BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c17918_g1_i2 len=2600 path=[2578:0-1286 3865:1287-2599]

Length=2600
                                                                      Score     E

emb|CDP17778.1|  unnamed protein product                                747   0.0      
ref|XP_009604921.1|  PREDICTED: 65-kDa microtubule-associated pro...    696   0.0      
ref|XP_011093199.1|  PREDICTED: 65-kDa microtubule-associated pro...    691   0.0      
ref|XP_009789952.1|  PREDICTED: 65-kDa microtubule-associated pro...    689   0.0      
ref|XP_009604922.1|  PREDICTED: 65-kDa microtubule-associated pro...    686   0.0      
ref|XP_009789954.1|  PREDICTED: 65-kDa microtubule-associated pro...    679   0.0      
ref|XP_010325766.1|  PREDICTED: 65-kDa microtubule-associated pro...    664   0.0      
ref|XP_010245133.1|  PREDICTED: 65-kDa microtubule-associated pro...    662   0.0      
ref|XP_004231164.1|  PREDICTED: 65-kDa microtubule-associated pro...    661   0.0      
ref|XP_006339436.1|  PREDICTED: 65-kDa microtubule-associated pro...    660   0.0      
ref|XP_010277391.1|  PREDICTED: 65-kDa microtubule-associated pro...    657   0.0      
ref|XP_009761644.1|  PREDICTED: 65-kDa microtubule-associated pro...    654   0.0      
ref|XP_010325774.1|  PREDICTED: 65-kDa microtubule-associated pro...    654   0.0      
ref|XP_006339437.1|  PREDICTED: 65-kDa microtubule-associated pro...    653   0.0      
ref|XP_010325770.1|  PREDICTED: 65-kDa microtubule-associated pro...    651   0.0      
ref|XP_006490251.1|  PREDICTED: 65-kDa microtubule-associated pro...    646   0.0      
ref|XP_009594260.1|  PREDICTED: 65-kDa microtubule-associated pro...    646   0.0      
emb|CDP05295.1|  unnamed protein product                                644   0.0      
ref|XP_006421755.1|  hypothetical protein CICLE_v10004422mg             644   0.0      
gb|KDO65387.1|  hypothetical protein CISIN_1g004728mg                   643   0.0      
ref|XP_011076282.1|  PREDICTED: 65-kDa microtubule-associated pro...    639   0.0      
gb|KDP31478.1|  hypothetical protein JCGZ_15429                         635   0.0      
ref|XP_004495425.1|  PREDICTED: 65-kDa microtubule-associated pro...    633   0.0      
ref|XP_006348061.1|  PREDICTED: 65-kDa microtubule-associated pro...    634   0.0      
ref|XP_008467287.1|  PREDICTED: 65-kDa microtubule-associated pro...    632   0.0      
ref|XP_010245134.1|  PREDICTED: 65-kDa microtubule-associated pro...    632   0.0      
ref|XP_004234161.1|  PREDICTED: 65-kDa microtubule-associated pro...    632   0.0      
gb|EYU30567.1|  hypothetical protein MIMGU_mgv1a002283mg                630   0.0      
ref|XP_007143898.1|  hypothetical protein PHAVU_007G111500g             629   0.0      
ref|XP_004143655.1|  PREDICTED: 65-kDa microtubule-associated pro...    629   0.0      
ref|XP_004158108.1|  PREDICTED: LOW QUALITY PROTEIN: 65-kDa micro...    627   0.0      
ref|XP_004308160.1|  PREDICTED: 65-kDa microtubule-associated pro...    624   0.0      
ref|XP_002513279.1|  Protein regulator of cytokinesis, putative         623   0.0      Ricinus communis
ref|XP_007038465.1|  Microtubule associated protein family protei...    621   0.0      
ref|XP_010035008.1|  PREDICTED: LOW QUALITY PROTEIN: 65-kDa micro...    619   0.0      
ref|XP_006606398.1|  PREDICTED: 65-kDa microtubule-associated pro...    618   0.0      
gb|KHG09945.1|  65-kDa microtubule-associated 3 -like protein           618   0.0      
ref|XP_006487487.1|  PREDICTED: 65-kDa microtubule-associated pro...    617   0.0      
ref|XP_003536194.2|  PREDICTED: 65-kDa microtubule-associated pro...    617   0.0      
gb|KHN30546.1|  65-kDa microtubule-associated protein 3                 615   0.0      
ref|XP_002318272.2|  hypothetical protein POPTR_0012s14340g             614   0.0      Populus trichocarpa [western balsam poplar]
gb|KDO50061.1|  hypothetical protein CISIN_1g004858mg                   613   0.0      
ref|XP_006423735.1|  hypothetical protein CICLE_v10027898mg             611   0.0      
ref|XP_002267584.1|  PREDICTED: 65-kDa microtubule-associated pro...    610   0.0      Vitis vinifera
gb|KCW46270.1|  hypothetical protein EUGRSUZ_K00145                     609   0.0      
ref|XP_007220225.1|  hypothetical protein PRUPE_ppa002178mg             608   0.0      
ref|XP_002322422.2|  hypothetical protein POPTR_0015s14350g             608   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_007038462.1|  Microtubule associated protein family protei...    606   0.0      
ref|XP_010109100.1|  hypothetical protein L484_012976                   606   0.0      
ref|XP_008234352.1|  PREDICTED: 65-kDa microtubule-associated pro...    605   0.0      
ref|XP_011029980.1|  PREDICTED: 65-kDa microtubule-associated pro...    604   0.0      
ref|XP_011029981.1|  PREDICTED: 65-kDa microtubule-associated pro...    604   0.0      
gb|EYU25004.1|  hypothetical protein MIMGU_mgv1a001889mg                603   0.0      
ref|XP_009625234.1|  PREDICTED: 65-kDa microtubule-associated pro...    602   0.0      
gb|KEH42819.1|  microtubule associated protein, MAP65/ASE1 family...    602   0.0      
ref|XP_011041686.1|  PREDICTED: 65-kDa microtubule-associated pro...    602   0.0      
ref|XP_006340370.1|  PREDICTED: 65-kDa microtubule-associated pro...    602   0.0      
ref|XP_003622331.1|  Protein regulator of cytokinesis                   601   0.0      
ref|XP_007038464.1|  Microtubule associated protein family protei...    597   0.0      
ref|XP_009758362.1|  PREDICTED: 65-kDa microtubule-associated pro...    600   0.0      
ref|XP_010924154.1|  PREDICTED: 65-kDa microtubule-associated pro...    597   0.0      
gb|AAT40494.2|  Putative microtubule-associated protein, identical      598   0.0      Solanum demissum
ref|XP_004251251.1|  PREDICTED: 65-kDa microtubule-associated pro...    597   0.0      
ref|XP_008376372.1|  PREDICTED: 65-kDa microtubule-associated pro...    596   0.0      
ref|XP_009374532.1|  PREDICTED: 65-kDa microtubule-associated pro...    596   0.0      
ref|XP_010682846.1|  PREDICTED: 65-kDa microtubule-associated pro...    596   0.0      
ref|XP_008800929.1|  PREDICTED: 65-kDa microtubule-associated pro...    594   0.0      
ref|XP_007038463.1|  Microtubule associated protein family protei...    591   0.0      
ref|XP_008376463.1|  PREDICTED: 65-kDa microtubule-associated pro...    593   0.0      
ref|XP_009400357.1|  PREDICTED: 65-kDa microtubule-associated pro...    594   0.0      
gb|KHG27998.1|  65-kDa microtubule-associated 3 -like protein           593   0.0      
ref|XP_007220182.1|  hypothetical protein PRUPE_ppa015556mg             591   0.0      
ref|XP_008800928.1|  PREDICTED: 65-kDa microtubule-associated pro...    590   0.0      
ref|XP_009372918.1|  PREDICTED: 65-kDa microtubule-associated pro...    590   0.0      
gb|KDP37892.1|  hypothetical protein JCGZ_05774                         590   0.0      
ref|XP_009346944.1|  PREDICTED: 65-kDa microtubule-associated pro...    589   0.0      
ref|XP_007038467.1|  Microtubule associated protein (MAP65/ASE1) ...    581   0.0      
ref|XP_010536522.1|  PREDICTED: 65-kDa microtubule-associated pro...    587   0.0      
ref|XP_010692266.1|  PREDICTED: 65-kDa microtubule-associated pro...    586   0.0      
gb|KHN27850.1|  65-kDa microtubule-associated protein 3                 585   0.0      
ref|XP_007052040.1|  Microtubule associated protein family protei...    584   0.0      
ref|XP_006490933.1|  PREDICTED: 65-kDa microtubule-associated pro...    581   0.0      
ref|XP_008232725.1|  PREDICTED: 65-kDa microtubule-associated pro...    580   0.0      
ref|XP_009374533.1|  PREDICTED: 65-kDa microtubule-associated pro...    576   0.0      
gb|KCW90811.1|  hypothetical protein EUGRSUZ_A02875                     581   0.0      
ref|XP_008343706.1|  PREDICTED: 65-kDa microtubule-associated pro...    571   0.0      
ref|XP_009374534.1|  PREDICTED: 65-kDa microtubule-associated pro...    570   0.0      
ref|XP_010062006.1|  PREDICTED: 65-kDa microtubule-associated pro...    575   0.0      
gb|AES75903.2|  65-kDa microtubule-associated-like protein              575   0.0      
ref|XP_010671976.1|  PREDICTED: 65-kDa microtubule-associated pro...    575   0.0      
ref|XP_010661645.1|  PREDICTED: 65-kDa microtubule-associated pro...    574   0.0      
ref|XP_003569581.1|  PREDICTED: 65-kDa microtubule-associated pro...    572   0.0      
ref|XP_010924160.1|  PREDICTED: 65-kDa microtubule-associated pro...    572   0.0      
ref|XP_002273473.2|  PREDICTED: 65-kDa microtubule-associated pro...    573   0.0      Vitis vinifera
gb|KDP28747.1|  hypothetical protein JCGZ_14518                         572   0.0      
ref|XP_008675177.1|  PREDICTED: 65-kDa microtubule-associated pro...    570   0.0      
ref|XP_008376464.1|  PREDICTED: 65-kDa microtubule-associated pro...    569   0.0      
ref|XP_004148126.1|  PREDICTED: 65-kDa microtubule-associated pro...    570   0.0      
ref|XP_004514978.1|  PREDICTED: 65-kDa microtubule-associated pro...    568   0.0      
ref|NP_001130355.1|  uncharacterized protein LOC100191450               564   0.0      Zea mays [maize]
ref|XP_002456163.1|  hypothetical protein SORBIDRAFT_03g031480          563   0.0      Sorghum bicolor [broomcorn]
ref|XP_008439114.1|  PREDICTED: 65-kDa microtubule-associated pro...    560   0.0      
emb|CDM83899.1|  unnamed protein product                                556   0.0      
ref|XP_011101133.1|  PREDICTED: 65-kDa microtubule-associated pro...    558   0.0      
ref|XP_007052041.1|  Microtubule associated protein (MAP65/ASE1) ...    551   0.0      
ref|XP_002865869.1|  hypothetical protein ARALYDRAFT_495230             556   0.0      
ref|XP_011034440.1|  PREDICTED: 65-kDa microtubule-associated pro...    557   0.0      
ref|XP_004514980.1|  PREDICTED: 65-kDa microtubule-associated pro...    552   0.0      
ref|XP_002320728.2|  hypothetical protein POPTR_0014s06560g             557   0.0      Populus trichocarpa [western balsam poplar]
gb|EYU19490.1|  hypothetical protein MIMGU_mgv1a002138mg                556   0.0      
ref|NP_001043901.1|  Os01g0685900                                       554   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_003619685.1|  Protein regulator of cytokinesis                   557   0.0      
gb|EPS73877.1|  hypothetical protein M569_00872                         553   0.0      
ref|XP_007152403.1|  hypothetical protein PHAVU_004G127100g             549   0.0      
emb|CBI38858.3|  unnamed protein product                                547   0.0      
gb|EMT05504.1|  hypothetical protein F775_31522                         548   1e-179   
ref|XP_007152402.1|  hypothetical protein PHAVU_004G127100g             541   4e-179   
ref|XP_007052042.1|  Microtubule associated protein family protei...    539   9e-179   
ref|XP_010443482.1|  PREDICTED: 65-kDa microtubule-associated pro...    545   1e-178   
ref|XP_010555626.1|  PREDICTED: 65-kDa microtubule-associated pro...    545   3e-178   
ref|XP_009391119.1|  PREDICTED: 65-kDa microtubule-associated pro...    542   4e-178   
ref|XP_006646215.1|  PREDICTED: 65-kDa microtubule-associated pro...    541   9e-178   
ref|NP_199973.1|  microtubule associated protein MAP65-3                542   1e-177   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010536523.1|  PREDICTED: 65-kDa microtubule-associated pro...    540   2e-177   
ref|XP_006401934.1|  hypothetical protein EUTSA_v10012827mg             540   5e-177   
ref|XP_009400493.1|  PREDICTED: 65-kDa microtubule-associated pro...    537   5e-177   
ref|XP_007038466.1|  Microtubule associated protein (MAP65/ASE1) ...    532   6e-177   
gb|KHG02023.1|  65-kDa microtubule-associated 4 -like protein           538   3e-176   
gb|EYU19491.1|  hypothetical protein MIMGU_mgv1a018733mg                531   6e-176   
ref|XP_006655570.1|  PREDICTED: 65-kDa microtubule-associated pro...    536   1e-175   
emb|CAN67461.1|  hypothetical protein VITISV_024292                     535   5e-175   Vitis vinifera
ref|XP_011034447.1|  PREDICTED: 65-kDa microtubule-associated pro...    529   5e-174   
ref|XP_009110219.1|  PREDICTED: 65-kDa microtubule-associated pro...    529   1e-172   
ref|XP_009107313.1|  PREDICTED: 65-kDa microtubule-associated pro...    527   6e-172   
gb|KGN57292.1|  hypothetical protein Csa_3G176870                       526   8e-172   
ref|XP_004972100.1|  PREDICTED: uncharacterized protein LOC101763014    540   2e-169   
emb|CAN77019.1|  hypothetical protein VITISV_039795                     530   4e-169   Vitis vinifera
ref|XP_002511727.1|  PLE, putative                                      518   6e-168   Ricinus communis
gb|EEC79661.1|  hypothetical protein OsI_20904                          514   2e-167   Oryza sativa Indica Group [Indian rice]
ref|XP_009347040.1|  PREDICTED: 65-kDa microtubule-associated pro...    514   7e-167   
ref|XP_008790070.1|  PREDICTED: 65-kDa microtubule-associated pro...    508   1e-166   
gb|AAT85198.1|  unknown protein                                         509   2e-165   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006402536.1|  hypothetical protein EUTSA_v10005817mg             508   1e-164   
ref|NP_001056260.2|  Os05g0552900                                       509   2e-164   Oryza sativa Japonica Group [Japonica rice]
gb|EEE64623.1|  hypothetical protein OsJ_19475                          504   2e-163   Oryza sativa Japonica Group [Japonica rice]
emb|CDY62713.1|  BnaC04g55380D                                          502   2e-162   
ref|XP_009138809.1|  PREDICTED: LOW QUALITY PROTEIN: 65-kDa micro...    498   6e-161   
sp|Q9LZY0.2|MA654_ARATH  RecName: Full=65-kDa microtubule-associa...    496   4e-160   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010512415.1|  PREDICTED: 65-kDa microtubule-associated pro...    492   9e-159   
ref|XP_010446032.1|  PREDICTED: 65-kDa microtubule-associated pro...    497   9e-159   
ref|XP_010413509.1|  PREDICTED: 65-kDa microtubule-associated pro...    491   3e-158   
ref|XP_010231054.1|  PREDICTED: 65-kDa microtubule-associated pro...    487   1e-156   
emb|CDX89081.1|  BnaA04g01050D                                          485   7e-156   
ref|XP_006290680.1|  hypothetical protein CARUB_v10016774mg             481   2e-154   
gb|EMS68430.1|  hypothetical protein TRIUR3_15650                       481   2e-154   
ref|XP_010934514.1|  PREDICTED: 65-kDa microtubule-associated pro...    469   4e-152   
ref|XP_002878351.1|  predicted protein                                  473   7e-152   
ref|XP_006280317.1|  hypothetical protein CARUB_v10026240mg             466   5e-151   
ref|XP_002277391.2|  PREDICTED: LOW QUALITY PROTEIN: 65-kDa micro...    466   8e-150   Vitis vinifera
ref|NP_191643.1|  microtubule-associated protein 65-4                   468   1e-149   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006839047.1|  hypothetical protein AMTR_s00090p00059550          462   1e-148   
gb|EMS51834.1|  hypothetical protein TRIUR3_03672                       469   5e-148   
ref|XP_006587884.1|  PREDICTED: 65-kDa microtubule-associated pro...    464   1e-147   
ref|XP_010913972.1|  PREDICTED: 65-kDa microtubule-associated pro...    459   3e-147   
ref|XP_006587886.1|  PREDICTED: 65-kDa microtubule-associated pro...    462   4e-147   
ref|XP_011007613.1|  PREDICTED: 65-kDa microtubule-associated pro...    456   3e-146   
ref|XP_008776645.1|  PREDICTED: 65-kDa microtubule-associated pro...    454   2e-145   
ref|XP_009588990.1|  PREDICTED: 65-kDa microtubule-associated pro...    454   2e-145   
ref|XP_003623742.1|  NAD(P)H-quinone oxidoreductase chain               466   3e-145   
ref|XP_011095467.1|  PREDICTED: 65-kDa microtubule-associated pro...    453   4e-145   
ref|XP_002316774.2|  hypothetical protein POPTR_0011s09500g             453   4e-145   Populus trichocarpa [western balsam poplar]
gb|AES79960.2|  microtubule associated protein, MAP65/ASE1 family...    466   4e-145   
ref|XP_008227010.1|  PREDICTED: 65-kDa microtubule-associated pro...    452   8e-145   
ref|XP_008782921.1|  PREDICTED: 65-kDa microtubule-associated pro...    452   1e-144   
ref|XP_010550565.1|  PREDICTED: 65-kDa microtubule-associated pro...    451   1e-144   
gb|KDO85848.1|  hypothetical protein CISIN_1g045523mg                   453   3e-144   
ref|XP_010550561.1|  PREDICTED: 65-kDa microtubule-associated pro...    451   5e-144   
gb|KHG07371.1|  65-kDa microtubule-associated 1 -like protein           451   5e-144   
ref|XP_007020696.1|  Microtubule-associated proteins 65-1 isoform 1     449   1e-143   
emb|CDP13779.1|  unnamed protein product                                449   1e-143   
ref|XP_007020697.1|  Microtubule-associated proteins 65-1 isoform 2     447   2e-143   
emb|CAN73840.1|  hypothetical protein VITISV_007561                     450   3e-143   Vitis vinifera
ref|XP_002981583.1|  hypothetical protein SELMODRAFT_21452              448   3e-143   
ref|XP_002963209.1|  hypothetical protein SELMODRAFT_21497              447   4e-143   
ref|XP_009398767.1|  PREDICTED: 65-kDa microtubule-associated pro...    448   6e-143   
ref|XP_006346185.1|  PREDICTED: 65-kDa microtubule-associated pro...    447   1e-142   
ref|XP_006445240.1|  hypothetical protein CICLE_v10019629mg             444   3e-142   
ref|XP_010227508.1|  PREDICTED: 65-kDa microtubule-associated pro...    446   3e-142   
ref|XP_006851756.1|  hypothetical protein AMTR_s00040p00225910          451   3e-142   
ref|XP_010252611.1|  PREDICTED: 65-kDa microtubule-associated pro...    446   5e-142   
ref|NP_001265928.1|  Hop-interacting protein THI016                     445   8e-142   
gb|ACN85253.1|  microtubule-associated protein MAP65-1a                 443   4e-141   Oryza officinalis
gb|ACN85226.1|  microtubule-associated protein MAP65-1a                 441   1e-140   Oryza punctata
ref|XP_010270085.1|  PREDICTED: 65-kDa microtubule-associated pro...    441   2e-140   
ref|XP_010096093.1|  hypothetical protein L484_012448                   445   2e-140   
gb|ACN85211.1|  microtubule-associated protein MAP65-1a                 441   3e-140   Oryza glaberrima
ref|XP_002531201.1|  Protein regulator of cytokinesis, putative         441   3e-140   Ricinus communis
ref|XP_010928887.1|  PREDICTED: 65-kDa microtubule-associated pro...    440   5e-140   
ref|NP_001058056.1|  Os06g0611000                                       440   6e-140   Oryza sativa Japonica Group [Japonica rice]
gb|ACN85279.1|  microtubule-associated protein MAP65-1a                 440   7e-140   Oryza alta
gb|EYU27387.1|  hypothetical protein MIMGU_mgv1a003477mg                440   7e-140   
gb|ACN85233.1|  microtubule-associated protein MAP65-1a                 439   8e-140   Oryza minuta
ref|XP_009394695.1|  PREDICTED: 65-kDa microtubule-associated pro...    439   9e-140   
gb|ACN85194.1|  microtubule-associated protein MAP65-1a                 439   1e-139   Oryza rufipogon [common wild rice]
gb|KDO62132.1|  hypothetical protein CISIN_1g007822mg                   438   3e-139   
gb|ACN85178.1|  microtubule-associated protein MAP65-1a                 438   3e-139   Oryza sativa f. spontanea
emb|CDY36737.1|  BnaA03g11490D                                          440   3e-139   
ref|XP_006452462.1|  hypothetical protein CICLE_v10007823mg             438   3e-139   
ref|XP_009132397.1|  PREDICTED: 65-kDa microtubule-associated pro...    438   3e-139   
gb|EPS69123.1|  hypothetical protein M569_05644                         435   3e-139   
ref|XP_007139995.1|  hypothetical protein PHAVU_008G076000g             442   4e-139   
ref|XP_008227009.1|  PREDICTED: 65-kDa microtubule-associated pro...    438   7e-139   
ref|XP_002864778.1|  microtubule associated protein family protein      436   8e-139   
ref|XP_006656241.1|  PREDICTED: 65-kDa microtubule-associated pro...    437   9e-139   
ref|XP_009760793.1|  PREDICTED: 65-kDa microtubule-associated pro...    437   1e-138   
ref|XP_004294398.1|  PREDICTED: 65-kDa microtubule-associated pro...    436   2e-138   
gb|KDP39198.1|  hypothetical protein JCGZ_00955                         436   2e-138   
gb|EPS64691.1|  hypothetical protein M569_10086                         436   2e-138   
gb|KHG26044.1|  65-kDa microtubule-associated 1 -like protein           434   1e-137   
ref|XP_010433442.1|  PREDICTED: 65-kDa microtubule-associated pro...    433   2e-137   
ref|XP_010438700.1|  PREDICTED: 65-kDa microtubule-associated pro...    433   2e-137   
emb|CAD58680.1|  65kD microtubule associated protein                    433   2e-137   Daucus carota [carrots]
ref|XP_010928150.1|  PREDICTED: 65-kDa microtubule-associated pro...    434   2e-137   
ref|XP_008811151.1|  PREDICTED: 65-kDa microtubule-associated pro...    434   2e-137   
ref|XP_011097829.1|  PREDICTED: 65-kDa microtubule-associated pro...    433   2e-137   
emb|CDY17313.1|  BnaA10g09470D                                          433   3e-137   
ref|XP_003617643.1|  Microtubule-associated protein MAP65-1a            432   4e-137   
ref|XP_003519598.1|  PREDICTED: 65-kDa microtubule-associated pro...    432   5e-137   
ref|XP_010485060.1|  PREDICTED: 65-kDa microtubule-associated pro...    427   7e-137   
ref|XP_004965899.1|  PREDICTED: 65-kDa microtubule-associated pro...    432   7e-137   
emb|CDY19902.1|  BnaC09g31680D                                          432   8e-137   
ref|XP_009787869.1|  PREDICTED: 65-kDa microtubule-associated pro...    431   1e-136   
ref|XP_002437274.1|  hypothetical protein SORBIDRAFT_10g023980          431   1e-136   Sorghum bicolor [broomcorn]
gb|ACN85285.1|  microtubule-associated protein MAP65-1a                 431   1e-136   Oryza australiensis
ref|XP_010545152.1|  PREDICTED: 65-kDa microtubule-associated pro...    435   2e-136   
ref|XP_010060274.1|  PREDICTED: 65-kDa microtubule-associated pro...    431   2e-136   
gb|KHN38240.1|  65-kDa microtubule-associated protein 1                 431   2e-136   
ref|XP_009120044.1|  PREDICTED: 65-kDa microtubule-associated pro...    431   3e-136   
gb|KHN23889.1|  65-kDa microtubule-associated protein 1                 430   4e-136   
emb|CDY12006.1|  BnaC03g14320D                                          432   4e-136   
ref|XP_006851821.1|  hypothetical protein AMTR_s00041p00052270          428   6e-136   
ref|XP_006394416.1|  hypothetical protein EUTSA_v10003940mg             428   7e-136   
gb|AAX12477.1|  microtubule associated protein                          429   9e-136   Zinnia elegans [garden zinnia]
ref|XP_009361055.1|  PREDICTED: 65-kDa microtubule-associated pro...    429   1e-135   
ref|XP_006656018.1|  PREDICTED: 65-kDa microtubule-associated pro...    429   1e-135   
