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            RKGFKLV IK+++P+K FAQ+HYHDLK+RPFF+GLC+FLSSGPV+AMVWE
Sbjct  109  RKGFKLVGIKVLIPTKQFAQQHYHDLKERPFFNGLCDFLSSGPVIAMVWE  158



>ref|XP_003567773.2| PREDICTED: uncharacterized protein LOC100837174 [Brachypodium 
distachyon]
Length=536

 Score =   178 bits (452),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +2

Query  365  ILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVP  544
            + A+PAAAYM+Q+++AHAAEMERTFIAIKPDGVQRGL+SEI+SRFERKGFKLVAIK++VP
Sbjct  366  LAAVPAAAYMLQDQEAHAAEMERTFIAIKPDGVQRGLISEIVSRFERKGFKLVAIKLVVP  425

Query  545  SKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            SK FAQ+HYHDLK+RPFFSGLC+FLSSGPV+AMVWE
Sbjct  426  SKEFAQKHYHDLKERPFFSGLCDFLSSGPVLAMVWE  461



>ref|NP_001150023.1| LOC100283650 [Zea mays]
 gb|ACG37558.1| nucleoside diphosphate kinase 4 [Zea mays]
Length=238

 Score =   168 bits (426),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +2

Query  332  SANASRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKG  511
            S +A+  W +   A+PAA YM+Q+++AHAAEMERTFIAIKPDGVQRGL+SEI+SRFERKG
Sbjct  57   SHHAASGWGAIAAAVPAAVYMLQDQEAHAAEMERTFIAIKPDGVQRGLISEIMSRFERKG  116

Query  512  FKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            +KLVAIK++VPSK FA++HYHDLK+RPFFSGLC+FLSSGPV+AMVWE
Sbjct  117  YKLVAIKLIVPSKEFAEKHYHDLKERPFFSGLCDFLSSGPVLAMVWE  163



>gb|ACN31682.1| unknown [Zea mays]
Length=238

 Score =   168 bits (426),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +2

Query  332  SANASRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKG  511
            S +A+  W +   A+PAA YM+Q+++AHAAEMERTFIAIKPDGVQRGL+SEI+SRFERKG
Sbjct  57   SHHAASGWGAIAAAVPAAVYMLQDQEAHAAEMERTFIAIKPDGVQRGLISEIMSRFERKG  116

Query  512  FKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            +KLVAIK++VPSK FA++HYHDLK+RPFFSGLC+FLSSGPV+AMVWE
Sbjct  117  YKLVAIKLIVPSKEFAEKHYHDLKERPFFSGLCDFLSSGPVLAMVWE  163



>gb|KCW72422.1| hypothetical protein EUGRSUZ_E00871 [Eucalyptus grandis]
Length=213

 Score =   167 bits (424),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = +2

Query  326  AESANASRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFER  505
             + A   RN     +++    YM+QE++AHAAE+ER+FIAIKPDGVQRGL+SEIISRFER
Sbjct  30   GDLATGIRNLFHINISVFMRVYMLQEQEAHAAELERSFIAIKPDGVQRGLISEIISRFER  89

Query  506  KGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            KGFKLVAIK++VP+K FAQ+HYHDLK+RPFF+GLC+FLSSGPVVAMVWE
Sbjct  90   KGFKLVAIKVVVPTKDFAQKHYHDLKERPFFNGLCDFLSSGPVVAMVWE  138



>ref|XP_006852661.1| hypothetical protein AMTR_s00021p00246310 [Amborella trichopoda]
 gb|ERN14128.1| hypothetical protein AMTR_s00021p00246310 [Amborella trichopoda]
Length=220

 Score =   167 bits (424),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +2

Query  323  RAESANASRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFE  502
            +A S NA R  ISG L LP A YM+ ++   AAE+ERTFIAIKPDGVQRGL++EIISRFE
Sbjct  37   QAYSNNALRGCISGALCLPMAVYMLHDQ-TQAAELERTFIAIKPDGVQRGLIAEIISRFE  95

Query  503  RKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            +KG+KLVAIK++VPSK FAQ+HYHDL +RPFF+GLC+FLSSGPV+AMVWE
Sbjct  96   QKGYKLVAIKLVVPSKEFAQKHYHDLSERPFFNGLCDFLSSGPVLAMVWE  145



>ref|XP_011026887.1| PREDICTED: nucleoside diphosphate kinase 4, chloroplastic isoform 
X2 [Populus euphratica]
Length=162

 Score =   166 bits (419),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 76/87 (87%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = +2

Query  392  MIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHY  571
            M+QE++AHAAE+ERTFIAIKPDGVQRGL+SEIISRFERKGFKLVAIKI+VPSK FAQ+HY
Sbjct  1    MLQEQEAHAAELERTFIAIKPDGVQRGLISEIISRFERKGFKLVAIKIVVPSKDFAQKHY  60

Query  572  HDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            HDLK RPFF GLC+FLSSGPVVAMVWE
Sbjct  61   HDLKTRPFFDGLCDFLSSGPVVAMVWE  87



>gb|AFK41131.1| unknown [Medicago truncatula]
Length=234

 Score =   166 bits (421),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = +2

Query  323  RAESANASRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFE  502
            R  S N S +WI+G LALPAAAY++Q+++ HAAE+ERTFIAIKPDGVQRGL+SEIISRFE
Sbjct  50   RTASGNGSTSWIAGALALPAAAYILQDQEVHAAELERTFIAIKPDGVQRGLISEIISRFE  109

Query  503  RKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            RKG+KLV IK++ P+K FA++HYHDLK+RPFF GLC+FLSSGPV+AMVWE
Sbjct  110  RKGYKLVGIKVLHPTKEFAKQHYHDLKERPFFDGLCDFLSSGPVIAMVWE  159



>gb|KEH21220.1| nucleoside diphosphate kinase-like protein [Medicago truncatula]
Length=234

 Score =   166 bits (421),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = +2

Query  323  RAESANASRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFE  502
            R  S N S +WI+G LALPAAAY++Q+++ HAAE+ERTFIAIKPDGVQRGL+SEIISRFE
Sbjct  50   RTASGNGSTSWIAGALALPAAAYILQDQEVHAAELERTFIAIKPDGVQRGLISEIISRFE  109

Query  503  RKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            RKG+KLV IK++ P+K FA++HYHDLK+RPFF GLC+FLSSGPV+AMVWE
Sbjct  110  RKGYKLVGIKVLHPTKEFAKQHYHDLKERPFFDGLCDFLSSGPVIAMVWE  159



>ref|NP_001150225.1| nucleoside diphosphate kinase 4 [Zea mays]
 gb|ACG38297.1| nucleoside diphosphate kinase 4 [Zea mays]
Length=237

 Score =   166 bits (421),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 77/108 (71%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = +2

Query  329  ESANASRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERK  508
            + ++A+  W +   A+PAA YM+Q+++AHAAEMERTFIAIKPDGVQRGL+SEI++RFERK
Sbjct  55   QGSHAASGWGAIAAAVPAAVYMLQDQEAHAAEMERTFIAIKPDGVQRGLISEIVNRFERK  114

Query  509  GFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            G+KLVAIK++VPSK FA++HYHDLK+RPFF+GLC+FLSSGPV+AMVWE
Sbjct  115  GYKLVAIKLIVPSKGFAEKHYHDLKERPFFNGLCDFLSSGPVLAMVWE  162



>gb|AFW79436.1| putative nucleoside diphosphate kinase family protein [Zea mays]
Length=237

 Score =   166 bits (421),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 77/108 (71%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = +2

Query  329  ESANASRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERK  508
            + ++A+  W +   A+PAA YM+Q+++AHAAEMERTFIAIKPDGVQRGL+SEI++RFERK
Sbjct  55   QGSHAASGWGAIAAAVPAAVYMLQDQEAHAAEMERTFIAIKPDGVQRGLISEIVNRFERK  114

Query  509  GFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            G+KLVAIK++VPSK FA++HYHDLK+RPFF+GLC+FLSSGPV+AMVWE
Sbjct  115  GYKLVAIKLIVPSKGFAEKHYHDLKERPFFNGLCDFLSSGPVLAMVWE  162



>emb|CDY40857.1| BnaC09g26080D [Brassica napus]
Length=335

 Score =   169 bits (428),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 91/98 (93%), Gaps = 3/98 (3%)
 Frame = +2

Query  353  WISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIK  532
            WI+G+LALPAAAYM+Q+++  AAEMERTFIAIKPDG   GL+SEIISRFERKGFKLV IK
Sbjct  234  WITGLLALPAAAYMVQDQEVLAAEMERTFIAIKPDG---GLISEIISRFERKGFKLVGIK  290

Query  533  IMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMV  646
            ++VPSK FAQ+HYHDLK+RPFF+GLC+FLSSGPV+AMV
Sbjct  291  VVVPSKDFAQKHYHDLKERPFFNGLCDFLSSGPVIAMV  328



>dbj|BAJ87594.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=246

 Score =   166 bits (421),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 73/88 (83%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = +2

Query  389  YMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRH  568
            YM+Q +D HAAEMERTFIAIKPDGVQRGL+SEI+SRFERKG+KLVAIK++VPSK FA++H
Sbjct  84   YMLQGQDVHAAEMERTFIAIKPDGVQRGLISEIVSRFERKGYKLVAIKLVVPSKQFAEKH  143

Query  569  YHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            YHDLK+RPFFSGLC+FLSSGPV+AMVWE
Sbjct  144  YHDLKERPFFSGLCDFLSSGPVLAMVWE  171



>ref|XP_006584526.1| PREDICTED: uncharacterized protein LOC100527141 isoform X1 [Glycine 
max]
Length=486

 Score =   172 bits (436),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +2

Query  368  LALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPS  547
            LALPAAAYM Q+++  AAE+ERTFIAIKPDGVQRGL+SEIISRFERKG+KLV IK+++P 
Sbjct  317  LALPAAAYMFQDQEVQAAELERTFIAIKPDGVQRGLISEIISRFERKGYKLVGIKVVIPK  376

Query  548  KVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            K FAQRHYHDLK+RPFF GLC+FLSSGPV+AMVWE
Sbjct  377  KEFAQRHYHDLKERPFFDGLCDFLSSGPVIAMVWE  411



>ref|XP_008361295.1| PREDICTED: nucleoside diphosphate kinase III, chloroplastic/mitochondrial, 
partial [Malus domestica]
Length=169

 Score =   163 bits (413),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = +2

Query  371  ALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSK  550
            +L + AYM+ +++ HAAE+ERTFIAIKPDGVQRGL++EIISRFERKGFKLV IK++VP+K
Sbjct  1    SLISLAYMLVDQEVHAAELERTFIAIKPDGVQRGLIAEIISRFERKGFKLVGIKVVVPTK  60

Query  551  VFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
             FAQ+HYHDLK+RPFFSGLC+FLSSGPV+AMVWE
Sbjct  61   DFAQKHYHDLKERPFFSGLCDFLSSGPVIAMVWE  94



>gb|ACN35580.1| unknown [Zea mays]
 gb|AFW79437.1| putative nucleoside diphosphate kinase family protein [Zea mays]
Length=162

 Score =   160 bits (406),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  392  MIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHY  571
            M+Q+++AHAAEMERTFIAIKPDGVQRGL+SEI++RFERKG+KLVAIK++VPSK FA++HY
Sbjct  1    MLQDQEAHAAEMERTFIAIKPDGVQRGLISEIVNRFERKGYKLVAIKLIVPSKGFAEKHY  60

Query  572  HDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            HDLK+RPFF+GLC+FLSSGPV+AMVWE
Sbjct  61   HDLKERPFFNGLCDFLSSGPVLAMVWE  87



>gb|KHM99900.1| Nucleoside diphosphate kinase IV, chloroplastic/mitochondrial 
[Glycine soja]
Length=162

 Score =   156 bits (394),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = +2

Query  392  MIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHY  571
            M Q+++  AAE+ERTFIAIKPDGVQRGL+SEIISRFERKG+KLV IK+++PSK FAQ+HY
Sbjct  1    MFQDQEVRAAELERTFIAIKPDGVQRGLISEIISRFERKGYKLVGIKVVIPSKEFAQKHY  60

Query  572  HDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            HDLK+RPFF GLC+FLSSGPV+AMVWE
Sbjct  61   HDLKERPFFDGLCDFLSSGPVIAMVWE  87



>ref|XP_006396973.1| hypothetical protein EUTSA_v10028863mg [Eutrema salsugineum]
 gb|ESQ38426.1| hypothetical protein EUTSA_v10028863mg [Eutrema salsugineum]
Length=286

 Score =   159 bits (403),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  332  SANASRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKG  511
            S  AS++W++G+LALPAAA M+Q+++  AAEMERTFIAIKPDGVQRGL+SEI+SRFERKG
Sbjct  105  SGVASKSWLTGLLALPAAALMLQDQEVLAAEMERTFIAIKPDGVQRGLISEIVSRFERKG  164

Query  512  FKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            FKLV IK++VPSK FAQ+HYHDLK+RPFF+GLC+FLSSGPV+AMVWE
Sbjct  165  FKLVGIKVVVPSKDFAQKHYHDLKERPFFNGLCDFLSSGPVIAMVWE  211



>ref|NP_001235503.1| uncharacterized protein LOC100527141 [Glycine max]
 gb|ACU16188.1| unknown [Glycine max]
Length=162

 Score =   153 bits (387),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +2

Query  392  MIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHY  571
            M Q+++  AAE+ERTFIAIKPDGVQRGL+SEIISRFERKG+KLV IK+++P K FAQRHY
Sbjct  1    MFQDQEVQAAELERTFIAIKPDGVQRGLISEIISRFERKGYKLVGIKVVIPKKEFAQRHY  60

Query  572  HDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            HDLK+ PFF GLC+FLSSGPV+AMVWE
Sbjct  61   HDLKEGPFFDGLCDFLSSGPVIAMVWE  87



>pdb|1W7W|A Chain A, Structure And Mutational Analysis Of A Plant Mitochondrial 
Nucleoside Diphosphate Kinase: Identification Of Residues 
Involved In Serine Phosphorylation And Oligomerization.
 pdb|1W7W|B Chain B, Structure And Mutational Analysis Of A Plant Mitochondrial 
Nucleoside Diphosphate Kinase: Identification Of Residues 
Involved In Serine Phosphorylation And Oligomerization.
 pdb|1W7W|C Chain C, Structure And Mutational Analysis Of A Plant Mitochondrial 
Nucleoside Diphosphate Kinase: Identification Of Residues 
Involved In Serine Phosphorylation And Oligomerization.
 pdb|1W7W|D Chain D, Structure And Mutational Analysis Of A Plant Mitochondrial 
Nucleoside Diphosphate Kinase: Identification Of Residues 
Involved In Serine Phosphorylation And Oligomerization.
 pdb|1W7W|E Chain E, Structure And Mutational Analysis Of A Plant Mitochondrial 
Nucleoside Diphosphate Kinase: Identification Of Residues 
Involved In Serine Phosphorylation And Oligomerization.
 pdb|1W7W|F Chain F, Structure And Mutational Analysis Of A Plant Mitochondrial 
Nucleoside Diphosphate Kinase: Identification Of Residues 
Involved In Serine Phosphorylation And Oligomerization.
Length=182

 Score =   150 bits (378),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 76/78 (97%), Gaps = 0/78 (0%)
 Frame = +2

Query  419  AEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFF  598
            AE+ERTFIAIKPDGVQRGL+SEIISRFERKGFKLV IK+++P+K FAQ+HYHDLK+RPFF
Sbjct  30   AELERTFIAIKPDGVQRGLISEIISRFERKGFKLVGIKVLIPTKQFAQQHYHDLKERPFF  89

