BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c17944_g1_i2 len=1240 path=[35:0-913 948:914-1239]

Length=1240
                                                                      Score     E

gb|ADO66668.1|  X intrinsic protein                                     445   9e-152   
ref|NP_001289505.1|  aquaporin AQPAn.G-like                             412   5e-139   
ref|XP_009774272.1|  PREDICTED: aquaporin AQPAn.G-like isoform X2       412   8e-139   
gb|ADO66675.1|  X intrinsic protein                                     410   3e-138   
ref|NP_001289455.1|  probable aquaporin PIP2-8                          407   4e-137   
gb|ADO66667.1|  X intrinsic protein                                     405   2e-136   
ref|XP_009630664.1|  PREDICTED: probable aquaporin PIP2-8 isoform X2    404   7e-136   
gb|ADO66669.1|  X intrinsic protein                                     399   1e-133   
ref|NP_001275444.1|  X intrinsic protein                                396   1e-132   
ref|XP_006367338.1|  PREDICTED: probable aquaporin PIP1-2 isoform X2    395   2e-132   
ref|NP_001238800.1|  X intrinsic protein                                394   8e-132   
ref|XP_010327383.1|  PREDICTED: X intrinsic protein isoform X1          394   1e-131   
ref|XP_006365918.1|  PREDICTED: aquaporin-4-like isoform X1             390   2e-130   
ref|XP_004248670.1|  PREDICTED: probable aquaporin TIP1-2 isoform X1    390   2e-130   
ref|XP_010327421.1|  PREDICTED: probable aquaporin TIP1-2 isoform X2    390   3e-130   
ref|XP_006365919.1|  PREDICTED: aquaporin-4-like isoform X2             390   4e-130   
ref|XP_006365921.1|  PREDICTED: aquaporin PIP1-6-like isoform X2        389   1e-129   
ref|XP_006365922.1|  PREDICTED: probable aquaporin PIP1-2-like          388   2e-129   
ref|XP_009794067.1|  PREDICTED: probable aquaporin TIP3-1               385   2e-128   
ref|XP_006365920.1|  PREDICTED: aquaporin PIP1-6-like isoform X1        384   7e-128   
ref|XP_010327422.1|  PREDICTED: probable aquaporin TIP3-1               384   1e-127   
ref|XP_009602731.1|  PREDICTED: aquaporin-like isoform X1               383   1e-127   
ref|XP_009602732.1|  PREDICTED: aquaporin-like isoform X2               376   7e-125   
ref|XP_010327420.1|  PREDICTED: probable aquaporin TIP3-2 isoform X1    374   5e-124   
ref|XP_009799353.1|  PREDICTED: probable aquaporin TIP3-1               374   6e-124   
ref|XP_004248667.1|  PREDICTED: probable aquaporin TIP3-2 isoform X2    374   8e-124   
ref|XP_011092871.1|  PREDICTED: aquaporin AQPcic-like                   375   9e-124   
gb|AHC32017.1|  aquaporin protein 23                                    371   7e-123   
ref|XP_009589922.1|  PREDICTED: aquaporin-like                          370   3e-122   
emb|CDO96960.1|  unnamed protein product                                369   6e-122   
emb|CDP15672.1|  unnamed protein product                                362   3e-119   
gb|EYU40406.1|  hypothetical protein MIMGU_mgv1a009528mg                362   4e-119   
ref|XP_004231447.1|  PREDICTED: aquaporin-like                          361   1e-118   
ref|XP_006359635.1|  PREDICTED: aquaporin-4-like                        358   1e-117   
ref|XP_010327386.1|  PREDICTED: uncharacterized protein LOC101252...    353   3e-116   
ref|NP_001274700.1|  uncharacterized protein LOC101252534               353   3e-116   
emb|CDO96962.1|  unnamed protein product                                353   1e-115   
ref|XP_010088679.1|  putative aquaporin PIP1-4                          338   6e-110   
ref|XP_010268700.1|  PREDICTED: aquaporin-like                          337   1e-109   
ref|XP_008236183.1|  PREDICTED: aquaporin-like                          335   1e-108   
ref|XP_007200872.1|  hypothetical protein PRUPE_ppb013496mg             332   7e-108   
ref|XP_010647342.1|  PREDICTED: probable aquaporin TIP3-2               332   9e-108   
ref|XP_009369012.1|  PREDICTED: aquaporin-like                          330   8e-107   
ref|XP_010028684.1|  PREDICTED: probable aquaporin TIP4-3               329   1e-106   
ref|XP_004292151.1|  PREDICTED: probable aquaporin PIP1-4-like          318   5e-102   
ref|XP_011046944.1|  PREDICTED: aquaporin AQPAn.G-like                  314   1e-100   
ref|XP_007041949.1|  Aquaporin, MIP family, PIP subfamily               314   4e-100   
ref|XP_011037252.1|  PREDICTED: aquaporin AQPAn.G-like                  311   7e-100   
ref|XP_011046910.1|  PREDICTED: aquaporin AQPAn.G-like                  311   7e-100   
ref|XP_009350956.1|  PREDICTED: aquaporin AQPAn.G-like                  311   8e-100   
ref|XP_002306164.2|  hypothetical protein POPTR_0004s17430g             310   3e-99    Populus trichocarpa [western balsam poplar]
ref|XP_011046933.1|  PREDICTED: aquaporin AQPAn.G-like                  308   1e-98    
ref|XP_002312985.2|  hypothetical protein POPTR_0009s13110g             307   3e-98    Populus trichocarpa [western balsam poplar]
gb|ADE34299.1|  aquaporin XIP1;1                                        305   2e-97    
gb|KDO44173.1|  hypothetical protein CISIN_1g040654mg                   303   2e-96    
ref|XP_007041948.1|  Aquaporin, MIP family, PIP subfamily               303   2e-96    
ref|XP_006487396.1|  PREDICTED: probable aquaporin PIP2-6-like          303   2e-96    
ref|XP_002312987.2|  hypothetical protein POPTR_0009s13100g             296   2e-94    Populus trichocarpa [western balsam poplar]
ref|XP_006379270.1|  hypothetical protein POPTR_0009s13100g             296   2e-94    
gb|KCW55469.1|  hypothetical protein EUGRSUZ_I01369                     291   2e-92    
gb|KDP27598.1|  hypothetical protein JCGZ_19603                         292   2e-92    
ref|XP_002312988.2|  hypothetical protein POPTR_0009s13070g             286   2e-90    Populus trichocarpa [western balsam poplar]
ref|XP_006423576.1|  hypothetical protein CICLE_v10028106mg             291   1e-88    
ref|XP_010647357.1|  PREDICTED: aquaporin AQPAn.G-like                  281   4e-88    
ref|XP_006423577.1|  hypothetical protein CICLE_v10029916mg             261   3e-81    
gb|KDO44174.1|  hypothetical protein CISIN_1g036381mg                   261   4e-81    
ref|XP_010690468.1|  PREDICTED: aquaporin AQPAe.a-like                  259   3e-79    
ref|XP_006379269.1|  hypothetical protein POPTR_0009s13080g             253   3e-78    
gb|EPS67222.1|  x intrinsic protein                                     253   3e-77    
ref|XP_008392025.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin-like     253   7e-76    
gb|EPS73657.1|  x intrinsic protein                                     231   6e-69    
ref|XP_006487440.1|  PREDICTED: probable aquaporin PIP2-8-like          181   2e-49    
ref|XP_008351523.1|  PREDICTED: aquaporin TIP1-2-like                   179   1e-48    
ref|XP_007041950.1|  Plasma membrane intrinsic protein 1A, putative     175   4e-47    
ref|XP_003540471.1|  PREDICTED: aquaporin TIP1-2-like                   175   4e-47    
emb|CCI69207.1|  XIP aquaporin                                          174   5e-47    
ref|XP_009358228.1|  PREDICTED: aquaporin TIP1-2-like                   172   6e-47    
ref|XP_007199345.1|  hypothetical protein PRUPE_ppa025096mg             173   1e-46    
ref|XP_002312986.2|  hypothetical protein POPTR_0009s13090g             169   5e-46    Populus trichocarpa [western balsam poplar]
gb|ACU19165.1|  unknown                                                 170   3e-45    Glycine max [soybeans]
ref|XP_007131587.1|  hypothetical protein PHAVU_011G025700g             169   3e-45    
ref|XP_008236217.1|  PREDICTED: aquaporin TIP1-2-like                   169   3e-45    
gb|KDP27599.1|  hypothetical protein JCGZ_19604                         167   1e-44    
ref|XP_004505805.1|  PREDICTED: aquaporin PIP-type-like                 167   2e-44    
gb|KEH30598.1|  major intrinsic protein (MIP) family transporter        167   3e-44    
gb|KEH30600.1|  major intrinsic protein (MIP) family transporter        164   6e-43    
ref|XP_007131588.1|  hypothetical protein PHAVU_011G025800g             162   1e-42    
ref|XP_011046921.1|  PREDICTED: aquaporin TIP3-1-like                   160   1e-42    
ref|XP_003538951.1|  PREDICTED: aquaporin PIP2-5-like                   162   2e-42    
ref|XP_002534036.1|  aquaporin transporter, putative                    160   6e-42    Ricinus communis
gb|AFK39177.1|  unknown                                                 160   9e-42    
ref|XP_002534077.1|  aquaporin transporter, putative                    159   2e-41    Ricinus communis
ref|XP_008457641.1|  PREDICTED: aquaporin TIP1-2-like                   160   2e-41    
ref|XP_004150077.1|  PREDICTED: probable aquaporin TIP3-1-like          159   4e-41    
ref|XP_009799368.1|  PREDICTED: uncharacterized protein LOC104245461    155   3e-40    
gb|KHN32315.1|  Putative aquaporin PIP2-6                               148   1e-37    
ref|XP_010088680.1|  Aquaporin PIP-type                                 149   2e-37    
gb|KHN32316.1|  Aquaporin PIP1-5                                        145   7e-37    
gb|AEQ29860.1|  aquaporin XIP                                           140   1e-36    
ref|XP_002534078.1|  aquaporin transporter, putative                    144   5e-36    Ricinus communis
gb|KHN05474.1|  Putative aquaporin PIP2-6                               136   7e-34    
ref|XP_003540625.1|  PREDICTED: probable aquaporin PIP1-2-like          134   7e-32    
emb|CBI37943.3|  unnamed protein product                                129   8e-32    
ref|XP_002961944.1|  hypothetical protein SELMODRAFT_76794              125   2e-29    
ref|XP_002971142.1|  hypothetical protein SELMODRAFT_94691              125   3e-29    
ref|XP_002533600.1|  aquaporin transporter, putative                    122   1e-28    Ricinus communis
gb|EPS60236.1|  hypothetical protein M569_14568                         105   3e-24    
ref|XP_006379271.1|  hypothetical protein POPTR_0009s13105g             107   2e-23    
gb|EPS60023.1|  hypothetical protein M569_14781                         102   4e-23    
ref|XP_002961942.1|  hypothetical protein SELMODRAFT_403379             107   8e-23    
ref|XP_007201100.1|  hypothetical protein PRUPE_ppa024682mg             102   2e-22    
ref|XP_002534035.1|  aquaporin transporter, putative                    100   3e-21    Ricinus communis
ref|XP_006387176.1|  hypothetical protein POPTR_1606s00200g           97.1    1e-20    
ref|XP_001758094.1|  predicted protein                                96.7    8e-20    
ref|XP_006964252.1|  predicted protein                                91.3    2e-17    
ref|XP_002971144.1|  hypothetical protein SELMODRAFT_36558            89.0    6e-17    
dbj|BAE65943.1|  unnamed protein product                              90.1    7e-17    Aspergillus oryzae
ref|XP_002384305.1|  aquaporin, putative                              90.1    8e-17    Aspergillus flavus NRRL3357
gb|EHK42605.1|  hypothetical protein TRIATDRAFT_319992                89.4    2e-16    
gb|KFG81885.1|  hypothetical protein MANI_118346                      88.6    3e-16    
gb|KFY94553.1|  hypothetical protein V500_03150                       90.1    4e-16    
gb|KFZ17098.1|  hypothetical protein V501_01889                       90.1    5e-16    
ref|XP_002964369.1|  hypothetical protein SELMODRAFT_27726            85.1    7e-16    
emb|CCD34687.1|  hypothetical protein BofuT4_P100910.1                85.9    2e-15    
ref|XP_009420459.1|  PREDICTED: probable aquaporin PIP1-2             85.5    2e-15    
gb|KID99996.1|  Aquaporin-like protein                                85.9    2e-15    
gb|ABK24473.1|  unknown                                               84.3    5e-15    Picea sitchensis
gb|KFK30621.1|  hypothetical protein AALP_AA6G005800                  84.3    5e-15    
emb|CDY07221.1|  BnaCnng02360D                                        84.0    7e-15    
emb|CDY38017.1|  BnaCnng08780D                                        84.0    7e-15    
emb|CAA04654.1|  major intrinsic protein PIPC                         82.4    9e-15    Craterostigma plantagineum
gb|ACN40976.1|  unknown                                               83.6    1e-14    Picea sitchensis
ref|XP_006396241.1|  hypothetical protein EUTSA_v10028860mg           83.2    1e-14    
gb|KID80148.1|  Aquaporin-like protein                                83.6    1e-14    
ref|XP_006418439.1|  hypothetical protein EUTSA_v10008397mg           83.2    2e-14    
ref|XP_002562918.1|  Pc20g03670                                       83.6    2e-14    Penicillium rubens Wisconsin 54-1255
emb|CDY15165.1|  BnaC05g00440D                                        83.6    2e-14    
gb|AFQ98315.1|  MIP2                                                  82.8    2e-14    
gb|EHK17775.1|  hypothetical protein TRIVIDRAFT_160074                83.6    2e-14    
sp|Q7XSQ9.3|PIP12_ORYSJ  RecName: Full=Probable aquaporin PIP1-2;...  82.8    2e-14    Oryza sativa Japonica Group [Japonica rice]
emb|CDY51161.1|  BnaA09g51960D                                        82.8    2e-14    
dbj|GAA90923.1|  aquaporin                                            83.2    2e-14    
emb|CDX91911.1|  BnaC03g32130D                                        82.4    2e-14    
gb|ABO71659.2|  trans-membrane water channel protein                  82.4    2e-14    Brassica juncea [brown mustard]
ref|XP_009134562.1|  PREDICTED: probable aquaporin PIP1-4             82.4    3e-14    
gb|KFY29418.1|  hypothetical protein V491_00037                       83.2    3e-14    
gb|KFX45364.1|  Aquaporin PIP2-6                                      83.2    3e-14    
ref|XP_002149425.1|  aquaporin transporter, putative                  83.2    3e-14    Talaromyces marneffei ATCC 18224
dbj|GAM33457.1|  aquaporin transporter                                83.2    3e-14    
ref|XP_009253558.1|  hypothetical protein FPSE_02164                  82.8    3e-14    
gb|KEF53902.1|  hypothetical protein A1O9_10304                       82.8    3e-14    
emb|CDX90046.1|  BnaA10g00360D                                        82.0    3e-14    
ref|XP_001390456.2|  MIP transporter                                  82.4    3e-14    Aspergillus niger CBS 513.88
gb|KFA66178.1|  hypothetical protein S40285_09582                     82.0    4e-14    
gb|KID91181.1|  Aquaporin-like protein                                82.4    4e-14    
gb|KHN33668.1|  Aquaporin PIP2-7                                      81.6    4e-14    
ref|XP_009386408.1|  PREDICTED: probable aquaporin PIP1-2             81.6    4e-14    
gb|KDP28617.1|  hypothetical protein JCGZ_14388                       81.6    5e-14    
ref|XP_002275303.1|  PREDICTED: aquaporin PIP1-2                      81.6    5e-14    Vitis vinifera
ref|XP_009118823.1|  PREDICTED: aquaporin PIP1-3                      81.6    5e-14    
gb|AGR83938.1|  aquaporin PIP1-4                                      81.3    5e-14    
gb|KEY74839.1|  hypothetical protein S7711_11047                      81.6    5e-14    
gb|KHG11128.1|  putative aquaporin PIP1-2                             81.6    5e-14    
gb|EKC31493.1|  Aquaporin-4                                           81.3    5e-14    
ref|XP_011046666.1|  PREDICTED: probable aquaporin PIP2-8             81.3    7e-14    
ref|XP_002306187.1|  membrane intrinsic family protein                80.9    7e-14    Populus trichocarpa [western balsam poplar]
ref|XP_009759265.1|  PREDICTED: probable aquaporin PIP1-2             80.9    9e-14    
gb|KDP23969.1|  hypothetical protein JCGZ_25357                       80.9    9e-14    
ref|XP_008797218.1|  PREDICTED: aquaporin TIP3-1-like                 80.1    1e-13    
ref|XP_009119712.1|  PREDICTED: aquaporin PIP1-3                      80.5    1e-13    
ref|XP_010109640.1|  hypothetical protein L484_015595                 81.6    2e-13    
ref|XP_001396483.2|  MIP transporter                                  80.5    2e-13    Aspergillus niger CBS 513.88
ref|XP_011019143.1|  PREDICTED: probable aquaporin PIP1-4             80.1    2e-13    
emb|CAB56217.1|  PM28B protein                                        80.1    2e-13    Spinacia oleracea
ref|XP_006581099.1|  PREDICTED: uncharacterized protein LOC100808290  82.0    2e-13    
gb|AAF65846.1|AF255796_1  aquaporin 2                                 79.7    2e-13    Allium cepa
ref|XP_009386206.1|  PREDICTED: probable aquaporin PIP1-2 isoform X1  79.3    3e-13    
gb|AGT36590.1|  aquaporin                                             79.3    3e-13    
gb|AFH36341.1|  aquaporin PIP1;3                                      79.3    3e-13    
ref|XP_002484748.1|  aquaporin transporter, putative                  80.1    3e-13    Talaromyces stipitatus ATCC 10500
gb|AFJ44204.1|  plasma membrane intrinsic protein 1                   79.3    3e-13    
ref|XP_009631880.1|  PREDICTED: probable aquaporin PIP1-2             79.3    3e-13    
ref|XP_008382110.1|  PREDICTED: probable aquaporin PIP2-8             79.3    3e-13    
ref|XP_007807367.1|  hypothetical protein MAC_01027                   80.5    3e-13    
gb|AAB09757.1|  similar to mipB gene product in Mesembryanthemum ...  79.3    3e-13    Mesembryanthemum crystallinum
ref|XP_003522619.2|  PREDICTED: aquaporin PIP2-7                      79.7    3e-13    
ref|XP_002511872.1|  Aquaporin PIP1.3, putative                       79.3    3e-13    Ricinus communis
gb|ACU14125.1|  unknown                                               79.0    3e-13    Glycine max [soybeans]
ref|XP_009762763.1|  PREDICTED: probable aquaporin PIP1-2             79.0    3e-13    
ref|XP_002309126.1|  plasma membrane intrinsic protein 1-1            79.3    3e-13    Populus trichocarpa [western balsam poplar]
gb|AEY75254.1|  aquaporin                                             79.0    4e-13    
ref|XP_009386050.1|  PREDICTED: probable aquaporin PIP1-2             79.0    4e-13    
emb|CAE01842.2|  OSJNBa0084K11.2                                      79.0    4e-13    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006362987.1|  PREDICTED: probable aquaporin PIP1-2-like        79.0    4e-13    
ref|XP_010670234.1|  PREDICTED: probable aquaporin PIP1-5             79.0    4e-13    
ref|XP_006288376.1|  hypothetical protein CARUB_v10001627mg           78.6    5e-13    
gb|EYU40445.1|  hypothetical protein MIMGU_mgv1a011413mg              78.6    5e-13    
gb|KFY35507.1|  hypothetical protein V494_05845                       79.3    5e-13    
ref|NP_567178.1|  plasma membrane intrinsic protein 1;4               78.6    5e-13    Arabidopsis thaliana [mouse-ear cress]
dbj|BAD90697.1|  plasma membrane intrinsic protein 2;1                78.6    5e-13    Mimosa pudica [sensitive-plant]
ref|XP_002872953.1|  hypothetical protein ARALYDRAFT_912203           78.6    6e-13    
ref|XP_010548112.1|  PREDICTED: probable aquaporin PIP2-8             78.6    6e-13    
sp|P42767.1|PIP1_ATRCA  RecName: Full=Aquaporin PIP-type              78.6    6e-13    Atriplex canescens [shadscale]
ref|XP_008778916.1|  PREDICTED: probable aquaporin PIP1-2 isoform X1  78.6    6e-13    
gb|KFY08157.1|  hypothetical protein V492_06492                       79.0    6e-13    
gb|AAL49749.1|AF452011_1  aquaporin-like protein                      78.6    6e-13    Petunia x hybrida [garden petunia]
gb|KHG13859.1|  putative aquaporin PIP-type 7a                        78.6    6e-13    
dbj|GAM40292.1|  aquaporin transporter                                79.0    6e-13    
gb|AAW55293.1|  aquaporin 1                                           76.6    6e-13    Aegiceras corniculatum
emb|CDX71738.1|  BnaC08g31360D                                        78.2    7e-13    
ref|XP_011043133.1|  PREDICTED: probable aquaporin PIP2-8             77.8    7e-13    
emb|CAH60721.1|  putative plasma membrane intrinsic protein           78.2    8e-13    Populus tremula x Populus tremuloides
gb|AAT74898.1|  plasma membrane intrinsic protein PIP1-1              78.2    8e-13    Fraxinus excelsior
ref|XP_007041804.1|  Plasma membrane intrinsic protein 2,8 isoform 1  77.8    8e-13    
tpg|DAA33860.1|  TPA: aquaporin PIP1;6                                78.2    8e-13    
dbj|BAF32042.1|  putative aquaporin                                   77.8    8e-13    Cryptomeria japonica
gb|ACU87556.1|  PIP protein                                           77.8    9e-13    
emb|CDY48920.1|  BnaA09g39170D                                        77.8    9e-13    
gb|ABH09323.1|  putative aquaporin                                    77.8    9e-13    Vitis vinifera
ref|NP_001289902.1|  probable aquaporin PIP1-4                        77.8    9e-13    
ref|XP_010456290.1|  PREDICTED: probable aquaporin PIP1-4             77.8    9e-13    
dbj|BAF44223.1|  aquaporin                                            78.6    1e-12    Iris x hollandica [Dutch iris]
gb|ACB38232.1|  aquaporin                                             77.8    1e-12    Gerbera hybrid cultivar
ref|XP_006383054.1|  plasma membrane intrinsic protein 1-1            77.4    1e-12    
ref|XP_010256616.1|  PREDICTED: aquaporin PIP1-1-like                 77.8    1e-12    
gb|KFK28910.1|  hypothetical protein AALP_AA7G063900                  77.8    1e-12    
ref|XP_002869782.1|  PIP1_5/PIP1D                                     77.4    1e-12    
gb|KHF98939.1|  putative aquaporin PIP2-8 -like protein               77.4    1e-12    
ref|XP_009138772.1|  PREDICTED: aquaporin PIP1-1                      77.4    1e-12    
ref|XP_006422584.1|  hypothetical protein CICLE_v10029003mg           77.4    1e-12    
pir||T10251  membrane protein MP23 precursor - cucurbit               77.4    1e-12 
gb|KFY00868.1|  hypothetical protein O988_03072                       78.2    1e-12    
ref|XP_009376943.1|  PREDICTED: probable aquaporin PIP2-8             77.4    1e-12    
gb|ACB87734.1|  aquaporin                                             77.4    1e-12    Manihot esculenta [manioc]
ref|XP_008787474.1|  PREDICTED: probable aquaporin PIP1-2             77.4    1e-12    
ref|XP_009400253.1|  PREDICTED: probable aquaporin PIP1-2             77.4    1e-12    
gb|ACB42441.1|  aquaporin PIP2;4                                      77.0    1e-12    Gossypium hirsutum [American cotton]
ref|XP_006357563.1|  PREDICTED: probable aquaporin PIP2-1-like        77.4    1e-12    
ref|XP_004137540.1|  PREDICTED: probable aquaporin TIP3-2-like        77.4    1e-12    
gb|EXL97756.1|  hypothetical protein FOIG_10077                       77.8    2e-12    
ref|NP_171668.1|  aquaporin PIP1-3                                    77.0    2e-12    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010543744.1|  PREDICTED: probable aquaporin PIP1-4             77.0    2e-12    
gb|AEA40490.1|  aquaporin PIP1-2                                      77.0    2e-12    
dbj|GAM17046.1|  hypothetical protein SAMD00019534_002210             78.6    2e-12    
dbj|BAD90701.1|  plasma membrane intrinsic protein 2;5                77.0    2e-12    Mimosa pudica [sensitive-plant]
gb|ACR56614.1|  plasma intrinsic protein 2;4                          77.0    2e-12    Juglans regia
ref|XP_006304071.1|  hypothetical protein CARUB_v10009929mg           77.0    2e-12    
ref|XP_002889360.1|  hypothetical protein ARALYDRAFT_470115           77.0    2e-12    
gb|AEO79975.1|  plasma intrinsic protein 1                            77.0    2e-12    
ref|NP_179277.1|  putative aquaporin PIP2-8                           77.0    2e-12    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010940492.1|  PREDICTED: probable aquaporin PIP1-2             77.0    2e-12    
gb|ACB71281.1|  plasma membrane intrinsic protein                     77.0    2e-12    Tamarix hispida
ref|XP_007675947.1|  hypothetical protein BAUCODRAFT_147735           77.8    2e-12    
gb|ACA50529.1|  putative aquaporin                                    77.0    2e-12    Brassica napus [oilseed rape]
ref|XP_009116806.1|  PREDICTED: aquaporin PIP1-1 isoform X1           77.0    2e-12    
dbj|BAF63508.1|  plasma membrane intrinsic protein                    77.0    2e-12    Potamogeton distinctus
ref|XP_007133932.1|  hypothetical protein PHAVU_010G004500g           77.0    2e-12    
gb|AGG39695.1|  aquaporin protein AQU17                               77.0    2e-12    
gb|AGD98705.1|  aquaporin                                             76.6    2e-12    
ref|XP_009418674.1|  PREDICTED: probable aquaporin PIP2-8             75.9    2e-12    
ref|XP_006634102.1|  PREDICTED: aquaporin-4-like                      77.0    2e-12    
tpg|DAA64677.1|  TPA: aquaporin PIP2 4a                               76.6    2e-12    
emb|CAA64896.1|  transmembrane channel protein                        76.6    2e-12    Brassica oleracea
gb|KHN96293.1|  Aquaporin-like protein                                76.6    2e-12    
gb|KCW88815.1|  hypothetical protein EUGRSUZ_A01153                   77.8    2e-12    
ref|XP_011084932.1|  PREDICTED: probable aquaporin PIP1-2             76.6    2e-12    
gb|ACU00102.1|  plasma membrane intrinsic protein PIP2.6              76.6    2e-12    Populus trichocarpa x Populus deltoides
ref|XP_006284249.1|  hypothetical protein CARUB_v10005414mg           76.6    2e-12    
ref|XP_002509815.1|  Aquaporin PIP1.3, putative                       76.6    2e-12    Ricinus communis
ref|XP_006413559.1|  hypothetical protein EUTSA_v10025910mg           76.6    2e-12    
ref|XP_009414436.1|  PREDICTED: probable aquaporin PIP2-6             76.6    2e-12    
ref|XP_001820529.2|  MIP transporter                                  77.0    2e-12    Aspergillus oryzae RIB40
ref|XP_010526891.1|  PREDICTED: probable aquaporin PIP2-8             76.6    2e-12    
ref|XP_009380931.1|  PREDICTED: aquaporin PIP1-1                      76.6    2e-12    
gb|AEA40491.1|  aquaporin PIP1-3                                      76.6    3e-12    
ref|XP_011045923.1|  PREDICTED: probable aquaporin PIP2-8             76.3    3e-12    
gb|KFK37381.1|  hypothetical protein AALP_AA4G249600                  76.6    3e-12    
gb|AAV80228.1|  aquaporin 1                                           76.6    3e-12    Aegiceras corniculatum
dbj|BAA92258.1|  plasma membrane aquaporin 1b                         76.6    3e-12    Raphanus sativus
gb|ACA50530.1|  putative aquaporin                                    76.6    3e-12    
ref|XP_010316437.1|  PREDICTED: probable aquaporin PIP2-8 isoform X1  75.9    3e-12    
ref|XP_008437248.1|  PREDICTED: probable aquaporin TIP3-2             76.3    3e-12    
gb|AHZ08398.1|  phosphatidylinosital biphosphate protein              76.3    3e-12    
ref|XP_004290727.1|  PREDICTED: aquaporin PIP2-7-like                 76.3    3e-12    
gb|AGR83936.1|  aquaporin PIP1-2                                      75.9    3e-12    
ref|XP_002521292.1|  Aquaporin PIP2.7, putative                       76.3    3e-12    
gb|AGR83935.1|  aquaporin PIP1-1                                      75.9    3e-12    
dbj|BAB40142.1|  plasma membrane intrinsic protein 1-1                76.3    3e-12    
ref|XP_010935853.1|  PREDICTED: probable aquaporin PIP1-2             76.3    3e-12    
gb|ACR56613.1|  plasma intrinsic protein 2;3                          76.3    3e-12    
gb|EYU38340.1|  hypothetical protein MIMGU_mgv1a018376mg              76.3    3e-12    
gb|KCW55551.1|  hypothetical protein EUGRSUZ_I01429                   76.3    3e-12    
gb|AGD98714.1|  aquaporin protein 11                                  76.3    3e-12    
ref|XP_002312952.1|  hypothetical protein POPTR_0009s13890g           75.9    4e-12    
gb|ABM54183.1|  aquaporin                                             75.9    4e-12    
ref|XP_009389186.1|  PREDICTED: probable aquaporin PIP2-6             75.9    4e-12    
gb|ACB10396.1|  aquaporin                                             75.9    4e-12    
dbj|BAI94500.1|  plasma membrane intrinsic protein                    76.3    4e-12    
ref|NP_001275065.1|  major intrinsic protein 2                        75.9    4e-12    
ref|XP_007026768.1|  Plasma membrane intrinsic protein 1,4            75.9    4e-12    
ref|XP_002453072.1|  hypothetical protein SORBIDRAFT_04g037800        75.9    4e-12    
ref|XP_009400343.1|  PREDICTED: probable aquaporin PIP2-6             75.9    4e-12    
gb|KFY85908.1|  hypothetical protein V500_08026                       76.6    4e-12    
ref|XP_009412922.1|  PREDICTED: probable aquaporin PIP2-6             75.9    4e-12    
emb|CAB46351.1|  major intrinsic protein 2                            75.9    4e-12    
gb|AGD98708.1|  aquaporin protein 5                                   75.9    4e-12    
ref|XP_009222744.1|  hypothetical protein GGTG_06660                  76.3    4e-12    
ref|XP_004164504.1|  PREDICTED: probable aquaporin TIP3-2-like        76.6    4e-12    
ref|NP_001077441.1|  aquaporin PIP1-3                                 74.7    5e-12    
gb|AEA40489.1|  aquaporin PIP1-1                                      75.5    5e-12    
tpg|DAA33864.1|  TPA: aquaporin PIP2;4                                75.5    5e-12    
gb|EYU41266.1|  hypothetical protein MIMGU_mgv1a011292mg              75.9    5e-12    
gb|AFN53630.1|  putative aquaporin PIP2-8                             77.8    5e-12    
ref|XP_009786071.1|  PREDICTED: aquaporin PIP2-7-like                 75.9    5e-12    
gb|AFH36336.1|  aquaporin PIP2;1                                      75.5    5e-12    
ref|XP_009355655.1|  PREDICTED: probable aquaporin PIP2-8             75.5    5e-12    
dbj|BAG68660.1|  plasma membrane intrinsic protein                    75.9    5e-12    
gb|EMT26209.1|  Aquaporin PIP2-3                                      75.9    5e-12    
gb|ABH09325.1|  putative aquaporin                                    75.5    5e-12    
gb|AFN53685.1|  putative aquaporin PIP2-8                             77.8    5e-12    
ref|NP_001274291.1|  probable aquaporin PIP-type pTOM75-like          75.5    6e-12    
emb|CAH59432.1|  aquaporin 2                                          75.5    6e-12    
gb|KDP25424.1|  hypothetical protein JCGZ_20580                       75.5    6e-12    
ref|XP_011092966.1|  PREDICTED: aquaporin PIP2-7                      75.5    6e-12    
ref|XP_009615789.1|  PREDICTED: aquaporin PIP2-7-like                 75.5    6e-12    
gb|ACB42440.1|  aquaporin PIP2;3                                      75.5    6e-12    
gb|ABK22355.1|  unknown                                               75.5    6e-12    
gb|KFX98979.1|  hypothetical protein V490_02000                       76.3    6e-12    
ref|XP_008377729.1|  PREDICTED: probable aquaporin PIP2-8             75.5    6e-12    
ref|NP_001280922.1|  probable aquaporin PIP1-4                        75.5    6e-12    
gb|KFY36810.1|  hypothetical protein V495_07588                       75.9    6e-12    
dbj|BAF32141.1|  putative aquaporin                                   75.1    6e-12    
emb|CAB06080.1|  porin                                                75.5    7e-12    
ref|XP_009382780.1|  PREDICTED: probable aquaporin PIP1-2             75.5    7e-12    
gb|ABJ98535.1|  PIP1 protein                                          75.1    7e-12    
gb|ABJ98538.1|  PIP1 protein                                          75.1    7e-12    
emb|CAA04653.1|  major intrinsic protein PIPB                         75.1    8e-12    
ref|XP_010439184.1|  PREDICTED: probable aquaporin PIP1-5             75.1    8e-12    
gb|KDO68093.1|  hypothetical protein CISIN_1g023370mg                 73.9    8e-12    
ref|XP_006402482.1|  hypothetical protein EUTSA_v10006141mg           75.1    8e-12    
ref|XP_010266027.1|  PREDICTED: aquaporin PIP2-7-like                 75.1    8e-12    
ref|XP_009350886.1|  PREDICTED: probable aquaporin PIP1-4             75.1    8e-12    
emb|CDY17511.1|  BnaC03g65520D                                        75.1    8e-12    
ref|XP_010046653.1|  PREDICTED: aquaporin PIP2-1-like                 75.1    8e-12    
ref|NP_001233846.1|  putative PIP-type aquaporin                      75.1    8e-12    
gb|AAG30607.1|AF314656_1  aquaporin                                   75.1    8e-12    
dbj|BAG68659.1|  plasma membrane intrinsic protein                    75.1    9e-12    
ref|NP_194071.1|  putative aquaporin PIP1-5                           75.1    9e-12    
dbj|BAO18631.1|  plasmamembrane intrinsic protein 2;9                 74.7    9e-12    
gb|EWZ33643.1|  hypothetical protein FOZG_13349                       75.5    9e-12    
gb|KHN31579.1|  Putative aquaporin PIP1-4                             74.7    9e-12    
gb|ACR56615.1|  plasma intrinsic protein 2;5                          74.7    9e-12    
gb|AAM65975.1|  plasma membrane intrinsic protein 1a                  75.1    9e-12    
ref|XP_008466925.1|  PREDICTED: LOW QUALITY PROTEIN: probable aqu...  73.6    9e-12    
gb|KDP44816.1|  hypothetical protein JCGZ_01316                       74.7    1e-11    
dbj|BAG06230.1|  plasma membrane intrinsic protein                    74.7    1e-11    
pdb|3CN6|A  Chain A, Crystal Structure Of The Spinach Aquaporin S...  75.1    1e-11    
ref|NP_001105131.1|  aquaporin PIP1-5                                 74.7    1e-11    
gb|ACU87555.1|  PIP protein                                           74.7    1e-11    
gb|AEH76327.1|  plasma membrane intrinsic protein 1                   74.7    1e-11    
ref|XP_006664813.1|  PREDICTED: probable aquaporin PIP2-6-like        74.7    1e-11    
gb|ABI96815.1|  plasma membrane intrinsic protein                     74.7    1e-11    
gb|AEY75243.1|  plasma membrane intrinsic protein                     74.7    1e-11    
ref|XP_009411509.1|  PREDICTED: aquaporin PIP1-1-like                 74.7    1e-11    
ref|XP_006664814.1|  PREDICTED: probable aquaporin PIP2-6-like        74.7    1e-11    
ref|XP_004500724.1|  PREDICTED: uncharacterized protein LOC101494283  76.6    1e-11    
gb|AFB82643.1|  aquaporin                                             74.7    1e-11    
ref|XP_006352272.1|  PREDICTED: probable aquaporin PIP-type pTOM7...  74.7    1e-11    
emb|CDX95670.1|  BnaC03g25510D                                        74.7    1e-11    
gb|EMT68895.1|  Aquaporin PIP-type                                    74.7    1e-11    
gb|EXM19363.1|  hypothetical protein FOTG_12619                       75.1    1e-11    
emb|CBI40389.3|  unnamed protein product                              73.2    1e-11    
ref|XP_009771075.1|  PREDICTED: aquaporin PIP2-7-like                 74.3    1e-11    
emb|CDX69112.1|  BnaC01g03410D                                        74.3    1e-11    
emb|CAH60720.1|  putative plasma membrane intrinsic protein           74.3    1e-11    
emb|CBI37861.3|  unnamed protein product                              73.2    1e-11    
ref|XP_010448716.1|  PREDICTED: probable aquaporin PIP1-5             74.3    1e-11    
ref|XP_002884019.1|  PIP2_8/PIP3B                                     74.3    1e-11    
gb|KFY80859.1|  hypothetical protein V499_00314                       75.1    1e-11    
ref|XP_006340945.1|  PREDICTED: aquaporin PIP2-7-like                 73.9    1e-11    
ref|XP_011015478.1|  PREDICTED: aquaporin PIP2-2-like                 74.3    1e-11    
ref|XP_010533655.1|  PREDICTED: aquaporin PIP1-3-like                 74.3    1e-11    
ref|XP_010433914.1|  PREDICTED: probable aquaporin PIP1-5             74.3    1e-11    
ref|XP_009105909.1|  PREDICTED: aquaporin PIP2-7                      74.3    1e-11    
ref|NP_001234625.1|  aquaporin                                        74.3    1e-11    
ref|XP_002446929.1|  hypothetical protein SORBIDRAFT_06g025150        74.3    2e-11    
ref|NP_001052292.1|  Os04g0233400                                     74.3    2e-11    
gb|ACE60220.1|  plasma membrane aquaporin                             73.9    2e-11    
gb|AAB61378.1|  aquaporin                                             74.3    2e-11    
ref|XP_011035995.1|  PREDICTED: probable aquaporin PIP1-2             74.3    2e-11    
ref|NP_001280914.1|  probable aquaporin PIP1-4                        74.3    2e-11    
gb|EKC35418.1|  Aquaporin-4                                           73.9    2e-11    
ref|XP_008602510.1|  MIP transporter                                  74.3    2e-11    
emb|CDP06739.1|  unnamed protein product                              73.9    2e-11    
ref|XP_009344552.1|  PREDICTED: probable aquaporin PIP1-4             73.9    2e-11    
ref|XP_009138343.1|  PREDICTED: aquaporin PIP2-7-like                 73.9    2e-11    
gb|EPS67791.1|  hypothetical protein M569_06982                       72.4    2e-11    
gb|EXK28734.1|  hypothetical protein FOMG_14640                       74.7    2e-11    
gb|AGD98712.1|  aquaporin protein 9                                   73.9    2e-11    
ref|XP_002315171.1|  hypothetical protein POPTR_0010s19930g           73.9    2e-11    
ref|XP_006846905.1|  hypothetical protein AMTR_s00152p00041700        73.9    2e-11    
ref|XP_010920097.1|  PREDICTED: probable aquaporin PIP2-6             73.9    2e-11    
gb|ACF39901.1|  aquaporin                                             73.9    2e-11    
gb|ADE76283.1|  unknown                                               73.6    2e-11    
ref|XP_011088776.1|  PREDICTED: uncharacterized protein LOC105169921  75.9    2e-11    
emb|CDX89115.1|  BnaA04g00710D                                        73.2    2e-11    
emb|CDX76314.1|  BnaA08g10860D                                        73.9    2e-11    
ref|XP_006296058.1|  hypothetical protein CARUB_v10025207mg           73.9    2e-11    
gb|KFZ24104.1|  hypothetical protein V502_01412                       74.7    2e-11    
gb|AGD98706.1|  aquaporin protein 3                                   73.9    2e-11    
ref|XP_010506589.1|  PREDICTED: aquaporin PIP1-2                      73.9    2e-11    
gb|ABH09327.1|  putative aquaporin                                    73.6    2e-11    
dbj|BAA20076.1|  water channel protein                                73.9    2e-11    
gb|AFB83067.1|  plasma intrinsic protein PIP2.1                       73.6    2e-11    
ref|NP_001267957.1|  aquaporin PIP2;2                                 73.6    2e-11    
ref|XP_006343971.1|  PREDICTED: probable aquaporin PIP-type pTOM7...  73.6    2e-11    
gb|AFW90554.1|  aquaporin                                             73.6    2e-11    
gb|AHB33474.1|  plasma intrinsic protein 1-1                          73.9    2e-11    
ref|XP_006360898.1|  PREDICTED: aquaporin PIP2-7-like                 73.6    2e-11    
gb|ABC01884.1|  plasma membrane intrinsic protein PIP2-like protein   73.6    2e-11    
gb|EMS49467.1|  Aquaporin PIP1-2                                      75.5    2e-11    
gb|AHX99531.1|  aquaporin PIP1                                        73.6    2e-11    
ref|XP_009630280.1|  PREDICTED: probable aquaporin PIP-type pTOM75    73.6    3e-11    
ref|XP_010107654.1|  Aquaporin PIP2-7                                 73.6    3e-11    
gb|EPS60284.1|  plasma membrane intrinsic protein                     73.6    3e-11    
gb|EHB09536.1|  Aquaporin-4                                           73.9    3e-11    
gb|ENH71469.1|  Aquaporin PIP-type                                    73.9    3e-11    
ref|XP_002454508.1|  hypothetical protein SORBIDRAFT_04g032430        73.6    3e-11    
ref|NP_001104934.1|  aquaporin PIP1-2                                 73.6    3e-11    
gb|AFH36339.1|  aquaporin PIP1;1                                      73.6    3e-11    
gb|ACF84511.1|  unknown                                               73.6    3e-11    
gb|ACL52629.1|  unknown                                               73.6    3e-11    
dbj|BAG72254.1|  aquaporin                                            72.8    3e-11    
ref|XP_006284279.1|  hypothetical protein CARUB_v10005443mg           73.2    3e-11    
emb|CAA04652.1|  major intrinsic protein PIPa2                        73.6    3e-11    
ref|XP_010516059.1|  PREDICTED: probable aquaporin PIP2-8             73.2    3e-11    
gb|ACC59097.1|  aquaporin                                             73.6    3e-11    
pdb|3CN5|A  Chain A, Crystal Structure Of The Spinach Aquaporin S...  73.6    3e-11    
emb|CDY66912.1|  BnaAnng23190D                                        72.4    3e-11    
ref|XP_009611050.1|  PREDICTED: aquaporin PIP2-7-like                 73.2    3e-11    
gb|ABJ98541.1|  PIP1 protein                                          73.2    3e-11    
pdb|2B5F|A  Chain A, Crystal Structure Of The Spinach Aquaporin S...  73.6    3e-11    
gb|ABO09756.1|  AQP4e                                                 74.3    3e-11    
ref|XP_010037720.1|  PREDICTED: aquaporin PIP1-3-like                 73.6    3e-11    
ref|NP_001105022.1|  aquaporin PIP1-3/PIP1-4                          73.2    3e-11    
ref|XP_003519383.1|  PREDICTED: probable aquaporin PIP-type 7a-like   73.2    3e-11    
ref|XP_010508083.1|  PREDICTED: aquaporin PIP1-2-like isoform X1      73.2    3e-11    
pdb|1Z98|A  Chain A, Crystal Structure Of The Spinach Aquaporin S...  73.2    4e-11    
gb|ACG39699.1|  aquaporin PIP1.1                                      72.8    4e-11    
ref|XP_010521765.1|  PREDICTED: aquaporin PIP2-7-like                 73.2    4e-11    
ref|NP_001267686.1|  uncharacterized protein LOC101215145             73.2    4e-11    
ref|XP_001758386.1|  predicted protein                                72.0    4e-11    
ref|XP_010028741.1|  PREDICTED: uncharacterized protein LOC104418957  75.1    4e-11    
ref|XP_010489282.1|  PREDICTED: probable aquaporin PIP2-8             72.8    4e-11    
ref|XP_009780961.1|  PREDICTED: aquaporin PIP2-7-like                 72.8    4e-11    
ref|XP_004149243.1|  PREDICTED: probable aquaporin PIP1-4-like is...  73.2    4e-11    
gb|ERE83823.1|  aquaporin-4-like protein                              74.3    4e-11    
gb|ACV70042.1|  aquaporin PIP1;1                                      71.6    4e-11    
ref|XP_004894949.1|  PREDICTED: aquaporin-4 isoform X1                73.6    4e-11    
gb|ACJ54703.1|  aquaporin                                             72.0    4e-11    
ref|NP_001105023.1|  aquaporin PIP1-6                                 73.2    4e-11    
ref|XP_008449258.1|  PREDICTED: aquaporin PIP2-2-like                 72.8    4e-11    
gb|ABL76066.1|  aquaporin 2                                           72.8    4e-11    
gb|EMP26444.1|  Aquaporin-4                                           74.7    4e-11    
ref|XP_005355847.1|  PREDICTED: aquaporin-4                           73.6    4e-11    
ref|XP_004307619.1|  PREDICTED: probable aquaporin PIP-type 7a-like   72.8    4e-11    
ref|XP_001769800.1|  predicted protein                                72.8    4e-11    
gb|ACC85598.1|  aquaporin                                             72.8    5e-11    
gb|AFB83065.1|  plasma intrinsic protein PIP1.1                       72.8    5e-11    
gb|EGU75229.1|  hypothetical protein FOXB_14275                       74.7    5e-11    
gb|AHX84137.1|  aquaporin                                             72.8    5e-11    
gb|AFW85290.1|  plasma membrane intrinsic protein1                    72.8    5e-11    
ref|XP_003570439.1|  PREDICTED: aquaporin PIP1-5                      72.8    5e-11    
ref|XP_008845867.1|  PREDICTED: aquaporin-4 isoform X2                73.2    5e-11    
gb|AEO13899.1|  aquaporin 8                                           72.8    5e-11    
gb|ACV70044.1|  aquaporin PIP1;1                                      71.2    5e-11    
gb|ACU81080.1|  aquaporin                                             72.8    5e-11    
gb|AFO63679.1|  plasma intrinsic protein 2                            72.8    5e-11    
ref|XP_002438067.1|  hypothetical protein SORBIDRAFT_10g007610        72.8    5e-11    
ref|XP_009143195.1|  PREDICTED: aquaporin PIP1-2 isoform X1           72.8    5e-11    
ref|XP_006298288.1|  hypothetical protein CARUB_v10014353mg           72.4    5e-11    
gb|EWG51840.1|  hypothetical protein FVEG_10709                       73.2    5e-11    
gb|AAO86706.1|  plasma membrane intrinsic protein                     72.8    5e-11    
ref|XP_007069741.1|  PREDICTED: aquaporin-4                           72.8    5e-11    
ref|XP_006339071.1|  PREDICTED: aquaporin PIP2-1-like                 72.4    6e-11    
gb|AFB83066.1|  plasma intrinsic protein PIP1.2                       72.4    6e-11    
gb|ACZ51371.1|  plasma membrane intrinsic protein                     72.8    6e-11    
ref|XP_004953388.1|  PREDICTED: aquaporin PIP1-2-like                 72.8    6e-11    
gb|AFD32162.1|  plasma membrane intrinsic protein                     72.4    6e-11    
gb|ACV70043.1|  aquaporin PIP1;1                                      71.2    6e-11    
gb|AAF71820.1|AF141900_1  putative aquaporin PIP2-2                   72.4    6e-11    
gb|AAZ03395.1|  Aqp4-Luc fusion protein                               74.7    6e-11    
ref|XP_004957505.1|  PREDICTED: probable aquaporin PIP2-7-like        72.4    6e-11    
gb|EWY81582.1|  hypothetical protein FOYG_15810                       73.2    6e-11    
ref|XP_002526867.1|  Aquaporin PIP1.3, putative                       72.4    7e-11    
gb|AAM65493.1|  water channel-like protein                            72.4    7e-11    
ref|XP_007622797.1|  PREDICTED: aquaporin-4                           72.8    7e-11    
ref|XP_010067506.1|  PREDICTED: probable aquaporin PIP1-2             72.4    7e-11    
gb|AAB18228.1|  MipE                                                  72.4    7e-11    
ref|XP_009133759.1|  PREDICTED: aquaporin PIP1-2-like                 71.2    7e-11    



>gb|ADO66668.1| X intrinsic protein [Ipomoea nil]
Length=335

 Score =   445 bits (1145),  Expect = 9e-152, Method: Compositional matrix adjust.
 Identities = 255/327 (78%), Positives = 290/327 (89%), Gaps = 8/327 (2%)
 Frame = -1

Query  1102  FGDEESHPHQNGGSNRVEDVSSTPTISNGNGNGTHQWTG--EKIPSSHLTLAQKLGLMDF  929
              GDEESHPH  GGS R+  VSS   +      G H+WTG  +K P + +TLAQKLG+MDF
Sbjct  11    LGDEESHPHNIGGSKRIAAVSSPFPM------GDHEWTGDDQKTPPASVTLAQKLGVMDF  64

Query  928   LSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPV  749
              SL+VWRAS+GE+ GTAVLVFM+D IVISTYE+++KMPNL+MS+LIAIVIT+LLLAVFPV
Sbjct  65    FSLNVWRASIGELIGTAVLVFMIDTIVISTYETDIKMPNLVMSVLIAIVITILLLAVFPV  124

Query  748   SGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCT  569
             SGGHINP ++FSAALVGIIS+SRAVIYMVAQCVGA LGALALKAVVSSSIENTFSLGGCT
Sbjct  125   SGGHINPIISFSAALVGIISISRAVIYMVAQCVGATLGALALKAVVSSSIENTFSLGGCT  184

Query  568   VTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgi  389
             +TV+APGPNGP+TVGL+  QAFWLE+FCSFVFLFASIWMAYD+RQAK LG VKV ++VG+
Sbjct  185   LTVIAPGPNGPITVGLEMAQAFWLEIFCSFVFLFASIWMAYDHRQAKSLGLVKVLSIVGM  244

Query  388   vlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLY  209
             VLGLLVFISTT+T KKGYAGAGMNPARC GAA+VRGGHLWDGHWIFWVGP IACVAFYLY
Sbjct  245   VLGLLVFISTTVTAKKGYAGAGMNPARCFGAAVVRGGHLWDGHWIFWVGPFIACVAFYLY  304

Query  208   TKIIPERHFHASGYPHDFFSTVKVGLG  128
             TKIIP +HFHA+GYPHDFFST+K+  G
Sbjct  305   TKIIPTQHFHATGYPHDFFSTLKLSCG  331



>ref|NP_001289505.1| aquaporin AQPAn.G-like [Nicotiana sylvestris]
 gb|ADO66676.1| X intrinsic protein [Nicotiana sylvestris]
Length=326

 Score =   412 bits (1060),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 244/326 (75%), Positives = 275/326 (84%), Gaps = 10/326 (3%)
 Frame = -1

Query  1102  FGDEESHPHQNGGSNRVEDVSSTPTISNGNGNGTHQWTGEKIPSSHLTLAQKLGLMDFLS  923
              GDEES    +GGSNRV+  SSTP   N +  G           + LT+AQ+LG+ DF S
Sbjct  9     LGDEESQ--LSGGSNRVQPFSSTPKNRNIDDEGKKH--------TSLTVAQRLGISDFFS  58

Query  922   LDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVSG  743
             LDVWRASMGE+ G+AVLVFMLD IVIST+ES+VKMPNLIMSILIAIVIT+LLLAV PVSG
Sbjct  59    LDVWRASMGELLGSAVLVFMLDTIVISTFESDVKMPNLIMSILIAIVITILLLAVVPVSG  118

Query  742   GHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTVT  563
             GHINP ++FSAALVGIISMSRA+IYMVAQCVGA+LGALALKAVVSS+I  TFSLGGCT+T
Sbjct  119   GHINPVISFSAALVGIISMSRAIIYMVAQCVGAILGALALKAVVSSTIAQTFSLGGCTIT  178

Query  562   VVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivl  383
             V+APGPNGP+TVGL+T QA WLE+FCSFVFLFASIWMAYD+RQAK LG V V ++VGIVL
Sbjct  179   VIAPGPNGPITVGLETAQALWLEIFCSFVFLFASIWMAYDHRQAKALGLVTVLSIVGIVL  238

Query  382   gllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTK  203
             GLLVFISTT+T KKGYAGAGMNPARC GAA+VRGGHLWDGHWIFWVGP IACVAFY+YTK
Sbjct  239   GLLVFISTTVTAKKGYAGAGMNPARCFGAAVVRGGHLWDGHWIFWVGPTIACVAFYVYTK  298

Query  202   IIPERHFHASGYPHDFFSTVKVGLGI  125
             IIP +HFHA GY +DF   VK   G+
Sbjct  299   IIPPQHFHADGYKYDFIGVVKASFGL  324



>ref|XP_009774272.1| PREDICTED: aquaporin AQPAn.G-like isoform X2 [Nicotiana sylvestris]
Length=325

 Score =   412 bits (1058),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 245/334 (73%), Positives = 277/334 (83%), Gaps = 11/334 (3%)
 Frame = -1

Query  1123  AKYTRQGFGDEESHPHQNGGSNRVEDVSSTPTISNGNGNGTHQWTGEKIPSSHLTLAQKL  944
             A  T    GDEES    +GGSNRV+  SSTP  +  +    H         + LT+AQ+L
Sbjct  2     ASNTSHVLGDEESQ--LSGGSNRVQPFSSTPKKNIDDEGKKH---------TSLTVAQRL  50

Query  943   GLMDFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlll  764
             G+ DF SLDVWRASMGE+ G+AVLVFMLD IVIST+ES+VKMPNLIMSILIAIVIT+LLL
Sbjct  51    GISDFFSLDVWRASMGELLGSAVLVFMLDTIVISTFESDVKMPNLIMSILIAIVITILLL  110

Query  763   aVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFS  584
             AV PVSGGHINP ++FSAALVGIISMSRA+IYMVAQCVGA+LGALALKAVVSS+I  TFS
Sbjct  111   AVVPVSGGHINPVISFSAALVGIISMSRAIIYMVAQCVGAILGALALKAVVSSTIAQTFS  170

Query  583   LGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvf  404
             LGGCT+TV+APGPNGP+TVGL+T QA WLE+FCSFVFLFASIWMAYD+RQAK LG V V 
Sbjct  171   LGGCTITVIAPGPNGPITVGLETAQALWLEIFCSFVFLFASIWMAYDHRQAKALGLVTVL  230

Query  403   tvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACV  224
             ++VGIVLGLLVFISTT+T KKGYAGAGMNPARC GAA+VRGGHLWDGHWIFWVGP IACV
Sbjct  231   SIVGIVLGLLVFISTTVTAKKGYAGAGMNPARCFGAAVVRGGHLWDGHWIFWVGPTIACV  290

Query  223   AFYLYTKIIPERHFHASGYPHDFFSTVKVGLGIR  122
             AFY+YTKIIP +HFHA GY +DF   VK   G+ 
Sbjct  291   AFYVYTKIIPPQHFHADGYKYDFIGVVKASFGLH  324



>gb|ADO66675.1| X intrinsic protein [Nicotiana sylvestris]
Length=325

 Score =   410 bits (1054),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 243/327 (74%), Positives = 275/327 (84%), Gaps = 11/327 (3%)
 Frame = -1

Query  1102  FGDEESHPHQNGGSNRVEDVSSTPTISNGNGNGTHQWTGEKIPSSHLTLAQKLGLMDFLS  923
              GDEES    +GGSNRV+  SSTP  +  +    H         + LT+AQ+LG+ DF S
Sbjct  9     LGDEESQ--LSGGSNRVQPFSSTPKKNIDDEGKKH---------TSLTVAQRLGISDFFS  57

Query  922   LDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVSG  743
             LDVWRASMGE+ G+AVLVFMLD IVIST+ES+VKMPNLIMSILIAIVIT+LLLAV PVSG
Sbjct  58    LDVWRASMGELLGSAVLVFMLDTIVISTFESDVKMPNLIMSILIAIVITILLLAVVPVSG  117

Query  742   GHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTVT  563
             GHINP ++FSAALVGIISMSRA+IYMVAQCVGA+LGALALKAVVSS+I  TFSLGGCT+T
Sbjct  118   GHINPVISFSAALVGIISMSRAIIYMVAQCVGAILGALALKAVVSSTIAQTFSLGGCTIT  177

Query  562   VVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivl  383
             V+APGPNGP+TVGL+T QA WLE+FCSFVFLFASIWMAYD+RQAK LG V V ++VGIVL
Sbjct  178   VIAPGPNGPITVGLETAQALWLEIFCSFVFLFASIWMAYDHRQAKALGLVTVLSIVGIVL  237

Query  382   gllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTK  203
             GLLVFISTT+T KKGYAGAGMNPARC GAA+VRGGHLWDGHWIFWVGP IACVAFY+YTK
Sbjct  238   GLLVFISTTVTAKKGYAGAGMNPARCFGAAVVRGGHLWDGHWIFWVGPTIACVAFYVYTK  297

Query  202   IIPERHFHASGYPHDFFSTVKVGLGIR  122
             IIP +HFHA GY +DF   VK   G+ 
Sbjct  298   IIPPQHFHADGYKYDFIGVVKASFGLH  324



>ref|NP_001289455.1| probable aquaporin PIP2-8 [Nicotiana tomentosiformis]
 gb|ADO66666.1| X intrinsic protein [Nicotiana tabacum]
 gb|ADO66674.1| X intrinsic protein [Nicotiana tomentosiformis]
Length=326

 Score =   407 bits (1047),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 241/326 (74%), Positives = 274/326 (84%), Gaps = 10/326 (3%)
 Frame = -1

Query  1102  FGDEESHPHQNGGSNRVEDVSSTPTISNGNGNGTHQWTGEKIPSSHLTLAQKLGLMDFLS  923
              GDEES    +GGSNRV+  SSTP   N +  G           + LT+AQ+LG+ DF S
Sbjct  9     LGDEESQ--LSGGSNRVQPFSSTPKNRNIDDEGKKH--------TSLTVAQRLGISDFFS  58