ref|XP_010448214.1|  PREDICTED: 65-kDa microtubule-associated pro...    428   1e-135   
ref|XP_006283406.1|  hypothetical protein CARUB_v10004454mg             428   2e-135   
ref|NP_001057475.1|  Os06g0308300                                       427   3e-135   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001151771.1|  microtubule-associated protein MAP65-1a            428   3e-135   Zea mays [maize]
ref|XP_003544755.1|  PREDICTED: 65-kDa microtubule-associated pro...    427   4e-135   
ref|XP_006282202.1|  hypothetical protein CARUB_v10028468mg             425   7e-135   
ref|XP_010675802.1|  PREDICTED: 65-kDa microtubule-associated pro...    426   1e-134   
ref|XP_010271123.1|  PREDICTED: 65-kDa microtubule-associated pro...    426   2e-134   
ref|XP_002298820.1|  microtubule associated family protein              426   2e-134   Populus trichocarpa [western balsam poplar]
ref|XP_002867542.1|  microtubule associated protein family protein      426   2e-134   
ref|XP_004492661.1|  PREDICTED: 65-kDa microtubule-associated pro...    429   3e-134   
gb|AFW76336.1|  microtubule-associated protein MAP65-1a                 425   4e-134   
ref|XP_009407909.1|  PREDICTED: 65-kDa microtubule-associated pro...    425   4e-134   
ref|NP_001151518.1|  microtubule-associated protein MAP65-1a            425   4e-134   Zea mays [maize]
ref|XP_010458439.1|  PREDICTED: 65-kDa microtubule-associated pro...    423   5e-134   
ref|XP_002975495.1|  hypothetical protein SELMODRAFT_103447             424   5e-134   
ref|XP_002978736.1|  hypothetical protein SELMODRAFT_109421             424   6e-134   
ref|XP_010554316.1|  PREDICTED: 65-kDa microtubule-associated pro...    424   1e-133   
ref|XP_004491431.1|  PREDICTED: 65-kDa microtubule-associated pro...    424   1e-133   
gb|ADE77097.1|  unknown                                                 424   1e-133   
gb|ACN85340.1|  microtubule-associated protein MAP65-1a                 420   2e-133   Oryza meyeriana var. granulata
emb|CDY20777.1|  BnaA02g09170D                                          423   3e-133   
ref|XP_007142344.1|  hypothetical protein PHAVU_008G272600g             422   3e-133   
ref|XP_008364470.1|  PREDICTED: 65-kDa microtubule-associated pro...    422   3e-133   
gb|KHG30555.1|  65-kDa microtubule-associated 1 -like protein           423   3e-133   
ref|XP_011046720.1|  PREDICTED: 65-kDa microtubule-associated pro...    422   4e-133   
ref|XP_010483914.1|  PREDICTED: 65-kDa microtubule-associated pro...    421   4e-133   
ref|XP_004251905.1|  PREDICTED: 65-kDa microtubule-associated pro...    421   5e-133   
ref|XP_004965317.1|  PREDICTED: 65-kDa microtubule-associated pro...    422   7e-133   
ref|NP_567756.1|  microtubule-associated protein 65-2                   421   1e-132   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008798834.1|  PREDICTED: 65-kDa microtubule-associated pro...    421   1e-132   
ref|XP_002438307.1|  hypothetical protein SORBIDRAFT_10g011790          421   1e-132   Sorghum bicolor [broomcorn]
ref|XP_010913218.1|  PREDICTED: 65-kDa microtubule-associated pro...    420   2e-132   
gb|KDO60866.1|  hypothetical protein CISIN_1g036719mg                   421   3e-132   
ref|XP_009151516.1|  PREDICTED: 65-kDa microtubule-associated pro...    418   4e-132   
ref|XP_009392160.1|  PREDICTED: 65-kDa microtubule-associated pro...    420   4e-132   
ref|XP_008798245.1|  PREDICTED: 65-kDa microtubule-associated pro...    419   7e-132   
ref|XP_006448077.1|  hypothetical protein CICLE_v10014662mg             419   7e-132   
ref|XP_010545245.1|  PREDICTED: 65-kDa microtubule-associated pro...    419   8e-132   
ref|XP_006344873.1|  PREDICTED: 65-kDa microtubule-associated pro...    418   8e-132   
ref|XP_010242184.1|  PREDICTED: 65-kDa microtubule-associated pro...    419   2e-131   
ref|XP_006401477.1|  hypothetical protein EUTSA_v10013064mg             417   3e-131   
ref|XP_003563914.1|  PREDICTED: 65-kDa microtubule-associated pro...    417   3e-131   
ref|NP_172922.2|  microtubule-associated protein 65-7                   418   3e-131   
emb|CDY00270.1|  BnaA06g21710D                                          416   4e-131   
ref|XP_006575692.1|  PREDICTED: 65-kDa microtubule-associated pro...    418   4e-131   
ref|XP_009618833.1|  PREDICTED: 65-kDa microtubule-associated pro...    417   4e-131   
emb|CDX86911.1|  BnaC03g51810D                                          415   4e-131   
ref|NP_200334.1|  microtubule-associated protein 65-1                   417   6e-131   
gb|EEC80473.1|  hypothetical protein OsI_22696                          425   7e-131   
ref|XP_007222054.1|  hypothetical protein PRUPE_ppa003128mg             417   7e-131   
ref|XP_008659489.1|  PREDICTED: 65-kDa microtubule-associated pro...    416   9e-131   
ref|XP_010244424.1|  PREDICTED: 65-kDa microtubule-associated pro...    416   1e-130   
gb|EMT05427.1|  hypothetical protein F775_27818                         415   2e-130   
ref|XP_001771255.1|  predicted protein                                  415   3e-130   
gb|EMS44988.1|  hypothetical protein TRIUR3_31845                       414   4e-130   
ref|XP_002864385.1|  atmap65-1                                          414   4e-130   
ref|XP_009334166.1|  PREDICTED: LOW QUALITY PROTEIN: 65-kDa micro...    414   6e-130   
ref|XP_003555698.1|  PREDICTED: 65-kDa microtubule-associated pro...    414   9e-130   
ref|XP_006280225.1|  hypothetical protein CARUB_v10026142mg             413   1e-129   
ref|XP_008449129.1|  PREDICTED: 65-kDa microtubule-associated pro...    412   2e-129   
ref|XP_010063053.1|  PREDICTED: 65-kDa microtubule-associated pro...    412   2e-129   
ref|XP_010482956.1|  PREDICTED: 65-kDa microtubule-associated pro...    412   3e-129   
ref|XP_001771216.1|  predicted protein                                  412   3e-129   
gb|EMT15572.1|  hypothetical protein F775_11435                         413   5e-129   
emb|CDY06596.1|  BnaC02g13200D                                          411   6e-129   
ref|XP_010936854.1|  PREDICTED: 65-kDa microtubule-associated pro...    411   8e-129   
ref|XP_009127015.1|  PREDICTED: 65-kDa microtubule-associated pro...    410   2e-128   
ref|XP_010449298.1|  PREDICTED: 65-kDa microtubule-associated pro...    410   2e-128   
gb|EAY87319.1|  hypothetical protein OsI_08723                          410   3e-128   
ref|XP_004170838.1|  PREDICTED: LOW QUALITY PROTEIN: 65-kDa micro...    409   4e-128   
ref|XP_008220951.1|  PREDICTED: 65-kDa microtubule-associated pro...    410   4e-128   
ref|XP_003534687.1|  PREDICTED: 65-kDa microtubule-associated pro...    409   5e-128   
ref|XP_006290762.1|  hypothetical protein CARUB_v10016866mg             409   6e-128   
ref|NP_001047950.1|  Os02g0720200                                       409   7e-128   
ref|XP_004149338.1|  PREDICTED: 65-kDa microtubule-associated pro...    408   8e-128   
ref|XP_008787693.1|  PREDICTED: 65-kDa microtubule-associated pro...    403   9e-128   
gb|KHN46514.1|  65-kDa microtubule-associated protein 6                 409   1e-127   
ref|XP_007146528.1|  hypothetical protein PHAVU_006G048500g             408   1e-127   
ref|XP_008381787.1|  PREDICTED: 65-kDa microtubule-associated pro...    408   1e-127   
emb|CDY14300.1|  BnaA08g14310D                                          407   1e-127   
ref|XP_007153034.1|  hypothetical protein PHAVU_003G002000g             408   2e-127   
ref|XP_010496431.1|  PREDICTED: 65-kDa microtubule-associated pro...    408   2e-127   
ref|XP_010066544.1|  PREDICTED: 65-kDa microtubule-associated pro...    408   2e-127   
ref|XP_010476536.1|  PREDICTED: 65-kDa microtubule-associated pro...    407   3e-127   
gb|KDP38177.1|  hypothetical protein JCGZ_04820                         407   3e-127   
ref|XP_006355037.1|  PREDICTED: 65-kDa microtubule-associated pro...    407   4e-127   
ref|XP_010458981.1|  PREDICTED: 65-kDa microtubule-associated pro...    407   4e-127   
ref|XP_010443144.1|  PREDICTED: 65-kDa microtubule-associated pro...    406   4e-127   
ref|XP_009109170.1|  PREDICTED: 65-kDa microtubule-associated pro...    406   5e-127   
emb|CDX81663.1|  BnaC08g39380D                                          407   5e-127   
ref|XP_001753966.1|  predicted protein                                  406   7e-127   
ref|XP_009117882.1|  PREDICTED: 65-kDa microtubule-associated pro...    405   1e-126   
ref|XP_001772642.1|  predicted protein                                  405   2e-126   
ref|XP_001772684.1|  predicted protein                                  404   2e-126   
emb|CDX87240.1|  BnaC09g05550D                                          402   4e-126   
ref|XP_011075736.1|  PREDICTED: 65-kDa microtubule-associated pro...    404   6e-126   
ref|XP_010928891.1|  PREDICTED: 65-kDa microtubule-associated pro...    403   6e-126   
ref|XP_006413142.1|  hypothetical protein EUTSA_v10024776mg             403   8e-126   
ref|XP_003589752.1|  hypothetical protein MTR_1g038840                  404   1e-125   
ref|XP_009112094.1|  PREDICTED: 65-kDa microtubule-associated pro...    401   1e-125   
gb|KHM99079.1|  65-kDa microtubule-associated protein 6                 403   1e-125   
emb|CDY33748.1|  BnaA09g45540D                                          403   1e-125   
emb|CDY17624.1|  BnaA06g34430D                                          403   2e-125   
ref|XP_002521913.1|  PLE, putative                                      402   2e-125   
ref|XP_009101289.1|  PREDICTED: 65-kDa microtubule-associated pro...    403   2e-125   
ref|XP_008231710.1|  PREDICTED: 65-kDa microtubule-associated pro...    401   2e-125   
ref|XP_010909304.1|  PREDICTED: 65-kDa microtubule-associated pro...    404   2e-125   
ref|XP_006660676.1|  PREDICTED: 65-kDa microtubule-associated pro...    402   3e-125   
ref|XP_009403547.1|  PREDICTED: 65-kDa microtubule-associated pro...    401   4e-125   
ref|XP_011024708.1|  PREDICTED: 65-kDa microtubule-associated pro...    402   5e-125   
ref|NP_001190542.1|  microtubule-associated protein 65-1                402   8e-125   
ref|XP_010105537.1|  hypothetical protein L484_019280                   400   1e-124   
ref|XP_004956977.1|  PREDICTED: 65-kDa microtubule-associated pro...    400   1e-124   
ref|XP_007221047.1|  hypothetical protein PRUPE_ppa015695mg             399   2e-124   
ref|XP_010063054.1|  PREDICTED: 65-kDa microtubule-associated pro...    399   2e-124   
ref|NP_178300.3|  microtubule-associated protein 65-6                   400   2e-124   
gb|AAF79248.1|AC006917_33  F10B6.9                                      401   2e-124   
ref|XP_010905622.1|  PREDICTED: 65-kDa microtubule-associated pro...    400   3e-124   
ref|XP_002462473.1|  hypothetical protein SORBIDRAFT_02g026260          399   4e-124   
ref|XP_008466912.1|  PREDICTED: 65-kDa microtubule-associated pro...    399   4e-124   
ref|XP_004498106.1|  PREDICTED: 65-kDa microtubule-associated pro...    399   5e-124   
ref|XP_002311550.2|  hypothetical protein POPTR_0008s13910g             399   5e-124   
ref|XP_008449128.1|  PREDICTED: 65-kDa microtubule-associated pro...    395   5e-124   
gb|ACQ90586.1|  putative microtubule-associated protein                 399   6e-124   
emb|CDX97365.1|  BnaC08g12300D                                          405   6e-124   
ref|XP_010513928.1|  PREDICTED: 65-kDa microtubule-associated pro...    399   7e-124   
ref|XP_010502193.1|  PREDICTED: 65-kDa microtubule-associated pro...    399   7e-124   
emb|CDY03090.1|  BnaC07g21370D                                          399   8e-124   
ref|XP_010502197.1|  PREDICTED: 65-kDa microtubule-associated pro...    399   9e-124   
ref|XP_009351596.1|  PREDICTED: 65-kDa microtubule-associated pro...    398   1e-123   
ref|XP_002875099.1|  atmap65-6                                          398   1e-123   
ref|NP_201031.1|  microtubule-associated protein 65-9                   396   1e-123   
ref|XP_006416984.1|  hypothetical protein EUTSA_v10007124mg             397   3e-123   
ref|XP_009403548.1|  PREDICTED: 65-kDa microtubule-associated pro...    396   3e-123   
ref|XP_004236913.1|  PREDICTED: 65-kDa microtubule-associated pro...    397   3e-123   
tpg|DAA61726.1|  TPA: hypothetical protein ZEAMMB73_874970              397   4e-123   
ref|XP_009142754.1|  PREDICTED: 65-kDa microtubule-associated pro...    395   4e-123   
ref|NP_001063326.2|  Os09g0450300                                       396   4e-123   
dbj|BAD37971.1|  putative microtubule-associated protein MAP65-1a       396   4e-123   
emb|CDY16786.1|  BnaA09g05960D                                          394   7e-123   
ref|XP_009798327.1|  PREDICTED: 65-kDa microtubule-associated pro...    396   8e-123   
emb|CDX89305.1|  BnaA01g15880D                                          395   9e-123   
ref|XP_010031028.1|  PREDICTED: 65-kDa microtubule-associated pro...    394   9e-123   
ref|XP_006836226.1|  hypothetical protein AMTR_s00101p00107070          395   1e-122   
ref|XP_004167937.1|  PREDICTED: 65-kDa microtubule-associated pro...    395   2e-122   
ref|XP_004299004.1|  PREDICTED: 65-kDa microtubule-associated pro...    395   2e-122   
ref|XP_004150149.1|  PREDICTED: 65-kDa microtubule-associated pro...    394   3e-122   
ref|XP_002892823.1|  F10B6.9                                            395   3e-122   
ref|XP_003578204.1|  PREDICTED: 65-kDa microtubule-associated pro...    394   5e-122   
ref|XP_009142761.1|  PREDICTED: 65-kDa microtubule-associated pro...    392   5e-122   
gb|EYU26921.1|  hypothetical protein MIMGU_mgv1a003544mg                393   5e-122   
ref|XP_010659056.1|  PREDICTED: 65-kDa microtubule-associated pro...    392   8e-122   
gb|EEE69829.1|  hypothetical protein OsJ_29585                          391   1e-121   
ref|XP_010271124.1|  PREDICTED: 65-kDa microtubule-associated pro...    391   2e-121   
ref|XP_006304780.1|  hypothetical protein CARUB_v10012320mg             392   3e-121   
ref|XP_010554372.1|  PREDICTED: 65-kDa microtubule-associated pro...    392   3e-121   
ref|XP_006849458.1|  hypothetical protein AMTR_s00024p00078360          391   6e-121   
ref|XP_009405774.1|  PREDICTED: 65-kDa microtubule-associated pro...    390   8e-121   
ref|XP_002983486.1|  hypothetical protein SELMODRAFT_21619              389   8e-121   
ref|XP_004985068.1|  PREDICTED: 65-kDa microtubule-associated pro...    390   1e-120   
ref|XP_006647805.1|  PREDICTED: 65-kDa microtubule-associated pro...    390   1e-120   
dbj|BAJ86160.1|  predicted protein                                      389   2e-120   
emb|CDP05474.1|  unnamed protein product                                389   2e-120   
ref|XP_002271779.2|  PREDICTED: 65-kDa microtubule-associated pro...    389   3e-120   
gb|ACJ85676.1|  unknown                                                 386   4e-120   
gb|EEC84679.1|  hypothetical protein OsI_31594                          388   6e-120   
emb|CBI26699.3|  unnamed protein product                                384   6e-120   
ref|XP_010327410.1|  PREDICTED: 65-kDa microtubule-associated pro...    387   7e-120   
ref|XP_007045448.1|  Microtubule associated protein (MAP65/ASE1) ...    388   9e-120   
ref|XP_003558404.1|  PREDICTED: 65-kDa microtubule-associated pro...    387   1e-119   
ref|XP_006347681.1|  PREDICTED: 65-kDa microtubule-associated pro...    386   2e-119   
gb|EMT10302.1|  hypothetical protein F775_07635                         386   2e-119   
ref|XP_009390345.1|  PREDICTED: 65-kDa microtubule-associated pro...    386   3e-119   
ref|XP_010242317.1|  PREDICTED: 65-kDa microtubule-associated pro...    385   3e-119   
ref|XP_011020464.1|  PREDICTED: 65-kDa microtubule-associated pro...    385   4e-119   
ref|XP_004511089.1|  PREDICTED: 65-kDa microtubule-associated pro...    384   7e-119   
emb|CDX94287.1|  BnaC01g18970D                                          387   9e-119   
ref|XP_011086296.1|  PREDICTED: 65-kDa microtubule-associated pro...    384   9e-119   
ref|XP_009381007.1|  PREDICTED: 65-kDa microtubule-associated pro...    385   9e-119   
ref|XP_009608506.1|  PREDICTED: 65-kDa microtubule-associated pro...    385   1e-118   
ref|XP_009417899.1|  PREDICTED: 65-kDa microtubule-associated pro...    383   4e-118   
gb|AFW76335.1|  hypothetical protein ZEAMMB73_223549                    382   5e-118   
ref|XP_008795133.1|  PREDICTED: 65-kDa microtubule-associated pro...    382   5e-118   
ref|XP_007045449.1|  Microtubule associated protein (MAP65/ASE1) ...    383   6e-118   
ref|XP_009779411.1|  PREDICTED: 65-kDa microtubule-associated pro...    382   6e-118   
ref|XP_004308670.1|  PREDICTED: 65-kDa microtubule-associated pro...    382   6e-118   
ref|XP_009403369.1|  PREDICTED: 65-kDa microtubule-associated pro...    384   7e-118   
dbj|BAD62190.1|  putative microtubule-associated protein                378   8e-118   
ref|XP_004956975.1|  PREDICTED: 65-kDa microtubule-associated pro...    383   9e-118   
gb|EMS60666.1|  hypothetical protein TRIUR3_20799                       387   9e-118   
ref|XP_006492296.1|  PREDICTED: 65-kDa microtubule-associated pro...    380   2e-117   
ref|XP_006364065.1|  PREDICTED: 65-kDa microtubule-associated pro...    381   2e-117   
ref|XP_009591247.1|  PREDICTED: 65-kDa microtubule-associated pro...    380   3e-117   
ref|XP_010530467.1|  PREDICTED: 65-kDa microtubule-associated pro...    380   3e-117   
ref|XP_007010780.1|  65-kDa microtubule-associated protein 5 isof...    380   3e-117   
tpg|DAA44293.1|  TPA: hypothetical protein ZEAMMB73_532166              381   4e-117   
ref|NP_001146699.1|  uncharacterized protein LOC100280300               381   4e-117   
ref|XP_006649703.1|  PREDICTED: 65-kDa microtubule-associated pro...    381   5e-117   
ref|XP_002304813.1|  microtubule associated family protein              379   7e-117   
ref|XP_002281677.1|  PREDICTED: 65-kDa microtubule-associated pro...    380   8e-117   
gb|ADQ43179.1|  unknown                                                 380   1e-116   
gb|AAO06976.1|  Unknown protein                                         378   4e-116   
ref|NP_001049496.1|  Os03g0237600                                       378   4e-116   
ref|XP_009405776.1|  PREDICTED: 65-kDa microtubule-associated pro...    377   4e-116   
ref|XP_006848367.1|  hypothetical protein AMTR_s00013p00194760          377   1e-115   
gb|KDO62133.1|  hypothetical protein CISIN_1g007822mg                   372   1e-115   
ref|XP_009403368.1|  PREDICTED: 65-kDa microtubule-associated pro...    378   2e-115   
emb|CBI27647.3|  unnamed protein product                                375   2e-115   
ref|XP_009361914.1|  PREDICTED: 65-kDa microtubule-associated pro...    375   2e-115   
ref|XP_010316528.1|  PREDICTED: 65-kDa microtubule-associated pro...    376   2e-115   
ref|XP_007221824.1|  hypothetical protein PRUPE_ppa003164mg             374   2e-114   
ref|XP_003541570.1|  PREDICTED: 65-kDa microtubule-associated pro...    372   2e-114   
ref|XP_010936857.1|  PREDICTED: 65-kDa microtubule-associated pro...    372   2e-114   
ref|XP_010250731.1|  PREDICTED: 65-kDa microtubule-associated pro...    373   3e-114   
dbj|BAA97189.1|  unnamed protein product                                369   8e-114   
gb|EPS61295.1|  hypothetical protein M569_13500                         371   1e-113   
gb|AGT15900.1|  hypothetical protein SHCRBa_121_B20_F_50                372   1e-113   
ref|XP_008806639.1|  PREDICTED: 65-kDa microtubule-associated pro...    372   1e-113   
ref|XP_010105800.1|  hypothetical protein L484_005475                   370   2e-113   
gb|EMT18033.1|  hypothetical protein F775_05328                         370   2e-113   
gb|EMT21645.1|  hypothetical protein F775_08242                         370   3e-113   
ref|XP_003628012.1|  Protein regulator of cytokinesis                   369   3e-113   
ref|XP_009616662.1|  PREDICTED: 65-kDa microtubule-associated pro...    371   3e-113   
gb|KHN23892.1|  65-kDa microtubule-associated protein 1                 370   4e-113   
ref|XP_004147082.1|  PREDICTED: 65-kDa microtubule-associated pro...    369   6e-113   
ref|XP_009759884.1|  PREDICTED: 65-kDa microtubule-associated pro...    370   1e-112   
ref|XP_002525548.1|  Protein regulator of cytokinesis, putative         368   1e-112   
ref|XP_011024765.1|  PREDICTED: 65-kDa microtubule-associated pro...    367   1e-112   
ref|NP_001045750.1|  Os02g0126300                                       367   2e-112   
ref|XP_008445947.1|  PREDICTED: 65-kDa microtubule-associated pro...    367   2e-112   
ref|XP_003568463.1|  PREDICTED: 65-kDa microtubule-associated pro...    367   3e-112   
gb|EMS47967.1|  hypothetical protein TRIUR3_18204                       367   4e-112   
gb|EAZ24419.1|  hypothetical protein OsJ_08172                          366   5e-112   
ref|XP_004962104.1|  PREDICTED: 65-kDa microtubule-associated pro...    366   6e-112   
ref|XP_002311551.2|  hypothetical protein POPTR_0008s13910g             365   7e-112   
ref|XP_010096007.1|  hypothetical protein L484_023998                   369   8e-112   
ref|XP_007213916.1|  hypothetical protein PRUPE_ppa005914mg             361   8e-112   
ref|XP_010670563.1|  PREDICTED: 65-kDa microtubule-associated pro...    365   9e-112   
gb|KEH40949.1|  microtubule associated protein, MAP65/ASE1 family...    365   1e-111   
dbj|BAK05836.1|  predicted protein                                      365   2e-111   
ref|XP_006411095.1|  hypothetical protein EUTSA_v10016463mg             364   2e-111   
ref|XP_008389850.1|  PREDICTED: 65-kDa microtubule-associated pro...    365   3e-111   
ref|XP_006432377.1|  hypothetical protein CICLE_v10000741mg             364   3e-111   
ref|XP_008356798.1|  PREDICTED: 65-kDa microtubule-associated pro...    363   3e-111   
ref|XP_002465585.1|  hypothetical protein SORBIDRAFT_01g041610          365   3e-111   
ref|XP_004962103.1|  PREDICTED: 65-kDa microtubule-associated pro...    363   5e-111   
ref|XP_007133642.1|  hypothetical protein PHAVU_011G196700g             363   6e-111   
gb|KDP26794.1|  hypothetical protein JCGZ_17952                         363   8e-111   
ref|XP_008389849.1|  PREDICTED: 65-kDa microtubule-associated pro...    364   1e-110   
gb|KDP40572.1|  hypothetical protein JCGZ_24571                         363   1e-110   
gb|EMT03839.1|  Putative receptor protein kinase ZmPK1                  382   1e-110   
ref|XP_006471331.1|  PREDICTED: 65-kDa microtubule-associated pro...    362   1e-110   
ref|NP_001055528.1|  Os05g0409400                                       361   4e-110   
ref|XP_009385153.1|  PREDICTED: 65-kDa microtubule-associated pro...    361   7e-110   