Query  599  SGLCNFLSSGPVVAMVWE  652
            +GLC+FLSSGPV+AMVWE
Sbjct  90   NGLCDFLSSGPVIAMVWE  107



>ref|XP_002963221.1| hypothetical protein SELMODRAFT_270355 [Selaginella moellendorffii]
 gb|EFJ35092.1| hypothetical protein SELMODRAFT_270355 [Selaginella moellendorffii]
Length=234

 Score =   148 bits (373),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 85/106 (80%), Gaps = 0/106 (0%)
 Frame = +2

Query  335  ANASRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGF  514
            + AS  WI    ALPAA         HAAE+ERTFIAIKPDGVQRGL+SEIISRFERKG+
Sbjct  55   STASAKWILAAAALPAAVLGSAVSTVHAAEIERTFIAIKPDGVQRGLISEIISRFERKGY  114

Query  515  KLVAIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            KLVAIKI+ P+K FA  HY DLK+RPFF+GLC+FLSSGPVVAMVWE
Sbjct  115  KLVAIKILTPTKEFAMLHYDDLKERPFFNGLCDFLSSGPVVAMVWE  160



>ref|XP_002974524.1| hypothetical protein SELMODRAFT_228272 [Selaginella moellendorffii]
 gb|EFJ24044.1| hypothetical protein SELMODRAFT_228272 [Selaginella moellendorffii]
Length=234

 Score =   147 bits (372),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +2

Query  413  HAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRP  592
            HAAE+ERTFIAIKPDGVQRGL+SEIISRFERKG+KLVAIKI+ P+K FA  HY DLK+RP
Sbjct  81   HAAEIERTFIAIKPDGVQRGLISEIISRFERKGYKLVAIKILTPTKEFAMLHYDDLKERP  140

Query  593  FFSGLCNFLSSGPVVAMVWE  652
            FF+GLC+FLSSGPVVAMVWE
Sbjct  141  FFNGLCDFLSSGPVVAMVWE  160



>gb|KCW72423.1| hypothetical protein EUGRSUZ_E00871 [Eucalyptus grandis]
Length=181

 Score =   145 bits (367),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 75/76 (99%), Gaps = 0/76 (0%)
 Frame = +2

Query  425  MERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSG  604
            +ER+FIAIKPDGVQRGL+SEIISRFERKGFKLVAIK++VP+K FAQ+HYHDLK+RPFF+G
Sbjct  31   LERSFIAIKPDGVQRGLISEIISRFERKGFKLVAIKVVVPTKDFAQKHYHDLKERPFFNG  90

Query  605  LCNFLSSGPVVAMVWE  652
            LC+FLSSGPVVAMVWE
Sbjct  91   LCDFLSSGPVVAMVWE  106



>gb|AFW79438.1| putative nucleoside diphosphate kinase family protein [Zea mays]
Length=151

 Score =   144 bits (363),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 75/76 (99%), Gaps = 0/76 (0%)
 Frame = +2

Query  425  MERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSG  604
            MERTFIAIKPDGVQRGL+SEI++RFERKG+KLVAIK++VPSK FA++HYHDLK+RPFF+G
Sbjct  1    MERTFIAIKPDGVQRGLISEIVNRFERKGYKLVAIKLIVPSKGFAEKHYHDLKERPFFNG  60

Query  605  LCNFLSSGPVVAMVWE  652
            LC+FLSSGPV+AMVWE
Sbjct  61   LCDFLSSGPVLAMVWE  76



>ref|XP_010433843.1| PREDICTED: nucleoside diphosphate kinase IV, chloroplastic/mitochondrial 
isoform X2 [Camelina sativa]
Length=220

 Score =   144 bits (362),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 82/103 (80%), Gaps = 17/103 (17%)
 Frame = +2

Query  344  SRNWISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLV  523
            S++WI+G+LALPAAA+M+Q+++  AAE                 VSEI+SRFERKG+KLV
Sbjct  60   SKSWITGLLALPAAAFMLQDQEVLAAE-----------------VSEIVSRFERKGYKLV  102

Query  524  AIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
             IK+MVPSK FAQ+HYHDLK+RPFF+GLCNFLSSGPVVAMVWE
Sbjct  103  GIKVMVPSKGFAQKHYHDLKERPFFNGLCNFLSSGPVVAMVWE  145



>gb|EMS63054.1| Nucleoside diphosphate kinase IV, chloroplastic/mitochondrial 
[Triticum urartu]
Length=399

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 75/76 (99%), Gaps = 0/76 (0%)
 Frame = +2

Query  425  MERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSG  604
            MERTFIAIKPDGVQRGL+SEI+SRFERKG+KLVAIK++VPSK FA++HYHDLK+RPFFSG
Sbjct  249  MERTFIAIKPDGVQRGLISEIVSRFERKGYKLVAIKLVVPSKQFAEKHYHDLKERPFFSG  308

Query  605  LCNFLSSGPVVAMVWE  652
            LC+FLSSGPV+AMVWE
Sbjct  309  LCDFLSSGPVLAMVWE  324



>ref|XP_001754760.1| NDPK3a nucleotide diphosphate kinase 3 protein [Physcomitrella 
patens]
 gb|EDQ80214.1| NDPK3a nucleotide diphosphate kinase 3 protein [Physcomitrella 
patens]
Length=151

 Score =   137 bits (345),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = +2

Query  422  EMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFS  601
            ++ERTFIAIKPDGVQRGL+SEII RFERKG+KLVAIK++VP+K FA +HY DL  RPFF+
Sbjct  2    DLERTFIAIKPDGVQRGLISEIIGRFERKGYKLVAIKLIVPTKEFAAQHYDDLSSRPFFN  61

Query  602  GLCNFLSSGPVVAMVWE  652
            GLC+FLSSGPVVAMVWE
Sbjct  62   GLCDFLSSGPVVAMVWE  78



>ref|XP_001780320.1| NDPK3a nucleotide diphosphate kinase 3protein [Physcomitrella 
patens]
 gb|EDQ54879.1| NDPK3a nucleotide diphosphate kinase 3protein [Physcomitrella 
patens]
Length=151

 Score =   137 bits (345),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = +2

Query  422  EMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFS  601
            ++ERTFIAIKPDGVQRGL+SEII RFERKG+KLVAIK++VP+K FA +HY DL  RPFF+
Sbjct  2    QLERTFIAIKPDGVQRGLISEIIGRFERKGYKLVAIKLIVPTKEFAAQHYDDLSSRPFFN  61

Query  602  GLCNFLSSGPVVAMVWE  652
            GLC+FLSSGPVVAMVWE
Sbjct  62   GLCDFLSSGPVVAMVWE  78



>sp|P81766.1|NDK3_SPIOL RecName: Full=Nucleoside diphosphate kinase 3; AltName: Full=Nucleoside 
diphosphate kinase III; Short=NDK III; Short=NDP 
kinase III; Short=NDPK III [Spinacia oleracea]
 gb|AAB34017.1| nucleoside diphosphate kinase type III, NDP kinase III {EC 2.7.4.6} 
[Spinacia oleracea=spinach, leaves, Peptide, 153 aa]
 prf||2110218A NDP kinase
Length=153

 Score =   132 bits (332),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +2

Query  419  AEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFF  598
            AE ERTFIAIKPDGVQRGL+SEI++RFERKGF LVAIK+++PS+ FAQ+HY DLKD+PF+
Sbjct  1    AEFERTFIAIKPDGVQRGLISEIVARFERKGFSLVAIKVVIPSRPFAQKHYADLKDKPFY  60

Query  599  SGLCNFLSSGPVVAMVWE  652
             GL  + SSGPVVAMVWE
Sbjct  61   VGLVAYWSSGPVVAMVWE  78



>ref|XP_003272315.1| PREDICTED: nucleoside diphosphate kinase 2, chloroplastic-like 
isoform 1 [Nomascus leucogenys]
Length=196

 Score =   124 bits (311),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 73/103 (71%), Gaps = 2/103 (2%)
 Frame = +2

Query  350  NWISGILALPAAAYMIQEK--DAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLV  523
             W+ G   + AAA  +Q K  +   A  ERTFIAIKPDGVQRGLV EII RFE+KGF+LV
Sbjct  21   TWVPGAFRVLAAAAGVQAKQLEGTMANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLV  80

Query  524  AIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
             +K M  S+   + HY DLKDRPFF+GL  ++ SGPVVAMVWE
Sbjct  81   GLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWE  123



>ref|WP_019477947.1| MULTISPECIES: nucleoside diphosphate kinase [Prochlorococcus]
Length=151

 Score =   122 bits (307),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  428  ERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGL  607
            ERTFIAIKPDGVQRGL+SEII RFERKGFKLV +K ++PSK  AQ+HY   KDRPFF  L
Sbjct  3    ERTFIAIKPDGVQRGLISEIIGRFERKGFKLVGLKQLIPSKELAQKHYGVHKDRPFFGDL  62

Query  608  CNFLSSGPVVAMVWE  652
              F+SSGPV+AMVWE
Sbjct  63   VEFISSGPVIAMVWE  77



>ref|WP_036916352.1| MULTISPECIES: nucleoside diphosphate kinase [Prochlorococcus]
 gb|KGG16901.1| Nucleoside diphosphate kinase [Prochlorococcus sp. MIT 0602]
 gb|KGG18124.1| Nucleoside diphosphate kinase [Prochlorococcus sp. MIT 0603]
Length=151

 Score =   121 bits (304),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = +2

Query  425  MERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSG  604
            +ERTF+AIKPDGVQRGLV EI+ RFERKGFKLVA+K ++PSK  A++HY   ++RPFF G
Sbjct  3    VERTFLAIKPDGVQRGLVGEILGRFERKGFKLVALKQLIPSKDLAEKHYGVHRERPFFGG  62

Query  605  LCNFLSSGPVVAMVWE  652
            L NF++SGPVVAMVWE
Sbjct  63   LVNFITSGPVVAMVWE  78



>ref|WP_019477407.1| nucleoside diphosphate kinase [Prochlorococcus sp. W7]
Length=151

 Score =   121 bits (304),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  428  ERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGL  607
            ERTFIAIKPDGVQRGL+SEII RFERKGFKLV +K ++PSK  AQ+HY   KD+PFF  L
Sbjct  3    ERTFIAIKPDGVQRGLISEIIGRFERKGFKLVGLKQLIPSKELAQKHYGVHKDKPFFGDL  62

Query  608  CNFLSSGPVVAMVWE  652
              F+SSGPV+AMVWE
Sbjct  63   VEFISSGPVIAMVWE  77



>ref|WP_019475958.1| nucleoside diphosphate kinase [Prochlorococcus sp. W4]
Length=152

 Score =   121 bits (304),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  428  ERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGL  607
            ERTFIAIKPDGVQRG +SEII RFERKGFKLVA+K ++PS   AQ+HY   KDRPFFS L
Sbjct  4    ERTFIAIKPDGVQRGFISEIIGRFERKGFKLVALKQLIPSIELAQKHYGVHKDRPFFSNL  63

Query  608  CNFLSSGPVVAMVWE  652
             +F+SSGPVVAMVWE
Sbjct  64   VDFISSGPVVAMVWE  78



>ref|WP_011822862.1| nucleoside diphosphate kinase [Prochlorococcus marinus]
 ref|YP_001013889.1| nucleoside diphosphate kinase [Prochlorococcus marinus str. NATL1A]
 sp|A2BZG4.1|NDK_PROM1 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP 
kinase; AltName: Full=Nucleoside-2-P kinase [Prochlorococcus 
marinus str. NATL1A]
 gb|ABM74624.1| Nucleoside diphosphate kinase [Prochlorococcus marinus str. NATL1A]
Length=151

 Score =   121 bits (304),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +2

Query  425  MERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSG  604
            +ERTF+AIKPDGVQRGL++EI+ RFE KGFKLV +K + PSK  A++HY   KDRPFFSG
Sbjct  3    LERTFVAIKPDGVQRGLIAEILGRFETKGFKLVGLKQLTPSKELAEKHYGVHKDRPFFSG  62

Query  605  LCNFLSSGPVVAMVWE  652
            L +F++SGPVVAMVWE
Sbjct  63   LVDFITSGPVVAMVWE  78



>ref|WP_036906135.1| nucleoside diphosphate kinase [Prochlorococcus marinus]
 gb|KGG20691.1| Nucleoside diphosphate kinase [Prochlorococcus marinus str. PAC1]
Length=151

 Score =   121 bits (303),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +2

Query  425  MERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSG  604
            +ERTF+AIKPDGVQRGL++EI+ RFE KGFKLV +K + PSK  A++HY   KDRPFFSG
Sbjct  3    LERTFVAIKPDGVQRGLIAEILGRFETKGFKLVGLKQLTPSKELAEKHYGVHKDRPFFSG  62

Query  605  LCNFLSSGPVVAMVWE  652
            L +F++SGPVVAMVWE
Sbjct  63   LVDFITSGPVVAMVWE  78



>ref|WP_036901808.1| nucleoside diphosphate kinase [Prochlorococcus sp. MIT 0601]
 gb|KGG13341.1| Nucleoside diphosphate kinase [Prochlorococcus sp. MIT 0601]
Length=152

 Score =   120 bits (302),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = +2

Query  425  MERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSG  604
            +ERTF+AIKPDGVQRGLV EI+SRFERKGFKL+A+K ++PS+  A++HY   K+RPFF G
Sbjct  3    VERTFLAIKPDGVQRGLVGEIVSRFERKGFKLIALKQLIPSRELAEKHYGVHKERPFFPG  62

Query  605  LCNFLSSGPVVAMVWE  652
            L +F++SGPVVAMVWE
Sbjct  63   LVDFITSGPVVAMVWE  78



>ref|WP_011294011.1| nucleoside diphosphate kinase [Prochlorococcus marinus]
 ref|YP_292570.1| nucleoside diphosphate kinase [Prochlorococcus marinus str. NATL2A]
 sp|Q46I11.1|NDK_PROMT RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP 
kinase; AltName: Full=Nucleoside-2-P kinase [Prochlorococcus 
marinus str. NATL2A]
 gb|AAZ58867.1| nucleoside diphosphate kinase [Prochlorococcus marinus str. NATL2A]
Length=151

 Score =   120 bits (302),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +2

Query  425  MERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSG  604
            +ERTF+AIKPDGVQRGL++EI+ RFE KGFKLV +K + PSK  A++HY   KDRPFFSG
Sbjct  3    LERTFVAIKPDGVQRGLIAEILGRFETKGFKLVGLKQLTPSKELAEKHYGVHKDRPFFSG  62

Query  605  LCNFLSSGPVVAMVWE  652
            L +F++SGPV+AMVWE
Sbjct  63   LVDFITSGPVIAMVWE  78



>ref|WP_036892097.1| MULTISPECIES: nucleoside diphosphate kinase [Prochlorococcus]
 sp|Q7VEG3.2|NDK_PROMA RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP 
kinase; AltName: Full=Nucleoside-2-P kinase [Prochlorococcus 
marinus subsp. marinus str. CCMP1375]
 gb|KGG11646.1| Nucleoside diphosphate kinase [Prochlorococcus marinus str. LG]
 gb|KGG22681.1| Nucleoside diphosphate kinase [Prochlorococcus marinus str. SS35]
 gb|KGG32897.1| Nucleoside diphosphate kinase [Prochlorococcus marinus str. SS51]
 gb|KGG36592.1| Nucleoside diphosphate kinase [Prochlorococcus sp. SS52]
Length=151

 Score =   120 bits (301),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +2

Query  425  MERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSG  604
            +ERTF+AIKPDGVQRGLV EI+ RFERKGFKLV +K ++PSK  A++HY   K+RPFF+G
Sbjct  3    VERTFLAIKPDGVQRGLVGEILGRFERKGFKLVGLKQLIPSKELAEKHYGVHKERPFFTG  62