Query  922   LDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVSG  743
             LDVWRAS+GE+ G+AVLVFMLD IVIST+ES+VKMPNLIMSILIAIVIT+LLLAV PVSG
Sbjct  59    LDVWRASVGELLGSAVLVFMLDTIVISTFESDVKMPNLIMSILIAIVITILLLAVVPVSG  118

Query  742   GHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTVT  563
             GHINP ++FSAALVGIISMSRA+IYMVAQCVGA+LGALALKAVVSS+I  TFSLGGCT+T
Sbjct  119   GHINPVISFSAALVGIISMSRAIIYMVAQCVGAILGALALKAVVSSTIAQTFSLGGCTIT  178

Query  562   VVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivl  383
             V+APGPNGP+TVGL+  QA WLE+FC+FVFLFASIWMAYD+RQAK LG V V ++VGIVL
Sbjct  179   VIAPGPNGPITVGLEMAQALWLEIFCTFVFLFASIWMAYDHRQAKALGLVTVLSIVGIVL  238

Query  382   gllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTK  203
             GLLVFISTT+T KKGYAGAGMNPARC GAA+VRGGHLWDGHWIFWVGP IACVAFY+YTK
Sbjct  239   GLLVFISTTVTMKKGYAGAGMNPARCFGAAVVRGGHLWDGHWIFWVGPTIACVAFYVYTK  298

Query  202   IIPERHFHASGYPHDFFSTVKVGLGI  125
             IIP +HFHA GY +DF   VK   G+
Sbjct  299   IIPPKHFHADGYKYDFIGVVKASFGL  324



>gb|ADO66667.1| X intrinsic protein [Nicotiana tabacum]
 gb|ADO66673.1| X intrinsic protein [Nicotiana tomentosiformis]
Length=325

 Score =   405 bits (1042),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 240/326 (74%), Positives = 274/326 (84%), Gaps = 11/326 (3%)
 Frame = -1

Query  1102  FGDEESHPHQNGGSNRVEDVSSTPTISNGNGNGTHQWTGEKIPSSHLTLAQKLGLMDFLS  923
              GDEES    +GGSNRV+  SSTP  +  +    H         + LT+AQ+LG+ DF S
Sbjct  9     LGDEESQ--LSGGSNRVQPFSSTPKKNIDDEGKKH---------TSLTVAQRLGISDFFS  57

Query  922   LDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVSG  743
             LDVWRAS+GE+ G+AVLVFMLD IVIST+ES+VKMPNLIMSILIAIVIT+LLLAV PVSG
Sbjct  58    LDVWRASVGELLGSAVLVFMLDTIVISTFESDVKMPNLIMSILIAIVITILLLAVVPVSG  117

Query  742   GHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTVT  563
             GHINP ++FSAALVGIISMSRA+IYMVAQCVGA+LGALALKAVVSS+I  TFSLGGCT+T
Sbjct  118   GHINPVISFSAALVGIISMSRAIIYMVAQCVGAILGALALKAVVSSTIAQTFSLGGCTIT  177

Query  562   VVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivl  383
             V+APGPNGP+TVGL+  QA WLE+FC+FVFLFASIWMAYD+RQAK LG V V ++VGIVL
Sbjct  178   VIAPGPNGPITVGLEMAQALWLEIFCTFVFLFASIWMAYDHRQAKALGLVTVLSIVGIVL  237

Query  382   gllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTK  203
             GLLVFISTT+T KKGYAGAGMNPARC GAA+VRGGHLWDGHWIFWVGP IACVAFY+YTK
Sbjct  238   GLLVFISTTVTMKKGYAGAGMNPARCFGAAVVRGGHLWDGHWIFWVGPTIACVAFYVYTK  297

Query  202   IIPERHFHASGYPHDFFSTVKVGLGI  125
             IIP +HFHA GY +DF   VK   G+
Sbjct  298   IIPPKHFHADGYKYDFIGVVKASFGL  323



>ref|XP_009630664.1| PREDICTED: probable aquaporin PIP2-8 isoform X2 [Nicotiana tomentosiformis]
Length=325

 Score =   404 bits (1039),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 240/326 (74%), Positives = 274/326 (84%), Gaps = 11/326 (3%)
 Frame = -1

Query  1102  FGDEESHPHQNGGSNRVEDVSSTPTISNGNGNGTHQWTGEKIPSSHLTLAQKLGLMDFLS  923
              GDEES    +GGSNRV+  SSTP  +  +    H         + LT+AQ+LG+ DF S
Sbjct  9     LGDEESQ--LSGGSNRVQPFSSTPKKNIDDEGKKH---------TSLTVAQRLGISDFFS  57

Query  922   LDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVSG  743
             LDVWRAS+GE+ G+AVLVFMLD IVIST+ES+VKMPNLIMSILIAIVIT+LLLAV PVSG
Sbjct  58    LDVWRASVGELLGSAVLVFMLDTIVISTFESDVKMPNLIMSILIAIVITILLLAVVPVSG  117

Query  742   GHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTVT  563
             GHINP ++FSAALVGIISMSRA+IYMVAQCVGA+LGALALKAVVSS+I  TFSLGGCT+T
Sbjct  118   GHINPVISFSAALVGIISMSRAIIYMVAQCVGAILGALALKAVVSSTIAQTFSLGGCTIT  177

Query  562   VVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivl  383
             V+APGPNGP+TVGL+  QA WLE+FC+FVFLFASIWMAYD+RQAK LG V V ++VGIVL
Sbjct  178   VIAPGPNGPITVGLEMAQALWLEIFCTFVFLFASIWMAYDHRQAKALGLVTVLSIVGIVL  237

Query  382   gllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTK  203
             GLLVFISTT+T KKGYAGAGMNPARC GAA+VRGGHLWDGHWIFWVGP IACVAFY+YTK
Sbjct  238   GLLVFISTTVTMKKGYAGAGMNPARCFGAAVVRGGHLWDGHWIFWVGPTIACVAFYVYTK  297

Query  202   IIPERHFHASGYPHDFFSTVKVGLGI  125
             IIP +HFHA GY +DF   VK   G+
Sbjct  298   IIPPKHFHADGYKYDFIGVVKALFGL  323



>gb|ADO66669.1| X intrinsic protein [Solanum tuberosum]
Length=325

 Score =   399 bits (1024),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 233/322 (72%), Positives = 274/322 (85%), Gaps = 11/322 (3%)
 Frame = -1

Query  1102  FGDEESHPHQNGGSNRVEDVSSTPTISNGNGNGTHQWTGEKIPSSHLTLAQKLGLMDFLS  923
             FGDEES    +GG+NRV+  SSTP  +  + +G  Q        + L+L+Q+LG+ DF  
Sbjct  9     FGDEESQ--LSGGTNRVQPCSSTPRKNTIDDDGKKQ--------NFLSLSQRLGIQDFFC  58

Query  922   LDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVSG  743
             LDVWRASMGE+ G+AVLVFMLD IVIST+ES+ KMPNLIMSILIA+VIT+LLLAV PVSG
Sbjct  59    LDVWRASMGELLGSAVLVFMLDTIVISTFESDTKMPNLIMSILIAVVITILLLAVVPVSG  118

Query  742   GHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTVT  563
             GHINP ++FSAALVGIISMSRA+IY+VAQC+GAVLGALAL+AVVSSSIE+TFSLGGCTVT
Sbjct  119   GHINPVISFSAALVGIISMSRAIIYIVAQCLGAVLGALALRAVVSSSIEDTFSLGGCTVT  178

Query  562   VVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivl  383
             ++APGPNGPVTVGL+T QA WLE+FC+FVFLFASIWMAYD+RQAK LGHV V ++VG+VL
Sbjct  179   IIAPGPNGPVTVGLETAQALWLEIFCTFVFLFASIWMAYDHRQAKALGHVTVLSIVGLVL  238

Query  382   gllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTK  203
             GLLVFISTT+T KKGY GAG+NPARC+G A++RGGHLWDGHWIFWVGP I CVAFY+YTK
Sbjct  239   GLLVFISTTVTAKKGYGGAGINPARCLGPAIIRGGHLWDGHWIFWVGPTIGCVAFYVYTK  298

Query  202   IIPERHFHAS-GYPHDFFSTVK  140
             IIP +HF A  G+ HDF   VK
Sbjct  299   IIPPKHFLAEYGFKHDFVGVVK  320



>ref|NP_001275444.1| X intrinsic protein [Solanum tuberosum]
 gb|ADO66670.1| X intrinsic protein [Solanum tuberosum]
Length=326

 Score =   396 bits (1018),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 235/322 (73%), Positives = 274/322 (85%), Gaps = 10/322 (3%)
 Frame = -1

Query  1102  FGDEESHPHQNGGSNRVEDVSSTPTISNGNGNGTHQWTGEKIPSSHLTLAQKLGLMDFLS  923
             FGDEES    +GG+NRV+  SSTP   N     T    G+K   + L+L+Q+LG+ DF  
Sbjct  9     FGDEESQ--LSGGTNRVQPCSSTPRNRN-----TIDDDGKK--QNFLSLSQRLGIQDFFC  59

Query  922   LDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVSG  743
             LDVWRASMGE+ G+AVLVFMLD IVIST+ES+ KMPNLIMSILIA+VIT+LLLAV PVSG
Sbjct  60    LDVWRASMGELLGSAVLVFMLDTIVISTFESDTKMPNLIMSILIAVVITILLLAVVPVSG  119

Query  742   GHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTVT  563
             GHINP ++FSAALVGIISMSRA+IY+VAQC+GAVLGALAL+AVVSSSIE+TFSLGGCTVT
Sbjct  120   GHINPVISFSAALVGIISMSRAIIYIVAQCLGAVLGALALRAVVSSSIEDTFSLGGCTVT  179

Query  562   VVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivl  383
             ++APGPNGPVTVGL+T QA WLE+FC+FVFLFASIWMAYD+RQAK LGHV V ++VG+VL
Sbjct  180   IIAPGPNGPVTVGLETAQALWLEIFCTFVFLFASIWMAYDHRQAKALGHVTVLSIVGLVL  239

Query  382   gllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTK  203
             GLLVFISTT+T KKGY GAG+NPARC+G A++RGGHLWDGHWIFWVGP I CVAFY+YTK
Sbjct  240   GLLVFISTTVTAKKGYGGAGINPARCLGPAIIRGGHLWDGHWIFWVGPTIGCVAFYVYTK  299

Query  202   IIPERHFHAS-GYPHDFFSTVK  140
             IIP +HF A  G+ HDF   VK
Sbjct  300   IIPPKHFLAEYGFKHDFVGVVK  321



>ref|XP_006367338.1| PREDICTED: probable aquaporin PIP1-2 isoform X2 [Solanum tuberosum]
Length=325

 Score =   395 bits (1016),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 233/322 (72%), Positives = 274/322 (85%), Gaps = 11/322 (3%)
 Frame = -1

Query  1102  FGDEESHPHQNGGSNRVEDVSSTPTISNGNGNGTHQWTGEKIPSSHLTLAQKLGLMDFLS  923
             FGDEES    +GG+NRV+  SSTP  +  + +G       K P+  L+L+Q+LG+ DF  
Sbjct  9     FGDEESQ--LSGGTNRVQPCSSTPRKNTIDDDG-------KKPN-FLSLSQRLGIQDFFC  58

Query  922   LDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVSG  743
             LDVWRASMGE+ G+AVLVFMLD IVIST+ESE KMPNLIMSILIA+VIT+LLLAV PVSG
Sbjct  59    LDVWRASMGELLGSAVLVFMLDTIVISTFESETKMPNLIMSILIAVVITILLLAVVPVSG  118

Query  742   GHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTVT  563
             GHINP ++FSAALVGIISMSRA+IY+VAQC+GA+LGALAL+AVVSSSIE+TFSLGGCTVT
Sbjct  119   GHINPVISFSAALVGIISMSRAIIYIVAQCLGAILGALALRAVVSSSIEDTFSLGGCTVT  178

Query  562   VVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivl  383
             ++APGPNGPVT GL+T QA WLE+FC+FVFLFASIWMAYD+RQAK LGHV V ++VG+VL
Sbjct  179   IIAPGPNGPVTKGLETAQALWLEIFCTFVFLFASIWMAYDHRQAKALGHVTVLSIVGVVL  238

Query  382   gllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTK  203
             GLLVFISTT+T KKGY GAG+NPARC+G A++RGGHLWDGHWIFWVGP I CVAFY+YTK
Sbjct  239   GLLVFISTTVTAKKGYGGAGINPARCLGPAIIRGGHLWDGHWIFWVGPTIGCVAFYVYTK  298

Query  202   IIPERHFHAS-GYPHDFFSTVK  140
             IIP +HF A  G+ HDF   VK
Sbjct  299   IIPSKHFLAEYGFKHDFVGVVK  320



>ref|NP_001238800.1| X intrinsic protein [Solanum lycopersicum]
 gb|ADO66671.1| X intrinsic protein [Solanum lycopersicum]
Length=328

 Score =   394 bits (1013),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 234/322 (73%), Positives = 272/322 (84%), Gaps = 8/322 (2%)
 Frame = -1

Query  1102  FGDEESHPHQNGGSNRVEDVSSTPTISNGNGNGTHQWTGEKIPSSHLTLAQKLGLMDFLS  923
             FGDEES    +GG+NRV+  SSTP       N      G+K   + L+L+Q+LG+ DF  
Sbjct  9     FGDEESQ--ISGGTNRVQPCSSTP---RNRINTIDDDEGKK--HNFLSLSQRLGVADFFC  61

Query  922   LDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVSG  743
             LDVWRASMGE+ G+AVLVFMLD IVIST+ESE KMPNLIMSILIA+VIT+LLLAV PVSG
Sbjct  62    LDVWRASMGELLGSAVLVFMLDTIVISTFESETKMPNLIMSILIAVVITILLLAVVPVSG  121

Query  742   GHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTVT  563
             GHINP ++FSAALVGIISMSRA+IY+VAQCVGA+LGALAL+AVVSSSIE+TFSLGGCTVT
Sbjct  122   GHINPVISFSAALVGIISMSRAIIYIVAQCVGAILGALALRAVVSSSIEDTFSLGGCTVT  181

Query  562   VVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivl  383
             ++APGPNGPV VGL+T QA WLE+FC+FVFLFASIWMAYD+RQAK LGHV V ++VG+VL
Sbjct  182   IIAPGPNGPVIVGLETAQALWLEIFCTFVFLFASIWMAYDHRQAKALGHVTVLSIVGLVL  241

Query  382   gllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTK  203
             GLLVFISTT+T KKGY GAG+NPARC+G A++RGGHLWDGHWIFWVGP I CVAFY+YTK
Sbjct  242   GLLVFISTTVTAKKGYGGAGINPARCLGPAIIRGGHLWDGHWIFWVGPTIGCVAFYVYTK  301

Query  202   IIPERHFHAS-GYPHDFFSTVK  140
             IIP +HF A  G+ HDF   VK
Sbjct  302   IIPTKHFLAEYGFKHDFVGVVK  323



>ref|XP_010327383.1| PREDICTED: X intrinsic protein isoform X1 [Solanum lycopersicum]
 gb|ADO66672.1| X intrinsic protein [Solanum lycopersicum]
 dbj|BAO18652.1| X-intrinsic protein 1;1 [Solanum lycopersicum]
Length=327

 Score =   394 bits (1011),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 234/322 (73%), Positives = 272/322 (84%), Gaps = 9/322 (3%)
 Frame = -1

Query  1102  FGDEESHPHQNGGSNRVEDVSSTPTISNGNGNGTHQWTGEKIPSSHLTLAQKLGLMDFLS  923
             FGDEES    +GG+NRV+  SSTP       N      G+K   + L+L+Q+LG+ DF  
Sbjct  9     FGDEESQ--ISGGTNRVQPCSSTPR----KINTIDDDEGKK--HNFLSLSQRLGVADFFC  60

Query  922   LDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVSG  743
             LDVWRASMGE+ G+AVLVFMLD IVIST+ESE KMPNLIMSILIA+VIT+LLLAV PVSG
Sbjct  61    LDVWRASMGELLGSAVLVFMLDTIVISTFESETKMPNLIMSILIAVVITILLLAVVPVSG  120

Query  742   GHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTVT  563
             GHINP ++FSAALVGIISMSRA+IY+VAQCVGA+LGALAL+AVVSSSIE+TFSLGGCTVT
Sbjct  121   GHINPVISFSAALVGIISMSRAIIYIVAQCVGAILGALALRAVVSSSIEDTFSLGGCTVT  180

Query  562   VVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivl  383
             ++APGPNGPV VGL+T QA WLE+FC+FVFLFASIWMAYD+RQAK LGHV V ++VG+VL
Sbjct  181   IIAPGPNGPVIVGLETAQALWLEIFCTFVFLFASIWMAYDHRQAKALGHVTVLSIVGLVL  240

Query  382   gllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTK  203
             GLLVFISTT+T KKGY GAG+NPARC+G A++RGGHLWDGHWIFWVGP I CVAFY+YTK
Sbjct  241   GLLVFISTTVTAKKGYGGAGINPARCLGPAIIRGGHLWDGHWIFWVGPTIGCVAFYVYTK  300

Query  202   IIPERHFHAS-GYPHDFFSTVK  140
             IIP +HF A  G+ HDF   VK
Sbjct  301   IIPTKHFLAEYGFKHDFVGVVK  322



>ref|XP_006365918.1| PREDICTED: aquaporin-4-like isoform X1 [Solanum tuberosum]
Length=328

 Score =   390 bits (1003),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 231/326 (71%), Positives = 275/326 (84%), Gaps = 10/326 (3%)
 Frame = -1

Query  1102  FGDEESHPHQNGGSNRVEDVSSTPTISNGNGNGTHQWTGEKIPSSHLTLAQKLGLMDFLS  923
             FGDEE+    +GG+NRV+  SSTP   N     T    G+K   + L+ +++LG+ DF  
Sbjct  9     FGDEENQ--LSGGTNRVQTCSSTPRNRN-----TIDDEGKK--PNFLSFSERLGVPDFFC  59

Query  922   LDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVSG  743
             LDVWRASMGE+ GTAVLVFMLD IVIST+ES+ KMPNLIMSILIA+VIT+LLLAV PVSG
Sbjct  60    LDVWRASMGELLGTAVLVFMLDTIVISTFESDTKMPNLIMSILIAVVITILLLAVVPVSG  119

Query  742   GHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTVT  563
             GHINP ++FSAALVGIISMSRA+IY++AQC+GA+LGALAL+AVVSSSIE+TFSLGGCTVT
Sbjct  120   GHINPVISFSAALVGIISMSRAIIYIMAQCIGAILGALALRAVVSSSIEDTFSLGGCTVT  179

Query  562   VVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivl  383
             ++APGPNGP+T+GL+T QA WLE+FC+FVFLFASIWMAYD+RQAK LGHV V ++VG+VL
Sbjct  180   IIAPGPNGPITLGLETAQALWLEIFCTFVFLFASIWMAYDHRQAKALGHVTVLSIVGVVL  239

Query  382   gllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTK  203
             GLLVFISTT+T KKGY GAG+NPARC+G A++RGGHLWDGHWIFWVGP I CVAFY+YTK
Sbjct  240   GLLVFISTTVTGKKGYGGAGINPARCLGPAIIRGGHLWDGHWIFWVGPTIGCVAFYVYTK  299

Query  202   IIPERHFHAS-GYPHDFFSTVKVGLG  128
             IIP +HF+A  GY HDF   VK   G
Sbjct  300   IIPAKHFNAEYGYKHDFVGVVKALFG  325



>ref|XP_004248670.1| PREDICTED: probable aquaporin TIP1-2 isoform X1 [Solanum lycopersicum]
Length=328

 Score =   390 bits (1003),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 228/326 (70%), Positives = 276/326 (85%), Gaps = 10/326 (3%)
 Frame = -1

Query  1102  FGDEESHPHQNGGSNRVEDVSSTPTISNGNGNGTHQWTGEKIPSSHLTLAQKLGLMDFLS  923
             FGDEE+    + G+N+V+  SSTP         T    G+K+  + L+ +++LG+ DF S
Sbjct  9     FGDEENQ--FSCGTNKVQPCSSTP-----KSRSTIDDEGKKL--NFLSFSERLGVSDFFS  59

Query  922   LDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVSG  743
             LDVWRAS+GE+ GTAVLVFMLD IVIST ES++KMPNLI+SIL A++IT+LLLAV PVSG
Sbjct  60    LDVWRASIGELLGTAVLVFMLDTIVISTLESDIKMPNLILSILAAVIITILLLAVVPVSG  119

Query  742   GHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTVT  563
             GHINP ++FSAALVGIISMSRA+IY++AQC+GA+LGALALKAVVSSSIE+TFSLGGCT+T
Sbjct  120   GHINPVISFSAALVGIISMSRAIIYIMAQCLGAILGALALKAVVSSSIEDTFSLGGCTIT  179

Query  562   VVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivl  383
             ++APGPNGP++VGL+T QA WLE+FC+FVFLFASIWMAYD+RQAK LGHV V ++VG+VL
Sbjct  180   IIAPGPNGPISVGLETAQALWLEIFCTFVFLFASIWMAYDHRQAKALGHVTVLSIVGVVL  239

Query  382   gllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTK  203
             GLLVFISTT+T KKGYAGAGMNPARC G A+VRGGHLWDGHWIFWVGP+I CVAFY+YTK
Sbjct  240   GLLVFISTTVTAKKGYAGAGMNPARCFGPAIVRGGHLWDGHWIFWVGPIIGCVAFYVYTK  299

Query  202   IIPERHFHAS-GYPHDFFSTVKVGLG  128
             IIP +HF+A  GY HDF   VK  +G
Sbjct  300   IIPTKHFNAEYGYKHDFVGVVKALVG  325



>ref|XP_010327421.1| PREDICTED: probable aquaporin TIP1-2 isoform X2 [Solanum lycopersicum]
Length=327

 Score =   390 bits (1002),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 227/326 (70%), Positives = 274/326 (84%), Gaps = 11/326 (3%)
 Frame = -1

Query  1102  FGDEESHPHQNGGSNRVEDVSSTPTISNGNGNGTHQWTGEKIPSSHLTLAQKLGLMDFLS  923
             FGDEE+    + G+N+V+  SSTP  S  +  G           + L+ +++LG+ DF S
Sbjct  9     FGDEENQ--FSCGTNKVQPCSSTPKRSTIDDEGKKL--------NFLSFSERLGVSDFFS  58

Query  922   LDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVSG  743
             LDVWRAS+GE+ GTAVLVFMLD IVIST ES++KMPNLI+SIL A++IT+LLLAV PVSG
Sbjct  59    LDVWRASIGELLGTAVLVFMLDTIVISTLESDIKMPNLILSILAAVIITILLLAVVPVSG  118

Query  742   GHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTVT  563
             GHINP ++FSAALVGIISMSRA+IY++AQC+GA+LGALALKAVVSSSIE+TFSLGGCT+T
Sbjct  119   GHINPVISFSAALVGIISMSRAIIYIMAQCLGAILGALALKAVVSSSIEDTFSLGGCTIT  178

Query  562   VVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivl  383
             ++APGPNGP++VGL+T QA WLE+FC+FVFLFASIWMAYD+RQAK LGHV V ++VG+VL
Sbjct  179   IIAPGPNGPISVGLETAQALWLEIFCTFVFLFASIWMAYDHRQAKALGHVTVLSIVGVVL  238

Query  382   gllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTK  203
             GLLVFISTT+T KKGYAGAGMNPARC G A+VRGGHLWDGHWIFWVGP+I CVAFY+YTK
Sbjct  239   GLLVFISTTVTAKKGYAGAGMNPARCFGPAIVRGGHLWDGHWIFWVGPIIGCVAFYVYTK  298

Query  202   IIPERHFHAS-GYPHDFFSTVKVGLG  128
             IIP +HF+A  GY HDF   VK  +G
Sbjct  299   IIPTKHFNAEYGYKHDFVGVVKALVG  324



>ref|XP_006365919.1| PREDICTED: aquaporin-4-like isoform X2 [Solanum tuberosum]
Length=327

 Score =   390 bits (1001),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 230/326 (71%), Positives = 275/326 (84%), Gaps = 11/326 (3%)
 Frame = -1

Query  1102  FGDEESHPHQNGGSNRVEDVSSTPTISNGNGNGTHQWTGEKIPSSHLTLAQKLGLMDFLS  923
             FGDEE+    +GG+NRV+  SSTP  +  +  G       K P+  L+ +++LG+ DF  
Sbjct  9     FGDEENQ--LSGGTNRVQTCSSTPRKNTIDDEG-------KKPN-FLSFSERLGVPDFFC  58

Query  922   LDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVSG  743
             LDVWRASMGE+ GTAVLVFMLD IVIST+ES+ KMPNLIMSILIA+VIT+LLLAV PVSG
Sbjct  59    LDVWRASMGELLGTAVLVFMLDTIVISTFESDTKMPNLIMSILIAVVITILLLAVVPVSG  118

Query  742   GHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTVT  563
             GHINP ++FSAALVGIISMSRA+IY++AQC+GA+LGALAL+AVVSSSIE+TFSLGGCTVT
Sbjct  119   GHINPVISFSAALVGIISMSRAIIYIMAQCIGAILGALALRAVVSSSIEDTFSLGGCTVT  178

Query  562   VVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivl  383
             ++APGPNGP+T+GL+T QA WLE+FC+FVFLFASIWMAYD+RQAK LGHV V ++VG+VL
Sbjct  179   IIAPGPNGPITLGLETAQALWLEIFCTFVFLFASIWMAYDHRQAKALGHVTVLSIVGVVL  238

Query  382   gllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTK  203
             GLLVFISTT+T KKGY GAG+NPARC+G A++RGGHLWDGHWIFWVGP I CVAFY+YTK
Sbjct  239   GLLVFISTTVTGKKGYGGAGINPARCLGPAIIRGGHLWDGHWIFWVGPTIGCVAFYVYTK  298

Query  202   IIPERHFHAS-GYPHDFFSTVKVGLG  128
             IIP +HF+A  GY HDF   VK   G
Sbjct  299   IIPAKHFNAEYGYKHDFVGVVKALFG  324



>ref|XP_006365921.1| PREDICTED: aquaporin PIP1-6-like isoform X2 [Solanum tuberosum]
Length=327

 Score =   389 bits (998),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 231/326 (71%), Positives = 272/326 (83%), Gaps = 11/326 (3%)
 Frame = -1

Query  1102  FGDEESHPHQNGGSNRVEDVSSTPTISNGNGNGTHQWTGEKIPSSHLTLAQKLGLMDFLS  923
             FGDEES    +GG+NRV+  SSTP  S  +  G  Q        + L+L+Q+LG+ DF S
Sbjct  9     FGDEESQ--LSGGNNRVQPYSSTPKKSIIDDEGKKQ--------NFLSLSQRLGVPDFFS  58

Query  922   LDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVSG  743
             LDVWRASMGE+ G+AVLVFM+D IVIST ES+ KM NLIMSILIAIV+T+LLLAV PVSG
Sbjct  59    LDVWRASMGELLGSAVLVFMVDTIVISTSESDTKMSNLIMSILIAIVLTILLLAVVPVSG  118

Query  742   GHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTVT  563
             GH+NP ++FSAALVGIISMSRA+IY+VAQC+GAVLGALALKAVVSS+I+ TFSLGGCT+T
Sbjct  119   GHLNPVISFSAALVGIISMSRAIIYIVAQCLGAVLGALALKAVVSSTIDETFSLGGCTIT  178

Query  562   VVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivl  383
             V+APGPNGPVT+GL+T QA WLE+FC+FV LFASIWMAYD+RQAK LG V V ++VG+VL
Sbjct  179   VIAPGPNGPVTLGLETAQALWLEIFCTFVLLFASIWMAYDHRQAKALGLVTVLSIVGLVL  238

Query  382   gllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTK  203
             GLLVFISTT+T K+GYAG GMNPARC+G A+VRGGHLWDGHWIFW+GP I+CVAFY+YTK
Sbjct  239   GLLVFISTTVTAKRGYAGVGMNPARCLGPAIVRGGHLWDGHWIFWIGPTISCVAFYVYTK  298

Query  202   IIPERHFHAS-GYPHDFFSTVKVGLG  128
             IIP +HFHA  GY HDF   VK   G
Sbjct  299   IIPPKHFHAEYGYKHDFVGVVKALFG  324



>ref|XP_006365922.1| PREDICTED: probable aquaporin PIP1-2-like [Solanum tuberosum]
Length=327

 Score =   388 bits (997),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 233/326 (71%), Positives = 271/326 (83%), Gaps = 11/326 (3%)
 Frame = -1

Query  1102  FGDEESHPHQNGGSNRVEDVSSTPTISNGNGNGTHQWTGEKIPSSHLTLAQKLGLMDFLS  923
             FGDEES    + G+N+V+  SSTP  S  +  G       K P+  L+ +++LG+ DF S
Sbjct  9     FGDEESQ--LSCGTNKVQPCSSTPKKSTIDDEG-------KKPN-FLSFSERLGVPDFFS  58

Query  922   LDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVSG  743
             LDVWRASMGE+ GTAVLVFMLD IVIST ES+ KMPNLI+SIL A++IT+LLLAV PVSG
Sbjct  59    LDVWRASMGELLGTAVLVFMLDTIVISTLESDTKMPNLILSILAAVIITILLLAVVPVSG  118

Query  742   GHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTVT  563
             GHINP ++FSAALVGIISMSRA+IY++AQCVGA+LGALALKAVVSS+IE TFSLGGCTVT
Sbjct  119   GHINPVISFSAALVGIISMSRAIIYIMAQCVGAILGALALKAVVSSTIEGTFSLGGCTVT  178

Query  562   VVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivl  383
             V+APGPNGPVTVGL+T QA WLE+FC+FVFLFASIWMAYD+RQAK LGHV V ++VG+VL
Sbjct  179   VIAPGPNGPVTVGLETAQALWLEIFCTFVFLFASIWMAYDHRQAKALGHVTVLSIVGVVL  238

Query  382   gllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTK  203
             GLLVFISTT+T KKGYAGAG+NPARC G A+VRGGHLWDGHWIFWVGP I CVAFY+YTK
Sbjct  239   GLLVFISTTVTAKKGYAGAGINPARCFGPAIVRGGHLWDGHWIFWVGPTIGCVAFYVYTK  298

Query  202   IIPERHFHAS-GYPHDFFSTVKVGLG  128
             IIP +HF+A   Y HDF   VK   G
Sbjct  299   IIPTKHFNAEYEYKHDFVGVVKALFG  324



>ref|XP_009794067.1| PREDICTED: probable aquaporin TIP3-1 [Nicotiana sylvestris]
Length=313

 Score =   385 bits (988),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 230/328 (70%), Positives = 262/328 (80%), Gaps = 23/328 (7%)
 Frame = -1

Query  1123  AKYTRQGFGDEESHPHQNGGSNRVEDVSSTPTISNGNGNGTHQWTGEKIPSSHLTLAQKL  944
             A  TR    DEE+              SS P I   N              S LTL+Q+L
Sbjct  2     AATTRDALDDEETQ------------FSSIPKIDEENKK-----------KSPLTLSQRL  38

Query  943   GLMDFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlll  764
             GL DF S DVWRAS+GE+ GTAVLVFMLD IVIST ES+VKMPNLIMSIL AI IT+LLL
Sbjct  39    GLPDFFSPDVWRASVGELLGTAVLVFMLDTIVISTLESDVKMPNLIMSILAAITITILLL  98

Query  763   aVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFS  584
             AVFPVSGGH+NP ++ SAALVGIISMSRA+IY+VAQC+GA LGALALKAVVSSSIENTFS
Sbjct  99    AVFPVSGGHLNPVISCSAALVGIISMSRAIIYIVAQCIGATLGALALKAVVSSSIENTFS  158

Query  583   LGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvf  404
             LGGCT+TV++ GPNGP+TVG++T QAFWLE+FC+FVFLFAS+WMAYD+RQAK LG V + 
Sbjct  159   LGGCTLTVISSGPNGPITVGIETAQAFWLEIFCTFVFLFASVWMAYDHRQAKSLGLVTIM  218

Query  403   tvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACV  224
             +++G+VLGLLVFISTT+T KKGYAGAGMNPARC GAALVRGG+LWDGHWIFWVGP IAC 
Sbjct  219   SIIGLVLGLLVFISTTVTGKKGYAGAGMNPARCFGAALVRGGNLWDGHWIFWVGPAIACW  278

Query  223   AFYLYTKIIPERHFHASGYPHDFFSTVK  140
             AFYLYTKIIP +HFHA GY HDFF  +K
Sbjct  279   AFYLYTKIIPLQHFHADGYKHDFFGVIK  306



>ref|XP_006365920.1| PREDICTED: aquaporin PIP1-6-like isoform X1 [Solanum tuberosum]
Length=328

 Score =   384 bits (986),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 230/326 (71%), Positives = 271/326 (83%), Gaps = 10/326 (3%)
 Frame = -1

Query  1102  FGDEESHPHQNGGSNRVEDVSSTPTISNGNGNGTHQWTGEKIPSSHLTLAQKLGLMDFLS  923
             FGDEES    +GG+NRV+  SSTP              G+K   + L+L+Q+LG+ DF S
Sbjct  9     FGDEESQ--LSGGNNRVQPYSSTP-----KNRSIIDDEGKK--QNFLSLSQRLGVPDFFS  59

Query  922   LDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVSG  743
             LDVWRASMGE+ G+AVLVFM+D IVIST ES+ KM NLIMSILIAIV+T+LLLAV PVSG
Sbjct  60    LDVWRASMGELLGSAVLVFMVDTIVISTSESDTKMSNLIMSILIAIVLTILLLAVVPVSG  119

Query  742   GHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTVT  563
             GH+NP ++FSAALVGIISMSRA+IY+VAQC+GAVLGALALKAVVSS+I+ TFSLGGCT+T
Sbjct  120   GHLNPVISFSAALVGIISMSRAIIYIVAQCLGAVLGALALKAVVSSTIDETFSLGGCTIT  179

Query  562   VVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivl  383
             V+APGPNGPVT+GL+T QA WLE+FC+FV LFASIWMAYD+RQAK LG V V ++VG+VL
Sbjct  180   VIAPGPNGPVTLGLETAQALWLEIFCTFVLLFASIWMAYDHRQAKALGLVTVLSIVGLVL  239

Query  382   gllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTK  203
             GLLVFISTT+T K+GYAG GMNPARC+G A+VRGGHLWDGHWIFW+GP I+CVAFY+YTK
Sbjct  240   GLLVFISTTVTAKRGYAGVGMNPARCLGPAIVRGGHLWDGHWIFWIGPTISCVAFYVYTK  299

Query  202   IIPERHFHAS-GYPHDFFSTVKVGLG  128
             IIP +HFHA  GY HDF   VK   G
Sbjct  300   IIPPKHFHAEYGYKHDFVGVVKALFG  325



>ref|XP_010327422.1| PREDICTED: probable aquaporin TIP3-1 [Solanum lycopersicum]
Length=328

 Score =   384 bits (985),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 226/322 (70%), Positives = 270/322 (84%), Gaps = 10/322 (3%)
 Frame = -1

Query  1102  FGDEESHPHQNGGSNRVEDVSSTPTISNGNGNGTHQWTGEKIPSSHLTLAQKLGLMDFLS  923
              GDEES     G +NRV+  SSTP  +  +  G  Q        + L+L+Q+LG+ DF S
Sbjct  9     LGDEESQ-LSAGNTNRVQPYSSTPKKNTIDDEGKKQ--------NFLSLSQRLGVPDFFS  59

Query  922   LDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVSG  743
             LDVWRASMGE+ G+AVLVFM+D IVIST ES+ +MPNLIMSIL+AIV+ VLLLAV PVSG
Sbjct  60    LDVWRASMGELLGSAVLVFMVDTIVISTSESDAEMPNLIMSILLAIVLIVLLLAVVPVSG  119

Query  742   GHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTVT  563
             GH+NP ++FSAALVGIISMSRA+IY++AQC+GAVLGALALKAVVSS+IE+TFSLGGCT+T
Sbjct  120   GHLNPVISFSAALVGIISMSRAIIYIMAQCLGAVLGALALKAVVSSTIEDTFSLGGCTIT  179

Query  562   VVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivl  383
             ++APGPNGPVT+GL+T QA WLE+FC+FV LFASIWMAYD+RQAK LG V V T+VG+VL
Sbjct  180   IIAPGPNGPVTLGLETAQALWLEIFCTFVLLFASIWMAYDHRQAKALGLVTVLTIVGLVL  239

Query  382   gllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTK  203
             GLLVFISTT+TTK+GYAG GMNPARC+G A+VRGGHLWDGHWIFW+GP I+C+AFY+YTK
Sbjct  240   GLLVFISTTVTTKRGYAGVGMNPARCLGPAIVRGGHLWDGHWIFWIGPTISCLAFYVYTK  299

Query  202   IIPERHFHAS-GYPHDFFSTVK  140
             IIP +HFHA  GY HDF   VK
Sbjct  300   IIPPKHFHAEYGYKHDFVGVVK  321



>ref|XP_009602731.1| PREDICTED: aquaporin-like isoform X1 [Nicotiana tomentosiformis]
Length=313

 Score =   383 bits (983),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 234/332 (70%), Positives = 264/332 (80%), Gaps = 23/332 (7%)
 Frame = -1

Query  1123  AKYTRQGFGDEESHPHQNGGSNRVEDVSSTPTISNGNGNGTHQWTGEKIPSSHLTLAQKL  944
             A  TR   GDEE+              SS P I   N         +K P   LTL+Q+L
Sbjct  2     AATTRDALGDEETQ------------FSSIPKIDEENK--------KKAP---LTLSQRL  38

Query  943   GLMDFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlll  764
             GL DF+S DVWRAS+GE+ GTAVLVFMLD IVIST ES+VKMPNLIMSIL AI IT+LLL
Sbjct  39    GLPDFVSPDVWRASVGELLGTAVLVFMLDNIVISTLESDVKMPNLIMSILAAITITILLL  98

Query  763   aVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFS  584
             AVFPVSGGH+NP ++ SA LVGIISMSRA+IY+VAQC+GA LGALALKAVVSSSIE TFS
Sbjct  99    AVFPVSGGHLNPVISCSATLVGIISMSRAIIYIVAQCIGAALGALALKAVVSSSIEQTFS  158

Query  583   LGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvf  404
             LGGCT+TV+ PGPNGP+TVGL+T QAFWLE+FC+FVFLFAS+WMAYD+RQAK LG V V 
Sbjct  159   LGGCTLTVILPGPNGPITVGLETAQAFWLEIFCTFVFLFASVWMAYDHRQAKSLGLVTVM  218

Query  403   tvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACV  224
             ++VG+VLGLLVFISTT+T KKGYAGAGMNPARC GAALVRGGHLW+GHWIFWVGP IAC 
Sbjct  219   SIVGLVLGLLVFISTTVTGKKGYAGAGMNPARCFGAALVRGGHLWNGHWIFWVGPAIACW  278

Query  223   AFYLYTKIIPERHFHASGYPHDFFSTVKVGLG  128
             AFYLYTKIIP +HFHA GY HDF   +K   G
Sbjct  279   AFYLYTKIIPPQHFHADGYKHDFVGVIKALFG  310



>ref|XP_009602732.1| PREDICTED: aquaporin-like isoform X2 [Nicotiana tomentosiformis]
Length=308

 Score =   376 bits (965),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 221/286 (77%), Positives = 250/286 (87%), Gaps = 0/286 (0%)
 Frame = -1

Query  985  EKIPSSHLTLAQKLGLMDFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLI  806
            E    + LTL+Q+LGL DF+S DVWRAS+GE+ GTAVLVFMLD IVIST ES+VKMPNLI
Sbjct  20   ENKKKAPLTLSQRLGLPDFVSPDVWRASVGELLGTAVLVFMLDNIVISTLESDVKMPNLI  79

Query  805  MSiliaivitvlllaVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgala  626
            MSIL AI IT+LLLAVFPVSGGH+NP ++ SA LVGIISMSRA+IY+VAQC+GA LGALA
Sbjct  80   MSILAAITITILLLAVFPVSGGHLNPVISCSATLVGIISMSRAIIYIVAQCIGAALGALA  139

Query  625  lkavvssSIENTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAY  446
            LKAVVSSSIE TFSLGGCT+TV+ PGPNGP+TVGL+T QAFWLE+FC+FVFLFAS+WMAY
Sbjct  140  LKAVVSSSIEQTFSLGGCTLTVILPGPNGPITVGLETAQAFWLEIFCTFVFLFASVWMAY  199

Query  445  DYRQAKVLGHVKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWD  266
            D+RQAK LG V V ++VG+VLGLLVFISTT+T KKGYAGAGMNPARC GAALVRGGHLW+
Sbjct  200  DHRQAKSLGLVTVMSIVGLVLGLLVFISTTVTGKKGYAGAGMNPARCFGAALVRGGHLWN  259

Query  265  GHWIFWVGPLIACVAFYLYTKIIPERHFHASGYPHDFFSTVKVGLG  128
            GHWIFWVGP IAC AFYLYTKIIP +HFHA GY HDF   +K   G
Sbjct  260  GHWIFWVGPAIACWAFYLYTKIIPPQHFHADGYKHDFVGVIKALFG  305



>ref|XP_010327420.1| PREDICTED: probable aquaporin TIP3-2 isoform X1 [Solanum lycopersicum]
Length=326

 Score =   374 bits (961),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 226/322 (70%), Positives = 266/322 (83%), Gaps = 10/322 (3%)
 Frame = -1

Query  1102  FGDEESHPHQNGGSNRVEDVSSTPTISNGNGNGTHQWTGEKIPSSHLTLAQKLGLMDFLS  923
             FGDEE+     GG+N+V+  SST    N     T    G+K     L+ +++LG+ DF  
Sbjct  9     FGDEENQ--LPGGTNKVQPCSSTSRNRN-----TIDDEGKK--PIFLSFSERLGVPDFFC  59

Query  922   LDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVSG  743
             LDVWRASMGE+ G+AVLVFMLD IVIST ES+ KMPNLIMSILIAIVIT+LLLAV PVSG
Sbjct  60    LDVWRASMGELLGSAVLVFMLDTIVISTLESDTKMPNLIMSILIAIVITILLLAVVPVSG  119

Query  742   GHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTVT  563
             GHINP ++FSAALVGIISMSRA+IY++AQCVGA+LGALAL+AVVSSSIE+TFSLGGCT+T
Sbjct  120   GHINPIISFSAALVGIISMSRAIIYIMAQCVGAILGALALRAVVSSSIEDTFSLGGCTIT  179

Query  562   VVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivl  383
             ++APGPNGPV VGL+  QA WLE+FC+FVFLFASIWMAYD+RQAK LGHV V ++VG+VL
Sbjct  180   IIAPGPNGPVIVGLEMAQALWLEIFCTFVFLFASIWMAYDHRQAKSLGHVTVLSIVGVVL  239

Query  382   gllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTK  203
             GLLVFISTT+T +KGY GAGMNPARC+G A++RGGHLWDGHWIFWVGP I CVAFY+YTK
Sbjct  240   GLLVFISTTVTARKGYGGAGMNPARCLGPAIIRGGHLWDGHWIFWVGPTIGCVAFYVYTK  299

Query  202   IIPERHFHAS-GYPHDFFSTVK  140
             IIP +HF    G+ HDF   VK
Sbjct  300   IIPPKHFLGEYGFKHDFVGVVK  321



>ref|XP_009799353.1| PREDICTED: probable aquaporin TIP3-1 [Nicotiana sylvestris]
Length=327

 Score =   374 bits (960),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 214/322 (66%), Positives = 258/322 (80%), Gaps = 9/322 (3%)
 Frame = -1

Query  1102  FGDEESHPHQNGGSNRVEDVSSTPTISNGNGNGTHQWTGEKIPSSHLTLAQKLGLMDFLS  923
              GDEES     G SN+++ ++ST                EK   + LT+A++LGL DF S
Sbjct  9     LGDEESQSISFGSSNKIQPITSTQK---------QVLDDEKKRYTSLTMAERLGLPDFFS  59

Query  922   LDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVSG  743
             LDVWRAS+GE+ G+AVLVFMLD IVIST ES+VKMPNLIMSILIAI +T+L+LAVFPVSG
Sbjct  60    LDVWRASVGELLGSAVLVFMLDTIVISTLESDVKMPNLIMSILIAITLTILILAVFPVSG  119

Query  742   GHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTVT  563
             GHI+P ++FS+ALVG+ISMSRA+IY+ AQC GA+LGALALKAVVSS+IE  FSLGGCT+T
Sbjct  120   GHISPVISFSSALVGLISMSRAIIYISAQCFGAILGALALKAVVSSTIEQRFSLGGCTIT  179

Query  562   VVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivl  383
             V+ PG NGPVTVGL+  QAFWLE  C+F  LF S+WMAYD+RQ+K LG + V ++VG++ 
Sbjct  180   VITPGTNGPVTVGLEIAQAFWLEFVCTFALLFGSLWMAYDHRQSKKLGLITVMSIVGLLA  239

Query  382   gllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTK  203
             GLLVFISTT+T KKGYAGAGMNPARC GAA+VRGGHLW+GHWIFWVGP +AC AFY YTK
Sbjct  240   GLLVFISTTVTAKKGYAGAGMNPARCFGAAIVRGGHLWNGHWIFWVGPGLACFAFYFYTK  299

Query  202   IIPERHFHASGYPHDFFSTVKV  137
             IIP  HFHA GY HDF + ++V
Sbjct  300   IIPPNHFHADGYKHDFLAIIEV  321



>ref|XP_004248667.1| PREDICTED: probable aquaporin TIP3-2 isoform X2 [Solanum lycopersicum]
Length=325

 Score =   374 bits (959),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 223/322 (69%), Positives = 264/322 (82%), Gaps = 11/322 (3%)
 Frame = -1

Query  1102  FGDEESHPHQNGGSNRVEDVSSTPTISNGNGNGTHQWTGEKIPSSHLTLAQKLGLMDFLS  923
             FGDEE+     GG+N+V+  SST   +  +  G             L+ +++LG+ DF  
Sbjct  9     FGDEENQ--LPGGTNKVQPCSSTSRKNTIDDEGKKP--------IFLSFSERLGVPDFFC  58

Query  922   LDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVSG  743
             LDVWRASMGE+ G+AVLVFMLD IVIST ES+ KMPNLIMSILIAIVIT+LLLAV PVSG
Sbjct  59    LDVWRASMGELLGSAVLVFMLDTIVISTLESDTKMPNLIMSILIAIVITILLLAVVPVSG  118

Query  742   GHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTVT  563
             GHINP ++FSAALVGIISMSRA+IY++AQCVGA+LGALAL+AVVSSSIE+TFSLGGCT+T
Sbjct  119   GHINPIISFSAALVGIISMSRAIIYIMAQCVGAILGALALRAVVSSSIEDTFSLGGCTIT  178

Query  562   VVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivl  383
             ++APGPNGPV VGL+  QA WLE+FC+FVFLFASIWMAYD+RQAK LGHV V ++VG+VL
Sbjct  179   IIAPGPNGPVIVGLEMAQALWLEIFCTFVFLFASIWMAYDHRQAKSLGHVTVLSIVGVVL  238

Query  382   gllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTK  203
             GLLVFISTT+T +KGY GAGMNPARC+G A++RGGHLWDGHWIFWVGP I CVAFY+YTK
Sbjct  239   GLLVFISTTVTARKGYGGAGMNPARCLGPAIIRGGHLWDGHWIFWVGPTIGCVAFYVYTK  298

Query  202   IIPERHFHAS-GYPHDFFSTVK  140
             IIP +HF    G+ HDF   VK
Sbjct  299   IIPPKHFLGEYGFKHDFVGVVK  320



>ref|XP_011092871.1| PREDICTED: aquaporin AQPcic-like [Sesamum indicum]
Length=355

 Score =   375 bits (962),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 219/362 (60%), Positives = 281/362 (78%), Gaps = 11/362 (3%)
 Frame = -1

Query  1198  YIGFSKKKKKYRIQGL-FKLRYQNMAAKYTRQGFGDEESHPHQNGGSNRVEDVSSTPTIS  1022
             Y+G  ++  K  +     K   ++MA+  + Q     +    Q  G+ +++ + STP   
Sbjct  2     YMGRQQRNAKSEVISFKNKKLIESMASNSSGQQLHAVDDEESQTVGT-KIQPLPSTPP--  58

Query  1021  NGNGNGTHQWTGEKIPSSHL--TLAQKLGLMDFLSLDVWRASMGEVFGTAVLVFMLDAIV  848
                   T  WT ++     L  TL   LGL +FL+LDV+RAS+GE+ GTAVLVFMLD IV
Sbjct  59    -----RTKNWTVDQENKGQLSPTLTDVLGLDEFLTLDVYRASVGELLGTAVLVFMLDTIV  113

Query  847   ISTYESEVKMPNLIMSiliaivitvlllaVFPVSGGHINPTVTFSAALVGIISMSRAVIY  668
             IST+ES++KMPNL++S+L A++IT+LLLAV PVSGGHINP ++FSAALVG+ISMSRA++Y
Sbjct  114   ISTFESDIKMPNLVLSVLAAVIITILLLAVHPVSGGHINPIISFSAALVGLISMSRALVY  173

Query  667   MVAQCvgavlgalalkavvssSIENTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVF  488
             +VAQC GA+LGALALKAVVSS+IE  FSLGGCT+TVVAPGP+GP+ +GL+T QAFWLE+ 
Sbjct  174   IVAQCAGAILGALALKAVVSSAIEQNFSLGGCTITVVAPGPDGPIMIGLETAQAFWLEII  233

Query  487   CSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivlgllvfISTTLTTKKGYAGAGMNPAR  308
             CSF+FLFASIWMAYD+RQAK LGHV VF++VG+VLGLLVF+S+T+T +KGY GAGMNPAR
Sbjct  234   CSFIFLFASIWMAYDHRQAKQLGHVLVFSIVGVVLGLLVFVSSTVTAQKGYVGAGMNPAR  293

Query  307   CVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTKIIPERHFHASGYPHDFFSTVKVGLG  128
             C+G A+VRGGHLWDGHW+FW GP IACVAFYLYTKIIP +H  +  Y HDF++ VKV  G
Sbjct  294   CIGPAIVRGGHLWDGHWVFWAGPAIACVAFYLYTKIIPRQHHRSKAYDHDFYNVVKVMFG  353

Query  127   IR  122
             ++
Sbjct  354   VK  355



>gb|AHC32017.1| aquaporin protein 23 [Camellia sinensis]
Length=326

 Score =   371 bits (953),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 217/323 (67%), Positives = 262/323 (81%), Gaps = 14/323 (4%)
 Frame = -1

Query  1105  GFGDEESHPHQNGGSNRVEDVSSTPTISNGNGNGTHQWTGEK-IPSSHLTLAQKLGLMDF  929
             G  DEESH     G +R++ +SSTP         + QW  E+    +  TL ++LG  D 
Sbjct  7     GLEDEESH-----GGSRIQPLSSTPM--------SEQWRIEEGKQQTCTTLGERLGFKDL  53

Query  928   LSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPV  749
              SL+VWRASMGE+ GT+VLVFMLD IVISTYE E K PNLIMSILIA+ IT+LLLAVFPV
Sbjct  54    FSLNVWRASMGELLGTSVLVFMLDTIVISTYEIETKTPNLIMSILIALTITILLLAVFPV  113

Query  748   SGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCT  569
             SGGH+NP ++FSAALVGIIS+SRA IY+VAQC+GA+LGALAL+AVV+S+IE TFSLGGCT
Sbjct  114   SGGHMNPIISFSAALVGIISISRAAIYIVAQCLGAILGALALQAVVNSTIEQTFSLGGCT  173

Query  568   VTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgi  389
             +TV+APGP GP+T GL+T QA WLE+ CSFVFLFAS+W+A+D RQAK LGHV V T++G+
Sbjct  174   LTVIAPGPQGPITTGLETGQALWLEIICSFVFLFASVWIAFDGRQAKALGHVIVCTIIGL  233

Query  388   vlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLY  209
             VLGLLVF+STT+T  KGYAGAGMNPARC+G A+VRGGHLW+GHW+FW GP IAC AFYLY
Sbjct  234   VLGLLVFVSTTVTATKGYAGAGMNPARCLGPAVVRGGHLWNGHWVFWAGPAIACGAFYLY  293

Query  208   TKIIPERHFHASGYPHDFFSTVK  140
             T+IIP +HFHA+GY HDF +  K
Sbjct  294   TRIIPHQHFHATGYKHDFLNMFK  316



>ref|XP_009589922.1| PREDICTED: aquaporin-like [Nicotiana tomentosiformis]
Length=327

 Score =   370 bits (949),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 213/321 (66%), Positives = 255/321 (79%), Gaps = 9/321 (3%)
 Frame = -1

Query  1102  FGDEESHPHQNGGSNRVEDVSSTPTISNGNGNGTHQWTGEKIPSSHLTLAQKLGLMDFLS  923
              GDEES       SN+++     P IS    N       EK   + LTLA++LGL DF S
Sbjct  9     LGDEESQNISFASSNKIQ-----PFISTQKYN----LDDEKKKYTSLTLAERLGLPDFFS  59

Query  922   LDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVSG  743
             LDVWRAS+GE+ G+AVLVFMLD IVIST ES+VKMPNLIMS LIAI +T+L+LAVFPVSG
Sbjct  60    LDVWRASVGELLGSAVLVFMLDTIVISTLESDVKMPNLIMSFLIAITLTILILAVFPVSG  119

Query  742   GHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTVT  563
             GHI+P ++FS+ALVG+ISMSRA+IY+ AQC+GA+LGALALKAVVSS+IE  FSLGGCT+T
Sbjct  120   GHISPVISFSSALVGLISMSRAIIYITAQCLGAILGALALKAVVSSTIEQRFSLGGCTIT  179

Query  562   VVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivl  383
             V+ PG NGP TVGL+  QAFWLE  C+F  LF S+WMAYD+RQ+K LG + V ++VG++ 
Sbjct  180   VITPGTNGPATVGLEIAQAFWLEFLCTFALLFGSLWMAYDHRQSKKLGLISVMSIVGLLA  239

Query  382   gllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTK  203
             GLLVFISTT+T KKGYAGAGMNPARC GAA+VRGGHLW+GHWIFWVGP +AC AFY YTK
Sbjct  240   GLLVFISTTVTAKKGYAGAGMNPARCFGAAIVRGGHLWNGHWIFWVGPGLACFAFYFYTK  299

Query  202   IIPERHFHASGYPHDFFSTVK  140
             IIP  HFHA GY HDF + ++
Sbjct  300   IIPRNHFHADGYKHDFLAIIE  320



>emb|CDO96960.1| unnamed protein product [Coffea canephora]
Length=326

 Score =   369 bits (947),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 212/319 (66%), Positives = 263/319 (82%), Gaps = 12/319 (4%)
 Frame = -1

Query  1096  DEESHPHQNGGSNRVEDVSSTPTISNGNGNGTHQWTGEKIPSSHLTLAQKLGLMDFLSLD  917
             +EESH       NR++ +S  P  +        QWT ++   S  +L+++LGL +FLSL+
Sbjct  13    EEESH----AAGNRIQPMSIAPAPA--------QWTADEKKQSSFSLSERLGLDEFLSLN  60

Query  916   VWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVSGGH  737
             VWRAS+GE+ G+AVLVFM+D IVIST E++VKMPNLI+SIL+AI+I +LLLAV PVSGGH
Sbjct  61    VWRASVGELLGSAVLVFMIDTIVISTIETDVKMPNLILSILVAIIIAILLLAVHPVSGGH  120

Query  736   INPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTVTVV  557
             INP ++FSAALVG+ISMSRA+IY++AQC G VLGALALKAVVSS+IE TFSLGGCT+TV+
Sbjct  121   INPIISFSAALVGLISMSRAIIYIIAQCAGGVLGALALKAVVSSNIERTFSLGGCTLTVI  180

Query  556   APGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivlgl  377
             APGP GPVT+GL+T QAFWLEVFCSFVFLFAS+WMAYD+RQ   +G + VF+++GIVLGL
Sbjct  181   APGPQGPVTIGLETAQAFWLEVFCSFVFLFASVWMAYDHRQRNSIGLIPVFSIIGIVLGL  240

Query  376   lvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTKII  197
             LVF+STT+T  KGYAGAGMNPARC GAA+VRGGHLW+ HWIFW GP +AC AFY+YT+II
Sbjct  241   LVFVSTTVTATKGYAGAGMNPARCFGAAVVRGGHLWEEHWIFWAGPAVACFAFYVYTRII  300

Query  196   PERHFHASGYPHDFFSTVK  140
             P  HFHA G+ HDFF  ++
Sbjct  301   PNNHFHAEGFKHDFFGILR  319



>emb|CDP15672.1| unnamed protein product [Coffea canephora]
Length=327

 Score =   362 bits (929),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 214/331 (65%), Positives = 262/331 (79%), Gaps = 12/331 (4%)
 Frame = -1

Query  1129  MAAKYTRQGFGDEESHPHQNGGSNRVEDVSSTPTISNGNGNGTHQWTGEKIPSSHLTLAQ  950
             MAA         EE   +    SN ++ VSSTP         + QWT E+      +L++
Sbjct  1     MAANSGNVYLSMEEERRY---ASNSIQPVSSTPQ--------SEQWTPEQKKLESFSLSE  49

Query  949   KLGLMDFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvl  770
             +LGL +FLSL VWRAS+GE+FGTAVLVF++D IVIST +S+VKMPNLIMSI++AI+IT++
Sbjct  50    RLGLDEFLSLHVWRASVGELFGTAVLVFLIDTIVISTLDSDVKMPNLIMSIVLAIMITIV  109

Query  769   llaVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENT  590
             LLAV PVSGGHINP V+FSAALVG+ISMSRA+IY++AQC+GAVLGALALKAVVS +IE T
Sbjct  110   LLAVHPVSGGHINPIVSFSAALVGLISMSRAIIYIIAQCLGAVLGALALKAVVSGNIERT  169