>emb|CDP17778.1| unnamed protein product [Coffea canephora]
Length=703

 Score =   747 bits (1928),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/701 (61%), Positives = 541/701 (77%), Gaps = 22/701 (3%)
 Frame = +1

Query  280   METTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVA  459
             METTC SLLSELQKIW+E+GEPE ERDKM+ +LEQECL+AYRRKVDQAS+  AQL+QAVA
Sbjct  1     METTCGSLLSELQKIWDEVGEPETERDKMIFELEQECLQAYRRKVDQASQCRAQLQQAVA  60

Query  460   ESEAELARICAALGEQPVNVRQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQID  639
             +S++ELA I AALGE+P++VRQ+S SLK ELQA+   LE+M+KRK+ERK+ F EV++QID
Sbjct  61    DSDSELAFIYAALGERPMHVRQTSGSLKVELQAVTSELEQMRKRKMERKNHFIEVVEQID  120

Query  640   SVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESLNSL  819
             ++ KEL  S +E   M  +D+SDLSL+RLED+K+ LL+L+KEKS+RLKQVLDHL +LNSL
Sbjct  121   NISKELSVSSEETLSMTIVDDSDLSLKRLEDLKTQLLALEKEKSNRLKQVLDHLNTLNSL  180

Query  820   CIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQRLHMLQNLATT  999
             C+VLG+DFK T+ EIHPTL DSS+++S+S +TIERLS AI  L+++KIQR+  LQ+LA T
Sbjct  181   CLVLGLDFKLTVSEIHPTLDDSSSVRSISVQTIERLSIAIRRLKDLKIQRVQKLQDLAAT  240

Query  1000  IVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQEMKSSK  1179
             +VELW LMD PVEEQQ F NVT  IAAS +E+T+PN LSLD L+ AE EV RLQ+MKSSK
Sbjct  241   MVELWCLMDTPVEEQQRFQNVTCNIAASVNEITQPNTLSLDFLEYAEAEVLRLQQMKSSK  300

Query  1180  MKEVLLKKRITLEELCRQAHLAIDDS--IEFTDETIESGAIDPSHLLEQLEIQISNVKEE  1353
             +KEVL KKR+ LEE+CR AH+ ++D   I+F+ ETIESGAIDPS+LLEQ+E+QIS +KEE
Sbjct  301   IKEVLFKKRLQLEEICRGAHMVVEDHNPIDFSIETIESGAIDPSYLLEQIEVQISKIKEE  360

Query  1354  AFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVNKIPGM  1533
             AFSRKEILEKVEKWL ACEEE WLE+YNR+DNRYN GRG HL+LKRAEKAR LVNKIP M
Sbjct  361   AFSRKEILEKVEKWLVACEEERWLEEYNRDDNRYNAGRGAHLILKRAEKARGLVNKIPAM  420

Query  1534  LEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQGQLMAE  1713
             +E LTS+ K WE +RGV FLYDGVSLLSML+QY +LK+EKE ERQRQRDQKKLQGQLM E
Sbjct  421   IEVLTSKPKAWEKQRGVEFLYDGVSLLSMLDQYRILKEEKEQERQRQRDQKKLQGQLMVE  480

Query  1714  QEVLFGSKRSPSQSGKK----NVVGGASNKRISVGGAMLQTPYTERAPLSSHSLKKINPV  1881
             +E LFGSK SP++S +K    +  GG+SNKR SVGG MLQ  Y E+A  +S    K N  
Sbjct  481   KEALFGSKPSPTKSSRKIFGTSAGGGSSNKRFSVGGMMLQNSYPEKAVHTSQFSNKSNTS  540

Query  1882  KQQALANIT-QNYVALSSGRRE-SSMHAKQPSCNKSNLQKTE-PTQRKPLSPI-SSLSFN  2049
             K   L N        LSSG+R  S + +K+PS   S+ ++TE  + RKPLSP+ SS S N
Sbjct  541   KLHVLQNFQPHGGTILSSGKRHISGVQSKKPSSYGSDQRQTELRSIRKPLSPLYSSFSSN  600

Query  2050  TSSANIMDKISESEELRE-MPASL--LTTPIKNVSGIGGNATPKtmpipmpstpasaass  2220
              + AN+ D+ + ++EL + +P++   + TP K +    GN TPK   +P+P     +  S
Sbjct  601   ANYANLQDEKNRNQELVDTLPSNKADMVTPNKRIPAFEGNETPK--CMPIPMPLTPSTVS  658

Query  2221  iamQMGMTPAPVAATTPMV--GHDGVEYSYEEMRAGFLLPR  2337
               M+M MTPA     TP V  G+ G+EYS+EE RAGF+LP+
Sbjct  659   STMRMAMTPA-----TPCVPPGNGGIEYSFEERRAGFILPK  694



>ref|XP_009604921.1| PREDICTED: 65-kDa microtubule-associated protein 3-like isoform 
X1 [Nicotiana tomentosiformis]
Length=747

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/740 (57%), Positives = 524/740 (71%), Gaps = 54/740 (7%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M+NRQ+++ L METTC SLLSE+Q+IW+E+GEPEIERDKML +L+QECLE Y+RKV+QAS
Sbjct  1     MHNRQSEKPLHMETTCGSLLSEMQRIWDEMGEPEIERDKMLFELQQECLEIYKRKVNQAS  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSRSLKTELQAIMPlleemkkrklerk  606
             RS AQL+QAVA SEAELA+ICAALGEQ    RQS RSL  EL+AI P LEEMKKRK ER 
Sbjct  61    RSRAQLQQAVANSEAELAKICAALGEQSSYARQSYRSLNEELKAIKPKLEEMKKRKRERM  120

Query  607   HQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQ  786
              QF+ V+DQI  + KEL    +E   M ++DE+DLS++RLE+M+++LL+LQKEKSDRLK 
Sbjct  121   DQFAAVVDQIQCISKELCVHLQENTQMSSIDENDLSVKRLEEMQNYLLALQKEKSDRLKL  180

Query  787   VLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQ  966
             VL HL ++NSLC+VLGID+K  I EI PT+ D S  K++S   I +LSA I+ L+ +K Q
Sbjct  181   VLVHLTTINSLCVVLGIDYKQIIAEIDPTMDDFSVSKNISKYMILKLSATINRLKGLKNQ  240

Query  967   RLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIE  1146
             RL  LQ++ATT+VELWNLMD P+EEQQ F +  R IAASE+E+ EPN LS+D L+ AE E
Sbjct  241   RLLRLQDIATTLVELWNLMDTPLEEQQQFHDFIRHIAASENEINEPNVLSVDSLQHAETE  300

Query  1147  VSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAID--DSIEFTDETIESGAIDPSHLLEQ  1320
             VSRLQEMKS+KMKEVLL+KR+ LEE+CR+AH+ I+   S++F+ E IESGA DPS+LLE+
Sbjct  301   VSRLQEMKSTKMKEVLLRKRLDLEEICRKAHMVIEIQHSVDFSVEAIESGANDPSYLLEK  360