Query  605  LCNFLSSGPVVAMVWE  652
            L  F++SGPVVAMVWE
Sbjct  63   LVGFITSGPVVAMVWE  78



>ref|XP_003272317.2| PREDICTED: nucleoside diphosphate kinase 2, chloroplastic-like 
isoform 3 [Nomascus leucogenys]
Length=311

 Score =   124 bits (311),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 73/103 (71%), Gaps = 2/103 (2%)
 Frame = +2

Query  350  NWISGILALPAAAYMIQEK--DAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLV  523
             W+ G   + AAA  +Q K  +   A  ERTFIAIKPDGVQRGLV EII RFE+KGF+LV
Sbjct  21   TWVPGAFRVLAAAAGVQAKQLEGTMANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLV  80

Query  524  AIKIMVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
             +K M  S+   + HY DLKDRPFF+GL  ++ SGPVVAMVWE
Sbjct  81   GLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWE  123


 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +2

Query  419  AEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFF  598
            A +ERTFIAIKPDGVQRGLV EII RFE+KGF+LVA+K +  S+   ++HY DLKDRPFF
Sbjct  161  ANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYVDLKDRPFF  220

Query  599  SGLCNFLSSGPVVAMVWE  652
             GL  +++SGPVVAMVWE
Sbjct  221  PGLVKYMNSGPVVAMVWE  238



>ref|WP_036899223.1| nucleoside diphosphate kinase [Prochlorococcus marinus]
Length=152

 Score =   120 bits (300),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +2

Query  428  ERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGL  607
            E+TFIAIKPDGVQRG +SEII RFERKGFKLVA+K ++PSK  AQ+HY   K+RPFF+ L
Sbjct  4    EKTFIAIKPDGVQRGFISEIIGRFERKGFKLVALKQLIPSKELAQKHYGVHKERPFFNDL  63

Query  608  CNFLSSGPVVAMVWE  652
             +F+SSGPVVAMVWE
Sbjct  64   VDFISSGPVVAMVWE  78



>gb|ELW63014.1| Nucleoside diphosphate kinase B [Tupaia chinensis]
Length=194

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 75/99 (76%), Gaps = 0/99 (0%)
 Frame = +2

Query  356  ISGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKI  535
            I+ +LA   ++  +    A  + +ERTFIAIKPDGVQRGLV EII RFE+KGF+LVA+K 
Sbjct  23   INALLANLHSSLRVPPASATISNLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKF  82

Query  536  MVPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
            +  S+   ++HY+DLKDRPFF GL  +++SGPVVAMVWE
Sbjct  83   LRASEEHLKQHYNDLKDRPFFPGLVKYMNSGPVVAMVWE  121



>ref|WP_019475031.1| nucleoside diphosphate kinase [Prochlorococcus sp. W2]
Length=152

 Score =   119 bits (299),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +2

Query  428  ERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGL  607
            E+TFIAIKPDGVQRG +SEII RFERKGFKLVA+K ++PSK  AQ+HY   K+RPFF+ L
Sbjct  4    EKTFIAIKPDGVQRGFISEIIGRFERKGFKLVALKQLIPSKELAQKHYGVHKERPFFNDL  63

Query  608  CNFLSSGPVVAMVWE  652
             +F+SSGPVVAMVWE
Sbjct  64   VDFISSGPVVAMVWE  78



>ref|WP_011365437.1| nucleoside diphosphate kinase [Synechococcus sp. CC9605]
 ref|YP_382797.1| nucleoside diphosphate kinase [Synechococcus sp. CC9605]
 sp|Q3AGP0.1|NDK_SYNSC RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP 
kinase; AltName: Full=Nucleoside-2-P kinase [Synechococcus 
sp. CC9605]
 gb|ABB36242.1| Nucleoside-diphosphate kinase [Synechococcus sp. CC9605]
Length=151

 Score =   119 bits (299),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  428  ERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGL  607
            ERTFIAIKPDGVQRGLV EI+ RFERKGFKLV +K + PS+  A++HY   K+RPFF+GL
Sbjct  3    ERTFIAIKPDGVQRGLVGEILGRFERKGFKLVGLKQITPSRALAEQHYGVHKERPFFAGL  62

Query  608  CNFLSSGPVVAMVWE  652
             +F++SGPVVAMVWE
Sbjct  63   VDFITSGPVVAMVWE  77



>gb|AHF64904.1| Nucleoside-diphosphate kinase [Synechococcus sp. WH 8109]
Length=151

 Score =   119 bits (299),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  428  ERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGL  607
            ERTFIAIKPDGVQRGLV EI+ RFERKGFKLV +K + PS+  A++HY   K+RPFF+GL
Sbjct  3    ERTFIAIKPDGVQRGLVGEILGRFERKGFKLVGLKQITPSRALAEQHYGVHKERPFFAGL  62

Query  608  CNFLSSGPVVAMVWE  652
             +F++SGPVVAMVWE
Sbjct  63   VDFITSGPVVAMVWE  77



>gb|EFO63236.1| Nucleoside diphosphate kinase [Giardia lamblia P15]
Length=151

 Score =   119 bits (299),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = +2

Query  428  ERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGL  607
            ERTF+ +KPDGVQRGLV EIISRFER+GFKLVA+K  VPSK   + HY +   RPFF+GL
Sbjct  4    ERTFLMVKPDGVQRGLVGEIISRFERRGFKLVAMKFFVPSKNLVEEHYKEHATRPFFAGL  63

Query  608  CNFLSSGPVVAMVWE  652
            C FLSSGPV AMVWE
Sbjct  64   CKFLSSGPVCAMVWE  78



>ref|XP_006635154.1| PREDICTED: nucleoside diphosphate kinase-like [Lepisosteus oculatus]
Length=153

 Score =   119 bits (299),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +2

Query  416  AAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPF  595
            AA+ ERTFIAIKPDGVQRGL+ EII RFE+KGF+LVA+K++  S+   + HY DLKDRPF
Sbjct  2    AAQEERTFIAIKPDGVQRGLIGEIIKRFEQKGFRLVAMKMLHASEELLKEHYIDLKDRPF  61

Query  596  FSGLCNFLSSGPVVAMVWE  652
            +SGL  +++SGPVVAMVWE
Sbjct  62   YSGLVKYMNSGPVVAMVWE  80



>ref|XP_007239713.1| PREDICTED: nucleoside diphosphate kinase-like isoform X2 [Astyanax 
mexicanus]
Length=151

 Score =   119 bits (299),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +2

Query  416  AAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPF  595
            A   ERTFIAIKPDGVQRGL+ EII RFE KGFKLV +KI+  S+   ++HY DLKDRPF
Sbjct  2    AGNQERTFIAIKPDGVQRGLIGEIIKRFELKGFKLVGLKILHASEDLLKQHYSDLKDRPF  61

Query  596  FSGLCNFLSSGPVVAMVWE  652
            F GL +++SSGPVVAMVWE
Sbjct  62   FPGLVSYMSSGPVVAMVWE  80



>ref|WP_038650506.1| nucleoside diphosphate kinase [Prochlorococcus sp. MIT 0801]
 gb|AIQ96155.1| Nucleoside diphosphate kinase [Prochlorococcus sp. MIT 0801]
Length=151

 Score =   119 bits (299),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +2

Query  425  MERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSG  604
            +ERTF+AIKPDGVQRGL++EI+ RFE KGFKLV +K + PSK  A++HY   KDRPFFSG
Sbjct  3    LERTFVAIKPDGVQRGLIAEILGRFETKGFKLVGLKQLKPSKELAEKHYGVHKDRPFFSG  62

Query  605  LCNFLSSGPVVAMVWE  652
            L +F++SGPV+AMVWE
Sbjct  63   LVDFITSGPVIAMVWE  78



>ref|WP_011129211.1| nucleoside diphosphate kinase [Synechococcus sp. WH 8102]
 ref|NP_898447.1| nucleoside diphosphate kinase [Synechococcus sp. WH 8102]
 sp|Q7U3S1.1|NDK_SYNPX RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP 
kinase; AltName: Full=Nucleoside-2-P kinase [Synechococcus 
sp. WH 8102]
 emb|CAE08873.1| Nucleoside diphosphate kinase [Synechococcus sp. WH 8102]
Length=151

 Score =   119 bits (298),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  428  ERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGL  607
            ERTFIAIKPDGVQRGLV EI+ RFERKGFKLV +K + PS+  A++HY   K+RPFF+GL
Sbjct  3    ERTFIAIKPDGVQRGLVGEILGRFERKGFKLVGLKQITPSRALAEQHYGVHKERPFFAGL  62

Query  608  CNFLSSGPVVAMVWE  652
             +F++SGPVVAMVWE
Sbjct  63   VDFITSGPVVAMVWE  77



>gb|AIE73959.1| Nucleoside diphosphate kinase [Synechocystis sp. PCC 6714]
Length=149

 Score =   119 bits (298),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = +2

Query  425  MERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSG  604
            MERTFI IKPDGVQR L+ EI+ RFERKGFKLVA+K+M  S+  A++HY  L D+PFFSG
Sbjct  1    MERTFIMIKPDGVQRQLIGEIVGRFERKGFKLVAMKVMTVSQELAEKHYEALNDKPFFSG  60

Query  605  LCNFLSSGPVVAMVWE  652
            L NF+ S PVVAMVWE
Sbjct  61   LVNFICSSPVVAMVWE  76



>ref|WP_012164102.1| nucleoside diphosphate kinase [Acaryochloris marina]
 ref|YP_001518040.1| nucleoside diphosphate kinase [Acaryochloris marina MBIC11017]
 sp|B0C4I0.1|NDK_ACAM1 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP 
kinase; AltName: Full=Nucleoside-2-P kinase [Acaryochloris 
marina MBIC11017]
 gb|ABW28723.1| nucleoside diphosphate kinase [Acaryochloris marina MBIC11017]
Length=149

 Score =   119 bits (298),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = +2

Query  425  MERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSG  604
            MERTF+A+KPDGVQRGLV EIISR+E KGF LV +K+MV S+  A++HY + K++PFFSG
Sbjct  1    MERTFLAVKPDGVQRGLVGEIISRYEAKGFTLVGLKLMVVSRELAEQHYGEHKEKPFFSG  60

Query  605  LCNFLSSGPVVAMVWE  652
            L +F++SGPVVAMVWE
Sbjct  61   LVDFITSGPVVAMVWE  76



>ref|WP_011124205.1| nucleoside diphosphate kinase [Prochlorococcus marinus]
 ref|NP_874444.1| Nucleoside diphosphate kinase [Prochlorococcus marinus subsp. 
marinus str. CCMP1375]
 gb|AAP99096.1| Nucleoside diphosphate kinase [Prochlorococcus marinus subsp. 
marinus str. CCMP1375]
 gb|KGG22346.1| Nucleoside diphosphate kinase [Prochlorococcus marinus str. SS2]
Length=170

 Score =   119 bits (299),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +2

Query  425  MERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSG  604
            +ERTF+AIKPDGVQRGLV EI+ RFERKGFKLV +K ++PSK  A++HY   K+RPFF+G
Sbjct  22   VERTFLAIKPDGVQRGLVGEILGRFERKGFKLVGLKQLIPSKELAEKHYGVHKERPFFTG  81

Query  605  LCNFLSSGPVVAMVWE  652
            L  F++SGPVVAMVWE
Sbjct  82   LVGFITSGPVVAMVWE  97



>gb|EWM29213.1| nucleoside diphosphate kinase a [Nannochloropsis gaditana]
Length=113

 Score =   118 bits (295),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 59/75 (79%), Gaps = 0/75 (0%)
 Frame = +2

Query  428  ERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGL  607
            ERT+I IKPDGVQRGLV EII RFERKGFKLVA+K M  SK     HY DL D+PFF GL
Sbjct  4    ERTYIMIKPDGVQRGLVGEIIGRFERKGFKLVALKSMNASKDLLNEHYQDLADKPFFGGL  63

Query  608  CNFLSSGPVVAMVWE  652
              ++SSGPV+AMVWE
Sbjct  64   VAYMSSGPVIAMVWE  78



>ref|WP_028953069.1| nucleoside diphosphate kinase [Synechococcus sp. CC9616]
Length=152

 Score =   119 bits (297),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = +2

Query  425  MERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSG  604
            +ER+F+AIKPDGVQRGLV EII RFERKGFKLV +K + PS+  A++HY   KDRPFF+G
Sbjct  3    VERSFVAIKPDGVQRGLVGEIIGRFERKGFKLVGLKQITPSRELAEQHYGVHKDRPFFAG  62

Query  605  LCNFLSSGPVVAMVWE  652
            L  F++SGPVVAMVWE
Sbjct  63   LVEFITSGPVVAMVWE  78



>ref|XP_007239712.1| PREDICTED: nucleoside diphosphate kinase-like isoform X1 [Astyanax 
mexicanus]
Length=173

 Score =   119 bits (299),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +2

Query  416  AAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPF  595
            A   ERTFIAIKPDGVQRGL+ EII RFE KGFKLV +KI+  S+   ++HY DLKDRPF
Sbjct  24   AGNQERTFIAIKPDGVQRGLIGEIIKRFELKGFKLVGLKILHASEDLLKQHYSDLKDRPF  83

Query  596  FSGLCNFLSSGPVVAMVWE  652
            F GL +++SSGPVVAMVWE
Sbjct  84   FPGLVSYMSSGPVVAMVWE  102



>gb|EES99236.1| Nucleoside diphosphate kinase [Giardia intestinalis ATCC 50581]
 gb|ESU41688.1| Nucleoside diphosphate kinase [Giardia intestinalis]
Length=151

 Score =   119 bits (297),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = +2

Query  428  ERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGL  607
            ERTF+ +KPDGVQRGLV EIISRFER+GFKLVA+K  VPSK   + HY +   RPFF+GL
Sbjct  4    ERTFLMVKPDGVQRGLVGEIISRFERRGFKLVAMKFFVPSKNLVEEHYKEHAARPFFAGL  63

Query  608  CNFLSSGPVVAMVWE  652
            C FLSSGPV AMVWE
Sbjct  64   CKFLSSGPVCAMVWE  78



>ref|WP_007101278.1| nucleoside diphosphate kinase [Synechococcus sp. RS9917]
 gb|EAQ70467.1| Nucleoside-diphosphate kinase [Synechococcus sp. RS9917]
Length=151

 Score =   119 bits (297),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  428  ERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGL  607
            ERTFIAIKPDGVQRGLV EI+ RFERKGFKLV +K + PS+  A++HY   K+RPFF+GL
Sbjct  3    ERTFIAIKPDGVQRGLVGEILGRFERKGFKLVGLKQLTPSRELAEQHYGVHKERPFFAGL  62

Query  608  CNFLSSGPVVAMVWE  652
             +F++SGPVVAMVWE
Sbjct  63   VDFITSGPVVAMVWE  77



>ref|XP_001706095.1| Nucleoside diphosphate kinase [Giardia lamblia ATCC 50803]
 gb|EDO78421.1| Nucleoside diphosphate kinase [Giardia lamblia ATCC 50803]
 gb|ESU36398.1| Nucleoside diphosphate kinase [Giardia intestinalis]
Length=151

 Score =   119 bits (297),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = +2

Query  428  ERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGL  607
            ERTF+ +KPDGVQRGLV EIISRFER+GFKLVA+K  VPSK   + HY +   RPFF+GL
Sbjct  4    ERTFLMVKPDGVQRGLVGEIISRFERRGFKLVAMKFFVPSKNLVEEHYKEHAARPFFAGL  63

Query  608  CNFLSSGPVVAMVWE  652
            C FLSSGPV AMVWE
Sbjct  64   CKFLSSGPVCAMVWE  78



>ref|XP_001567673.1| nucleoside diphosphate kinase b [Leishmania braziliensis MHOM/BR/75/M2904]
 emb|CAM43116.1| nucleoside diphosphate kinase b [Leishmania braziliensis MHOM/BR/75/M2904]
Length=151