Query  589   FSLGGCTVTVVAPGPNG-PVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHV  413
             FSLGGCT+++V PGP G PVT+GL T QAFWLEVFCSFVFLFAS+WMAYD+RQ   +G V
Sbjct  170   FSLGGCTLSIVTPGPQGSPVTIGLGTAQAFWLEVFCSFVFLFASLWMAYDHRQKNSIGLV  229

Query  412   KvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLI  233
             +V  +VG VLGLLVFIST++T  KGY GAG+NPARC G A+VRGGHLWDGHW+FW GP +
Sbjct  230   RVLAIVGTVLGLLVFISTSVTAAKGYGGAGINPARCFGPAVVRGGHLWDGHWVFWAGPAV  289

Query  232   ACVAFYLYTKIIPERHFHASGYPHDFFSTVK  140
             ACVAFY+YT+IIP  HFHA  + HDFF  ++
Sbjct  290   ACVAFYVYTQIIPNDHFHAQEFKHDFFGILR  320



>gb|EYU40406.1| hypothetical protein MIMGU_mgv1a009528mg [Erythranthe guttata]
Length=339

 Score =   362 bits (929),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 217/323 (67%), Positives = 262/323 (81%), Gaps = 15/323 (5%)
 Frame = -1

Query  1096  DEESHPHQNGGSNRVEDVSSTPTISNGNGNGTHQWT---GEKIPSSHLTLAQKLGLMDFL  926
             DEES   Q  G ++++  +STP        G   W     +K      T++  LGL D  
Sbjct  19    DEES---QISGRSKIQP-ASTP--------GQENWVVDPDQKKQQLPPTISDILGLDDLF  66

Query  925   SLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVS  746
             SL+VWRAS+GE+ GTAVLVFMLD IVIST ES++KMPNL++S L AI+IT+LLLAV PVS
Sbjct  67    SLEVWRASVGELLGTAVLVFMLDTIVISTIESDIKMPNLVLSALAAIIITILLLAVHPVS  126

Query  745   GGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTV  566
             GGHINP ++FSAALVGIIS+S+A+IY+VAQC+GA LGALALKAVVSS+IE +FSLGGCT+
Sbjct  127   GGHINPIISFSAALVGIISLSKALIYIVAQCIGATLGALALKAVVSSTIEQSFSLGGCTL  186

Query  565   TVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgiv  386
             TVV  GPNGPV +G+ T QAFWLE+FCSF+FLFASIWMAYD+RQAK LGHV VF++VG+V
Sbjct  187   TVVTAGPNGPVEIGIGTAQAFWLEIFCSFIFLFASIWMAYDHRQAKELGHVLVFSIVGVV  246

Query  385   lgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYT  206
             LGLLVF+STT+TT+KGYAGAGMNPARC+GAA+VRGGHLW+GHW+FW GP IACVAFYLYT
Sbjct  247   LGLLVFVSTTVTTQKGYAGAGMNPARCLGAAIVRGGHLWEGHWVFWAGPGIACVAFYLYT  306

Query  205   KIIPERHFHASGYPHDFFSTVKV  137
             KIIP  H  +  Y HDF++ VKV
Sbjct  307   KIIPRNHHRSKAYDHDFYNIVKV  329



>ref|XP_004231447.1| PREDICTED: aquaporin-like [Solanum lycopersicum]
Length=328

 Score =   361 bits (926),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 214/329 (65%), Positives = 258/329 (78%), Gaps = 23/329 (7%)
 Frame = -1

Query  1102  FGDEESHPHQNGGSNRVEDVSSTPTISNGNGNGTHQWTGEKIPSSH--------LTLAQK  947
              GDEES     G SN+++     PTIS          T +++PSS         LT+A++
Sbjct  9     LGDEESQ-LSFGSSNKIQ-----PTIS---------ITQKQVPSSDDEKKKYTCLTMAER  53

Query  946   LGLMDFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvll  767
             LGL DF SLDVWRAS+GE+ G+AVLVFMLD +VIST ES+VKMPNLIMSILIAI +T+L+
Sbjct  54    LGLPDFFSLDVWRASVGELLGSAVLVFMLDTVVISTLESDVKMPNLIMSILIAITLTILI  113

Query  766   laVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTF  587
             LAVFPVSGGHI+P +TFS+ALVG+ISMSRA+IY+VAQCVGA+LGALALKAV+SS+IE  F
Sbjct  114   LAVFPVSGGHISPVITFSSALVGLISMSRAIIYIVAQCVGAILGALALKAVLSSTIEQRF  173

Query  586   SLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKv  407
             SLGGCTVTVV PG NGP  VGL+  QAFWLE  C+F  LF S+WMAYD+RQ+K LG + V
Sbjct  174   SLGGCTVTVVTPGLNGPEIVGLEIAQAFWLEFMCTFALLFGSLWMAYDHRQSKALGLITV  233

Query  406   ftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIAC  227
              ++VG++ G+LVFIST++T KKGYAGAGMNPARC GAA VRGGHLW+GHWIFWVGP +AC
Sbjct  234   MSIVGLLAGILVFISTSVTAKKGYAGAGMNPARCFGAAFVRGGHLWNGHWIFWVGPGLAC  293

Query  226   VAFYLYTKIIPERHFHASGYPHDFFSTVK  140
              AFY YTKIIP  HF   GY HDF + ++
Sbjct  294   FAFYFYTKIIPSDHFQTDGYKHDFLAIIE  322



>ref|XP_006359635.1| PREDICTED: aquaporin-4-like [Solanum tuberosum]
Length=328

 Score =   358 bits (919),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 210/321 (65%), Positives = 253/321 (79%), Gaps = 7/321 (2%)
 Frame = -1

Query  1102  FGDEESHPHQNGGSNRVEDVSSTPTISNGNGNGTHQWTGEKIPSSHLTLAQKLGLMDFLS  923
              GDEES     G SN+++     PTIS            EK   + LT+A++LGL DF S
Sbjct  9     LGDEESQ-LSFGSSNKIQ-----PTISFTQKQ-VSILDDEKKKYTCLTMAERLGLPDFFS  61

Query  922   LDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVSG  743
             LDVWRAS+GE+ G+AVLVFMLD IVIST ES+VKMPNLIMSILIAI +T+L+LAVFPVSG
Sbjct  62    LDVWRASVGELLGSAVLVFMLDTIVISTLESDVKMPNLIMSILIAITLTILILAVFPVSG  121

Query  742   GHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTVT  563
             GHI+P +TFS+ALVG+ISMSRA+IY+VAQC+GA+LGALALKAV+SS+IE  FSLGGCTVT
Sbjct  122   GHISPVITFSSALVGLISMSRAIIYIVAQCIGAILGALALKAVLSSTIEQRFSLGGCTVT  181

Query  562   VVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivl  383
             VV PG NGP  VGL+  QAFWLE  C+F  LF S+WMAYD+RQ+K LG + V ++VG++ 
Sbjct  182   VVTPGLNGPEIVGLEIAQAFWLEFMCTFALLFGSLWMAYDHRQSKALGLITVMSIVGLLA  241

Query  382   gllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTK  203
             G+LVFIST++T KKGYAGAGMNPARC GAA VRGGHLW+GHWIFWVGP +AC AFY Y K
Sbjct  242   GILVFISTSVTAKKGYAGAGMNPARCFGAAFVRGGHLWNGHWIFWVGPGLACFAFYFYIK  301

Query  202   IIPERHFHASGYPHDFFSTVK  140
             IIP  HF   GY +DF + ++
Sbjct  302   IIPSNHFQTDGYKYDFLAIIE  322



>ref|XP_010327386.1| PREDICTED: uncharacterized protein LOC101252534 isoform X1 [Solanum 
lycopersicum]
Length=295

 Score =   353 bits (906),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 211/274 (77%), Positives = 239/274 (87%), Gaps = 1/274 (0%)
 Frame = -1

Query  946  LGLMDFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvll  767
            LG+  F  LDVWRASMGE+ G+AVLVFMLD IVIST ES+ KMPNLIMSILIAIVIT+LL
Sbjct  19   LGVPGFFCLDVWRASMGELIGSAVLVFMLDTIVISTLESDTKMPNLIMSILIAIVITILL  78

Query  766  laVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTF  587
            LAV PVSGGHINP ++FSAALVGIISMSRA+IY++AQCVGA+LGALAL+AVVSSSIE+TF
Sbjct  79   LAVVPVSGGHINPIISFSAALVGIISMSRAIIYIMAQCVGAILGALALRAVVSSSIEDTF  138

Query  586  SLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKv  407
            SLGGCT+T++A GPNGPV VGL+  QA WLE+FC+FVFLFASIWMAYD+RQAK LG V V
Sbjct  139  SLGGCTITIIASGPNGPVIVGLEMAQALWLEIFCTFVFLFASIWMAYDHRQAKALGLVTV  198

Query  406  ftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIAC  227
             ++VG+VLGLLVFISTT+T K+GY GAGMNPARC+G ALVRGGHLWDGHWIFWVGP I C
Sbjct  199  LSIVGLVLGLLVFISTTITAKRGYGGAGMNPARCLGPALVRGGHLWDGHWIFWVGPTIGC  258

Query  226  VAFYLYTKIIPERHFHAS-GYPHDFFSTVKVGLG  128
            VAFY+YTKIIP  HF+A  GY HDF   VK   G
Sbjct  259  VAFYVYTKIIPAEHFNAEYGYKHDFVGVVKALFG  292



>ref|NP_001274700.1| uncharacterized protein LOC101252534 [Solanum lycopersicum]
 dbj|BAO18653.1| X-intrinsic protein 1;2 [Solanum lycopersicum]
Length=302

 Score =   353 bits (907),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 211/274 (77%), Positives = 239/274 (87%), Gaps = 1/274 (0%)
 Frame = -1

Query  946  LGLMDFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvll  767
            LG+  F  LDVWRASMGE+ G+AVLVFMLD IVIST ES+ KMPNLIMSILIAIVIT+LL
Sbjct  26   LGVPGFFCLDVWRASMGELIGSAVLVFMLDTIVISTLESDTKMPNLIMSILIAIVITILL  85

Query  766  laVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTF  587
            LAV PVSGGHINP ++FSAALVGIISMSRA+IY++AQCVGA+LGALAL+AVVSSSIE+TF
Sbjct  86   LAVVPVSGGHINPIISFSAALVGIISMSRAIIYIMAQCVGAILGALALRAVVSSSIEDTF  145

Query  586  SLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKv  407
            SLGGCT+T++A GPNGPV VGL+  QA WLE+FC+FVFLFASIWMAYD+RQAK LG V V
Sbjct  146  SLGGCTITIIASGPNGPVIVGLEMAQALWLEIFCTFVFLFASIWMAYDHRQAKALGLVTV  205

Query  406  ftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIAC  227
             ++VG+VLGLLVFISTT+T K+GY GAGMNPARC+G ALVRGGHLWDGHWIFWVGP I C
Sbjct  206  LSIVGLVLGLLVFISTTITAKRGYGGAGMNPARCLGPALVRGGHLWDGHWIFWVGPTIGC  265

Query  226  VAFYLYTKIIPERHFHAS-GYPHDFFSTVKVGLG  128
            VAFY+YTKIIP  HF+A  GY HDF   VK   G
Sbjct  266  VAFYVYTKIIPAEHFNAEYGYKHDFVGVVKALFG  299



>emb|CDO96962.1| unnamed protein product [Coffea canephora]
Length=326

 Score =   353 bits (905),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 208/325 (64%), Positives = 262/325 (81%), Gaps = 12/325 (4%)
 Frame = -1

Query  1096  DEESHPHQNGGSNRVEDVSSTPTISNGNGNGTHQWTGEKIPSSHLTLAQKLGLMDFLSLD  917
             +EES        NR++ +S+TP  +        QWT ++   +  +L+++LGL +FLSL+
Sbjct  13    EEESQ----AAGNRMQPMSTTPVPA--------QWTADEKKQTAFSLSERLGLDEFLSLN  60

Query  916   VWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVSGGH  737
             VWRA++GE+ GTAVLVFM D IVIST E++VKMPNLI+SIL+AI+I +LLLAV PVSGGH
Sbjct  61    VWRAALGELLGTAVLVFMFDTIVISTLETDVKMPNLILSILLAIIIAILLLAVDPVSGGH  120

Query  736   INPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTVTVV  557
             INP V+FSA L+G+ISMSRA+IY++AQC G VLGALALKAVVSS+IE TFSL GCT+TV+
Sbjct  121   INPIVSFSAGLIGLISMSRAIIYIIAQCAGGVLGALALKAVVSSNIERTFSLAGCTLTVI  180

Query  556   APGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivlgl  377
             APGP GPVT GL+  QAFWLE FCSFVFLFASIW+ +D+RQ   +G ++VF+++GIVLGL
Sbjct  181   APGPEGPVTKGLEAAQAFWLEAFCSFVFLFASIWILFDHRQRNSIGMIRVFSIIGIVLGL  240

Query  376   lvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTKII  197
             LVF+STT+T  KGYAGAGMNPARC GAA+VRGGHLW+GHWIFW GP +AC+AFY+YT II
Sbjct  241   LVFVSTTVTATKGYAGAGMNPARCFGAAVVRGGHLWEGHWIFWAGPAVACLAFYVYTLII  300

Query  196   PERHFHASGYPHDFFSTVKVGLGIR  122
             P+ HFHA GY HDFF  ++   G+ 
Sbjct  301   PDDHFHAEGYKHDFFGILRTISGLE  325



>ref|XP_010088679.1| putative aquaporin PIP1-4 [Morus notabilis]
 gb|EXB36846.1| putative aquaporin PIP1-4 [Morus notabilis]
Length=325

 Score =   338 bits (867),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 198/282 (70%), Positives = 236/282 (84%), Gaps = 0/282 (0%)
 Frame = -1

Query  985  EKIPSSHLTLAQKLGLMDFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLI  806
             K  S+  T  Q LGL +  SL+VWRAS+ E+ GTA+LVF LD IVIS+YE+    PNLI
Sbjct  41   RKKHSNPTTFCQLLGLDELFSLEVWRASLAELVGTAILVFALDTIVISSYETITSAPNLI  100

Query  805  MSiliaivitvlllaVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgala  626
            MSILIAI++ +LL+A  PVSGGHINP +T SAALVGIIS+SRA IY++AQCVGA+LGALA
Sbjct  101  MSILIAIIVAILLIATNPVSGGHINPVITLSAALVGIISLSRAAIYILAQCVGAILGALA  160

Query  625  lkavvssSIENTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAY  446
            LKAVV+S+IE TFSLGGCT+TV+APGPNGP  VG+ T Q  WLE+ C+FVFL+ASIW+A+
Sbjct  161  LKAVVNSTIEETFSLGGCTLTVIAPGPNGPSVVGIGTGQGLWLEILCTFVFLWASIWIAF  220

Query  445  DYRQAKVLGHVKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWD  266
            D+RQA+ LG V V ++VGIV+GLLVFISTT+T  KGYAG GMNPARC+GAALVRGGHLW 
Sbjct  221  DHRQAQALGKVVVLSIVGIVVGLLVFISTTVTAAKGYAGVGMNPARCLGAALVRGGHLWY  280

Query  265  GHWIFWVGPLIACVAFYLYTKIIPERHFHASGYPHDFFSTVK  140
            GHW+FWVGP IACVAFYLYTKIIP +H+HA GY HDFF+ VK
Sbjct  281  GHWVFWVGPTIACVAFYLYTKIIPRQHYHAEGYKHDFFNVVK  322



>ref|XP_010268700.1| PREDICTED: aquaporin-like [Nelumbo nucifera]
Length=306

 Score =   337 bits (863),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 183/275 (67%), Positives = 235/275 (85%), Gaps = 1/275 (0%)
 Frame = -1

Query  961  TLAQKLGLMDFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaiv  782
            TL+++ GL +  SL VW+AS+ E+ GTA+LVF LD +VIS+YE++ K PNL+MS  + + 
Sbjct  28   TLSERFGLEELFSLKVWQASVAELLGTAILVFALDTLVISSYETDTKTPNLVMSFFVFLS  87

Query  781  itvlllaVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssS  602
            +TVLLLA  P+SGGHINP +TFSAAL+G+IS+SRA +Y++AQCVG VLGALALKAVVS +
Sbjct  88   VTVLLLATSPISGGHINPVITFSAALIGLISLSRAAVYILAQCVGGVLGALALKAVVSGT  147

Query  601  IENTFSLGGCTVTVV-APGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKV  425
            I++TFSLGGCT+ V+ A GPNGP+T+GL+T QA WLE+ C+FVFLFASIW+A+D+RQAK 
Sbjct  148  IQHTFSLGGCTLNVIIAEGPNGPITMGLETSQALWLEIICTFVFLFASIWIAFDHRQAKA  207

Query  424  LGHVKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWV  245
            LG V V +++G V+GLLVF+STTLTTKKGY+G GMNPARC+G ALVRGGHLW+GHW+FW 
Sbjct  208  LGPVTVCSIIGAVVGLLVFVSTTLTTKKGYSGVGMNPARCIGPALVRGGHLWNGHWVFWA  267

Query  244  GPLIACVAFYLYTKIIPERHFHASGYPHDFFSTVK  140
            GP IACVAFYLYT+IIP +HFH +GY +D F+T+K
Sbjct  268  GPAIACVAFYLYTRIIPRQHFHTTGYKYDLFTTLK  302



>ref|XP_008236183.1| PREDICTED: aquaporin-like [Prunus mume]
Length=337

 Score =   335 bits (859),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 194/308 (63%), Positives = 245/308 (80%), Gaps = 9/308 (3%)
 Frame = -1

Query  1060  NRVEDVSSTPTISNGNGNGTHQWTGEK-IPSSHLTLAQKLGLMDFLSLDVWRASMGEVFG  884
             +RV  +SSTP         +  W  E+   SS  TL++KLGL +  SL VWRAS+ E+ G
Sbjct  25    DRVHPLSSTPL--------SEHWNVEEGKKSSPSTLSEKLGLHELFSLKVWRASLAELVG  76

Query  883   TAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVSGGHINPTVTFSAAL  704
             +AVLVF +D IVIS+YE++   PNL+M+ILI+I + +LLLA  P+SGGHINP VT SAA 
Sbjct  77    SAVLVFAIDTIVISSYETKTTTPNLVMAILISITVAILLLATNPISGGHINPVVTLSAAF  136

Query  703   VGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTVTVVAPGPNGPVTVG  524
             VG+IS+SRA +Y+++QC GA+LGALALKAVV+SSIE TFSLGGCT+TV+APGP+GP+ +G
Sbjct  137   VGLISLSRAAVYILSQCTGAILGALALKAVVNSSIEETFSLGGCTLTVIAPGPHGPIIMG  196

Query  523   LDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivlgllvfISTTLTTK  344
             ++T QA WLE+ C+FVFLFASIWMA+D+RQA  +G V VF++VG V GLLVFISTT+T  
Sbjct  197   IETTQALWLEIICTFVFLFASIWMAFDHRQAHAVGRVVVFSIVGTVAGLLVFISTTVTAV  256

Query  343   KGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTKIIPERHFHASGYP  164
             KGYAG GMNPARC+G AL+R GHLW+GHW+FWVGP+IACVAFYLYTKIIP +HFH  G+ 
Sbjct  257   KGYAGVGMNPARCLGPALIRRGHLWNGHWVFWVGPIIACVAFYLYTKIIPRQHFHMDGHT  316

Query  163   HDFFSTVK  140
             HD  + VK
Sbjct  317   HDTVNIVK  324



>ref|XP_007200872.1| hypothetical protein PRUPE_ppb013496mg [Prunus persica]
 gb|EMJ02071.1| hypothetical protein PRUPE_ppb013496mg [Prunus persica]
Length=314

 Score =   332 bits (852),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 193/308 (63%), Positives = 242/308 (79%), Gaps = 9/308 (3%)
 Frame = -1

Query  1060  NRVEDVSSTPTISNGNGNGTHQWTGEKIP-SSHLTLAQKLGLMDFLSLDVWRASMGEVFG  884
             +RV   SSTP         +  W  E++  SS  TL++KLGL +  SL VWRAS+ E+ G
Sbjct  11    DRVHPFSSTPM--------SEHWNVEEVKKSSPSTLSKKLGLHELFSLKVWRASLAELVG  62

Query  883   TAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVSGGHINPTVTFSAAL  704
             +AVLVF +D IVIS+YE+    PNL+M+ILI+I + +LLLA  P+SGGHINP VT SA  
Sbjct  63    SAVLVFAIDTIVISSYETRTTTPNLVMAILISITVAILLLATNPISGGHINPVVTLSAVF  122

Query  703   VGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTVTVVAPGPNGPVTVG  524
             VG+IS+SRA +Y+++QC GAVLGALALKAVV+SSIE TFSLGGCT+TV+APGP+GP+ +G
Sbjct  123   VGLISLSRAAVYILSQCAGAVLGALALKAVVNSSIEETFSLGGCTLTVIAPGPHGPIIIG  182

Query  523   LDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivlgllvfISTTLTTK  344
             ++T QA WLE+ C+FVFLFASIWMA+D+RQA  +G V VF++VG V+GLLVFISTT+T  
Sbjct  183   IETTQALWLEIICTFVFLFASIWMAFDHRQAHAVGRVVVFSIVGTVVGLLVFISTTVTAV  242

Query  343   KGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTKIIPERHFHASGYP  164
             KGYAG GMNPARC+G AL+RGGHLW+GHW+FWVGP+IACV FYLY KIIP +HFH  GY 
Sbjct  243   KGYAGVGMNPARCLGPALIRGGHLWNGHWVFWVGPIIACVTFYLYIKIIPRQHFHMDGYT  302

Query  163   HDFFSTVK  140
              D  + VK
Sbjct  303   QDTVNIVK  310



>ref|XP_010647342.1| PREDICTED: probable aquaporin TIP3-2 [Vitis vinifera]
Length=320

 Score =   332 bits (852),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 190/320 (59%), Positives = 246/320 (77%), Gaps = 12/320 (4%)
 Frame = -1

Query  1099  GDEESHPHQNGGSNRVEDVSSTPTISNGNGNGTHQWTGEKIPSSHLTLAQKLGLMDFLSL  920
             GDEE +PH NG   R++ V STP           QW  E+    + T+ ++LGL +  S 
Sbjct  9     GDEE-NPH-NG--IRIQPVLSTPM--------AEQWKSEEGKKMNTTMGERLGLNELFSP  56

Query  919   DVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVSGG  740
              VWRAS+ E+ GTA+LVF+LD IVIS+ +++ K PNLIMS+++AI I +LLLA  PVSGG
Sbjct  57    QVWRASLAELLGTALLVFLLDTIVISSIQTQTKTPNLIMSVVVAITIAILLLATIPVSGG  116

Query  739   HINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTVTV  560
             HINP +TFSAAL+G+IS SRA +Y +AQC+G VLGALALKAVV+++IE TFSLGGCT+++
Sbjct  117   HINPVITFSAALLGLISFSRAAVYFLAQCLGGVLGALALKAVVNNTIEETFSLGGCTLSI  176

Query  559   VAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivlg  380
             V PGP GP+T+GL+T Q  W+EV C+F+FLFAS+W+A+D RQAKV G V V +++G VLG
Sbjct  177   VEPGPKGPITIGLETGQGLWMEVICTFIFLFASVWIAFDERQAKVHGAVVVCSIIGTVLG  236

Query  379   llvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTKI  200
             LLVF+STT+T  KGYAGAGMNPARC+G AL+RGGHLWDGHW+FW GP IAC+AFYLY KI
Sbjct  237   LLVFVSTTVTATKGYAGAGMNPARCLGPALIRGGHLWDGHWVFWAGPAIACMAFYLYIKI  296

Query  199   IPERHFHASGYPHDFFSTVK  140
             IP+ HF    + HD  + ++
Sbjct  297   IPDHHFKGKEHKHDLLNILR  316



>ref|XP_009369012.1| PREDICTED: aquaporin-like [Pyrus x bretschneideri]
 ref|XP_009337927.1| PREDICTED: aquaporin-like [Pyrus x bretschneideri]
Length=314

 Score =   330 bits (845),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 191/308 (62%), Positives = 241/308 (78%), Gaps = 9/308 (3%)
 Frame = -1

Query  1060  NRVEDVSSTPTISNGNGNGTHQWTGEKIPS-SHLTLAQKLGLMDFLSLDVWRASMGEVFG  884
              RV   SS+P         +  W  E+    S  TL+QKLG  +  S  VWRAS+ E+ G
Sbjct  11    ERVHPFSSSPM--------SEHWNIEEAKKLSPFTLSQKLGFHELFSSKVWRASLAELVG  62

Query  883   TAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVSGGHINPTVTFSAAL  704
             +AVLVF +D IVIS+YE++  +PNLIM+ILI+I + +LLL   P+SGGHINP VT SAAL
Sbjct  63    SAVLVFAIDTIVISSYETQTTIPNLIMAILISITVAILLLVTNPISGGHINPVVTLSAAL  122

Query  703   VGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTVTVVAPGPNGPVTVG  524
             +G+IS+SRA +Y+++QCVGAVLGALALKAVV+++IE TFSLGGCT+TV+APGP+GP+ +G
Sbjct  123   LGLISLSRAAVYILSQCVGAVLGALALKAVVNNNIEGTFSLGGCTLTVIAPGPHGPIIMG  182

Query  523   LDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivlgllvfISTTLTTK  344
             ++T QA WLE+FC+FVFLFASIW+A+D+RQA  LG V VF+++GIV GLLVFISTT+TT 
Sbjct  183   IETTQALWLEIFCTFVFLFASIWIAFDHRQAHALGRVVVFSIIGIVAGLLVFISTTVTTA  242

Query  343   KGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTKIIPERHFHASGYP  164
             KGYAG GMNPARC G AL+RGG LW+GHW+FWVGP +ACVAFYLY KIIP  HFH  G+ 
Sbjct  243   KGYAGVGMNPARCFGPALIRGGRLWNGHWVFWVGPAVACVAFYLYIKIIPRHHFHMEGFK  302

Query  163   HDFFSTVK  140
             HD  + VK
Sbjct  303   HDTLNIVK  310



>ref|XP_010028684.1| PREDICTED: probable aquaporin TIP4-3 [Eucalyptus grandis]
 gb|KCW55468.1| hypothetical protein EUGRSUZ_I01369 [Eucalyptus grandis]
Length=321

 Score =   329 bits (844),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 199/321 (62%), Positives = 245/321 (76%), Gaps = 13/321 (4%)
 Frame = -1

Query  1099  GDEESHPHQNGGSNRVEDVSSTPTISNGNGNGTHQWTGEKIPSSHLTLAQKLGLMDFLSL  920
             GDEES        +RV+  S TP    GN   T    G   P+S   L++ LGL DF SL
Sbjct  9     GDEESVLS----GSRVQPFS-TPMEERGNVKDT----GRHKPTS---LSEILGLKDFFSL  56

Query  919   DVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVSGG  740
             +VWRAS+ E+ G AVLVF LD IVIS+YE++ K  NLIMS LIAI + +LLLA  PVSGG
Sbjct  57    EVWRASVAELLGMAVLVFALDTIVISSYETDTKTANLIMSFLIAITVAILLLATSPVSGG  116

Query  739   HINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTVTV  560
             H+NP +TF+AAL G+IS+SRA +Y++AQC GAVLGALAL+AVV+S IE TFSLGGCT+ V
Sbjct  117   HVNPVITFTAALTGLISLSRAAVYILAQCGGAVLGALALEAVVNSKIEQTFSLGGCTLNV  176

Query  559   VAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivlg  380
             VAPGP GPVT+GL  VQA WLE+ C+FVFLF SIW+A D+RQAK LG + +F+++G+V+G
Sbjct  177   VAPGPEGPVTIGLGLVQALWLEIICTFVFLFTSIWIAIDHRQAKALGRLIIFSIIGVVVG  236

Query  379   llvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTKI  200
             L+VFISTT+T  KGYAG GMNPARC+G ALVRGGHLW GHW+FWVGP IACV FYLY K+
Sbjct  237   LIVFISTTVTGTKGYAGVGMNPARCLGPALVRGGHLWSGHWVFWVGPAIACVGFYLYMKV  296

Query  199   IPERHF-HASGYPHDFFSTVK  140
             +P +HF HA GY +D  + +K
Sbjct  297   VPTKHFHHAEGYKYDVLNILK  317



>ref|XP_004292151.1| PREDICTED: probable aquaporin PIP1-4-like [Fragaria vesca subsp. 
vesca]
Length=318

 Score =   318 bits (814),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 185/290 (64%), Positives = 232/290 (80%), Gaps = 2/290 (1%)
 Frame = -1

Query  1003  THQWTGE--KIPSSHLTLAQKLGLMDFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYES  830
             +  W  E  K  S   +L++ LGL +     VWRAS+ E+ GTAVLVF +D IVIS+ E+
Sbjct  25    SEHWKTEEGKKSSRPSSLSEVLGLRELFCPQVWRASLAELVGTAVLVFAIDTIVISSIET  84

Query  829   EVKMPNLIMSiliaivitvlllaVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCv  650
                 PNL++SIL+AI++ +LL+A  PVSGGHINP +TFSAA VG+IS SRA +Y+  QCV
Sbjct  85    NTSSPNLLLSILVAIIVAILLIATNPVSGGHINPVITFSAATVGLISFSRAAVYIFMQCV  144

Query  649   gavlgalalkavvssSIENTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFL  470
             G VLGALALKAVV+SS+++TFSLGGCT+TVVAPGP GPVT+G++T QA WLEV C+F+FL
Sbjct  145   GGVLGALALKAVVNSSLQDTFSLGGCTLTVVAPGPQGPVTIGIETGQALWLEVICTFIFL  204

Query  469   FASIWMAYDYRQAKVLGHVKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAAL  290
             FASIW+A+D+RQA  +G V V ++VGIV+G+LVFIST++TT KGYAGAGMNPARC+G AL
Sbjct  205   FASIWIAFDHRQAHPMGKVMVLSIVGIVVGILVFISTSVTTVKGYAGAGMNPARCLGPAL  264

Query  289   VRGGHLWDGHWIFWVGPLIACVAFYLYTKIIPERHFHASGYPHDFFSTVK  140
             VRGGHLW GHW+FWVGP IAC+AFYLY K+IP +HFH  GY HD F  +K
Sbjct  265   VRGGHLWTGHWVFWVGPTIACLAFYLYVKLIPRQHFHVEGYKHDIFDYMK  314



>ref|XP_011046944.1| PREDICTED: aquaporin AQPAn.G-like [Populus euphratica]
Length=306

 Score =   314 bits (804),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 189/306 (62%), Positives = 235/306 (77%), Gaps = 12/306 (4%)
 Frame = -1

Query  1096  DEESHPHQNGGSNRVEDVSSTPTISNGNGNGTHQWTGEKIPSSHLTLAQKLGLMDFLSLD  917
             DEES        NR++  ++TP               E+  +  +TL + LGL D LSL 
Sbjct  10    DEESLYS----GNRIQPFATTPM--------AEALKNEEGKTKQITLREILGLEDLLSLT  57

Query  916   VWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVSGGH  737
             VWRAS+ E+ GTAVLVF LD IVIST ++   MPNLI+S L+AI+IT+LLLA FP+SGGH
Sbjct  58    VWRASVAELLGTAVLVFALDTIVISTIQTGTNMPNLILSTLVAIIITILLLATFPISGGH  117

Query  736   INPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTVTVV  557
             INP +TF+A L G+IS+S+  IY +AQCVGA+ GALALKAVV+S IE TFSLGGCT+T+V
Sbjct  118   INPIITFAAFLTGLISLSKTFIYTLAQCVGAIFGALALKAVVNSEIEKTFSLGGCTLTIV  177

Query  556   APGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivlgl  377
             APGP+GP  +GL+T QA WLE+ C FVFLFAS+WMA+D+RQA+ +G V VF +VGIVLGL
Sbjct  178   APGPHGPTVIGLETSQALWLEIICGFVFLFASVWMAFDHRQAEGIGRVSVFIIVGIVLGL  237

Query  376   lvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTKII  197
             LVF+STT+T  KGYAGAG+NPARC+G A+VRGGHLW+GHW+FWVGP IACVAF +YTKII
Sbjct  238   LVFVSTTVTATKGYAGAGLNPARCLGPAIVRGGHLWNGHWVFWVGPAIACVAFAVYTKII  297

Query  196   PERHFH  179
             P +  H
Sbjct  298   PRQLAH  303



>ref|XP_007041949.1| Aquaporin, MIP family, PIP subfamily [Theobroma cacao]
 gb|EOX97780.1| Aquaporin, MIP family, PIP subfamily [Theobroma cacao]
Length=342

 Score =   314 bits (804),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 190/307 (62%), Positives = 237/307 (77%), Gaps = 13/307 (4%)
 Frame = -1

Query  1096  DEESHPHQNGGSNRVEDVSSTPTISNGNGNGTHQWTGEKIPSSHLTLAQKLGLMDFLSLD  917
             DEES      G N+V+  +STPT          + T EK P + L+ ++ L L +  SL+
Sbjct  48    DEES----IYGRNKVQPFASTPT--------PGKVTEEKHPKASLS-SKVLSLEELFSLE  94

Query  916   VWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVSGGH  737
             VWRAS+ E+ GTAVLVF LD IVIST ++E K PNL+MS+LIA V+ VLLLA +P+SGGH
Sbjct  95    VWRASLAELLGTAVLVFSLDTIVISTLQTETKTPNLVMSVLIAFVVAVLLLATYPISGGH  154

Query  736   INPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTVTVV  557
             INP VTF+A L G++S+SRA I+++AQ VG +LGALALKAVVSS IE T+SLGGCTVT+V
Sbjct  155   INPIVTFAALLTGLVSISRAAIFILAQSVGGILGALALKAVVSSGIERTYSLGGCTVTIV  214

Query  556   APGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivlgl  377
             APGP+GP  +GL+T QA WLE+ CSFVFLFAS+WMA+D RQAK +G V V  ++GIVLGL
Sbjct  215   APGPHGPTVIGLETSQALWLEIICSFVFLFASVWMAFDRRQAKAVGRVMVCVILGIVLGL  274

Query  376   lvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTKII  197
             LV+ISTT+T  KGY+GAG+NPARC+G A+VRGGHLWD HWIFW+GP I CVAF LY K+I
Sbjct  275   LVYISTTVTATKGYSGAGLNPARCLGPAVVRGGHLWDKHWIFWIGPAIGCVAFALYVKMI  334

Query  196   PERHFHA  176
             P  H H+
Sbjct  335   PREHTHS  341



>ref|XP_011037252.1| PREDICTED: aquaporin AQPAn.G-like [Populus euphratica]
Length=308

 Score =   311 bits (798),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 189/311 (61%), Positives = 234/311 (75%), Gaps = 20/311 (6%)
 Frame = -1

Query  1096  DEES-----HPHQNGGSNRVEDVSSTPTISNGNGNGTHQWTGEKIPSSHLTLAQKLGLMD  932
             DEES     +PH +  +   E V         N  G  +   +K P    TL + LGL D
Sbjct  10    DEESLYSGKNPHPSATTPMAEVVQ--------NEGGIQK---KKSP----TLIEMLGLED  54

Query  931   FLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFP  752
               SL  WRAS+ E+ GTAVLVF LD IVIST +++ K PNLI+S L+AI++T+LLLA +P
Sbjct  55    LFSLTTWRASVAELLGTAVLVFALDTIVISTIQTQTKTPNLILSTLVAIIVTILLLATYP  114

Query  751   VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGC  572
             +SGGHINP VTF+A L G+IS+S+A IY++AQCVG ++GALALK VV+S IE TFSLGGC
Sbjct  115   ISGGHINPVVTFAALLTGLISISKAFIYILAQCVGGIVGALALKVVVNSEIEQTFSLGGC  174

Query  571   TVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvg  392
             T+TVVAPGP+GP  VGL+T QA WLE+ C FVFLFAS+WMA+D+RQAK LG V V  +VG
Sbjct  175   TLTVVAPGPDGPTVVGLETGQALWLEIICGFVFLFASVWMAFDHRQAKGLGRVNVLIIVG  234

Query  391   ivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYL  212
             IVLGLLV++STT+T  KGYAGAG+NPARC+G A+VRGGHLW+GHW+FWVGP IACVAF +
Sbjct  235   IVLGLLVYVSTTVTATKGYAGAGLNPARCLGPAIVRGGHLWNGHWVFWVGPAIACVAFAI  294

Query  211   YTKIIPERHFH  179
             YTK+IP    H
Sbjct  295   YTKVIPSHLSH  305



>ref|XP_011046910.1| PREDICTED: aquaporin AQPAn.G-like [Populus euphratica]
Length=306

 Score =   311 bits (798),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 181/295 (61%), Positives = 228/295 (77%), Gaps = 10/295 (3%)
 Frame = -1

Query  1066  GSNRVEDVSSTPTISNGNGNGTHQWTGEKIPSSHLTLAQKLGLMDFLSLDVWRASMGEVF  887
             G N+V+  +STP  S            E+       L++ LGL + +SL+VWRAS+ EVF
Sbjct  16    GGNKVQPFASTPRPSKT----------ERGKRDSSALSRILGLDELVSLNVWRASLAEVF  65

Query  886   GTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVSGGHINPTVTFSAA  707
             GTAVLVF +D IVIS+YE++ K PNLIM+ LIAI I +LLLA FP+SGGH+NP +T SA 
Sbjct  66    GTAVLVFAMDTIVISSYETQTKTPNLIMATLIAITIAILLLATFPISGGHMNPAITLSAM  125

Query  706   LVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTVTVVAPGPNGPVTV  527
               G+I+ SRA IY++AQC+GA+LGALALKAVV S+IE TFSLGGCT+ ++APGP+GPV +
Sbjct  126   FTGLITASRAAIYILAQCIGAILGALALKAVVKSTIEQTFSLGGCTLKIIAPGPSGPVAI  185

Query  526   GLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivlgllvfISTTLTT  347
             GL+T QA WLE+ C+FVFLF+SIW+A+D RQA  LG V   +++G+V+GLLVFISTT+T 
Sbjct  186   GLETGQALWLEIICTFVFLFSSIWIAFDRRQAIALGRVVFCSIIGLVVGLLVFISTTVTA  245

Query  346   KKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTKIIPERHF  182
              KGYAG GMNPARC+G ALVRGGHLW GHW+FWVGP++A VAF LYTKIIP  H 
Sbjct  246   TKGYAGVGMNPARCLGPALVRGGHLWKGHWVFWVGPVVASVAFSLYTKIIPREHL  300



>ref|XP_009350956.1| PREDICTED: aquaporin AQPAn.G-like [Pyrus x bretschneideri]
Length=308

 Score =   311 bits (798),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 190/311 (61%), Positives = 235/311 (76%), Gaps = 20/311 (6%)
 Frame = -1

Query  1096  DEES-----HPHQNGGSNRVEDVSSTPTISNGNGNGTHQWTGEKIPSSHLTLAQKLGLMD  932
             DEES     +PH +  +   E V         N  G  +   +K P    TL + LGL D
Sbjct  10    DEESLYSGKNPHPSATTPMAEVVQ--------NEGGIQK---KKSP----TLIEMLGLED  54

Query  931   FLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFP  752
               SL  WRAS+ E+ GTAVLVF LD IVIST +++ K PNLI+S L+AI++T+LLLA +P
Sbjct  55    LFSLTTWRASVAELLGTAVLVFALDTIVISTIQTQTKTPNLILSTLVAIIVTILLLATYP  114

Query  751   VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGC  572
             +SGGHINP VTF+A L G+IS+S+A IY++AQCVG ++GALALKAVV+S IE TFSLGGC
Sbjct  115   ISGGHINPVVTFAALLTGLISISKAFIYILAQCVGGIVGALALKAVVNSEIEQTFSLGGC  174

Query  571   TVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvg  392
             T+TVVAPGP+GP  VGL+T QA WLE+ C FVFLFAS+WMA+D+RQAK LG V V  +VG
Sbjct  175   TLTVVAPGPDGPTVVGLETGQALWLEIICGFVFLFASVWMAFDHRQAKGLGRVNVLIIVG  234

Query  391   ivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYL  212
             IVLGLLV++STT+T  KGYAGAG+NPARC+G A+VRGGHLW+GHW+FWVGP IACVAF +
Sbjct  235   IVLGLLVYVSTTVTATKGYAGAGLNPARCLGPAIVRGGHLWNGHWVFWVGPAIACVAFAI  294

Query  211   YTKIIPERHFH  179
             YTK+IP    H
Sbjct  295   YTKVIPSHLSH  305



>ref|XP_002306164.2| hypothetical protein POPTR_0004s17430g [Populus trichocarpa]
 gb|EEE86675.2| hypothetical protein POPTR_0004s17430g [Populus trichocarpa]
Length=309

 Score =   310 bits (795),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 178/261 (68%), Positives = 218/261 (84%), Gaps = 0/261 (0%)
 Frame = -1

Query  961  TLAQKLGLMDFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaiv  782
            TL + LGL D  SL  WRAS+ E+ GTAVLVF LD IVIST +++ K PNLI+S L+AI+
Sbjct  46   TLREILGLEDLFSLTTWRASVAELLGTAVLVFALDTIVISTIQTQTKTPNLILSTLVAII  105

Query  781  itvlllaVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssS  602
            +T+LLLA +P+SGGHINP VTF+A L G+IS+S+A IY++AQCVG ++GALALKAVV+S 
Sbjct  106  VTILLLATYPISGGHINPIVTFAALLTGLISISKAFIYILAQCVGGIVGALALKAVVNSE  165

Query  601  IENTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVL  422
            IE TFSLGGCT+TVVAPGP GP  VGL+T QA WLE+ C FVFLFAS+WMA+D+RQAK L
Sbjct  166  IERTFSLGGCTLTVVAPGPEGPTVVGLETGQALWLEIICGFVFLFASVWMAFDHRQAKGL  225

Query  421  GHVKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVG  242
            G V V  +VGIVLGLLV++STT+T  KGYAGAG+NPARC+G A+VRGGHLW+GHW+FWVG
Sbjct  226  GRVNVLIIVGIVLGLLVYVSTTVTATKGYAGAGLNPARCLGPAIVRGGHLWNGHWVFWVG  285

Query  241  PLIACVAFYLYTKIIPERHFH  179
            P IACVAF +YTK+IP +  H
Sbjct  286  PAIACVAFAIYTKVIPSQLSH  306



>ref|XP_011046933.1| PREDICTED: aquaporin AQPAn.G-like [Populus euphratica]
Length=306

 Score =   308 bits (790),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 193/318 (61%), Positives = 241/318 (76%), Gaps = 19/318 (6%)
 Frame = -1

Query  1123  AKYTRQGFGDEESHPHQNGGSNRVEDVSSTPT---ISNGNGNGTHQWTGEKIPSSHLTLA  953
             A YT    GDEE+      G+N++   ++TPT   + N  G    + T          L+
Sbjct  2     AGYTE---GDEENL----FGANKIHRFATTPTAEVVENEKGMKKQKST---------ILS  45

Query  952   QKLGLMDFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitv  773
             + LGL D +SL VWRAS+ E+ GTAVLVF LD IVIST   E K+PNLI+SIL AI+IT+
Sbjct  46    EILGLEDLVSLTVWRASVAELIGTAVLVFTLDTIVISTMRIETKIPNLILSILAAIIITI  105

Query  772   lllaVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIEN  593
             L+LA FP+SGGHINP VTF+A L G++S+SRA+IY++AQCVG + GALALKAVV+S I+ 
Sbjct  106   LVLATFPISGGHINPLVTFAALLTGLVSLSRAIIYVLAQCVGGIFGALALKAVVNSEIQK  165

Query  592   TFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHV  413
             TFSLGGCT+T+VAPGP+G   +GL+T QA WLE+ C FVFLFAS+WMA+D RQAK LG V
Sbjct  166   TFSLGGCTLTIVAPGPDGQTVIGLETSQALWLEIICGFVFLFASVWMAFDQRQAKALGRV  225

Query  412   KvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLI  233
              VF ++GIV+GLLV+ISTT+T  KGYAGAG+NPARC+G A+VRGGHLWDGHW+FWVGP I
Sbjct  226   NVFIIIGIVVGLLVYISTTVTATKGYAGAGLNPARCLGPAIVRGGHLWDGHWVFWVGPGI  285

Query  232   ACVAFYLYTKIIPERHFH  179
             ACV F LYTK+IP +  H
Sbjct  286   ACVVFALYTKLIPPQLSH  303



>ref|XP_002312985.2| hypothetical protein POPTR_0009s13110g [Populus trichocarpa]
 gb|EEE86940.2| hypothetical protein POPTR_0009s13110g [Populus trichocarpa]
Length=306

 Score =   307 bits (787),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 179/295 (61%), Positives = 229/295 (78%), Gaps = 10/295 (3%)
 Frame = -1

Query  1066  GSNRVEDVSSTPTISNGNGNGTHQWTGEKIPSSHLTLAQKLGLMDFLSLDVWRASMGEVF  887
             G N+V+  +STP  S            E+       L++ LGL + +SL+VWRAS+ EVF
Sbjct  16    GGNKVQPFASTPRPSKT----------ERGKRDSSALSRILGLDELVSLNVWRASLAEVF  65

Query  886   GTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVSGGHINPTVTFSAA  707
             GTAVLVF +D IVIS+YE++ K PNL+M+ LIAI I +LLLA FP+SGGHINP +T SA 
Sbjct  66    GTAVLVFAMDTIVISSYETQTKTPNLVMATLIAITIAILLLATFPISGGHINPAITLSAM  125

Query  706   LVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTVTVVAPGPNGPVTV  527
               G+I++SRA IY++AQC+GA+LGALALKAVV+S+IE TFSLGGCT+ +VAPGP+GPV +
Sbjct  126   FTGLITVSRAAIYILAQCIGAILGALALKAVVNSTIEQTFSLGGCTLKIVAPGPSGPVAI  185

Query  526   GLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivlgllvfISTTLTT  347
             GL+T QA WLE+ C+FVFLF+SI++A+D RQA  LG V   +++G+V+GLLVFISTT+T 
Sbjct  186   GLETGQALWLEIICTFVFLFSSIYIAFDRRQAIALGRVVFCSIIGLVVGLLVFISTTVTA  245

Query  346   KKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTKIIPERHF  182
              KGYAG GMNPARC+G ALVRGGHLW GHW+FWVGP++A + F LYTKIIP  H 
Sbjct  246   TKGYAGVGMNPARCLGPALVRGGHLWKGHWVFWVGPIVASLTFSLYTKIIPREHL  300



>gb|ADE34299.1| aquaporin XIP1;1 [Gossypium hirsutum]
Length=302

 Score =   305 bits (782),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 179/309 (58%), Positives = 235/309 (76%), Gaps = 15/309 (5%)
 Frame = -1

Query  1105  GFGDEESHPHQNGGSNRVEDVSSTPTISNGNGNGTHQWTGEKIPSSHLTLAQKLGLMDFL  926
             G  ++E + +      RV    +TP + +           EK   S  TL + L L +  
Sbjct  8     GVIEDEENAYTG---TRVRPFVATPRVED-----------EK-KQSPTTLNKILCLEELF  52

Query  925   SLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVS  746
             SL+VWRAS+ E+ GTAVLVF +D IVIS+YE++ K P+LIMS LIA+ ITVLLLA FP+S
Sbjct  53    SLEVWRASLAELLGTAVLVFAMDTIVISSYETQTKTPHLIMSFLIAVTITVLLLATFPIS  112

Query  745   GGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTV  566
             GGHINP ++ +A+L G+IS+SRA IY++AQCVG VLGALAL++VV++ IE TFSLGGCT+
Sbjct  113   GGHINPVISLAASLTGVISLSRAAIYILAQCVGGVLGALALQSVVNTKIEQTFSLGGCTL  172

Query  565   TVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgiv  386
             T+V P  NGP+ +GL+T QA WLE+ C+FVFLFASIW+A+D RQAK LG V V +++G+V
Sbjct  173   TIVVPSANGPLVIGLETSQALWLEIICTFVFLFASIWIAFDKRQAKHLGRVVVCSIIGVV  232

Query  385   lgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYT  206
             +GL+VFISTT+T+ KGYAG GMNPARC+G AL+RGGHLW+GHW+FW GP++ACVAF LYT
Sbjct  233   VGLIVFISTTVTSTKGYAGVGMNPARCLGPALIRGGHLWNGHWVFWAGPVVACVAFALYT  292

Query  205   KIIPERHFH  179
             K+IP +  H
Sbjct  293   KLIPSQLLH  301



>gb|KDO44173.1| hypothetical protein CISIN_1g040654mg [Citrus sinensis]
Length=306

 Score =   303 bits (776),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 180/296 (61%), Positives = 223/296 (75%), Gaps = 8/296 (3%)
 Frame = -1

Query  1066  GSNRVEDVSSTPTISNGNGNGTHQWTGEKIPSSHLTLAQKLGLMDFLSLDVWRASMGEVF  887
             G NRV+  + TP           +   E+   +  T  + LG  D  S+ VWRASM E+ 
Sbjct  16    GGNRVQPFA-TP-------KQEQRLMDEEKKQNPSTWKKILGFEDIFSVKVWRASMAELL  67

Query  886   GTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVSGGHINPTVTFSAA  707
             GTAVLVF LD IVIS+ +++ K PNL+MS L+AI+IT+LL+A FP+SGGHINP V+F+AA
Sbjct  68    GTAVLVFALDTIVISSIQTDTKTPNLVMSTLVAIIITILLIATFPISGGHINPLVSFAAA  127

Query  706   LVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTVTVVAPGPNGPVTV  527
             L GI S +RA IY++AQCVG + GALAL+AVV+  I + FSLGGCT+ VV PGP+GPV +
Sbjct  128   LTGITSFTRAAIYILAQCVGGIFGALALEAVVTKKIAHNFSLGGCTLNVVVPGPDGPVEI  187

Query  526   GLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivlgllvfISTTLTT  347
             GL T QA WLE+ CSFVFLFAS+WMA+D RQAK LG V V  V+G VLGLLVF+STT+T 
Sbjct  188   GLGTRQALWLEIICSFVFLFASVWMAFDSRQAKALGRVTVCIVIGTVLGLLVFVSTTVTA  247

Query  346   KKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTKIIPERHFH  179
             +KGYAGAG+NPARC+G ALVRGGHLWD HW+FW GP IACVAF LYTK+IP ++ H
Sbjct  248   QKGYAGAGLNPARCLGPALVRGGHLWDRHWVFWAGPAIACVAFALYTKLIPSQNLH  303



>ref|XP_007041948.1| Aquaporin, MIP family, PIP subfamily [Theobroma cacao]
 gb|EOX97779.1| Aquaporin, MIP family, PIP subfamily [Theobroma cacao]
Length=307

 Score =   303 bits (775),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 183/308 (59%), Positives = 228/308 (74%), Gaps = 11/308 (4%)
 Frame = -1

Query  1102  FGDEESHPHQNGGSNRVEDVSSTPTISNGNGNGTHQWTGEKIPSSHLTLAQKLGLMDFLS  923
             F DEE+         RV   +STP +      G  +   EK  + +  L     L +  S
Sbjct  10    FEDEENVYT----GTRVRPFASTPRV------GQRRAEEEKKQNPN-ALKMTFSLKELFS  58

Query  922   LDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVSG  743
             L+VWR S+ E+ GTAVLVF++D IVIS+YE+E K P+LIMS LIA+ IT+LLLA FP+SG
Sbjct  59    LEVWRGSLAELLGTAVLVFVMDTIVISSYETETKTPHLIMSFLIAVTITILLLATFPISG  118

Query  742   GHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTVT  563
             GHINP ++ +AAL GIIS SRA +Y++AQCVG +LGALAL+AVV+S IE TFSLGGCT+T
Sbjct  119   GHINPVISLAAALTGIISFSRAAVYILAQCVGGILGALALQAVVNSKIEQTFSLGGCTLT  178

Query  562   VVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivl  383
             +V P  NGP+ +GL T QA WLE+FC+FV LFASIW+A+D RQAK LG V V +V+GIV+
Sbjct  179   IVVPSANGPLVIGLKTSQALWLEIFCTFVLLFASIWIAFDKRQAKHLGRVMVCSVIGIVV  238

Query  382   gllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTK  203
             GL+VFISTT+T  KGYAG GMNPARC+G AL+RGGHLW GHW+FW GP IAC AF LYTK
Sbjct  239   GLIVFISTTVTATKGYAGVGMNPARCLGPALIRGGHLWSGHWVFWAGPAIACAAFALYTK  298

Query  202   IIPERHFH  179
             +IP +  H
Sbjct  299   VIPSQLLH  306



>ref|XP_006487396.1| PREDICTED: probable aquaporin PIP2-6-like [Citrus sinensis]
Length=306

 Score =   303 bits (775),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 180/296 (61%), Positives = 223/296 (75%), Gaps = 8/296 (3%)
 Frame = -1

Query  1066  GSNRVEDVSSTPTISNGNGNGTHQWTGEKIPSSHLTLAQKLGLMDFLSLDVWRASMGEVF  887
             G NRV+  + TP           +   E+   +  T  + LG  D  S+ VWRASM E+ 
Sbjct  16    GGNRVQPFA-TP-------KQEQRLMDEEKRQNPSTWKKILGFEDIFSVKVWRASMAELL  67

Query  886   GTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVSGGHINPTVTFSAA  707
             GTAVLVF LD IVIS+ +++ K PNL+MS L+AI+IT+LL+A FP+SGGHINP V+F+AA
Sbjct  68    GTAVLVFALDTIVISSIQTDTKTPNLVMSTLVAIIITILLIATFPISGGHINPLVSFAAA  127

Query  706   LVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTVTVVAPGPNGPVTV  527
             L GI S +RA IY++AQCVG + GALAL+AVV+  I + FSLGGCT+ VV PGP+GPV +
Sbjct  128   LTGITSFTRAAIYILAQCVGGIFGALALEAVVTKKIAHNFSLGGCTLNVVVPGPDGPVEI  187

Query  526   GLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivlgllvfISTTLTT  347
             GL T QA WLE+ CSFVFLFAS+WMA+D RQAK LG V V  V+G VLGLLVF+STT+T 
Sbjct  188   GLGTRQALWLEIICSFVFLFASVWMAFDSRQAKALGRVTVCIVIGTVLGLLVFVSTTVTA  247

Query  346   KKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTKIIPERHFH  179
             +KGYAGAG+NPARC+G ALVRGGHLWD HW+FW GP IACVAF LYTK+IP ++ H
Sbjct  248   QKGYAGAGLNPARCLGPALVRGGHLWDRHWVFWAGPAIACVAFALYTKLIPSQNLH  303



>ref|XP_002312987.2| hypothetical protein POPTR_0009s13100g [Populus trichocarpa]
 gb|EEE86942.2| hypothetical protein POPTR_0009s13100g [Populus trichocarpa]
Length=278

 Score =   296 bits (759),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 178/265 (67%), Positives = 221/265 (83%), Gaps = 0/265 (0%)
 Frame = -1

Query  973  SSHLTLAQKLGLMDFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSil  794
            +  +T  + LGL D LSL VWRAS+ E+ GTAVLVF LD IVIST ++   MPNLI+S L
Sbjct  11   TKQITWREILGLEDLLSLTVWRASVAELLGTAVLVFALDTIVISTIQTGTNMPNLILSTL  70

Query  793  iaivitvlllaVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkav  614
            +AI+IT+LLLA FP+SGGHINP +TF+A L G+IS+S+  IY++AQCVGA  GALALKAV
Sbjct  71   VAIIITILLLATFPISGGHINPIITFAAFLTGLISLSKTFIYILAQCVGATFGALALKAV  130

Query  613  vssSIENTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQ  434
            V+S IENT+SLGGCT+T+VAPGP+GP  +GL+T QA WLE+ C FVFLFAS+WMA+D+RQ
Sbjct  131  VNSEIENTYSLGGCTLTIVAPGPHGPTVIGLETNQALWLEIICGFVFLFASVWMAFDHRQ  190

Query  433  AKVLGHVKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWI  254
            A+ +G V VF + GIVLGLLVF+STT+TT KGYAGAG+NPARC+G A+VRGGHLW+GHW+
Sbjct  191  AQGIGRVGVFIIGGIVLGLLVFVSTTVTTTKGYAGAGLNPARCLGPAIVRGGHLWNGHWV  250

Query  253  FWVGPLIACVAFYLYTKIIPERHFH  179
            FWVGP +ACVAF +YTKIIP +  H
Sbjct  251  FWVGPAVACVAFAVYTKIIPRQLAH  275



>ref|XP_006379270.1| hypothetical protein POPTR_0009s13100g [Populus trichocarpa]
 gb|ERP57067.1| hypothetical protein POPTR_0009s13100g [Populus trichocarpa]
Length=279

 Score =   296 bits (759),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 178/265 (67%), Positives = 221/265 (83%), Gaps = 0/265 (0%)
 Frame = -1

Query  973  SSHLTLAQKLGLMDFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSil  794
            +  +T  + LGL D LSL VWRAS+ E+ GTAVLVF LD IVIST ++   MPNLI+S L
Sbjct  12   TKQITWREILGLEDLLSLTVWRASVAELLGTAVLVFALDTIVISTIQTGTNMPNLILSTL  71

Query  793  iaivitvlllaVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkav  614
            +AI+IT+LLLA FP+SGGHINP +TF+A L G+IS+S+  IY++AQCVGA  GALALKAV
Sbjct  72   VAIIITILLLATFPISGGHINPIITFAAFLTGLISLSKTFIYILAQCVGATFGALALKAV  131

Query  613  vssSIENTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQ  434
            V+S IENT+SLGGCT+T+VAPGP+GP  +GL+T QA WLE+ C FVFLFAS+WMA+D+RQ
Sbjct  132  VNSEIENTYSLGGCTLTIVAPGPHGPTVIGLETNQALWLEIICGFVFLFASVWMAFDHRQ  191

Query  433  AKVLGHVKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWI  254
            A+ +G V VF + GIVLGLLVF+STT+TT KGYAGAG+NPARC+G A+VRGGHLW+GHW+
Sbjct  192  AQGIGRVGVFIIGGIVLGLLVFVSTTVTTTKGYAGAGLNPARCLGPAIVRGGHLWNGHWV  251