Query  1321  LEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEK  1500
             LE+QIS VKEEAFSR++ILEKVEKWLAAC+EE WLE+YNR++NRY+GGRGTH  LKRAEK
Sbjct  361   LEVQISKVKEEAFSRRDILEKVEKWLAACDEECWLEEYNRDENRYHGGRGTHRNLKRAEK  420

Query  1501  ARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRD  1680
             AR LVNKIP M+E L SRA  W  ERG  FLYDGV+LLSM+EQY  L++EKELERQRQRD
Sbjct  421   ARVLVNKIPAMVETLRSRASAWLKERGHEFLYDGVALLSMVEQYCALQREKELERQRQRD  480

Query  1681  QKKLQGQLMAEQEVLFGSKRSPSQSGKKNV---VGGASNKRISVGGAMLQTPYTERAPLS  1851
             QKKLQGQLM EQE LFGS  SPS+S KKN    +GG +NKR+S+GGAMLQTPY  +A  S
Sbjct  481   QKKLQGQLMVEQEALFGSIPSPSKSAKKNFRPSMGGLTNKRLSLGGAMLQTPYAGKAAPS  540

Query  1852  SHSLKKINPVKQQALANITQNYVALSSGRRESSMHAK-QPSCNKSNLQKTEPTQ--RKPL  2022
             SH+ +  + +KQQ   N  Q      +GRR+S M  K Q SC  SN  +TE  Q  R P 
Sbjct  541   SHTGRLSSSLKQQTPQNSHQ------TGRRDSFMAPKRQQSCKVSNPPRTESKQTMRPPP  594

Query  2023  SPISSLS---------------FNTSSANIMDKISESEELREMPASLLTTPIKNVSGIGG  2157
              P  + S                N S+ NI ++  +S E++E P SL  TP+   + I  
Sbjct  595   DPRRTESTQTRKPLSPLSSMLSSNASTINIQNQTLKSGEVKETP-SLNKTPVMTPTKIAS  653

Query  2158  ------------NATPKtmpipmpstpasaassiamQMGM--TPAPVA-----ATTPMVG  2280
                         N TP   P  + S      +   M + M  TP+ V+     A TP V 
Sbjct  654   AVEDRLKETMSLNKTPVMTPTKIASAVEGCITPKTMTIPMPATPSTVSIAMQTAMTPAVL  713

Query  2281  H-----DGVEYSYEEMRAGF  2325
             H       +EYS+EE RAG+
Sbjct  714   HVSGCAGDIEYSFEERRAGY  733



>ref|XP_011093199.1| PREDICTED: 65-kDa microtubule-associated protein 3 [Sesamum indicum]
Length=704

 Score =   691 bits (1782),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/723 (58%), Positives = 517/723 (72%), Gaps = 61/723 (8%)
 Frame = +1

Query  280   METTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVA  459
             METTC SLLSELQKIW+E+GE + ERDKML +LEQECL+AYRRKVDQA+R  AQLRQAVA
Sbjct  1     METTCGSLLSELQKIWDEVGEVDKERDKMLFELEQECLDAYRRKVDQANRCRAQLRQAVA  60

Query  460   ESEAELARICAALGEQPVNVRQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQID  639
             ++EA+LA IC+ALGE+P ++++SS SLK ELQ IMP LE+MK+++ ERK QF+EVL QI+
Sbjct  61    DAEAQLADICSALGERPSHIKKSSGSLKKELQEIMPRLEDMKRKRNERKGQFAEVLKQIN  120

Query  640   SVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESLNSL  819
             S+  EL  S KE  + I +DE+DLS++RL+D++S LL LQ+EK +RLKQVLD L  L +L
Sbjct  121   SISTELAGSTKENLNTILIDENDLSMKRLDDLRSQLLMLQEEKGERLKQVLDQLNVLKAL  180

Query  820   CIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQRLHMLQNLATT  999
             C+VLG+DFK T+  +HP+L DS   KS+S +TIE LSA I  L++VK+QR+  LQ+LA T
Sbjct  181   CLVLGMDFKLTVCGVHPSLDDSCCAKSISVDTIESLSATIFRLKDVKLQRMRRLQDLAMT  240

Query  1000  IVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQEMKSSK  1179
             +VELWNLMD PVEEQQ+F NVT  IAA+ESE+TEPN LSL+ + +AE EV RLQEMK SK
Sbjct  241   MVELWNLMDAPVEEQQMFQNVTCTIAAAESEITEPNCLSLEFINNAETEVIRLQEMKMSK  300

Query  1180  MKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHLLEQLEIQISNVKEE  1353
             +KEV LKKR+ LEE+CR+AH+ ++     +F+ E+IESGAI  S LLEQLE QIS VKEE
Sbjct  301   IKEVFLKKRLVLEEICREAHMVVEGQFGTDFSLESIESGAISTSFLLEQLENQISKVKEE  360

Query  1354  AFSRKEILEKVEKWLAACEEESWLEdyn----rndnrynggrgTHLMLKRAEKARALVNK  1521
             AFSRKEILEKV+KWLAA EEE WLE+YN     +DNRYN GRGTHL+LKRAEKAR +VNK
Sbjct  361   AFSRKEILEKVQKWLAAREEECWLEEYNRVGHNDDNRYNAGRGTHLLLKRAEKARVIVNK  420

Query  1522  IPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQGQ  1701
             IP M+EAL S+AK WE ER V FLYDGV L+SM++QY  LK  KE ERQRQRD+KKLQGQ
Sbjct  421   IPAMVEALKSKAKAWEKERKVEFLYDGVGLVSMVDQYFELKHLKEQERQRQRDRKKLQGQ  480

Query  1702  LMAEQEVLFGSKRSPSQSGKKNV---VGGASNKRISVGGAMLQTPYTERAPLSSHSLKKI  1872
             L+AEQE ++GSK SPS+SG KN+    GG  NKR S+GGAMLQ    ++A LSS SL K 
Sbjct  481   LLAEQEAIYGSKPSPSKSGNKNLRPSTGGVGNKRFSLGGAMLQNTLADKAALSSRSLLKN  540

Query  1873  NPVKQQALANITQN-YVALSSGRRESSMH-AKQPSCNKSNLQKTE--PTQRKPLSPISSL  2040
             NPVK+Q+  N +   ++  SSG++ +S    K  S N SN Q  E  P  RK LSP+SSL
Sbjct  541   NPVKRQSSHNHSNKAFMPHSSGKKNTSAGPVKHHSSNASNSQHAELLPL-RKALSPLSSL  599

Query  2041  SFNTSSANIMDKISESEELRE------MPASLLTTPIKNVSGIGGNATPKtmpipmpstp  2202
             S N  S N  D+ ++S + ++       PA   TTP KNVS    N TPKTM        
Sbjct  600   SSNIISCNFQDQNTKSGDFQDTHVVCKTPA---TTPTKNVSTHDENRTPKTM--------  648

Query  2203  asaassiamQMGMTPAPVAATTPMVG----------------HDGVEYSYEEMRAGFLLP  2334
                           P PV AT P V                   GVEYS+EE RAGF+LP
Sbjct  649   --------------PIPVPATPPTVSAAMQTTTTPFTPAIRVAGGVEYSFEEKRAGFVLP  694

Query  2335  RLH  2343
             R H
Sbjct  695   RSH  697



>ref|XP_009789952.1| PREDICTED: 65-kDa microtubule-associated protein 3-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009789953.1| PREDICTED: 65-kDa microtubule-associated protein 3-like isoform 
X1 [Nicotiana sylvestris]
Length=747

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/739 (57%), Positives = 524/739 (71%), Gaps = 52/739 (7%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M+NRQ+D+ L METTC SLLSE+Q+IW+E+GEPEIERDKML +L+QECLE Y+RKV+QAS
Sbjct  1     MHNRQSDKPLHMETTCGSLLSEMQRIWDEMGEPEIERDKMLFELQQECLEIYKRKVNQAS  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSRSLKTELQAIMPlleemkkrklerk  606
             RS AQL+Q VA SEAELA+ICAALGEQ    RQSS+SL  EL+AI P LEEMKKRK ER 
Sbjct  61    RSRAQLQQTVANSEAELAKICAALGEQSSYARQSSKSLNEELKAIKPKLEEMKKRKRERM  120

Query  607   HQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQ  786
              QF+ V+DQI  + KEL    +  + M  +DE+DLS+RRLE+MK++L++LQKEKSDRLK 
Sbjct  121   DQFAAVVDQIQCISKELCVHFQGNKQMSVIDENDLSVRRLEEMKNYLIALQKEKSDRLKL  180

Query  787   VLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQ  966
             VLDHL S+NSLC+VLGID+K TI +I PT+ D S  K++S + I +LSA I+ L+++K Q
Sbjct  181   VLDHLTSINSLCVVLGIDYKQTIVDIDPTMDDFSVSKNISKDMIIKLSATINRLKDLKKQ  240

Query  967   RLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIE  1146
             RL  LQ++ATT+VELWNLMD P+ EQQ F + TR IAASE+E+ EPN LSLD L+ AE E
Sbjct  241   RLLRLQDIATTLVELWNLMDTPLVEQQQFHDFTRHIAASENEINEPNILSLDSLQHAEAE  300

Query  1147  VSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAIDD--SIEFTDETIESGAIDPSHLLEQ  1320
             VS LQEMKS+KMKEVLL+KR+ LEE+CR+AH+ I+   S++F+ E IESGA DPS+LLE+
Sbjct  301   VSTLQEMKSTKMKEVLLRKRLDLEEICRKAHMIIETQHSVDFSVEAIESGANDPSYLLEK  360

Query  1321  LEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEK  1500
             LE+ IS VKEEAFSR++ILEKVEKWLAAC+EE WLE+YNR++NRY+GGRGTH  LKRAEK
Sbjct  361   LEVLISKVKEEAFSRRDILEKVEKWLAACDEECWLEEYNRDENRYHGGRGTHRNLKRAEK  420

Query  1501  ARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRD  1680
             AR LVNKIP M+E L SRA  W+ ERG  FLYDGV+LLSM+EQY  L++EKELERQRQRD
Sbjct  421   ARVLVNKIPAMVETLRSRASAWQKERGHEFLYDGVALLSMVEQYCALQREKELERQRQRD  480

Query  1681  QKKLQGQLMAEQEVLFGSKRSPSQSGKKNV---VGGASNKRISVGGAMLQTPYTERAPLS  1851
             QKKLQGQLM EQE LFGS  SP +S KKN    +GG +NKR+S+GGAMLQTPY  +A  S
Sbjct  481   QKKLQGQLMVEQEALFGSIPSPLKSAKKNFRPSMGGLTNKRLSLGGAMLQTPYAGKAAPS  540

Query  1852  SHSLKKINPVKQQALANITQNYVALSSGRRESSMH-AKQPSCNKSNLQKTEPTQR-KPL-  2022
             S+S +  + +KQQ   N  Q      +GRR+S M   KQ SC  SN   TE  Q  KPL 
Sbjct  541   SYSGRLCSSLKQQTPQNSHQ------TGRRDSFMAPKKQQSCKVSNSLGTESKQTMKPLP  594

Query  2023  SPISSLS---------------FNTSSANIMDKISESEELREMPA---SLLTTPIKNVSG  2148
              P  + S                N S+ NI ++  +S   +E P+   + L TP K  S 
Sbjct  595   DPRRTESTQTRKPLSPLSSMLSSNASTINIQNQTLKSGGDKETPSLNKTPLMTPTKIASA  654

Query  2149  IGG--------NATPKtmpipmpstpasaassiamQMGM--TPAPVA-----ATTPMVGH  2283
             +          N TP   P  + S      +   M + M  TP+ V+     A TP   H
Sbjct  655   VEDRLNETMSLNRTPVMAPTKITSAVEGCITPKTMTIPMPATPSTVSIAMQTAMTPAALH  714

Query  2284  -----DGVEYSYEEMRAGF  2325
                  D +EYS+EE RAG+
Sbjct  715   VSGCTDDIEYSFEERRAGY  733



>ref|XP_009604922.1| PREDICTED: 65-kDa microtubule-associated protein 3-like isoform 
X2 [Nicotiana tomentosiformis]
Length=745

 Score =   686 bits (1770),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/740 (56%), Positives = 522/740 (71%), Gaps = 56/740 (8%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M+NRQ+++ L METTC SLLSE+Q+IW+E+GEPEIERDKML +L+QECLE Y+RKV+QAS
Sbjct  1     MHNRQSEKPLHMETTCGSLLSEMQRIWDEMGEPEIERDKMLFELQQECLEIYKRKVNQAS  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSRSLKTELQAIMPlleemkkrklerk  606
             RS AQL+QAVA SEAELA+ICAALGEQ    RQS RSL  EL+AI P LEEMKKRK ER 
Sbjct  61    RSRAQLQQAVANSEAELAKICAALGEQSSYARQSYRSLNEELKAIKPKLEEMKKRKRERM  120

Query  607   HQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQ  786
              QF+ V+DQI  + KEL    +E   M ++DE+DLS++RLE+M+++LL+LQKEKSDRLK 
Sbjct  121   DQFAAVVDQIQCISKELCVHLQENTQMSSIDENDLSVKRLEEMQNYLLALQKEKSDRLKL  180

Query  787   VLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQ  966
             VL HL ++NSLC+VLGID+K  I EI PT+ D S  K++S   I +LSA I+ L+ +K Q
Sbjct  181   VLVHLTTINSLCVVLGIDYKQIIAEIDPTMDDFSVSKNISKYMILKLSATINRLKGLKNQ  240

Query  967   RLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIE  1146
             RL  LQ++ATT+VELWNLMD P+EEQQ F +  R IAASE+E+ EPN LS+D L+ AE E
Sbjct  241   RLLRLQDIATTLVELWNLMDTPLEEQQQFHDFIRHIAASENEINEPNVLSVDSLQHAETE  300

Query  1147  VSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAID--DSIEFTDETIESGAIDPSHLLEQ  1320
             VSRLQEMKS+KMKEVLL+KR+ LEE+CR+AH+ I+   S++F+ E IESGA DPS+LLE+
Sbjct  301   VSRLQEMKSTKMKEVLLRKRLDLEEICRKAHMVIEIQHSVDFSVEAIESGANDPSYLLEK  360

Query  1321  LEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEK  1500
             LE+QIS VKEEAFSR++ILEKVEKWLAAC+EE WLE+YNR++NRY+GGRGTH  LKRAEK
Sbjct  361   LEVQISKVKEEAFSRRDILEKVEKWLAACDEECWLEEYNRDENRYHGGRGTHRNLKRAEK  420

Query  1501  ARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRD  1680
             AR LVNKIP M+E L SRA  W  ERG  FLYDGV+LLSM+EQY  L++EKELERQRQR 
Sbjct  421   ARVLVNKIPAMVETLRSRASAWLKERGHEFLYDGVALLSMVEQYCALQREKELERQRQR-  479

Query  1681  QKKLQGQLMAEQEVLFGSKRSPSQSGKKNV---VGGASNKRISVGGAMLQTPYTERAPLS  1851
              KKLQGQLM EQE LFGS  SPS+S KKN    +GG +NKR+S+GGAMLQTPY  +A  S
Sbjct  480   -KKLQGQLMVEQEALFGSIPSPSKSAKKNFRPSMGGLTNKRLSLGGAMLQTPYAGKAAPS  538

Query  1852  SHSLKKINPVKQQALANITQNYVALSSGRRESSMHAK-QPSCNKSNLQKTEPTQ--RKPL  2022
             SH+ +  + +KQQ   N  Q      +GRR+S M  K Q SC  SN  +TE  Q  R P 
Sbjct  539   SHTGRLSSSLKQQTPQNSHQ------TGRRDSFMAPKRQQSCKVSNPPRTESKQTMRPPP  592

Query  2023  SPISSLS---------------FNTSSANIMDKISESEELREMPASLLTTPIKNVSGIGG  2157
              P  + S                N S+ NI ++  +S E++E P SL  TP+   + I  
Sbjct  593   DPRRTESTQTRKPLSPLSSMLSSNASTINIQNQTLKSGEVKETP-SLNKTPVMTPTKIAS  651

Query  2158  ------------NATPKtmpipmpstpasaassiamQMGM--TPAPVA-----ATTPMVG  2280
                         N TP   P  + S      +   M + M  TP+ V+     A TP V 
Sbjct  652   AVEDRLKETMSLNKTPVMTPTKIASAVEGCITPKTMTIPMPATPSTVSIAMQTAMTPAVL  711

Query  2281  H-----DGVEYSYEEMRAGF  2325
             H       +EYS+EE RAG+
Sbjct  712   HVSGCAGDIEYSFEERRAGY  731



>ref|XP_009789954.1| PREDICTED: 65-kDa microtubule-associated protein 3-like isoform 
X2 [Nicotiana sylvestris]
Length=745

 Score =   679 bits (1753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/739 (57%), Positives = 522/739 (71%), Gaps = 54/739 (7%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M+NRQ+D+ L METTC SLLSE+Q+IW+E+GEPEIERDKML +L+QECLE Y+RKV+QAS
Sbjct  1     MHNRQSDKPLHMETTCGSLLSEMQRIWDEMGEPEIERDKMLFELQQECLEIYKRKVNQAS  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSRSLKTELQAIMPlleemkkrklerk  606
             RS AQL+Q VA SEAELA+ICAALGEQ    RQSS+SL  EL+AI P LEEMKKRK ER 
Sbjct  61    RSRAQLQQTVANSEAELAKICAALGEQSSYARQSSKSLNEELKAIKPKLEEMKKRKRERM  120

Query  607   HQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQ  786
              QF+ V+DQI  + KEL    +  + M  +DE+DLS+RRLE+MK++L++LQKEKSDRLK 
Sbjct  121   DQFAAVVDQIQCISKELCVHFQGNKQMSVIDENDLSVRRLEEMKNYLIALQKEKSDRLKL  180

Query  787   VLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQ  966
             VLDHL S+NSLC+VLGID+K TI +I PT+ D S  K++S + I +LSA I+ L+++K Q
Sbjct  181   VLDHLTSINSLCVVLGIDYKQTIVDIDPTMDDFSVSKNISKDMIIKLSATINRLKDLKKQ  240

Query  967   RLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIE  1146
             RL  LQ++ATT+VELWNLMD P+ EQQ F + TR IAASE+E+ EPN LSLD L+ AE E
Sbjct  241   RLLRLQDIATTLVELWNLMDTPLVEQQQFHDFTRHIAASENEINEPNILSLDSLQHAEAE  300

Query  1147  VSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAIDD--SIEFTDETIESGAIDPSHLLEQ  1320
             VS LQEMKS+KMKEVLL+KR+ LEE+CR+AH+ I+   S++F+ E IESGA DPS+LLE+
Sbjct  301   VSTLQEMKSTKMKEVLLRKRLDLEEICRKAHMIIETQHSVDFSVEAIESGANDPSYLLEK  360