 Score =   119 bits (297),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = +2

Query  428  ERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGL  607
            ERTFIAIKPDGVQRGLV EIISRFERKGFKLVA+K++ P+   AQ HY DL  +PFF GL
Sbjct  4    ERTFIAIKPDGVQRGLVGEIISRFERKGFKLVALKMLQPTTEQAQGHYKDLASKPFFEGL  63

Query  608  CNFLSSGPVVAMVWE  652
              + SSGP+V MVWE
Sbjct  64   VKYFSSGPIVCMVWE  78



>ref|XP_008836629.1| PREDICTED: nucleoside diphosphate kinase B [Nannospalax galili]
Length=152

 Score =   119 bits (297),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +2

Query  419  AEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFF  598
            A +ERTFIAIKPDGVQRGLV EII RFE+KGF+LVA+K +  S+   ++HY DLKDRPFF
Sbjct  2    ANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFF  61

Query  599  SGLCNFLSSGPVVAMVWE  652
            SGL  +++SGPVVAMVWE
Sbjct  62   SGLVKYMNSGPVVAMVWE  79



>ref|WP_006042870.1| MULTISPECIES: nucleoside diphosphate kinase [Synechococcus]
 ref|YP_001226111.1| nucleoside diphosphate kinase [Synechococcus sp. WH 7803]
 sp|A5GPE9.1|NDK_SYNPW RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP 
kinase; AltName: Full=Nucleoside-2-P kinase [Synechococcus 
sp. WH 7803]
 gb|EAR17317.1| Nucleoside-diphosphate kinase [Synechococcus sp. WH 7805]
 emb|CAK24814.1| Nucleoside diphosphate kinase [Synechococcus sp. WH 7803]
Length=152

 Score =   119 bits (297),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  428  ERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGL  607
            ERTFIAIKPDGVQRGL+ EI+ RFERKGFKLV +K + PS+  A++HY   K+RPFF+GL
Sbjct  4    ERTFIAIKPDGVQRGLIGEILGRFERKGFKLVGLKQLTPSRELAEQHYGVHKERPFFAGL  63

Query  608  CNFLSSGPVVAMVWE  652
             +F++SGPVVAMVWE
Sbjct  64   VDFITSGPVVAMVWE  78



>pdb|3R9L|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From 
Giardia Lamblia Featuring A Disordered Dinucleotide Binding 
Site
Length=155

 Score =   119 bits (297),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = +2

Query  428  ERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGL  607
            ERTF+ +KPDGVQRGLV EIISRFER+GFKLVA+K  VPSK   + HY +   RPFF+GL
Sbjct  8    ERTFLMVKPDGVQRGLVGEIISRFERRGFKLVAMKFFVPSKNLVEEHYKEHAARPFFAGL  67

Query  608  CNFLSSGPVVAMVWE  652
            C FLSSGPV AMVWE
Sbjct  68   CKFLSSGPVCAMVWE  82



>pdb|3L7U|A Chain A, Crystal Structure Of Human Nm23-H1
 pdb|3L7U|B Chain B, Crystal Structure Of Human Nm23-H1
 pdb|3L7U|C Chain C, Crystal Structure Of Human Nm23-H1
Length=172

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 65/83 (78%), Gaps = 0/83 (0%)
 Frame = +2

Query  404  KDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLK  583
            + +H A  ERTFIAIKPDGVQRGLV EII RFE+KGF+LV +K M  S+   + HY DLK
Sbjct  17   RGSHMANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLK  76

Query  584  DRPFFSGLCNFLSSGPVVAMVWE  652
            DRPFF+GL  ++ SGPVVAMVWE
Sbjct  77   DRPFFAGLVKYMHSGPVVAMVWE  99



>ref|WP_015174722.1| nucleoside diphosphate kinase [Oscillatoria nigro-viridis]
 ref|YP_007113809.1| nucleoside diphosphate kinase [Oscillatoria nigro-viridis PCC 
7112]
 gb|AFZ05393.1| nucleoside diphosphate kinase [Oscillatoria nigro-viridis PCC 
7112]
Length=149

 Score =   118 bits (296),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = +2

Query  425  MERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSG  604
            MERTF+AIKPDGVQRGLV EII RFE KGFKLV +K+M  S+  A++HY   K++PFF+G
Sbjct  1    MERTFLAIKPDGVQRGLVGEIIGRFEAKGFKLVGMKLMTASRELAEQHYDVHKEKPFFAG  60

Query  605  LCNFLSSGPVVAMVWE  652
            L NF++SGPVVAMVWE
Sbjct  61   LVNFITSGPVVAMVWE  76



>ref|WP_038552400.1| nucleoside diphosphate kinase [Synechococcus sp. KORDI-52]
 gb|AII48195.1| nucleoside diphosphate kinase [Synechococcus sp. KORDI-52]
Length=151

 Score =   119 bits (297),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  428  ERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGL  607
            ERTF+AIKPDGVQRGLV EI+ RFERKGFKLV +K + PS+  A+ HY   K+RPFF+GL
Sbjct  3    ERTFVAIKPDGVQRGLVGEILGRFERKGFKLVGLKQITPSRALAEEHYGVHKERPFFAGL  62

Query  608  CNFLSSGPVVAMVWE  652
             +F++SGPVVAMVWE
Sbjct  63   VDFITSGPVVAMVWE  77



>ref|WP_032514112.1| nucleoside diphosphate kinase [Prochlorococcus marinus]
 gb|KGF89382.1| Nucleoside diphosphate kinase [Prochlorococcus marinus str. MIT 
9107]
 gb|KGF91128.1| Nucleoside diphosphate kinase [Prochlorococcus marinus str. MIT 
9116]
 gb|KGF94431.1| Nucleoside diphosphate kinase [Prochlorococcus marinus str. MIT 
9123]
Length=152

 Score =   118 bits (296),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  428  ERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGL  607
            ERTFIAIKPDGVQRG VSEII RFE+KGFKLV +K ++PSK  AQ HY   K+RPFF  L
Sbjct  4    ERTFIAIKPDGVQRGYVSEIIGRFEKKGFKLVGLKQLIPSKDLAQNHYGVHKERPFFGDL  63

Query  608  CNFLSSGPVVAMVWE  652
             NF+SSGPVVAMVW+
Sbjct  64   VNFISSGPVVAMVWQ  78



>ref|WP_032523032.1| nucleoside diphosphate kinase [Prochlorococcus marinus]
 gb|KGF94745.1| Nucleoside diphosphate kinase [Prochlorococcus marinus str. MIT 
9201]
Length=152

 Score =   118 bits (296),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  428  ERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGL  607
            ERTFIAIKPDGVQRG V+EII RFE+KGFKLV +K ++PSK  AQ HY   K+RPFF  L
Sbjct  4    ERTFIAIKPDGVQRGYVAEIIGRFEKKGFKLVGLKQLIPSKDLAQNHYGVHKERPFFGDL  63

Query  608  CNFLSSGPVVAMVWE  652
             NF+SSGPVVAMVWE
Sbjct  64   VNFISSGPVVAMVWE  78



>ref|WP_012194609.1| nucleoside diphosphate kinase [Prochlorococcus marinus]
 ref|YP_001549938.1| nucleoside diphosphate kinase [Prochlorococcus marinus str. MIT 
9211]
 sp|A9B9E7.1|NDK_PROM4 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP 
kinase; AltName: Full=Nucleoside-2-P kinase [Prochlorococcus 
marinus str. MIT 9211]
 gb|ABX07984.1| Nucleoside diphosphate kinase [Prochlorococcus marinus str. MIT 
9211]
Length=151

 Score =   118 bits (296),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +2

Query  428  ERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGL  607
            ERTF+AIKPDGVQRGLV EI+SRFERKGFKL+A+K ++PS+  A++HY   ++RPFF GL
Sbjct  4    ERTFLAIKPDGVQRGLVGEILSRFERKGFKLIALKQLIPSRALAEQHYGVHRERPFFKGL  63

Query  608  CNFLSSGPVVAMVWE  652
             +F++SGPV+AM+WE
Sbjct  64   VDFITSGPVIAMIWE  78



>ref|XP_005321668.1| PREDICTED: nucleoside diphosphate kinase A isoform X2 [Ictidomys 
tridecemlineatus]
Length=152

 Score =   118 bits (296),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  419  AEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFF  598
            A  ERTFIAIKPDGVQRGLV EII RFE+KGF+LV +K+M  S+   + HY DLKDRPFF
Sbjct  2    ANNERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKLMQASEDLLKEHYIDLKDRPFF  61

Query  599  SGLCNFLSSGPVVAMVWE  652
            SGL  ++ SGPVVAMVWE
Sbjct  62   SGLVKYMHSGPVVAMVWE  79



>ref|WP_025973085.1| nucleoside diphosphate kinase [Prochlorococcus sp. scB241_528P18]
Length=152

 Score =   118 bits (296),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  428  ERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGL  607
            ERTFIAIKPDGVQRG VSEII RFE+KGFKLV +K ++PSK  AQ HY   ++RPFFS L
Sbjct  4    ERTFIAIKPDGVQRGYVSEIIGRFEKKGFKLVGLKQLIPSKELAQNHYGVHRERPFFSDL  63

Query  608  CNFLSSGPVVAMVWE  652
             +F+SSGPVVAMVWE
Sbjct  64   VDFISSGPVVAMVWE  78



>ref|WP_007099240.1| nucleoside diphosphate kinase [Synechococcus sp. RS9916]
 gb|EAU75143.1| Nucleoside-diphosphate kinase [Synechococcus sp. RS9916]
Length=152

 Score =   118 bits (296),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  428  ERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGL  607
            ERTF+AIKPDGVQRGLV EI+ RFERKGFKLV +K + PS+  A+ HY   K+RPFF+GL
Sbjct  4    ERTFVAIKPDGVQRGLVGEILGRFERKGFKLVGLKQITPSRALAEEHYGVHKERPFFAGL  63

Query  608  CNFLSSGPVVAMVWE  652
             +F++SGPVVAMVWE
Sbjct  64   VDFITSGPVVAMVWE  78



>ref|XP_005321667.1| PREDICTED: nucleoside diphosphate kinase A isoform X1 [Ictidomys 
tridecemlineatus]
Length=167

 Score =   119 bits (297),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  419  AEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFF  598
            A  ERTFIAIKPDGVQRGLV EII RFE+KGF+LV +K+M  S+   + HY DLKDRPFF
Sbjct  17   ANNERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKLMQASEDLLKEHYIDLKDRPFF  76

Query  599  SGLCNFLSSGPVVAMVWE  652
            SGL  ++ SGPVVAMVWE
Sbjct  77   SGLVKYMHSGPVVAMVWE  94



>ref|XP_006218470.1| PREDICTED: nucleoside diphosphate kinase A 1-like isoform X1 
[Vicugna pacos]
 ref|XP_006218471.1| PREDICTED: nucleoside diphosphate kinase A 1-like isoform X2 
[Vicugna pacos]
 ref|XP_006218472.1| PREDICTED: nucleoside diphosphate kinase A 1-like isoform X3 
[Vicugna pacos]
 ref|XP_006218473.1| PREDICTED: nucleoside diphosphate kinase A 1-like isoform X4 
[Vicugna pacos]
Length=152

 Score =   118 bits (296),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +2

Query  419  AEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFF  598
            A  ERTFIAIKPDGVQRGLV EII RFE+KGF+LVA+K+M  S+   + HY DLKDRPFF
Sbjct  2    ANSERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKLMQASEDLLKEHYIDLKDRPFF  61

Query  599  SGLCNFLSSGPVVAMVWE  652
            +GL  ++ SGPVVAMVWE
Sbjct  62   AGLVKYMHSGPVVAMVWE  79



>ref|XP_007086749.1| PREDICTED: nucleoside diphosphate kinase B-like isoform X1 [Panthera 
tigris altaica]
Length=152

 Score =   118 bits (295),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +2

Query  419  AEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFF  598
            A  ERTFIAIKPDGVQRGLV EII RFE+KGF+LVA+K++  S+   ++HY DLKDRPFF
Sbjct  2    ANSERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKLIQASEELLKQHYIDLKDRPFF  61

Query  599  SGLCNFLSSGPVVAMVWE  652
             GL  ++SSGPVVAMVWE
Sbjct  62   PGLVKYMSSGPVVAMVWE  79



>ref|WP_011936789.1| nucleoside diphosphate kinase [Synechococcus sp. RCC307]
 ref|YP_001228633.1| nucleoside diphosphate kinase [Synechococcus sp. RCC307]
 emb|CAK29280.1| Nucleoside diphosphate kinase [Synechococcus sp. RCC307]
Length=187

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 65/81 (80%), Gaps = 0/81 (0%)
 Frame = +2

Query  410  AHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDR  589
            +     ERTFIAIKPDGVQRGLV EI+ RFERKGFKLV +K + PS+  A++HY   K+R
Sbjct  33   SQTMSTERTFIAIKPDGVQRGLVGEILGRFERKGFKLVGLKQLTPSRELAEQHYGVHKER  92

Query  590  PFFSGLCNFLSSGPVVAMVWE  652
            PFF+GL +F++SGPVVAMVWE
Sbjct  93   PFFAGLVDFITSGPVVAMVWE  113



>pdb|4KPC|A Chain A, Crystal Structure Of The Nucleoside Diphosphate Kinase 
B From Leishmania Braziliensis
 pdb|4KPC|B Chain B, Crystal Structure Of The Nucleoside Diphosphate Kinase 
B From Leishmania Braziliensis
Length=171

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = +2

Query  428  ERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGL  607
            ERTFIAIKPDGVQRGLV EIISRFERKGFKLVA+K++ P+   AQ HY DL  +PFF GL
Sbjct  24   ERTFIAIKPDGVQRGLVGEIISRFERKGFKLVALKMLQPTTEQAQGHYKDLASKPFFEGL  83

Query  608  CNFLSSGPVVAMVWE  652
              + SSGP+V MVWE
Sbjct  84   VKYFSSGPIVCMVWE  98



>ref|XP_004395264.1| PREDICTED: nucleoside diphosphate kinase B-like isoform 1 [Odobenus 
rosmarus divergens]
 ref|XP_004395266.1| PREDICTED: nucleoside diphosphate kinase B-like isoform 3 [Odobenus 
rosmarus divergens]
Length=152

 Score =   118 bits (295),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  419  AEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFF  598
            A  ERTFIAIKPDGVQRGLV EII RFE+KGF+LVA+K +  S+   Q+HY DLKDRPFF
Sbjct  2    AHQERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVALKFLQASEELLQQHYLDLKDRPFF  61

Query  599  SGLCNFLSSGPVVAMVWE  652
             GL  ++ SGPVVAMVWE
Sbjct  62   PGLVKYMHSGPVVAMVWE  79



>ref|XP_004363037.1| nucleoside diphosphate kinase [Dictyostelium fasciculatum]
 gb|EGG25186.1| nucleoside diphosphate kinase [Dictyostelium fasciculatum]
Length=161

 Score =   118 bits (296),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  428  ERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGL  607
            ERTFIAIKPDGV RGLV EIISRF+RKG+ LV +K +VPSK  A+ HY + K+RPFFSGL
Sbjct  5    ERTFIAIKPDGVARGLVGEIISRFQRKGYTLVGLKQVVPSKDLAESHYEEHKERPFFSGL  64

Query  608  CNFLSSGPVVAMVWE  652
             +F++SGPVVAMVWE
Sbjct  65   VSFITSGPVVAMVWE  79



>gb|EIE86357.1| nucleoside diphosphate kinase [Rhizopus delemar RA 99-880]
Length=226

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 65/76 (86%), Gaps = 1/76 (1%)
 Frame = +2