Query  253  FWVGPLIACVAFYLYTKIIPERHFH  179
            FWVGP +ACVAF +YTKIIP +  H
Sbjct  252  FWVGPAVACVAFAVYTKIIPRQLAH  276



>gb|KCW55469.1| hypothetical protein EUGRSUZ_I01369 [Eucalyptus grandis]
Length=253

 Score =   291 bits (744),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 168/248 (68%), Positives = 206/248 (83%), Gaps = 1/248 (0%)
 Frame = -1

Query  880  AVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVSGGHINPTVTFSAALV  701
            AVLVF LD IVIS+YE++ K  NLIMS LIAI + +LLLA  PVSGGH+NP +TF+AAL 
Sbjct  2    AVLVFALDTIVISSYETDTKTANLIMSFLIAITVAILLLATSPVSGGHVNPVITFTAALT  61

Query  700  GIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTVTVVAPGPNGPVTVGL  521
            G+IS+SRA +Y++AQC GAVLGALAL+AVV+S IE TFSLGGCT+ VVAPGP GPVT+GL
Sbjct  62   GLISLSRAAVYILAQCGGAVLGALALEAVVNSKIEQTFSLGGCTLNVVAPGPEGPVTIGL  121

Query  520  DTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivlgllvfISTTLTTKK  341
              VQA WLE+ C+FVFLF SIW+A D+RQAK LG + +F+++G+V+GL+VFISTT+T  K
Sbjct  122  GLVQALWLEIICTFVFLFTSIWIAIDHRQAKALGRLIIFSIIGVVVGLIVFISTTVTGTK  181

Query  340  GYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTKIIPERHF-HASGYP  164
            GYAG GMNPARC+G ALVRGGHLW GHW+FWVGP IACV FYLY K++P +HF HA GY 
Sbjct  182  GYAGVGMNPARCLGPALVRGGHLWSGHWVFWVGPAIACVGFYLYMKVVPTKHFHHAEGYK  241

Query  163  HDFFSTVK  140
            +D  + +K
Sbjct  242  YDVLNILK  249



>gb|KDP27598.1| hypothetical protein JCGZ_19603 [Jatropha curcas]
Length=303

 Score =   292 bits (748),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 171/303 (56%), Positives = 233/303 (77%), Gaps = 10/303 (3%)
 Frame = -1

Query  1102  FGDEESHPHQNGGSNRVEDVSSTPTISNGNGNGTHQWTGEKIPSSHLTLAQKLGLMDFLS  923
             F ++E + H   G  +++ ++STP  +     G     G+K   S   + + LGL +  S
Sbjct  7     FVEDEENEH---GGTKIQPLASTPMPNLDKTEG-----GKK--QSPTNMNKVLGLEELSS  56

Query  922   LDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVSG  743
              +VWRAS+ E+ GTA LVF +D IVISTYE+E K PNLIMS LIAI +T+LL+A  P+S 
Sbjct  57    SNVWRASLAELLGTAALVFAMDTIVISTYETETKTPNLIMSALIAITVTILLIATSPISH  116

Query  742   GHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTVT  563
             GHINP +TF+A   G +S+SRA +Y++AQC+GA+LGALALKAV++S++E TFSLGGCT++
Sbjct  117   GHINPVITFAALFTGRVSLSRAAVYILAQCLGAILGALALKAVLNSTVEETFSLGGCTLS  176

Query  562   VVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivl  383
             +VAPGP+GP+ +GL+T +A WLE+ C+F FLF+SIW+A+D RQ+  LG V V  ++G+V+
Sbjct  177   IVAPGPHGPILIGLETDRALWLEIICTFFFLFSSIWLAFDKRQSTPLGRVIVCCIIGLVV  236

Query  382   gllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTK  203
             GLLVFISTT+T +KGYAG GMNPARC+G AL+RGGHLW GHW+FWVGP+I+C+AF +Y K
Sbjct  237   GLLVFISTTVTAQKGYAGVGMNPARCLGPALIRGGHLWSGHWVFWVGPIISCIAFGVYVK  296

Query  202   IIP  194
             IIP
Sbjct  297   IIP  299



>ref|XP_002312988.2| hypothetical protein POPTR_0009s13070g, partial [Populus trichocarpa]
 gb|EEE86943.2| hypothetical protein POPTR_0009s13070g, partial [Populus trichocarpa]
Length=263

 Score =   286 bits (731),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 171/250 (68%), Positives = 209/250 (84%), Gaps = 0/250 (0%)
 Frame = -1

Query  928  LSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPV  749
            +S  VWRAS+ E+ GTAVLVF LD IVIST   E K+PNLI+SIL AI+IT+L+LA FP+
Sbjct  11   VSAQVWRASVAELIGTAVLVFTLDTIVISTIRIETKIPNLILSILAAIIITILILATFPI  70

Query  748  SGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCT  569
            SGGHINP VTF+A L G++S+S+A+IY++AQCVG + GALALKAVV+  I+ TFSLGGCT
Sbjct  71   SGGHINPLVTFAALLTGLVSLSKAIIYILAQCVGGIFGALALKAVVNREIQQTFSLGGCT  130

Query  568  VTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgi  389
            +TVVAPGP+G   +GL+T QA WLE+ C FVFLFAS+WMA+D RQAK LG V VF ++GI
Sbjct  131  LTVVAPGPDGQTVIGLETSQALWLEIICGFVFLFASVWMAFDQRQAKALGRVNVFIIIGI  190

Query  388  vlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLY  209
            V+GLLV+ISTT+T  KGYAGAG+NPARC+G A+VRGGHLWDGHW+FWVGP IACV F LY
Sbjct  191  VVGLLVYISTTVTATKGYAGAGLNPARCLGPAIVRGGHLWDGHWVFWVGPGIACVLFALY  250

Query  208  TKIIPERHFH  179
            TK+IP +  H
Sbjct  251  TKLIPPQLSH  260



>ref|XP_006423576.1| hypothetical protein CICLE_v10028106mg [Citrus clementina]
 gb|ESR36816.1| hypothetical protein CICLE_v10028106mg [Citrus clementina]
Length=565

 Score =   291 bits (745),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 179/289 (62%), Positives = 217/289 (75%), Gaps = 8/289 (3%)
 Frame = -1

Query  1066  GSNRVEDVSSTPTISNGNGNGTHQWTGEKIPSSHLTLAQKLGLMDFLSLDVWRASMGEVF  887
             G NRV+  + TP           +   E+   +  T  + LG  D  S+ VWRASM E+ 
Sbjct  16    GGNRVQPFA-TP-------KQEQRLMDEEKKQNPSTWKKILGFEDIFSVKVWRASMAELL  67

Query  886   GTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVSGGHINPTVTFSAA  707
             GTAVLVF LD IVIS+ +++ K PNL+MS L+AI IT+LLLA FP+SGGHINP V+F+AA
Sbjct  68    GTAVLVFALDTIVISSIQTDTKTPNLVMSTLVAITITILLLATFPISGGHINPLVSFAAA  127

Query  706   LVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTVTVVAPGPNGPVTV  527
             L GI S SRA IY++AQCVG + GALALKAVV++ I + FSLGGCT+ VV PGP+G V +
Sbjct  128   LTGIASFSRAAIYILAQCVGGIFGALALKAVVTNKIAHNFSLGGCTLNVVVPGPDGLVEI  187

Query  526   GLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivlgllvfISTTLTT  347
             GL T QA WLE+ CSFVFLFAS+WMA+D RQAK LG V V  V+G VLGLLVF+STT+T 
Sbjct  188   GLGTRQALWLEIICSFVFLFASVWMAFDSRQAKALGRVTVCIVIGTVLGLLVFVSTTVTA  247

Query  346   KKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTKI  200
             +KGYAGAG+NPARC+G ALVRGGHLWD HW+FW GP IACVAF LYTK+
Sbjct  248   QKGYAGAGLNPARCLGPALVRGGHLWDRHWVFWAGPAIACVAFALYTKM  296


 Score =   176 bits (446),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 113/287 (39%), Positives = 166/287 (58%), Gaps = 17/287 (6%)
 Frame = -1

Query  994  WTGEKIPSSHLTLAQKLGLMDFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMP  815
            W G  I      L  K+          WRA+  E+  TA LVF L   +IS  +S V   
Sbjct  280  WAGPAIACVAFALYTKM----------WRAAFTELVATAFLVFTLTTSIISCLDSHVSEQ  329

Query  814  NLIMSiliaivitvlllaVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlg  635
             L++ I + I+  + L+   P+SGGH++P  TF AAL GI++++RA  Y++AQC+G+++G
Sbjct  330  KLLVPIAVFIIAFLFLMVTVPLSGGHMSPVFTFIAALKGIVTLARAATYVLAQCLGSIVG  389

Query  634  alalkavvssSIENTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIW  455
             L + +V+S +    +SLGGC +       NG  + G+    A  LE  C+FV LF  + 
Sbjct  390  FLIINSVMSHNAARRYSLGGCLI-----AGNG-TSAGISAETALILEFTCTFVVLFVGVT  443

Query  454  MAYDYRQAKVLGHVKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGH  275
            +A+D R+ K LG V V  +V   + + VF+S T+T K GYAG G+NPARC+G AL+ GG 
Sbjct  444  IAFDKRRCKELGLVVVCAIVAGAMAIAVFVSITVTQKPGYAGVGLNPARCLGPALLHGGP  503

Query  274  LWDGHWIFWVGPLIACVAFYLYTKIIPERHF-HASGYPHDFFSTVKV  137
            LW GHW+FWVGP +ACV +Y + K +PE        + HD  +  +V
Sbjct  504  LWKGHWVFWVGPFLACVVYYGFAKTLPEEGLVWEDKFEHDIINLARV  550



>ref|XP_010647357.1| PREDICTED: aquaporin AQPAn.G-like [Vitis vinifera]
 ref|XP_010647364.1| PREDICTED: aquaporin AQPAn.G-like [Vitis vinifera]
 emb|CBI37945.3| unnamed protein product [Vitis vinifera]
Length=304

 Score =   281 bits (720),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 160/248 (65%), Positives = 207/248 (83%), Gaps = 0/248 (0%)
 Frame = -1

Query  934  DFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVF  755
            +F S +VWRAS+ E+ GTAVLVF+LD IVIS+Y+++ + PNL++S  I   +T+LLLA F
Sbjct  43   EFFSPEVWRASVAELLGTAVLVFVLDTIVISSYQTKTETPNLVISFFIFPTLTILLLATF  102

Query  754  PVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGG  575
            P+SGGHINP +TFSAALVG+IS SRA +Y++AQC GAVLGALALKAVV+S+IE TFSLGG
Sbjct  103  PISGGHINPIITFSAALVGVISHSRACVYVLAQCAGAVLGALALKAVVNSNIEETFSLGG  162

Query  574  CTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvv  395
            CT++V+ PGP+G +TVG++T QA WLE+ C+FV LFAS+W+ +D RQAK LG V V +++
Sbjct  163  CTLSVIVPGPDGAITVGINTGQALWLEIICTFVLLFASVWIGFDDRQAKALGLVLVCSII  222

Query  394  givlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFY  215
            G V G+LVF+STT+T  KGYAGAGMNPARC+GAALVRGG LW+G W+FWVGP IAC+ F+
Sbjct  223  GAVAGVLVFVSTTVTATKGYAGAGMNPARCLGAALVRGGQLWNGLWVFWVGPAIACLLFH  282

Query  214  LYTKIIPE  191
            +Y K I +
Sbjct  283  VYVKTIRD  290



>ref|XP_006423577.1| hypothetical protein CICLE_v10029916mg, partial [Citrus clementina]
 gb|ESR36817.1| hypothetical protein CICLE_v10029916mg, partial [Citrus clementina]
Length=235

 Score =   261 bits (667),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 150/246 (61%), Positives = 186/246 (76%), Gaps = 13/246 (5%)
 Frame = -1

Query  916  VWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVSGGH  737
            VWRAS+ EV GTA+LVF LD IVIS+ +++  +  L+++              FP+SGGH
Sbjct  1    VWRASLTEVLGTALLVFALDTIVISSIQTDTIIAILLLAT-------------FPISGGH  47

Query  736  INPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTVTVV  557
            INP VTFSAAL+G ++++RA IY++AQCVG V GALA KAVVS+ IE+ FSLGG T+ VV
Sbjct  48   INPLVTFSAALIGHMTITRAAIYILAQCVGGVFGALAPKAVVSTKIEHAFSLGGRTLIVV  107

Query  556  APGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivlgl  377
               PNGPV +GLDT  A WLE+FCSFVFLFAS+WMA+D RQAK L  V V  ++G+VLGL
Sbjct  108  EQQPNGPVELGLDTGVALWLEIFCSFVFLFASMWMAFDERQAKALARVSVCIILGVVLGL  167

Query  376  lvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTKII  197
            L+F+STT+T +KGY GAG NPARC+G A VRGGHLWD HW+FW GP  ACVAF LY K+I
Sbjct  168  LIFVSTTVTAQKGYGGAGRNPARCLGPAFVRGGHLWDRHWVFWAGPATACVAFALYIKLI  227

Query  196  PERHFH  179
            P +H H
Sbjct  228  PSQHLH  233



>gb|KDO44174.1| hypothetical protein CISIN_1g036381mg, partial [Citrus sinensis]
Length=235

 Score =   261 bits (667),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 150/246 (61%), Positives = 186/246 (76%), Gaps = 13/246 (5%)
 Frame = -1

Query  916  VWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVSGGH  737
            VWRAS+ EV GTA+LVF LD IVIS+ +++  +  L+++              FP+SGGH
Sbjct  1    VWRASLTEVLGTALLVFALDTIVISSIQTDTIIAILLLAT-------------FPISGGH  47

Query  736  INPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTVTVV  557
            INP VTFSAAL+G ++++RA IY++AQCVG V GALA KAVVS+ IE+ FSLGG T+ VV
Sbjct  48   INPLVTFSAALIGHMTVTRAAIYILAQCVGGVFGALAPKAVVSTKIEHAFSLGGRTLIVV  107

Query  556  APGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivlgl  377
               PNGPV +GLDT  A WLE+FCSFVFLFAS+WMA+D RQAK L  V V  ++G+VLGL
Sbjct  108  EQQPNGPVELGLDTGVALWLEIFCSFVFLFASMWMAFDERQAKALARVSVCIILGVVLGL  167

Query  376  lvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTKII  197
            L+F+STT+T +KGY GAG NPARC+G A VRGGHLWD HW+FW GP  ACVAF LY K+I
Sbjct  168  LIFVSTTVTAQKGYGGAGRNPARCLGPAFVRGGHLWDRHWVFWAGPATACVAFALYIKLI  227

Query  196  PERHFH  179
            P +H H
Sbjct  228  PSQHLH  233



>ref|XP_010690468.1| PREDICTED: aquaporin AQPAe.a-like [Beta vulgaris subsp. vulgaris]
Length=312

 Score =   259 bits (661),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 147/310 (47%), Positives = 212/310 (68%), Gaps = 12/310 (4%)
 Frame = -1

Query  1102  FGDEESHPHQNGGSN-RVEDVSSTPTISNGNGNGTHQWTGEKIPSSHLTLAQKLGLMDFL  926
              G+E  +    G +N R+  VS+TPT          Q T E+I          +G  +  
Sbjct  9     LGEENCNKEYEGATNARILPVSATPT---------KQKTEERIVGKSAKFLHWIGYEEIF  59

Query  925   SLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVS  746
             S  VWRAS+ E+  TA+LVFMLD I IS+  +    PN+I++  +AI++  L L   P+S
Sbjct  60    SSQVWRASVAELLSTAILVFMLDTIFISSKINN-DTPNIILACFVAIIVAFLRLTTHPIS  118

Query  745   GGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTV  566
             GGHINPT+T SAA +G+IS  RA+IY++AQC+G++LGA AL+ + + S  +++ LGGCT+
Sbjct  119   GGHINPTITISAAFMGLISFCRAMIYLIAQCIGSILGAWALQGMFAGSTTHSYLLGGCTL  178

Query  565   TVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgiv  386
              V   GP+GP TVG++  Q  W E+  +F+FLF S+WMA+D +++K LG V +  + G+V
Sbjct  179   VVATLGPDGPTTVGIEIAQGLWTEIIYTFIFLF-SVWMAFDQKRSKELGQVVMCAITGVV  237

Query  385   lgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYT  206
             +GL +++S+T+TTKKGY GA +NPARC+G A+VRGGHLW  HW+FWVGP+IAC+AFYLY+
Sbjct  238   VGLTMYLSSTVTTKKGYTGAVINPARCIGPAVVRGGHLWADHWVFWVGPIIACIAFYLYS  297

Query  205   KIIPERHFHA  176
              I+P +HF A
Sbjct  298   MILPLQHFKA  307



>ref|XP_006379269.1| hypothetical protein POPTR_0009s13080g [Populus trichocarpa]
 gb|ERP57066.1| hypothetical protein POPTR_0009s13080g [Populus trichocarpa]
Length=217

 Score =   253 bits (645),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 149/214 (70%), Positives = 186/214 (87%), Gaps = 0/214 (0%)
 Frame = -1

Query  820  MPNLIMSiliaivitvlllaVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgav  641
            MPNLI+S L+AI+IT+LLLA FP+SGGHINP +TF+A L G+IS+S+  IY++AQCVGA+
Sbjct  1    MPNLILSTLVAIIITILLLATFPISGGHINPIITFAAFLTGLISLSKTFIYILAQCVGAI  60

Query  640  lgalalkavvssSIENTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFAS  461
             GALALKAVV+S IE T+SLGGCT+T+VAPGP+GP  +GL+T QA WLE+ C FVFLFAS
Sbjct  61   FGALALKAVVNSEIEKTYSLGGCTLTIVAPGPHGPTVIGLETNQALWLEIICGFVFLFAS  120

Query  460  IWMAYDYRQAKVLGHVKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRG  281
            +WMA+D+RQA+ +G V+V  +VGIVLGLLVF+STT+T  KGYAGAG+NPARC+G A+VRG
Sbjct  121  VWMAFDHRQAQGIGRVRVLIIVGIVLGLLVFVSTTVTATKGYAGAGLNPARCLGPAIVRG  180

Query  280  GHLWDGHWIFWVGPLIACVAFYLYTKIIPERHFH  179
            GHLW+GHW+FWVGP IACVAF +YTKIIP +  H
Sbjct  181  GHLWNGHWVFWVGPAIACVAFAVYTKIIPRQLAH  214



>gb|EPS67222.1| x intrinsic protein [Genlisea aurea]
Length=282

 Score =   253 bits (645),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 148/270 (55%), Positives = 204/270 (76%), Gaps = 3/270 (1%)
 Frame = -1

Query  946  LGLMDFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvll  767
            LG+ +F+SL++WR+S GE+  +AVL FMLDA++I+T E+  +M  LI+SIL+ +  T++ 
Sbjct  2    LGVKEFISLELWRSSAGELLASAVLTFMLDAVIIATTETITEMQGLILSILVGVTFTIVF  61

Query  766  laVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTF  587
            LA+ P+SG  I+P VT SAAL+G+IS++RA++Y VAQC+G +LGALALK+V+++   + F
Sbjct  62   LAMAPISGACIDPMVTVSAALIGLISITRALVYTVAQCLGGILGALALKSVIAAEYADAF  121

Query  586  SLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKv  407
            SL GCTVTV++P     V +GL   +AF +E  CSFV  F  +WMAYD+RQ    G VKV
Sbjct  122  SLCGCTVTVISPAG---VEIGLGVGKAFLMEFICSFVVQFMCLWMAYDFRQIGEYGRVKV  178

Query  406  ftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIAC  227
            FT+VGIV+ L+VF+S ++T  KGY+GA MNPARC G+A+VR GHLWDGHW+FWVGP+ A 
Sbjct  179  FTIVGIVVALVVFVSISVTGAKGYSGAAMNPARCFGSAVVRSGHLWDGHWVFWVGPIFAS  238

Query  226  VAFYLYTKIIPERHFHASGYPHDFFSTVKV  137
            VAFYLYTKII   H+    Y HDFF+ + +
Sbjct  239  VAFYLYTKIISREHYQVKPYDHDFFNVIDL  268



>ref|XP_008392025.1| PREDICTED: LOW QUALITY PROTEIN: aquaporin-like [Malus domestica]
Length=408

 Score =   253 bits (646),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 139/262 (53%), Positives = 182/262 (69%), Gaps = 10/262 (4%)
 Frame = -1

Query  922  LDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVSG  743
            L VW AS  E+ GTAVLVF +D + IS+YE++  +PN I   ++            P+SG
Sbjct  133  LLVWIASQAELVGTAVLVFTIDTVXISSYETKTTIPNFITVEILLHATN-------PISG  185

Query  742  GHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTVT  563
            GHINP VT S  LVG+IS+SR V+Y+++QC GAVLG LALK VV++SIE TFSLGGCT+ 
Sbjct  186  GHINPVVTLSXTLVGLISLSRXVVYILSQCAGAVLGVLALKVVVNNSIEGTFSLGGCTLA  245

Query  562  VVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDY-RQAKVLGHVKvftvvgiv  386
            V+APGPNGP+ + ++T Q   LE+ C+FVFLFASIW+A+D+ RQ   LG  +V   + + 
Sbjct  246  VIAPGPNGPIIMDIETTQGLRLEIICTFVFLFASIWIAFDHHRQVHNLG--RVVVXLIVG  303

Query  385  lgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYT  206
            + + +  STT+T  KGYAG G  PARC G  L+R G L +GHW+ WVGP+IAC+ FYLY 
Sbjct  304  IVVGLLXSTTVTVAKGYAGVGCXPARCFGPILIRXGRLXNGHWVIWVGPIIACMVFYLYI  363

Query  205  KIIPERHFHASGYPHDFFSTVK  140
            KII  +HFH  GY HD  + VK
Sbjct  364  KIISRQHFHPEGYKHDSLNIVK  385



>gb|EPS73657.1| x intrinsic protein, partial [Genlisea aurea]
Length=280

 Score =   231 bits (589),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 141/275 (51%), Positives = 194/275 (71%), Gaps = 6/275 (2%)
 Frame = -1

Query  961  TLAQKLGLMDFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaiv  782
            TL++ LG  +  SL++WRAS+GE  G+AVL FMLD + I+T E+  +M  LI+S LI + 
Sbjct  7    TLSEILGFNELPSLELWRASVGEFVGSAVLTFMLDTVTIATTETIDEMQPLILSALIGLT  66

Query  781  itvlllaVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssS  602
            +T+L LAV P+SGG +NP ++ SAALVG+IS SRA +Y+ A+C+GA+LG  ALK+V+S  
Sbjct  67   LTILFLAVAPISGGFVNPMISLSAALVGLISFSRAAVYIAAECLGAILGVAALKSVISYQ  126

Query  601  IENTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVL  422
             +  FSL GC+V +        V       +AF  E F  F  LF  +WMA+D++Q    
Sbjct  127  YQEAFSLCGCSVAIGGGMREAAVE------KAFLTEFFSCFAVLFLCVWMAFDFKQIGHY  180

Query  421  GHVKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVG  242
            G VKVF+++GIV+ L+VF+S ++T +KGY GAGMNPA+C  +A+V+GGHLWDGHW+FWVG
Sbjct  181  GRVKVFSIIGIVVALVVFVSISVTNQKGYTGAGMNPAKCFASAVVKGGHLWDGHWVFWVG  240

Query  241  PLIACVAFYLYTKIIPERHFHASGYPHDFFSTVKV  137
            P +A V FYLYTKIIP  HF A  Y HDF + V++
Sbjct  241  PTLASVVFYLYTKIIPRHHFQAKPYDHDFSNVVEL  275



>ref|XP_006487440.1| PREDICTED: probable aquaporin PIP2-8-like [Citrus sinensis]
 gb|KDO44172.1| hypothetical protein CISIN_1g045670mg [Citrus sinensis]
Length=319

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 118/307 (38%), Positives = 178/307 (58%), Gaps = 8/307 (3%)
 Frame = -1

Query  1054  VEDVSSTPTISNGNGNGTHQWTGEKIPSSHLTLAQKLGLMDFLSLDVWRASMGEVFGTAV  875
             V   ++ P  S G     ++     I    + LA  +G  +F S  +WRA+  E+  TA 
Sbjct  5     VSHEAADPLPSQGFSIEKNEIMNGTITRREMFLAC-IGFYEFFSPKMWRAAFTELVATAF  63

Query  874   LVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVSGGHINPTVTFSAALVGI  695
             LVF L   +IS  +S V    L++ I + I+  + L+   P+SGGH++P  TF AAL GI
Sbjct  64    LVFTLTTSIISCLDSHVSEQKLLVPIAVFIIAFLFLMVTVPLSGGHMSPVFTFIAALQGI  123

Query  694   ISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTVTVVAPGPNGPVTVGLDT  515
             ++++RA  Y++AQC+G+++G L + +V+S +    +SLGGC +       NG  + G+  
Sbjct  124   VTLARAATYVLAQCLGSIVGFLIINSVMSHNAARRYSLGGCLI-----AGNG-TSAGISA  177

Query  514   VQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivlgllvfISTTLTTKKGY  335
               A  LE  C+FV LF  + +A+D R+ K LG V V  +V   + + VF+S T+T K GY
Sbjct  178   ETALILEFTCTFVVLFVGVTIAFDKRRCKELGLVVVCAIVAGAMAIAVFVSITVTQKPGY  237

Query  334   AGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTKIIPERHFH-ASGYPHD  158
             AG G+NPARC+G AL+ GG LW GHW+FWVGP +ACV +Y + K +PE        + HD
Sbjct  238   AGVGLNPARCLGPALLHGGPLWKGHWVFWVGPFLACVVYYGFAKTLPEEGLVWEDKFEHD  297

Query  157   FFSTVKV  137
               +  +V
Sbjct  298   IINLARV  304



>ref|XP_008351523.1| PREDICTED: aquaporin TIP1-2-like [Malus domestica]
Length=304

 Score =   179 bits (453),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 112/255 (44%), Positives = 168/255 (66%), Gaps = 6/255 (2%)
 Frame = -1

Query  946  LGLMDFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvll  767
            +G  ++ S ++WRA++ E+  TA LVF L + +IS  +S    P L++ I + I+  +LL
Sbjct  40   IGAHEYFSPEMWRAALTELVATASLVFSLTSSIISCLDSGEVDPKLLVPISVFIIAFLLL  99

Query  766  laVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTF  587
            L   P+SGGH++P  TF A L G I+++RA IY++AQC G+VLG L +K V+       +
Sbjct  100  LVTVPLSGGHMSPVFTFIATLKGAITLARASIYILAQCFGSVLGFLIMKTVMDQHAVQKY  159

Query  586  SLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKv  407
            SLGGCT+       +GP T G++T  A  LEV C+FV LF  + +A+D R++K LG   V
Sbjct  160  SLGGCTIQ-----GSGP-TSGVETQTALVLEVXCTFVVLFVGVTVAFDKRRSKELGLPMV  213

Query  406  ftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIAC  227
              VV   + + VF+S T+T + GYAG G+NPARC+GAAL++GG LWDGHW+FWVGP++AC
Sbjct  214  CVVVAGSMAIAVFVSVTVTGRAGYAGVGLNPARCLGAALLQGGILWDGHWVFWVGPILAC  273

Query  226  VAFYLYTKIIPERHF  182
              ++  +  +P++  
Sbjct  274  SVYHCLSLNLPKQDL  288



>ref|XP_007041950.1| Plasma membrane intrinsic protein 1A, putative [Theobroma cacao]
 gb|EOX97781.1| Plasma membrane intrinsic protein 1A, putative [Theobroma cacao]
Length=319

 Score =   175 bits (443),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 105/253 (42%), Positives = 161/253 (64%), Gaps = 6/253 (2%)
 Frame = -1

Query  946  LGLMDFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvll  767
            +G  +F S ++W+A++ E+  TA L+F L   ++S  +S    P L++   + I+  + L
Sbjct  40   IGAHEFSSPEMWKAALTELVATASLMFTLTTSIVSCLDSHETDPKLLVPFAVFIIAFLFL  99

Query  766  laVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTF  587
            +   P+SGGH++P  TF AAL GII+++RA IY++AQCVG++ G L L +V+       +
Sbjct  100  MVTVPLSGGHMSPVFTFIAALKGIITLARASIYILAQCVGSLTGFLILNSVMDQDAAKRY  159

Query  586  SLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKv  407
            SLGGCT+       NG  T G+    A  LE  C+F+ L   + +A+D R++K LG   V
Sbjct  160  SLGGCTIN-----GNGS-TSGISPGTALILEFCCTFLVLLVGVTIAFDKRRSKELGLPMV  213

Query  406  ftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIAC  227
              VV   + + VF+S ++T + GYAG G+NP+RC+G AL+RGG LWDGHW+FWVGP  AC
Sbjct  214  CAVVAGAMAVAVFVSISVTGRAGYAGVGLNPSRCLGPALLRGGQLWDGHWVFWVGPCFAC  273

Query  226  VAFYLYTKIIPER  188
            + +Y +TK +P+ 
Sbjct  274  IIYYCFTKGLPKE  286



>ref|XP_003540471.1| PREDICTED: aquaporin TIP1-2-like [Glycine max]
 gb|KHN05475.1| Aquaporin-4 [Glycine soja]
Length=312

 Score =   175 bits (443),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 109/279 (39%), Positives = 174/279 (62%), Gaps = 13/279 (5%)
 Frame = -1

Query  1003  THQWTGEKIP-------SSHLTLAQKLGLMDFLSLDVWRASMGEVFGTAVLVFMLDAIVI  845
              H  + E +P       SS       +G  +F +++ W+A++ E+  TA L+F L +  I
Sbjct  8     VHSHSREPMPRGLVHEKSSEPKFLAYIGAHEFFTIETWKAALVELIATAALMFTLTSCNI  67

Query  844   STYESEVKMPNLIMSiliaivitvlllaVFPVSGGHINPTVTFSAALVGIISMSRAVIYM  665
             +  ES+   P LI+   + I++ + L+ + P+SGGH+NP  TF AAL G++++SRA++Y+
Sbjct  68    ACLESQDVNPKLILPFAVFIIVFLFLIVIVPLSGGHMNPIFTFIAALKGVVTLSRALLYV  127

Query  664   VAQCvgavlgalalkavvssSIENTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFC  485
              AQC+G+++G   LK+V+   + +T+SLGGC     A G  G  + GL    A  LE  C
Sbjct  128   SAQCIGSIIGFFVLKSVMEPKLADTYSLGGC-----ALGDKGQSS-GLRPQDALLLEFSC  181

Query  484   SFVFLFASIWMAYDYRQAKVLGHVKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARC  305
             +F+ LF  + +A+D ++ K LG   V  VV   L L VF+S T+T + GYAGAG++PARC
Sbjct  182   TFLVLFVGLTLAFDKKRCKELGLPMVCLVVAASLALAVFVSITVTGRPGYAGAGLSPARC  241

Query  304   VGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTKIIPER  188
             +G AL+ GG LW+GHW+FW+GP +AC+ +Y  +  +P++
Sbjct  242   LGPALLHGGPLWNGHWVFWLGPFLACIIYYSVSINLPKK  280



>emb|CCI69207.1| XIP aquaporin [Lotus japonicus]
Length=299

 Score =   174 bits (441),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 110/287 (38%), Positives = 175/287 (61%), Gaps = 9/287 (3%)
 Frame = -1

Query  997  QWTGEKIPSSHLTLAQKLGLMDFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKM  818
            Q + E+  +S       +G+ +    + W+A+M E+  TA LVF L   +I+  +S    
Sbjct  18   QTSNERKNASRGKFLASIGVHEIFRSETWKAAMTELAATASLVFTLTTSIIACLDSHETD  77

Query  817  PNLIMSiliaivitvlllaVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavl  638
            P L++  ++ I+  + L+   P+SGGH++P  T  AAL G+++++RA+IYM AQCVG+++
Sbjct  78   PKLLVPFVVFIIAFLFLIVTVPLSGGHMSPVFTIIAALKGVVTLTRALIYMFAQCVGSII  137

Query  637  galalkavvssSIENTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASI  458
            G   LK V+   + +T+SLGGCT+     G NG V   +    A  LE+ C+F+ LF  +
Sbjct  138  GFFVLKCVMDPKLVHTYSLGGCTI-----GGNG-VNSAITEYDALLLEISCTFLVLFLGV  191

Query  457  WMAYDYRQAKVLGHVKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGG  278
             +A+D ++AK LG   V  VV   + L VF+S T+T + GYAG G+NPARC+G AL++GG
Sbjct  192  TLAFDKKRAKELGLPMVCMVVAGAMALAVFVSITVTGRPGYAGVGLNPARCLGPALLQGG  251

Query  277  HLWDGHWIFWVGPLIACVAFYLYTKIIPERHFHASGYPHDFFSTVKV  137
             +W+GHW+FWVG  +AC+ +Y+ +  +P+     SG     F  VK+
Sbjct  252  SVWNGHWVFWVGSFLACIIYYVVSVNLPK---EGSGIGDGEFDVVKL  295



>ref|XP_009358228.1| PREDICTED: aquaporin TIP1-2-like [Pyrus x bretschneideri]
Length=255

 Score =   172 bits (437),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 111/245 (45%), Positives = 163/245 (67%), Gaps = 6/245 (2%)
 Frame = -1

Query  916  VWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVSGGH  737
            +WRA++ E+  TA LVF L + +IS  +S    P L++ I + I+  +LLL   P+SGGH
Sbjct  1    MWRAALTELVATASLVFSLTSSIISCLDSGEVDPKLLVPISVFIIAFLLLLVTVPLSGGH  60

Query  736  INPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTVTVV  557
            ++P  TF AAL G I+++RA +Y++AQC G+VLG L +K V+       +SLGGCT+   
Sbjct  61   MSPVFTFIAALKGAITLARASVYILAQCFGSVLGFLIMKTVMDQHAVQEYSLGGCTIH--  118

Query  556  APGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivlgl  377
                +GP T G+ T  A  LEV C+FV LF  + +A+D R++K LG   V  VV   + L
Sbjct  119  ---GSGP-TSGVGTQTALVLEVACTFVVLFVGVTVAFDKRRSKELGLPMVCVVVAGSMAL  174

Query  376  lvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTKII  197
             VF+S T+T + GYAG G+NPARC+GAAL++GG LWDGHW+FWVGP++AC  ++  +  +
Sbjct  175  AVFVSVTVTGRSGYAGVGLNPARCLGAALLQGGILWDGHWVFWVGPILACSVYHCLSFNL  234

Query  196  PERHF  182
            P+++ 
Sbjct  235  PKQNL  239



>ref|XP_007199345.1| hypothetical protein PRUPE_ppa025096mg [Prunus persica]
 gb|EMJ00544.1| hypothetical protein PRUPE_ppa025096mg [Prunus persica]
Length=304

 Score =   173 bits (439),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 110/274 (40%), Positives = 164/274 (60%), Gaps = 6/274 (2%)
 Frame = -1

Query  973  SSHLTLAQKLGLMDFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSil  794
            S  L     +G  ++ S ++WRA+  E+  TA L+F L + +IS  ES    P L++ I 
Sbjct  31   SLRLKFLATIGAHEYFSPEMWRAAFTELVATASLLFTLTSSIISCLESGEVDPKLLVPIA  90

Query  793  iaivitvlllaVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkav  614
            + I+  + LL   P+SGGH++P  TF AAL G+I+ +RA IY++AQC+G++LG L +K V
Sbjct  91   VFIIAFLFLLVTVPLSGGHMSPVFTFIAALKGVITFARASIYILAQCIGSILGFLIIKTV  150

Query  613  vssSIENTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQ  434
            +  +    +SLGGCT+           T G+ T  A  +E  C+FV LF  + +A+D R+
Sbjct  151  MDQNAAQKYSLGGCTIK------GSGSTSGVGTQTALMVEFACTFVVLFVGVTVAFDKRR  204

Query  433  AKVLGHVKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWI  254
             K LG   V  VV   + L VF+S T+T + GYAG G++PARC+G AL++GG LWDGHW+
Sbjct  205  CKELGLAMVCAVVAGAMALAVFVSITVTGRVGYAGVGLSPARCLGPALLQGGRLWDGHWV  264

Query  253  FWVGPLIACVAFYLYTKIIPERHFHASGYPHDFF  152
            FWVGP++AC  +Y  +  +P     +     D  
Sbjct  265  FWVGPILACSVYYCVSLNLPNEGLKSVEEECDIL  298



>ref|XP_002312986.2| hypothetical protein POPTR_0009s13090g [Populus trichocarpa]
 gb|EEE86941.2| hypothetical protein POPTR_0009s13090g [Populus trichocarpa]
Length=237

 Score =   169 bits (429),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 100/241 (41%), Positives = 150/241 (62%), Gaps = 8/241 (3%)
 Frame = -1

Query  916  VWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVSGGH  737
            +WRA++ E+  TA L+F L   +IS  ES    P  ++   I ++    LL   P+SGGH
Sbjct  1    MWRATLTELVATACLLFTLTTSIISCLESTTAEPKFLIPFAIFVIAFFFLLTTVPLSGGH  60

Query  736  INPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTVTVV  557
            ++P  TF AAL G+I+  RA+ YM AQCVG+++  L +K+V+  + E  +SLGGC +   
Sbjct  61   MSPVFTFIAALEGVITPVRALFYMSAQCVGSIVAYLVIKSVMDKNAEEKYSLGGCMID--  118

Query  556  APGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivlgl  377
                NG    G+    AF LE  C+F+ LF  + +A+D R+ K LG   V  ++   + L
Sbjct  119  ---GNGE---GISPTNAFILEFSCTFIVLFVGVTVAFDKRRCKELGLQMVCGILAGAMTL  172

Query  376  lvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTKII  197
              F+S ++T + GYAGAG+NPARC+G +L++GG LW GHW+FWVGP +AC+ +Y +T  +
Sbjct  173  AFFVSISVTGRAGYAGAGLNPARCLGPSLLKGGRLWYGHWVFWVGPFVACIVYYGFTLTL  232

Query  196  P  194
            P
Sbjct  233  P  233



>gb|ACU19165.1| unknown [Glycine max]
Length=319

 Score =   170 bits (430),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 107/279 (38%), Positives = 172/279 (62%), Gaps = 13/279 (5%)
 Frame = -1

Query  1003  THQWTGEKIP-------SSHLTLAQKLGLMDFLSLDVWRASMGEVFGTAVLVFMLDAIVI  845
              H  + E +P       SS       +G  +F +++ W+A++ E+  TA L+F L +  I
Sbjct  8     VHSHSREPMPRGLVHEKSSEPKFLAYIGAHEFFTIETWKAALVELIATAALMFTLTSCNI  67

Query  844   STYESEVKMPNLIMSiliaivitvlllaVFPVSGGHINPTVTFSAALVGIISMSRAVIYM  665
             +  ES+   P LI+   + I++ + L+ + P+SGGH+NP  TF AAL G++++ RA++Y+
Sbjct  68    ACLESQDVNPKLILPFAVFIIVFLFLIVIVPLSGGHMNPIFTFIAALKGVVTLFRALLYV  127

Query  664   VAQCvgavlgalalkavvssSIENTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFC  485
              AQC+G+++G   LK+V+   + +T+ LGGC     A G  G  + GL    A  LE  C
Sbjct  128   SAQCIGSIIGFFVLKSVMEPKLADTYFLGGC-----ALGDKGQ-SFGLRPQDALLLEFSC  181

Query  484   SFVFLFASIWMAYDYRQAKVLGHVKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARC  305
             +F+ LF  + +A+D ++ K LG   V  VV   L L VF+S T+T + GYAGAG++PARC
Sbjct  182   TFLVLFVGLTLAFDKKRCKELGLPMVCLVVAASLALAVFVSITVTGRPGYAGAGLSPARC  241

Query  304   VGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTKIIPER  188
             +G AL+ GG LW+GHW+FW+GP +AC+ +Y  +  +P++
Sbjct  242   LGPALLHGGPLWNGHWVFWLGPFLACIIYYSVSINLPKK  280



>ref|XP_007131587.1| hypothetical protein PHAVU_011G025700g [Phaseolus vulgaris]
 gb|ESW03581.1| hypothetical protein PHAVU_011G025700g [Phaseolus vulgaris]
Length=308

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 99/253 (39%), Positives = 161/253 (64%), Gaps = 6/253 (2%)
 Frame = -1

Query  946  LGLMDFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvll  767
            +G  +  + + W+A+M E+  T  L+F L +  ++  ES+   P L++   + I + + L
Sbjct  30   IGAHEIFTAETWKAAMVELIATGALMFTLTSCSVACLESKEVNPKLLIPFAVFITVYLFL  89

Query  766  laVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTF  587
            + + PVSGGH+NP  TF AAL G++++SRA++Y++AQC+G+V+G   LK+V+   + +T+
Sbjct  90   IVMVPVSGGHMNPIFTFVAALKGVVTLSRALLYVLAQCIGSVIGFFVLKSVMEPKLAHTY  149

Query  586  SLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKv  407
            SLGGC +       +   +  ++   A  LE  C+ + LF  + +A+D ++ K LG   V
Sbjct  150  SLGGCAIG------DKLQSSAINPHDALLLEFSCTLLVLFVGVTVAFDKKRCKELGFPMV  203

Query  406  ftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIAC  227
              VV     L VF+S T+T + GYAG G+NPARC+G AL+ GG LW+GHWIFWVGP +AC
Sbjct  204  CFVVAASFALAVFLSITVTGRPGYAGVGLNPARCLGPALLHGGSLWNGHWIFWVGPFLAC  263

Query  226  VAFYLYTKIIPER  188
            + +Y  + I+P++
Sbjct  264  IIYYSVSIILPKK  276



>ref|XP_008236217.1| PREDICTED: aquaporin TIP1-2-like [Prunus mume]
Length=304

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 109/274 (40%), Positives = 160/274 (58%), Gaps = 6/274 (2%)
 Frame = -1

Query  973  SSHLTLAQKLGLMDFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSil  794
            S  L     +G  ++ S ++WRA+  E+  TA L+F L + +IS  ES    P L++ I 
Sbjct  31   SLRLKFLTAIGAHEYFSPEMWRAAFTELVATASLLFTLTSSIISCLESGEVDPKLLVPIA  90

Query  793  iaivitvlllaVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkav  614
            + I+  + LL   P+SGGH++P  TF AA  G+I+  RA  Y++AQC+G++LG L +K V
Sbjct  91   VFIIAFLFLLVTVPLSGGHMSPVFTFIAAFKGVITFVRASTYILAQCIGSILGFLIIKTV  150

Query  613  vssSIENTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQ  434
            +  +    +SLGGCT+           T G+ T  A  +E  C+FV LF  + +A+D R+
Sbjct  151  MDQNAAQKYSLGGCTIK------GSGSTSGVGTQTALMVEFACTFVVLFVGVTVAFDKRR  204

Query  433  AKVLGHVKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWI  254
             K LG   V  VV   + L VF+S T+T + GYAG G+NPARC+G AL+ GG LWDGHW+
Sbjct  205  CKELGLAMVCAVVAGAMALAVFVSITVTGRVGYAGVGLNPARCLGPALLLGGRLWDGHWV  264

Query  253  FWVGPLIACVAFYLYTKIIPERHFHASGYPHDFF  152
            FWVGP++AC  +Y  +  +P     +     D  
Sbjct  265  FWVGPILACSVYYCVSLNLPNEGLKSVEEECDIL  298



>gb|KDP27599.1| hypothetical protein JCGZ_19604 [Jatropha curcas]
Length=271

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 102/270 (38%), Positives = 162/270 (60%), Gaps = 8/270 (3%)
 Frame = -1

Query  985  EKIPSSHLTLAQKLGLMDFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLI  806
            E I ++      ++G  +  S ++WRA++ E+  TA L+F L   +IS  +S    P L+
Sbjct  6    ETIRTTKTGFLFRIGAHELFSQEMWRAALTELVATACLLFTLTISIISCLDSHEADPKLL  65

Query  805  MSiliaivitvlllaVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgala  626
            +   I I+   LLL   P+SGGH++P  TF AAL G+ ++ RA+ Y++AQC+G+V+  + 
Sbjct  66   IPFTIFIIAFFLLLTTIPLSGGHMSPIFTFIAALKGLTTLVRALFYILAQCIGSVMAYML  125

Query  625  lkavvssSIENTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAY  446
            +K+V+   I   + LGGC +       NG    G+    A  LE  C+FV LF  + + +
Sbjct  126  IKSVMDHRIAEKYYLGGCIID-----GNGK---GIAQTTALVLEFCCTFVVLFVGVTVGF  177

Query  445  DYRQAKVLGHVKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWD  266
            D R+ K LG V V  ++   +GL VF+S ++T + GY G G+NPARC+G AL+ GG LWD
Sbjct  178  DTRRFKELGLVMVCVILAASMGLAVFVSISVTGRAGYGGVGLNPARCLGPALLHGGSLWD  237

Query  265  GHWIFWVGPLIACVAFYLYTKIIPERHFHA  176
            GHW+FWVGP +AC+ ++ ++  +P +   +
Sbjct  238  GHWVFWVGPFLACIFYHAFSFTLPRQEMES  267



>ref|XP_004505805.1| PREDICTED: aquaporin PIP-type-like [Cicer arietinum]
Length=285

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 100/254 (39%), Positives = 163/254 (64%), Gaps = 6/254 (2%)
 Frame = -1

Query  949  KLGLMDFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvl  770
             +G  +F S + W+A+  E+  TA L+  L + +I+  +S    P LI+ I++ I+  + 
Sbjct  38   SIGSHEFFSPETWKAAFTELVATASLMITLTSSIIACLDSHETDPKLIIPIVVFIIAFLF  97

Query  769  llaVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENT  590
            L+   P+SGGH++P  TF AAL G++++SRA++Y++AQC+G+++G   LK V+  ++ NT
Sbjct  98   LIVTIPLSGGHMSPVFTFIAALKGVVTLSRALLYILAQCIGSIIGFYILKCVMDPNLINT  157

Query  589  FSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVK  410
            +SLGGC +     G  G +   +    A  LE  C+F+ LF  + +A+D +++K LG   
Sbjct  158  YSLGGCAI-----GGKG-LNSSIHQHDALLLEFSCTFLVLFLGVTLAFDKKRSKDLGLPM  211

Query  409  vftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIA  230
            +  V+   + L VF+S T+T + GYAG G+NPARC+GAAL  GG LW+GHW+FWVGP++A
Sbjct  212  ICLVIAGAMALAVFVSITVTGRAGYAGVGLNPARCLGAALFHGGSLWNGHWVFWVGPILA  271

Query  229  CVAFYLYTKIIPER  188
            C+ +Y  +  +P  
Sbjct  272  CLMYYSLSINLPNE  285



>gb|KEH30598.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=329

 Score =   167 bits (424),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 113/310 (36%), Positives = 188/310 (61%), Gaps = 15/310 (5%)
 Frame = -1

Query  1042  SSTPTISNGNGNGTHQWTGEKI---PSSHLT--LAQKLGLMDFLSLDVWRASMGEVFGTA  878
             S+   +++ N + + Q T EKI   P + L       LG+ +  S + W+A++ E+  TA
Sbjct  3     STNSRVADENLSMSFQ-TCEKICLGPKTPLKGKFQASLGVHEIFSPETWKAALIELVATA  61

Query  877   VLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVSGGHINPTVTFSAALVG  698
              L+    A +I+  +S+   P LI+   + I+  + L+   P+SGGH++P  TF AAL G
Sbjct  62    SLMVTFTASIIACLDSQELDPKLIIPFAVFIIAFLFLIVTVPLSGGHMSPVFTFIAALKG  121

Query  697   IISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTVTVVAPGPNGPVTVGLD  518
              +++SRA++Y++AQC+G+++G   L  V+   + NT+SLGGC     A G  G +   ++
Sbjct  122   FVTISRALLYVLAQCIGSIIGFYILNCVMDPKLINTYSLGGC-----ALGDKG-LNSSIN  175

Query  517   TVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivlgllvfISTTLTTKKG  338
               +A  LE  C+F+ LF  + +A+D +++K LG   V  VV   + L VF+S T++ + G
Sbjct  176   QHEALLLEFSCTFLVLFLGVTLAFDKKRSKNLGLPLVCLVVAGSMALAVFLSITVSGRTG  235

Query  337   YAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTKIIPERHFHASGYPHD  158
             YAG G+NPARC+GAAL+ GG LW+GHW+FWVGP++AC+ +Y  +  +P+     S +  +
Sbjct  236   YAGVGLNPARCLGAALLHGGSLWNGHWLFWVGPILACLLYYSVSINLPKE---VSVWDDE  292

Query  157   FFSTVKVGLG  128
              +  +K+ LG
Sbjct  293   EYVVLKLPLG  302



>gb|KEH30600.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=316

 Score =   164 bits (414),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 95/254 (37%), Positives = 157/254 (62%), Gaps = 6/254 (2%)
 Frame = -1

Query  949  KLGLMDFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvl  770
             +G  +  S + W+A++ E+  TA L+F L + +I+  +S    P LI+  ++ I+  + 
Sbjct  24   SIGAHEIFSPETWKAALTELVATASLMFTLTSSIIACLDSHEVDPKLIVPFVVFIIAFLF  83

Query  769  llaVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENT  590
            L+   P+SGGH++P  T  A L G++++SRAV+Y++AQC+G+ +G   L  V+   + NT
Sbjct  84   LIVTVPLSGGHMSPVFTCIAVLKGVVTLSRAVLYVLAQCIGSTIGFYILNCVMDPKLINT  143

Query  589  FSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVK  410
            +SLGGC +          +   ++   A  LE  C+F+ LF  + + +D + +K LG   
Sbjct  144  YSLGGCAIG------GKELNSSINQHDALLLEFSCTFLVLFLGVTLGFDKKMSKNLGLTM  197

Query  409  vftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIA  230
            V  V+   + L VF+S T+T + GYAG G+NPARC+GAAL+ GG LW+GHW+FWVGP++A
Sbjct  198  VCLVIAGAMALAVFVSITITGRAGYAGVGLNPARCLGAALIHGGSLWNGHWVFWVGPILA  257

Query  229  CVAFYLYTKIIPER  188
            C+ +Y  +  +P+ 
Sbjct  258  CLIYYSISINLPKE  271



>ref|XP_007131588.1| hypothetical protein PHAVU_011G025800g [Phaseolus vulgaris]
 gb|ESW03582.1| hypothetical protein PHAVU_011G025800g [Phaseolus vulgaris]
Length=280

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 97/253 (38%), Positives = 157/253 (62%), Gaps = 6/253 (2%)
 Frame = -1

Query  916  VWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVSGGH  737
            +WRA++ E+  TA L+F L   +++  +SE   P L++   + I+  + LL   P+SGGH
Sbjct  1    MWRAALTELTATASLMFTLTTSIVACLDSEEVDPKLLVPFAVFIIAFLFLLVTVPLSGGH  60

Query  736  INPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTVTVV  557
            ++P  TF  AL G+++++RA+IY++AQC+G+++G   LK V+   +  T+SLGGC +   
Sbjct  61   MSPVFTFIGALKGVVTLTRALIYVLAQCIGSIIGFFILKCVIDPKLAYTYSLGGCAID--  118

Query  556  APGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivlgl  377
                   V+ G+    A  +E  C+FV LF  + +A+D ++++ LG   V  VV   + L
Sbjct  119  ----GQRVSFGIKAQNALLVEFACTFVVLFVGVTLAFDKKRSRELGLPMVCLVVAGAMAL  174

Query  376  lvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTKII  197
             VF+S T+T + GYAG G+NPARC+G AL+ GG LW GHW+FW+GP +AC+ +Y+ +  +
Sbjct  175  AVFVSITVTGQPGYAGVGLNPARCLGPALLHGGSLWHGHWVFWLGPFLACMLYYVVSINL  234

Query  196  PERHFHASGYPHD  158
            P+         HD
Sbjct  235  PKEDLVWVEGEHD  247



>ref|XP_011046921.1| PREDICTED: aquaporin TIP3-1-like [Populus euphratica]
Length=239

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 95/241 (39%), Positives = 148/241 (61%), Gaps = 8/241 (3%)
 Frame = -1

Query  916  VWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVSGGH  737
            +WRA++ E+  TA L+F L   +IS  ES    P  ++   I ++    LL   P+SGG+
Sbjct  1    MWRATLTELVATACLLFTLTTSIISCLESTTAEPKFLIPFAIFVIAFFFLLTTVPLSGGY  60

Query  736  INPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTVTVV  557
            ++P  TF AAL G+I+  RA+ Y+ AQCVG+++  L +K+V+  + E  +SLGGC +   
Sbjct  61   MSPVFTFIAALEGVITPVRALFYVSAQCVGSIVAYLVIKSVIDKNAEEKYSLGGCMID--  118

Query  556  APGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivlgl  377
                NG    G+    AF LE  C+F+ LF  + +A+D R+ + +G   V  ++   + L
Sbjct  119  ---GNGE---GISPTNAFILEFSCTFIVLFVGVTVAFDKRRCQEIGLQMVCGILAGAMAL  172

Query  376  lvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTKII  197
              F+S ++T + GYAG G+NPARC+G  L++GG LW GHW+FWVGP +AC+ +Y +T  +
Sbjct  173  AFFVSISVTGRAGYAGVGLNPARCLGPLLLKGGRLWYGHWVFWVGPFVACIVYYGFTLTL  232

Query  196  P  194
            P
Sbjct  233  P  233



>ref|XP_003538951.1| PREDICTED: aquaporin PIP2-5-like [Glycine max]
Length=331

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 94/253 (37%), Positives = 159/253 (63%), Gaps = 2/253 (1%)
 Frame = -1

Query  946  LGLMDFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvll  767
            +G  +    ++W+A++ E+  TA L+F L   +I+  +S    P L++   +  +  + L
Sbjct  39   IGAHEIFRPEMWKAALTELTATASLMFTLTTSIIACLDSHEIDPKLLVPFAVFTIAFLFL  98

Query  766  laVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTF  587
            +   P++GGH++P  TF AAL G+++++RA+IY++AQC+G+++G   LK V+   +  T+
Sbjct  99   IVTVPLTGGHMSPVFTFIAALKGVVTLTRALIYVLAQCIGSIIGFFILKCVMDPKLAYTY  158

Query  586  SLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKv  407
            SLGGC ++    G     + G+  + A  +E  C+FV LF  + +A+D ++++ LG   V
Sbjct  159  SLGGCAIS--GQGVINSSSGGIKPLDALLVEFTCTFVVLFVGVTLAFDKKRSRDLGLPMV  216

Query  406  ftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIAC  227
              VV   + L VF+S T+T + GYAG G+NPARC+G AL+ GG LW+GHW+FW+GP +AC
Sbjct  217  CLVVAGAMALAVFVSITVTGRAGYAGVGLNPARCLGPALLHGGLLWEGHWVFWLGPFLAC  276

Query  226  VAFYLYTKIIPER  188
            V +Y  +  +P  
Sbjct  277  VVYYAVSINLPRE  289



>ref|XP_002534036.1| aquaporin transporter, putative [Ricinus communis]
 gb|EEF28349.1| aquaporin transporter, putative [Ricinus communis]
Length=309

 Score =   160 bits (406),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 98/269 (36%), Positives = 162/269 (60%), Gaps = 10/269 (4%)
 Frame = -1

Query  988  GEKIPSSHLTLAQKLGLMDFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNL  809
            G + P+S  +   +LG+ +  S ++WRA+  E+  +A  +F L   +I+  ES    P L
Sbjct  21   GRQFPNS--SFLTRLGVHELYSPEMWRAAFTELVASATFLFTLSTTIIACLESHETAPKL  78

Query  808  IMSiliaivitvlllaVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgal  629
            ++ + +  +    LL   P+SGG  +PT TF AAL G+IS +RA+ Y + QC+GA++G +
Sbjct  79   VIPVAVFFIALFWLLPTVPLSGGFFSPTFTFMAALRGVISFTRALFYCLGQCLGAIIGYI  138

Query  628  alkavvssSIENTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMA  449
             LK+V+  +I + ++LGGC V       NG    G+    A  +E  C+F+ L+ ++ + 
Sbjct  139  ILKSVMDPTIAHKYALGGCMVN-----GNGE---GVSAGTALMIEFSCTFLVLYTAMTIV  190

Query  448  YDYRQAKVLGHVKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLW  269
             D ++ + LG   V  ++     + VF+STT+T + GY G G+NPARC+  AL+ GG LW
Sbjct  191  LDKKKCQDLGLTMVCIIISGAYAVSVFVSTTVTGRVGYGGVGLNPARCLAPALLLGGALW  250

Query  268  DGHWIFWVGPLIACVAFYLYTKIIPERHF  182
            DGHW+FWVGP+ AC  +Y+ + ++P++ F
Sbjct  251  DGHWVFWVGPVCACSVYYVCSLMLPKQGF  279



>gb|AFK39177.1| unknown [Lotus japonicus]
Length=306

 Score =   160 bits (405),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 104/279 (37%), Positives = 174/279 (62%), Gaps = 12/279 (4%)
 Frame = -1

Query  949  KLGLMDFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvl  770
             +G  +F S+++W+A++ E+  +A L+F L + +I+  +S    P LI+   + ++  + 
Sbjct  29   SIGAHEFYSIEMWKAALTELMTSACLMFTLISTIIACLDSHEVDPKLIVPFAVFVITFLF  88

Query  769  llaVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENT  590
            L+   P+SGG I+P  T  AAL G+++++RA+IY++AQC+G+++G   LK+V+   + +T
Sbjct  89   LMVAAPLSGGLISPVFTSIAALKGLVTLARALIYVLAQCIGSIIGFYMLKSVMDPKLVHT  148

Query  589  FSLGGCTVTVVAPGPNGPVTVGLDTVQ---AFWLEVFCSFVFLFASIWMAYDYRQAKVLG  419
            +SLGGC++     G +G V++G    Q      +E  C+FV LF  I +A+D +++K LG
Sbjct  149  YSLGGCSI-----GEDG-VSIGSSLQQHAGVLLVEFACTFVVLFVGITVAFDKKRSKELG  202

Query  418  HVKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGP  239
               V  VV   + L VF+S T+T + GYAG G+NP RC+G AL+ GG LW GHW+FWVGP
Sbjct  203  LPMVCVVVSASVALAVFVSITVTGRAGYAGVGINPGRCLGPALLHGGSLWSGHWVFWVGP  262