Query  1321  LEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEK  1500
             LE+ IS VKEEAFSR++ILEKVEKWLAAC+EE WLE+YNR++NRY+GGRGTH  LKRAEK
Sbjct  361   LEVLISKVKEEAFSRRDILEKVEKWLAACDEECWLEEYNRDENRYHGGRGTHRNLKRAEK  420

Query  1501  ARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRD  1680
             AR LVNKIP M+E L SRA  W+ ERG  FLYDGV+LLSM+EQY  L++EKELERQRQR 
Sbjct  421   ARVLVNKIPAMVETLRSRASAWQKERGHEFLYDGVALLSMVEQYCALQREKELERQRQR-  479

Query  1681  QKKLQGQLMAEQEVLFGSKRSPSQSGKKNV---VGGASNKRISVGGAMLQTPYTERAPLS  1851
              KKLQGQLM EQE LFGS  SP +S KKN    +GG +NKR+S+GGAMLQTPY  +A  S
Sbjct  480   -KKLQGQLMVEQEALFGSIPSPLKSAKKNFRPSMGGLTNKRLSLGGAMLQTPYAGKAAPS  538

Query  1852  SHSLKKINPVKQQALANITQNYVALSSGRRESSMH-AKQPSCNKSNLQKTEPTQR-KPL-  2022
             S+S +  + +KQQ   N  Q      +GRR+S M   KQ SC  SN   TE  Q  KPL 
Sbjct  539   SYSGRLCSSLKQQTPQNSHQ------TGRRDSFMAPKKQQSCKVSNSLGTESKQTMKPLP  592

Query  2023  SPISSLS---------------FNTSSANIMDKISESEELREMPA---SLLTTPIKNVSG  2148
              P  + S                N S+ NI ++  +S   +E P+   + L TP K  S 
Sbjct  593   DPRRTESTQTRKPLSPLSSMLSSNASTINIQNQTLKSGGDKETPSLNKTPLMTPTKIASA  652

Query  2149  IGG--------NATPKtmpipmpstpasaassiamQMGM--TPAPVA-----ATTPMVGH  2283
             +          N TP   P  + S      +   M + M  TP+ V+     A TP   H
Sbjct  653   VEDRLNETMSLNRTPVMAPTKITSAVEGCITPKTMTIPMPATPSTVSIAMQTAMTPAALH  712

Query  2284  -----DGVEYSYEEMRAGF  2325
                  D +EYS+EE RAG+
Sbjct  713   VSGCTDDIEYSFEERRAGY  731



>ref|XP_010325766.1| PREDICTED: 65-kDa microtubule-associated protein 3-like isoform 
X2 [Solanum lycopersicum]
Length=755

 Score =   664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/776 (53%), Positives = 522/776 (67%), Gaps = 116/776 (15%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M N Q+++ L METTC SLLSE+Q+IW+E+GEP+IERDKML +L+QECLEAYRRKV+QAS
Sbjct  1     MNNSQSEKPLHMETTCGSLLSEMQRIWDEMGEPDIERDKMLFELQQECLEAYRRKVNQAS  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSRSLKTELQAIMPlleemkkrklerk  606
             R  AQLRQ VA+SEAE+A+ICAALGEQ    RQ SRSLK EL+AI P LEEMK+RK ER 
Sbjct  61    RCRAQLRQTVADSEAEIAKICAALGEQSSYARQISRSLKEELEAIKPKLEEMKRRKGERM  120

Query  607   HQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQ  786
             +QF+ V+DQI +  KEL    +E   M  +DE+DLS+RRLE+M+++LL+LQKEKSDRLK 
Sbjct  121   NQFAAVVDQIQTFSKELCLHFQENAQMSVIDENDLSVRRLEEMQNYLLALQKEKSDRLKL  180

Query  787   VLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQ  966
             ++DHL ++NSLC+VLG+D+K TI E+ PTL DS  LK++S + I +LSA I+ L E+K Q
Sbjct  181   LVDHLTTINSLCVVLGVDYKQTISEVDPTLEDSRVLKNISKDMIFKLSAMINRLEELKKQ  240

Query  967   RLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIE  1146
             RL  LQ+LATT+++LW+LMD P+EEQQ F + TR IAASE+E+ EPN LS D L+ AE E
Sbjct  241   RLLRLQDLATTLIQLWSLMDTPLEEQQKFYDFTRHIAASENEINEPNVLSADSLQHAEAE  300

Query  1147  VSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAID--DSIEFTDETIESGAIDPSHLLEQ  1320
             VSRLQ MKS+KMKEVLL+KR+ LEE+CR+AHL I+  +S++F+ E IESG IDPS+LLEQ
Sbjct  301   VSRLQAMKSTKMKEVLLRKRLELEEICRKAHLVIETQNSVDFSVEAIESGTIDPSYLLEQ  360

Query  1321  LEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEK  1500
             +E+QI+ VKEE FSR+EILEK+EKWLAAC+EE WLE+YNR++NRY+GG+GTH  LKRAEK
Sbjct  361   IEVQIAKVKEETFSRREILEKLEKWLAACDEECWLEEYNRDENRYHGGKGTHRNLKRAEK  420

Query  1501  ARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRD  1680
             AR LVNKIP M+E L  R   W+ ERG  FLYDGV++L MLEQY +LKQE+ELERQRQRD
Sbjct  421   ARVLVNKIPAMVETLRLRTSAWQKERGHEFLYDGVAVLYMLEQYCVLKQERELERQRQRD  480

Query  1681  QKKLQGQLMAEQEVLFGSKRSPSQSGKKNV---VGGASNKRISVGGAMLQTPYTER-APL  1848
             QKKLQGQLM EQE LFGS  SPS+S KKN    +GG +NKR+S+GG+MLQ PY  + AP 
Sbjct  481   QKKLQGQLMVEQEALFGSIPSPSKSAKKNFRPSMGGLTNKRLSLGGSMLQIPYAGKPAPS  540

Query  1849  S--SHSLKKINPVKQQALANITQNYVALSSGRRESSMHAKQPSCNKSNLQ-----KTE--  2001
             S  S SLK+  P                 SGRR+S +    P  N+ NL      +TE  
Sbjct  541   SRLSSSLKQQTP----------------QSGRRDSILA---PRKNQGNLYPPCTPRTELV  581

Query  2002  PTQRKPLSPISSLS------------------------------FNTSSANIMDKISESE  2091
              T++ PL+P  + S                               N S+ NI ++  +S 
Sbjct  582   QTRKAPLNPPRTKSAQIRKGPLNPPKNATTQTRKPLSPLSSLLSSNASTINIQNQTLKSG  641

Query  2092  ELRE----------MPASLLT-----------------TPIKNVSGIGGNATPKtmpipm  2190
              ++E           P  + T                 TP K  S + G+ TPKT+PIP 
Sbjct  642   VVQEALYLNRTPVMTPTKITTAEGRLKETVSFNKTPIITPTKIASAVEGSITPKTLPIP-  700

Query  2191  pstpasaassiamQMGMTPAPVA-----ATTPMVGH-----DGVEYSYEEMRAGFL  2328
                           M  TP+ V+     A TP   H     D +EYS+EE R G++
Sbjct  701   --------------MPATPSSVSTAMQTAMTPSSRHVSACADNIEYSFEERRTGYV  742



>ref|XP_010245133.1| PREDICTED: 65-kDa microtubule-associated protein 3-like isoform 
X1 [Nelumbo nucifera]
Length=777

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/776 (52%), Positives = 536/776 (69%), Gaps = 83/776 (11%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M N Q+DQ L+METTC SLL ELQ IW+E+GE E ERDKML +LE+ECLE YRRKVDQA+
Sbjct  1     MSNLQSDQLLQMETTCGSLLYELQMIWDEVGESEAERDKMLLELERECLEVYRRKVDQAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSRS---LKTELQAIMPlleemkkrkl  597
             R  AQLRQA+A++EAELA IC+A+GE+PV++RQS ++   LK EL AI+P LEEM+KRK 
Sbjct  61    RCRAQLRQAIADNEAELATICSAMGERPVHIRQSDQNSGRLKEELAAIIPQLEEMRKRKC  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             +R++QF EVL+QI  +  E+ KS       I +DE+DLS+R+ E++   L +LQKEKSDR
Sbjct  121   DRRNQFLEVLEQIQRISNEICKSTDYNSSKIVVDETDLSMRKFEELHRQLHALQKEKSDR  180

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             LKQVLDHL +LNSLC+VLG+DFK TI E+HP+L DS   K++S +TIER+ +AI +L EV
Sbjct  181   LKQVLDHLSTLNSLCLVLGMDFKQTINEVHPSLNDSEGTKNISDDTIERMDSAIQKLLEV  240

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             KI+R+  LQ+LATT++ELWNLMD P+ EQQ+F NVT  IAASE E+TEPN LS + +   
Sbjct  241   KIKRMRRLQDLATTMLELWNLMDTPIGEQQIFQNVTCKIAASEQEITEPNILSEEFINYV  300

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLA--IDDSIEFTDETIESGAIDPSHL  1311
             E EVS+L+++K+SKMKE++LKKR  +EE+CR+ H+   ID+ +E+  E IESGA+DP+ +
Sbjct  301   EEEVSKLEDLKASKMKELVLKKRSEMEEICRRTHMVAEIDNGMEYAIEAIESGAVDPACI  360

Query  1312  LEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKR  1491
             LEQ+E+QI+ VKEEAFSRKEILEKVEKWLAACEEESWLE+YNR++NRYN GRG HL LKR
Sbjct  361   LEQIELQIAKVKEEAFSRKEILEKVEKWLAACEEESWLEEYNRDENRYNAGRGAHLTLKR  420

Query  1492  AEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQR  1671
             AEKARA+VNK+P M++AL ++ + WE ERG+ FLYDGV LLSMLE+Y +L+QEKE ER+R
Sbjct  421   AEKARAVVNKLPAMIDALGTKVRTWERERGIEFLYDGVRLLSMLEEYNILRQEKEQERKR  480

Query  1672  QRDQKKLQGQLMAEQEVLFGSKRSPS--QSGKKN---VVGGASNKRISVGGAMLQTPYTE  1836
             QRDQKKLQGQL+AEQE LFGSK SPS  QSGKK     +GGA+ +R+S+GGAMLQTP  +
Sbjct  481   QRDQKKLQGQLIAEQEALFGSKPSPSKPQSGKKGPRMSIGGANGRRLSLGGAMLQTPKPD  540

Query  1837  ---RAPLSSHSLKKINPVKQQALANITQN--YVALSSGRRE---SSMHAKQPSCNKSNLQ  1992
                 A L+ H    + P K+  L +  Q+   VALS+GRR    + +  K+ S N +N  
Sbjct  541   LPHPAKLTPH----LRPSKKGGLLSHHQDDSCVALSAGRRGLDIAGLPVKKHSFNAANSH  596

Query  1993  KTE-PTQRKPLSPISSLSFNTSSANIMDKISE---------------------------S  2088
             + E P  RKP SP+S+      + N ++ +++                            
Sbjct  597   EIESPMTRKPFSPLSAAMLPKVNPNFLEDLNKVQGGTMQKTLPNSNTPLATPSKLACVTD  656

Query  2089  EELR----EMPASLLTTP--------------------IKNVSGIGGNATPKtmpipmps  2196
             E+ R    +MP  + TTP                    +   + I  N TPK   +P+P 
Sbjct  657   EDNRTPKEKMPIPMPTTPSTISVSMQTATTPAPAIATVLFGANKIEDNRTPK-EKMPIPV  715

Query  2197  tpasaassiamQMGMTPAPVAATTPMVG-------HDGVEYSYEEMRAGFLLPRLH  2343
                 +  S+ MQ   TPAP  AT  + G       H+ VEYS+EE RAGF++P+ H
Sbjct  716   PTTPSTISVPMQTATTPAPAIATV-LFGADKIEEMHEEVEYSFEERRAGFVIPKTH  770



>ref|XP_004231164.1| PREDICTED: 65-kDa microtubule-associated protein 3-like isoform 
X1 [Solanum lycopersicum]
Length=756

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/777 (53%), Positives = 522/777 (67%), Gaps = 117/777 (15%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M N Q+++ L METTC SLLSE+Q+IW+E+GEP+IERDKML +L+QECLEAYRRKV+QAS
Sbjct  1     MNNSQSEKPLHMETTCGSLLSEMQRIWDEMGEPDIERDKMLFELQQECLEAYRRKVNQAS  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQS-SRSLKTELQAIMPlleemkkrkler  603
             R  AQLRQ VA+SEAE+A+ICAALGEQ    RQ  SRSLK EL+AI P LEEMK+RK ER
Sbjct  61    RCRAQLRQTVADSEAEIAKICAALGEQSSYARQQISRSLKEELEAIKPKLEEMKRRKGER  120

Query  604   kHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLK  783
              +QF+ V+DQI +  KEL    +E   M  +DE+DLS+RRLE+M+++LL+LQKEKSDRLK
Sbjct  121   MNQFAAVVDQIQTFSKELCLHFQENAQMSVIDENDLSVRRLEEMQNYLLALQKEKSDRLK  180

Query  784   QVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKI  963
              ++DHL ++NSLC+VLG+D+K TI E+ PTL DS  LK++S + I +LSA I+ L E+K 
Sbjct  181   LLVDHLTTINSLCVVLGVDYKQTISEVDPTLEDSRVLKNISKDMIFKLSAMINRLEELKK  240

Query  964   QRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEI  1143
             QRL  LQ+LATT+++LW+LMD P+EEQQ F + TR IAASE+E+ EPN LS D L+ AE 
Sbjct  241   QRLLRLQDLATTLIQLWSLMDTPLEEQQKFYDFTRHIAASENEINEPNVLSADSLQHAEA  300

Query  1144  EVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAID--DSIEFTDETIESGAIDPSHLLE  1317
             EVSRLQ MKS+KMKEVLL+KR+ LEE+CR+AHL I+  +S++F+ E IESG IDPS+LLE
Sbjct  301   EVSRLQAMKSTKMKEVLLRKRLELEEICRKAHLVIETQNSVDFSVEAIESGTIDPSYLLE  360

Query  1318  QLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAE  1497
             Q+E+QI+ VKEE FSR+EILEK+EKWLAAC+EE WLE+YNR++NRY+GG+GTH  LKRAE
Sbjct  361   QIEVQIAKVKEETFSRREILEKLEKWLAACDEECWLEEYNRDENRYHGGKGTHRNLKRAE  420

Query  1498  KARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQR  1677
             KAR LVNKIP M+E L  R   W+ ERG  FLYDGV++L MLEQY +LKQE+ELERQRQR
Sbjct  421   KARVLVNKIPAMVETLRLRTSAWQKERGHEFLYDGVAVLYMLEQYCVLKQERELERQRQR  480

Query  1678  DQKKLQGQLMAEQEVLFGSKRSPSQSGKKNV---VGGASNKRISVGGAMLQTPYTER-AP  1845
             DQKKLQGQLM EQE LFGS  SPS+S KKN    +GG +NKR+S+GG+MLQ PY  + AP
Sbjct  481   DQKKLQGQLMVEQEALFGSIPSPSKSAKKNFRPSMGGLTNKRLSLGGSMLQIPYAGKPAP  540

Query  1846  LS--SHSLKKINPVKQQALANITQNYVALSSGRRESSMHAKQPSCNKSNLQ-----KTE-  2001
              S  S SLK+  P                 SGRR+S +    P  N+ NL      +TE 
Sbjct  541   SSRLSSSLKQQTP----------------QSGRRDSILA---PRKNQGNLYPPCTPRTEL  581

Query  2002  -PTQRKPLSPISSLS------------------------------FNTSSANIMDKISES  2088
               T++ PL+P  + S                               N S+ NI ++  +S
Sbjct  582   VQTRKAPLNPPRTKSAQIRKGPLNPPKNATTQTRKPLSPLSSLLSSNASTINIQNQTLKS  641

Query  2089  EELRE----------MPASLLT-----------------TPIKNVSGIGGNATPKtmpip  2187
               ++E           P  + T                 TP K  S + G+ TPKT+PIP
Sbjct  642   GVVQEALYLNRTPVMTPTKITTAEGRLKETVSFNKTPIITPTKIASAVEGSITPKTLPIP  701

Query  2188  mpstpasaassiamQMGMTPAPVA-----ATTPMVGH-----DGVEYSYEEMRAGFL  2328
                            M  TP+ V+     A TP   H     D +EYS+EE R G++
Sbjct  702   ---------------MPATPSSVSTAMQTAMTPSSRHVSACADNIEYSFEERRTGYV  743



>ref|XP_006339436.1| PREDICTED: 65-kDa microtubule-associated protein 3-like isoform 
X1 [Solanum tuberosum]
Length=755

 Score =   660 bits (1703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/750 (54%), Positives = 519/750 (69%), Gaps = 64/750 (9%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M N Q+++ L METTC SLLSE+Q+IW+E+GE +IERDKML +L+QECLEAYRRKV+QAS
Sbjct  1     MNNSQSEKPLHMETTCGSLLSEMQRIWDEMGELDIERDKMLFELQQECLEAYRRKVNQAS  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSRSLKTELQAIMPlleemkkrklerk  606
             R  AQL+Q +A+SEAE+A+ICAALGEQ    RQSSRSLK EL+AI P LEEMK+RK ERK
Sbjct  61    RCRAQLQQTIADSEAEIAKICAALGEQSSYARQSSRSLKEELEAIKPKLEEMKRRKGERK  120

Query  607   HQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQ  786
             +QF+ V++QI +  KEL    +E   M  +DE+DLS++RLE+M+++LL+LQKEKSDRLK 
Sbjct  121   NQFAAVVNQIQTFSKELCLHFQENAQMSVIDENDLSVKRLEEMQNYLLALQKEKSDRLKL  180

Query  787   VLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQ  966
             ++D+L ++NSLC+VLG+D+K TI E+ PTL DS  LK++S + I +LSA IH L E+K Q
Sbjct  181   LVDNLTTINSLCVVLGVDYKQTIAEVDPTLDDSRVLKNISKDMIFKLSAMIHRLEELKKQ  240

Query  967   RLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIE  1146
             RL  LQ+LATT++ELW+LMD P+EEQQ F + TR IAASE+E+ EPN LS D L+ AE E
Sbjct  241   RLLRLQDLATTLIELWSLMDTPLEEQQKFYDFTRHIAASENEINEPNVLSADSLQHAEAE  300

Query  1147  VSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAID--DSIEFTDETIESGAIDPSHLLEQ  1320
             VSRLQ MKS+KMKEVLL+KR+ LEE+CR+AHL I+  +S++F+ E IESGAIDPS+LLEQ
Sbjct  301   VSRLQAMKSTKMKEVLLRKRLELEEICRKAHLVIETQNSVDFSVEAIESGAIDPSYLLEQ  360

Query  1321  LEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEK  1500
             +E+QIS VKEE FSR+EILEK+EKWLAAC+EE WLE+YNR++NRY+GG+GTH  LKRAEK
Sbjct  361   IEVQISKVKEETFSRREILEKLEKWLAACDEECWLEEYNRDENRYHGGKGTHRNLKRAEK  420