Query  428  ERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGL  607
            ERTFIAIKPDGVQRGLV ++ISRFE +G+KLV +K + PSK  A++HY DLK RPFF+GL
Sbjct  75   ERTFIAIKPDGVQRGLVGKVISRFEERGYKLVGLKAIAPSKELAEKHYEDLKARPFFAGL  134

Query  608  CNFLSSG-PVVAMVWE  652
             N+++SG PV+AMVWE
Sbjct  135  VNYMTSGTPVIAMVWE  150



>ref|XP_006739379.1| PREDICTED: nucleoside diphosphate kinase B isoform X1 [Leptonychotes 
weddellii]
Length=152

 Score =   118 bits (295),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  419  AEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFF  598
            A  ERTFIAIKPDGVQRGLV EII RFE+KGF+LVA+K +  S+   Q+HY DLKDRPFF
Sbjct  2    AHQERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLQASEELLQQHYLDLKDRPFF  61

Query  599  SGLCNFLSSGPVVAMVWE  652
             GL  ++ SGPVVAMVWE
Sbjct  62   PGLVKYMHSGPVVAMVWE  79



>ref|WP_010873220.1| nucleoside diphosphate kinase [Synechocystis sp. PCC 6803]
 ref|NP_441918.1| nucleoside diphosphate kinase [Synechocystis sp. PCC 6803]
 ref|YP_005383786.1| nucleoside diphosphate kinase [Synechocystis sp. PCC 6803 substr. 
GT-I]
 ref|YP_005386955.1| nucleoside diphosphate kinase [Synechocystis sp. PCC 6803 substr. 
PCC-P]
 ref|YP_005409662.1| nucleoside diphosphate kinase [Synechocystis sp. PCC 6803 substr. 
PCC-N]
 ref|YP_005651978.1| nucleoside diphosphate kinase [Synechocystis sp. PCC 6803]
 ref|YP_007451798.1| nucleoside diphosphate kinase [Synechocystis sp. PCC 6803]
 sp|P74494.1|NDK_SYNY3 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP 
kinase; AltName: Full=Nucleoside-2-P kinase [Synechocystis 
sp. PCC 6803 substr. Kazusa]
 dbj|BAA18596.1| nucleoside diphosphate kinase [Synechocystis sp. PCC 6803]
 dbj|BAK50773.1| nucleoside diphosphate kinase [Synechocystis sp. PCC 6803]
 dbj|BAL29771.1| nucleoside diphosphate kinase [Synechocystis sp. PCC 6803 substr. 
GT-I]
 dbj|BAL32940.1| nucleoside diphosphate kinase [Synechocystis sp. PCC 6803 substr. 
PCC-N]
 dbj|BAL36109.1| nucleoside diphosphate kinase [Synechocystis sp. PCC 6803 substr. 
PCC-P]
 dbj|BAM54673.1| nucleoside diphosphate kinase [Synechocystis sp. PCC 6803]
 gb|AGF52284.1| nucleoside diphosphate kinase [Synechocystis sp. PCC 6803]
Length=149

 Score =   118 bits (295),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = +2

Query  425  MERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSG  604
            MERTFI IKPDGVQR L+ EI+ RFE+KGFKLVA+K+M  S+  A++HY  L D+PFFSG
Sbjct  1    MERTFIMIKPDGVQRQLIGEIVGRFEKKGFKLVAMKVMTVSQELAEKHYEALNDKPFFSG  60

Query  605  LCNFLSSGPVVAMVWE  652
            L NF+ S PVVAMVWE
Sbjct  61   LVNFICSSPVVAMVWE  76



>ref|WP_028051727.1| nucleoside diphosphate kinase [Carboxydothermus ferrireducens]
Length=149

 Score =   117 bits (294),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = +2

Query  425  MERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSG  604
            MERTFI +KPDGVQRGLV EIISRFE++GFKLV +K+M  S+  A+ HY + K +PFF G
Sbjct  1    MERTFIMVKPDGVQRGLVGEIISRFEKRGFKLVGLKLMQISRELAETHYGEHKGKPFFEG  60

Query  605  LCNFLSSGPVVAMVWE  652
            L NF++SGPVVAMVWE
Sbjct  61   LVNFITSGPVVAMVWE  76



>ref|XP_006177030.1| PREDICTED: nucleoside diphosphate kinase A 1 isoform X1 [Camelus 
ferus]
 ref|XP_006177032.1| PREDICTED: nucleoside diphosphate kinase A 1 isoform X3 [Camelus 
ferus]
 ref|XP_006177033.1| PREDICTED: nucleoside diphosphate kinase A 1 isoform X4 [Camelus 
ferus]
 ref|XP_010947915.1| PREDICTED: nucleoside diphosphate kinase A [Camelus bactrianus]
 ref|XP_010988623.1| PREDICTED: nucleoside diphosphate kinase A [Camelus dromedarius]
Length=152

 Score =   118 bits (295),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +2

Query  419  AEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFF  598
            A  ERTFIAIKPDGVQRGLV EII RFE+KGF+L+A+K+M  S+   + HY DLKDRPFF
Sbjct  2    ANSERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLIAMKLMQASEDLLKEHYIDLKDRPFF  61

Query  599  SGLCNFLSSGPVVAMVWE  652
            +GL  ++ SGPVVAMVWE
Sbjct  62   AGLVKYMHSGPVVAMVWE  79



>ref|WP_011343163.1| nucleoside diphosphate kinase [Carboxydothermus hydrogenoformans]
 ref|YP_359087.1| nucleoside diphosphate kinase [Carboxydothermus hydrogenoformans 
Z-2901]
 sp|Q3AFJ7.1|NDK_CARHZ RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP 
kinase; AltName: Full=Nucleoside-2-P kinase [Carboxydothermus 
hydrogenoformans Z-2901]
 gb|ABB15304.1| nucleoside diphosphate kinase [Carboxydothermus hydrogenoformans 
Z-2901]
Length=149

 Score =   117 bits (294),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = +2

Query  425  MERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSG  604
            MERTFI +KPDGVQRGLV EIISRFE++GFKLV +K+M  S+  A+ HY + K +PFF G
Sbjct  1    MERTFIMVKPDGVQRGLVGEIISRFEKRGFKLVGLKLMQISRELAETHYGEHKGKPFFEG  60

Query  605  LCNFLSSGPVVAMVWE  652
            L NF++SGPVVAMVWE
Sbjct  61   LLNFITSGPVVAMVWE  76



>gb|EPY86739.1| nucleoside diphosphate kinase A isoform a [Camelus ferus]
Length=168

 Score =   118 bits (296),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +2

Query  419  AEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFF  598
            A  ERTFIAIKPDGVQRGLV EII RFE+KGF+L+A+K+M  S+   + HY DLKDRPFF
Sbjct  18   ANSERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLIAMKLMQASEDLLKEHYIDLKDRPFF  77

Query  599  SGLCNFLSSGPVVAMVWE  652
            +GL  ++ SGPVVAMVWE
Sbjct  78   AGLVKYMHSGPVVAMVWE  95



>ref|XP_005693696.1| PREDICTED: nucleoside diphosphate kinase B isoform X1 [Capra 
hircus]
Length=152

 Score =   117 bits (294),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 66/81 (81%), Gaps = 3/81 (4%)
 Frame = +2

Query  410  AHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDR  589
            AHA   ERTFIAIKPDGVQRGLV E+I RFE+KGF+LVA+K +  S+   Q+HY DLKDR
Sbjct  2    AHA---ERTFIAIKPDGVQRGLVGEVIKRFEQKGFRLVAMKFLQASEELLQQHYIDLKDR  58

Query  590  PFFSGLCNFLSSGPVVAMVWE  652
            PFF GL  +++SGPVVAMVWE
Sbjct  59   PFFPGLVKYMNSGPVVAMVWE  79



>ref|XP_008726150.1| nucleoside diphosphate kinase [Cladophialophora carrionii CBS 
160.54]
 gb|ETI24214.1| nucleoside diphosphate kinase [Cladophialophora carrionii CBS 
160.54]
Length=152

 Score =   117 bits (294),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  428  ERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGL  607
            E+TFIA+KPDGVQRGLV +IISRFE++G+KLVAIK+  P K   ++HY DLKD+PFF GL
Sbjct  4    EQTFIAVKPDGVQRGLVGDIISRFEKRGYKLVAIKMTSPGKEHLEKHYEDLKDKPFFKGL  63

Query  608  CNFLSSGPVVAMVWE  652
              ++ SGP+VAMVWE
Sbjct  64   VTYMLSGPIVAMVWE  78



>ref|NP_001127154.1| nucleoside diphosphate kinase B [Pongo abelii]
 sp|Q5RFH3.1|NDKB_PONAB RecName: Full=Nucleoside diphosphate kinase B; Short=NDK B; Short=NDP 
kinase B; AltName: Full=Histidine protein kinase NDKB 
[Pongo abelii]
 emb|CAH89484.1| hypothetical protein [Pongo abelii]
Length=152

 Score =   117 bits (294),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +2

Query  419  AEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFF  598
            A +ERTFIAIKPDGVQRGLV EII RFE+KGF+LVA+K +  S+   ++HY DLKDRPFF
Sbjct  2    ANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYTDLKDRPFF  61

Query  599  SGLCNFLSSGPVVAMVWE  652
             GL  +++SGPVVAMVWE
Sbjct  62   PGLVKYMNSGPVVAMVWE  79



>ref|XP_006940265.1| PREDICTED: nucleoside diphosphate kinase A [Felis catus]
Length=152

 Score =   117 bits (294),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +2

Query  419  AEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFF  598
            A  ERTFIAIKPDGVQRGLV EII RFE+KGF+LVA+K++  S+   + HY DLKDRPFF
Sbjct  2    ANSERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKLIQASEDLLKEHYIDLKDRPFF  61

Query  599  SGLCNFLSSGPVVAMVWE  652
            +GL  ++ SGPVVAMVWE
Sbjct  62   AGLVKYMQSGPVVAMVWE  79



>ref|XP_007757280.1| nucleoside diphosphate kinase [Cladophialophora yegresii CBS 
114405]
 gb|EXJ60927.1| nucleoside diphosphate kinase [Cladophialophora yegresii CBS 
114405]
Length=152

 Score =   117 bits (294),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  428  ERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGL  607
            E+TFIA+KPDGVQRGLV +IISRFE++G+KLVAIK+  P K   ++HY DLKD+PFF GL
Sbjct  4    EQTFIAVKPDGVQRGLVGDIISRFEKRGYKLVAIKMTSPGKEHLEKHYEDLKDKPFFKGL  63

Query  608  CNFLSSGPVVAMVWE  652
              ++ SGP+VAMVWE
Sbjct  64   VTYMLSGPIVAMVWE  78



>ref|XP_308641.4| AGAP007120-PA [Anopheles gambiae str. PEST]
 gb|EAA04524.4| AGAP007120-PA [Anopheles gambiae str. PEST]
Length=168

 Score =   118 bits (295),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 62/81 (77%), Gaps = 0/81 (0%)
 Frame = +2

Query  410  AHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDR  589
            A AA  ERTFI IKPDGVQRGLV +I+ RFE KGFKLVA+K M PSK   ++HY DL  R
Sbjct  15   AMAANKERTFIMIKPDGVQRGLVGQIMQRFEAKGFKLVAMKFMWPSKELLEKHYADLSAR  74

Query  590  PFFSGLCNFLSSGPVVAMVWE  652
            PFF GL  ++SSGPVV MVWE
Sbjct  75   PFFPGLVTYMSSGPVVPMVWE  95



>emb|CBJ28342.1| expressed unknown protein [Ectocarpus siliculosus]
Length=237

 Score =   120 bits (300),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 72/98 (73%), Gaps = 4/98 (4%)
 Frame = +2

Query  359  SGILALPAAAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIM  538
            + + A PA  Y  +   AH    ER+FIAIKPDGVQR LV E+ISRFE+KG+KLVA+K++
Sbjct  69   TALCAAPAFKYTGEPGTAH----ERSFIAIKPDGVQRQLVGEVISRFEKKGYKLVAMKMI  124

Query  539  VPSKVFAQRHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
             P+K  A  HY DL  +PFFSGL ++ SSGP+VAMVWE
Sbjct  125  WPTKEMAANHYADLSKKPFFSGLVDYFSSGPIVAMVWE  162



>ref|WP_006854110.1| nucleoside diphosphate kinase [Synechococcus sp. WH 8016]
 gb|EHA61903.1| Nucleoside diphosphate kinase [Synechococcus sp. WH 8016]
Length=152

 Score =   117 bits (294),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  428  ERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGL  607
            ER+FIAIKPDGVQRGLV EI+ RFERKGFKLV +K + PS+  A++HY   K+RPFF+GL
Sbjct  4    ERSFIAIKPDGVQRGLVGEILGRFERKGFKLVGLKQLTPSRELAEQHYGVHKERPFFAGL  63

Query  608  CNFLSSGPVVAMVWE  652
             +F++SGPVVAMVWE
Sbjct  64   VDFITSGPVVAMVWE  78



>ref|WP_010467689.1| nucleoside diphosphate kinase [Acaryochloris sp. CCMEE 5410]
Length=149

 Score =   117 bits (293),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +2

Query  425  MERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSG  604
            MERTF+A+KPDGVQRGLV EIISR+E KGF LV +K+MV S+  A++HY + K++PFF G
Sbjct  1    MERTFLAVKPDGVQRGLVGEIISRYEAKGFTLVGLKLMVVSRELAEQHYGEHKEKPFFGG  60

Query  605  LCNFLSSGPVVAMVWE  652
            L +F++SGPVVAMVWE
Sbjct  61   LVDFITSGPVVAMVWE  76



>ref|WP_009788698.1| MULTISPECIES: nucleoside diphosphate kinase [Synechococcus]
 ref|YP_378172.1| nucleoside diphosphate kinase [Synechococcus sp. CC9902]
 sp|Q3AVV5.1|NDK_SYNS9 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP 
kinase; AltName: Full=Nucleoside-2-P kinase [Synechococcus 
sp. CC9902]
 gb|ABB27129.1| nucleoside diphosphate kinase [Synechococcus sp. CC9902]
 gb|EAU71336.1| Nucleoside-diphosphate kinase [Synechococcus sp. BL107]
Length=151

 Score =   117 bits (293),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  428  ERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGL  607
            ERTF+AIKPDGVQRGLV EI+ RFERKGFKLV +K + PS+  A+ HY   K+RPFF+GL
Sbjct  3    ERTFVAIKPDGVQRGLVGEILGRFERKGFKLVGLKQITPSRALAEEHYGVHKERPFFAGL  62

Query  608  CNFLSSGPVVAMVWE  652
              F++SGPVVAMVWE
Sbjct  63   VGFITSGPVVAMVWE  77



>gb|AII46406.1| nucleoside diphosphate kinase [Synechococcus sp. KORDI-49]
Length=151

 Score =   117 bits (293),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  428  ERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGL  607
            ERTFIAIKPDGVQRGLV EI+ RFERKGFKLV +K   PS+  A++HY   K+RPFF+GL
Sbjct  3    ERTFIAIKPDGVQRGLVGEILGRFERKGFKLVGLKQTTPSRELAEQHYGVHKERPFFAGL  62

Query  608  CNFLSSGPVVAMVWE  652
              F++SGPVVAMVWE
Sbjct  63   VEFITSGPVVAMVWE  77



>ref|XP_007525610.1| PREDICTED: nucleoside diphosphate kinase B isoform X1 [Erinaceus 
europaeus]
Length=152

 Score =   117 bits (293),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +2

Query  419  AEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFF  598
            A  ERTFIAIKPDGVQRGLV EII RFE+KGF+LVA+K +  S+   ++HY DLKDRPFF
Sbjct  2    ANTERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLQASEELLKQHYIDLKDRPFF  61