Query  238  LIACVAFYLYTKIIPERHFHASGYPHDFFSTVKVGLGIR  122
             +AC+ +Y  +  +P+  F   G+    +  + + LG R
Sbjct  263  FLACIIYYGVSVNMPKEKF---GWVDGEYDILTLALGHR  298



>ref|XP_002534077.1| aquaporin transporter, putative [Ricinus communis]
 gb|EEF28305.1| aquaporin transporter, putative [Ricinus communis]
Length=303

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 96/269 (36%), Positives = 164/269 (61%), Gaps = 10/269 (4%)
 Frame = -1

Query  988  GEKIPSSHLTLAQKLGLMDFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNL  809
            G + P+S  +   ++G+ +  SL++WRA++ E+  +A  +F L   +I+  ES    P L
Sbjct  15   GRQSPNS--SFCTRIGVHELYSLEMWRAAVTELVASATFLFTLSTTIIACLESHETSPKL  72

Query  808  IMSiliaivitvlllaVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgal  629
            ++ +++ ++    LL   P+SGG  +PT  F AAL G+IS  RA+ Y + QC GA++G +
Sbjct  73   VIPVVVFLIAFFWLLTTVPLSGGFFSPTFAFMAALSGVISFVRALFYCLGQCFGAIIGYM  132

Query  628  alkavvssSIENTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMA  449
             LK+V+  +I + ++LGGC V     G    V+ G     A  +E  C+F+ L+ ++ + 
Sbjct  133  ILKSVMDPTIAHKYALGGCMVN----GGGEGVSAG----TALMVEFSCTFLVLYVAMTII  184

Query  448  YDYRQAKVLGHVKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLW  269
             D ++ + LG   V  ++     + VF+STT+T + GY G G+NPARC+  AL+ GG LW
Sbjct  185  LDKKKCQELGLTMVCVIISGAYAVSVFVSTTVTGRIGYGGVGLNPARCLAPALLLGGSLW  244

Query  268  DGHWIFWVGPLIACVAFYLYTKIIPERHF  182
            DGHW+FWVGP+ +C  +Y+++ ++P++ F
Sbjct  245  DGHWVFWVGPICSCSVYYVFSLLLPKQGF  273



>ref|XP_008457641.1| PREDICTED: aquaporin TIP1-2-like [Cucumis melo]
Length=316

 Score =   160 bits (404),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 93/251 (37%), Positives = 153/251 (61%), Gaps = 6/251 (2%)
 Frame = -1

Query  946  LGLMDFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvll  767
            +G  +  S ++W+A+M E+  TA+L+F L   ++S   S    P L++   + I++ + L
Sbjct  36   IGAHELFSQEMWKAAMTELVATALLIFCLTTSIVSCLNSHQSDPKLLIPFAVFIILFLFL  95

Query  766  laVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTF  587
            +  FP+SGG ++P   F AAL G+I+ +RA +Y++AQC+ ++L  L +K  +S  + + +
Sbjct  96   VVTFPLSGGFLSPIFAFIAALHGVITFTRATVYILAQCLASILAFLMIKDAMSPDVADKY  155

Query  586  SLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKv  407
            SLGGCT+      P      GL    A  LE  C+FV L+  + +  D + ++  G   V
Sbjct  156  SLGGCTIRGTGETP------GLSVTTALILEFACTFVVLYVGVTVVLDQKMSERFGLPMV  209

Query  406  ftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIAC  227
              ++     + VF+STT+T + GY G G++PARC+G A++RGG LW+GHW+FWVGP  AC
Sbjct  210  CGMIAASSAVAVFVSTTITGRAGYGGVGLSPARCLGPAVLRGGLLWEGHWVFWVGPFAAC  269

Query  226  VAFYLYTKIIP  194
            V +Y ++K +P
Sbjct  270  VVYYGFSKNLP  280



>ref|XP_004150077.1| PREDICTED: probable aquaporin TIP3-1-like [Cucumis sativus]
 ref|XP_004158414.1| PREDICTED: probable aquaporin TIP3-1-like [Cucumis sativus]
 gb|KGN61890.1| hypothetical protein Csa_2G263850 [Cucumis sativus]
Length=319

 Score =   159 bits (401),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 93/252 (37%), Positives = 157/252 (62%), Gaps = 6/252 (2%)
 Frame = -1

Query  946  LGLMDFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvll  767
            +G+ +  S ++W+A+M E+  T++L+F L   ++S   S    P L++ I + I++ + L
Sbjct  34   IGVHELFSQEMWKAAMTELVATSLLIFCLTTSIVSCLNSHQSDPKLLIPIAVFIILFLFL  93

Query  766  laVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTF  587
            +  FP+SGG ++P   F AAL G+I+ +RA IY++AQC+G++L  L +K  ++  + + +
Sbjct  94   VVTFPLSGGFLSPIFAFIAALHGVITFTRATIYILAQCLGSILAFLMIKDAMNPDVADKY  153

Query  586  SLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKv  407
            SLGGCT+      P      GL    A  LE  C+FV L+  + +  D + ++  G   V
Sbjct  154  SLGGCTIRGTGETP------GLSLTTALVLEFACTFVVLYVGVTVVLDQKMSEQFGLPMV  207

Query  406  ftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIAC  227
              ++     + VF+STT+T + GY G G++PARC+G A++RGG LW+GHW+FWVGP +AC
Sbjct  208  CGMIAASSAVAVFVSTTITGRAGYGGVGLSPARCLGPAVLRGGLLWEGHWVFWVGPFVAC  267

Query  226  VAFYLYTKIIPE  191
            V +Y ++  +P+
Sbjct  268  VVYYGFSMNLPK  279



>ref|XP_009799368.1| PREDICTED: uncharacterized protein LOC104245461 [Nicotiana sylvestris]
Length=250

 Score =   155 bits (391),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 107/189 (57%), Positives = 139/189 (74%), Gaps = 17/189 (9%)
 Frame = -1

Query  1102  FGDEESHPHQNGGSNRVEDVSSTPTISNGNGNGTHQWTGEKIPSSHLTLAQKLGLMDFLS  923
              GDEES     G SN+++ ++ST                EK   + LT+A++LGL DF S
Sbjct  63    LGDEESQSISFGSSNKIQPITSTQK---------QVLDDEKKRYTSLTMAERLGLPDFFS  113

Query  922   LDVWRASM--------GEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvll  767
             LD+  ++M        GE+ G+AVLVF+LD IVIST ES+VKMPNLIMSILIAI +T+L+
Sbjct  114   LDLTLSNMLLTCVYRFGELLGSAVLVFILDTIVISTLESDVKMPNLIMSILIAITLTILI  173

Query  766   laVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTF  587
             LAVFPVSGGHI+P ++FS+ALVG+ISM++A+IY+  QC+GA+L ALALKAVVSS+IE  F
Sbjct  174   LAVFPVSGGHISPVISFSSALVGLISMTQAIIYITTQCLGAILSALALKAVVSSTIEQRF  233

Query  586   SLGGCTVTV  560
             SLGGCT+TV
Sbjct  234   SLGGCTITV  242



>gb|KHN32315.1| Putative aquaporin PIP2-6 [Glycine soja]
Length=268

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 87/228 (38%), Positives = 144/228 (63%), Gaps = 2/228 (1%)
 Frame = -1

Query  871  VFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVSGGHINPTVTFSAALVGII  692
            +F L   +I+  +S    P L++   +  +  + L+   P++GGH++P  TF AAL G++
Sbjct  1    MFTLTTSIIACLDSHEIDPKLLVPFAVFTIAFLFLIVTVPLTGGHMSPVFTFIAALKGVV  60

Query  691  SMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTVTVVAPGPNGPVTVGLDTV  512
            +++RA+IY++AQC+G+++G   LK V+   +  T+SLGGC ++    G     + G+  +
Sbjct  61   TLTRALIYVLAQCIGSIIGFFILKCVMDPKLAYTYSLGGCAIS--GQGVINSSSGGIKPL  118

Query  511  QAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivlgllvfISTTLTTKKGYA  332
             A  +E  C+FV LF  + +A+D ++++ LG   V  VV   + L VF+S T+T + GYA
Sbjct  119  DALLVEFTCTFVVLFVGVTLAFDKKRSRDLGLPMVCLVVAGAMALAVFVSITVTGRAGYA  178

Query  331  GAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTKIIPER  188
            G G+NPARC+G AL+ GG LW+GHW+FW+GP +ACV +Y  +  +P  
Sbjct  179  GVGLNPARCLGPALLHGGLLWEGHWVFWLGPFLACVVYYAVSINLPRE  226



>ref|XP_010088680.1| Aquaporin PIP-type [Morus notabilis]
 gb|EXB36847.1| Aquaporin PIP-type [Morus notabilis]
Length=331

 Score =   149 bits (377),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 103/252 (41%), Positives = 153/252 (61%), Gaps = 6/252 (2%)
 Frame = -1

Query  946  LGLMDFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvll  767
            +G  +F S ++WRA++ E   TA L+F L   +IS  +S    P L++   + I+  + L
Sbjct  50   IGAHEFFSPEMWRAALTESVATACLMFSLTCSIISCLDSHQADPKLLVPFAVFIIAFLFL  109

Query  766  laVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTF  587
            +   P++GGH++P  TF +AL G+I++SRA IY++AQCVG+++G L +KA ++      +
Sbjct  110  IVTVPLTGGHMSPVFTFISALKGVITLSRASIYVLAQCVGSLMGFLVIKAAMNKPAAEKY  169

Query  586  SLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKv  407
             LGGC +              L+   A  LE  C+FV LF  + +A D R+ K LG V V
Sbjct  170  FLGGCGIMGHGGANR------LEPNTALVLEFACTFVVLFVGVTVALDERRCKELGLVMV  223

Query  406  ftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIAC  227
              VV   +GL VF+S T+T + GYAG G+NPARC+G AL+ GG LW GHW+FWVGP +AC
Sbjct  224  CVVVAGSMGLAVFVSITVTGRAGYAGVGLNPARCLGPALLIGGELWYGHWVFWVGPFLAC  283

Query  226  VAFYLYTKIIPE  191
              +Y  +  +P 
Sbjct  284  SLYYGISMNLPR  295



>gb|KHN32316.1| Aquaporin PIP1-5 [Glycine soja]
Length=247

 Score =   145 bits (366),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 87/209 (42%), Positives = 136/209 (65%), Gaps = 8/209 (4%)
 Frame = -1

Query  754  PVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGG  575
            P+SGGH+NP  TF AAL G++++SRA++Y+ AQC+G+++G   LK+V+   + +T+SLGG
Sbjct  32   PLSGGHMNPIFTFIAALKGVVTLSRALLYVSAQCIGSIIGFFVLKSVMEPKLADTYSLGG  91

Query  574  CTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvv  395
            C +  +     G +  G+    A  LE  C+F+ LF  + +A+D ++ K LG   V  VV
Sbjct  92   CALGDL----KGKIP-GIKPQDALLLEFSCTFLVLFLGLTLAFDKKRCKELGLPMVCLVV  146

Query  394  givlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFY  215
               L L VF+S T+T + GYAGAG++PARC+G AL+ GG LW+GHW+FW+GP +AC+ +Y
Sbjct  147  AASLALAVFVSITVTGRPGYAGAGLSPARCLGPALLLGGPLWNGHWVFWLGPFLACIIYY  206

Query  214  LYTKIIPERHFHASGYPHDFFSTVKVGLG  128
              +  +P++        +D    +K+ LG
Sbjct  207  SVSINLPKKDLDGVDGEYD---VLKLALG  232



>gb|AEQ29860.1| aquaporin XIP [Malus prunifolia]
Length=106

 Score =   140 bits (353),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 89/106 (84%), Gaps = 0/106 (0%)
 Frame = -1

Query  517  TVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivlgllvfISTTLTTKKG  338
            T QA WLE+ C+FVFLFASIW+A+D+RQA  LG V VF++VGIV GLLVFISTT+T  KG
Sbjct  1    TTQALWLEIICTFVFLFASIWIAFDHRQAHALGRVVVFSIVGIVAGLLVFISTTVTAAKG  60

Query  337  YAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTKI  200
            YAG GMNPARC G A++RGG LW+GHW+FWVGP++ACV FY Y KI
Sbjct  61   YAGVGMNPARCFGPAVIRGGRLWNGHWVFWVGPIVACVTFYSYIKI  106



>ref|XP_002534078.1| aquaporin transporter, putative [Ricinus communis]
 gb|EEF28306.1| aquaporin transporter, putative [Ricinus communis]
Length=285

 Score =   144 bits (363),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 89/259 (34%), Positives = 148/259 (57%), Gaps = 8/259 (3%)
 Frame = -1

Query  916  VWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVSGGH  737
            +WRA++ E+  T   +F L   +I+  ES    P L++ I +  +  + L+   P+SGG 
Sbjct  1    MWRAAVTELVATGTFLFTLSTTIIACLESHESDPKLLIPIAVFFIAFLWLMVTVPLSGGL  60

Query  736  INPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTVTVV  557
             +P  +F AAL G+I+  RA+ Y + Q +GA++  L LK V+  ++ + ++L GC V   
Sbjct  61   FSPAFSFIAALRGVITFVRALFYSLGQLLGALIAYLILKGVMDPNMAHKYALAGCMVN--  118

Query  556  APGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivlgl  377
              G    V+VG     A  +E+ C+F+ L+ ++ +  D ++   LG   V  ++  +   
Sbjct  119  --GNGAGVSVG----TALIIEILCTFMVLYVAMTIILDKQKCMDLGLTTVCVIISGIYAA  172

Query  376  lvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTKII  197
             VF+S T+T + GY G G+NPARC+G  L+ GG LW+GHW+FWVGP  AC+ +Y Y+ ++
Sbjct  173  SVFVSITVTGRPGYGGVGLNPARCLGPVLLMGGALWEGHWVFWVGPFCACMIYYAYSLML  232

Query  196  PERHFHASGYPHDFFSTVK  140
            P+R F  +    D    V+
Sbjct  233  PKRGFVRADIEEDIIKLVR  251



>gb|KHN05474.1| Putative aquaporin PIP2-6, partial [Glycine soja]
Length=215

 Score =   136 bits (342),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 119/180 (66%), Gaps = 6/180 (3%)
 Frame = -1

Query  754  PVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGG  575
            P++GGH++P  TF AAL G+++++RA+IY++AQC+G+++G   LK V+   +  T+SLGG
Sbjct  5    PLTGGHMSPVFTFIAALKGVVTLTRALIYVLAQCIGSIIGFFILKCVMDPKLAYTYSLGG  64

Query  574  CTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvv  395
            C +     G N     G     A  +E  C+FV LF ++ +A+D ++++ LG + V  +V
Sbjct  65   CAID--GQGANS----GFKPQDALLVEFTCTFVVLFGAVTLAFDKKRSRDLGLLMVCLLV  118

Query  394  givlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFY  215
               + L  F+S TLT +  YAG G+NPARC+G AL+ GG LW+GHW+ W+G  +ACV +Y
Sbjct  119  AGAMALASFVSITLTGQASYAGVGLNPARCLGPALLHGGSLWEGHWVLWLGSFLACVVYY  178



>ref|XP_003540625.1| PREDICTED: probable aquaporin PIP1-2-like [Glycine max]
Length=328

 Score =   134 bits (336),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 76/181 (42%), Positives = 119/181 (66%), Gaps = 7/181 (4%)
 Frame = -1

Query  754  PVSGGHINPTVTFSAALVGIISMSRAVIYMVAQ-CvgavlgalalkavvssSIENTFSLG  578
            P++GGH++P  TF AAL G+++++RA+IY++AQ C+G+++G   LK V+   +  T+SLG
Sbjct  104  PLTGGHMSPVFTFIAALKGVVTLTRALIYVLAQLCIGSIIGFFILKCVMDPKLAYTYSLG  163

Query  577  GCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftv  398
            GC +     G N     G     A  +E  C+FV LF ++ +A+D ++++ LG + V  +
Sbjct  164  GCAID--GQGANS----GFKPQDALLVEFTCTFVVLFGAVTLAFDKKRSRDLGLLMVCLL  217

Query  397  vgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAF  218
            V   + L  F+S TLT +  YAG G+NPARC+G AL+ GG LW+GHW+ W+G  +ACV +
Sbjct  218  VAGAMALAAFVSITLTGQASYAGVGLNPARCLGPALLHGGSLWEGHWVLWLGSFLACVVY  277

Query  217  Y  215
            Y
Sbjct  278  Y  278



>emb|CBI37943.3| unnamed protein product [Vitis vinifera]
Length=154

 Score =   129 bits (323),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 103/149 (69%), Gaps = 12/149 (8%)
 Frame = -1

Query  1099  GDEESHPHQNGGSNRVEDVSSTPTISNGNGNGTHQWTGEKIPSSHLTLAQKLGLMDFLSL  920
             GDEE +PH NG   R++ V STP           QW  E+    + T+ ++LGL +  S 
Sbjct  9     GDEE-NPH-NG--IRIQPVLSTPM--------AEQWKSEEGKKMNTTMGERLGLNELFSP  56

Query  919   DVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVSGG  740
              VWRAS+ E+ GTA+LVF+LD IVIS+ +++ K PNLIMS+++AI I +LLLA  PVSGG
Sbjct  57    QVWRASLAELLGTALLVFLLDTIVISSIQTQTKTPNLIMSVVVAITIAILLLATIPVSGG  116

Query  739   HINPTVTFSAALVGIISMSRAVIYMVAQC  653
             HINP +TFSAAL+G+IS SRA +Y +AQ 
Sbjct  117   HINPVITFSAALLGLISFSRAAVYFLAQL  145



>ref|XP_002961944.1| hypothetical protein SELMODRAFT_76794, partial [Selaginella moellendorffii]
 gb|EFJ37204.1| hypothetical protein SELMODRAFT_76794, partial [Selaginella moellendorffii]
Length=277

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 100/268 (37%), Positives = 146/268 (54%), Gaps = 13/268 (5%)
 Frame = -1

Query  922  LDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVSG  743
            L VWR+ + E   T   VF    I++S  +     P   +S+L  +VI+ L+L+V P SG
Sbjct  1    LQVWRSCLVECLATGAFVFASILIIVSCSQQSAS-PMTAISVLHFLVISFLILSVAPSSG  59

Query  742  GHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTVT  563
            GH+NP +TF A ++G +S SR V+Y  AQC+G++ G+L +K V+   + + F+LGGCT+ 
Sbjct  60   GHLNPCITFMAMVLGYVSPSRVVMYTGAQCIGSIFGSLCMKLVLPHEVAHKFALGGCTI-  118

Query  562  VVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivl  383
                        G     AF  E F +F  +F    +A D  +A V G +   T +   +
Sbjct  119  ------RNSAGAGFPVGSAFVAETFFTFFLMFIVATLALDPFRAPVFGAILAPTFIAAAV  172

Query  382  gllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGH---LWDGHWIFWVGPLIACVAFYL  212
            G+LVF+S  L    GY+GAGMNPARC+G A+V G H   LW GHW++WV P  A V   +
Sbjct  173  GVLVFVSGGLAL--GYSGAGMNPARCIGPAVVMGSHNEELWRGHWLWWVAPYFATVLVAV  230

Query  211  YTKIIPERHFHASGYPHDFFSTVKVGLG  128
               ++P  H        DF S++K   G
Sbjct  231  VYCLVPPHHVDIYRGRKDFISSLKKAFG  258



>ref|XP_002971142.1| hypothetical protein SELMODRAFT_94691, partial [Selaginella moellendorffii]
 gb|EFJ27740.1| hypothetical protein SELMODRAFT_94691, partial [Selaginella moellendorffii]
Length=277

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 100/268 (37%), Positives = 146/268 (54%), Gaps = 13/268 (5%)
 Frame = -1

Query  922  LDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVSG  743
            L VWR+ + E   T   VF    I++S  +     P   +S+L  +VI+ L+L+V P SG
Sbjct  1    LQVWRSCLVECLATGAFVFASILIIVSCSQQSAS-PMTSISVLHFLVISFLILSVAPSSG  59

Query  742  GHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTVT  563
            GH+NP +TF A ++G +S SR V+Y  AQC+G++ G+L +K V+   + + F+LGGCT+ 
Sbjct  60   GHLNPCITFMAMVLGYVSPSRVVMYTGAQCIGSIFGSLCMKLVLPHEVAHKFALGGCTI-  118

Query  562  VVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivl  383
                        G     AF  E F +F  +F    +A D  +A V G +   T +   +
Sbjct  119  ------RNSAGAGFPVGSAFVAETFFTFFLMFIVATLALDPFRAPVFGAILAPTFIAAAV  172

Query  382  gllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGH---LWDGHWIFWVGPLIACVAFYL  212
            G+LVF+S  L    GY+GAGMNPARC+G A+V G H   LW GHW++WV P  A V   +
Sbjct  173  GVLVFVSGGLAL--GYSGAGMNPARCIGPAVVMGSHNEELWRGHWLWWVAPYFATVLVAV  230

Query  211  YTKIIPERHFHASGYPHDFFSTVKVGLG  128
               ++P  H        DF S++K   G
Sbjct  231  VYCLVPPHHVDIYRGRKDFISSLKKAFG  258



>ref|XP_002533600.1| aquaporin transporter, putative [Ricinus communis]
 gb|EEF28782.1| aquaporin transporter, putative [Ricinus communis]
Length=243

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 95/146 (65%), Gaps = 13/146 (9%)
 Frame = -1

Query  1078  HQNG-GSNRVEDVSSTP---TISNGNGNGTHQWTGEKIPSSHLTLAQKLGLMDFLSLDVW  911
              +NG G  RV+  +STP    + N NG      T         T ++ LGL +  SL+VW
Sbjct  11    EENGYGGRRVQPFASTPLGAALDNTNGGKKQNPT---------TFSRVLGLEELSSLNVW  61

Query  910   RASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVSGGHIN  731
             RAS+ EV GTA LVF  D IVISTYE+E K PNLIM+ LIA+ +T+LL A FP+SGGHIN
Sbjct  62    RASVAEVLGTAALVFATDTIVISTYETETKTPNLIMAALIAMTVTILLTATFPISGGHIN  121

Query  730   PTVTFSAALVGIISMSRAVIYMVAQC  653
             P +T SAA  G++S  RA +Y++AQC
Sbjct  122   PVITISAAFTGLVSPVRAAVYILAQC  147


 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -1

Query  355  LTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAF  218
            L T    +GAG+NPARC G A+VRG HLW+GHW+FWVGP IACVAF
Sbjct  197  LLTTVPLSGAGINPARCFGPAIVRGDHLWNGHWVFWVGPFIACVAF  242



>gb|EPS60236.1| hypothetical protein M569_14568, partial [Genlisea aurea]
Length=107

 Score =   105 bits (263),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 77/107 (72%), Gaps = 1/107 (1%)
 Frame = -1

Query  445  DYRQAKVLGHVKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWD  266
            D RQA  LG VKVF+ VG+++GLLV++S+++T + GY G G+NPARC G A+VRGGHLW+
Sbjct  1    DRRQAAALGIVKVFSFVGLMVGLLVYLSSSVTGRVGYTGVGLNPARCFGPAVVRGGHLWN  60

Query  265  GHWIFWVGPLIACVAFYLYTKIIPERHFHAS-GYPHDFFSTVKVGLG  128
            GHW+FW GP IA V FY+Y KIIP +H      Y HDF   + +  G
Sbjct  61   GHWVFWAGPGIASVLFYVYVKIIPSQHHRPKHSYDHDFLHVINILFG  107



>ref|XP_006379271.1| hypothetical protein POPTR_0009s13105g [Populus trichocarpa]
 gb|ERP57068.1| hypothetical protein POPTR_0009s13105g [Populus trichocarpa]
Length=218

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 67/165 (41%), Positives = 102/165 (62%), Gaps = 8/165 (5%)
 Frame = -1

Query  754  PVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGG  575
            P+SGGH++P  TF  AL G+I+  RA+  + AQC+G+++  L +K+V+  + E  +SL G
Sbjct  62   PLSGGHMSPVFTFIDALEGVITPVRALFSVSAQCIGSIVAYLVIKSVMDKNTEEKYSLDG  121

Query  574  CTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvv  395
            C +       NG    G+    AF LE  C+F+ LF  + +A+D R+ K LG   V  ++
Sbjct  122  CMID-----GNGE---GISPTNAFILEFSCTFIVLFVGVTVAFDKRRCKELGLQMVCGIL  173

Query  394  givlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGH  260
               + L  F+S ++T K GYAG G+NPARC+G +L++GG LW GH
Sbjct  174  AEAMTLAFFVSISVTGKAGYAGVGLNPARCLGPSLLKGGRLWYGH  218



>gb|EPS60023.1| hypothetical protein M569_14781, partial [Genlisea aurea]
Length=107

 Score =   102 bits (255),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 78/107 (73%), Gaps = 1/107 (1%)
 Frame = -1

Query  445  DYRQAKVLGHVKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWD  266
            D RQA  LG V+VF+ VG+++GLLV++S+++T + GY+G G+NPARC G A+VRGGHLW+
Sbjct  1    DRRQAAALGIVRVFSFVGLMVGLLVYLSSSVTGRVGYSGVGLNPARCFGPAVVRGGHLWN  60

Query  265  GHWIFWVGPLIACVAFYLYTKIIPERHFHAS-GYPHDFFSTVKVGLG  128
            GHW+FW GP IA V FY+Y KI P +H      + HDF   +K+  G
Sbjct  61   GHWVFWAGPGIASVLFYVYVKISPSQHHRPKHSHDHDFLHVIKILFG  107



>ref|XP_002961942.1| hypothetical protein SELMODRAFT_403379 [Selaginella moellendorffii]
 gb|EFJ37202.1| hypothetical protein SELMODRAFT_403379 [Selaginella moellendorffii]
Length=297

 Score =   107 bits (266),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 98/281 (35%), Positives = 151/281 (54%), Gaps = 12/281 (4%)
 Frame = -1

Query  973  SSHLTLAQKLGLMDFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKM-PNLIMSi  797
            +S L + + L L DF++L+ WR+ + E   T   VF    I++S+ +      P   ++I
Sbjct  16   ASSLQILKFLQLQDFITLEAWRSCLVECLATIAFVFSSILIIVSSSQQSSSGSPMASIAI  75

Query  796  liaivitvlllaVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalka  617
            L +I++ +++L+V P SGGH NP +TF A ++G +S S+ V+Y  AQCVG++  +L  K 
Sbjct  76   LHSILVFIIILSVAPSSGGHFNPCITFLAMVLGYVSPSKLVMYTGAQCVGSIFASLCAKL  135

Query  616  vvssSIENTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYR  437
            V+   +   F+LGGC +             GL    AF  E   +FV +F    +A D  
Sbjct  136  VLPDDLALKFALGGCVM-------QNSAGSGLSIGSAFVAESMFTFVLMFVVANLALDPF  188

Query  436  QAKVLGHVKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRG-GHLWDGH  260
            Q +  G +   + +G  +GLL+F S  L    GY+GAGMNPARC+G A+V G     DGH
Sbjct  189  QGRAFGAILPPSFIGAAVGLLIFASGGLVV--GYSGAGMNPARCLGPAVVMGSSSTRDGH  246

Query  259  WIFWVGPLIACVAFYLYTKIIPERHFHASGYPH-DFFSTVK  140
            W++W+ P  A V   +   ++P  H    G    D  S+VK
Sbjct  247  WVWWIAPYSATVMVSVLYCLVPPHHALYRGREDLDLVSSVK  287



>ref|XP_007201100.1| hypothetical protein PRUPE_ppa024682mg, partial [Prunus persica]
 gb|EMJ02299.1| hypothetical protein PRUPE_ppa024682mg, partial [Prunus persica]
Length=147

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/126 (48%), Positives = 80/126 (63%), Gaps = 6/126 (5%)
 Frame = -1

Query  601  IENTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVL  422
            +E  F LGGCT+       NG  T G+    AF LE  C+F+ LF  I +A+D +++K +
Sbjct  22   LEQKFLLGGCTLNA-----NGE-THGISPGDAFLLEFVCTFLLLFVGITVAFDKKRSKEV  75

Query  421  GHVKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVG  242
            G   V   +   +GL VFIS T+T   GY+G G+NPARC+G ALVRGG LW GHW+FW  
Sbjct  76   GPPWVCFKLSAPMGLGVFISITITGTAGYSGIGLNPARCLGPALVRGGSLWHGHWVFWFA  135

Query  241  PLIACV  224
            P++ACV
Sbjct  136  PILACV  141



>ref|XP_002534035.1| aquaporin transporter, putative [Ricinus communis]
 gb|EEF28348.1| aquaporin transporter, putative [Ricinus communis]
Length=208

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 65/181 (36%), Positives = 114/181 (63%), Gaps = 8/181 (4%)
 Frame = -1

Query  961  TLAQKLGLMDFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaiv  782
            T   ++G  +F S ++WRA   E+  TA L+FML   +I+  ES+   P L++ I++ ++
Sbjct  19   TFLARIGAHEFFSPEMWRAVATELVATACLLFMLTTTIIACLESKETEPKLLIPIVVFVI  78

Query  781  itvlllaVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssS  602
            + ++L+   P+SGGH++P  TF AAL G+IS+ RA+ Y++AQCVG+++  L +K+V+  +
Sbjct  79   VFLVLVVTVPLSGGHMSPVFTFIAALRGLISLVRALFYVLAQCVGSIMAYLVIKSVMDET  138

Query  601  IENTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVL  422
            + + ++LGGC V       NG    G+ T  A  +E  C+F+ L+ +I +A+D +  + L
Sbjct  139  VADKYALGGCMV-----NGNGA---GVSTGTALVIEFACTFLVLYVAITVAFDKKMCQEL  190

Query  421  G  419
            G
Sbjct  191  G  191



>ref|XP_006387176.1| hypothetical protein POPTR_1606s00200g [Populus trichocarpa]
 gb|ERP46090.1| hypothetical protein POPTR_1606s00200g [Populus trichocarpa]
Length=132

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = -1

Query  364  STTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTKIIPERH  185
            STT+T  KGYAG GMNPARC+G ALVRGGHLW GHW+ WVG ++A VAF LYTK+I   H
Sbjct  66   STTVTATKGYAGVGMNPARCLGPALVRGGHLWKGHWVLWVGSVVASVAFSLYTKMISREH  125

Query  184  F  182
             
Sbjct  126  L  126



>ref|XP_001758094.1| predicted protein [Physcomitrella patens]
 gb|EDQ76916.1| predicted protein [Physcomitrella patens]
Length=202

 Score = 96.7 bits (239),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 104/172 (60%), Gaps = 4/172 (2%)
 Frame = -1

Query  754  PVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGG  575
            P +GGH+NP +T++  L G IS  R V+Y++ Q +G+++G+   K VV +++   ++LGG
Sbjct  21   PATGGHVNPCITWTEMLTGHISPVRGVLYIIGQILGSIVGSFMAKIVVGNALATQYNLGG  80

Query  574  CTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvv  395
            C +       +G   +GL T +A  LE+  +F  LF S  +A D  +    G+     ++
Sbjct  81   CYLQSRVSATSG--MMGLGTGRALVLEIVLAFFVLFISYSVALDPPRLPRTGYTLAPFMI  138

Query  394  givlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGP  239
            G ++GL +F    L +  GY GAG+NP RC+G A+V GG +W GHW+FWVGP
Sbjct  139  GGIVGLCIFAGAGLFS--GYGGAGINPGRCIGPAVVLGGSMWTGHWVFWVGP  188



>ref|XP_006964252.1| predicted protein [Trichoderma reesei QM6a]
 gb|EGR49911.1| predicted protein [Trichoderma reesei QM6a]
 gb|ETS03250.1| aquaporin-like protein [Trichoderma reesei RUT C-30]
Length=294

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 81/257 (32%), Positives = 119/257 (46%), Gaps = 28/257 (11%)
 Frame = -1

Query  934  DFLSLDVWRASMGEVFGTAVLVFMLDAIV--ISTYESE-----VKMPNLIMSiliaivit  776
             +L + VW++++ E+  T+ LVF+   I   I  Y +      + + N+I+         
Sbjct  34   QWLDVSVWKSAVVEMVATSCLVFLSGQITATIEGYGTPQVGGYIGISNIILLSTFIYATA  93

Query  775  vlllaVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIE  596
                   P SGGH+NP +TFSA L G+ S+ R ++YM AQ +G  L    L  V      
Sbjct  94   -------PASGGHLNPMITFSAILTGLCSVPRGILYMSAQTLGGALAGGLLLGVWGHERA  146

Query  595  NTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGH  416
             +   GGC        P           Q +  EVF SFV LF S  +  D RQA + G 
Sbjct  147  TSLQGGGCWYDPSQASPG----------QVYLNEVFSSFVLLFLSFGVGLDPRQAALFGP  196

Query  415  VKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPL  236
                 +VG  LGL+ F S+ +    GYAGA MNP+RC+   + R    +   W++W GP 
Sbjct  197  RMGPLLVGASLGLVTFSSSGII--PGYAGAQMNPSRCLAFGIARRNMSY--QWVWWFGPA  252

Query  235  IACVAFYLYTKIIPERH  185
            +  +   L   +IP  H
Sbjct  253  VGGLIEALLYNLIPPHH  269



>ref|XP_002971144.1| hypothetical protein SELMODRAFT_36558, partial [Selaginella moellendorffii]
 gb|EFJ27742.1| hypothetical protein SELMODRAFT_36558, partial [Selaginella moellendorffii]
Length=230

 Score = 89.0 bits (219),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 97/178 (54%), Gaps = 10/178 (6%)
 Frame = -1

Query  754  PVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGG  575
            P SGGH NP +TF A ++G +S S+ V+Y  AQCVG++  +L  K V+   +   F+LGG
Sbjct  56   PSSGGHFNPCITFLAMVLGYVSPSKLVMYTGAQCVGSIFASLCAKLVLPDDLALKFALGG  115

Query  574  CTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvv  395
            C +             GL    AF  E   +FV +F    +A D  Q +  G +   + +
Sbjct  116  CVM-------QNSAGSGLSIGSAFVAESMFTFVLMFVVANLALDPFQGRAFGAILPPSFI  168

Query  394  givlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRG-GHLWDGHWIFWVGPLIACV  224
            G   GLL+F S  L    GY+GAGMNPARC+G A+V G     DGHW++W+ P  A V
Sbjct  169  GAAAGLLIFASGGLVV--GYSGAGMNPARCLGPAVVMGSSSTRDGHWVWWIAPYSATV  224



>dbj|BAE65943.1| unnamed protein product [Aspergillus oryzae RIB40]
 gb|EIT82429.1| hypothetical protein Ao3042_00451 [Aspergillus oryzae 3.042]
 gb|KDE81971.1| hypothetical protein AO1008_08561 [Aspergillus oryzae 100-8]
Length=317

 Score = 90.1 bits (222),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 89/279 (32%), Positives = 131/279 (47%), Gaps = 32/279 (11%)
 Frame = -1

Query  985  EKIPSSH--LTLAQKLGLMDFLSLDVWR-------ASMGEVFGTAVLVFMLDAIV-----  848
            EK+P +   ++L++   L  FLSLD+W+       ASM  VF +A +     A V     
Sbjct  48   EKVPDAAPWMSLSEIFDLRGFLSLDLWKFACLECIASMMNVFISAWVTLHEPAAVEAPKT  107

Query  847  -ISTYESEVKMPNLIMSiliaivitvlllaVFPVSGGHINPTVTFSAALVGIISMSRAVI  671
             +  Y +      L   +   ++  +L+    P SGGHI+PT+T +     II+  RA++
Sbjct  108  EVGIYHTVTFFSPLFGGLTNLLLTPLLIYTFAPSSGGHISPTITLATLFARIITFPRAIL  167

Query  670  YMVAQCvgavlgalalkavvssSIENTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEV  491
            YM  Q +G  L   A+           F++GGC V           T  +    A  +E 
Sbjct  168  YMAGQTLGGALAGFAIHTAYG---SRDFTVGGCHVD----------TTLVPVNAALIIEF  214

Query  490  FCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivlgllvfISTTLTTKKGYAGAGMNPA  311
            F   V +F +  +A D RQAK+ GH     +VG+VLG++ +   T  T+ GY GA +NPA
Sbjct  215  FACLVLIFLAFGVALDPRQAKIFGHAAGPWLVGVVLGVVCW--ATAFTRPGYIGASLNPA  272

Query  310  RCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTKIIP  194
            RC G  +         HW+ WV PL A VA  L   I P
Sbjct  273  RCFGVYV--ASEFPGYHWVHWVAPLAAAVAHGLVYLIDP  309



>ref|XP_002384305.1| aquaporin, putative [Aspergillus flavus NRRL3357]
 gb|EED45369.1| aquaporin, putative [Aspergillus flavus NRRL3357]
Length=317

 Score = 90.1 bits (222),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 89/279 (32%), Positives = 131/279 (47%), Gaps = 32/279 (11%)
 Frame = -1

Query  985  EKIPSSH--LTLAQKLGLMDFLSLDVWR-------ASMGEVFGTAVLVFMLDAIV-----  848
            EK+P +   ++L++   L  FLSLD+W+       ASM  VF +A +     A V     
Sbjct  48   EKVPDAAPWMSLSEIFDLRGFLSLDLWKFACLECIASMMNVFISAWVTLHEPAAVEAPKT  107

Query  847  -ISTYESEVKMPNLIMSiliaivitvlllaVFPVSGGHINPTVTFSAALVGIISMSRAVI  671
             +  Y +      L   +   ++  +L+    P SGGHI+PT+T +     II+  RA++
Sbjct  108  EVGIYHTVTFFSPLFGGLTNLLLTPLLIYTFAPSSGGHISPTITLATLFARIITFPRAIL  167

Query  670  YMVAQCvgavlgalalkavvssSIENTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEV  491
            YM  Q +G  L   A+           F++GGC V           T  +    A  +E 
Sbjct  168  YMAGQTLGGALAGFAIHTAYG---SRDFTVGGCHVD----------TTLVPVNAALIIEF  214

Query  490  FCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivlgllvfISTTLTTKKGYAGAGMNPA  311
            F   V +F +  +A D RQAK+ GH     +VG+VLG++ +   T  T+ GY GA +NPA
Sbjct  215  FACLVLIFLAFGVALDPRQAKIFGHAAGPWLVGVVLGVVCW--ATAFTRPGYIGASLNPA  272

Query  310  RCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTKIIP  194
            RC G  +         HW+ WV PL A VA  L   I P
Sbjct  273  RCFGVYV--ASEFPGYHWVHWVAPLAAAVAHGLVYLIDP  309



>gb|EHK42605.1| hypothetical protein TRIATDRAFT_319992 [Trichoderma atroviride 
IMI 206040]
Length=341

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 80/251 (32%), Positives = 118/251 (47%), Gaps = 28/251 (11%)
 Frame = -1

Query  916  VWRASMGEVFGTAVLVFMLDAIV--ISTYESE-----VKMPNLIMSiliaivitvlllaV  758
            +WR+++ E+  T   VF+   IV  ISTY +      + + NL++       +       
Sbjct  80   LWRSAVVELIATCCQVFVSGQIVATISTYGTPQLGAYIGISNLVLIATFIYAVA------  133

Query  757  FPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLG  578
             P SGGH+NPT+TF+A L G+ S+ R ++Y+V Q  G  LG   L  +           G
Sbjct  134  -PASGGHMNPTITFAAVLTGLCSVPRGLLYLVGQTAGGALGGGILLGIWGKERAIAVRGG  192

Query  577  GCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftv  398
            GC        P           Q +  E F SFV LF +  +  D RQA + G      +
Sbjct  193  GCWYDPSQANPG----------QIYLNETFASFVLLFLAFGVGLDPRQAALFGPRMGPAL  242

Query  397  vgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAF  218
            VG  LGL+ F ++ +    GYAGA MNPA+C G  + R    +   WI+W GP +A +  
Sbjct  243  VGASLGLVSFSTSGII--PGYAGAQMNPAKCFGNGIARMDLSY--QWIYWFGPAVAGIMM  298

Query  217  YLYTKIIPERH  185
             +   +IP  H
Sbjct  299  GILYNLIPPHH  309



>gb|KFG81885.1| hypothetical protein MANI_118346 [Metarhizium anisopliae]
Length=321

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 90/256 (35%), Positives = 127/256 (50%), Gaps = 22/256 (9%)
 Frame = -1

Query  940  LMDFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNL--IMSiliaivitvll  767
            L  +LS  +W+A++ E   T+ LV++   + +ST  S    P +   + I   I++T+ +
Sbjct  69   LAGWLSPAIWKAAVVEAIATSCLVYV-SLLAVSTLAS-YNTPRIGGYIGIFNTILLTIFI  126

Query  766  laVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTF  587
             A  P SGGHINP +TFSA L GI  + R V+Y+  Q +GA L    L  V       + 
Sbjct  127  YATSPASGGHINPMITFSAILAGICPLPRGVLYICGQLLGASLAGGILIGVWGEDKAASI  186

Query  586  SLGGC--TVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHV  413
              GGC  T +V + G            Q F  EV  SFV L+ S  +  D RQA + G  
Sbjct  187  HGGGCFFTPSVTSAG------------QVFLNEVAASFVILYLSYGVGLDPRQAVLFGPR  234

Query  412  KvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLI  233
                +VG  LGL+ F S+ +    GY GA  NPARC  AA+ R    +   WI+W GP +
Sbjct  235  LGPLLVGASLGLVSFASSGIA--DGYGGAQANPARCFAAAIARKDMSY--QWIWWFGPAV  290

Query  232  ACVAFYLYTKIIPERH  185
            A V   ++   IP  H
Sbjct  291  AGVLLAVFYNTIPPHH  306



>gb|KFY94553.1| hypothetical protein V500_03150 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
Length=657

 Score = 90.1 bits (222),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 89/315 (28%), Positives = 147/315 (47%), Gaps = 37/315 (12%)
 Frame = -1

Query  1084  HPHQNGGSN-RVEDVSSTPTISNGNGN------GT---HQWTGEKIPSS--HLTLAQKLG  941
             HP +   +N R   V + P      GN      GT   ++ T  + P +  HLT  +   
Sbjct  15    HPAETSRTNGRTVKVLAEPFAGRLGGNQQFVLSGTEPGYEKTVSRRPDAALHLTWKESFD  74

Query  940   LMDFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVK------MPNLIMSiliaivi  779
             L  F  +++W+ ++ E + T++LVF+  +I I    S  +       P ++++I   I +
Sbjct  75    LRGFTDMELWKQAIFEGWATSMLVFITGSIAIGLKASATQTSIGPLFPTIMVAITNLISL  134

Query  778   tvlllaVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSI  599
              + + A  PVSGGH+NP VT +     + +  R ++Y++ Q +GA +G   ++A +    
Sbjct  135   PLFIFAAAPVSGGHMNPLVTIATFAARLSTFPRTLLYILLQTLGATIGGFMIRAALGDKF  194

Query  598   ENTFSLGGCTVTV--VAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKV  425
              N   + GC++    ++PG            +AF  E   S   +F    +  D RQ  V
Sbjct  195   SNIV-VPGCSINADFISPG------------EAFAFETMTSLCLIFLIFAVGLDPRQKNV  241

Query  424   LGHVKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWV  245
             LG      + G+ L L    S  +  K GY+GA MNPARC G     GG  W+ H+I W+
Sbjct  242   LGPALGTFLCGLALSLCNIASGFI--KDGYSGAAMNPARCFGLIAAFGG--WEYHYIHWL  297

Query  244   GPLIACVAFYLYTKI  200
             GP+   V   ++  I
Sbjct  298   GPITGAVINAMFLNI  312



>gb|KFZ17098.1| hypothetical protein V501_01889 [Pseudogymnoascus pannorum VKM 
F-4519 (FW-2642)]
Length=657

 Score = 90.1 bits (222),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 89/315 (28%), Positives = 147/315 (47%), Gaps = 37/315 (12%)
 Frame = -1

Query  1084  HPHQNGGSN-RVEDVSSTPTISNGNGN------GT---HQWTGEKIPSS--HLTLAQKLG  941
             HP +   +N R   V + P      GN      GT   ++ T  + P +  HLT  +   
Sbjct  15    HPAETSRTNGRTVKVLAEPFAGRLGGNQQFVLSGTEPGYEKTVSRRPDAALHLTWKESFD  74

Query  940   LMDFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVK------MPNLIMSiliaivi  779
             L  F  +++W+ ++ E + T++LVF+  +I I    S  +       P ++++I   I +
Sbjct  75    LRGFTDMELWKQAIFEGWATSMLVFITGSIAIGLKASATQTSIGPLFPTIMVAITNLISL  134

Query  778   tvlllaVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSI  599
              + + A  PVSGGH+NP VT +     + +  R ++Y++ Q +GA +G   ++A +    
Sbjct  135   PLFIFAAAPVSGGHMNPLVTIATFAARLSTFPRTLLYILLQTLGATIGGFMIRAALGDKF  194

Query  598   ENTFSLGGCTVTV--VAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKV  425
              N   + GC++    ++PG            +AF  E   S   +F    +  D RQ  V
Sbjct  195   SNIV-VPGCSINADFISPG------------EAFAFETMTSLCLIFLIFAVGLDPRQKNV  241

Query  424   LGHVKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWV  245
             LG      + G+ L L    S  +  K GY+GA MNPARC G     GG  W+ H+I W+
Sbjct  242   LGPALGTFLCGLALSLCNIASGFI--KDGYSGAAMNPARCFGLIAAFGG--WEYHYIHWL  297

Query  244   GPLIACVAFYLYTKI  200
             GP+   V   ++  I
Sbjct  298   GPITGAVINAMFLNI  312



>ref|XP_002964369.1| hypothetical protein SELMODRAFT_27726, partial [Selaginella moellendorffii]
 ref|XP_002967663.1| hypothetical protein SELMODRAFT_17607, partial [Selaginella moellendorffii]
 gb|EFJ31010.1| hypothetical protein SELMODRAFT_17607, partial [Selaginella moellendorffii]
 gb|EFJ34702.1| hypothetical protein SELMODRAFT_27726, partial [Selaginella moellendorffii]
Length=182

 Score = 85.1 bits (209),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 68/179 (38%), Positives = 95/179 (53%), Gaps = 2/179 (1%)
 Frame = -1

Query  751  VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGC  572
            V  GH+NP  T++  L G  +  RA++YM AQ +GA++G LA K VV+       SL GC
Sbjct  1    VGAGHLNPIFTYTTMLTGHTTAVRAMLYMAAQSLGALIGTLAAKQVVARDFVEKNSLAGC  60

Query  571  TVTVVAPGPNG-PVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvv  395
             +  V     G     GL        E+F +F+ +F +     +    +  G +     +
Sbjct  61   LLGEVVRTSRGLEWPEGLTPRAGLISEIFFTFLLIFVAYSTLLEPGNFRQTGPILAALSI  120

Query  394  givlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAF  218
            G   GL  FIS+ L +   Y+GAGMNPARC+G A+V+G  LWD HW+FW GP IA   F
Sbjct  121  GGAAGLFTFISSQLKSPY-YSGAGMNPARCLGPAIVQGSTLWDCHWVFWAGPFIAGTIF  178



>emb|CCD34687.1| hypothetical protein BofuT4_P100910.1 [Botrytis cinerea T4]
Length=312

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 72/233 (31%), Positives = 113/233 (48%), Gaps = 14/233 (6%)
 Frame = -1

Query  922  LDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPVSG  743
            + VW+++  E  GT  L ++   I IS   S+       + +    ++T+ + A+ P SG
Sbjct  71   ITVWKSAFIEFVGTTCLCYLSAFISISIRNSDTTQVAAYVGVTNIFLLTLFICALAPASG  130

Query  742  GHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTVT  563
            GH+NP +TF+  + G+    R V+YM+ Q  GA L    ++  +       ++ GGC + 
Sbjct  131  GHMNPIITFATVITGLTGFPRGVLYMIGQTTGAALAGGLIRGSLGEQRTLIYNGGGCFLE  190

Query  562  VVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivl  383
                      T  +   QA+ +E   S + L  S   A D RQA++ G      +VG  L
Sbjct  191  ----------TTNVSEGQAYLIESILSCIMLILSFGTALDPRQAQLFGPRLGPFMVGCTL  240

Query  382  gllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACV  224
            GL+ F S  L    GY GAG+NPARC   A+ RG   +   WI+W GP+   +
Sbjct  241  GLVSFSSINL--APGYPGAGLNPARCFAFAVARGSFAY--QWIWWFGPVTGAI  289



>ref|XP_009420459.1| PREDICTED: probable aquaporin PIP1-2 [Musa acuminata subsp. malaccensis]
Length=287

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 66/186 (35%), Positives = 94/186 (51%), Gaps = 18/186 (10%)
 Frame = -1

Query  751  VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGC  572
            +SGGHINP VTF   L   +S++RA+ YMV QC+GA+ GA  +K       EN     G 
Sbjct  109  ISGGHINPAVTFGLFLARKLSLTRALFYMVMQCLGAICGAGVVKGFQKGLYENN----GG  164

Query  571  TVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvg  392
               VVAPG      +G + V  F          L  +++ A D +++    HV +   + 
Sbjct  165  GANVVAPGYTKGDGLGAEIVGTF---------ILVYTVFSATDAKRSARDSHVPILAPLP  215

Query  391  ivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGPLIACVAFY  215
            I   + +    T+       G G+NPAR +GAA++   GH WD HWIFWVGP I      
Sbjct  216  IGFAVFLVHLATIPI----TGTGINPARSLGAAIIYNKGHAWDDHWIFWVGPFIGAALAA  271

Query  214  LYTKII  197
            LY +++
Sbjct  272  LYHQVV  277



>gb|KID99996.1| Aquaporin-like protein, partial [Metarhizium majus ARSEF 297]
Length=321

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 85/261 (33%), Positives = 122/261 (47%), Gaps = 32/261 (12%)
 Frame = -1

Query  940  LMDFLSLDVWRASMGEVFGTAVLVF--MLDAIVISTYESE-----VKMPNLIMSiliaiv  782
            L  +LS  +W+A+  E   T+ LV+  +L    +S+Y +      + + N I+  +    
Sbjct  69   LAGWLSPAIWKAAAVEAIATSCLVYVSLLAVSTLSSYNTPRVGGYIGIFNTILLTIFIYA  128

Query  781  itvlllaVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssS  602
             +       P SGGHINP +TFSA L GI  + R V+Y+  Q +GA L    L  V    
Sbjct  129  TS-------PASGGHINPMITFSAILAGICPVPRGVLYLCGQLLGAALAGGILTGVWGEE  181

Query  601  IENTFSLGGC--TVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAK  428
               +   GGC  T +V + G            Q F  EV  SF  L+ S  +  D RQA 
Sbjct  182  KAASIHGGGCFFTPSVTSAG------------QVFLNEVAASFAILYLSYGVGLDPRQAV  229

Query  427  VLGHVKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFW  248
            + G      +VG  LGL+ F S+ +    GY GA  NPARC  AA+ R    +   WI+W
Sbjct  230  LFGPRLGPLLVGASLGLVSFASSGIA--DGYGGAQANPARCFAAAIARKDMSY--QWIWW  285

Query  247  VGPLIACVAFYLYTKIIPERH  185
             GP +A V   ++   IP  +
Sbjct  286  FGPAVAAVLLAVFYNTIPPHY  306



>gb|ABK24473.1| unknown [Picea sitchensis]
 gb|ABK26331.1| unknown [Picea sitchensis]
 gb|ABK26817.1| unknown [Picea sitchensis]
 gb|ABR16472.1| unknown [Picea sitchensis]
 gb|ACN40451.1| unknown [Picea sitchensis]
 gb|ACN41108.1| unknown [Picea sitchensis]
Length=292

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 70/191 (37%), Positives = 96/191 (50%), Gaps = 22/191 (12%)
 Frame = -1

Query  751  VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGC  572
            +SGGHINP VTF   L   +S+ RAV YMV QC    LGA+    VV   +E+ + L G 
Sbjct  114  ISGGHINPAVTFGLFLARKLSLPRAVFYMVCQC----LGAICGAGVVKGFMESEYELDGG  169

Query  571  TVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvg  392
               VVAPG      +G + V  F          L  +++ A D +++    HV +   + 
Sbjct  170  GANVVAPGYTKGDGLGAEIVGTF---------VLVYTVFSATDAKRSARDSHVPLLAPLP  220

Query  391  ivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGPLI--ACVA  221
            I   + +    T+       G G+NPAR +GAA++    H WD HWIFWVGP I  A  A
Sbjct  221  IGFAVFLVHLATIPI----TGTGINPARSLGAAIIYNKDHAWDDHWIFWVGPFIGAALAA  276

Query  220  FY--LYTKIIP  194
            FY  +  + IP
Sbjct  277  FYHVIIIRAIP  287



>gb|KFK30621.1| hypothetical protein AALP_AA6G005800 [Arabis alpina]
Length=286

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 78/254 (31%), Positives = 118/254 (46%), Gaps = 29/254 (11%)
 Frame = -1

Query  934  DFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVF  755
            +  S   WRA + E   T    F+   I + T     + PN+  S+ I  +       +F
Sbjct  44   ELSSWSFWRAGIAEFIAT----FLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIF  99

Query  754  P-------VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIE  596
                    +SGGHINP VTF   L   +S++RAV YM+ QC+GA+ GA  +K        
Sbjct  100  ALVYCTAGISGGHINPAVTFGLFLARKLSLTRAVFYMIMQCLGAICGAGVVKGFQ----P  155

Query  595  NTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGH  416
            N + L G     VA G      +G         E+  +FV ++ +++ A D +++    H
Sbjct  156  NAYQLQGGGANTVAHGYTKGSGLG--------AEIIGTFVLVY-TVFSATDAKRSARDSH  206

Query  415  VKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGP  239
            V +   + I   + +    T+       G G+NPAR +GAA++   GH WD HWIFWVGP
Sbjct  207  VPILAPLPIGFAVFLVHLATIPIT----GTGINPARSLGAAIIYNKGHAWDDHWIFWVGP  262

Query  238  LIACVAFYLYTKII  197
             I      LY  ++
Sbjct  263  FIGAALAALYHTLV  276



>emb|CDY07221.1| BnaCnng02360D [Brassica napus]
Length=286

 Score = 84.0 bits (206),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 81/254 (32%), Positives = 122/254 (48%), Gaps = 29/254 (11%)
 Frame = -1

Query  934  DFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVF  755
            +  S   WRA + E   T    F+   I + T     + PN+  S+ I  +       +F
Sbjct  44   ELSSWSFWRAGIAEFIAT----FLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIF  99

Query  754  P-------VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIE  596
                    +SGGHINP VTF   L   +S++RAV YM+ QC+GA+ GA  +K    +  E
Sbjct  100  ALVYCTAGISGGHINPAVTFGLFLARKLSLTRAVFYMIMQCLGAICGAGVVKGFQPTPYE  159

Query  595  NTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGH  416
               +LGG   T VAPG +    +G         E+  +FV ++ +++ A D +++    H
Sbjct  160  ---TLGGGANT-VAPGYSKGSGLG--------AEIIGTFVLVY-TVFSATDAKRSARDSH  206

Query  415  VKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGP  239
            V +   + I   + +    T+       G G+NPAR +GAA++    H WD HWIFWVGP
Sbjct  207  VPILAPLPIGFAVFLVHLATIPIT----GTGINPARSLGAAIIYNKDHSWDNHWIFWVGP  262

Query  238  LIACVAFYLYTKII  197
             I      LY  I+
Sbjct  263  FIGAALAALYHTIV  276



>emb|CDY38017.1| BnaCnng08780D [Brassica napus]
Length=286

 Score = 84.0 bits (206),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 80/254 (31%), Positives = 123/254 (48%), Gaps = 29/254 (11%)
 Frame = -1

Query  934  DFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVF  755
            +  S   WRA + E   T    F+   I + T +  +  PN+  S+ I  +       +F
Sbjct  44   ELSSWSFWRAGIAEFIAT----FLFLYITVLTNQRVMGAPNMCASVGIQGIAWAFGGMIF  99

Query  754  P-------VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIE  596
                    +SGGHINP VTF   L   +S++RAV YMV QC+GA+ GA  +K    +  +
Sbjct  100  ALVYCTAGISGGHINPAVTFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFQPTPYQ  159

Query  595  NTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGH  416
               +LGG   T VAPG      +G         E+  +FV ++ +++ A D +++    H
Sbjct  160  ---TLGGGANT-VAPGYTKGSGLG--------AEIIGTFVLVY-TVFSATDAKRSARDSH  206

Query  415  VKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGP  239
            V +   + I   + +    T+       G G+NPAR +GAA++    H WD HWIFWVGP
Sbjct  207  VPILAPLPIGFAVFLVHLATIPIT----GTGINPARSLGAAIIYNKDHAWDDHWIFWVGP  262

Query  238  LIACVAFYLYTKII  197
             I      LY +++
Sbjct  263  FIGAALAALYHQLV  276



>emb|CAA04654.1| major intrinsic protein PIPC [Craterostigma plantagineum]
Length=198

 Score = 82.4 bits (202),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 65/186 (35%), Positives = 97/186 (52%), Gaps = 18/186 (10%)
 Frame = -1

Query  751  VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGC  572
            +SGGHINP VTF   L   +S+ RAV YM+AQC    LGA+    +V + + N ++  G 
Sbjct  12   ISGGHINPAVTFGLFLARKVSLIRAVSYMIAQC----LGAICGVGLVKAFMHNPYNRLGG  67

Query  571  TVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvg  392
                VAPG N    +G         E+  +FV ++ +++ A D +++    HV V   + 
Sbjct  68   GANTVAPGYNKGTALG--------AEIIGTFVLVY-TVFSATDPKRSARDSHVPVLAPLP  118

Query  391  ivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGPLIACVAFY  215
            I   + +    T+       G G+NPAR  GAA++   G  WD HWIFWVGP +  +A  
Sbjct  119  IGFAVFMVHLATIPIT----GTGINPARSFGAAVIFNNGKAWDDHWIFWVGPFLGALAAA  174

Query  214  LYTKII  197
            +Y + I
Sbjct  175  IYHQYI  180



>gb|ACN40976.1| unknown [Picea sitchensis]
Length=292

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 68/182 (37%), Positives = 91/182 (50%), Gaps = 20/182 (11%)
 Frame = -1