Query  1501  ARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRD  1680
             AR L NKIP M+E L  RA  W+ ERG  FLYDGV++L MLEQY +LKQE+ELERQR RD
Sbjct  421   ARVLFNKIPAMVETLRLRASVWQKERGHEFLYDGVAILYMLEQYCVLKQERELERQRLRD  480

Query  1681  QKKLQGQLMAEQEVLFGSKRSPSQSGKKNV---VGGASNKRISVGGAMLQTPYTERA---  1842
             QKKLQGQLM EQE LFGS  SPS+S KKN    +GG +NKR+S+GG+MLQTPY  +A   
Sbjct  481   QKKLQGQLMVEQEALFGSIPSPSKSAKKNFRPSMGGLTNKRLSLGGSMLQTPYAGKAAPS  540

Query  1843  -----------PLSSHSLKKINPVKQQA--------LANITQNYVALSSGRRESSMHAKQ  1965
                        P S      + P K Q          A   Q   AL +  R  S   ++
Sbjct  541   SRLSSLLEQQTPQSGRRDSFLAPRKHQGSLYPPYTPRAESVQTRKALLNPPRTESAQIRK  600

Query  1966  PSCNKSNLQKTEPTQRKPLSPISSLSFNTSSANIMD-----------------------K  2076
                N      T+ T++      S LS N S+ NI +                       K
Sbjct  601   GPLNPPKPATTQ-TRKPLSPLSSLLSSNVSTINIQNQTLKSGMVQEALYLNKTPVMTPTK  659

Query  2077  ISESEELREMPASL----LTTPIKNVSGIGGNATPKtmpipmpstpasaassiamQMGMT  2244
             I+ +E   E   SL    + TP K  S + G+ TPK   +P+P     ++ S AMQ  MT
Sbjct  660   ITSAERRLEETVSLNKTPIMTPTKIASAVEGSITPK--TLPIPMPATPSSVSTAMQTAMT  717

Query  2245  PAP--VAATTPMVGHDGVEYSYEEMRAGFL  2328
             PA   V+A       D +EYS+EE RAG++
Sbjct  718   PASRHVSACA-----DNIEYSFEERRAGYV  742



>ref|XP_010277391.1| PREDICTED: 65-kDa microtubule-associated protein 3 [Nelumbo nucifera]
 ref|XP_010277392.1| PREDICTED: 65-kDa microtubule-associated protein 3 [Nelumbo nucifera]
Length=736

 Score =   657 bits (1694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/669 (59%), Positives = 502/669 (75%), Gaps = 34/669 (5%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M N Q DQ L+METTC SLL ELQ IWNE+GE + ERDKML +LEQECLE YRRKVDQA+
Sbjct  1     MSNLQTDQLLQMETTCGSLLYELQIIWNEVGESDAERDKMLLELEQECLEVYRRKVDQAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQ---SSRSLKTELQAIMPlleemkkrkl  597
             R  AQLRQA+A+SEAELA IC+A+GE+PV++RQ   S+ SLK EL+AI+P LEEM+KRK 
Sbjct  61    RCRAQLRQAIADSEAELATICSAMGERPVHIRQCDQSAVSLKEELKAIIPQLEEMQKRKC  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             +RK+QF EVL+ I  +  E+G+S      ++ +DE+DLSLR+LE++   L +LQKEKSDR
Sbjct  121   DRKNQFLEVLEHIQKISNEIGRSTDNPSKVV-VDETDLSLRKLEELHQQLHALQKEKSDR  179

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             LKQVLDHL +LNSLC+VLG+DFK TI E+HP+L DS   K++S +TIERL++AI  LR+V
Sbjct  180   LKQVLDHLNTLNSLCLVLGMDFKQTINEVHPSLDDSEGTKNISNDTIERLASAIQRLRKV  239

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             KI+R+  LQ+LATT++ELWNLMD P+EEQQ+F NVT  IAASE E+TE N LS++ +   
Sbjct  240   KIERMQKLQDLATTMLELWNLMDTPIEEQQIFQNVTCNIAASEHEITEQNTLSVEFINYV  299

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLA--IDDSIEFTDETIESGAIDPSHL  1311
             E EVSRL+++K+SKMKE++LKKR  LEE+CR+ HL    D ++E+  E IESGA+DP+ +
Sbjct  300   EEEVSRLEDLKASKMKELVLKKRSELEEICRRTHLVAEADGAMEYAIEAIESGAVDPASI  359

Query  1312  LEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKR  1491
             LEQ+E+QI+ VKEEAFSRKEILEKVEKWL ACEEESWLE+YNR+DNRYN GRG HL LKR
Sbjct  360   LEQIELQIARVKEEAFSRKEILEKVEKWLTACEEESWLEEYNRDDNRYNAGRGAHLTLKR  419

Query  1492  AEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQR  1671
             AEKARA+VNK+P M++AL S+   WE ERG+ F YDGV LLSMLE+Y +L+QEKE ER+R
Sbjct  420   AEKARAIVNKLPAMVDALVSKVTAWERERGIEFAYDGVRLLSMLEEYNILRQEKEQERKR  479

Query  1672  QRDQKKLQGQLMAEQEVLFGSKRSPS--QSGKKN---VVGGASNKRISVGGAMLQTPYTE  1836
             QRDQKKLQGQL+AEQE LFGSK SP   QSGKK      GGAS++R+S+GGAMLQTP   
Sbjct  480   QRDQKKLQGQLIAEQEALFGSKPSPMKLQSGKKGPRMSTGGASSRRLSLGGAMLQTP---  536

Query  1837  RAPLSSHSLK---KINPVKQQALANITQN--YVALSSGRRE---SSMHAKQPSCNKSNLQ  1992
               P  SHS K   ++ P K+  L +  Q+  + ALS+GRR    + +  K+ S N S ++
Sbjct  537   -KPDLSHSTKATPRLRPNKKSDLLSHNQDDSFAALSAGRRGLDVAGLPVKKHSFNASEIE  595

Query  1993  KTEPTQRKPLSPISS--LSFNTSSANI---MDKISESEELREMPA--SLLTTPIK--NVS  2145
                P +RKP SP+SS  LS   ++ N    ++K+      + +P+  + LTTP K   V+
Sbjct  596   S--PMKRKPFSPVSSAMLSKVNNTTNFLEDLNKVHGGTLQKTLPSNNTPLTTPSKLSTVT  653

Query  2146  GIGGNATPK  2172
                 N TPK
Sbjct  654   DDDENRTPK  662



>ref|XP_009761644.1| PREDICTED: 65-kDa microtubule-associated protein 3-like [Nicotiana 
sylvestris]
 ref|XP_009761645.1| PREDICTED: 65-kDa microtubule-associated protein 3-like [Nicotiana 
sylvestris]
Length=736

 Score =   654 bits (1687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/747 (52%), Positives = 516/747 (69%), Gaps = 78/747 (10%)
 Frame = +1

Query  259   QNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCA  438
             Q+D   +METTC SLL ELQ IW+E+GEP+ ERDK+L +LE+ECLE YRRKVDQA++S A
Sbjct  5     QSDTIQQMETTCGSLLYELQIIWDEVGEPDTERDKLLYELERECLEVYRRKVDQANKSRA  64

Query  439   QLRQAVAESEAELARICAALGEQPVNVRQSSRSL---KTELQAIMPlleemkkrklerkH  609
             QLRQA+A+SEAELA IC+A+GE+PV++RQS ++L   K EL+ I+P L+EM+KRK +RK+
Sbjct  65    QLRQAIADSEAELATICSAMGERPVHIRQSDQNLGGLKAELRTILPELDEMRKRKSDRKN  124

Query  610   QFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQV  789
             QF EV++QI  +  E+          + +DESDLSLR+LE++ + L +LQKEKS+RLKQV
Sbjct  125   QFIEVIEQIQKIRDEIFVPTG-CTTSVVVDESDLSLRKLEELHAELQALQKEKSERLKQV  183

Query  790   LDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQR  969
             LDHL +LNSLC+VLG+DFK+T+ E+HP+LG+S   K++S +TI+ L+AAI  LREVK+QR
Sbjct  184   LDHLSALNSLCLVLGMDFKHTVNEVHPSLGESEGTKNISNDTIQHLAAAIGRLREVKLQR  243

Query  970   LHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEV  1149
             +  LQ+LA++++ELWNLMD P+EEQQ F NVT  IAASE E+TEPN LS++ +   E EV
Sbjct  244   MQRLQDLASSMLELWNLMDTPIEEQQTFQNVTCKIAASEHEITEPNILSVEFINYVEGEV  303

Query  1150  SRLQEMKSSKMKEVLLKKRITLEELCRQAHLAI--DDSIEFTDETIESGAIDPSHLLEQL  1323
             SRL+E+K+SKMKE++LKKR  LEE CR+ HL    D++++   E IESGA+D + +LEQ+
Sbjct  304   SRLEELKASKMKELVLKKRSELEEFCRRTHLVADSDNAMDVAIEAIESGAVDAASILEQI  363

Query  1324  EIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKA  1503
             E+QI+ VKEEAFSRKEILEKVEKW+AACEEE WLE+YNR+DNRYN GRG HL LKRAEKA
Sbjct  364   ELQIAQVKEEAFSRKEILEKVEKWIAACEEECWLEEYNRDDNRYNAGRGAHLTLKRAEKA  423

Query  1504  RALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQ  1683
             RALVNK+P M++AL S+ K WE ERGV F+YDG+ LL+MLE+Y +L+QEKE ER+R+RDQ
Sbjct  424   RALVNKLPAMVDALASKTKAWENERGVEFMYDGIRLLAMLEEYNILRQEKEQERKRERDQ  483

Query  1684  KKLQGQLMAEQEVLFGSKRSP-----SQSGKKNVVGGASNKRISVGGAMLQTP-----YT  1833
             KKLQGQLMAE E ++GSK SP     ++ G++    GA+N+R+SVGG MLQTP     ++
Sbjct  484   KKLQGQLMAEHEAIYGSKPSPMKNQSAKKGRRMSCSGATNRRLSVGGTMLQTPKPELLHS  543

Query  1834  ERAPLSSHSLKKINPVKQQALAN--ITQNYVALSSGRRE---SSMHAKQPSCNKSNLQKT  1998
              +   ++H  KK +   Q+   N  I     ALS GR+    + + +K+ S N   ++KT
Sbjct  544   TKVTPNTHQAKKSDLFHQKDQFNHSINDGLTALSGGRKTLDLAGLPSKKQSINGCEIEKT  603

Query  1999  EPTQRKPLSPISSLSFNTSSANIM-----DKISESEELREMPASLL--TTPIKNVSGI-G  2154
                 RKP SPISS   + S+A  M      K +E      +P+S +  +TP+K +     
Sbjct  604   --MTRKPFSPISSTDSSKSNATNMLEDMNRKHNEMATKTTLPSSHIPFSTPVKTLYTTEE  661

Query  2155  GNATPKtmpipmpstpasaassiamQMGMTPAPVAAT-----TPM-----VGHDGV----  2292
              N TP                     + M P PV +T      PM       H+ V    
Sbjct  662   ENRTP---------------------IAMPPIPVPSTPSTMSAPMQTAITPAHNVVVPYN  700

Query  2293  ------------EYSYEEMRAGFLLPR  2337
                         EYS+EE RAGF+LPR
Sbjct  701   YSKPVEEIPEEIEYSFEERRAGFVLPR  727



>ref|XP_010325774.1| PREDICTED: 65-kDa microtubule-associated protein 3-like isoform 
X4 [Solanum lycopersicum]
Length=745

 Score =   654 bits (1686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/766 (53%), Positives = 515/766 (67%), Gaps = 117/766 (15%)
 Frame = +1

Query  280   METTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVA  459
             METTC SLLSE+Q+IW+E+GEP+IERDKML +L+QECLEAYRRKV+QASR  AQLRQ VA
Sbjct  1     METTCGSLLSEMQRIWDEMGEPDIERDKMLFELQQECLEAYRRKVNQASRCRAQLRQTVA  60

Query  460   ESEAELARICAALGEQPVNVRQS-SRSLKTELQAIMPlleemkkrklerkHQFSEVLDQI  636
             +SEAE+A+ICAALGEQ    RQ  SRSLK EL+AI P LEEMK+RK ER +QF+ V+DQI
Sbjct  61    DSEAEIAKICAALGEQSSYARQQISRSLKEELEAIKPKLEEMKRRKGERMNQFAAVVDQI  120

Query  637   DSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESLNS  816
              +  KEL    +E   M  +DE+DLS+RRLE+M+++LL+LQKEKSDRLK ++DHL ++NS
Sbjct  121   QTFSKELCLHFQENAQMSVIDENDLSVRRLEEMQNYLLALQKEKSDRLKLLVDHLTTINS  180

Query  817   LCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQRLHMLQNLAT  996
             LC+VLG+D+K TI E+ PTL DS  LK++S + I +LSA I+ L E+K QRL  LQ+LAT
Sbjct  181   LCVVLGVDYKQTISEVDPTLEDSRVLKNISKDMIFKLSAMINRLEELKKQRLLRLQDLAT  240

Query  997   TIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQEMKSS  1176
             T+++LW+LMD P+EEQQ F + TR IAASE+E+ EPN LS D L+ AE EVSRLQ MKS+
Sbjct  241   TLIQLWSLMDTPLEEQQKFYDFTRHIAASENEINEPNVLSADSLQHAEAEVSRLQAMKST  300

Query  1177  KMKEVLLKKRITLEELCRQAHLAID--DSIEFTDETIESGAIDPSHLLEQLEIQISNVKE  1350
             KMKEVLL+KR+ LEE+CR+AHL I+  +S++F+ E IESG IDPS+LLEQ+E+QI+ VKE
Sbjct  301   KMKEVLLRKRLELEEICRKAHLVIETQNSVDFSVEAIESGTIDPSYLLEQIEVQIAKVKE  360

Query  1351  EAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVNKIPG  1530
             E FSR+EILEK+EKWLAAC+EE WLE+YNR++NRY+GG+GTH  LKRAEKAR LVNKIP 
Sbjct  361   ETFSRREILEKLEKWLAACDEECWLEEYNRDENRYHGGKGTHRNLKRAEKARVLVNKIPA  420

Query  1531  MLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQGQLMA  1710
             M+E L  R   W+ ERG  FLYDGV++L MLEQY +LKQE+ELERQRQRDQKKLQGQLM 
Sbjct  421   MVETLRLRTSAWQKERGHEFLYDGVAVLYMLEQYCVLKQERELERQRQRDQKKLQGQLMV  480

Query  1711  EQEVLFGSKRSPSQSGKKNV---VGGASNKRISVGGAMLQTPYTER-APLS--SHSLKKI  1872
             EQE LFGS  SPS+S KKN    +GG +NKR+S+GG+MLQ PY  + AP S  S SLK+ 
Sbjct  481   EQEALFGSIPSPSKSAKKNFRPSMGGLTNKRLSLGGSMLQIPYAGKPAPSSRLSSSLKQQ  540

Query  1873  NPVKQQALANITQNYVALSSGRRESSMHAKQPSCNKSNLQ-----KTE--PTQRKPLSPI  2031
              P                 SGRR+S +    P  N+ NL      +TE   T++ PL+P 
Sbjct  541   TP----------------QSGRRDSILA---PRKNQGNLYPPCTPRTELVQTRKAPLNPP  581

Query  2032  SSLS------------------------------FNTSSANIMDKISESEELRE------  2103
              + S                               N S+ NI ++  +S  ++E      
Sbjct  582   RTKSAQIRKGPLNPPKNATTQTRKPLSPLSSLLSSNASTINIQNQTLKSGVVQEALYLNR  641

Query  2104  ----MPASLLT-----------------TPIKNVSGIGGNATPKtmpipmpstpasaass  2220
                  P  + T                 TP K  S + G+ TPKT+PIP           
Sbjct  642   TPVMTPTKITTAEGRLKETVSFNKTPIITPTKIASAVEGSITPKTLPIP-----------  690

Query  2221  iamQMGMTPAPVA-----ATTPMVGH-----DGVEYSYEEMRAGFL  2328
                 M  TP+ V+     A TP   H     D +EYS+EE R G++
Sbjct  691   ----MPATPSSVSTAMQTAMTPSSRHVSACADNIEYSFEERRTGYV  732



>ref|XP_006339437.1| PREDICTED: 65-kDa microtubule-associated protein 3-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006339438.1| PREDICTED: 65-kDa microtubule-associated protein 3-like isoform 
X3 [Solanum tuberosum]
Length=744

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/739 (54%), Positives = 512/739 (69%), Gaps = 64/739 (9%)
 Frame = +1

Query  280   METTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVA  459
             METTC SLLSE+Q+IW+E+GE +IERDKML +L+QECLEAYRRKV+QASR  AQL+Q +A
Sbjct  1     METTCGSLLSEMQRIWDEMGELDIERDKMLFELQQECLEAYRRKVNQASRCRAQLQQTIA  60

Query  460   ESEAELARICAALGEQPVNVRQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQID  639
             +SEAE+A+ICAALGEQ    RQSSRSLK EL+AI P LEEMK+RK ERK+QF+ V++QI 
Sbjct  61    DSEAEIAKICAALGEQSSYARQSSRSLKEELEAIKPKLEEMKRRKGERKNQFAAVVNQIQ  120

Query  640   SVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESLNSL  819
             +  KEL    +E   M  +DE+DLS++RLE+M+++LL+LQKEKSDRLK ++D+L ++NSL
Sbjct  121   TFSKELCLHFQENAQMSVIDENDLSVKRLEEMQNYLLALQKEKSDRLKLLVDNLTTINSL  180

Query  820   CIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQRLHMLQNLATT  999
             C+VLG+D+K TI E+ PTL DS  LK++S + I +LSA IH L E+K QRL  LQ+LATT
Sbjct  181   CVVLGVDYKQTIAEVDPTLDDSRVLKNISKDMIFKLSAMIHRLEELKKQRLLRLQDLATT  240

Query  1000  IVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQEMKSSK  1179
             ++ELW+LMD P+EEQQ F + TR IAASE+E+ EPN LS D L+ AE EVSRLQ MKS+K
Sbjct  241   LIELWSLMDTPLEEQQKFYDFTRHIAASENEINEPNVLSADSLQHAEAEVSRLQAMKSTK  300

Query  1180  MKEVLLKKRITLEELCRQAHLAID--DSIEFTDETIESGAIDPSHLLEQLEIQISNVKEE  1353
             MKEVLL+KR+ LEE+CR+AHL I+  +S++F+ E IESGAIDPS+LLEQ+E+QIS VKEE
Sbjct  301   MKEVLLRKRLELEEICRKAHLVIETQNSVDFSVEAIESGAIDPSYLLEQIEVQISKVKEE  360

Query  1354  AFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVNKIPGM  1533
              FSR+EILEK+EKWLAAC+EE WLE+YNR++NRY+GG+GTH  LKRAEKAR L NKIP M
Sbjct  361   TFSRREILEKLEKWLAACDEECWLEEYNRDENRYHGGKGTHRNLKRAEKARVLFNKIPAM  420

Query  1534  LEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQGQLMAE  1713
             +E L  RA  W+ ERG  FLYDGV++L MLEQY +LKQE+ELERQR RDQKKLQGQLM E
Sbjct  421   VETLRLRASVWQKERGHEFLYDGVAILYMLEQYCVLKQERELERQRLRDQKKLQGQLMVE  480