Query  599  SGLCNFLSSGPVVAMVWE  652
             GL  +++SGPVVAMVWE
Sbjct  62   PGLVKYMNSGPVVAMVWE  79



>ref|XP_005350593.1| PREDICTED: nucleoside diphosphate kinase A isoform X1 [Microtus 
ochrogaster]
 ref|XP_005350594.1| PREDICTED: nucleoside diphosphate kinase A isoform X2 [Microtus 
ochrogaster]
Length=152

 Score =   117 bits (293),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +2

Query  419  AEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFF  598
            A  ERTFIAIKPDGVQRGLV EII RFE+KGF+LV +K M  S+   + HY DLKDRPFF
Sbjct  2    ANTERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYIDLKDRPFF  61

Query  599  SGLCNFLSSGPVVAMVWE  652
            +GL  ++ SGPVVAMVWE
Sbjct  62   TGLVKYMHSGPVVAMVWE  79



>ref|WP_017653455.1| nucleoside diphosphate kinase [Microchaete sp. PCC 7126]
Length=149

 Score =   117 bits (293),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = +2

Query  425  MERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSG  604
            MERTF+AIKPDGVQRGL+SEII RFE+KGF LV +K + PSK  A+ HY   + RPFF+G
Sbjct  1    MERTFLAIKPDGVQRGLISEIIGRFEKKGFTLVGLKFLTPSKELAEEHYAVHRQRPFFAG  60

Query  605  LCNFLSSGPVVAMVWE  652
            L  F++SGPVVAMVWE
Sbjct  61   LVEFITSGPVVAMVWE  76



>ref|XP_007176555.1| PREDICTED: nucleoside diphosphate kinase A 1-like isoform X1 
[Balaenoptera acutorostrata scammoni]
 ref|XP_007176556.1| PREDICTED: nucleoside diphosphate kinase A 1-like isoform X2 
[Balaenoptera acutorostrata scammoni]
 ref|XP_007176557.1| PREDICTED: nucleoside diphosphate kinase A 1-like isoform X3 
[Balaenoptera acutorostrata scammoni]
Length=152

 Score =   117 bits (293),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  419  AEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFF  598
            A  ERTFIAIKPDGVQRGLV EII RFE+KGF+LVA+K M  S+   + HY DLKDRPFF
Sbjct  2    ANSERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFMQASEDLLKEHYIDLKDRPFF  61

Query  599  SGLCNFLSSGPVVAMVWE  652
            +GL  ++ SGPVVAMVWE
Sbjct  62   AGLVKYMHSGPVVAMVWE  79



>ref|WP_006173202.1| nucleoside diphosphate kinase [Synechococcus sp. WH 5701]
 gb|EAQ76583.1| Nucleoside-diphosphate kinase [Synechococcus sp. WH 5701]
Length=152

 Score =   117 bits (293),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +2

Query  425  MERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSG  604
            +ERTF+AIKPDGVQRGLV EI+ RFERKGFKLV +K +VPS+  A+ HY   ++RPFF+G
Sbjct  3    VERTFLAIKPDGVQRGLVGEILGRFERKGFKLVGLKQLVPSRELAESHYGVHRERPFFAG  62

Query  605  LCNFLSSGPVVAMVWE  652
            L +F++SGPVVAMVWE
Sbjct  63   LVDFITSGPVVAMVWE  78



>ref|XP_007086750.1| PREDICTED: nucleoside diphosphate kinase B-like isoform X2 [Panthera 
tigris altaica]
Length=152

 Score =   117 bits (293),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +2

Query  419  AEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFF  598
            A  ERTFIAIKPDGVQRGLV EII RFE+KGF+LVA+K++  S+   + HY DLKDRPFF
Sbjct  2    ANSERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKLIQASEDLLKEHYIDLKDRPFF  61

Query  599  SGLCNFLSSGPVVAMVWE  652
            +GL  ++ SGPVVAMVWE
Sbjct  62   AGLVKYMQSGPVVAMVWE  79



>ref|XP_006972065.1| PREDICTED: nucleoside diphosphate kinase B isoform X1 [Peromyscus 
maniculatus bairdii]
 ref|XP_006972066.1| PREDICTED: nucleoside diphosphate kinase B isoform X2 [Peromyscus 
maniculatus bairdii]
Length=152

 Score =   117 bits (293),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +2

Query  419  AEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFF  598
            A +ERTFIAIKPDGVQRGLV EII RFE+KGF+LVA+K +  S+   ++HY DLKDRPFF
Sbjct  2    ANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFF  61

Query  599  SGLCNFLSSGPVVAMVWE  652
             GL  +++SGPVVAMVWE
Sbjct  62   PGLVKYMNSGPVVAMVWE  79



>ref|NP_001191678.1| nucleoside diphosphate kinase A [Oryctolagus cuniculus]
 ref|XP_008269326.1| PREDICTED: nucleoside diphosphate kinase A isoform X1 [Oryctolagus 
cuniculus]
Length=152

 Score =   117 bits (293),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  419  AEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFF  598
            A  ERTFIAIKPDGVQRGLV EII RFE+KGF+LV++K+M  S+   + HY DLKDRPFF
Sbjct  2    ANTERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVSLKLMQASEDLLREHYIDLKDRPFF  61

Query  599  SGLCNFLSSGPVVAMVWE  652
             GL  ++ SGPVVAMVWE
Sbjct  62   PGLVKYMHSGPVVAMVWE  79



>ref|NP_001191688.1| nucleoside diphosphate kinase A [Sus scrofa]
 ref|XP_005668988.1| PREDICTED: nucleoside diphosphate kinase A isoform X1 [Sus scrofa]
Length=152

 Score =   117 bits (293),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  419  AEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFF  598
            A  ERTFIAIKPDGVQRGLV EII RFE+KGF+LVA+K M  S+   + HY DLKDRPFF
Sbjct  2    ASSERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFMQASEDLLKEHYIDLKDRPFF  61

Query  599  SGLCNFLSSGPVVAMVWE  652
            +GL  ++ SGPVVAMVWE
Sbjct  62   AGLVTYMHSGPVVAMVWE  79



>ref|WP_011620633.1| nucleoside diphosphate kinase [Synechococcus sp. CC9311]
 ref|YP_731929.1| nucleoside diphosphate kinase [Synechococcus sp. CC9311]
 sp|Q0I6J3.1|NDK_SYNS3 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP 
kinase; AltName: Full=Nucleoside-2-P kinase [Synechococcus 
sp. CC9311]
 gb|ABI45404.1| nucleoside diphosphate kinase [Synechococcus sp. CC9311]
Length=152

 Score =   117 bits (293),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  428  ERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGL  607
            ER+FIAIKPDGVQRGLV EI+ RFERKGFKLV +K + PS+  A++HY   K+RPFF GL
Sbjct  4    ERSFIAIKPDGVQRGLVGEILGRFERKGFKLVGLKQLTPSRELAEQHYGVHKERPFFGGL  63

Query  608  CNFLSSGPVVAMVWE  652
             +F++SGPVVAMVWE
Sbjct  64   VDFITSGPVVAMVWE  78



>ref|XP_007465059.1| PREDICTED: nucleoside diphosphate kinase A 1-like [Lipotes vexillifer]
Length=152

 Score =   117 bits (293),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  419  AEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFF  598
            A  ERTFIAIKPDGVQRGLV EII RFE+KGF+LVA+K M  S+   + HY DLKDRPFF
Sbjct  2    ANSERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFMQASEDLLKEHYIDLKDRPFF  61

Query  599  SGLCNFLSSGPVVAMVWE  652
            +GL  ++ SGPVVAMVWE
Sbjct  62   AGLVKYMHSGPVVAMVWE  79



>ref|XP_008516172.1| PREDICTED: nucleoside diphosphate kinase A 2 isoform X3 [Equus 
przewalskii]
Length=196

 Score =   118 bits (296),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 69/90 (77%), Gaps = 0/90 (0%)
 Frame = +2

Query  383  AAYMIQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQ  562
            A + +++ +   A  ERTFIAIKPDGVQR LV EII RFE+KGF+LVA+K M  S+   +
Sbjct  34   APWDLEQLEGTMAHSERTFIAIKPDGVQRSLVGEIIKRFEQKGFRLVAMKFMRASEDLLK  93

Query  563  RHYHDLKDRPFFSGLCNFLSSGPVVAMVWE  652
             HY+DLKDRPFF+GL  ++ SGPVVAMVWE
Sbjct  94   EHYNDLKDRPFFAGLVKYMHSGPVVAMVWE  123



>ref|XP_004282598.1| PREDICTED: nucleoside diphosphate kinase A 1 isoform 2 [Orcinus 
orca]
Length=152

 Score =   117 bits (293),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  419  AEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFF  598
            A  ERTFIAIKPDGVQRGLV EII RFE+KGF+LVA+K M  S+   + HY DLKDRPFF
Sbjct  2    ANSERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFMQASEDLLKEHYIDLKDRPFF  61

Query  599  SGLCNFLSSGPVVAMVWE  652
            +GL  ++ SGPVVAMVWE
Sbjct  62   AGLVKYMHSGPVVAMVWE  79



>ref|WP_025925747.1| nucleoside diphosphate kinase [Prochlorococcus sp. scB241_528J8]
Length=152

 Score =   117 bits (293),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  428  ERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGL  607
            ERTFIAIKPDGVQRG VSEII RFE+KGFKLV +K ++PSK  AQ HY   ++RPFF  L
Sbjct  4    ERTFIAIKPDGVQRGYVSEIIGRFEKKGFKLVGLKQLIPSKELAQNHYGVHRERPFFGDL  63

Query  608  CNFLSSGPVVAMVWE  652
             +F+SSGPVVAMVWE
Sbjct  64   VDFISSGPVVAMVWE  78



>ref|XP_007424650.1| PREDICTED: nucleoside diphosphate kinase-like [Python bivittatus]
Length=153

 Score =   117 bits (293),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +2

Query  416  AAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPF  595
            A+  ERTFIAIKPDGVQRGLV EII RFE+KGF LVA+K++  S+   ++HY DLKDRPF
Sbjct  2    ASNTERTFIAIKPDGVQRGLVGEIIKRFEQKGFHLVAMKMLHASEELLKQHYIDLKDRPF  61

Query  596  FSGLCNFLSSGPVVAMVWE  652
            +SGL  +++SGPV+AMVWE
Sbjct  62   YSGLVKYMNSGPVIAMVWE  80



>ref|XP_007745646.1| nucleoside diphosphate kinase [Cladophialophora psammophila CBS 
110553]
 gb|EXJ69794.1| nucleoside diphosphate kinase [Cladophialophora psammophila CBS 
110553]
Length=152

 Score =   117 bits (293),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  428  ERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGL  607
            E+TFIA+KPDGVQRGLV +IISRFE++G+KLVAIK++ PSK   ++HY DL D+PFF GL
Sbjct  4    EQTFIAVKPDGVQRGLVGDIISRFEKRGYKLVAIKMVSPSKEHLEKHYEDLSDKPFFKGL  63

Query  608  CNFLSSGPVVAMVWE  652
              ++ SGP+VAMVWE
Sbjct  64   VTYMLSGPIVAMVWE  78



>ref|WP_025968927.1| nucleoside diphosphate kinase [Prochlorococcus sp. scB245a_519G16]
Length=152

 Score =   117 bits (292),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  428  ERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGL  607
            ERTFIAIKPDGVQRG VSEII RFE+KGFKLV +K ++PSK  AQ HY   ++RPFF  L
Sbjct  4    ERTFIAIKPDGVQRGYVSEIIGRFEKKGFKLVGLKQLIPSKELAQNHYGVHRERPFFGDL  63

Query  608  CNFLSSGPVVAMVWE  652
             +F+SSGPVVAMVWE
Sbjct  64   VDFISSGPVVAMVWE  78



>ref|WP_025905759.1| MULTISPECIES: nucleoside diphosphate kinase [Prochlorococcus]
Length=152

 Score =   117 bits (292),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  428  ERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGL  607
            ERTFIAIKPDGVQRG VSEII RFE+KGFKLV +K ++PSK  AQ HY   ++RPFF  L
Sbjct  4    ERTFIAIKPDGVQRGYVSEIIGRFEKKGFKLVGLKQLIPSKELAQNHYGVHRERPFFGDL  63

Query  608  CNFLSSGPVVAMVWE  652
             +F+SSGPVVAMVWE
Sbjct  64   VDFISSGPVVAMVWE  78



>ref|XP_003711050.1| nucleoside diphosphate kinase [Magnaporthe oryzae 70-15]
 gb|EHA58438.1| nucleoside diphosphate kinase [Magnaporthe oryzae 70-15]
Length=237

 Score =   119 bits (298),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = +2

Query  404  KDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLK  583
            K+      E+TFIAIKPDGVQRGLV  IISRFE++G+KLVAIK++ P K   ++HY DLK
Sbjct  80   KNTAKMSTEQTFIAIKPDGVQRGLVGPIISRFEQRGYKLVAIKLVTPGKAHLEQHYADLK  139

Query  584  DRPFFSGLCNFLSSGPVVAMVWE  652
            D+PFF+GL  +++SGP+ AMVWE
Sbjct  140  DKPFFAGLVEYMNSGPIAAMVWE  162



>ref|NP_001187018.1| putative oncoprotein nm23 [Ictalurus punctatus]
 gb|AAG14350.1|AF283993_1 putative oncoprotein nm23 [Ictalurus punctatus]
 gb|ADO29305.1| nucleoside diphosphate kinase b [Ictalurus punctatus]
Length=153

 Score =   117 bits (292),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +2

Query  416  AAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPF  595
            AA+ ERTFIAIKPDGVQRGL+ +II RFE+KGF+LVA+K +  S+   ++HY DLKDRPF
Sbjct  2    AAKAERTFIAIKPDGVQRGLIGDIIKRFEQKGFRLVALKFLQASEDLLKQHYIDLKDRPF  61

Query  596  FSGLCNFLSSGPVVAMVWE  652
            + GL  ++SSGPVVAMVWE
Sbjct  62   YPGLVKYMSSGPVVAMVWE  80



>ref|WP_025924018.1| MULTISPECIES: nucleoside diphosphate kinase [Prochlorococcus]
Length=152

 Score =   117 bits (292),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  428  ERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGL  607
            ERTFIAIKPDGVQRG VSEII RFE+KGFKLV +K ++PSK  AQ HY   ++RPFF  L
Sbjct  4    ERTFIAIKPDGVQRGYVSEIIGRFEKKGFKLVGLKQLIPSKELAQNHYGVHRERPFFGDL  63

Query  608  CNFLSSGPVVAMVWE  652
             +F+SSGPVVAMVWE
Sbjct  64   VDFISSGPVVAMVWE  78



>ref|WP_025934186.1| nucleoside diphosphate kinase, partial [Prochlorococcus sp. scB243_498J20]
Length=138

 Score =   116 bits (291),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  428  ERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGL  607
            ERTFIAIKPDGVQRG +SEII RFE+KGFKLV +K ++PSK  AQ HY   ++RPFF  L
Sbjct  4    ERTFIAIKPDGVQRGYISEIIGRFEKKGFKLVGLKQLIPSKELAQNHYGVHRERPFFGDL  63

Query  608  CNFLSSGPVVAMVWE  652
             +F+SSGPVVAMVWE
Sbjct  64   VDFISSGPVVAMVWE  78



>ref|WP_025972755.1| nucleoside diphosphate kinase [Prochlorococcus sp. scB241_527L22]
Length=152

 Score =   117 bits (292),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  428  ERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGL  607
            ERTFIAIKPDGVQRG VSEII RFE+KGFKLV +K ++PSK  AQ HY   ++RPFF  L
Sbjct  4    ERTFIAIKPDGVQRGYVSEIIGRFEKKGFKLVGLKQLIPSKELAQNHYGIHRERPFFGDL  63