Query  751  VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGC  572
            +SGGHINP VTF   L   +S+ RAV YMV QC    LGA+    VV   +E+ + L G 
Sbjct  114  ISGGHINPAVTFGLFLARKLSLPRAVFYMVCQC----LGAICGAGVVKGFMESEYELDGG  169

Query  571  TVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvg  392
               VVAPG      +G   V  F          L  +++ A D +++    HV +   + 
Sbjct  170  GANVVAPGYTKGDGLGAKIVGTF---------VLVYTVFSATDAKRSARDSHVPLLAPLP  220

Query  391  ivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGPLI--ACVA  221
            I   + +    T+       G G+NPAR +GAA++    H WD HWIFWVGP I  A  A
Sbjct  221  IGFAVFLVHLATIPI----TGTGINPARSLGAAIIYNKDHAWDDHWIFWVGPFIGAALAA  276

Query  220  FY  215
            FY
Sbjct  277  FY  278



>ref|XP_006396241.1| hypothetical protein EUTSA_v10028860mg [Eutrema salsugineum]
 dbj|BAJ34288.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ37694.1| hypothetical protein EUTSA_v10028860mg [Eutrema salsugineum]
Length=286

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 80/254 (31%), Positives = 122/254 (48%), Gaps = 29/254 (11%)
 Frame = -1

Query  934  DFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVF  755
            +  S   WRA + E   T    F+   I + T     + PN+  S+ I  +       +F
Sbjct  44   ELSSWSFWRAGIAEFIAT----FLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIF  99

Query  754  P-------VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIE  596
                    +SGGHINP VTF   L   +S++RAV YM+ QC+GA+ GA  +K    +  +
Sbjct  100  ALVYCTAGISGGHINPAVTFGLFLARKLSLTRAVFYMIMQCLGAICGAGVVKGFQPTPYQ  159

Query  595  NTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGH  416
               +LGG   T VAPG      +G         E+  +FV ++ +++ A D +++    H
Sbjct  160  ---TLGGGANT-VAPGYTKGSGLG--------AEIIGTFVLVY-TVFSATDAKRSARDSH  206

Query  415  VKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGP  239
            V +   + I   + +    T+       G G+NPAR +GAA++    H WD HWIFWVGP
Sbjct  207  VPILAPLPIGFAVFLVHLATIPIT----GTGINPARSLGAAIIYNKDHSWDDHWIFWVGP  262

Query  238  LIACVAFYLYTKII  197
             I      LY +I+
Sbjct  263  FIGAALAALYHQIV  276



>gb|KID80148.1| Aquaporin-like protein, partial [Metarhizium brunneum ARSEF 3297]
Length=321

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 87/256 (34%), Positives = 124/256 (48%), Gaps = 22/256 (9%)
 Frame = -1

Query  940  LMDFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNL--IMSiliaivitvll  767
            L  +LS  +W+A++ E   T+ L ++   + +ST  S    P +   + I   +++T+ +
Sbjct  69   LAGWLSPAIWKAAVVEAIATSCLSYV-SLLAVSTLVS-YNTPRIGGYIGIFNTVLLTIFI  126

Query  766  laVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTF  587
             A  P SGGHINP +TFSA L GI  + R V+Y+  Q +GA L    L  V         
Sbjct  127  YATSPASGGHINPMITFSAILAGICPLPRGVLYICGQLLGASLAGGILTGVWGEEKAAII  186

Query  586  SLGGC--TVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHV  413
              GGC  T +V + G            Q F  EV  SF  L+ S  +  D RQA + G  
Sbjct  187  HGGGCFFTPSVTSAG------------QVFLNEVAASFAILYLSYGVGLDPRQAVLFGPR  234

Query  412  KvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLI  233
                +VG  LGL+ F S+ +    GY GA  NPARC  AA+ R    +   WI+W GP +
Sbjct  235  LGPLLVGASLGLVSFASSGIA--DGYGGAQANPARCFAAAIARKDMSY--QWIWWFGPAV  290

Query  232  ACVAFYLYTKIIPERH  185
            A V   ++   IP  H
Sbjct  291  AGVLLAVFYNTIPPHH  306



>ref|XP_006418439.1| hypothetical protein EUTSA_v10008397mg [Eutrema salsugineum]
 gb|ESQ36792.1| hypothetical protein EUTSA_v10008397mg [Eutrema salsugineum]
Length=286

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 76/261 (29%), Positives = 114/261 (44%), Gaps = 43/261 (16%)
 Frame = -1

Query  934  DFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVF  755
            +  S   WRA + E   T    F+   I + T     + PN+  S+ I  +       +F
Sbjct  44   ELSSWSFWRAGIAEFIAT----FLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIF  99

Query  754  P-------VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIE  596
                    +SGGHINP VTF   L   +S+SRAV YMV QC+GA+               
Sbjct  100  ALVYCTAGISGGHINPAVTFGLLLARKLSLSRAVFYMVMQCLGAI---------------  144

Query  595  NTFSLGGCTVTVVAPGPNGPVTVGLDTV-------QAFWLEVFCSFVFLFASIWMAYDYR  437
                 G   V    P P   +  G +TV            E+  +FV ++ +++ A D +
Sbjct  145  ----CGAGVVKGFQPNPYQTLGGGANTVAHGYTKGSGLGAEIIGTFVLVY-TVFSATDAK  199

Query  436  QAKVLGHVKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGH  260
            ++    HV +   + I   + +    T+       G G+NPAR +GAA++    H WD H
Sbjct  200  RSARDSHVPILAPLPIGFAVFLVHLATIPIT----GTGINPARSLGAAIIYNKDHAWDDH  255

Query  259  WIFWVGPLIACVAFYLYTKII  197
            WIFWVGP I      LY +++
Sbjct  256  WIFWVGPFIGAALAALYHQLV  276



>ref|XP_002562918.1| Pc20g03670 [Penicillium rubens Wisconsin 54-1255]
 emb|CAP85696.1| Pc20g03670 [Penicillium rubens Wisconsin 54-1255]
Length=315

 Score = 83.6 bits (205),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 87/321 (27%), Positives = 143/321 (45%), Gaps = 34/321 (11%)
 Frame = -1

Query  1093  EESHP--HQNGGSNRVEDVSSTPTISNGNGNGTHQWTG-------EKIPSSHLTL--AQK  947
             E+  P   QNGG  R   V STP       N     +         K P +   +  +Q 
Sbjct  10    EQPRPLEGQNGGIRRRFQVESTPFAGRIGANQEFSVSPLEEAELLRKTPDAAPLVPWSQM  69

Query  946   LGLMDFLSLDVWRASMGEVFGTAVLVFMLDAIVIST------YESEVKMPNLIMSiliai  785
             +    F+ L++W+A+  E   T +LV+    + +          +   +P+LI  +L  +
Sbjct  70    ICPNQFIQLNIWKAAFVEGVVTCLLVYFTCFLAVGLGKMAGHLATGPVVPSLIGGLLNTL  129

Query  784   vitvlllaVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvss  605
              + + + A  PVSGGH+NPT+T +     + +  R+++Y+  Q +GA +    L+     
Sbjct  130   TLPLFIFAAGPVSGGHVNPTITMATFFARLSTFPRSILYISFQLLGATVAGYLLRGSFD-  188

Query  604   SIENTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKV  425
                 +F + GC +          V+VG     AF +EV   F+ +F S  +  D RQ +V
Sbjct  189   --TRSFVIPGCVIDTSV------VSVG----SAFTIEVTTDFMLIFLSFSVGLDPRQREV  236

Query  424   LGHVKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWV  245
              G       V + + L +    T  ++ GY G G NPARC GA +  G H    HWI W+
Sbjct  237   FG--PALGPVFVGIILGITSFGTGYSQVGYTGFGGNPARCFGAMV--GSHFTSYHWIHWL  292

Query  244   GPLIACVAFYLYTKIIPERHF  182
             GP++A +   +    IP   +
Sbjct  293   GPIVASILHGIMYYFIPPYQY  313



>emb|CDY15165.1| BnaC05g00440D [Brassica napus]
Length=324

 Score = 83.6 bits (205),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 81/254 (32%), Positives = 122/254 (48%), Gaps = 29/254 (11%)
 Frame = -1

Query  934  DFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVF  755
            +  S   WRA + E   T    F+   I + T     + PN+  S+ I  +       +F
Sbjct  82   ELSSWSFWRAGIAEFIAT----FLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIF  137

Query  754  P-------VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIE  596
                    +SGGHINP VTF   L   +S++RAV YMV QC+GA+ GA  +K    S  +
Sbjct  138  ALVYCTAGISGGHINPAVTFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFQPSPYQ  197

Query  595  NTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGH  416
               +LGG   T VAPG      +G         E+  +FV ++ +++ A D +++    H
Sbjct  198  ---TLGGGANT-VAPGYTKGSGLG--------AEIIGTFVLVY-TVFSATDAKRSARDSH  244

Query  415  VKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGP  239
            V +   + I   + +    T+       G G+NPAR +GAA++    H WD HWIFWVGP
Sbjct  245  VPILAPLPIGFAVFLVHLATIPI----TGTGINPARSLGAAIIYNKDHSWDDHWIFWVGP  300

Query  238  LIACVAFYLYTKII  197
             I      LY +++
Sbjct  301  FIGAALAALYHQLV  314



>gb|AFQ98315.1| MIP2 [Eutrema halophilum]
Length=284

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 80/254 (31%), Positives = 122/254 (48%), Gaps = 29/254 (11%)
 Frame = -1

Query  934  DFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVF  755
            +  S   WRA + E   T    F+   I + T     + PN+  S+ I  +       +F
Sbjct  44   ELSSWSFWRAGIAEFIAT----FLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIF  99

Query  754  P-------VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIE  596
                    +SGGHINP VTF   L   +S++RAV YM+ QC+GA+ GA  +K    +  +
Sbjct  100  ALVYCTAGISGGHINPAVTFGLFLARKLSLTRAVFYMIMQCLGAICGAGVVKGFQPTPYQ  159

Query  595  NTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGH  416
               +LGG   T VAPG      +G         E+  +FV ++ +++ A D +++    H
Sbjct  160  ---TLGGGANT-VAPGYTKGSGLG--------AEIIGTFVLVY-TVFSATDAKRSARDSH  206

Query  415  VKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGP  239
            V +   + I   + +    T+       G G+NPAR +GAA++    H WD HWIFWVGP
Sbjct  207  VPILAPLPIGFAVFLVHLATIPIT----GTGINPARSLGAAIIYNKDHSWDDHWIFWVGP  262

Query  238  LIACVAFYLYTKII  197
             I      LY +I+
Sbjct  263  FIGAALAALYHQIV  276



>gb|EHK17775.1| hypothetical protein TRIVIDRAFT_160074 [Trichoderma virens Gv29-8]
Length=321

 Score = 83.6 bits (205),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 86/310 (28%), Positives = 143/310 (46%), Gaps = 46/310 (15%)
 Frame = -1

Query  1081  PHQNGGSNRVEDVSSTPTISN-----GNGNGTHQWTGEKIPSSHLTLAQK-------LGL  938
             PH N  ++R  D  + P+ +N     G      +++ EK   + + L QK       + L
Sbjct  6     PHANFWTSR-HDAEALPSPTNVIPFAGRIGANQEFSLEKNNCTQIELLQKFPDAAPWIPL  64

Query  937   MDFLSLD------VWRASMGEVFGTAVLVFMLDAI------VISTYESEVKMPNLIMSil  794
              D LSL       +W+A++ E  GT +LV++   +      +++ + S   +P+L+  + 
Sbjct  65    RDSLSLRPLLEAVLWKAAVVEAIGTCLLVYLTCFVAVGLGQMVNVFASGALVPSLLGGLT  124

Query  793   iaivitvlllaVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkav  614
               +++ + + A  PVSG H+NP +TF+     + ++ R ++Y+  Q  G  +  L L+A 
Sbjct  125   AILILPLFIFATGPVSGAHLNPAITFATFFARLATLPRCILYVGFQTFGGAMAGLLLRAS  184

Query  613   vssSIENTFSLGGCTV--TVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDY  440
                    +FS+ GC    T+V+ G             AF +E    F  +F S  +  D 
Sbjct  185   FD---TRSFSVPGCYFDSTIVSTG------------SAFAIEFITDFALIFLSFGVGLDP  229

Query  439   RQAKVLGHVKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGH  260
             RQ  V G       + + L L +    T  ++ GY G   NPARC GA +  G H    H
Sbjct  230   RQRSVFG--PALGPIFVGLVLGMCTFVTGFSRVGYTGFSGNPARCFGAMV--GSHFAPYH  285

Query  259   WIFWVGPLIA  230
             WI+WV PL A
Sbjct  286   WIYWVAPLSA  295



>sp|Q7XSQ9.3|PIP12_ORYSJ RecName: Full=Probable aquaporin PIP1-2; AltName: Full=OsPIP1;2; 
AltName: Full=Plasma membrane intrinsic protein 1-2 [Oryza 
sativa Japonica Group]
 emb|CAH68052.1| B0103C08-B0602B01.9 [Oryza sativa Indica Group]
 gb|EAY95145.1| hypothetical protein OsI_16963 [Oryza sativa Indica Group]
 gb|EAZ31617.1| hypothetical protein OsJ_15761 [Oryza sativa Japonica Group]
Length=288

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 65/186 (35%), Positives = 93/186 (50%), Gaps = 18/186 (10%)
 Frame = -1

Query  751  VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGC  572
            +SGGHINP VTF   L   +S++RA+ YMV QC+GA+ GA  +K       E T    G 
Sbjct  110  ISGGHINPAVTFGLFLARKLSLTRALFYMVMQCLGAICGAGVVKGFQKGLYETT----GG  165

Query  571  TVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvg  392
               VVAPG      +G + V  F          L  +++ A D ++     HV +   + 
Sbjct  166  GANVVAPGYTKGDGLGAEIVGTF---------ILVYTVFSATDAKRNARDSHVPILAPLP  216

Query  391  ivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRG-GHLWDGHWIFWVGPLIACVAFY  215
            I   + +    T+       G G+NPAR +GAA++   GH WD HWIFWVGP I      
Sbjct  217  IGFAVFLVHLATIPI----TGTGINPARSLGAAIIYNRGHAWDDHWIFWVGPFIGAALAA  272

Query  214  LYTKII  197
            +Y +++
Sbjct  273  IYHQVV  278



>emb|CDY51161.1| BnaA09g51960D [Brassica napus]
Length=286

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 80/254 (31%), Positives = 122/254 (48%), Gaps = 29/254 (11%)
 Frame = -1

Query  934  DFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVF  755
            +  S   WRA + E   T    F+   I + T     + PN+  S+ I  +       +F
Sbjct  44   ELSSWSFWRAGIAEFIAT----FLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIF  99

Query  754  P-------VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIE  596
                    +SGGHINP VTF   L   +S++RAV YM+ QC+GA+ GA  +K    +  +
Sbjct  100  ALVYCTAGISGGHINPAVTFGLFLARKLSLTRAVFYMIMQCLGAICGAGVVKGFQPTPYQ  159

Query  595  NTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGH  416
               +LGG   T VAPG +    +G         E+  +FV ++ +++ A D +++    H
Sbjct  160  ---TLGGGANT-VAPGYSKGSGLG--------AEIIGTFVLVY-TVFSATDAKRSARDSH  206

Query  415  VKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGP  239
            V +   + I   + +    T+       G G+NPAR +GAA++    H WD HWIFWVGP
Sbjct  207  VPILAPLPIGFAVFLVHLATIPIT----GTGINPARSLGAAIIYNKDHSWDDHWIFWVGP  262

Query  238  LIACVAFYLYTKII  197
             I      LY  I+
Sbjct  263  FIGAALAALYHTIV  276



>dbj|GAA90923.1| aquaporin [Aspergillus kawachii IFO 4308]
Length=321

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 88/316 (28%), Positives = 144/316 (46%), Gaps = 42/316 (13%)
 Frame = -1

Query  1102  FGDEESHPHQNGGSNRVEDVSSTPTISNGNGNGTHQWTG-------EKIPSSH--LTLAQ  950
             +  +E+HP  +G    +   +       GN +     T        EK+P +   +TL +
Sbjct  9     YESDETHPQHHGLEPAIPPFAGR---MGGNQDFVVDRTDPKNSKVLEKVPDAAPCMTLKE  65

Query  949   KLGLMDFLSLDVWRASMGEVFGTAVLVFM--------LDAIVISTYESEVKMPNLIMSil  794
                L  FLS+D+W+ ++ E   + + VF+        L A      ++ V       S  
Sbjct  66    IFDLRGFLSVDLWKFAVLECIASMMNVFITCWVTTHPLSATTSPKGQAGVYGTVTFFSPA  125

Query  793   -----iaivitvlllaVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgal  629
                    ++  +L+    P SGGHI+PT+T +     II+  R ++Y+  Q +G  L   
Sbjct  126   FGGLTNLLLTPLLIYTFSPSSGGHISPTITLATFFARIITFPRMILYLAGQTLGGALAGF  185

Query  628   alkavvssSIENTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMA  449
             A+ +   +     F++GGC +           +  +       +E F   + +F +  +A
Sbjct  186   AMHSAYGT---REFTVGGCHID----------STMVSATDGLVIEFFACLILIFLAFGVA  232

Query  448   YDYRQAKVLGHVKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLW  269
              D RQAKV GH     +VG+VLG++ +   T  T++GY GA +NPARC GA +      +
Sbjct  233   LDPRQAKVFGHAVSPWLVGVVLGVVTWG--TAFTREGYIGASVNPARCFGAYVASEFPTY  290

Query  268   DGHWIFWVGPLIACVA  221
               HWI WVGPL A VA
Sbjct  291   --HWIHWVGPLAAAVA  304



>emb|CDX91911.1| BnaC03g32130D [Brassica napus]
Length=288

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 81/254 (32%), Positives = 122/254 (48%), Gaps = 29/254 (11%)
 Frame = -1

Query  934  DFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVF  755
            +  S   WRA + E   T    F+   I + T     + PN+  S+ I  +       +F
Sbjct  44   ELSSWSFWRAGIAEFIAT----FLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIF  99

Query  754  P-------VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIE  596
                    +SGGHINP VTF   L   +S++RAV YM+ QC+GAV GA  +K    +  +
Sbjct  100  ALVYCTAGISGGHINPAVTFGLFLARKLSLTRAVFYMIMQCLGAVCGAGVVKGFQPTPYQ  159

Query  595  NTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGH  416
               +LGG   T VAPG +    +G         E+  +FV ++ +++ A D +++    H
Sbjct  160  ---TLGGGANT-VAPGYSKGSGLG--------AEIIGTFVLVY-TVFSATDAKRSARDSH  206

Query  415  VKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGP  239
            V +   + I   + +    T+       G G+NPAR +GAA++    H WD HWIFWVGP
Sbjct  207  VPILAPLPIGFAVFLVHLATIPI----TGTGINPARSLGAAIIYNKDHSWDDHWIFWVGP  262

Query  238  LIACVAFYLYTKII  197
             I      LY  I+
Sbjct  263  FIGAALAALYHTIV  276



>gb|ABO71659.2| trans-membrane water channel protein [Brassica juncea]
Length=288

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 80/254 (31%), Positives = 122/254 (48%), Gaps = 29/254 (11%)
 Frame = -1

Query  934  DFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVF  755
            +  S   WRA + E   T    F+   I + T     + PN+  S+ I  +       +F
Sbjct  44   ELSSWSFWRAGIAEFIAT----FLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIF  99

Query  754  P-------VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIE  596
                    +SGGHINP VTF   L   +S++RAV YM+ QC+GA+ GA  +K    +  +
Sbjct  100  ALVYCTAGISGGHINPAVTFGLFLARKLSLTRAVFYMIMQCLGAICGAGVIKGFQPTPYQ  159

Query  595  NTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGH  416
               +LGG   T VAPG +    +G         E+  +FV ++ +++ A D +++    H
Sbjct  160  ---TLGGGANT-VAPGYSKGSGLG--------AEIIGTFVLVY-TVFSATDAKRSARDSH  206

Query  415  VKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGP  239
            V +   + I   + +    T+       G G+NPAR +GAA++    H WD HWIFWVGP
Sbjct  207  VPILAPLPIGFAVFLVHLATIPI----TGTGINPARSLGAAIIYNKDHSWDDHWIFWVGP  262

Query  238  LIACVAFYLYTKII  197
             I      LY  I+
Sbjct  263  FIGAALAALYHTIV  276



>ref|XP_009134562.1| PREDICTED: probable aquaporin PIP1-4 [Brassica rapa]
 emb|CDX74334.1| BnaA03g27130D [Brassica napus]
Length=288

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 80/254 (31%), Positives = 122/254 (48%), Gaps = 29/254 (11%)
 Frame = -1

Query  934  DFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVF  755
            +  S   WRA + E   T    F+   I + T     + PN+  S+ I  +       +F
Sbjct  44   ELSSWSFWRAGIAEFIAT----FLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIF  99

Query  754  P-------VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIE  596
                    +SGGHINP VTF   L   +S++RAV YM+ QC+GA+ GA  +K    +  +
Sbjct  100  ALVYCTAGISGGHINPAVTFGLFLARKLSLTRAVFYMIMQCLGAICGAGVVKGFQPTPYQ  159

Query  595  NTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGH  416
               +LGG   T VAPG +    +G         E+  +FV ++ +++ A D +++    H
Sbjct  160  ---TLGGGANT-VAPGYSKGSGLG--------AEIIGTFVLVY-TVFSATDAKRSARDSH  206

Query  415  VKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGP  239
            V +   + I   + +    T+       G G+NPAR +GAA++    H WD HWIFWVGP
Sbjct  207  VPILAPLPIGFAVFLVHLATIPI----TGTGINPARSLGAAIIYNKDHSWDDHWIFWVGP  262

Query  238  LIACVAFYLYTKII  197
             I      LY  I+
Sbjct  263  FIGAALAALYHTIV  276



>gb|KFY29418.1| hypothetical protein V491_00037 [Pseudogymnoascus pannorum VKM 
F-3775]
Length=334

 Score = 83.2 bits (204),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 85/272 (31%), Positives = 131/272 (48%), Gaps = 33/272 (12%)
 Frame = -1

Query  991  TGEKIP--SSHLTLAQKLGLMDFLSLDVWRASMGEVFGTAVLVFMLDAIV----------  848
            T +++P  S  ++L +   L  FL L++W+A++ E  GT +LV++   I           
Sbjct  49   TLKRVPDASPFISLREIFDLRGFLVLELWKAAVIEGVGTLLLVWITVLIAAHSSTAPPPT  108

Query  847  ----ISTYESEVKMPNLIMSiliaivitvlllaVFPVSGGHINPTVTFSAALVGIISMSR  680
                   Y + + +  LI  +   I++ + +  + PVSGGH+NP +T S     + +  R
Sbjct  109  PSPTSGIYSTPIFLGPLIGGLTNMIILPLFIYCLGPVSGGHLNPIITMSTFTARLTTFPR  168

Query  679  AVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFW  500
             V+Y+V Q  GA +  L L++         F +GGCTV           T  +     F 
Sbjct  169  MVLYIVFQTAGACIAGLMLRSSFG---SRDFLVGGCTVD----------TALVPIADIFA  215

Query  499  LEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivlgllvfISTTLTTKKGYAGAGM  320
            LE    F  LF +  +  D RQA   G      +VG+VLG++ F ++   T+ GYAGA M
Sbjct  216  LEFMADFTLLFLAFGVGLDPRQAGTFGPALGPFLVGVVLGVMSFGTS--ITRAGYAGASM  273

Query  319  NPARCVGAALVRGGHLWDGHWIFWVGPLIACV  224
            NPARC GA +  G    +  WI WV P+ A V
Sbjct  274  NPARCTGAFV--GSRFPEFAWIVWVAPVAASV  303



>gb|KFX45364.1| Aquaporin PIP2-6 [Talaromyces marneffei PM1]
Length=334

 Score = 83.2 bits (204),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 82/277 (30%), Positives = 134/277 (48%), Gaps = 34/277 (12%)
 Frame = -1

Query  973  SSHLTLAQKLGLMDFLSLDVWRASMGEVFGTAVLVFMLDAIVIS----------------  842
            +  + +++ L L  FL L++W+ ++ E   + +L+F+   I I                 
Sbjct  67   APFMRISEALDLRGFLDLNLWKFAIVEGVASFLLIFITGWIAIQPKPTSSSSASTAASSA  126

Query  841  -TYESEVKMPNLIMSiliaivitvlllaVFPVSGGHINPTVTFSAALVGIISMSRAVIYM  665
              + +   +  L+  I   + +T+ +    PVSGGHINPT+T +     +IS  R V+Y+
Sbjct  127  GVFGTASFLGPLVGGITNWLFLTLFIYCFAPVSGGHINPTITLATFFARLISFPRMVLYL  186

Query  664  VAQCvgavlgalalkavvssSIENTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFC  485
            + Q  G  L  L LK V      + F++GGC V           T  ++  QA  LE  C
Sbjct  187  IGQTAGGALAGLVLKDVYG---SSDFAVGGCLVE----------TNLVEVRQALVLEFMC  233

Query  484  SFVFLFASIWMAYDYRQAKVLGHVKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARC  305
            + + +F +  +A + RQ ++ G      +VG+ LGLL + S     K GYAGA MNPARC
Sbjct  234  TLILIFLAFGVALNPRQERIYGPALAPWLVGLALGLLSWGSG--YEKPGYAGASMNPARC  291

Query  304  VGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTKIIP  194
             G  +  G      HWI WVG + A +   ++ +++P
Sbjct  292  FGVYV--GSGFPGYHWIHWVGVICATLGHGVFYQLLP  326



>ref|XP_002149425.1| aquaporin transporter, putative [Talaromyces marneffei ATCC 18224]
 gb|EEA23258.1| aquaporin transporter, putative [Talaromyces marneffei ATCC 18224]
Length=334

 Score = 83.2 bits (204),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 82/277 (30%), Positives = 133/277 (48%), Gaps = 34/277 (12%)
 Frame = -1

Query  973  SSHLTLAQKLGLMDFLSLDVWRASMGEVFGTAVLVFMLDAIVIS----------------  842
            +  + +++ L L  FL L++W+ ++ E   + +L+F+   I I                 
Sbjct  67   APFMRISEALDLRGFLDLNLWKFAIVEGVASFLLIFITGWIAIQPKPTSSSSASTAASSA  126

Query  841  -TYESEVKMPNLIMSiliaivitvlllaVFPVSGGHINPTVTFSAALVGIISMSRAVIYM  665
              + +   +  L+  I     +T+ +    PVSGGHINPT+T +     +IS  R V+Y+
Sbjct  127  GVFGTASFLGPLVGGITNWFFLTLFIYCFAPVSGGHINPTITLATFFARLISFPRMVLYL  186

Query  664  VAQCvgavlgalalkavvssSIENTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFC  485
            + Q  G  L  L LK V      + F++GGC V           T  ++  QA  LE  C
Sbjct  187  IGQTAGGALAGLVLKDVYG---SSDFAVGGCLVE----------TNLVEVRQALVLEFMC  233

Query  484  SFVFLFASIWMAYDYRQAKVLGHVKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARC  305
            + + +F +  +A + RQ ++ G      +VG+ LGLL + S     K GYAGA MNPARC
Sbjct  234  TLILIFLAFGVALNPRQERIYGPALAPWLVGLALGLLSWGSG--YEKPGYAGASMNPARC  291

Query  304  VGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTKIIP  194
             G  +  G      HWI WVG + A +   ++ +++P
Sbjct  292  FGVYV--GSGFPGYHWIHWVGVICATLGHGVFYQLLP  326



>dbj|GAM33457.1| aquaporin transporter [Talaromyces cellulolyticus]
Length=334

 Score = 83.2 bits (204),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 68/187 (36%), Positives = 98/187 (52%), Gaps = 17/187 (9%)
 Frame = -1

Query  754  PVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGG  575
            P+SGGHINPT+T +     +IS  R V+Y++ Q  GA L  L LK V      + F++GG
Sbjct  157  PISGGHINPTITLATFFARLISFPRMVLYLIGQMAGAALAGLVLKDVYG---SSDFAVGG  213

Query  574  CTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvv  395
            C +           T  +   QAF LE  C+   +F +  +A + RQ ++ G      +V
Sbjct  214  CLIE----------TNLVKVRQAFVLEFMCTLTLIFIAFGVALNPRQERIFGPALAPWLV  263

Query  394  givlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFY  215
            G+ LGLL + S     K GYAGA MNPARC G  +  G      HWI WVG + A +   
Sbjct  264  GLTLGLLSWSSA--YEKPGYAGASMNPARCFGVYV--GSGFPGYHWILWVGVICATLGHG  319

Query  214  LYTKIIP  194
            ++ +++P
Sbjct  320  VFYQLLP  326



>ref|XP_009253558.1| hypothetical protein FPSE_02164 [Fusarium pseudograminearum CS3096]
 gb|EKJ77666.1| hypothetical protein FPSE_02164 [Fusarium pseudograminearum CS3096]
Length=330

 Score = 82.8 bits (203),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 86/274 (31%), Positives = 134/274 (49%), Gaps = 32/274 (12%)
 Frame = -1

Query  973  SSHLTLAQKLGLMDFLSLDVWRASMGEVFGTAVLVFML-------DAIV------ISTYE  833
            + H++  + + +    ++D+W+A+M E  GT + VF+        D I       +  ++
Sbjct  68   TPHMSFRELVDVRPITNIDLWKAAMIEGIGTLLSVFVTIWASSSPDVIPAQPTRQLGNFD  127

Query  832  SEVKMPNLIMSiliaivitvlllaVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQC  653
            +   +  L+  I+  I+IT+ +     VSG H NP +TF+     + S+ R ++Y+ AQ 
Sbjct  128  NAAFIGPLVGGIINVILITLFITCFGAVSGAHFNPLITFATFCARLCSLPRMILYIPAQV  187

Query  652  vgavlgalalkavvssSIENTFSLGGC-TVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFV  476
             GA L  L ++A         F  GGC   T V P             +AF +E+  S V
Sbjct  188  GGAALAGLLVRASWGG---RDFKTGGCWLFTEVVP-----------AREAFVIELVFSTV  233

Query  475  FLFASIWMAYDYRQAKVLGHVKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGA  296
             LF +  +  D RQAK++G      +VG+ +G + F S    T+ GY GAGMNPARC+GA
Sbjct  234  LLFLAFGVGLDPRQAKIIGPALGPFLVGLSVGTMSFGSAF--TRYGYGGAGMNPARCMGA  291

Query  295  ALVRGGHLWDGHWIFWVGPLIACVAFYLYTKIIP  194
             +  G      HWI WV   IAC+A  +    IP
Sbjct  292  FV--GSRFPSWHWIHWVANFIACIAHGICYYFIP  323



>gb|KEF53902.1| hypothetical protein A1O9_10304 [Exophiala aquamarina CBS 119918]
Length=325

 Score = 82.8 bits (203),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 77/262 (29%), Positives = 127/262 (48%), Gaps = 25/262 (10%)
 Frame = -1

Query  985  EKIPSSH--LTLAQKLGLMDFLSLDVWRASMGEVFGTAVLVFM--LDAI----VISTYES  830
            +K P +   + +   L L  FL +++W+A+  E   + +L+++    AI    V   + S
Sbjct  52   QKFPDAAPWIPVRDALSLNGFLQIELWKAAAMEAIASCLLIYLTCFAAIGLGQVAPAFSS  111

Query  829  EVKMPNLIMSiliaivitvlllaVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCv  650
               +P LI  +   + + + + +  PVSG HINPT+T +     + S+ RAV+Y+  Q +
Sbjct  112  GPVVPGLIGGLTALVALPLFIYSAGPVSGAHINPTITITTFFSRLCSLPRAVLYISFQTL  171

Query  649  gavlgalalkavvssSIENTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFL  470
            G  +    L+A +      +F + GC +           T  +    AF +EV  +F  +
Sbjct  172  GGTIAGFLLRASMD---TRSFIVPGCYID----------TSMISLSSAFTIEVTTNFAMV  218

Query  469  FASIWMAYDYRQAKVLGHVKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAAL  290
            F S  +  D RQ +V G       VG+++G+  F   T  ++ GY G   NPARC GA +
Sbjct  219  FLSFGVGLDPRQREVFGPALGPIFVGLIVGMCSFF--TGVSRDGYTGFSGNPARCFGAMV  276

Query  289  VRGGHLWDGHWIFWVGPLIACV  224
              G H    HWI W+GPL A +
Sbjct  277  --GSHFSSYHWIHWIGPLTAAI  296



>emb|CDX90046.1| BnaA10g00360D [Brassica napus]
Length=286

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 80/254 (31%), Positives = 124/254 (49%), Gaps = 29/254 (11%)
 Frame = -1

Query  934  DFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVF  755
            +  S   WRA + E   T    F+   I + T     + PN+  S+ I  +       +F
Sbjct  44   ELSSWSFWRAGIAEFIAT----FLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIF  99

Query  754  P-------VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIE  596
                    +SGGHINP VTF   L   +S++RAV+Y+V QC+GAV GA  +K    +  +
Sbjct  100  ALVYCTAGISGGHINPAVTFGLFLARKLSLTRAVLYIVMQCLGAVCGAGVVKGFQPTPYQ  159

Query  595  NTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGH  416
               +LGG   T VAPG +    +G         E+  +FV ++ +++ A D +++    H
Sbjct  160  ---TLGGGANT-VAPGYSKGSGLG--------AEIIGTFVLVY-TVFSATDAKRSARDSH  206

Query  415  VKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGP  239
            V +   + I   + +    T+       G G+NPAR +GAA++    H WD HWIFWVGP
Sbjct  207  VPILAPLPIGFAVFLVHLATIPIT----GTGINPARSLGAAIIYNKDHSWDDHWIFWVGP  262

Query  238  LIACVAFYLYTKII  197
             I      LY +++
Sbjct  263  FIGAALAALYHQLV  276



>ref|XP_001390456.2| MIP transporter [Aspergillus niger CBS 513.88]
Length=321

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 88/316 (28%), Positives = 144/316 (46%), Gaps = 42/316 (13%)
 Frame = -1

Query  1102  FGDEESHPHQNGGSNRVEDVSSTPTISNGNGNGTHQWTG-------EKIPSSH--LTLAQ  950
             +  +E+HP  +G    +   +       GN +     T        E++P +   +TL +
Sbjct  9     YESDETHPQHHGLEPAIPPFAGR---MGGNQDFVVDRTDPKNSKVLERVPDAAPCMTLKE  65

Query  949   KLGLMDFLSLDVWRASMGEVFGTAVLVFM--------LDAIVISTYESEVKMPNLIMSil  794
                L  FLS+D+W+ ++ E   + + VF+        L A      ++ V       S  
Sbjct  66    IFDLRGFLSVDLWKFAVLECIASMMNVFITCWVTTHPLSATTSPKGQAGVYGTVTFFSPT  125

Query  793   -----iaivitvlllaVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgal  629
                    ++  +L+    P SGGHI+PT+T +     II+  R ++Y+  Q +G  L   
Sbjct  126   FGGLTNLLLTPLLIYTFSPSSGGHISPTITLATFFARIITFPRMILYLAGQTLGGALAGF  185

Query  628   alkavvssSIENTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMA  449
             A+ +   +     F++GGC +           T  +       +E F   + +F +  +A
Sbjct  186   AMHSAYGT---REFTVGGCHID----------TTMVSAKDGLVIEFFACLILIFLAFGVA  232

Query  448   YDYRQAKVLGHVKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLW  269
              D RQAKV GH     +VG+VLG++ +   T  T++GY GA +NPARC GA +      +
Sbjct  233   LDPRQAKVFGHAVSPWLVGVVLGIVTWG--TAFTREGYIGASVNPARCFGAYVASDFPTY  290

Query  268   DGHWIFWVGPLIACVA  221
               HWI WVGPL A VA
Sbjct  291   --HWIHWVGPLAAAVA  304



>gb|KFA66178.1| hypothetical protein S40285_09582 [Stachybotrys chlorohalonata 
IBT 40285]
Length=310

 Score = 82.0 bits (201),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 86/313 (27%), Positives = 136/313 (43%), Gaps = 26/313 (8%)
 Frame = -1

Query  1084  HPHQNGGSNRVEDVSSTPTISNGNGNGTHQWTGEKIPSSHLTLA--------QKLGLMDF  929
             HPH+       +  S   T    N      + G   PS+  T++        +   +  +
Sbjct  12    HPHERRPEPLADGSSGEKTPRPAN---IAVFDGSFAPSARPTVSADKPWYNDRDYFVKGW  68

Query  928   LSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFPV  749
              S  +W+A+  E  GT  +V++   I  +    +       + I   ++++V + A    
Sbjct  69    TSRQIWKAAFVESVGTFGVVYISGQISATLMNYDTVQIGAYIGISTIVLLSVFIYATAAG  128

Query  748   SGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCT  569
             +GGH+NP +TFSA L G   + R V+Y+  Q  G+ +    L A         +  GGC 
Sbjct  129   TGGHMNPMITFSAVLSGFCPLPRGVLYLGGQVAGSAVAGGLLMATWGGERAIRYCGGGCF  188

Query  568   VTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgi  389
                            L + QAF  E+ CSF+ L+ +  +  D RQA + G      +VG 
Sbjct  189   YD----------PSQLSSGQAFLNEIVCSFILLYLAYGVGLDPRQAMLFGPKMGPLLVGA  238

Query  388   vlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLY  209
              +GL+ F ++      GYAGA M+P RC    + R     DG WI+W GP IA V   + 
Sbjct  239   SVGLIAFANSGAV--PGYAGAQMHPGRCFAFGIAR--QDMDGQWIWWFGPAIAAVLLAIM  294

Query  208   TKIIPERHFHASG  170
               +IP  HF + G
Sbjct  295   YNLIPP-HFASKG  306



>gb|KID91181.1| Aquaporin-like protein [Metarhizium guizhouense ARSEF 977]
Length=327

 Score = 82.4 bits (202),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 72/192 (38%), Positives = 94/192 (49%), Gaps = 18/192 (9%)
 Frame = -1

Query  754  PVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGG  575
            P SGGHINP +TFSA L GI  + R V+Y+  Q +GA L    L  V       +   GG
Sbjct  137  PASGGHINPMITFSAILAGICPVPRGVLYLCGQLLGAALAGGILTGVWGEEKAASIHGGG  196

Query  574  C--TVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvft  401
            C  T +V + G            Q F  EV  SFV L+ S  +  D RQA + G      
Sbjct  197  CFFTPSVTSAG------------QVFLNEVAASFVILYLSYGVGLDPRQAVLFGPRLGPL  244

Query  400  vvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVA  221
            +VG  LGL+ F S+ +    GY GA  NPARC  AA+ R    +   WI+W GP +A V 
Sbjct  245  LVGASLGLVSFASSGIA--DGYGGAQANPARCFAAAIARKDMSY--QWIWWFGPAVAAVL  300

Query  220  FYLYTKIIPERH  185
              ++   IP  +
Sbjct  301  LAVFYNTIPPHY  312



>gb|KHN33668.1| Aquaporin PIP2-7 [Glycine soja]
Length=272

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 66/182 (36%), Positives = 99/182 (54%), Gaps = 18/182 (10%)
 Frame = -1

Query  751  VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGC  572
            +SGGHINP VTF   L   +S+ RA+ YMVAQC+GA+ G   +KA +  S     SLGG 
Sbjct  89   ISGGHINPAVTFGLFLARKVSLIRALFYMVAQCLGAICGVGLVKAFMKHSYN---SLGG-  144

Query  571  TVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvg  392
                   G N  V+ G +   A   E+  +FV ++ +++ A D +++    H+ V   + 
Sbjct  145  -------GANS-VSAGYNKGSALGAEIIGTFVLVY-TVFSATDPKRSARDSHIPVLAPLP  195

Query  391  ivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGPLIACVAFY  215
            I   + +    T+       G G+NPAR  GAA++   G +WD HWIFWVGP +  +A++
Sbjct  196  IGFAVFMVHLATIPIT----GTGINPARSFGAAVIYNNGKVWDDHWIFWVGPFVGALAYH  251

Query  214  LY  209
             Y
Sbjct  252  QY  253



>ref|XP_009386408.1| PREDICTED: probable aquaporin PIP1-2 [Musa acuminata subsp. malaccensis]
Length=287

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 66/186 (35%), Positives = 93/186 (50%), Gaps = 18/186 (10%)
 Frame = -1

Query  751  VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGC  572
            +SGGHINP VTF   L   +S++RA+ YMV QC+GA+ GA  +K       EN     G 
Sbjct  109  ISGGHINPAVTFGLLLARKLSLTRALFYMVMQCLGAICGAGVVKGFKKGLYENN----GG  164

Query  571  TVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvg  392
               VVAPG      +G + V  F          L  +++ A D +++    HV V   + 
Sbjct  165  GANVVAPGYTKGGGLGAEIVGTF---------ILVYTVFSATDAKRSARDSHVPVLAPLP  215

Query  391  ivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGPLIACVAFY  215
            I   + +    T+       G G+NPAR +GAA+V    H W+ HWIFWVGP I      
Sbjct  216  IGFAVFLVHLATIPIT----GTGINPARSLGAAIVYDKSHAWNDHWIFWVGPFIGAALAA  271

Query  214  LYTKII  197
            +Y +I+
Sbjct  272  MYQQIV  277



>gb|KDP28617.1| hypothetical protein JCGZ_14388 [Jatropha curcas]
Length=286

 Score = 81.6 bits (200),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 73/250 (29%), Positives = 122/250 (49%), Gaps = 21/250 (8%)
 Frame = -1

Query  934  DFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVF  755
            +  S   WRA + E   + + +++  + V+    S  K   + +  +      ++   V+
Sbjct  44   ELQSWSFWRAGIAEFMASFLFLYVAISTVMGYSRSSNKCATVGVQGIAWAFGGMIFALVY  103

Query  754  P---VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFS  584
                +SGGHINP VTF   L   +S++RA+ YMV QC+GA+ GA  +K          + 
Sbjct  104  STAGISGGHINPAVTFGLLLARKVSLTRAIFYMVMQCLGAICGAGVVKGFQ----PTPYQ  159

Query  583  LGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvf  404
            +GG    +V PG +    +G         E+  +FV ++ +++ A D +++    HV + 
Sbjct  160  MGGGGANMVQPGYSKGDGLG--------AEIVGTFVLVY-TVFSATDAKRSARDSHVPIL  210

Query  403  tvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGPLIAC  227
              + I   + V    T+       GAG+NPAR +GAA++    + WD HWIFWVGP I  
Sbjct  211  APLPIGFAVFVVNMATIPIT----GAGINPARSLGAAVIYNNDNGWDDHWIFWVGPFIGA  266

Query  226  VAFYLYTKII  197
                LY +I+
Sbjct  267  ALAALYHQIV  276



>ref|XP_002275303.1| PREDICTED: aquaporin PIP1-2 [Vitis vinifera]
 ref|XP_010661800.1| PREDICTED: aquaporin PIP1-2 [Vitis vinifera]
Length=286

 Score = 81.6 bits (200),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 79/251 (31%), Positives = 118/251 (47%), Gaps = 29/251 (12%)
 Frame = -1

Query  925  SLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVF---  755
            S   WRA + E   T + ++    I+IST    VK PN   ++    +       +F   
Sbjct  47   SWSFWRAGIAEFMATFIFLY----IIISTIIGVVKSPNKCATVGFQGIAWACGGMIFVLV  102

Query  754  ----PVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTF  587
                 +SGGHINP VTF   L   +S++RAV YM+ QC+GA+ GA  +K       E   
Sbjct  103  YCTAGISGGHINPAVTFGLLLARKLSLTRAVFYMIMQCLGAICGAGMVKWFQRHDFE---  159

Query  586  SLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKv  407
            +LGG        G N  V  G   +     E+  +FV ++ ++  A D ++     HV +
Sbjct  160  TLGG--------GINA-VASGYSKLAGLGAEIVGTFVLVY-TVLSATDAKRNARDSHVPI  209

Query  406  ftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRG-GHLWDGHWIFWVGPLIA  230
               + I   + +    T+       G G+NPAR +GAA++   G+ WD  WIFWVGP I 
Sbjct  210  LAPLPIGFAVFLVHLATIPIT----GTGINPARSLGAAIIYNRGNAWDDMWIFWVGPFIG  265

Query  229  CVAFYLYTKII  197
                 LY +I+
Sbjct  266  ATLATLYHQIV  276



>ref|XP_009118823.1| PREDICTED: aquaporin PIP1-3 [Brassica rapa]
Length=286

 Score = 81.6 bits (200),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 81/254 (32%), Positives = 122/254 (48%), Gaps = 29/254 (11%)
 Frame = -1

Query  934  DFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVF  755
            +  S   WRA + E   T    F+   I + T     + PN+  S+ I  +       +F
Sbjct  44   ELSSWSFWRAGIAEFIAT----FLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIF  99

Query  754  P-------VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIE  596
                    +SGGHINP VTF   L   +S++RAV Y+V QC+GAV GA  +K    S  +
Sbjct  100  ALVYCTAGISGGHINPAVTFGLFLARKLSLTRAVFYIVMQCLGAVCGAGVVKGFQPSPYQ  159

Query  595  NTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGH  416
               +LGG   T VAPG      +G         E+  +FV ++ +++ A D +++    H
Sbjct  160  ---TLGGGANT-VAPGYTKGSGLG--------AEIIGTFVLVY-TVFSATDAKRSARDSH  206

Query  415  VKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGP  239
            V +   + I   + +    T+       G G+NPAR +GAA++    H WD HWIFWVGP
Sbjct  207  VPILAPLPIGFAVFLVHLATIPIT----GTGINPARSLGAAIIYNKDHAWDDHWIFWVGP  262

Query  238  LIACVAFYLYTKII  197
             I      LY +++
Sbjct  263  FIGAALAALYHQLV  276



>gb|AGR83938.1| aquaporin PIP1-4, partial [Brassica napus]
Length=259

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 80/250 (32%), Positives = 120/250 (48%), Gaps = 29/250 (12%)
 Frame = -1

Query  934  DFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVF  755
            +  S   WRA + E   T    F+   I + T     + PN+  S+ I  +       +F
Sbjct  31   ELSSWSFWRAGIAEFIAT----FLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIF  86

Query  754  P-------VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIE  596
                    +SGGHINP VTF   L   +S++RAV YM+ QC+GAV GA  +K    +  +
Sbjct  87   ALVYCTAGISGGHINPAVTFGLFLARKLSLTRAVFYMITQCLGAVCGAGVVKGFQPTPYQ  146

Query  595  NTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGH  416
               +LGG   T VAPG +    +G         E+  +FV ++ +++ A D +++    H
Sbjct  147  ---TLGGGANT-VAPGYSKGSGLG--------AEIIGTFVLVY-TVFSATDAKRSARDSH  193

Query  415  VKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGP  239
            V +   + I   + +    T+       G G+NPAR +GAA++    H WD HWIFWVGP
Sbjct  194  VPLLAPLPIGFAVFLVHLATIPIT----GTGINPARSLGAAIIYNKDHSWDDHWIFWVGP  249

Query  238  LIACVAFYLY  209
             I      LY
Sbjct  250  FIGAALAALY  259



>gb|KEY74839.1| hypothetical protein S7711_11047 [Stachybotrys chartarum IBT 
7711]
 gb|KFA45647.1| hypothetical protein S40293_08922 [Stachybotrys chartarum IBT 
40293]
Length=310

 Score = 81.6 bits (200),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 65/193 (34%), Positives = 92/193 (48%), Gaps = 15/193 (8%)
 Frame = -1

Query  748  SGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCT  569
            +GGH+NP +TFSA L G   + R V+Y+  Q  G+ +    L A         +  GGC 
Sbjct  129  TGGHMNPMITFSAVLSGFCPLPRGVLYLGGQVAGSAVAGGLLMATWGGERAIRYRGGGCF  188

Query  568  VTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgi  389
                           L + QAF  E+ CSF+ L+ +  +  D RQA + G      +VG 
Sbjct  189  YDPSQ----------LSSGQAFLNEIVCSFILLYLAYGVGLDPRQAMLFGPKTGPLLVGA  238

Query  388  vlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLY  209
             +GL+ F ++      GYAGA M+P RC    + R     DG WI+W GP IA V   + 
Sbjct  239  SVGLIAFANSGAV--PGYAGAQMHPGRCFAFGIAR--QDMDGQWIWWFGPAIAAVLLAIM  294

Query  208  TKIIPERHFHASG  170
              +IP  HF + G
Sbjct  295  YNLIPP-HFASKG  306



>gb|KHG11128.1| putative aquaporin PIP1-2 [Gossypium arboreum]
Length=287

 Score = 81.6 bits (200),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 65/186 (35%), Positives = 95/186 (51%), Gaps = 18/186 (10%)
 Frame = -1

Query  751  VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGC  572
            +SGGHINP VTF   L   +S++RAV YM+ QC+GA+ GA  +K+   +  E    LGG 
Sbjct  110  ISGGHINPAVTFGLLLARKLSLTRAVFYMIMQCLGAICGAAVVKSFQKTQYER---LGGG  166

Query  571  TVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvg  392
              T         ++ G         E+  +FV ++ +++ A D ++     HV +   + 
Sbjct  167  ANT---------ISSGYSKTSGLGAEIVGTFVLVY-TVFSATDAKRNARDSHVPILAPLP  216

Query  391  ivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGPLIACVAFY  215
            I   + V    T+       G G+NPAR +GAAL+      WD HWIFWVGPLI      
Sbjct  217  IGFAVFVVHLATIPI----TGTGINPARSLGAALIYNKDQAWDDHWIFWVGPLIGAALAA  272

Query  214  LYTKII  197
            LY +I+
Sbjct  273  LYHQIV  278



>gb|EKC31493.1| Aquaporin-4 [Crassostrea gigas]
Length=285

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 74/249 (30%), Positives = 126/249 (51%), Gaps = 26/249 (10%)
 Frame = -1

Query  940  LMDFLSLDVWRASMGEVFGTAVLVFMLDAIVISTY-ESEVKMPNLIMSiliaivitvlll  764
            L D  S ++WRA+  E+ GT  LVF   A       +++  +  + +S+   +++  ++ 
Sbjct  5    LEDLTSPNLWRAAAAELLGTLFLVFFGCATATGQQNQADTTVDYVQISLTFGLIVGTMVW  64

Query  763  aVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFS  584
             +  VSGGHINP VT +A +   +S+ RA++Y+V+Q          + A +   +    +
Sbjct  65   GIAHVSGGHINPAVTLAALVTRRVSIVRALMYIVSQL-----IGAIVGAAILFGLTPAAA  119

Query  583  LGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvf  404
             GG  V     G +G VT      Q F +EV  +FV +F ++  + D ++  + G   + 
Sbjct  120  RGGLGVN----GMSGDVT----EAQGFGVEVMITFVLVF-TVLASIDEKRTDLKGSAPLT  170

Query  403  tvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIAC-  227
              + + +G LV I+        Y G  MNPAR  G A+++  + WD HW+FW+GP++   
Sbjct  171  IGLAVAVGHLVAIA--------YTGCSMNPARSFGPAVIQ--NAWDAHWVFWIGPMVGSF  220

Query  226  VAFYLYTKI  200
            VA  LY  I
Sbjct  221  VAALLYEYI  229



>ref|XP_011046666.1| PREDICTED: probable aquaporin PIP2-8 [Populus euphratica]
Length=279

 Score = 81.3 bits (199),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 82/255 (32%), Positives = 127/255 (50%), Gaps = 24/255 (9%)
 Frame = -1

Query  940  LMDFLSLDVW---RASMGEVFGTAVLVFMLDAIVISTYESEVKMPN---LIMSiliaivi  779
            L+DF  + +W   RA + E   T + +++  A VI    ++        L ++     +I
Sbjct  24   LLDFGEIKLWSFYRALIAEFIATLLFLYVTVATVIGHKSNKDPCDGVGLLGIAWAFGGMI  83

Query  778  tvlllaVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSI  599
             +L+     +SGGHINP VTF   L   +S+ RAV YMVAQC+GA+ G   +KA +    
Sbjct  84   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMK---  140

Query  598  ENTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLG  419
            +N  SLGG   T         V +G +T  A   E+  +FV ++ +++ A D +++    
Sbjct  141  KNYNSLGGGANT---------VAMGYNTGTALGAEIIGTFVLVY-TVFSATDPKRSARDS  190

Query  418  HVKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVG  242
            HV V   + I   + +    T+       G G+NPAR  GAA++      WD HWIFWVG
Sbjct  191  HVPVLAPLPIGFAVFMVHLATIPIT----GTGINPARSFGAAVIFNNEKAWDDHWIFWVG  246

Query  241  PLIACVAFYLYTKII  197
            P +  +A   Y + I
Sbjct  247  PFVGALAAAAYHQYI  261



>ref|XP_002306187.1| membrane intrinsic family protein [Populus trichocarpa]
 gb|ABK95359.1| unknown [Populus trichocarpa]
 gb|EEE86698.1| membrane intrinsic family protein [Populus trichocarpa]
Length=279

 Score = 80.9 bits (198),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 68/186 (37%), Positives = 98/186 (53%), Gaps = 18/186 (10%)
 Frame = -1

Query  751  VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGC  572
            +SGGHINP VTF   L   +S+ RAV YMVAQC+GA+ G   +KA +    +N  SLGG 
Sbjct  93   ISGGHINPAVTFGLFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMK---KNYNSLGGG  149

Query  571  TVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvg  392
              T         V +G +T  A   E+  +FV ++ +++ A D +++    HV V   + 
Sbjct  150  ANT---------VAMGYNTGTALGAEIIGTFVLVY-TVFSATDPKRSARDSHVPVLAPLP  199

Query  391  ivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGPLIACVAFY  215
            I   + +    T+       G G+NPAR  GAA++      WD HWIFWVGP +  +A  
Sbjct  200  IGFAVFMVHLATIPIT----GTGINPARSFGAAVIFNNEKAWDDHWIFWVGPFVGALAAA  255

Query  214  LYTKII  197
             Y + I
Sbjct  256  AYHQYI  261



>ref|XP_009759265.1| PREDICTED: probable aquaporin PIP1-2 [Nicotiana sylvestris]
Length=286

 Score = 80.9 bits (198),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 75/250 (30%), Positives = 125/250 (50%), Gaps = 21/250 (8%)
 Frame = -1

Query  934  DFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVF  755
            + +S   +RA + E   T + +++    V+   +SE K P + +  +      ++   V+
Sbjct  45   ELMSWSFYRAGIAEFMATFLFLYITVLTVMGVSKSESKCPTVGIQGIAWAFGGMIFALVY  104

Query  754  ---PVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFS  584
                +SGGHINP VTF   L   +S++RA+ YMV QC+GA+ GA  +K       +  + 
Sbjct  105  CTAGISGGHINPAVTFGLFLARKLSVTRALFYMVMQCLGAICGAGVVKGFG----KTLYQ  160

Query  583  LGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvf  404
              G    VV PG     T G D + A   E+  +FV ++ +++ A D +++    HV + 
Sbjct  161  TKGGGANVVNPG----YTKG-DGLGA---EIVGTFVLVY-TVFSATDAKRSARDSHVPIL  211

Query  403  tvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGG-HLWDGHWIFWVGPLIAC  227
              + I   + +    T+       G G+NPAR +GAA++    H W+ HWIFWVGP I  
Sbjct  212  APLPIGFAVFLVHLATIPI----TGTGINPARSLGAAIIYNKEHAWNDHWIFWVGPFIGA  267

Query  226  VAFYLYTKII  197
                LY +++
Sbjct  268  ALAALYHQVV  277



>gb|KDP23969.1| hypothetical protein JCGZ_25357 [Jatropha curcas]
Length=283

 Score = 80.9 bits (198),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 87/259 (34%), Positives = 124/259 (48%), Gaps = 30/259 (12%)
 Frame = -1

Query  940  LMDFLSLDVW---RASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvl  770
            L+D   L  W   RA + E+  T + +F+  A VI+   S   M +    + +  V    
Sbjct  26   LLDIEELTKWSFYRAVIAELVATLIFLFVTVATVIANKAST--MSSGCGGVGLLGVAWSF  83

Query  769  llaVF-------PVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavv  611
               +F        +SGGHINP VTF   L   +S++RAV Y+VAQCVGA++G   +K +V
Sbjct  84   GSTIFILVYCTAGISGGHINPAVTFGLLLARKVSLNRAVAYIVAQCVGAIIGVALVKGLV  143

Query  610  ssSIENTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQA  431
                +   SLGG        G N  VT G        +E+  +F FL  ++  A D ++ 
Sbjct  144  KDLYK---SLGG--------GANS-VTAGFSIGTGLGVEILGTF-FLEYTVLSATDPKRK  190

Query  430  KVLGHVKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHL-WDGHWI  254
                HV V   + I   + V    TL       G G+NPAR  GAA++    + WD HWI
Sbjct  191  ARDSHVPVLAPLPIGFTVFVVHMATLPI----TGTGINPARSFGAAVIYNKKMVWDDHWI  246

Query  253  FWVGPLIACVAFYLYTKII  197
            FWVGPL+   A   Y +I+
Sbjct  247  FWVGPLVGAAAAAAYHQIV  265



>ref|XP_008797218.1| PREDICTED: aquaporin TIP3-1-like [Phoenix dactylifera]
Length=257

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 83/270 (31%), Positives = 124/270 (46%), Gaps = 36/270 (13%)
 Frame = -1

Query  934  DFLSLDVWRASMGEVFGTAVLVFMLDAIVIST---YESEVKMPNLIM-Siliaivitvll  767
            D +  D  RA++ E  GTA+ VF  +  V+S    Y+       L+M +I  A+ + V +
Sbjct  14   DAVQPDTMRAALSEFIGTAIFVFAGEGSVLSLEKLYKDTSTASGLVMVAIAHALALFVAV  73

Query  766  laVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTF  587
               F +SGGHINP VTF A + G IS+  AV Y VAQ +GA++ +L L+          F
Sbjct  74   SIAFNISGGHINPAVTFGALVGGRISVIHAVCYWVAQLLGAIVASLLLRVATGGMRPLGF  133

Query  586  SLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKv  407
            SLG                 G+    A  LE+  +F  ++     A D ++    GH+  
Sbjct  134  SLGS----------------GIGEWHAVLLEIVMTFGLVYTVYATAIDPKR----GHLG-  172