Query  1714  QEVLFGSKRSPSQSGKKNV---VGGASNKRISVGGAMLQTPYTERA--------------  1842
             QE LFGS  SPS+S KKN    +GG +NKR+S+GG+MLQTPY  +A              
Sbjct  481   QEALFGSIPSPSKSAKKNFRPSMGGLTNKRLSLGGSMLQTPYAGKAAPSSRLSSLLEQQT  540

Query  1843  PLSSHSLKKINPVKQQA--------LANITQNYVALSSGRRESSMHAKQPSCNKSNLQKT  1998
             P S      + P K Q          A   Q   AL +  R  S   ++   N      T
Sbjct  541   PQSGRRDSFLAPRKHQGSLYPPYTPRAESVQTRKALLNPPRTESAQIRKGPLNPPKPATT  600

Query  1999  EPTQRKPLSPISSLSFNTSSANIMD-----------------------KISESEELREMP  2109
             + T++      S LS N S+ NI +                       KI+ +E   E  
Sbjct  601   Q-TRKPLSPLSSLLSSNVSTINIQNQTLKSGMVQEALYLNKTPVMTPTKITSAERRLEET  659

Query  2110  ASL----LTTPIKNVSGIGGNATPKtmpipmpstpasaassiamQMGMTPAP--VAATTP  2271
              SL    + TP K  S + G+ TPK   +P+P     ++ S AMQ  MTPA   V+A   
Sbjct  660   VSLNKTPIMTPTKIASAVEGSITPK--TLPIPMPATPSSVSTAMQTAMTPASRHVSACA-  716

Query  2272  MVGHDGVEYSYEEMRAGFL  2328
                 D +EYS+EE RAG++
Sbjct  717   ----DNIEYSFEERRAGYV  731



>ref|XP_010325770.1| PREDICTED: 65-kDa microtubule-associated protein 3-like isoform 
X3 [Solanum lycopersicum]
Length=754

 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/777 (52%), Positives = 520/777 (67%), Gaps = 119/777 (15%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M N Q+++ L METTC SLLSE+Q+IW+E+GEP+IERDKML +L+QECLEAYRRKV+QAS
Sbjct  1     MNNSQSEKPLHMETTCGSLLSEMQRIWDEMGEPDIERDKMLFELQQECLEAYRRKVNQAS  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQS-SRSLKTELQAIMPlleemkkrkler  603
             R  AQLRQ VA+SEAE+A+ICAALGEQ    RQ  SRSLK EL+AI P LEEMK+RK ER
Sbjct  61    RCRAQLRQTVADSEAEIAKICAALGEQSSYARQQISRSLKEELEAIKPKLEEMKRRKGER  120

Query  604   kHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLK  783
              +QF+ V+DQI +  KEL    +E   M  +DE+DLS+RRLE+M+++LL+LQKEKSDRLK
Sbjct  121   MNQFAAVVDQIQTFSKELCLHFQENAQMSVIDENDLSVRRLEEMQNYLLALQKEKSDRLK  180

Query  784   QVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKI  963
              ++DHL ++NSLC+VLG+D+K TI E+ PTL DS  LK++S + I +LSA I+ L E+K 
Sbjct  181   LLVDHLTTINSLCVVLGVDYKQTISEVDPTLEDSRVLKNISKDMIFKLSAMINRLEELKK  240

Query  964   QRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEI  1143
             QRL  LQ+LATT+++LW+LMD P+EEQQ F + TR IAASE+E+ EPN LS D L+ AE 
Sbjct  241   QRLLRLQDLATTLIQLWSLMDTPLEEQQKFYDFTRHIAASENEINEPNVLSADSLQHAEA  300

Query  1144  EVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAID--DSIEFTDETIESGAIDPSHLLE  1317
             EVSRLQ MKS+KMKEVLL+KR+ LEE+CR+AHL I+  +S++F+ E IESG IDPS+LLE
Sbjct  301   EVSRLQAMKSTKMKEVLLRKRLELEEICRKAHLVIETQNSVDFSVEAIESGTIDPSYLLE  360

Query  1318  QLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAE  1497
             Q+E+QI+ VKEE FSR+EILEK+EKWLAAC+EE WLE+YNR++NRY+GG+GTH  LKRAE
Sbjct  361   QIEVQIAKVKEETFSRREILEKLEKWLAACDEECWLEEYNRDENRYHGGKGTHRNLKRAE  420

Query  1498  KARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQR  1677
             KAR LVNKIP M+E L  R   W+ ERG  FLYDGV++L MLEQY +LKQE+ELERQRQR
Sbjct  421   KARVLVNKIPAMVETLRLRTSAWQKERGHEFLYDGVAVLYMLEQYCVLKQERELERQRQR  480

Query  1678  DQKKLQGQLMAEQEVLFGSKRSPSQSGKKNV---VGGASNKRISVGGAMLQTPYTER-AP  1845
               KKLQGQLM EQE LFGS  SPS+S KKN    +GG +NKR+S+GG+MLQ PY  + AP
Sbjct  481   --KKLQGQLMVEQEALFGSIPSPSKSAKKNFRPSMGGLTNKRLSLGGSMLQIPYAGKPAP  538

Query  1846  LS--SHSLKKINPVKQQALANITQNYVALSSGRRESSMHAKQPSCNKSNLQ-----KTE-  2001
              S  S SLK+  P                 SGRR+S +    P  N+ NL      +TE 
Sbjct  539   SSRLSSSLKQQTP----------------QSGRRDSILA---PRKNQGNLYPPCTPRTEL  579

Query  2002  -PTQRKPLSPISSLS------------------------------FNTSSANIMDKISES  2088
               T++ PL+P  + S                               N S+ NI ++  +S
Sbjct  580   VQTRKAPLNPPRTKSAQIRKGPLNPPKNATTQTRKPLSPLSSLLSSNASTINIQNQTLKS  639

Query  2089  EELRE----------MPASLLT-----------------TPIKNVSGIGGNATPKtmpip  2187
               ++E           P  + T                 TP K  S + G+ TPKT+PIP
Sbjct  640   GVVQEALYLNRTPVMTPTKITTAEGRLKETVSFNKTPIITPTKIASAVEGSITPKTLPIP  699

Query  2188  mpstpasaassiamQMGMTPAPVA-----ATTPMVGH-----DGVEYSYEEMRAGFL  2328
                            M  TP+ V+     A TP   H     D +EYS+EE R G++
Sbjct  700   ---------------MPATPSSVSTAMQTAMTPSSRHVSACADNIEYSFEERRTGYV  741



>ref|XP_006490251.1| PREDICTED: 65-kDa microtubule-associated protein 3-like isoform 
X1 [Citrus sinensis]
 ref|XP_006490252.1| PREDICTED: 65-kDa microtubule-associated protein 3-like isoform 
X2 [Citrus sinensis]
Length=733

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/729 (55%), Positives = 517/729 (71%), Gaps = 40/729 (5%)
 Frame = +1

Query  259   QNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCA  438
              ND  L++ETTC SLL ELQ IW+E+GE + +RDKML +LEQECLE YRRKVDQA+R  A
Sbjct  4     HNDPLLQVETTCGSLLYELQIIWDEVGETDTDRDKMLLELEQECLEVYRRKVDQANRCRA  63

Query  439   QLRQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrklerkH  609
             QLRQA+A+SEAELA IC+A+GE+PV++RQS +   SLK EL  I+P +EEM+KRK +RK 
Sbjct  64    QLRQAIADSEAELAAICSAMGERPVHIRQSDQTAESLKEELGRILPQVEEMRKRKSDRKK  123

Query  610   QFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQV  789
             QF +VL+QI+ +  E+  S   +     +D++DLSLR+LE+    L  LQKEKS+RLKQV
Sbjct  124   QFVDVLEQIEMIKSEILGSTVYISSKTVVDDADLSLRKLEEFHRELHELQKEKSNRLKQV  183

Query  790   LDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQR  969
              DHL +L+SLC VLGIDFK+T+ +IHP+  ++    S+S + IERL+ AIH+LREVKIQR
Sbjct  184   QDHLNTLSSLCSVLGIDFKHTVSDIHPSFCENEGSMSISNDAIERLTIAIHKLREVKIQR  243

Query  970   LHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEV  1149
             +  LQ+LATT++ELWNLMD PVEEQQ F +VT  IAASE E+TEPN LS+D +   E EV
Sbjct  244   MQKLQDLATTMLELWNLMDTPVEEQQAFQSVTCNIAASEHEITEPNTLSVDFISYVETEV  303

Query  1150  SRLQEMKSSKMKEVLLKKRITLEELCRQAHLAI--DDSIEFTDETIESGAIDPSHLLEQL  1323
             SRL+E+K+SKMKE++LKKR+ LEE+CR  H+    D SIE+  E IESGA+DP+++LEQ+
Sbjct  304   SRLEELKTSKMKELVLKKRLELEEICRNTHMVPENDHSIEYAIEAIESGAMDPANVLEQI  363

Query  1324  EIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKA  1503
             E+QI+ VKEEAFSRKEILE+VEKWL ACEEE WLE+YNR+DNRYN G+G HL LKRAEKA
Sbjct  364   ELQIAKVKEEAFSRKEILERVEKWLGACEEECWLEEYNRDDNRYNAGKGAHLTLKRAEKA  423

Query  1504  RALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQ  1683
             R+LVNK+PGM+EAL S+   WE ERGV FLYDGV LLSMLE+Y +L+QEKE ER+RQRDQ
Sbjct  424   RSLVNKLPGMVEALASKTIAWEKERGVEFLYDGVRLLSMLEEYAILRQEKEQERRRQRDQ  483

Query  1684  KKLQGQLMAEQEVLFGSKRSPS--QSGKKN---VVGGASNKRISVGGAMLQTPYTE----  1836
             KKLQGQL+AEQE L+GSK SPS  QS KK      G  S++R+SVGGAMLQTP  E    
Sbjct  484   KKLQGQLIAEQEALYGSKPSPSKTQSVKKAPRVSTGSVSHRRLSVGGAMLQTPKPELPSS  543

Query  1837  -RAPLSSHSLKKINPVKQQALANITQN--YVALSSGRRESSMHAKQPSCNKSNLQKTEPT  2007
              +A     ++KKI+ + Q    N+  +  + ALS+GRR   + A  P   K +L   EP 
Sbjct  544   TKATPHPRTVKKIDRILQNDHTNVRMDDGFAALSAGRRGLDI-AGFP-IKKHSLGACEPQ  601

Query  2008  Q---RKPLSPISSLSFNTSSANIMDKISESEELREM-------PASLLTTPIKNVSGIG-  2154
                 RKP SPISS +  +S +NI++ + +     E        P    TTP K  + +  
Sbjct  602   SPMIRKPFSPISSTA--SSKSNIINLLEDLNSHGETTMQKAVPPIESFTTPSKTNTLVDE  659

Query  2155  GNATPKtmpipmpstpasaassiamQMGMTPAPVAATTPMV------GHDGVEYSYEEMR  2316
              N TPK   +P+P     +  S+ MQ  +TPA  +A  P          + +EYS+EE R
Sbjct  660   ENRTPK--AMPIPVPSTPSTVSVPMQTAITPAHASAPIPYGTTQVEETAEEIEYSFEERR  717

Query  2317  AGFLLPRLH  2343
             AGF+LP+ H
Sbjct  718   AGFVLPKTH  726



>ref|XP_009594260.1| PREDICTED: 65-kDa microtubule-associated protein 3-like [Nicotiana 
tomentosiformis]
 ref|XP_009594261.1| PREDICTED: 65-kDa microtubule-associated protein 3-like [Nicotiana 
tomentosiformis]
Length=737

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/731 (52%), Positives = 517/731 (71%), Gaps = 46/731 (6%)
 Frame = +1

Query  259   QNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCA  438
             Q+D   +METTC SLL ELQ IW+E+GE + ERDK+L +LE+ECLE YRRKVDQA++S A
Sbjct  5     QSDTIQQMETTCGSLLYELQIIWDEVGESDTERDKLLYELERECLEVYRRKVDQANKSRA  64

Query  439   QLRQAVAESEAELARICAALGEQPVNVRQSSRSL---KTELQAIMPlleemkkrklerkH  609
             QLRQA+A+SEAELA IC+A+GE+PV++RQS ++L   K EL+ I+P L+EM+KRK +RK+
Sbjct  65    QLRQAIADSEAELAAICSAVGERPVHIRQSDQNLGGLKAELRTILPELDEMRKRKSDRKN  124

Query  610   QFSEVLDQI----DSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             QF EV++QI    D +    G +       + +DESDLSLR+LE++ + L +LQKEKS+R
Sbjct  125   QFIEVIEQIQKMRDEIFMPTGCTTS-----VVVDESDLSLRKLEELHAELQALQKEKSER  179

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             LKQVLDHL +LNSLC+VLG+DFK+T+ E+HP+LG+S   K++S +TI+ L+AAI  LREV
Sbjct  180   LKQVLDHLSALNSLCLVLGMDFKHTVNEVHPSLGESEGTKNISNDTIQHLAAAIGRLREV  239

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             K+QR+  LQ+LA++++ELWNLMD P+EEQQ F NVT  IAASE E+TEPN LS++ +   
Sbjct  240   KLQRMQRLQDLASSMLELWNLMDTPIEEQQTFQNVTCKIAASEHEITEPNILSVEFINYV  299

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAI--DDSIEFTDETIESGAIDPSHL  1311
             E EVSRL+E+K+SKMKE++LKKR  LEE CR+ HL    D++++   E IESG +D + +
Sbjct  300   EGEVSRLEELKASKMKELVLKKRSELEEFCRRTHLVADSDNAMDVAIEAIESGVVDAASI  359

Query  1312  LEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKR  1491
             LEQ+E+QI+ VKEEAFSRKEILEK+EKW+AACEEE WLE+YNR+DNRYN GRG HL LKR
Sbjct  360   LEQIELQIAQVKEEAFSRKEILEKMEKWIAACEEECWLEEYNRDDNRYNAGRGAHLTLKR  419

Query  1492  AEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQR  1671
             AEKARALVNK+P M++AL S+ K WE ERGV F YDG+ LL+MLE+Y +L+QEKE ER+R
Sbjct  420   AEKARALVNKLPAMVDALASKTKAWENERGVEFTYDGIRLLAMLEEYNILRQEKEQERKR  479

Query  1672  QRDQKKLQGQLMAEQEVLFGSKRSP-----SQSGKKNVVGGASNKRISVGGAMLQTP---  1827
             +RDQKKLQGQLMAE E ++GSK SP     ++ G++    GA+N+R+SVGG MLQTP   
Sbjct  480   ERDQKKLQGQLMAEHEAIYGSKPSPMKNQSAKKGRRMSCSGATNRRLSVGGTMLQTPKPE  539

Query  1828  --YTERAPLSSHSLKKINPVKQQALANITQN--YVALSSGRRE---SSMHAKQPSCNKSN  1986
               ++ +A  ++H  KK +   Q+   N + N    ALS GR+    + + +K+ S N   
Sbjct  540   LLHSTKATPNTHQAKKSDLFHQKDQFNHSTNDGLTALSGGRKTLDLAGLPSKKQSINGCE  599

Query  1987  LQKTEPTQRKPLSPISSL-SFNTSSANIMDKISESEELREMPASL------LTTPIKNVS  2145
             ++KT    RKP SPISS  S  +++ NI++ ++          +L       +TP+K + 
Sbjct  600   IEKT--MTRKPFSPISSTDSCKSNATNILEDMNRKHNDMATKTTLPGSHIPFSTPVKTLY  657

Query  2146  GI-GGNATPKtmpipmpstpasaassiamQMGMTPAPVAAT------TPMVGHDGVEYSY  2304
                  N TP     P+P     +  S  MQ  +TPA   A             + +EYS+
Sbjct  658   TTEEENRTP-IAMPPIPVPSTPSTVSAPMQTAITPAHNVAVPYNYSKPVEEIPEEIEYSF  716

Query  2305  EEMRAGFLLPR  2337
             EE RAGF+LPR
Sbjct  717   EERRAGFVLPR  727



>emb|CDP05295.1| unnamed protein product [Coffea canephora]
Length=731

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/724 (55%), Positives = 522/724 (72%), Gaps = 43/724 (6%)
 Frame = +1

Query  265   DQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQL  444
             D  +++ETTC +LL ELQ IW+E+GE + ERDKML +LE+ECLE YRRKVDQA++  AQL
Sbjct  7     DPLMQLETTCGTLLYELQIIWDEVGESDTERDKMLLELERECLEVYRRKVDQANKCRAQL  66

Query  445   RQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrklerkHQF  615
             RQA+A+SEAELA IC+A+GE+PV++RQS +   SLK EL+AI+P L+EM+KRK ERK+QF
Sbjct  67    RQAIADSEAELAAICSAMGERPVHIRQSDQNPGSLKAELRAIVPQLDEMRKRKCERKNQF  126

Query  616   SEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLD  795
              E+L+QI  +  E+ +S         LDE+DLSLR+LE++++ L +LQ EKS+RLK+VLD
Sbjct  127   LEILEQIQKIKCEIYRSTGYPPANTVLDETDLSLRKLEELQTELQALQMEKSERLKKVLD  186

Query  796   HLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQRLH  975
              L +LNSLC+VLG+DFK T+GE+HP+LG+S   K++S +TIE+L+AAI  LRE+KIQR+ 
Sbjct  187   RLNTLNSLCVVLGMDFKETVGEVHPSLGESEGTKNISNDTIEQLAAAIQRLREIKIQRMQ  246

Query  976   MLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSR  1155
              LQ+LAT+++ELWNLMD PVEEQQ+F +VT  IAASE E TEPN LS+D +K  E EVSR
Sbjct  247   RLQDLATSLLELWNLMDTPVEEQQIFQSVTANIAASEDETTEPNMLSVDFIKYVEAEVSR  306

Query  1156  LQEMKSSKMKEVLLKKRITLEELCRQAHLA--IDDSIEFTDETIESGAIDPSHLLEQLEI  1329
             L+E+K+SKMKE++LKKR  LE++CR+ H+    D S++   E IE GA+D S +LEQ+E+
Sbjct  307   LEELKASKMKELVLKKRFELEDICRKTHIIPESDSSLDVAIEAIELGAVDASSVLEQIEL  366

Query  1330  QISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARA  1509
             QISN+KEEAF RKEILEKVEKW+AACEEE WLE+YNR+DNRYN GRG HL LKRAEKARA
Sbjct  367   QISNIKEEAFCRKEILEKVEKWMAACEEECWLEEYNRDDNRYNAGRGAHLTLKRAEKARA  426

Query  1510  LVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKK  1689
             LVNK+P M+EAL S+   WE ERG  F YDG+ LLSMLE+Y +L+QEKELER+RQRDQKK
Sbjct  427   LVNKLPAMVEALASKITAWENERGTEFSYDGIRLLSMLEEYTILRQEKELERKRQRDQKK  486