Query  608  CNFLSSGPVVAMVWE  652
             +F+SSGPVVAMVWE
Sbjct  64   VDFISSGPVVAMVWE  78



>ref|XP_004764912.1| PREDICTED: nucleoside diphosphate kinase 2, chloroplastic-like 
isoform X3 [Mustela putorius furo]
Length=152

 Score =   117 bits (292),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +2

Query  419  AEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFF  598
            A  ERTFIAIKPDGVQRGLV EII RFE+KGF+LVA+K +  S+   ++HY DLKDRPFF
Sbjct  2    AHQERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLQASQELLKQHYIDLKDRPFF  61

Query  599  SGLCNFLSSGPVVAMVWE  652
             GL  +++SGPVVAMVWE
Sbjct  62   PGLVKYMNSGPVVAMVWE  79



>gb|EPY39770.1| nucleoside diphosphate kinase B [Angomonas deanei]
 gb|EPY42973.1| nucleoside-diphosphate kinase [Angomonas deanei]
Length=151

 Score =   117 bits (292),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = +2

Query  428  ERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGL  607
            ERTFIAIKPDGVQRGLV EII+RFERKGFKLVA+K++ PSK  A+ HY DL  +PFF  L
Sbjct  4    ERTFIAIKPDGVQRGLVGEIIARFERKGFKLVALKMLQPSKEQAEGHYTDLSSKPFFPAL  63

Query  608  CNFLSSGPVVAMVWE  652
              + SSGP+V MVWE
Sbjct  64   VQYFSSGPIVGMVWE  78



>ref|WP_025935574.1| nucleoside diphosphate kinase [Prochlorococcus sp. scB243_498N4]
Length=152

 Score =   117 bits (292),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  428  ERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGL  607
            ERTFIAIKPDGVQRG VSEII RFE+KGFKLV +K ++PSK  AQ HY   ++RPFF  L
Sbjct  4    ERTFIAIKPDGVQRGYVSEIIGRFEKKGFKLVGLKQLIPSKELAQNHYGVHRERPFFGDL  63

Query  608  CNFLSSGPVVAMVWE  652
             +F+SSGPVVAMVWE
Sbjct  64   VDFISSGPVVAMVWE  78



>ref|WP_025932884.1| MULTISPECIES: nucleoside diphosphate kinase [Prochlorococcus]
 gb|KGG02044.1| Nucleoside diphosphate kinase [Prochlorococcus marinus str. MIT 
9314]
Length=152

 Score =   117 bits (292),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  428  ERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGL  607
            ERTFIAIKPDGVQRG VSEII RFE+KGFKLV +K ++PSK  AQ HY   ++RPFF  L
Sbjct  4    ERTFIAIKPDGVQRGYVSEIIGRFEKKGFKLVGLKQLIPSKELAQNHYGVHRERPFFGDL  63

Query  608  CNFLSSGPVVAMVWE  652
             +F+SSGPVVAMVWE
Sbjct  64   VDFISSGPVVAMVWE  78



>ref|WP_032523835.1| nucleoside diphosphate kinase [Prochlorococcus marinus]
 gb|KGF88278.1| Nucleoside diphosphate kinase [Prochlorococcus marinus str. GP2]
Length=152

 Score =   117 bits (292),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  428  ERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGL  607
            ERTFIAIKPDGVQRG VSEII RFE+KGFKLV +K ++PSK  AQ HY   ++RPFF  L
Sbjct  4    ERTFIAIKPDGVQRGYVSEIIGRFEKKGFKLVGLKQLIPSKELAQNHYGVHRERPFFGDL  63

Query  608  CNFLSSGPVVAMVWE  652
             +F+SSGPVVAMVWE
Sbjct  64   VDFISSGPVVAMVWE  78



>ref|XP_006177031.1| PREDICTED: nucleoside diphosphate kinase A 1 isoform X2 [Camelus 
ferus]
Length=152

 Score =   117 bits (292),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  419  AEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFF  598
            A  ERTFIAIKPDGVQRGLV EII RFE+KGF+L+A+K+M  S+   + HY DLKDRPF+
Sbjct  2    ANSERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLIAMKLMQASEELLKEHYIDLKDRPFY  61

Query  599  SGLCNFLSSGPVVAMVWE  652
             GL  ++ SGPVVAMVWE
Sbjct  62   PGLVKYMGSGPVVAMVWE  79



>ref|WP_006909561.1| nucleoside diphosphate kinase [Cyanobium sp. PCC 7001]
 gb|EDY37660.1| nucleoside diphosphate kinase [Cyanobium sp. PCC 7001]
Length=161

 Score =   117 bits (293),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  428  ERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGL  607
            ERTFIAIKPDGVQRGLV EI+ RFERKGFKLV +K + PS+  A+ HY   ++RPFF+GL
Sbjct  13   ERTFIAIKPDGVQRGLVGEILGRFERKGFKLVGLKQLTPSRELAENHYGVHRERPFFAGL  72

Query  608  CNFLSSGPVVAMVWE  652
             +F++SGPVVAMVWE
Sbjct  73   VDFITSGPVVAMVWE  87



>ref|WP_025915355.1| nucleoside diphosphate kinase [Prochlorococcus sp. scB245a_520K10]
Length=152

 Score =   117 bits (292),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  428  ERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGL  607
            ERTFIAIKPDGVQRG VSEII RFE+KGFKLV +K ++PSK  AQ HY   ++RPFF  L
Sbjct  4    ERTFIAIKPDGVQRGYVSEIIGRFEKKGFKLVGLKQLIPSKELAQNHYGVHRERPFFGDL  63

Query  608  CNFLSSGPVVAMVWE  652
             +F+SSGPVVAMVWE
Sbjct  64   VDFISSGPVVAMVWE  78



>ref|WP_025893874.1| MULTISPECIES: nucleoside diphosphate kinase [Prochlorococcus]
Length=152

 Score =   117 bits (292),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  428  ERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGL  607
            ERTFIAIKPDGVQRG VSEII RFE+KGFKLV +K ++PSK  AQ HY   ++RPFF  L
Sbjct  4    ERTFIAIKPDGVQRGYVSEIIGRFEKKGFKLVGLKQLIPSKELAQNHYGVHRERPFFGDL  63

Query  608  CNFLSSGPVVAMVWE  652
             +F+SSGPVVAMVWE
Sbjct  64   VDFISSGPVVAMVWE  78



>ref|NP_956264.1| nucleoside diphosphate kinase B [Danio rerio]
 gb|AAH59486.1| Non-metastatic cells 2-like, protein (NM23B) expressed in [Danio 
rerio]
Length=153

 Score =   117 bits (292),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +2

Query  428  ERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGL  607
            ERTFIAIKPDGVQRGLV EII RFE+KGFKLVA+K++   +   ++HY DLKDRPFF GL
Sbjct  6    ERTFIAIKPDGVQRGLVGEIIKRFEQKGFKLVAMKLIQADEDLLRQHYSDLKDRPFFPGL  65

Query  608  CNFLSSGPVVAMVWE  652
             +++S+GPVVAMVWE
Sbjct  66   VSYMSAGPVVAMVWE  80



>ref|WP_032519846.1| nucleoside diphosphate kinase [Prochlorococcus marinus]
 gb|KGG08514.1| Nucleoside diphosphate kinase [Prochlorococcus marinus str. SB]
Length=152

 Score =   117 bits (292),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  428  ERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGL  607
            ERTFIAIKPDGVQRG VSEII RFE+KGFKLV +K ++PSK  AQ HY   ++RPFF  L
Sbjct  4    ERTFIAIKPDGVQRGYVSEIIGRFEKKGFKLVGLKQLIPSKELAQNHYGVHRERPFFGDL  63

Query  608  CNFLSSGPVVAMVWE  652
             +F+SSGPVVAMVWE
Sbjct  64   VDFISSGPVVAMVWE  78



>ref|WP_025943157.1| nucleoside diphosphate kinase [Prochlorococcus sp. scB241_526B19]
Length=152

 Score =   117 bits (292),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  428  ERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGL  607
            ERTFIAIKPDGVQRG VSEII RFE+KGFKLV +K ++PSK  AQ HY   ++RPFF  L
Sbjct  4    ERTFIAIKPDGVQRGYVSEIIGRFEKKGFKLVGLKQLIPSKELAQNHYGVHRERPFFGDL  63

Query  608  CNFLSSGPVVAMVWE  652
             +F+SSGPVVAMVWE
Sbjct  64   VDFISSGPVVAMVWE  78



>ref|NP_001191447.1| nucleoside diphosphate kinase B [Macaca mulatta]
 ref|XP_003912809.1| PREDICTED: nucleoside diphosphate kinase B [Papio anubis]
 ref|XP_005583807.1| PREDICTED: nucleoside diphosphate kinase B isoform X1 [Macaca 
fascicularis]
 ref|XP_005583808.1| PREDICTED: nucleoside diphosphate kinase B isoform X2 [Macaca 
fascicularis]
 ref|XP_008009630.1| PREDICTED: nucleoside diphosphate kinase B isoform X1 [Chlorocebus 
sabaeus]
 ref|XP_009188549.1| PREDICTED: nucleoside diphosphate kinase B [Papio anubis]
Length=152

 Score =   117 bits (292),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +2

Query  419  AEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFF  598
            A +ERTFIAIKPDGVQRGLV EII RFE+KGF+LVA+K +  S+   ++HY DLKDRPFF
Sbjct  2    ANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYVDLKDRPFF  61

Query  599  SGLCNFLSSGPVVAMVWE  652
             GL  +++SGPVVAMVWE
Sbjct  62   PGLVKYMNSGPVVAMVWE  79



>ref|WP_011862077.1| nucleoside diphosphate kinase [Prochlorococcus marinus]
 ref|YP_001090273.1| nucleoside diphosphate kinase [Prochlorococcus marinus str. MIT 
9301]
 sp|A3PA97.1|NDK_PROM0 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP 
kinase; AltName: Full=Nucleoside-2-P kinase [Prochlorococcus 
marinus str. MIT 9301]
 gb|ABO16672.1| Nucleoside diphosphate kinase [Prochlorococcus marinus str. MIT 
9301]
Length=152

 Score =   117 bits (292),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  428  ERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGL  607
            ERTFIAIKPDGVQRG VSEII RFE+KGFKLV +K ++PSK  AQ HY   ++RPFF  L
Sbjct  4    ERTFIAIKPDGVQRGYVSEIIGRFEKKGFKLVGLKQLIPSKELAQNHYGVHRERPFFGDL  63

Query  608  CNFLSSGPVVAMVWE  652
             +F+SSGPVVAMVWE
Sbjct  64   VDFISSGPVVAMVWE  78



>ref|WP_025942681.1| nucleoside diphosphate kinase, partial [Prochlorococcus sp. scB245a_521O23]
Length=134

 Score =   116 bits (291),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  428  ERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGL  607
            ERTFIAIKPDGVQRG +SEII RFE+KGFKLV +K ++PSK  AQ HY   ++RPFF  L
Sbjct  4    ERTFIAIKPDGVQRGYISEIIGRFEKKGFKLVGLKQLIPSKELAQNHYGVHRERPFFGDL  63

Query  608  CNFLSSGPVVAMVWE  652
             +F+SSGPVVAMVWE
Sbjct  64   VDFISSGPVVAMVWE  78



>ref|XP_005350592.1| PREDICTED: nucleoside diphosphate kinase B [Microtus ochrogaster]
Length=152

 Score =   117 bits (292),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +2

Query  419  AEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFF  598
            A +ERTFIAIKPDGVQRGLV EII RFE+KGF+LVA+K +  S+   ++HY DLKDRPFF
Sbjct  2    ANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFF  61

Query  599  SGLCNFLSSGPVVAMVWE  652
             GL  +++SGPVVAMVWE
Sbjct  62   PGLVKYMNSGPVVAMVWE  79



>pdb|3BBC|A Chain A, Crystal Structure Of R88a Mutant Of The Nm23-H2 Transcription 
Factor
 pdb|3BBC|B Chain B, Crystal Structure Of R88a Mutant Of The Nm23-H2 Transcription 
Factor
 pdb|3BBC|C Chain C, Crystal Structure Of R88a Mutant Of The Nm23-H2 Transcription 
Factor
 pdb|3BBC|D Chain D, Crystal Structure Of R88a Mutant Of The Nm23-H2 Transcription 
Factor
 pdb|3BBC|E Chain E, Crystal Structure Of R88a Mutant Of The Nm23-H2 Transcription 
Factor
 pdb|3BBC|F Chain F, Crystal Structure Of R88a Mutant Of The Nm23-H2 Transcription 
Factor
Length=151

 Score =   117 bits (292),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +2

Query  419  AEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFF  598
            A +ERTFIAIKPDGVQRGLV EII RFE+KGF+LVA+K +  S+   ++HY DLKDRPFF
Sbjct  1    ANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFF  60

Query  599  SGLCNFLSSGPVVAMVWE  652
             GL  +++SGPVVAMVWE
Sbjct  61   PGLVKYMNSGPVVAMVWE  78



>ref|WP_011375612.1| nucleoside diphosphate kinase [Prochlorococcus marinus]
 ref|YP_396544.1| nucleoside diphosphate kinase [Prochlorococcus marinus str. MIT 
9312]
 sp|Q31DD7.1|NDK_PROM9 RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP 
kinase; AltName: Full=Nucleoside-2-P kinase [Prochlorococcus 
marinus str. MIT 9312]
 gb|ABB49108.1| nucleoside diphosphate kinase [Prochlorococcus marinus str. MIT 
9312]
 gb|KGF99655.1| Nucleoside diphosphate kinase [Prochlorococcus marinus str. MIT 
9311]
Length=152

 Score =   117 bits (292),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  428  ERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGL  607
            ERTFIAIKPDGVQRG VSEII RFE+KGFKLV +K ++PSK  AQ HY   ++RPFF  L
Sbjct  4    ERTFIAIKPDGVQRGYVSEIIGRFEKKGFKLVGLKQLIPSKDLAQNHYGVHRERPFFGDL  63

Query  608  CNFLSSGPVVAMVWE  652
             +F+SSGPVVAMVWE
Sbjct  64   VDFISSGPVVAMVWE  78



>ref|XP_007062841.1| PREDICTED: nucleoside diphosphate kinase A isoform X2 [Chelonia 
mydas]
Length=152

 Score =   117 bits (292),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  428  ERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGL  607
            ERTFIAIKPDGVQRGLV EII RFE+KGFKLVA+K M  S+   + HY DLKDRPF++GL
Sbjct  7    ERTFIAIKPDGVQRGLVGEIIKRFEQKGFKLVAMKFMQASEDLLKEHYIDLKDRPFYAGL  66

Query  608  CNFLSSGPVVAMVWE  652
              ++ SGPVVAMVWE
Sbjct  67   VKYMHSGPVVAMVWE  81



>gb|ABW04136.1| nucleoside-diphosphate kinase [Epinephelus coioides]
Length=151

 Score =   117 bits (292),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  428  ERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGL  607
            ERTFIA+KPDGVQRGL+ +II RFE+KGFKLVA+K + P++   ++HY DLKD+PFFSGL
Sbjct  4    ERTFIAVKPDGVQRGLIGDIIKRFEQKGFKLVAMKFLQPTEELLKQHYMDLKDKPFFSGL  63

Query  608  CNFLSSGPVVAMVWE  652
              ++ SGPVVAM WE
Sbjct  64   IQYMKSGPVVAMAWE  78



>ref|XP_010340228.1| PREDICTED: nucleoside diphosphate kinase B [Saimiri boliviensis 
boliviensis]
 ref|XP_010340229.1| PREDICTED: nucleoside diphosphate kinase B [Saimiri boliviensis 
boliviensis]
Length=152

 Score =   117 bits (292),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +2

Query  419  AEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFF  598
            A +ERTFIAIKPDGVQRGLV EII RFE+KGF+LVA+K +  S+   ++HY DLKDRPFF
Sbjct  2    ANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFF  61