Query  406  ftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLI-A  230
                   L +   +   +     + GA MNPAR  G ALV  G  W  HW++W+GP + A
Sbjct  173  ---TIAPLAIGFVVGANILAGGPFDGASMNPARAFGPALV--GWRWRRHWVYWLGPFVGA  227

Query  229  CVAFYLYTKII-----PERHFHASGYPHDF  155
             +A  +Y  ++     P  H H    P D+
Sbjct  228  GIAGVMYEYLVIPTETPHPHAHQPLAPEDY  257



>ref|XP_009119712.1| PREDICTED: aquaporin PIP1-3 [Brassica rapa]
Length=286

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 80/254 (31%), Positives = 123/254 (48%), Gaps = 29/254 (11%)
 Frame = -1

Query  934  DFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVF  755
            +  S   WRA + E   T    F+   I + T     + PN+  S+ I  +       +F
Sbjct  44   ELSSWSFWRAGIAEFIAT----FLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIF  99

Query  754  P-------VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIE  596
                    +SGGHINP VTF   L   +S++RAV Y+V QC+GAV GA  +K    +  +
Sbjct  100  ALVYCTAGISGGHINPAVTFGLFLARKLSLTRAVPYIVMQCLGAVCGAGVVKGFQPTPYQ  159

Query  595  NTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGH  416
               +LGG   T VAPG +    +G         E+  +FV ++ +++ A D +++    H
Sbjct  160  ---TLGGGANT-VAPGYSKGSGLG--------AEIIGTFVLVY-TVFSATDAKRSARDSH  206

Query  415  VKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGP  239
            V +   + I   + +    T+       G G+NPAR +GAA++    H WD HWIFWVGP
Sbjct  207  VPILAPLPIGFAVFLVHLATIPIT----GTGINPARSLGAAIIYNKDHSWDDHWIFWVGP  262

Query  238  LIACVAFYLYTKII  197
             I      LY +++
Sbjct  263  FIGAALAALYHQLV  276



>ref|XP_010109640.1| hypothetical protein L484_015595 [Morus notabilis]
 gb|EXC23685.1| hypothetical protein L484_015595 [Morus notabilis]
Length=419

 Score = 81.6 bits (200),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 66/186 (35%), Positives = 94/186 (51%), Gaps = 18/186 (10%)
 Frame = -1

Query  751  VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGC  572
            +SGGHINP VTF   L   +S++RAV YM+ QC+GA+ GA  +K    +  E    LGG 
Sbjct  110  ISGGHINPAVTFGLLLARKLSLTRAVFYMIMQCLGAICGAGVVKGFQKTQYE---VLGGG  166

Query  571  TVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvg  392
              TV A         G         E+  +FV ++ +++ A D ++     HV +   + 
Sbjct  167  ANTVAA---------GYSKSDGLGAEIVGTFVLVY-TVFSATDAKRNARDSHVPILAPLP  216

Query  391  ivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGPLIACVAFY  215
            I   + +    T+       G G+NPAR +GAAL+    H WD HWIFWVGP I      
Sbjct  217  IGFAVFLVHLATIPI----TGTGINPARSLGAALIYNREHAWDDHWIFWVGPFIGAALAA  272

Query  214  LYTKII  197
            LY +I+
Sbjct  273  LYHQIV  278



>ref|XP_001396483.2| MIP transporter [Aspergillus niger CBS 513.88]
Length=320

 Score = 80.5 bits (197),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 78/281 (28%), Positives = 128/281 (46%), Gaps = 33/281 (12%)
 Frame = -1

Query  985  EKIPSSHLTLAQK--LGLMDFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPN  812
             K+P +   ++ +    +  F  LD+WR ++ E  GT +L F+      +        P+
Sbjct  54   RKVPDAAPLMSARDAFNVRGFTDLDLWRFAVVECVGTMMLAFITAWAAATPANVAPPTPS  113

Query  811  --------------LIMSiliaivitvlllaVFPVSGGHINPTVTFSAALVGIISMSRAV  674
                          L+ ++   +++T+ + +   VSG H+NPT+T +     +IS+ R V
Sbjct  114  TPAGIFATTAFLGPLVGAVTNWLLLTLFIFSFSSVSGSHLNPTITLATFFARLISLPRMV  173

Query  673  IYMVAQCvgavlgalalkavvssSIENTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLE  494
            +Y+  Q +G  L    L++         +S+GGC V           T  +   +AF LE
Sbjct  174  LYLCGQILGGALAGWILQSAFG---SGQYSVGGCVVD----------TALVPVREAFVLE  220

Query  493  VFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivlgllvfISTTLTTKKGYAGAGMNP  314
              CS   +F S  +  D RQ +V G      +VG+VLG +   S    T++GY GA +NP
Sbjct  221  FICSLTLIFLSFGVGLDPRQVRVYGAALSPWLVGMVLGAVSLGSA--YTREGYGGASLNP  278

Query  313  ARCVGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTKIIPE  191
            ARC G  +  G      HWI WV P+ A +   L   ++P 
Sbjct  279  ARCFGVYV--GSSFPGYHWIHWVAPIAAAIGHGLVYYLVPP  317



>ref|XP_011019143.1| PREDICTED: probable aquaporin PIP1-4 [Populus euphratica]
Length=287

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 76/250 (30%), Positives = 122/250 (49%), Gaps = 21/250 (8%)
 Frame = -1

Query  934  DFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVF  755
            ++LS   +RA + E   T + +++    V+    S  K   + +  +      ++ + V+
Sbjct  46   EWLSWSFYRAGIAEFVATFLFLYITVLTVMGVARSSTKCSTVGIQGIAWAFGGMIFVLVY  105

Query  754  ---PVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFS  584
                +SGGHINP VTF   L   ++++RAV YM+ QC+GA+ GA  +KA   S  E    
Sbjct  106  CTAGISGGHINPAVTFGLLLARKLTLTRAVFYMIMQCLGAICGAGVVKAFQKSPYE---I  162

Query  583  LGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvf  404
            LGG   T         V+ G        +E+  +FV ++ +++ A D +++    HV V 
Sbjct  163  LGGGANT---------VSTGYSKGSGLGVEILGTFVLVY-TVFSATDAKRSARDSHVPVL  212

Query  403  tvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGPLIAC  227
              + I   + +    T+       G G+NPAR +GAAL+      WD HWIFWVGP I  
Sbjct  213  APLPIGFAVFLVHLATIPIT----GTGINPARSLGAALIYNKDKAWDDHWIFWVGPFIGA  268

Query  226  VAFYLYTKII  197
                LY +I+
Sbjct  269  ALAALYQQIV  278



>emb|CAB56217.1| PM28B protein [Spinacia oleracea]
Length=285

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 79/254 (31%), Positives = 120/254 (47%), Gaps = 29/254 (11%)
 Frame = -1

Query  934  DFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVF  755
            +  S   WRA + E   T    F+   I I T     + PN+  S+ I  +       +F
Sbjct  43   ELQSWSFWRAGIAEFMAT----FLFLYITILTVMGVKRAPNMCASVGIQGIAWAFGGMIF  98

Query  754  P-------VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIE  596
                    +SGGHINP VTF   L   +S++RA+ YM+ QC+GA+ GA  +K        
Sbjct  99   ALVYCTAGISGGHINPAVTFGLLLARKLSLTRAMFYMIMQCLGAICGAGVVKGFQ----P  154

Query  595  NTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGH  416
            N + + G    VV    N   T G D + A   E+  +FV ++ +++ A D +++    H
Sbjct  155  NIYEMQGGGANVV----NHGYTRG-DGLGA---EIIGTFVLVY-TVFSATDAKRSARDSH  205

Query  415  VKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGP  239
            V +   + I   + +    T+       G G+NPAR +GAA++    H WD HWIFWVGP
Sbjct  206  VPILAPLPIGFAVFLVHLATIPIT----GTGINPARSLGAAIIFNKDHAWDHHWIFWVGP  261

Query  238  LIACVAFYLYTKII  197
             I      LY + +
Sbjct  262  FIGAALAALYHQTV  275



>ref|XP_006581099.1| PREDICTED: uncharacterized protein LOC100808290 [Glycine max]
Length=680

 Score = 82.0 bits (201),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 70/186 (38%), Positives = 101/186 (54%), Gaps = 18/186 (10%)
 Frame = -1

Query  751  VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGC  572
            +SGGHINP VTF   L   +S+ RAV YMVAQC+GA+ G   +KA +  S     SLGG 
Sbjct  494  ISGGHINPAVTFGLFLARKVSLIRAVFYMVAQCLGAICGVGLVKAFMKHSYN---SLGG-  549

Query  571  TVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvg  392
                   G N  V+ G +   A   E+  +FV ++ +++ A D +++    HV V   + 
Sbjct  550  -------GANS-VSAGYNKGSALGAEIIGTFVLVY-TVFSATDPKRSARDSHVPVLAPLP  600

Query  391  ivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGPLIACVAFY  215
            I   + +    T+       G G+NPAR +GAA++   G +WD HWIFWVGPL+  +A  
Sbjct  601  IGFAVFMVHLATIPIT----GTGINPARSLGAAVIYNNGKVWDEHWIFWVGPLVGALAAA  656

Query  214  LYTKII  197
             Y + I
Sbjct  657  AYHQYI  662



>gb|AAF65846.1|AF255796_1 aquaporin 2 [Allium cepa]
Length=288

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 64/186 (34%), Positives = 96/186 (52%), Gaps = 18/186 (10%)
 Frame = -1

Query  751  VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGC  572
            +SGGHINP VTF   L   +S++RAV YM+ QC+GA+ GA  LK       +  +   G 
Sbjct  110  ISGGHINPAVTFGLFLARKLSLTRAVFYMIMQCLGAICGAGVLKGYQ----KGLYMTQGG  165

Query  571  TVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvg  392
               VVAPG      +G         E+  +FV ++ +++ A D ++     HV +   + 
Sbjct  166  GANVVAPGYTKGSGLG--------AEIIGTFVLVY-TVFSATDAKRNARDSHVPILAPLP  216

Query  391  ivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGPLIACVAFY  215
            I   + +    T+       G G+NPAR +GAA++   GH W+ HWIFWVGP I      
Sbjct  217  IGFAVFLVHLATIPI----TGTGINPARSLGAAIIYNKGHAWNDHWIFWVGPFIGAALAA  272

Query  214  LYTKII  197
            +Y +I+
Sbjct  273  MYHQIV  278



>ref|XP_009386206.1| PREDICTED: probable aquaporin PIP1-2 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=286

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 64/186 (34%), Positives = 92/186 (49%), Gaps = 18/186 (10%)
 Frame = -1

Query  751  VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGC  572
            +SGGHINP VTF   L   +S++RA+ YMV QC+GA+ GA  +K       E+     G 
Sbjct  108  ISGGHINPAVTFGLFLARKLSLTRALFYMVMQCLGAICGAGVVKGYQKGLYESN----GG  163

Query  571  TVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvg  392
               VVAPG      +G + V  F          L  +++ A D ++     HV +   + 
Sbjct  164  GANVVAPGYTKGDGLGAEIVGTF---------ILVYTVFSATDAKRNARDSHVPILAPLP  214

Query  391  ivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGPLIACVAFY  215
            I   + +    T+       G G+NPAR +GAA++    H WD HWIFWVGP I      
Sbjct  215  IGFAVFLVHLATIPI----TGTGINPARSLGAAIIYNKKHAWDDHWIFWVGPFIGAALAA  270

Query  214  LYTKII  197
            +Y +I+
Sbjct  271  IYHQIV  276



>gb|AGT36590.1| aquaporin [Musa acuminata AAA Group]
Length=286

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 64/186 (34%), Positives = 92/186 (49%), Gaps = 18/186 (10%)
 Frame = -1

Query  751  VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGC  572
            +SGGHINP VTF   L   +S++RA+ YMV QC+GA+ GA  +K       E+     G 
Sbjct  108  ISGGHINPAVTFGLFLARKLSLTRALFYMVMQCLGAICGAGVVKGYQKGLYESN----GG  163

Query  571  TVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvg  392
               VVAPG      +G + V  F          L  +++ A D ++     HV +   + 
Sbjct  164  GANVVAPGYTKGDGLGAEIVGTF---------ILVYTVFSATDAKRNARDSHVPILAPLP  214

Query  391  ivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGPLIACVAFY  215
            I   + +    T+       G G+NPAR +GAA++    H WD HWIFWVGP I      
Sbjct  215  IGFAVFLVHLATIPI----TGTGINPARSLGAAIIYNKKHAWDDHWIFWVGPFIGAALAA  270

Query  214  LYTKII  197
            +Y +I+
Sbjct  271  IYHQIV  276



>gb|AFH36341.1| aquaporin PIP1;3 [Quercus petraea]
Length=286

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 65/186 (35%), Positives = 93/186 (50%), Gaps = 18/186 (10%)
 Frame = -1

Query  751  VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGC  572
            +SGGHINP VTF   L   +S++RAV Y+V QC+GA+ GA  +K       EN  S GG 
Sbjct  108  ISGGHINPAVTFGLFLARKLSLTRAVFYIVMQCLGAICGAGVVKGFEKGLYEN--SGGGA  165

Query  571  TVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvg  392
             V          V  G         E+  +FV ++ +++ A D ++     HV +   + 
Sbjct  166  NV----------VNHGYTKGDGLGAEIIGTFVLVY-TVFSATDAKRNARDSHVPILAPLP  214

Query  391  ivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGPLIACVAFY  215
            I   + +    T+       G G+NPAR +GAA++    H WD HWIFWVGP I      
Sbjct  215  IGFAVFLVHLATIPI----TGTGINPARSLGAAIIYNKDHAWDDHWIFWVGPFIGAALAA  270

Query  214  LYTKII  197
            LY +I+
Sbjct  271  LYHQIV  276



>ref|XP_002484748.1| aquaporin transporter, putative [Talaromyces stipitatus ATCC 
10500]
 gb|EED14795.1| aquaporin transporter, putative [Talaromyces stipitatus ATCC 
10500]
Length=333

 Score = 80.1 bits (196),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 78/277 (28%), Positives = 131/277 (47%), Gaps = 34/277 (12%)
 Frame = -1

Query  973  SSHLTLAQKLGLMDFLSLDVWRASMGEVFGTAVLVFMLDAIVIS----------------  842
            +  + +++ L L  FL  ++W+ ++ E   + +L+F+   I I                 
Sbjct  67   APFMRVSEALDLRGFLDWNLWKFAIVEGVASFLLIFITGWIAIRPRPASSTSSSTEPTAA  126

Query  841  -TYESEVKMPNLIMSiliaivitvlllaVFPVSGGHINPTVTFSAALVGIISMSRAVIYM  665
              + +   +  LI  I   + +T+ + +  P+SGGHINPT+T +     +IS+ R  +Y+
Sbjct  127  GVFGTSTFLGPLIGGITNWLFLTLFIYSFAPISGGHINPTITLATFFARLISLPRMTLYL  186

Query  664  VAQCvgavlgalalkavvssSIENTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFC  485
            + Q  G  L  L L  +      + F +GGC +           T  ++  QA  LE  C
Sbjct  187  MGQTGGGALAGLVLHNLFG---SSNFVVGGCFIE----------TNLVEVRQALLLEFMC  233

Query  484  SFVFLFASIWMAYDYRQAKVLGHVKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARC  305
            +   +F +  +A + RQ ++ G      +VG+ LGLL + S+    K GYAGA MNPARC
Sbjct  234  TLTLVFIAFGVALNPRQERIFGPALAPWLVGLTLGLLSWSSS--YEKPGYAGASMNPARC  291

Query  304  VGAALVRGGHLWDGHWIFWVGPLIACVAFYLYTKIIP  194
             G  +  G      HWI WVG   A +   L+ +++P
Sbjct  292  FGVYV--GSGFPGYHWIHWVGVFCATLGHGLFYQLLP  326



>gb|AFJ44204.1| plasma membrane intrinsic protein 1 [Hedychium coronarium]
Length=286

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 64/186 (34%), Positives = 93/186 (50%), Gaps = 18/186 (10%)
 Frame = -1

Query  751  VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGC  572
            +SGGHINP VTF   L   +S++RAV Y+V QC+GA+ GA  +K       E+     G 
Sbjct  108  ISGGHINPAVTFGLFLARKLSLTRAVFYIVMQCLGAICGAGVVKGFKKGLYESK----GG  163

Query  571  TVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvg  392
               VVAPG      +G + V  F          L  +++ A D +++    HV +   + 
Sbjct  164  GANVVAPGYTKGDGLGAEIVGTF---------ILVYTVFSATDAKRSARDSHVPILAPLP  214

Query  391  ivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGPLIACVAFY  215
            I   + +    T+       G G+NPAR +GAA++    H WD HWIFWVGP I      
Sbjct  215  IGFAVFLVHLATIPI----TGTGINPARSLGAAIIYNKDHAWDDHWIFWVGPFIGAALAA  270

Query  214  LYTKII  197
            +Y +I+
Sbjct  271  VYHQIV  276



>ref|XP_009631880.1| PREDICTED: probable aquaporin PIP1-2 [Nicotiana tomentosiformis]
 tpg|DAA64671.1| TPA_exp: aquaporin PIP1 4 [Nicotiana tabacum]
Length=285

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 72/250 (29%), Positives = 118/250 (47%), Gaps = 21/250 (8%)
 Frame = -1

Query  934  DFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVF  755
            +  S   +RA + E   T + +++    V+   +SE K   + +  +      ++   V+
Sbjct  44   ELTSWSFYRAGIAEFMATFLFLYITILTVMGVSKSESKCSTVGIQGIAWAFGGMIFALVY  103

Query  754  ---PVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFS  584
                +SGGHINP VTF   L   +S++RAV YMV QC+GA+ GA  +K            
Sbjct  104  CTAGISGGHINPAVTFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF----------  153

Query  583  LGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvf  404
              G T+     G    V +G         E+  +FV ++ +++ A D +++    HV + 
Sbjct  154  --GKTLYQTKGGGANVVNLGYTKGSGLGAEIVGTFVLVY-TVFSATDAKRSARDSHVPIL  210

Query  403  tvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGPLIAC  227
              + I   + +    T+       G G+NPAR +GAA++    H WD HWIFWVGP I  
Sbjct  211  APLPIGFAVFLVHLATIPI----TGTGINPARSLGAAIIYNQDHAWDDHWIFWVGPFIGA  266

Query  226  VAFYLYTKII  197
                LY +++
Sbjct  267  ALAALYHQVV  276



>ref|XP_008382110.1| PREDICTED: probable aquaporin PIP2-8 [Malus domestica]
Length=281

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 69/186 (37%), Positives = 97/186 (52%), Gaps = 18/186 (10%)
 Frame = -1

Query  751  VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGC  572
            +SGGHINP VTF   L   +S+ RAV Y VAQC+GA+ G   +KA       N  SLGG 
Sbjct  95   ISGGHINPAVTFGLFLARKVSLIRAVAYXVAQCLGAIAGVGLVKAFQK---HNYNSLGGG  151

Query  571  TVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvg  392
              + VAPG N    +G         E+  +FV ++ +++ A D +++    HV V   + 
Sbjct  152  ANS-VAPGYNKGTALG--------AEIIGTFVLVY-TVFSATDPKRSARDSHVPVLAPLP  201

Query  391  ivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGH-LWDGHWIFWVGPLIACVAFY  215
            I   + V    T+       G G+NPAR  GAA++     +WD HWIFWVGP +  +A  
Sbjct  202  IGFAVFVVHLATIPIT----GTGINPARSFGAAVIYNNEKVWDDHWIFWVGPFVGALAAA  257

Query  214  LYTKII  197
             Y + I
Sbjct  258  AYHQYI  263



>ref|XP_007807367.1| hypothetical protein MAC_01027 [Metarhizium acridum CQMa 102]
 gb|EFY92789.1| hypothetical protein MAC_01027 [Metarhizium acridum CQMa 102]
Length=369

 Score = 80.5 bits (197),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 87/261 (33%), Positives = 125/261 (48%), Gaps = 32/261 (12%)
 Frame = -1

Query  940  LMDFLSLDVWRASMGEVFGTAVLVF--MLDAIVISTYESE-----VKMPNLIMSiliaiv  782
            L  +LS  +WRA++ E   T+ L +  +L A  + +Y +      + + N I+       
Sbjct  118  LAGWLSPAIWRAAVVEAIATSCLAYASLLAASTLVSYNTPRIGGYIGIFNTIL-------  170

Query  781  itvlllaVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssS  602
            + +L+ A  P SGGH+NP +TFSA L GI  + R V+Y+ AQ +GA L    L  V    
Sbjct  171  LAILIYATSPASGGHMNPMITFSAILAGICPVPRGVLYLCAQLLGASLAGGILTGVWGEE  230

Query  601  IENTFSLGGC--TVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAK  428
                   GGC  T +V + G            Q F  E   SFV L+ +  +  D RQA 
Sbjct  231  KAAGIHGGGCFFTPSVTSAG------------QVFLNEAAASFVVLYLAYGVGLDPRQAI  278

Query  427  VLGHVKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFW  248
            + G      +VG  LGL+ F S+ +   +GY GA  NPARC  AA+ R    +   WI+W
Sbjct  279  LFGPRLGPLLVGASLGLVSFASSGIA--EGYGGAQANPARCFAAAIARKDMSY--QWIWW  334

Query  247  VGPLIACVAFYLYTKIIPERH  185
             GP  A V   ++   IP  H
Sbjct  335  FGPAAAAVLLAVFYNAIPPHH  355



>gb|AAB09757.1| similar to mipB gene product in Mesembryanthemum crystallinum, 
encoded by Genbank Accession Number L36097; MIP homolog; Method: 
conceptual translation supplied by author [Mesembryanthemum 
crystallinum]
Length=285

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 65/186 (35%), Positives = 99/186 (53%), Gaps = 18/186 (10%)
 Frame = -1

Query  751  VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGC  572
            +SGGHINP VTF   L   +S++RAV YM+ QC+GA+ GA  +K   S + E   S+GG 
Sbjct  107  ISGGHINPAVTFGLLLARKLSLTRAVFYMIMQCLGAICGAGVVKGFESGAYE---SMGGG  163

Query  571  TVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvg  392
               V +    G      D + A   E+  +FV ++ +++ A D +++    HV +   + 
Sbjct  164  ANVVASAYTKG------DGLGA---EIIGTFVLVY-TVFSATDAKRSARDSHVPLLAPLP  213

Query  391  ivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGPLIACVAFY  215
            I   + +    T+       G G+NPAR +GAA++    H WD HWIFWVGP I      
Sbjct  214  IGFAVFLVHLATIPIT----GTGINPARSLGAAIIYNKAHAWDDHWIFWVGPFIGAALAA  269

Query  214  LYTKII  197
            +Y +I+
Sbjct  270  VYHQIV  275



>ref|XP_003522619.2| PREDICTED: aquaporin PIP2-7 [Glycine max]
Length=322

 Score = 79.7 bits (195),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 67/186 (36%), Positives = 99/186 (53%), Gaps = 18/186 (10%)
 Frame = -1

Query  751  VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGC  572
            +SGGHINP VTF   L   +S+ RA+ YMVAQC+GA+ G   +KA +  S     SLGG 
Sbjct  136  ISGGHINPAVTFGLFLARKVSLIRALFYMVAQCLGAICGVGLVKAFMKHSYN---SLGG-  191

Query  571  TVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvg  392
                   G N  V+ G +   A   E+  +FV ++ +++ A D +++    H+ V   + 
Sbjct  192  -------GANS-VSAGYNKGSALGAEIIGTFVLVY-TVFSATDPKRSARDSHIPVLAPLP  242

Query  391  ivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGPLIACVAFY  215
            I   + +    T+       G G+NPAR  GAA++   G +WD HWIFWVGP +  +A  
Sbjct  243  IGFAVFMVHLATIPI----TGTGINPARSFGAAVIYNNGKVWDDHWIFWVGPFVGALAAA  298

Query  214  LYTKII  197
             Y + I
Sbjct  299  AYHQYI  304



>ref|XP_002511872.1| Aquaporin PIP1.3, putative [Ricinus communis]
 gb|EEF50541.1| Aquaporin PIP1.3, putative [Ricinus communis]
Length=286

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 65/186 (35%), Positives = 96/186 (52%), Gaps = 18/186 (10%)
 Frame = -1

Query  751  VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGC  572
            +SGGHINP VTF   L   +S++RA+ YMV QC+GA+ GA  +K    +  E      G 
Sbjct  108  ISGGHINPAVTFGLLLARKLSLNRAIFYMVMQCLGAICGAGVVKGFQPTPYERV----GG  163

Query  571  TVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvg  392
               +V PG +    +G         E+  +FV ++ +++ A D +++    HV V   + 
Sbjct  164  GANMVNPGYSKGDGLG--------AEIVGTFVLVY-TVFSATDAKRSARDSHVPVLAPLP  214

Query  391  ivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGPLIACVAFY  215
            I   + +    T+       G G+NPAR +GAA++    H WD HWIFWVGP I      
Sbjct  215  IGFAVFLVHLATIPIT----GTGINPARSLGAAIIYNKDHAWDDHWIFWVGPFIGAALAA  270

Query  214  LYTKII  197
            LY +II
Sbjct  271  LYHQII  276



>gb|ACU14125.1| unknown [Glycine max]
Length=262

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 67/186 (36%), Positives = 99/186 (53%), Gaps = 18/186 (10%)
 Frame = -1

Query  751  VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGC  572
            +SGGHINP VTF   L   +S+ RA+ YMVAQC+GA+ G   +KA +  S     SLGG 
Sbjct  89   ISGGHINPAVTFGLFLARKVSLIRALFYMVAQCLGAICGVGLVKAFMKHSYN---SLGG-  144

Query  571  TVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvg  392
                   G N  V+ G +   A   E+  +FV ++ +++ A D +++    H+ V   + 
Sbjct  145  -------GANS-VSAGYNKGSALGAEIIGTFVLVY-TVFSATDPKRSARDSHIPVLAPLP  195

Query  391  ivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGPLIACVAFY  215
            I   + +    T+       G G+NPAR  GAA++   G +WD HWIFWVGP +  +A  
Sbjct  196  IGFAVFMVHLATIPIT----GTGINPARSFGAAVIYNNGKVWDDHWIFWVGPFVGALAAA  251

Query  214  LYTKII  197
             Y + I
Sbjct  252  AYHQYI  257



>ref|XP_009762763.1| PREDICTED: probable aquaporin PIP1-2 [Nicotiana sylvestris]
Length=285

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 72/250 (29%), Positives = 118/250 (47%), Gaps = 21/250 (8%)
 Frame = -1

Query  934  DFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVF  755
            +  S   +RA + E   T + +++    V+   +SE K   + +  +      ++   V+
Sbjct  44   ELTSWSFYRAGIAEFMATFLFLYITILTVMGVSKSESKCSTVGIQGIAWAFGGMIFALVY  103

Query  754  ---PVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFS  584
                +SGGHINP VTF   L   +S++RAV YMV QC+GA+ GA  +K            
Sbjct  104  CTAGISGGHINPAVTFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF----------  153

Query  583  LGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvf  404
              G T+     G    V +G         E+  +FV ++ +++ A D +++    HV + 
Sbjct  154  --GKTLYQTKGGGANVVNLGYTKGSGLGAEIVGTFVLVY-TVFSATDAKRSARDSHVPLL  210

Query  403  tvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGPLIAC  227
              + I   + +    T+       G G+NPAR +GAA++    H WD HWIFWVGP I  
Sbjct  211  APLPIGFAVFLVHLATIPI----TGTGINPARSLGAAIIYNQDHAWDDHWIFWVGPFIGA  266

Query  226  VAFYLYTKII  197
                LY +++
Sbjct  267  ALAALYHQVV  276



>ref|XP_002309126.1| plasma membrane intrinsic protein 1-1 [Populus trichocarpa]
 gb|EEE92649.1| plasma membrane intrinsic protein 1-1 [Populus trichocarpa]
Length=287

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 75/250 (30%), Positives = 121/250 (48%), Gaps = 21/250 (8%)
 Frame = -1

Query  934  DFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVF  755
            ++LS   +RA + E   T + +++    V+    S  K   + +  +      ++ + V+
Sbjct  46   EWLSWSFYRAGIAEFVATFLFLYITVLTVMGVARSSTKCSTVGIQGIAWAFGGMIFVLVY  105

Query  754  ---PVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFS  584
                +SGGHINP VTF   L   ++++RAV YM+ QC+GA+ GA  +K    S  E    
Sbjct  106  CTAGISGGHINPAVTFGLLLARKLTLTRAVFYMIMQCLGAICGAGVVKGFQKSPYE---I  162

Query  583  LGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvf  404
            LGG   T         V+ G        +E+  +FV ++ +++ A D +++    HV V 
Sbjct  163  LGGGANT---------VSTGYSKGSGLGVEILGTFVLVY-TVFSATDAKRSARDSHVPVL  212

Query  403  tvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGPLIAC  227
              + I   + +    T+       G G+NPAR +GAAL+      WD HWIFWVGP I  
Sbjct  213  APLPIGFAVFLVHLATIPI----TGTGINPARSLGAALIYNKDKAWDDHWIFWVGPFIGA  268

Query  226  VAFYLYTKII  197
                LY +I+
Sbjct  269  ALASLYHQIV  278



>gb|AEY75254.1| aquaporin [Atriplex canescens]
Length=282

 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 74/254 (29%), Positives = 119/254 (47%), Gaps = 43/254 (17%)
 Frame = -1

Query  913  WRASMGEVFGTAVLVFMLDAIVISTYESEVK----MPNLIMSiliaivitvlllaVFPVS  746
            WRA++ E   T + +++  A VI  Y+ E      +  L ++     +I VL+     +S
Sbjct  39   WRAAIAEFIATLLFLYITVATVIG-YKKETDPCASVGLLGIAWSFGGMIFVLVYCTAGIS  97

Query  745  GGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTV  566
            GGHINP VTF   L   +S+ RA++YM+AQC GA+                      C V
Sbjct  98   GGHINPAVTFGLFLARKVSLLRALVYMIAQCAGAI----------------------CGV  135

Query  565  TVVAPGPNGP----------VTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGH  416
             +V     GP          V +G +   AF  E+  +FV ++ +++ A D +++    H
Sbjct  136  GLVKAFMKGPYNQFGGGANSVALGYNKGTAFGAELLGTFVLVY-TVFSATDPKRSARDSH  194

Query  415  VKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGP  239
            V +   + I   + +    T+       G G+NPAR  GAA++     +WD HWIFWVGP
Sbjct  195  VPILAPLPIGFAVFMVHLATIPIT----GTGINPARSFGAAVIYNNKKVWDDHWIFWVGP  250

Query  238  LIACVAFYLYTKII  197
             +  +A   Y + +
Sbjct  251  FVGALAAAAYHQYV  264



>ref|XP_009386050.1| PREDICTED: probable aquaporin PIP1-2 [Musa acuminata subsp. malaccensis]
Length=287

 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 62/186 (33%), Positives = 92/186 (49%), Gaps = 18/186 (10%)
 Frame = -1

Query  751  VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGC  572
            +SGGHINP VTF   L   +S++RA+ YMV QC+GA+ GA  +K       EN  + GG 
Sbjct  109  ISGGHINPAVTFGLFLARKLSLTRAIFYMVMQCLGAICGAGVVKGFQKGVYEN--NGGGA  166

Query  571  TVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvg  392
             V          V  G         E+  +F+ ++ +++ A D ++     HV +   + 
Sbjct  167  NV----------VAAGYSKGDGLGAEIVGTFILVY-TVFSATDAKRNARDSHVPILAPLP  215

Query  391  ivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGPLIACVAFY  215
            I   + +    T+       G G+NPAR +GAA++    H WD HWIFWVGP I      
Sbjct  216  IGFAVFLVHLATIPI----TGTGINPARSLGAAIIYNKDHAWDDHWIFWVGPFIGAALAA  271

Query  214  LYTKII  197
             Y +I+
Sbjct  272  FYHQIV  277



>emb|CAE01842.2| OSJNBa0084K11.2 [Oryza sativa Japonica Group]
Length=282

 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 64/186 (34%), Positives = 92/186 (49%), Gaps = 18/186 (10%)
 Frame = -1

Query  751  VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGC  572
            +SG HINP VTF   L   +S++RA+ YMV QC+GA+ GA  +K       E T    G 
Sbjct  104  ISGAHINPAVTFGLFLARKLSLTRALFYMVMQCLGAICGAGVVKGFQKGLYETT----GG  159

Query  571  TVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvg  392
               VVAPG      +G + V  F          L  +++ A D ++     HV +   + 
Sbjct  160  GANVVAPGYTKGDGLGAEIVGTF---------ILVYTVFSATDAKRNARDSHVPILAPLP  210

Query  391  ivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRG-GHLWDGHWIFWVGPLIACVAFY  215
            I   + +    T+       G G+NPAR +GAA++   GH WD HWIFWVGP I      
Sbjct  211  IGFAVFLVHLATIPIT----GTGINPARSLGAAIIYNRGHAWDDHWIFWVGPFIGAALAA  266

Query  214  LYTKII  197
            +Y +++
Sbjct  267  IYHQVV  272



>ref|XP_006362987.1| PREDICTED: probable aquaporin PIP1-2-like [Solanum tuberosum]
Length=286

 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 69/250 (28%), Positives = 117/250 (47%), Gaps = 21/250 (8%)
 Frame = -1

Query  934  DFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVF  755
            + +S   +RA + E   T + +++    V+   +S+ K   + +  +      ++   V+
Sbjct  45   ELMSWSFYRAGIAEFVATFLFLYITVLTVMGVSKSDSKCSTVGIQGIAWAFGGMIFALVY  104

Query  754  ---PVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFS  584
                +SGGHINP VTF   L   +S++RAV YMV QC         L A+  + +   F 
Sbjct  105  CTAGISGGHINPAVTFGLFLARKLSLTRAVFYMVMQC---------LGAICGAGVVKAF-  154

Query  583  LGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvf  404
              G T+     G    V VG         E+  +FV ++ +++ A D +++    HV + 
Sbjct  155  --GKTLYQTKGGGANVVNVGYTNGDGLGAEIIGTFVLVY-TVFSATDAKRSARDSHVPIL  211

Query  403  tvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGG-HLWDGHWIFWVGPLIAC  227
              + I   + +    T+       G G+NPAR +GAA++    H W+ HWIFWVGP I  
Sbjct  212  APLPIGFAVFLVHLATIPIT----GTGINPARSLGAAVIYNNEHAWNDHWIFWVGPFIGA  267

Query  226  VAFYLYTKII  197
                LY +++
Sbjct  268  ALAALYHQVV  277



>ref|XP_010670234.1| PREDICTED: probable aquaporin PIP1-5 [Beta vulgaris subsp. vulgaris]
Length=285

 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 77/254 (30%), Positives = 116/254 (46%), Gaps = 29/254 (11%)
 Frame = -1

Query  934  DFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVF  755
            +  S   WRA + E   T    F+   I + T     + PN+  S+ I  +       +F
Sbjct  43   ELQSWSFWRAGIAEFMAT----FLFLYITVLTVMGVKRTPNMCASVGIQGIAWAFGGMIF  98

Query  754  P-------VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIE  596
                    +SGGHINP VTF   L   +S++RAV YM+ QC+GA+ GA  +K    S  E
Sbjct  99   ALVYCTAGISGGHINPAVTFGLLLARKLSLTRAVFYMIMQCLGAICGAGVVKGFQPSLYE  158

Query  595  NTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGH  416
               + GG  V          V  G         E+  +FV ++ +++ A D +++    H
Sbjct  159  --INGGGANV----------VNHGYSKGDGLGAEIVGTFVLVY-TVFSATDAKRSARDSH  205

Query  415  VKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGP  239
            V +   + I   + +    T+       G G+NPAR +GAA++      WD HWIFWVGP
Sbjct  206  VPILAPLPIGFAVFLVHLATIPIT----GTGINPARSLGAAIIFNRDQAWDHHWIFWVGP  261

Query  238  LIACVAFYLYTKII  197
             I      LY +I+
Sbjct  262  FIGAALAALYHQIV  275



>ref|XP_006288376.1| hypothetical protein CARUB_v10001627mg [Capsella rubella]
 gb|EOA21274.1| hypothetical protein CARUB_v10001627mg [Capsella rubella]
Length=287

 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 64/186 (34%), Positives = 95/186 (51%), Gaps = 18/186 (10%)
 Frame = -1

Query  751  VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGC  572
            +SGGHINP VTF   L   +S++RAV YM+ QC+GA+ GA  +K       +   +LGG 
Sbjct  109  ISGGHINPAVTFGLFLARKLSLTRAVFYMIMQCLGAICGAGVVKGFQPKQYQ---TLGG-  164

Query  571  TVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvg  392
                   G NG V  G         E+  +FV ++ +++ A D +++    HV +   + 
Sbjct  165  -------GANG-VADGYSKGSGLGAEIIGTFVLVY-TVFSATDAKRSARDSHVPILAPLP  215

Query  391  ivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGPLIACVAFY  215
            I   + +    T+       G G+NPAR +GAA++    H WD HWIFWVGP I      
Sbjct  216  IGFAVFLVHLATIPI----TGTGINPARSLGAAIIYNKDHSWDDHWIFWVGPFIGAALAA  271

Query  214  LYTKII  197
            LY  ++
Sbjct  272  LYHTLV  277



>gb|EYU40445.1| hypothetical protein MIMGU_mgv1a011413mg [Erythranthe guttata]
Length=282

 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 64/186 (34%), Positives = 97/186 (52%), Gaps = 18/186 (10%)
 Frame = -1

Query  751  VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGC  572
            +SGGHINP VTF   L   +S+ RAV YMVAQC    LGA+    +V + +++ ++  G 
Sbjct  96   ISGGHINPAVTFGLFLARKVSLVRAVAYMVAQC----LGAICGVGLVKAFMKSPYNHLGG  151

Query  571  TVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvg  392
                VAPG N    +G         E+  +FV ++ +++ A D +++    HV V   + 
Sbjct  152  GANSVAPGYNKGTALG--------AEIIGTFVLVY-TVFSATDPKRSARDSHVPVLAPLP  202

Query  391  ivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGPLIACVAFY  215
            I   + +    T+       G G+NPAR  GAA++   G +WD  WIFWVGP +  +A  
Sbjct  203  IGFAVFMVHLATIPIT----GTGINPARSFGAAVIFNNGKVWDDQWIFWVGPFVGALAAA  258

Query  214  LYTKII  197
             Y + I
Sbjct  259  AYHQYI  264



>gb|KFY35507.1| hypothetical protein V494_05845 [Pseudogymnoascus pannorum VKM 
F-4513 (FW-928)]
Length=324

 Score = 79.3 bits (194),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 80/278 (29%), Positives = 130/278 (47%), Gaps = 33/278 (12%)
 Frame = -1

Query  1009  NGTHQWTGEKIP--SSHLTLAQKLGLMDFLSLDVWRASMGEVFGTAVLVFMLDAIV----  848
             N  H    +++P  S  ++  +   L  FL L++W+A++ E  GT +LV++   I     
Sbjct  33    NLDHVSILKRVPDASPFISAGEIFDLQGFLVLELWKAAIIEGVGTFLLVWITVLIAAHSS  92

Query  847   ----------ISTYESEVKMPNLIMSiliaivitvlllaVFPVSGGHINPTVTFSAALVG  698
                          + + + +  L+  I   I++T+ +  + PVSGGH+NP +T S     
Sbjct  93    TIPPPTPSPTSGIFSTPIFLGPLVGGITNMIILTLFIYCLGPVSGGHLNPIITMSTFTAR  152

Query  697   IISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTVTVVAPGPNGPVTVGLD  518
             + +  R V+Y+  Q  GA +  L +++         F +GGC++         P  V + 
Sbjct  153   LSTFPRMVLYIAFQTAGACIAGLMIRSSYG---SRDFLVGGCSID--------PALVPIA  201

Query  517   TVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivlgllvfISTTLTTKKG  338
              +  F LE    F  LF +  +  D RQA+  G    F  + + + L V    T  T+ G
Sbjct  202   DI--FALEFMADFTLLFLAFGVGLDPRQAQTFG--PAFGPLLVGIVLGVLSFGTSITRTG  257

Query  337   YAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLIACV  224
             YAGA MNPARC GA +  G H     W+ WV P++A V
Sbjct  258   YAGASMNPARCTGAFV--GSHFPGHAWVVWVAPIVASV  293



>ref|NP_567178.1| plasma membrane intrinsic protein 1;4 [Arabidopsis thaliana]
 sp|Q39196.1|PIP14_ARATH RecName: Full=Probable aquaporin PIP1-4; AltName: Full=Plasma 
membrane intrinsic protein 1-4; Short=AtPIP1;4; AltName: Full=Transmembrane 
protein C; Short=TMP-C [Arabidopsis thaliana]
 dbj|BAA05654.1| transmembrane protein [Arabidopsis thaliana]
 gb|AAM20676.1| probable plasma membrane intrinsic protein 1c [Arabidopsis thaliana]
 gb|AAM53343.1| probable plasma membrane intrinsic protein 1c [Arabidopsis thaliana]
 gb|AAN15649.1| probable plasma membrane intrinsic protein 1c [Arabidopsis thaliana]
 gb|AAP13421.1| At4g00430 [Arabidopsis thaliana]
 gb|AEE81879.1| plasma membrane intrinsic protein 1;4 [Arabidopsis thaliana]
Length=287

 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 76/254 (30%), Positives = 118/254 (46%), Gaps = 29/254 (11%)
 Frame = -1

Query  934  DFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVF  755
            +  S   +RA + E   T    F+   I + T     + PN+  S+ I  +       +F
Sbjct  45   ELSSWSFYRAGIAEFIAT----FLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIF  100

Query  754  P-------VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIE  596
                    +SGGHINP VTF   L   +S++RAV YM+ QC+GA+ GA  +K    +  +
Sbjct  101  ALVYCTAGISGGHINPAVTFGLFLARKLSLTRAVFYMIMQCLGAICGAGVVKGFQPTPYQ  160

Query  595  NTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGH  416
               +LGG   TV           G         E+  +FV ++ +++ A D +++    H
Sbjct  161  ---TLGGGANTVAH---------GYTKGSGLGAEIIGTFVLVY-TVFSATDAKRSARDSH  207

Query  415  VKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGP  239
            V +   + I   + +    T+       G G+NPAR +GAA++    H WD HWIFWVGP
Sbjct  208  VPILAPLPIGFAVFLVHLATIPIT----GTGINPARSLGAAIIYNKDHSWDDHWIFWVGP  263

Query  238  LIACVAFYLYTKII  197
             I      LY +I+
Sbjct  264  FIGAALAALYHQIV  277



>dbj|BAD90697.1| plasma membrane intrinsic protein 2;1 [Mimosa pudica]
Length=287

 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 66/186 (35%), Positives = 94/186 (51%), Gaps = 18/186 (10%)
 Frame = -1

Query  751  VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGC  572
            +SGGHINP VTF   L   +S+ RAV+YMVAQC GA+ G    KA   +  +      G 
Sbjct  103  ISGGHINPAVTFGLFLGRKVSLIRAVLYMVAQCAGAICGTGLAKAFQKAYYDRY----GG  158

Query  571  TVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvg  392
             V  V PG +    +G         E+  +FV ++ +++ A D ++     HV V   + 
Sbjct  159  GVNFVQPGYSKGTALG--------AEIIGTFVLVY-TVFSATDPKRNARDSHVPVLAPLP  209

Query  391  ivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGPLIACVAFY  215
            I   + +    T+       G G+NPAR  GAA++  G   WD HWIFWVGP I  +A  
Sbjct  210  IGFAVFMVHLATIPVT----GTGINPARSFGAAVIYNGSKAWDDHWIFWVGPAIGALAAA  265

Query  214  LYTKII  197
            +Y + I
Sbjct  266  IYHQYI  271



>ref|XP_002872953.1| hypothetical protein ARALYDRAFT_912203 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49212.1| hypothetical protein ARALYDRAFT_912203 [Arabidopsis lyrata subsp. 
lyrata]
Length=287

 Score = 78.6 bits (192),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 76/254 (30%), Positives = 118/254 (46%), Gaps = 29/254 (11%)
 Frame = -1

Query  934  DFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVF  755
            +  S   +RA + E   T    F+   I + T     + PN+  S+ I  +       +F
Sbjct  45   ELSSWSFYRAGIAEFIAT----FLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIF  100

Query  754  P-------VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIE  596
                    +SGGHINP VTF   L   +S++RAV YM+ QC+GA+ GA  +K    +  +
Sbjct  101  ALVYCTAGISGGHINPAVTFGLFLARKLSLTRAVFYMIMQCLGAICGAGVVKGFQPTHYQ  160

Query  595  NTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGH  416
               +LGG   TV           G         E+  +FV ++ +++ A D +++    H
Sbjct  161  ---TLGGGANTVAH---------GYTKGSGLGAEIIGTFVLVY-TVFSATDAKRSARDSH  207

Query  415  VKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGP  239
            V +   + I   + +    T+       G G+NPAR +GAA++    H WD HWIFWVGP
Sbjct  208  VPILAPLPIGFAVFLVHLATIPIT----GTGINPARSLGAAIIYNKDHSWDDHWIFWVGP  263

Query  238  LIACVAFYLYTKII  197
             I      LY +I+
Sbjct  264  FIGAALAALYHQIV  277



>ref|XP_010548112.1| PREDICTED: probable aquaporin PIP2-8 [Tarenaya hassleriana]
Length=281

 Score = 78.6 bits (192),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 66/187 (35%), Positives = 97/187 (52%), Gaps = 20/187 (11%)
 Frame = -1

Query  751  VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFS-LGG  575
            +SGGHINP VTF   L   +S+ RAV YMVAQC    LGA+    +V + ++N ++ LGG
Sbjct  95   ISGGHINPAVTFGLFLARKVSLVRAVAYMVAQC----LGAICGVGLVKAFMKNPYNRLGG  150

Query  574  CTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvv  395
               TV           G +T  A   E+  +FV ++ +++ A D +++    HV V   +
Sbjct  151  GANTVAD---------GYNTGTALGAEIIGTFVLVY-TVFSATDPKRSARDSHVPVLAPL  200

Query  394  givlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGPLIACVAF  218
             I   + +    T+       G G+NPAR  GAA++      WD HWIFWVGP +  +A 
Sbjct  201  PIGFAVFMVHLATIPIT----GTGINPARSFGAAVIYNNDKAWDDHWIFWVGPFVGALAA  256

Query  217  YLYTKII  197
              Y + I
Sbjct  257  AAYHQYI  263



>sp|P42767.1|PIP1_ATRCA RecName: Full=Aquaporin PIP-type [Atriplex canescens]
 gb|AAA86991.1| aquaporin [Atriplex canescens]
Length=282

 Score = 78.6 bits (192),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 74/254 (29%), Positives = 119/254 (47%), Gaps = 43/254 (17%)
 Frame = -1

Query  913  WRASMGEVFGTAVLVFMLDAIVISTYESEVK----MPNLIMSiliaivitvlllaVFPVS  746
            WRA++ E   T + +++  A VI  Y+ E      +  L ++     +I VL+     +S
Sbjct  39   WRAAIAEFIATLLFLYITVATVIG-YKKETDPCASVGLLGIAWSFGGMIFVLVYCTAGIS  97

Query  745  GGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTV  566
            GGHINP VTF   L   +S+ RA++YM+AQC GA+                      C V
Sbjct  98   GGHINPAVTFGLFLARKVSLLRALVYMIAQCAGAI----------------------CGV  135

Query  565  TVVAPGPNGP----------VTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGH  416
             +V     GP          V +G +   AF  E+  +FV ++ +++ A D +++    H
Sbjct  136  GLVKAFMKGPYNQFGGGANSVALGYNKGTAFGAELIGTFVLVY-TVFSATDPKRSARDSH  194

Query  415  VKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGP  239
            V +   + I   + +    T+       G G+NPAR  GAA++     +WD HWIFWVGP
Sbjct  195  VPILAPLPIGFAVFMVHLATIPIT----GTGINPARSFGAAVIYNKKRVWDDHWIFWVGP  250

Query  238  LIACVAFYLYTKII  197
             +  +A   Y + +
Sbjct  251  FVGALAAAAYHQYV  264



>ref|XP_008778916.1| PREDICTED: probable aquaporin PIP1-2 isoform X1 [Phoenix dactylifera]
Length=287

 Score = 78.6 bits (192),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 66/186 (35%), Positives = 98/186 (53%), Gaps = 18/186 (10%)
 Frame = -1

Query  751  VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGC  572
            +SGGHINP VTF   L   +S++RA++YMV QC+GA+ GA  +K       E+     G 
Sbjct  109  ISGGHINPAVTFGLLLARKLSLTRALLYMVMQCLGAICGAGVVKGFQKGIYESN----GG  164

Query  571  TVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvg  392
               VVAPG     T G D + A   E+  +FV ++ +++ A D +++    HV +   + 
Sbjct  165  GANVVAPG----YTKG-DGLGA---EIIGTFVLVY-TVFSATDAKRSARDSHVPLLAPLP  215

Query  391  ivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGPLIACVAFY  215
            I   + +    T+       G G+NPAR +GAA++    H WD  WIFWVGP I      
Sbjct  216  IGFAVFLVHLATIPI----TGTGINPARSLGAAIIYNKDHAWDDQWIFWVGPFIGAALAA  271

Query  214  LYTKII  197
             Y +I+
Sbjct  272  FYHQIV  277



>gb|KFY08157.1| hypothetical protein V492_06492 [Pseudogymnoascus pannorum VKM 
F-4246]
Length=309

 Score = 79.0 bits (193),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 81/270 (30%), Positives = 134/270 (50%), Gaps = 33/270 (12%)
 Frame = -1

Query  985  EKIP--SSHLTLAQKLGLMDFLSLDVWRASMGEVFGTAVLVFMLDAIV------------  848
            +++P  S  ++  +   L  FL L++W+A++ E  GT +LV++   I             
Sbjct  26   KRVPDASPFISAGEIFDLRGFLVLELWKAAIIEGVGTFLLVWITVLIAAHSSTIPPPTPS  85

Query  847  --ISTYESEVKMPNLIMSiliaivitvlllaVFPVSGGHINPTVTFSAALVGIISMSRAV  674
                 + + + +  L+  I   I++T+ +  + PVSGGH+NP +T S     + +  R V
Sbjct  86   PTSGIFSTPIFLGPLVGGITNMIILTLFIYCLGPVSGGHLNPIITMSTFTARLSTFPRMV  145

Query  673  IYMVAQCvgavlgalalkavvssSIENTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLE  494
            +Y++ Q  GA +  L +++         F +GGC++         P  V +  +  F LE
Sbjct  146  LYIIFQTAGACIAGLMIRSSYG---SRDFLVGGCSID--------PALVPIADI--FALE  192

Query  493  VFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivlgllvfISTTLTTKKGYAGAGMNP  314
                F  LF +  +  D RQA+  G      +VG+VLG+L F ++   T+ GYAGA MNP
Sbjct  193  FMADFTQLFLAFGVGLDPRQAQTFGPALGPFLVGVVLGVLSFGTSI--TRTGYAGASMNP  250

Query  313  ARCVGAALVRGGHLWDGHWIFWVGPLIACV  224
            ARC GA +  G H     W+ WV P++A V
Sbjct  251  ARCTGAFV--GSHFLGHAWVVWVAPIVASV  278



>gb|AAL49749.1|AF452011_1 aquaporin-like protein [Petunia x hybrida]
Length=286

 Score = 78.6 bits (192),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 71/250 (28%), Positives = 122/250 (49%), Gaps = 21/250 (8%)
 Frame = -1

Query  934  DFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVF  755
            + +S   +RA + E   T + +++    V+   +S+ K   + +  +      ++   V+
Sbjct  45   ELMSWSFYRAGIAEFMATFLFLYITVLTVMGVSKSDSKCSTVGIQGIAWAFGGMIFALVY  104

Query  754  ---PVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFS  584
                +SGGHINP VTF   L   +S++RA+ YMV QC+GA+ GA  +K       +  + 
Sbjct  105  CTAGISGGHINPAVTFGLFLARKLSLTRALFYMVMQCLGAICGAGVVKGFG----KTLYQ  160

Query  583  LGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvf  404
              G    VVAPG      +G         E+  +FV ++ +++ A D +++    HV + 
Sbjct  161  TKGGGANVVAPGYTKGDGLG--------AEIVGTFVLVY-TVFSATDAKRSARDSHVPLL  211

Query  403  tvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGG-HLWDGHWIFWVGPLIAC  227
              + I   + +    T+       G G+NPAR +GAA++    H W+ HWIFWVGP I  
Sbjct  212  APLPIGFAVFLVHLATIPIT----GTGINPARSLGAAIIYNQEHAWNDHWIFWVGPFIGA  267

Query  226  VAFYLYTKII  197
                LY +++
Sbjct  268  ALAALYHQVV  277



>gb|KHG13859.1| putative aquaporin PIP-type 7a [Gossypium arboreum]
Length=289

 Score = 78.6 bits (192),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 71/247 (29%), Positives = 120/247 (49%), Gaps = 20/247 (8%)
 Frame = -1

Query  925  SLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVF---  755
            S   +RA + E   T + +++    V+   + + K P + +  +      ++   V+   
Sbjct  50   SWSFYRAGIAEFMATFLFLYITILTVMGVVKEKTKCPTVGIQGIAWAFGGMIFALVYCTA  109

Query  754  PVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGG  575
             +SGGHINP VTF   L   +S++RAV YMV QC+GA+ GA  +K  +    +  + L G
Sbjct  110  GISGGHINPAVTFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFMG---KTRYGLLG  166

Query  574  CTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvv  395
                 V P       +G         E+  +FV ++ +++ A D +++    HV +   +
Sbjct  167  GGANAVNPDYTNGAALG--------AEIVGTFVLVY-TVFSATDAKRSARDSHVPILAPL  217

Query  394  givlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGPLIACVAF  218
             I   + +    T+       G G+NPAR +GAA++      WDGHWIFWVGP I  +  
Sbjct  218  PIGFAVFLVHLATIPV----TGTGINPARSLGAAIIFNKDKGWDGHWIFWVGPFIGALLA  273

Query  217  YLYTKII  197
             LY +++
Sbjct  274  ALYHQVV  280



>dbj|GAM40292.1| aquaporin transporter [Talaromyces cellulolyticus]
Length=324

 Score = 79.0 bits (193),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 84/271 (31%), Positives = 124/271 (46%), Gaps = 33/271 (12%)
 Frame = -1

Query  985  EKIPSSHLTLAQKLG--LMDFLSLDVWRASMGEVFGTAVLVFMLDAIVIST---------  839
            E+ P +   ++ + G  L  F  LD+WR    E+ GT +LVF+   I +           
Sbjct  58   ERFPDAAPLMSFREGTNLSGFWDLDLWRFGFIEMIGTMLLVFVTAWISVRPPMSSSAVPS  117

Query  838  -----YESEVKMPNLIMSiliaivitvlllaVFPVSGGHINPTVTFSAALVGIISMSRAV  674
                 + +   +  L   I+  + +T+ +     VSG H+NP ++ +  L  +IS  R  
Sbjct  118  SASGIFSTTAFLGPLFGGIINWLFLTLFIFTFSNVSGSHLNPAISIATFLARLISFPRMA  177

Query  673  IYMVAQCvgavlgalalkavvssSIENTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLE  494
            IY++ Q  G  +    L+          F+ GGC +            V LD  +AF LE
Sbjct  178  IYVLCQTTGGAIAGFTLRKAYG---ARDFTCGGCVIE--------QSMVPLD--EAFLLE  224

Query  493  VFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivlgllvfISTTLTTKKGYAGAGMNP  314
               S V +F S  +  D RQ KV G      +VG+VLG L   S  + T  G+AGA MNP
Sbjct  225  FMFSLVLIFLSFGVGLDPRQGKVYGPALSPFLVGMVLGTLSLGSAFVRT--GFAGASMNP  282

Query  313  ARCVGAALVRGGHLWDGHWIFWVGPLIACVA  221
            ARC G  +      +  HWI WVGP++A VA
Sbjct  283  ARCFGVFVATSFPTY--HWIHWVGPIVASVA  311



>gb|AAW55293.1| aquaporin 1 [Aegiceras corniculatum]
Length=178

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 97/185 (52%), Gaps = 17/185 (9%)
 Frame = -1

Query  748  SGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGCT  569
            SGGHINP VTF   L   +S++RAV YM+ QC+GA+ GA  +K        + F++ G  
Sbjct  1    SGGHINPAVTFGLLLARKLSLTRAVFYMIMQCLGAICGAGVVKGFEG---SSRFTIAGGG  57

Query  568  VTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgi  389
              VV PG     T G D + A   E+  +FV ++ +++ A D ++     HV +   + I
Sbjct  58   ANVVQPG----YTKG-DGLGA---EIVGTFVLVY-TVFSATDAKRNARDSHVPILAPLPI  108

Query  388  vlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGPLIACVAFYL  212
               + +    T+       G G+NPAR +GAA++      WD HWIFWVGP I      L
Sbjct  109  GFAVFLVHLATIPIT----GTGINPARSLGAAIIYNKDQAWDEHWIFWVGPFIGAALAAL  164

Query  211  YTKII  197
            Y +++
Sbjct  165  YHQVV  169



>emb|CDX71738.1| BnaC08g31360D [Brassica napus]
Length=286

 Score = 78.2 bits (191),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 76/254 (30%), Positives = 116/254 (46%), Gaps = 29/254 (11%)
 Frame = -1

Query  934  DFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVF  755
            +  S   WRA + E   T    F+   I + T     + PN+  S+ I  +       +F
Sbjct  44   ELSSWSFWRAGIAEFIAT----FLFLYITVLTVMGVKRSPNMCASVGIQGIAWAFGGMIF  99

Query  754  P-------VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIE  596
                    +SGGHINP VTF   L   +S++RA+ Y+V QC+GA+ GA  +K        
Sbjct  100  ALVYCTAGISGGHINPAVTFGLFLARKLSLTRALYYIVMQCLGAICGAGVVKGFQ----P  155

Query  595  NTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGH  416
            N +   G     VAPG      +G         E+  +FV ++ +++ A D ++     H
Sbjct  156  NQYQALGGGANTVAPGYTKGSGLG--------AEIIGTFVLVY-TVFSATDAKRNARDSH  206