Query  599  SGLCNFLSSGPVVAMVWE  652
             GL  +++SGPVVAMVWE
Sbjct  62   PGLVKYMNSGPVVAMVWE  79



>ref|XP_010384509.1| PREDICTED: nucleoside diphosphate kinase B [Rhinopithecus roxellana]
 ref|XP_010384510.1| PREDICTED: nucleoside diphosphate kinase B [Rhinopithecus roxellana]
 ref|XP_010385184.1| PREDICTED: nucleoside diphosphate kinase B [Rhinopithecus roxellana]
Length=152

 Score =   117 bits (292),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +2

Query  419  AEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFF  598
            A +ERTFIAIKPDGVQRGLV EII RFE+KGF+LVA+K +  S+   ++HY DLKDRPFF
Sbjct  2    ANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYVDLKDRPFF  61

Query  599  SGLCNFLSSGPVVAMVWE  652
             GL  +++SGPVVAMVWE
Sbjct  62   PGLVKYMNSGPVVAMVWE  79



>ref|XP_006925199.1| PREDICTED: nucleoside diphosphate kinase B, partial [Pteropus 
alecto]
Length=180

 Score =   117 bits (294),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +2

Query  419  AEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFF  598
            A MERTFIAIKPDGVQRGLV +I+ RFE+KGF+LVA+K +  S+   ++HY DLKDRPF+
Sbjct  30   ANMERTFIAIKPDGVQRGLVGDIVKRFEQKGFRLVAMKFLTASEELLKQHYIDLKDRPFY  89

Query  599  SGLCNFLSSGPVVAMVWE  652
             GL  +++SGPVVAMVWE
Sbjct  90   PGLVKYMNSGPVVAMVWE  107



>gb|AAP36444.1| Homo sapiens non-metastatic cells 2, protein (NM23B) expressed 
in [synthetic construct]
 gb|AAQ02492.1| non-metastatic cells nucleoside-diphosphate kinase 2 [synthetic 
construct]
 gb|AAX43819.1| non-metastatic cells 2 [synthetic construct]
 gb|AAX43820.1| non-metastatic cells 2 [synthetic construct]
Length=153

 Score =   117 bits (292),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +2

Query  419  AEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFF  598
            A +ERTFIAIKPDGVQRGLV EII RFE+KGF+LVA+K +  S+   ++HY DLKDRPFF
Sbjct  2    ANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFF  61

Query  599  SGLCNFLSSGPVVAMVWE  652
             GL  +++SGPVVAMVWE
Sbjct  62   PGLVKYMNSGPVVAMVWE  79



>gb|EFQ34225.1| nucleoside diphosphate kinase [Colletotrichum graminicola M1.001]
Length=153

 Score =   117 bits (292),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = +2

Query  428  ERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGL  607
            E+TFIAIKPDGVQRGL+  IISRFE +GFKLVAIK+M P K   + HY DLKD+PFF GL
Sbjct  4    EQTFIAIKPDGVQRGLIGPIISRFESRGFKLVAIKLMTPGKAHLEAHYADLKDKPFFGGL  63

Query  608  CNFLSSGPVVAMVWE  652
              +++SGP+ AMVWE
Sbjct  64   IEYMNSGPICAMVWE  78



>ref|NP_002503.1| nucleoside diphosphate kinase B isoform a [Homo sapiens]
 ref|NP_001018147.1| nucleoside diphosphate kinase B isoform a [Homo sapiens]
 ref|NP_001018148.1| nucleoside diphosphate kinase B isoform a [Homo sapiens]
 ref|NP_001018149.1| nucleoside diphosphate kinase B isoform a [Homo sapiens]
 ref|XP_008968873.1| PREDICTED: nucleoside diphosphate kinase B isoform X1 [Pan paniscus]
 sp|P22392.1|NDKB_HUMAN RecName: Full=Nucleoside diphosphate kinase B; Short=NDK B; Short=NDP 
kinase B; AltName: Full=C-myc purine-binding transcription 
factor PUF; AltName: Full=Histidine protein kinase NDKB; 
AltName: Full=nm23-H2 [Homo sapiens]
 pdb|1NSK|R Chain R, The Crystal Structure Of A Human Nucleoside Diphosphate 
Kinase, Nm23-H2
 pdb|1NSK|L Chain L, The Crystal Structure Of A Human Nucleoside Diphosphate 
Kinase, Nm23-H2
 pdb|1NSK|T Chain T, The Crystal Structure Of A Human Nucleoside Diphosphate 
Kinase, Nm23-H2
 pdb|1NSK|U Chain U, The Crystal Structure Of A Human Nucleoside Diphosphate 
Kinase, Nm23-H2
 pdb|1NSK|N Chain N, The Crystal Structure Of A Human Nucleoside Diphosphate 
Kinase, Nm23-H2
 pdb|1NSK|O Chain O, The Crystal Structure Of A Human Nucleoside Diphosphate 
Kinase, Nm23-H2
 gb|AAA36369.1| nm23-H2S product (putative NDP kinase); putative [Homo sapiens]
 gb|AAA60228.1| c-myc transcription factor [Homo sapiens]
 emb|CAB37870.1| NM23-H2 protein [Homo sapiens]
 gb|AAH02476.1| Non-metastatic cells 2, protein (NM23B) expressed in [Homo sapiens]
 gb|AAP35694.1| non-metastatic cells 2, protein (NM23B) expressed in [Homo sapiens]
 emb|CAG46519.1| NME2 [Homo sapiens]
 gb|AAX32195.1| non-metastatic cells 2 protein [synthetic construct]
 gb|AAX36594.1| non-metastatic cells 2 [synthetic construct]
 gb|AAH95458.1| NME2 protein [Homo sapiens]
 gb|EAW94564.1| hCG2001850, isoform CRA_b [Homo sapiens]
 gb|EAW94567.1| hCG2001850, isoform CRA_b [Homo sapiens]
 dbj|BAG36237.1| unnamed protein product [Homo sapiens]
 gb|ACJ13693.1| epididymis secretory sperm binding protein Li 155an [Homo sapiens]
Length=152

 Score =   117 bits (292),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +2

Query  419  AEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFF  598
            A +ERTFIAIKPDGVQRGLV EII RFE+KGF+LVA+K +  S+   ++HY DLKDRPFF
Sbjct  2    ANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFF  61

Query  599  SGLCNFLSSGPVVAMVWE  652
             GL  +++SGPVVAMVWE
Sbjct  62   PGLVKYMNSGPVVAMVWE  79



>ref|NP_001191806.1| nucleoside diphosphate kinase B [Callithrix jacchus]
Length=152

 Score =   117 bits (292),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +2

Query  419  AEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFF  598
            A +ERTFIAIKPDGVQRGLV EII RFE+KGF+LVA+K +  S+   ++HY DLKDRPFF
Sbjct  2    ANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFF  61

Query  599  SGLCNFLSSGPVVAMVWE  652
             GL  +++SGPVVAMVWE
Sbjct  62   PGLVKYMNSGPVVAMVWE  79



>ref|XP_007579698.1| putative nucleoside diphosphate kinase protein [Neofusicoccum 
parvum UCRNP2]
 gb|EOD52827.1| putative nucleoside diphosphate kinase protein [Neofusicoccum 
parvum UCRNP2]
Length=197

 Score =   118 bits (295),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = +2

Query  395  IQEKDAHAAEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYH  574
            IQ+++A     E+TFIA+KPDGVQRGLV  IISRFE +G+KL AIK++ PSK   ++HY 
Sbjct  38   IQQQEAATMTSEQTFIAVKPDGVQRGLVGNIISRFESRGYKLAAIKLVTPSKEHLEKHYS  97

Query  575  DLKDRPFFSGLCNFLSSGPVVAMVWE  652
            DL D+PFF GL  ++ SGPV AMVWE
Sbjct  98   DLADKPFFPGLIAYMGSGPVAAMVWE  123



>ref|XP_010215431.1| PREDICTED: nucleoside diphosphate kinase isoform X1 [Tinamus 
guttatus]
 ref|XP_010215432.1| PREDICTED: nucleoside diphosphate kinase isoform X1 [Tinamus 
guttatus]
Length=153

 Score =   117 bits (292),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +2

Query  428  ERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSGL  607
            ERTFIAIKPDGVQRGLV EII RFE+KGFKLVA+K++  S+   ++HY DLKDRPF++GL
Sbjct  6    ERTFIAIKPDGVQRGLVGEIIKRFEQKGFKLVAMKLIHASEDLLKQHYIDLKDRPFYAGL  65

Query  608  CNFLSSGPVVAMVWE  652
              +++SGPVVAMVWE
Sbjct  66   VKYMNSGPVVAMVWE  80



>pdb|1NUE|A Chain A, X-ray Structure Of Nm23 Human Nucleoside Diphosphate 
Kinase B Complexed With Gdp At 2 Angstroms Resolution
 pdb|1NUE|B Chain B, X-ray Structure Of Nm23 Human Nucleoside Diphosphate 
Kinase B Complexed With Gdp At 2 Angstroms Resolution
 pdb|1NUE|C Chain C, X-ray Structure Of Nm23 Human Nucleoside Diphosphate 
Kinase B Complexed With Gdp At 2 Angstroms Resolution
 pdb|1NUE|D Chain D, X-ray Structure Of Nm23 Human Nucleoside Diphosphate 
Kinase B Complexed With Gdp At 2 Angstroms Resolution
 pdb|1NUE|E Chain E, X-ray Structure Of Nm23 Human Nucleoside Diphosphate 
Kinase B Complexed With Gdp At 2 Angstroms Resolution
 pdb|1NUE|F Chain F, X-ray Structure Of Nm23 Human Nucleoside Diphosphate 
Kinase B Complexed With Gdp At 2 Angstroms Resolution
 pdb|3BBB|A Chain A, Crystal Structure Of The Nm23-H2 Transcription Factor 
Complex With Dinucleotide D(Ag)
 pdb|3BBB|B Chain B, Crystal Structure Of The Nm23-H2 Transcription Factor 
Complex With Dinucleotide D(Ag)
 pdb|3BBB|C Chain C, Crystal Structure Of The Nm23-H2 Transcription Factor 
Complex With Dinucleotide D(Ag)
 pdb|3BBB|D Chain D, Crystal Structure Of The Nm23-H2 Transcription Factor 
Complex With Dinucleotide D(Ag)
 pdb|3BBB|E Chain E, Crystal Structure Of The Nm23-H2 Transcription Factor 
Complex With Dinucleotide D(Ag)
 pdb|3BBB|F Chain F, Crystal Structure Of The Nm23-H2 Transcription Factor 
Complex With Dinucleotide D(Ag)
 pdb|3BBF|A Chain A, Crystal Structure Of The Nm23-H2 Transcription Factor 
Complex With Gdp
 pdb|3BBF|B Chain B, Crystal Structure Of The Nm23-H2 Transcription Factor 
Complex With Gdp
 pdb|3BBF|C Chain C, Crystal Structure Of The Nm23-H2 Transcription Factor 
Complex With Gdp
 pdb|3BBF|D Chain D, Crystal Structure Of The Nm23-H2 Transcription Factor 
Complex With Gdp
 pdb|3BBF|E Chain E, Crystal Structure Of The Nm23-H2 Transcription Factor 
Complex With Gdp
 pdb|3BBF|F Chain F, Crystal Structure Of The Nm23-H2 Transcription Factor 
Complex With Gdp
Length=151

 Score =   117 bits (292),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +2

Query  419  AEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFF  598
            A +ERTFIAIKPDGVQRGLV EII RFE+KGF+LVA+K +  S+   ++HY DLKDRPFF
Sbjct  1    ANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFF  60

Query  599  SGLCNFLSSGPVVAMVWE  652
             GL  +++SGPVVAMVWE
Sbjct  61   PGLVKYMNSGPVVAMVWE  78



>ref|NP_114021.2| nucleoside diphosphate kinase B [Rattus norvegicus]
 sp|P19804.1|NDKB_RAT RecName: Full=Nucleoside diphosphate kinase B; Short=NDK B; Short=NDP 
kinase B; AltName: Full=Histidine protein kinase NDKB; 
AltName: Full=P18 [Rattus norvegicus]
 gb|AAA41684.1| nucleoside diphosphate kinase [Rattus norvegicus]
 gb|AAH86599.1| Non-metastatic cells 2, protein (NM23B) expressed in [Rattus 
norvegicus]
 gb|EDM05687.1| rCG34286, isoform CRA_a [Rattus norvegicus]
 gb|EDM05688.1| rCG34286, isoform CRA_a [Rattus norvegicus]
Length=152

 Score =   117 bits (292),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +2

Query  419  AEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFF  598
            A +ERTFIAIKPDGVQRGLV EII RFE+KGF+LVA+K +  S+   ++HY DLKDRPFF
Sbjct  2    ANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFF  61

Query  599  SGLCNFLSSGPVVAMVWE  652
             GL  +++SGPVVAMVWE
Sbjct  62   PGLVKYMNSGPVVAMVWE  79



>ref|XP_003501424.1| PREDICTED: nucleoside diphosphate kinase A [Cricetulus griseus]
 ref|XP_007640214.1| PREDICTED: nucleoside diphosphate kinase A [Cricetulus griseus]
 ref|XP_007611649.1| PREDICTED: nucleoside diphosphate kinase A [Cricetulus griseus]
 ref|XP_007611650.1| PREDICTED: nucleoside diphosphate kinase A [Cricetulus griseus]
 gb|EGW08268.1| Nucleoside diphosphate kinase A [Cricetulus griseus]
 gb|ERE68085.1| nucleoside diphosphate kinase A-like isoform 2 [Cricetulus griseus]
Length=152

 Score =   117 bits (292),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +2

Query  419  AEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFF  598
            A  ERTFIAIKPDGVQRGLV EII RFE+KGF+LV +K M  S+   + HY DLKDRPFF
Sbjct  2    ANSERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYIDLKDRPFF  61

Query  599  SGLCNFLSSGPVVAMVWE  652
            +GL  ++ SGPVVAMVWE
Sbjct  62   TGLVKYMHSGPVVAMVWE  79



>tpg|DAA18578.1| TPA: nucleoside diphosphate kinase A 1 [Bos taurus]
Length=121

 Score =   115 bits (289),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  419  AEMERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFF  598
            A  ERTFIAIKPDGVQRGL+ EII RFE+KGF+LVA+K M  S+   + HY DLKDRPFF
Sbjct  2    ANSERTFIAIKPDGVQRGLMGEIIKRFEQKGFRLVAMKFMRASEDLLKEHYIDLKDRPFF  61

Query  599  SGLCNFLSSGPVVAMVWE  652
            +GL  ++ SGPVVAMVWE
Sbjct  62   AGLVKYMHSGPVVAMVWE  79



>ref|WP_015162738.1| nucleoside diphosphate kinase [Chamaesiphon minutus]
 ref|YP_007100190.1| nucleoside diphosphate kinase [Chamaesiphon minutus PCC 6605]
 gb|AFY96663.1| nucleoside diphosphate kinase [Chamaesiphon minutus PCC 6605]
Length=149

 Score =   116 bits (291),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = +2

Query  425  MERTFIAIKPDGVQRGLVSEIISRFERKGFKLVAIKIMVPSKVFAQRHYHDLKDRPFFSG  604
            MERTFIAIKPDGVQRGLV EII R E KGF LVA+K++ PS+  A++HY   K+RPFFSG
Sbjct  1    MERTFIAIKPDGVQRGLVGEIIRRLETKGFTLVALKLLHPSRELAEQHYAVHKERPFFSG  60

Query  605  LCNFLSSGPVVAMVWE  652
            L +F++SGPVVAMVW+
Sbjct  61   LVDFITSGPVVAMVWQ  76



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 922580742716