Query  415  VKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGP  239
            V +   + I   + +    T+       G G+NPAR +GAA++    H WD HW+FWVGP
Sbjct  207  VPILAPLPIGFAVFLVHLATIPIT----GTGINPARSLGAAIIYNKDHSWDDHWVFWVGP  262

Query  238  LIACVAFYLYTKII  197
             I      LY  I+
Sbjct  263  FIGAALAALYHVIV  276



>ref|XP_011043133.1| PREDICTED: probable aquaporin PIP2-8 [Populus euphratica]
Length=276

 Score = 77.8 bits (190),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 64/186 (34%), Positives = 96/186 (52%), Gaps = 18/186 (10%)
 Frame = -1

Query  751  VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGC  572
            +SGGHINP VTF   +   +S+ RAV YM+AQC+GA+LG   +  +     +      G 
Sbjct  90   ISGGHINPAVTFGLFVARKVSLIRAVAYMMAQCLGAMLGVWMVMILTGIHYDQA----GG  145

Query  571  TVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvg  392
             V VVAPG +    +G         E+  +FV ++ ++  A D ++     HV V   + 
Sbjct  146  AVNVVAPGYSKGTALGA--------EIIGTFVLVY-TVLAATDPKRMARDSHVPVLAPLP  196

Query  391  ivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGG-HLWDGHWIFWVGPLIACVAFY  215
            I   + V     +       G G+NPAR +GAA+V+    +WD HWIFWVGP +  +A  
Sbjct  197  IGFAVFVVHLALIPIT----GTGINPARSLGAAVVKNAKEIWDDHWIFWVGPFVGALAAA  252

Query  214  LYTKII  197
            +Y + I
Sbjct  253  VYHQYI  258



>emb|CAH60721.1| putative plasma membrane intrinsic protein [Populus tremula x 
Populus tremuloides]
Length=279

 Score = 78.2 bits (191),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 66/186 (35%), Positives = 96/186 (52%), Gaps = 18/186 (10%)
 Frame = -1

Query  751  VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGC  572
            +SGGHINP VTF   L   +S+ RAV YMVAQC+GA+ G   +KA +        SLGG 
Sbjct  93   ISGGHINPAVTFGLFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKKKYN---SLGGG  149

Query  571  TVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvg  392
              T         V +G +T  A   E+  +FV ++ +++ A D +++    H+ V   + 
Sbjct  150  ANT---------VAMGYNTGTALGAEIIGTFVLVY-TVFSATDPKRSARDSHIPVLAPLP  199

Query  391  ivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGPLIACVAFY  215
            I   + +    T+       G G+NPAR  GAA++      WD HWIFWVGP +  +A  
Sbjct  200  IGFAVFMVHLATIPIT----GTGINPARSFGAAVIFNNEKAWDDHWIFWVGPFVGALAAA  255

Query  214  LYTKII  197
             Y + I
Sbjct  256  AYHQYI  261



>gb|AAT74898.1| plasma membrane intrinsic protein PIP1-1 [Fraxinus excelsior]
Length=286

 Score = 78.2 bits (191),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 66/186 (35%), Positives = 98/186 (53%), Gaps = 18/186 (10%)
 Frame = -1

Query  751  VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGC  572
            +SGGHINP VTF   L   +S++RA+ YMV QC+GA+ GA  +K       +  +   G 
Sbjct  109  ISGGHINPAVTFGLFLARKLSLTRAIFYMVMQCLGAICGAGVVKGFG----KTLYMTKGG  164

Query  571  TVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvg  392
               VVAPG     T G D + A   E+  +FV ++ +++ A D +++    HV +   + 
Sbjct  165  GANVVAPG----YTKG-DGLGA---EIVGTFVLVY-TVFSATDAKRSARDSHVPILAPLP  215

Query  391  ivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGPLIACVAFY  215
            I   + +    T+       G G+NPAR +GAA++    H WD HWIFWVGP I      
Sbjct  216  IGFAVFLVHLATIPI----TGTGINPARSLGAAIIYNKDHAWDDHWIFWVGPFIGAALAA  271

Query  214  LYTKII  197
            LY  ++
Sbjct  272  LYHVVV  277



>ref|XP_007041804.1| Plasma membrane intrinsic protein 2,8 isoform 1 [Theobroma cacao]
 gb|EOX97635.1| Plasma membrane intrinsic protein 2,8 isoform 1 [Theobroma cacao]
Length=278

 Score = 77.8 bits (190),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 77/255 (30%), Positives = 124/255 (49%), Gaps = 24/255 (9%)
 Frame = -1

Query  940  LMDFLSLDVW---RASMGEVFGTAVLVFMLDAIVISTYESEVKMPN---LIMSiliaivi  779
            L+D   L +W   RA + E   T + +++  A VI   + +        L ++     +I
Sbjct  23   LIDMAELKLWSFYRALIAEFIATLLFLYVTIATVIGYKKQQDACDGVGLLGIAWAFGGMI  82

Query  778  tvlllaVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSI  599
             +L+     +SGGHINP VTF   L   +S+ RAV YMVAQC    LGA+    +V + +
Sbjct  83   FILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVAYMVAQC----LGAICGVGLVKAFM  138

Query  598  ENTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLG  419
            ++ ++  G     VA G N    +G         E+  +FV ++ +++ A D +++    
Sbjct  139  KHDYNSQGGGANTVASGYNKGTALG--------AEIIGTFVLVY-TVFSATDPKRSARDS  189

Query  418  HVKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGH-LWDGHWIFWVG  242
            HV V   + I   + +    T+       G G+NPAR +GAA++      WD HWIFWVG
Sbjct  190  HVPVLAPLPIGFAVFMVHLATIPIT----GTGINPARSIGAAVIYNNEKAWDDHWIFWVG  245

Query  241  PLIACVAFYLYTKII  197
            P +  +A   Y + I
Sbjct  246  PFVGALAAAAYHQYI  260



>tpg|DAA33860.1| TPA_inf: aquaporin PIP1;6 [Gossypium hirsutum]
 gb|KHG11081.1| putative aquaporin PIP1-4 -like protein [Gossypium arboreum]
Length=287

 Score = 78.2 bits (191),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 64/186 (34%), Positives = 93/186 (50%), Gaps = 18/186 (10%)
 Frame = -1

Query  751  VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGC  572
            +SGGHINP VTF   L   +S+ RAV YM+ QC+GA+ GA  +K+   +  E    LGG 
Sbjct  110  ISGGHINPAVTFGLFLARKLSLIRAVFYMIMQCLGAICGAAVVKSFQKTQYER---LGGG  166

Query  571  TVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvg  392
              T         V+ G         E+  +FV ++ +++ A D ++     HV +   + 
Sbjct  167  ANT---------VSSGYSKSSGLGAEIVGTFVLVY-TVFSATDAKRNARDSHVPILAPLP  216

Query  391  ivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGPLIACVAFY  215
            I   + +    T+       G G+NPAR +GAAL+      WD HWIFWVGP I      
Sbjct  217  IGFAVFLVHLATIPV----TGTGINPARSLGAALIYNKDQAWDDHWIFWVGPFIGAALAA  272

Query  214  LYTKII  197
            LY +I+
Sbjct  273  LYHQIV  278



>dbj|BAF32042.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32043.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32044.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32045.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32046.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32047.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32048.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32049.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32050.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32051.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32052.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32053.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32054.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32055.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32056.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32057.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32058.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32059.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32060.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32061.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32062.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32063.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32064.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32065.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32066.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32067.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32068.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32069.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32070.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32071.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32072.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32073.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32074.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32075.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32076.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32077.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32078.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32079.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32080.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32081.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32082.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32083.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32084.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32085.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32086.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32087.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32088.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32089.1| putative aquaporin [Cryptomeria japonica]
Length=275

 Score = 77.8 bits (190),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 79/255 (31%), Positives = 125/255 (49%), Gaps = 24/255 (9%)
 Frame = -1

Query  940  LMDFLSLDVW---RASMGEVFGTAVLVFMLDAIVISTYESEVKMPN---LIMSiliaivi  779
            L+DF    +W   RA + E   T + +++  A VI    +     +   L ++     +I
Sbjct  20   LVDFEEFKLWSFYRALIAEFIATLLFLYITVATVIGHKRTAANCGSVGILGIAWAFGGMI  79

Query  778  tvlllaVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSI  599
             VL+     +SGGHINP VTF   L   +S+ RAV+YMVAQC+GA+ G   +KA      
Sbjct  80   FVLVYCTAGISGGHINPAVTFGLFLARKVSLPRAVLYMVAQCLGAICGVGLVKAFQ----  135

Query  598  ENTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLG  419
            ++ + + G     VAPG +    +G         E+  +FV ++ +++ A D +++    
Sbjct  136  KSFYDMYGGGANSVAPGYSKGTGLG--------AEIIGTFVLVY-TVFSATDPKRSARDS  186

Query  418  HVKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRG-GHLWDGHWIFWVG  242
            HV V   + I   + +    T+       G G+NPAR  GAA++ G   +WD  WIFWVG
Sbjct  187  HVPVLAPLPIGFAVFMVHLATIPIT----GTGINPARSFGAAVIYGHDKIWDDQWIFWVG  242

Query  241  PLIACVAFYLYTKII  197
            P +   A   Y + I
Sbjct  243  PFLGAFAAAFYHQYI  257



>gb|ACU87556.1| PIP protein [Gossypium hirsutum]
Length=278

 Score = 77.8 bits (190),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 69/186 (37%), Positives = 98/186 (53%), Gaps = 18/186 (10%)
 Frame = -1

Query  751  VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGC  572
            +SGGHINP VTF   L   +S+ RAV YMVAQC+GA+ G   +KA + S      SLGG 
Sbjct  92   ISGGHINPAVTFGLFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKSEYN---SLGG-  147

Query  571  TVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvg  392
             V  VA G N    +G         E+  +FV ++ +++ A D +++    HV V   + 
Sbjct  148  GVNTVATGYNKGTALG--------AEIIGTFVLVY-TVFSATDPKRSARDSHVPVLAPLP  198

Query  391  ivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGPLIACVAFY  215
            I   + +    T+       G G+NPAR  GAA++      WD HWIFWVGP++  +A  
Sbjct  199  IGFAVFMVHLATIPIT----GTGINPARSFGAAVIYNNDKAWDDHWIFWVGPMVGALAAA  254

Query  214  LYTKII  197
             Y + I
Sbjct  255  AYHQYI  260



>emb|CDY48920.1| BnaA09g39170D [Brassica napus]
Length=286

 Score = 77.8 bits (190),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 76/254 (30%), Positives = 116/254 (46%), Gaps = 29/254 (11%)
 Frame = -1

Query  934  DFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVF  755
            +  S   WRA + E   T    F+   I + T     + PN+  S+ I  +       +F
Sbjct  44   ELSSWSFWRAGIAEFIAT----FLFLYITVLTVMGVKRSPNMCSSVGIQGIAWAFGGMIF  99

Query  754  P-------VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIE  596
                    +SGGHINP VTF   L   +S++RA+ Y+V QC+GA+ GA  +K        
Sbjct  100  ALVYCTAGISGGHINPAVTFGLFLARKLSLTRALYYIVMQCLGAICGAGVVKGFQ----P  155

Query  595  NTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGH  416
            N +   G     VAPG      +G         E+  +FV ++ +++ A D ++     H
Sbjct  156  NQYQALGGGANTVAPGYTKGSGLG--------AEIIGTFVLVY-TVFSATDAKRNARDSH  206

Query  415  VKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGP  239
            V +   + I   + +    T+       G G+NPAR +GAA++    H WD HW+FWVGP
Sbjct  207  VPILAPLPIGFAVFLVHLATIPIT----GTGINPARSLGAAIIYNKDHSWDDHWVFWVGP  262

Query  238  LIACVAFYLYTKII  197
             I      LY  I+
Sbjct  263  FIGAALAALYHVIV  276



>gb|ABH09323.1| putative aquaporin [Vitis vinifera]
Length=286

 Score = 77.8 bits (190),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 78/251 (31%), Positives = 117/251 (47%), Gaps = 29/251 (12%)
 Frame = -1

Query  925  SLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVFP--  752
            S   WRA + E   T    F+   I + T    V+ P+   ++ I  +       +F   
Sbjct  47   SWSFWRAGIAEFMAT----FLFPYITVLTVMGVVRSPSKCATVGIQGIAWAFGGMIFALV  102

Query  751  -----VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTF  587
                 +SGGH+NP VTF   L   +S++RAV YM+ QC+GA+ GA  +K       E   
Sbjct  103  YCTAGISGGHVNPAVTFGLLLARKLSLTRAVFYMIMQCLGAICGAGVVKGFQGHQYE---  159

Query  586  SLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKv  407
             LGG    V A  P G      D + A   E+  +FV ++ +++ A D ++     HV +
Sbjct  160  VLGGGANVVAAGYPKG------DGLGA---EIVGTFVLVY-TVFSATDAKRNARDSHVPI  209

Query  406  ftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRG-GHLWDGHWIFWVGPLIA  230
               + I   + +    T+       G G+NPAR +GAA++    H WD  WIFWVGP I 
Sbjct  210  LAPLPIGFAVFLVHLATIPIT----GTGINPARSLGAAIIYNREHAWDDMWIFWVGPFIG  265

Query  229  CVAFYLYTKII  197
                 LY +I+
Sbjct  266  AALAALYHQIV  276



>ref|NP_001289902.1| probable aquaporin PIP1-4 [Camelina sativa]
 ref|XP_010427011.1| PREDICTED: probable aquaporin PIP1-4 [Camelina sativa]
 gb|AEH76328.1| plasma membrane intrinsic protein 1-4 [Camelina sativa]
Length=287

 Score = 77.8 bits (190),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 63/186 (34%), Positives = 96/186 (52%), Gaps = 18/186 (10%)
 Frame = -1

Query  751  VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGC  572
            +SGGHINP VTF   L   +S++RAV Y++ QC+GA+ GA  +K       +   +LGG 
Sbjct  109  ISGGHINPAVTFGLFLARKLSLTRAVFYIIMQCLGAICGAGVVKGFQPKQYQ---TLGG-  164

Query  571  TVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvg  392
                   G NG V  G         E+  +FV ++ +++ A D +++    HV +   + 
Sbjct  165  -------GANG-VADGYSKGSGLGAEIIGTFVLVY-TVFSATDAKRSARDSHVPILAPLP  215

Query  391  ivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGPLIACVAFY  215
            I   + +    T+       G G+NPAR +GAA++    H WD HWIFWVGP I      
Sbjct  216  IGFAVFLVHLATIPI----TGTGINPARSLGAAIIYNKDHSWDDHWIFWVGPFIGAALAA  271

Query  214  LYTKII  197
            LY +++
Sbjct  272  LYHQLV  277



>ref|XP_010456290.1| PREDICTED: probable aquaporin PIP1-4 [Camelina sativa]
Length=287

 Score = 77.8 bits (190),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 63/186 (34%), Positives = 96/186 (52%), Gaps = 18/186 (10%)
 Frame = -1

Query  751  VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGC  572
            +SGGHINP VTF   L   +S++RAV Y++ QC+GA+ GA  +K       +   +LGG 
Sbjct  109  ISGGHINPAVTFGLFLARKLSLTRAVFYIIMQCLGAICGAGVVKGFQPKQYQ---TLGG-  164

Query  571  TVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvg  392
                   G NG V  G         E+  +FV ++ +++ A D +++    HV +   + 
Sbjct  165  -------GANG-VADGYSKGSGLGAEIIGTFVLVY-TVFSATDAKRSARDSHVPILAPLP  215

Query  391  ivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGPLIACVAFY  215
            I   + +    T+       G G+NPAR +GAA++    H WD HWIFWVGP I      
Sbjct  216  IGFAVFLVHLATIPI----TGTGINPARSLGAAIIYNKDHSWDDHWIFWVGPFIGAALAA  271

Query  214  LYTKII  197
            LY +++
Sbjct  272  LYHQLV  277



>dbj|BAF44223.1| aquaporin [Iris x hollandica]
Length=327

 Score = 78.6 bits (192),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 64/186 (34%), Positives = 91/186 (49%), Gaps = 18/186 (10%)
 Frame = -1

Query  751  VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGC  572
            +SGGHINP VTF   L   +S++RAV YMV QC+GA+ GA  +K       +      G 
Sbjct  111  ISGGHINPAVTFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGYGKMLYQTQ----GG  166

Query  571  TVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvg  392
               VVAPG      +G + V  F          L  +++ A D ++     HV +   + 
Sbjct  167  GANVVAPGYTKGDGLGAEIVGTF---------VLVYTVFSATDAKRNARDSHVPILAPLP  217

Query  391  ivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGPLIACVAFY  215
            I   + +    T+       G G+NPAR +GAA++    H WD HWIFWVGP I      
Sbjct  218  IGFAVFLVHLATIPI----TGTGINPARSLGAAIIYNNDHAWDDHWIFWVGPFIGAALAA  273

Query  214  LYTKII  197
            +Y +I+
Sbjct  274  MYHQIV  279



>gb|ACB38232.1| aquaporin [Gerbera hybrid cultivar]
Length=287

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 67/186 (36%), Positives = 95/186 (51%), Gaps = 17/186 (9%)
 Frame = -1

Query  751  VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGC  572
            +SGGHINP VTF   L   +S++RA+ YMV QC+GA+ GA  +K       ++ F+  G 
Sbjct  108  ISGGHINPAVTFGLLLARKLSLTRALFYMVMQCLGAICGAGVVKGFQG---KHQFTTLGG  164

Query  571  TVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvg  392
               VVA G      +G + +  F L      V LF S   A D +++    HV +   + 
Sbjct  165  GANVVAHGYTKGDGLGAEIIGTFVL------VTLFFS---ATDAKRSARDSHVPILAPLP  215

Query  391  ivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGPLIACVAFY  215
            I   + +    T+       G G+NPAR +GAA++    H WD HWIFWVGP I      
Sbjct  216  IGFAVFLVHLATIPI----TGTGINPARSLGAAIIYNKDHAWDDHWIFWVGPFIGAALAA  271

Query  214  LYTKII  197
            LY +I+
Sbjct  272  LYHQIV  277



>ref|XP_006383054.1| plasma membrane intrinsic protein 1-1 [Populus trichocarpa]
 gb|ERP60851.1| plasma membrane intrinsic protein 1-1 [Populus trichocarpa]
Length=272

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 64/186 (34%), Positives = 96/186 (52%), Gaps = 18/186 (10%)
 Frame = -1

Query  751  VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGC  572
            +SGGHINP VTF   +   +S+ RAV YM+AQC+GA+LG   +  +     +      G 
Sbjct  86   ISGGHINPAVTFGLFVARKVSLIRAVAYMMAQCLGAMLGVWMVMILTGIHYDQA----GG  141

Query  571  TVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvg  392
             V VVAPG +    +G         E+  +FV ++ ++  A D ++     HV V   + 
Sbjct  142  AVNVVAPGYSKGTALGA--------EIIGTFVLVY-TVLAATDPKRMARDSHVPVLAPLP  192

Query  391  ivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGG-HLWDGHWIFWVGPLIACVAFY  215
            I   + V     +       G G+NPAR +GAA+V+    +WD HWIFWVGP +  +A  
Sbjct  193  IGFAVFVVHLALIPIT----GTGINPARSLGAAVVKNAKEIWDDHWIFWVGPFVGALAAA  248

Query  214  LYTKII  197
            +Y + I
Sbjct  249  VYHQYI  254



>ref|XP_010256616.1| PREDICTED: aquaporin PIP1-1-like [Nelumbo nucifera]
Length=286

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 62/186 (33%), Positives = 97/186 (52%), Gaps = 18/186 (10%)
 Frame = -1

Query  751  VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGC  572
            +SGGHINP VTF   L   +S+SRA+ Y+V QC+GA+ GA  +K       ++ + + G 
Sbjct  109  ISGGHINPAVTFGLLLARKLSLSRALFYIVMQCLGAIFGAGVVKGFQ----KSQYEMLGG  164

Query  571  TVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvg  392
               VVA G +    +G         E+  +FV ++ +++ A D ++     HV +   + 
Sbjct  165  GANVVASGYSKGDGLG--------AEIIGTFVLVY-TVFSATDAKRNARDSHVPILAPLP  215

Query  391  ivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGPLIACVAFY  215
            I   + +    T+       G G+NPAR +GAA++    H WD HWIFWVGP I      
Sbjct  216  IGFAVFLVHLATIPI----TGTGINPARSLGAAIIYNKDHAWDDHWIFWVGPFIGAALAA  271

Query  214  LYTKII  197
            LY +++
Sbjct  272  LYHQLV  277



>gb|KFK28910.1| hypothetical protein AALP_AA7G063900 [Arabis alpina]
Length=287

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 76/254 (30%), Positives = 118/254 (46%), Gaps = 29/254 (11%)
 Frame = -1

Query  934  DFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVF  755
            +  S   +RA + E   T    F+   I + T     + PN+  S+ I  +       +F
Sbjct  45   ELKSWSFYRAGIAEFIAT----FLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIF  100

Query  754  P-------VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIE  596
                    VSGGHINP VTF   L   +S++RA+ Y++ QC+GA+ GA  +K        
Sbjct  101  ALVYCTAGVSGGHINPAVTFGLFLARKLSLTRALYYIIMQCLGAICGAGVVKGFQ----P  156

Query  595  NTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGH  416
              +   G    VVA G      +G         E+  +FV ++ +++ A D +++    H
Sbjct  157  GLYQANGGGANVVAHGYTKGSGLGA--------EIIGTFVLVY-TVFSATDAKRSARDSH  207

Query  415  VKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGP  239
            V +   + I   + +    T+       G G+NPAR +GAA++   GH WD HWIFWVGP
Sbjct  208  VPILAPLPIGFAVFLVHLATIPIT----GTGINPARSLGAAIIYNKGHAWDDHWIFWVGP  263

Query  238  LIACVAFYLYTKII  197
             I      LY +I+
Sbjct  264  FIGAALAALYHQIV  277



>ref|XP_002869782.1| PIP1_5/PIP1D [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46041.1| PIP1_5/PIP1D [Arabidopsis lyrata subsp. lyrata]
Length=287

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 75/254 (30%), Positives = 118/254 (46%), Gaps = 29/254 (11%)
 Frame = -1

Query  934  DFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVF  755
            +  S   +RA + E   T    F+   + + T     + PN+  S+ I  +       +F
Sbjct  45   ELKSWSFYRAGIAEFIAT----FLFLYVTVLTVMGVKRAPNMCASVGIQGIAWAFGGMIF  100

Query  754  P-------VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIE  596
                    +SGGHINP VTF   L   +S++RA+ Y+V QC+GA+ GA  +K        
Sbjct  101  ALVYCTAGISGGHINPAVTFGLFLARKLSLTRALFYIVMQCLGAICGAGVVKGFQ----P  156

Query  595  NTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGH  416
              +   G    VVA G      +G         E+  +FV ++ +++ A D +++    H
Sbjct  157  GLYQTNGGGANVVAHGYTKGSGLGA--------EIVGTFVLVY-TVFSATDAKRSARDSH  207

Query  415  VKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGP  239
            V +   + I   + +    T+       G G+NPAR +GAA++   GH WD HWIFWVGP
Sbjct  208  VPILAPLPIGFAVFLVHLATIPIT----GTGINPARSLGAAIIYNKGHAWDDHWIFWVGP  263

Query  238  LIACVAFYLYTKII  197
             I      LY +I+
Sbjct  264  FIGAALAALYHQIV  277



>gb|KHF98939.1| putative aquaporin PIP2-8 -like protein [Gossypium arboreum]
Length=278

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 67/186 (36%), Positives = 96/186 (52%), Gaps = 18/186 (10%)
 Frame = -1

Query  751  VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGC  572
            +SGGHINP VTF   L   +S+ RAV YMVAQC+GA+ G   +KA + S      SLGG 
Sbjct  92   ISGGHINPAVTFGLFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKSEYN---SLGGG  148

Query  571  TVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvg  392
              T         V  G +   A   E+  +FV ++ +++ A D +++    HV V   + 
Sbjct  149  ANT---------VATGYNKGTALGAEIIGTFVLVY-TVFSATDPKRSARDSHVPVLAPLP  198

Query  391  ivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGPLIACVAFY  215
            I   + +    T+       G G+NPAR  GAA++      WD HWIFWVGP++  +A  
Sbjct  199  IGFAVFMVHLATIPIT----GTGINPARSFGAAVIYNNDKAWDDHWIFWVGPMVGALAAA  254

Query  214  LYTKII  197
             Y + I
Sbjct  255  AYHQYI  260



>ref|XP_009138772.1| PREDICTED: aquaporin PIP1-1 [Brassica rapa]
Length=286

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 78/254 (31%), Positives = 119/254 (47%), Gaps = 29/254 (11%)
 Frame = -1

Query  934  DFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVF  755
            +  S   WRA + E   T    F+   I + T     + PN+  S+ I  +       +F
Sbjct  44   ELSSWSFWRAGIAEFIAT----FLFLYITVLTVMGVKRSPNMCASVGIQGIAWAFGGMIF  99

Query  754  P-------VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIE  596
                    +SGGHINP VTF   L   +S++RA+ Y+V QC+GA+ GA  +K       +
Sbjct  100  ALVYCTAGISGGHINPAVTFGLFLARKLSLTRALYYIVMQCLGAICGAGVVKGFQPKQYQ  159

Query  595  NTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGH  416
               +LGG   T VAPG      +G         E+  +FV ++ +++ A D ++     H
Sbjct  160  ---ALGGGANT-VAPGYTKGSGLG--------AEIIGTFVLVY-TVFSATDAKRNARDSH  206

Query  415  VKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGP  239
            V +   + I   + +    T+       G G+NPAR +GAA++    H WD HW+FWVGP
Sbjct  207  VPILAPLPIGFAVFLVHLATIRM----TGTGINPARSLGAAIIYNKDHSWDDHWVFWVGP  262

Query  238  LIACVAFYLYTKII  197
             I      LY  I+
Sbjct  263  FIGAALAALYHVIV  276



>ref|XP_006422584.1| hypothetical protein CICLE_v10029003mg [Citrus clementina]
 ref|XP_006486723.1| PREDICTED: aquaporin PIP2-7-like [Citrus sinensis]
 gb|ESR35824.1| hypothetical protein CICLE_v10029003mg [Citrus clementina]
 gb|KDO68090.1| hypothetical protein CISIN_1g023370mg [Citrus sinensis]
Length=283

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 66/186 (35%), Positives = 95/186 (51%), Gaps = 18/186 (10%)
 Frame = -1

Query  751  VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGC  572
            +SGGHINP VTF   L   +S+ RAV YMVAQC+GA+ G   +KA +        SLGG 
Sbjct  97   ISGGHINPAVTFGLFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKHEYN---SLGGG  153

Query  571  TVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvg  392
              TV +         G +   A   E+  +FV ++ +++ A D +++    HV V   + 
Sbjct  154  ANTVAS---------GYNKGSALGAEIIGTFVLVY-TVFSATDPKRSARDSHVPVLAPLP  203

Query  391  ivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGPLIACVAFY  215
            I   + +    T+       G G+NPAR  GAA++      WD HWIFWVGP +  +A  
Sbjct  204  IGFAVFMVHLATIPIT----GTGINPARSFGAAVIYNNDKAWDDHWIFWVGPFVGALAAA  259

Query  214  LYTKII  197
             Y + I
Sbjct  260  AYHQYI  265



>pir||T10251 membrane protein MP23 precursor - cucurbit
 dbj|BAA08107.1| MP23 precursor [Cucurbita cv. Kurokawa Amakuri]
Length=279

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 65/211 (31%), Positives = 91/211 (43%), Gaps = 45/211 (21%)
 Frame = -1

Query  751  VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGC  572
            +SGGH+NP VTF A L G IS+ R + Y VAQ                        LG  
Sbjct  102  ISGGHVNPAVTFGALLGGRISLIRGIFYWVAQI-----------------------LGAI  138

Query  571  TVTVV---APGPNGP----VTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHV  413
              +++   A G   P    V+ G+  +  F LE+  +F  ++     A D ++   LG +
Sbjct  139  VASLLLRLATGGMRPMGFFVSSGISEMHGFLLEIVLTFALVYTVYATAIDPKRGS-LGTI  197

Query  412  KvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLI  233
                +  IV          +     + GA MNPAR  G +LV  G  WD HWI+W+GPL+
Sbjct  198  APLAIGLIV-------GANILVGGAFDGACMNPARAFGPSLV--GWRWDNHWIYWIGPLL  248

Query  232  -----ACVAFYLYTKIIPERHFHASGYPHDF  155
                 A V  YL   + P  H H    P D+
Sbjct  249  GGGLAALVYEYLVIPVEPPLHTHQPLAPEDY  279



>gb|KFY00868.1| hypothetical protein O988_03072 [Pseudogymnoascus pannorum VKM 
F-3808]
Length=326

 Score = 78.2 bits (191),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 80/272 (29%), Positives = 131/272 (48%), Gaps = 37/272 (14%)
 Frame = -1

Query  985  EKIP--SSHLTLAQKLGLMDFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMP-  815
            +++P  S  ++L     L  FL +++W+A++ E  GT +LV++   + I+ + S V  P 
Sbjct  49   KRVPDASPFISLGDSFNLRGFLEVELWKAAIIEGVGTLLLVWI--TLFIAAHSSTVPPPA  106

Query  814  ---------------NLIMSiliaivitvlllaVFPVSGGHINPTVTFSAALVGIISMSR  680
                            L+  I   I++ + + ++ PVSGGH+NP +T S     + +  R
Sbjct  107  PSPTSGIYSTPIFLGPLVGGITNMIILPLFIYSLGPVSGGHLNPIITMSTFTARLTTFPR  166

Query  679  AVIYMVAQCvgavlgalalkavvssSIENTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFW  500
             V+Y+  Q  GA +  L +++         F +GGCT+           T  +     F 
Sbjct  167  MVLYLAFQTAGACIAGLMIRSSFG---SRDFLVGGCTID----------TSLVPIADIFA  213

Query  499  LEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvgivlgllvfISTTLTTKKGYAGAGM  320
            LE    F  LF +  +  D RQ    G      +VG+VLG+L F ++   ++ GYAGA M
Sbjct  214  LEFMADFTLLFLAFGVGLDPRQMGTFGPALGPFLVGVVLGVLSFGTS--ISRAGYAGASM  271

Query  319  NPARCVGAALVRGGHLWDGHWIFWVGPLIACV  224
            NPARC+GA +  G       W+ WV P++A V
Sbjct  272  NPARCMGAFV--GSRFPAYAWVVWVAPIVAAV  301



>ref|XP_009376943.1| PREDICTED: probable aquaporin PIP2-8 [Pyrus x bretschneideri]
Length=281

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 67/186 (36%), Positives = 97/186 (52%), Gaps = 18/186 (10%)
 Frame = -1

Query  751  VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGC  572
            +SGGHINP VTF   L   +S+ RAV Y+VAQC+GA+ G   +KA       N  SLGG 
Sbjct  95   ISGGHINPAVTFGLFLARKVSLIRAVAYIVAQCLGAIAGVGLVKAFQK---HNYNSLGGG  151

Query  571  TVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvg  392
              + V+PG N    +G         E+  +FV ++ +++ A D +++    HV V   + 
Sbjct  152  ANS-VSPGYNKGTALG--------AEIIGTFVLVY-TVFSATDPKRSARDSHVPVLAPLP  201

Query  391  ivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGH-LWDGHWIFWVGPLIACVAFY  215
            I   + V    T+       G G+NPAR  GAA++     +WD HWIFWVGP +  +   
Sbjct  202  IGFAVFVVHLATIPIT----GTGINPARSFGAAVIYNNEKVWDDHWIFWVGPFVGALGAA  257

Query  214  LYTKII  197
             Y + I
Sbjct  258  AYHQYI  263



>gb|ACB87734.1| aquaporin [Manihot esculenta]
Length=280

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 64/186 (34%), Positives = 98/186 (53%), Gaps = 18/186 (10%)
 Frame = -1

Query  751  VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGC  572
            +SGGHINP VTF   L   +S+ RAV YMVAQC    LGA+    +V + ++++++  G 
Sbjct  94   ISGGHINPAVTFGLFLARKVSLIRAVAYMVAQC----LGAICGVGLVKAFMKHSYNGLGG  149

Query  571  TVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvg  392
                VAPG +    +G         E+  +FV ++ +++ A D +++    HV V   + 
Sbjct  150  GANSVAPGYSKGTALG--------AEIIGTFVLVY-TVFSATDPKRSARDSHVPVLAPLP  200

Query  391  ivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGPLIACVAFY  215
            I   + +    T+       G G+NPAR  GAA++     +WD HWIFWVGP I  +A  
Sbjct  201  IGFAVFMVHLATIPIT----GTGINPARSFGAAVIYNNDKVWDDHWIFWVGPFIGALAAA  256

Query  214  LYTKII  197
             Y + I
Sbjct  257  AYHQYI  262



>ref|XP_008787474.1| PREDICTED: probable aquaporin PIP1-2 [Phoenix dactylifera]
Length=287

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 66/186 (35%), Positives = 96/186 (52%), Gaps = 18/186 (10%)
 Frame = -1

Query  751  VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGC  572
            +SGGHINP VTF   L   +S++RAV YMV QC+GA+ GA  +K       E+     G 
Sbjct  109  ISGGHINPAVTFGLLLARKLSLTRAVFYMVMQCLGAICGAGVVKGFQKGLYESN----GG  164

Query  571  TVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvg  392
               VVAPG     T G D + A   E+  +FV ++ ++  A D ++     HV +   + 
Sbjct  165  GANVVAPG----YTKG-DGLGA---EIIGTFVLVY-TVLSATDAKRNARDSHVPILAPLP  215

Query  391  ivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGPLIACVAFY  215
            I   + +    T+       G G+NPAR +GAA++    H WD  WIFWVGP I      
Sbjct  216  IGFAVFLVHLATIPI----TGTGINPARSLGAAIIYNKDHAWDDQWIFWVGPFIGAALAS  271

Query  214  LYTKII  197
            +Y +++
Sbjct  272  IYHQVV  277



>ref|XP_009400253.1| PREDICTED: probable aquaporin PIP1-2 [Musa acuminata subsp. malaccensis]
Length=285

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 64/186 (34%), Positives = 92/186 (49%), Gaps = 18/186 (10%)
 Frame = -1

Query  751  VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGC  572
            +SGGHINP VTF   L   +S++RAV YMV QC+GAV GA  +K       E+     G 
Sbjct  107  ISGGHINPAVTFGLFLARKLSLTRAVFYMVMQCLGAVCGAGVVKGFQKGVYESN----GG  162

Query  571  TVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvg  392
               VVA G +    +G + V  F          L  +++ A D ++     HV +   + 
Sbjct  163  GANVVASGYSKGDGLGAEIVGTF---------ILVYTVFSATDAKRNARDSHVPLLAPLP  213

Query  391  ivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGPLIACVAFY  215
            I   + +    T+       G G+NPAR +GAA++    H WD HWIFWVGP I      
Sbjct  214  IGFAVFLVHLATIPI----TGTGINPARSLGAAIIYNKDHAWDDHWIFWVGPFIGAALAA  269

Query  214  LYTKII  197
            +Y +++
Sbjct  270  IYHQVV  275



>gb|ACB42441.1| aquaporin PIP2;4 [Gossypium hirsutum]
 gb|KHG19165.1| Aquaporin PIP2-7 -like protein [Gossypium arboreum]
Length=278

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 66/186 (35%), Positives = 96/186 (52%), Gaps = 18/186 (10%)
 Frame = -1

Query  751  VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGC  572
            +SGGHINP VTF   L   +S+ RAV YMV+QC+GA+ G   +KA +        SLGG 
Sbjct  92   ISGGHINPAVTFGLFLARKVSLIRAVAYMVSQCLGAICGVGLVKAFMKHPYN---SLGGG  148

Query  571  TVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvg  392
              TV +   NG          A   E+  +FV ++ +++ A D +++    HV V   + 
Sbjct  149  ANTVASGYNNG---------TALGAEIIGTFVLVY-TVFSATDPKRSARDSHVPVLAPLP  198

Query  391  ivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGPLIACVAFY  215
            I   + +    T+       G G+NPAR  GAA++      WD HWIFWVGP +  +A  
Sbjct  199  IGFAVFMVHLATIPIT----GTGINPARSFGAAVIYNNDKAWDDHWIFWVGPFVGALAAA  254

Query  214  LYTKII  197
            +Y + I
Sbjct  255  IYHQYI  260



>ref|XP_006357563.1| PREDICTED: probable aquaporin PIP2-1-like [Solanum tuberosum]
Length=286

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 69/182 (38%), Positives = 97/182 (53%), Gaps = 20/182 (11%)
 Frame = -1

Query  751  VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGC  572
            +SGGHINP VTF   L   +S+ RAV+YMVAQC+GA+ G   +KA  S+     ++  G 
Sbjct  102  ISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGFVKAFQSAY----YNRYGG  157

Query  571  TVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvg  392
             V V+A G N  V +G         E+  +FV ++ +++ A D ++     HV V   + 
Sbjct  158  GVNVMAAGHNKGVGLG--------AEIIGTFVLVY-TVFSATDPKRNARDSHVPVLAPLP  208

Query  391  ivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGPLIAC--VA  221
            I   + +    T+       G G+NPAR  GAA++  G   WD HWIFWVGP I     A
Sbjct  209  IGFAVFMVHLATIPIT----GTGINPARSFGAAVIYNGDKAWDEHWIFWVGPFIGAFIAA  264

Query  220  FY  215
            FY
Sbjct  265  FY  266



>ref|XP_004137540.1| PREDICTED: probable aquaporin TIP3-2-like [Cucumis sativus]
 gb|KGN64227.1| hypothetical protein Csa_1G043290 [Cucumis sativus]
Length=289

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 66/211 (31%), Positives = 91/211 (43%), Gaps = 45/211 (21%)
 Frame = -1

Query  751  VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGC  572
            +SGGH+NP VTF A + G IS+ RA  Y VAQ                        LG  
Sbjct  112  ISGGHVNPAVTFGALIGGRISLIRAFFYWVAQI-----------------------LGAI  148

Query  571  TVTVV---APGPNGP----VTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHV  413
              +++   A G   P    V+ G+  +  F LE+  +F  ++     A D ++   LG +
Sbjct  149  IASLLLRLATGGMRPMGFFVSSGVSELHGFLLEIILTFALVYTVYATAIDPKRGS-LGTI  207

Query  412  KvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHLWDGHWIFWVGPLI  233
                +  IV          +     + GA MNPAR  G +LV  G  WD HWI+W+GPLI
Sbjct  208  APLAIGLIV-------GANILVGGAFDGACMNPARAFGPSLV--GWRWDNHWIYWIGPLI  258

Query  232  -----ACVAFYLYTKIIPERHFHASGYPHDF  155
                 A V  YL   + P  H H    P D+
Sbjct  259  GGGLAALVYEYLVIPVEPPLHTHQPLAPEDY  289



>gb|EXL97756.1| hypothetical protein FOIG_10077 [Fusarium oxysporum f. sp. cubense 
tropical race 4 54006]
Length=327

 Score = 77.8 bits (190),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 84/326 (26%), Positives = 144/326 (44%), Gaps = 42/326 (13%)
 Frame = -1

Query  1099  GDEESHPHQNGGSNRVEDVSS----------TPTISNGNGNGTHQWTGEKIPSSHLTLAQ  950
             GD E+ P+    S   +  S              +  G     H        + H++  +
Sbjct  13    GDVEARPNSEPSSPHYQSYSQPFAGRLGANQAYVVEGGTSEDDHLLHHAPDATPHMSFWE  72

Query  949   KLGLMDFLSLDVWRASMGEVFGTAVLVFMLDAIVIS-------------TYESEVKMPNL  809
              + +    +LD+W+A++ E  GT + V++   + IS             ++++   +  L
Sbjct  73    LMDMRPIKNLDLWKAALIEGIGTLLFVYITIWVNISPDIAPAAPTQRFGSFDNAAFLGPL  132

Query  808   IMSiliaivitvlllaVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgal  629
             I  +   I IT+ + +   +SG H NP +TF+     + S+ R ++Y+ AQ  G  L  L
Sbjct  133   IGGMTNLIFITLFITSFGAISGAHFNPLITFATFCARLCSLPRLILYVAAQIGGGALAGL  192

Query  628   alkavvssSIENTFSLGGCTV-TVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWM  452
              ++A         F +GGC + T + P             + F +E+  + + LF +  +
Sbjct  193   LVRASWGG---RDFKVGGCWLFTDIVP-----------PREIFVVELMSATLLLFLAFGV  238

Query  451   AYDYRQAKVLGHVKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGHL  272
               D RQAK++G      +VG+ +G + F S     + GY GAG+NPARC+GA +  G   
Sbjct  239   GLDPRQAKIIGPALGPFMVGLSVGTMSFASA--FARYGYGGAGLNPARCMGAFV--GSSF  294

Query  271   WDGHWIFWVGPLIACVAFYLYTKIIP  194
              D HWI WV    AC+   +    IP
Sbjct  295   PDWHWIHWVADWTACIIHGVCYYFIP  320



>ref|NP_171668.1| aquaporin PIP1-3 [Arabidopsis thaliana]
 sp|Q08733.1|PIP13_ARATH RecName: Full=Aquaporin PIP1-3; Short=AtPIP1;3; AltName: Full=Plasma 
membrane intrinsic protein 1c; Short=PIP1c; AltName: 
Full=Transmembrane protein B; Short=TMP-B [Arabidopsis thaliana]
 gb|AAF81320.1|AC061957_16 Identical to a plasma membrane intrinsic protein 1C (transmembrane 
protein B) from Arabidopsis thaliana gi|1175012 and contains 
a major intrinsic protein PF|00230 domain. ESTs gb|AI993641, 
gb|AA597672, gb|H36675, gb|N65332, gb|N96473, gb|T43232, 
gb|H37074, gb|H36992, gb|N65343, gb|T44267, gb|T45734, 
gb|N97036, gb|H36897, gb|Z17730, gb|T22715, gb|T13917, gb|T14921 
come from this gene [Arabidopsis thaliana]
 gb|AAK15545.1|AF348574_1 putative plasma membrane intrinsic protein 1c [Arabidopsis thaliana]
 emb|CAA49155.1| transmembrane protein TMP-B [Arabidopsis thaliana]
 gb|AEE27312.1| aquaporin PIP1-3 [Arabidopsis thaliana]
Length=286

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 73/261 (28%), Positives = 114/261 (44%), Gaps = 43/261 (16%)
 Frame = -1

Query  934  DFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVF  755
            +  S   +RA + E   T    F+   I + T     + PN+  S+ I  +       +F
Sbjct  44   ELSSWSFYRAGIAEFIAT----FLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIF  99

Query  754  P-------VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIE  596
                    +SGGHINP VTF   L   +S++RAV Y+V QC+GA+               
Sbjct  100  ALVYCTAGISGGHINPAVTFGLFLARKLSLTRAVFYIVMQCLGAI---------------  144

Query  595  NTFSLGGCTVTVVAPGPNGPVTVGLDTV-------QAFWLEVFCSFVFLFASIWMAYDYR  437
                 G   V    P P   +  G +TV            E+  +FV ++ +++ A D +
Sbjct  145  ----CGAGVVKGFQPNPYQTLGGGANTVAHGYTKGSGLGAEIIGTFVLVY-TVFSATDAK  199

Query  436  QAKVLGHVKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGH  260
            ++    HV +   + I   + +    T+       G G+NPAR +GAA++    H WD H
Sbjct  200  RSARDSHVPILAPLPIGFAVFLVHLATIPIT----GTGINPARSLGAAIIYNKDHAWDDH  255

Query  259  WIFWVGPLIACVAFYLYTKII  197
            WIFWVGP I      LY +++
Sbjct  256  WIFWVGPFIGAALAALYHQLV  276



>ref|XP_010543744.1| PREDICTED: probable aquaporin PIP1-4 [Tarenaya hassleriana]
Length=287

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 66/186 (35%), Positives = 94/186 (51%), Gaps = 17/186 (9%)
 Frame = -1

Query  751  VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGC  572
            +SGGHINP VT    L   +S++RAV YMV QC+GA+ GA  +K        N  SLGG 
Sbjct  111  ISGGHINPAVTLGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFQGK--SNFQSLGG-  167

Query  571  TVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvg  392
                   G N  V  G         E+  +FV ++ +++ A D +++    HV +   + 
Sbjct  168  -------GAN-VVNHGYTKGDGLGAEIIGTFVLVY-TVFSATDAKRSARDSHVPILAPLP  218

Query  391  ivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGPLIACVAFY  215
            I   + +    T+       G G+NPAR +GAA+V    H WD HWIFWVGP I      
Sbjct  219  IGFAVFLVHLATIPI----TGTGINPARSLGAAIVYNKDHAWDDHWIFWVGPFIGAALAA  274

Query  214  LYTKII  197
            LY +++
Sbjct  275  LYHQVV  280



>gb|AEA40490.1| aquaporin PIP1-2 [Brassica oleracea var. italica]
Length=280

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 78/254 (31%), Positives = 119/254 (47%), Gaps = 29/254 (11%)
 Frame = -1

Query  934  DFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVF  755
            +  S   WRA + E   T    F+   I + T     + PN+  S+ I  +       +F
Sbjct  43   ELASWSFWRAGIAEFIAT----FLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIF  98

Query  754  P-------VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIE  596
                    +SGGHINP VTF   L   +S++RAV Y+V QC+GA+ GA  +K       +
Sbjct  99   ALVYCTAGISGGHINPAVTFGLFLARKLSLTRAVYYIVMQCLGAICGAGVVKGSQPKQYQ  158

Query  595  NTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGH  416
               +LGG   T VAPG      +G         E+  +FV ++ +++ A D ++     H
Sbjct  159  ---ALGGGANT-VAPGYTKGSGLG--------AEIIGTFVLVY-TVFSATDAKRNARDSH  205

Query  415  VKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGP  239
            V +   + I   + +    T+       G G+NPAR +GAA++    + WD HW+FWVGP
Sbjct  206  VPILAPLPIGFAVFLVHLATIPIT----GTGINPARSLGAAIIFNKDNAWDDHWVFWVGP  261

Query  238  LIACVAFYLYTKII  197
             I      LY  I+
Sbjct  262  FIGAALAALYHVIV  275



>dbj|GAM17046.1| hypothetical protein SAMD00019534_002210 [Acytostelium subglobosum 
LB1]
Length=387

 Score = 78.6 bits (192),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 96/333 (29%), Positives = 149/333 (45%), Gaps = 50/333 (15%)
 Frame = -1

Query  1144  LRYQNMAAKYTRQGFGDEESHPHQNGGSNRVEDVSSTPTISNGNGNGTHQWTGEKIPSSH  965
             LRY N   K T    G++++ P +    +  +D  STP       +    W  E++ S H
Sbjct  74    LRYDNSDIKETGLDLGNDKTLPLEMDQIHD-QDTKSTPFSFREYISLLMGW--EEVRSKH  130

Query  964   LTLAQKLGLMDFLSLDVWRASMGEVFGTAVLVFMLDAIVI--------STYESEVKMPNL  809
             +                 RA + E+ GTAV   M   IVI        S +      P L
Sbjct  131   M----------------LRAVLTELIGTAVFTSMSIGIVIAVVNYYNFSVFNHSTPTPGL  174

Query  808   I--------MSiliaivitvlllaVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQC  653
             +        +S     ++ ++++A  P SGG +NP +T +  + G  ++ +  +Y+ AQ 
Sbjct  175   VPNPWQAFFISAFHFFLLVIMIIACGPNSGGILNPIITLTTMITGFTTIVKGTLYICAQL  234

Query  652   vgavlgalalkavvssSIENTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVF  473
             VGA++G+  + A V   I N   L  CT           +++G     A   E    F  
Sbjct  235   VGAIIGSALIYACVPFEIYNRTLLASCTF-------GNQMSIG----NALATEFLFGFFN  283

Query  472   LFASIWMAYDYRQAKVLGHVKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAA  293
             LF +  +A D RQ+K  G +    V+GI L + +FIS  L +   YAG G N +RC G A
Sbjct  284   LFITFTVALDPRQSKTFGILSAPLVIGITLFITLFISQGLLSY--YAGPGFNISRCFGPA  341

Query  292   LVRGGHLWDGHWIFWVGPLIACVAFYLYTKIIP  194
             +V G   WD +W+F VGPLI+     +   +IP
Sbjct  342   VVSG--TWDKYWVFVVGPLISSFGIGVLVNVIP  372



>dbj|BAD90701.1| plasma membrane intrinsic protein 2;5 [Mimosa pudica]
Length=281

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 68/186 (37%), Positives = 96/186 (52%), Gaps = 18/186 (10%)
 Frame = -1

Query  751  VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGC  572
            +SGGHINP VTF   L   +S+ RA+ YMVAQC+GA+ G   +KA +  S     SLGG 
Sbjct  95   ISGGHINPAVTFGLFLARKVSLIRALAYMVAQCLGAICGTGLVKAFMKHSYN---SLGG-  150

Query  571  TVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvg  392
                   G N  V  G     A   E+  +FV ++ +++ A D +++    HV V   + 
Sbjct  151  -------GAN-EVNSGYSKGTALGAEIIGTFVLVY-TVFSAIDPKRSARDSHVPVLAPLP  201

Query  391  ivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGPLIACVAFY  215
            I   + +    T+       G G+NPAR  GAA++   G  WD HWIFWVGP +  +A  
Sbjct  202  IGFAVFMVHLATIPIT----GTGINPARSFGAAVIYNNGKAWDDHWIFWVGPFVGALAAA  257

Query  214  LYTKII  197
             Y + I
Sbjct  258  AYHQYI  263



>gb|ACR56614.1| plasma intrinsic protein 2;4 [Juglans regia]
Length=280

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 81/254 (32%), Positives = 126/254 (50%), Gaps = 23/254 (9%)
 Frame = -1

Query  940  LMDFLSLDVW---RASMGEVFGTAVLVFMLDAIVISTYESEV--KMPNLIMSiliaivit  776
            L+D   L +W   RA + E   T + +++  A VI   +S     +  L ++     +I 
Sbjct  26   LIDLAELKLWSFYRALIAEFIATLLFLYITVATVIGYKKSGPCDGVGLLGIAWAFGGMIF  85

Query  775  vlllaVFPVSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIE  596
            VL+     +SGGHINP VTF   L   +S+ RAV+YMVAQC+GA+ G   +KA +     
Sbjct  86   VLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVVYMVAQCLGAICGVGLVKAFMK---H  142

Query  595  NTFSLGGCTVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGH  416
            +  +LGG T +V           G     A   E+  +FV ++ +++ A D +++    H
Sbjct  143  DYNTLGGGTNSVAQ---------GYSKGTALGAEIIGTFVLVY-TVFSATDPKRSARDSH  192

Query  415  VKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGHWIFWVGP  239
            V V   + I   + +    T+       G G+NPAR  GAA++     +WD HWIFWVGP
Sbjct  193  VPVLAPLPIGFAVFIVHLATIPIT----GTGINPARSFGAAVIYDNDKVWDEHWIFWVGP  248

Query  238  LIACVAFYLYTKII  197
             +  +A   Y + I
Sbjct  249  FVGALAAAAYHQYI  262



>ref|XP_006304071.1| hypothetical protein CARUB_v10009929mg [Capsella rubella]
 gb|EOA36969.1| hypothetical protein CARUB_v10009929mg [Capsella rubella]
Length=286

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 73/261 (28%), Positives = 114/261 (44%), Gaps = 43/261 (16%)
 Frame = -1

Query  934  DFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVF  755
            +  S   +RA + E   T    F+   I + T     + PN+  S+ I  +       +F
Sbjct  44   ELSSWSFYRAGIAEFIAT----FLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIF  99

Query  754  P-------VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIE  596
                    +SGGHINP VTF   L   +S++RAV Y+V QC+GA+               
Sbjct  100  ALVYCTAGISGGHINPAVTFGLFLARKLSLTRAVFYIVMQCLGAI---------------  144

Query  595  NTFSLGGCTVTVVAPGPNGPVTVGLDTV-------QAFWLEVFCSFVFLFASIWMAYDYR  437
                 G   V    P P   +  G +TV            E+  +FV ++ +++ A D +
Sbjct  145  ----CGAGVVKGFQPNPYQTLGGGANTVAHGYTKGSGLGAEIIGTFVLVY-TVFSATDAK  199

Query  436  QAKVLGHVKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGH  260
            ++    HV +   + I   + +    T+       G G+NPAR +GAA++    H WD H
Sbjct  200  RSARDSHVPILAPLPIGFAVFLVHLATIPIT----GTGINPARSLGAAIIYNKDHAWDDH  255

Query  259  WIFWVGPLIACVAFYLYTKII  197
            WIFWVGP I      LY +++
Sbjct  256  WIFWVGPFIGAALAALYHQLV  276



>ref|XP_002889360.1| hypothetical protein ARALYDRAFT_470115 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65619.1| hypothetical protein ARALYDRAFT_470115 [Arabidopsis lyrata subsp. 
lyrata]
Length=286

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 73/261 (28%), Positives = 114/261 (44%), Gaps = 43/261 (16%)
 Frame = -1

Query  934  DFLSLDVWRASMGEVFGTAVLVFMLDAIVISTYESEVKMPNLIMSiliaivitvlllaVF  755
            +  S   +RA + E   T    F+   I + T     + PN+  S+ I  +       +F
Sbjct  44   ELSSWSFYRAGIAEFIAT----FLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIF  99

Query  754  P-------VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIE  596
                    +SGGHINP VTF   L   +S++RAV Y+V QC+GA+               
Sbjct  100  ALVYCTAGISGGHINPAVTFGLFLARKLSLTRAVFYIVMQCLGAI---------------  144

Query  595  NTFSLGGCTVTVVAPGPNGPVTVGLDTV-------QAFWLEVFCSFVFLFASIWMAYDYR  437
                 G   V    P P   +  G +TV            E+  +FV ++ +++ A D +
Sbjct  145  ----CGAGVVKGFQPNPYQTLGGGANTVAHGYTKGSGLGAEIIGTFVLVY-TVFSATDAK  199

Query  436  QAKVLGHVKvftvvgivlgllvfISTTLTTKKGYAGAGMNPARCVGAALV-RGGHLWDGH  260
            ++    HV +   + I   + +    T+       G G+NPAR +GAA++    H WD H
Sbjct  200  RSARDSHVPILAPLPIGFAVFLVHLATIPIT----GTGINPARSLGAAIIYNKDHAWDDH  255

Query  259  WIFWVGPLIACVAFYLYTKII  197
            WIFWVGP I      LY +++
Sbjct  256  WIFWVGPFIGAALAALYHQLV  276



>gb|AEO79975.1| plasma intrinsic protein 1 [Gladiolus communis]
 gb|AFU52635.1| plasma membrane intrinsic protein, partial [Gladiolus hybrid 
cultivar]
Length=288

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 66/186 (35%), Positives = 96/186 (52%), Gaps = 18/186 (10%)
 Frame = -1

Query  751  VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGC  572
            +SGGHINP VTF   L   +S++RA+ YMV QC+GA+ GA  +K       E      G 
Sbjct  110  ISGGHINPAVTFGLFLARKLSLTRAIFYMVMQCLGAICGAGVVKGYQKGLYETK----GG  165

Query  571  TVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvg  392
               VVAPG     T G D + A   E+  +FV ++ +++ A D ++     HV +   + 
Sbjct  166  GANVVAPG----YTKG-DGLGA---EIIGTFVLVY-TVFSATDAKRNARDSHVPILAPLP  216

Query  391  ivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGG-HLWDGHWIFWVGPLIACVAFY  215
            I   + +    T+       G G+NPAR +GAA++    H W  HWIFWVGP I      
Sbjct  217  IGFAVFLVHLATIPI----TGTGINPARSLGAAIIYNKEHAWSDHWIFWVGPFIGAALAA  272

Query  214  LYTKII  197
            +Y +I+
Sbjct  273  IYHQIV  278



>ref|NP_179277.1| putative aquaporin PIP2-8 [Arabidopsis thaliana]
 sp|Q9ZVX8.1|PIP28_ARATH RecName: Full=Probable aquaporin PIP2-8; AltName: Full=Plasma 
membrane intrinsic protein 2-8; Short=AtPIP2;8; AltName: Full=Plasma 
membrane intrinsic protein 3b; Short=PIP3b; Contains: 
RecName: Full=Probable aquaporin PIP2-8, N-terminally processed 
[Arabidopsis thaliana]
 gb|AAC64216.1| putative plasma membrane intrinsic protein [Arabidopsis thaliana]
 gb|AAM15086.1| putative plasma membrane intrinsic protein [Arabidopsis thaliana]
 gb|AAO63278.1| At2g16850 [Arabidopsis thaliana]
 dbj|BAF00056.1| putative aquaporin [Arabidopsis thaliana]
 gb|AEC06543.1| putative aquaporin PIP2-8 [Arabidopsis thaliana]
Length=278

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 66/186 (35%), Positives = 95/186 (51%), Gaps = 18/186 (10%)
 Frame = -1

Query  751  VSGGHINPTVTFSAALVGIISMSRAVIYMVAQCvgavlgalalkavvssSIENTFSLGGC  572
            +SGGHINP VTF   L   +S+ RAV YMVAQC+GA+ G   +KA + +  +    LGG 
Sbjct  92   ISGGHINPAVTFGLFLARKVSLPRAVAYMVAQCLGAICGVGLVKAFMMTPYKR---LGGG  148

Query  571  TVTVVAPGPNGPVTVGLDTVQAFWLEVFCSFVFLFASIWMAYDYRQAKVLGHVKvftvvg  392
              TV           G  T  A   E+  +FV ++ +++ A D +++    HV V   + 
Sbjct  149  ANTVAD---------GYSTGTALGAEIIGTFVLVY-TVFSATDPKRSARDSHVPVLAPLP  198

Query  391  ivlgllvfISTTLTTKKGYAGAGMNPARCVGAALVRGGH-LWDGHWIFWVGPLIACVAFY  215
            I   + +    T+       G G+NPAR  GAA++      WD HWIFWVGP +  +A  
Sbjct  199  IGFAVFMVHLATIPIT----GTGINPARSFGAAVIYNNEKAWDDHWIFWVGPFVGALAAA  254

Query  214  LYTKII  197
             Y + I
Sbjct  255  AYHQYI  260



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3145178720708