Query  1690  LQGQLMAEQEVLFGSKRSP--SQSGKK----NVVGGASNKRISVGGAMLQTPYTE-----  1836
             LQGQL+ EQE L+GSK SP   QSGKK    +  GGASN+R+S+GG  LQTP  +     
Sbjct  487   LQGQLITEQEALYGSKPSPMKCQSGKKGSRLSCGGGASNRRLSLGGTTLQTPKADLLHPT  546

Query  1837  RAPLSSHSLKKINPVKQQALANITQN--YVALSSGRRE---SSMHAKQPSCNKSNLQKTE  2001
             RA  ++   KKI  + Q   +N+ ++    +LS+GRR    + +  K+ S  +S      
Sbjct  547   RATPNTRQAKKIERLHQNDHSNLLKDDGIASLSAGRRGLDIAGLPVKKSSFGES------  600

Query  2002  PTQRKPLSPISSLSFNTSSA-NIMDKISES------EELREMPASLLTTPIKNVSGI-GG  2157
             P  RKP SPISS   + S+A NI++ +S        + L    AS  TTP K +S +   
Sbjct  601   PMVRKPFSPISSTDSSKSNATNILEDLSRKHNDMLQKTLSSNNAS-FTTPSKIISAVEEE  659

Query  2158  NATPKtmpipmpstpasaassiamQMGMTPAPVAA----TTPMVG-HDGVEYSYEEMRAG  2322
             N TPK     +P     A  S+ MQ  +TPA  AA    + P+    + +EYS+EE RAG
Sbjct  660   NRTPK--AKTIPVPATPATVSVPMQTAVTPALFAAPPCNSKPVDDIPEEIEYSFEERRAG  717

Query  2323  FLLP  2334
             F+LP
Sbjct  718   FVLP  721



>ref|XP_006421755.1| hypothetical protein CICLE_v10004422mg [Citrus clementina]
 gb|ESR34995.1| hypothetical protein CICLE_v10004422mg [Citrus clementina]
Length=732

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/728 (55%), Positives = 517/728 (71%), Gaps = 39/728 (5%)
 Frame = +1

Query  259   QNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCA  438
              ND  L++ETTC SLL ELQ IW+E+GE + +RDKML +LEQECLE YRRKVDQA+R  A
Sbjct  4     HNDPLLQVETTCGSLLYELQIIWDEVGETDTDRDKMLLELEQECLEVYRRKVDQANRCRA  63

Query  439   QLRQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrklerkH  609
             QLRQA+A+SEA+LA IC+A+GE+PV++RQS +   SLK EL+ I+P +EEM+KRK +RK 
Sbjct  64    QLRQAIADSEADLAAICSAMGERPVHIRQSDQTAESLKEELRRILPQVEEMRKRKSDRKK  123

Query  610   QFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQV  789
             QF +VL+QI+ +  E+  S   +     +D++DLSLR+LE+    L  LQKEKS+RLKQV
Sbjct  124   QFVDVLEQIEMIKSEILGSTVYISSKTVVDDADLSLRKLEEFHRELHELQKEKSNRLKQV  183

Query  790   LDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQR  969
              DHL +L+SLC VLGIDFK+T+ +IHP+  ++    S+S + IERL+ AIH+LREVKIQR
Sbjct  184   QDHLNTLSSLCSVLGIDFKHTVSDIHPSFCENEGSMSISNDAIERLTIAIHKLREVKIQR  243

Query  970   LHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEV  1149
             +  LQ+LATT++ELWNLMD PVEEQQ F +VT  IAASE E+TEPN LS+D +   E EV
Sbjct  244   MQKLQDLATTMLELWNLMDTPVEEQQAFQSVTCNIAASEHEITEPNTLSVDFISYVETEV  303

Query  1150  SRLQEMKSSKMKEVLLKKRITLEELCRQAHLAI--DDSIEFTDETIESGAIDPSHLLEQL  1323
             SRL+E+K+SKMKE++LKKR+ LEE+CR  H+    D SIE+  E IESGA+D +++LEQ+
Sbjct  304   SRLEELKTSKMKELVLKKRLELEEICRNTHMVPENDHSIEYAIEAIESGAMDAANVLEQI  363

Query  1324  EIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKA  1503
             E+QI+ VKEEAFSRKEILE+VEKWL ACEEE WLE+YNR+DNRYN G+G HL LKRAEKA
Sbjct  364   ELQIAKVKEEAFSRKEILERVEKWLGACEEECWLEEYNRDDNRYNAGKGAHLTLKRAEKA  423

Query  1504  RALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQ  1683
             R+LVNK+PGM+EAL S+   WE ERGV FLYDGV LLSMLE+Y +L+QEKE ER+RQRDQ
Sbjct  424   RSLVNKLPGMVEALASKTIAWEKERGVEFLYDGVRLLSMLEEYTILRQEKEQERRRQRDQ  483

Query  1684  KKLQGQLMAEQEVLFGSKRSPS--QSGKKN---VVGGASNKRISVGGAMLQTPY----TE  1836
             KKLQGQL+AEQE L+GSK SPS  QS KK      G  S++R+SVGGAMLQTP     T 
Sbjct  484   KKLQGQLIAEQEALYGSKPSPSKTQSVKKAPRVSTGSVSHRRLSVGGAMLQTPKPELPTT  543

Query  1837  RAPLSSHSLKKINPVKQQALANITQN--YVALSSGRRESSMHAKQPSCNKSNLQKTEPTQ  2010
             +A     ++KKI+ + Q    NI  +  + ALS+GRR   + A  P   K +L   EP  
Sbjct  544   KATPHPRTVKKIDRILQNDHTNIRMDDGFAALSAGRRGLDI-AGFP-IKKHSLGACEPQS  601

Query  2011  ---RKPLSPISSLSFNTSSANIMDKISESEELREM-------PASLLTTPIKNVSGIG-G  2157
                RKP SPISS +  +S +NI++ + +     E        P    TTP K  + +   
Sbjct  602   PMIRKPFSPISSTA--SSKSNIINWLEDLNSHGETTMQKAAPPIESFTTPSKTNTLVDEE  659

Query  2158  NATPKtmpipmpstpasaassiamQMGMTPAPVAATTPMV------GHDGVEYSYEEMRA  2319
             N TPK   +P+P     +  S+ MQ  +TPA  +A  P          + +EYS+EE RA
Sbjct  660   NRTPK--AMPIPVPSTPSTVSVPMQTAITPAHASAPIPYGTTQVEETAEEIEYSFEERRA  717

Query  2320  GFLLPRLH  2343
             GF+LP+ H
Sbjct  718   GFVLPKTH  725



>gb|KDO65387.1| hypothetical protein CISIN_1g004728mg [Citrus sinensis]
Length=733

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/729 (55%), Positives = 517/729 (71%), Gaps = 40/729 (5%)
 Frame = +1

Query  259   QNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCA  438
              ND  L++ETTC SLL ELQ IW+E+GE + +RDKML +LEQECLE YRRKVDQA+R  A
Sbjct  4     HNDPLLQVETTCGSLLYELQIIWDEVGETDTDRDKMLLELEQECLEVYRRKVDQANRCRA  63

Query  439   QLRQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrklerkH  609
             QLRQA+A+SEA+LA IC+A+GE+PV++RQS +   SLK EL+ I+P +EEM+KRK +RK 
Sbjct  64    QLRQAIADSEADLAAICSAMGERPVHIRQSDQTAESLKEELRRILPQVEEMRKRKSDRKK  123

Query  610   QFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQV  789
             QF +VL+QI+ +  E+  S   +     +D++DLSLR+LE+    L  LQKEKS+RLKQV
Sbjct  124   QFVDVLEQIEMIKSEILGSTVYISSKTVVDDADLSLRKLEEFHRELHELQKEKSNRLKQV  183

Query  790   LDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQR  969
              DHL +L+SLC VLGIDFK+T+ +IHP+  ++    S+S + IERL+ AIH+LREVKIQR
Sbjct  184   QDHLNTLSSLCSVLGIDFKHTVSDIHPSFCENEGSMSISNDAIERLTIAIHKLREVKIQR  243

Query  970   LHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEV  1149
             +  LQ+LATT++ELWNLMD PVEEQQ F +VT  IAASE E+TEPN LS+D +   E EV
Sbjct  244   MQKLQDLATTMLELWNLMDTPVEEQQAFQSVTCNIAASEHEITEPNTLSVDFISYVETEV  303

Query  1150  SRLQEMKSSKMKEVLLKKRITLEELCRQAHLAI--DDSIEFTDETIESGAIDPSHLLEQL  1323
             SRL+E+K+SKMKE++LKKR+ LEE+CR  H+    D SIE+  E IESGA+D +++LEQ+
Sbjct  304   SRLEELKTSKMKELVLKKRLELEEICRNTHMVPENDHSIEYAIEAIESGAMDTANVLEQI  363

Query  1324  EIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKA  1503
             E+QI+ VKEEAFSRKEILE+VEKWL ACEEE WLE+YNR+DNRYN G+G HL LKRAEKA
Sbjct  364   ELQIAKVKEEAFSRKEILERVEKWLGACEEECWLEEYNRDDNRYNAGKGAHLTLKRAEKA  423

Query  1504  RALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQ  1683
             R+LVNK+PGM+EAL S+   WE ERGV FLYDGV LLSMLE+Y +L+QEKE ER+RQRDQ
Sbjct  424   RSLVNKLPGMVEALASKTIAWEKERGVEFLYDGVRLLSMLEEYTILRQEKEQERRRQRDQ  483

Query  1684  KKLQGQLMAEQEVLFGSKRSPS--QSGKKN---VVGGASNKRISVGGAMLQTPYTE----  1836
             KKLQGQL+AEQE L+GSK SPS  QS KK      G  S++R+SVGGAMLQTP  E    
Sbjct  484   KKLQGQLIAEQEALYGSKPSPSKTQSVKKAPRVSTGSVSHRRLSVGGAMLQTPKPELPSS  543

Query  1837  -RAPLSSHSLKKINPVKQQALANITQN--YVALSSGRRESSMHAKQPSCNKSNLQKTEPT  2007
              +A     ++KKI+ + Q    N+  +  + ALS+GRR   + A  P   K +L   EP 
Sbjct  544   TKATPHPRTVKKIDRILQNDHTNVRMDDGFAALSAGRRGLDI-AGFP-IKKHSLGACEPQ  601

Query  2008  Q---RKPLSPISSLSFNTSSANIMDKISESEELREM-------PASLLTTPIKNVSGIG-  2154
                 RKP SPISS +  +S +NI++ + +     E        P    TTP K  + +  
Sbjct  602   SPMIRKPFSPISSTA--SSKSNIINLLEDLNSHGETTMQKAVPPIESFTTPSKTNTLVDE  659

Query  2155  GNATPKtmpipmpstpasaassiamQMGMTPAPVAATTPMV------GHDGVEYSYEEMR  2316
              N TPK   +P+P     +  S+ MQ  +TPA  +A  P          + +EYS+EE R
Sbjct  660   ENRTPK--AMPIPVPSTPSTVSVPMQTAITPAHASAPIPYGTTQVEETAEEIEYSFEERR  717

Query  2317  AGFLLPRLH  2343
             AGF+LP+ H
Sbjct  718   AGFVLPKTH  726



>ref|XP_011076282.1| PREDICTED: 65-kDa microtubule-associated protein 3 [Sesamum indicum]
 ref|XP_011076283.1| PREDICTED: 65-kDa microtubule-associated protein 3 [Sesamum indicum]
Length=735

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/729 (53%), Positives = 511/729 (70%), Gaps = 44/729 (6%)
 Frame = +1

Query  277   RMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAV  456
             +METTC SLL ELQ IW+E+GE + ERD+ML +LEQEC+E YRRKVDQA++  AQLRQA+
Sbjct  4     QMETTCGSLLHELQIIWDEVGESDAERDRMLLELEQECMEVYRRKVDQANKCRAQLRQAI  63

Query  457   AESEAELARICAALGEQPVNVRQSSRS---LKTELQAIMPlleemkkrklerkHQFSEVL  627
             A++EAELA IC+A+GE+PV++RQS +S   LK EL+AI+P +EEM+KRK +RK+QF EVL
Sbjct  64    ADAEAELAAICSAMGERPVHIRQSDQSTGSLKAELRAILPEIEEMRKRKSDRKNQFIEVL  123

Query  628   DQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLES  807
             ++I  +  E+  S   + + IA+DE+DLSLR+L+++   L +LQKEKS+RLKQVL+HL  
Sbjct  124   EEIQRIKNEIYWSGGYVSNNIAVDETDLSLRKLDELHRELQALQKEKSERLKQVLEHLNY  183

Query  808   LNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQRLHMLQN  987
             L S C VLG+DFK T+  IHP+LG+S   KS+S +TIE+L  AI +LREVK+QR+  LQ+
Sbjct  184   LYSCCSVLGLDFKQTVCGIHPSLGESDGSKSISNDTIEQLGIAIQKLREVKVQRMQQLQD  243

Query  988   LATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQEM  1167
             LAT+++ELWNLMD P+EEQQ F  VT  IAASE E+TEP  LS D +   + EVSRL+E+
Sbjct  244   LATSLLELWNLMDTPIEEQQTFQKVTCNIAASEEEITEPGMLSADFINYVKAEVSRLEEL  303

Query  1168  KSSKMKEVLLKKRITLEELCRQAHLA--IDDSIEFTDETIESGAIDPSHLLEQLEIQISN  1341
             K+SKMKE++LKK+  LE++CR+ HL    D +I+   + +ESGA+D S +LEQ+E+QIS 
Sbjct  304   KASKMKELVLKKKAELEDICRKTHLIPESDSAIDLAVDAVESGAVDASFVLEQIELQISR  363

Query  1342  VKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVNK  1521
             VKEEA SRKEILEKVEKW+ AC+EESWLE+YNR+DNRYN GRG HL LKRAEKARALVNK
Sbjct  364   VKEEALSRKEILEKVEKWMTACQEESWLEEYNRDDNRYNAGRGAHLTLKRAEKARALVNK  423

Query  1522  IPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQGQ  1701
             +P M++ LTS+   WE E+GV F YDGV LLSMLE Y +L+QEKELER+RQRDQKKLQ Q
Sbjct  424   LPAMVDTLTSKTTTWEKEKGVDFTYDGVRLLSMLEDYLVLRQEKELERKRQRDQKKLQEQ  483

Query  1702  LMAEQEVLFGSKRSP--SQSGKK----NVVGGASNKRISVGGAMLQTPYTERAPLS----  1851
             L+ EQE L+GSK SP  +QS KK    +  GG +N+R+S+GG MLQTP  +  PL+    
Sbjct  484   LLTEQEALYGSKPSPMKNQSAKKGRRLSCGGGPNNRRLSLGGPMLQTPKADMPPLAKATP  543

Query  1852  -SHSLKKINPVKQQALANITQNYVALSSGRRE---SSMHAKQPSCNKSNLQKTE-PTQRK  2016
              + + KK   + Q  L +    + ALSSGRR    + +   Q S N  N ++ E P  RK
Sbjct  544   NTRNAKKTERINQDCLRD--DGFAALSSGRRGLDLAGLPINQHSLNLQNAREIESPIIRK  601

Query  2017  PLSPISSLSFNTSSA-NIMDKISESEELREMPASL------LTTPIKNVSGIGGNATPKt  2175
             P SPISS   + SSA NI++ ++       +P ++       +TP K ++ +  N TP+ 
Sbjct  602   PFSPISSTDSSKSSATNILEALNRKHN-DMLPKAITSDSTPFSTPSKTMADV-ENRTPQA  659

Query  2176  mp-------ipmpstpasaassiamQMGMTPAPV------AATTPMVGHDGVEYSYEEMR  2316
             M          +      A +    QM +TPAP+      A T      + +EYS+EE R
Sbjct  660   MAIPVPSTPSTVSIPMQMAITPAPAQMSITPAPIQKALLPAHTALKSVDEEIEYSFEEKR  719

Query  2317  AGFLLPRLH  2343
             AGF+LPR H
Sbjct  720   AGFVLPRSH  728



>gb|KDP31478.1| hypothetical protein JCGZ_15429 [Jatropha curcas]
Length=725

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/724 (55%), Positives = 524/724 (72%), Gaps = 36/724 (5%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M   QND  L++ET C SLL ELQ IWNE+GE + ERDKML +LEQECLE YRRKVDQA+
Sbjct  1     MSKLQNDPLLQLETICGSLLYELQIIWNEVGESDAERDKMLLELEQECLEVYRRKVDQAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrkl  597
             R+ AQLRQA+A+SEAELA IC+A+GE+PV++RQ+ +   SLK EL+ I+P LEEM+KR+L
Sbjct  61    RNRAQLRQAIADSEAELAAICSAMGERPVHIRQADQNAGSLKEELRLILPQLEEMRKREL  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             +R++QF EVL  I  +  E+  S       +A+DE+DLSLR+LE++   L +LQ EKSDR
Sbjct  121   DRRNQFLEVLADIQKISNEIYGSADH----VAVDETDLSLRKLEELHRQLHALQTEKSDR  176

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             LKQ+ +HL++LNSLC+VLG+D+K TI EIHP+ GDS   + +S ++I++L+ AIH+LRE+
Sbjct  177   LKQIQEHLDTLNSLCLVLGMDYKLTISEIHPSFGDSEGSRLISNDSIQKLATAIHKLREI  236

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             KIQR+  LQ+LATT++ELWNLMD P+EEQQ+F NVT  IAASE E+TEPN LS D +   
Sbjct  237   KIQRMQKLQDLATTMLELWNLMDTPIEEQQMFQNVTCNIAASEQEITEPNTLSDDFINYV  296

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLA--IDDSIEFTDETIESGAIDPSHL  1311
             E EVSRL+E+KSSKMK+++LKKR  LE++CR+ H+    D +I++  E IESG +DP+++
Sbjct  297   EAEVSRLEELKSSKMKDLVLKKRSELEDICRKTHMIPEADTAIDYAIEAIESGNVDPANV  356

Query  1312  LEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKR  1491
             LEQ+E+QI+N+KEEAFSRKEILEKVEKWLAACEEE WLE+YNR++NRYN GRGTHL LKR
Sbjct  357   LEQIELQIANIKEEAFSRKEILEKVEKWLAACEEECWLEEYNRDENRYNAGRGTHLTLKR  416

Query  1492  AEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQR  1671
             AEKARALVNK+PGM+EAL S+   WE ERG+ FLYDG+ LLSMLE+Y +L+QEKE ER+R
Sbjct  417   AEKARALVNKLPGMVEALASKTMAWENERGIDFLYDGIGLLSMLEEYTILRQEKEEERRR  476

Query  1672  QRDQKKLQGQLMAEQEVLFGSKRSPSQS-----GKKNVVGGASNKRISVGGAMLQTPYTE  1836
             QRDQKKLQGQL+AEQEVL+GSK SPS++       +   G AS+KR+S+GG MLQTP  +
Sbjct  477   QRDQKKLQGQLIAEQEVLYGSKPSPSKAQNLKKASRVSTGSASSKRLSLGGTMLQTPKPD  536

Query  1837  -----RAPLSSHSLKKINPVKQQALANITQN--YVALSSGRRE---SSMHAKQPSCNKSN  1986
                  +A  ++   KK++ +      N  Q+  + ALS+GRR    +   AK+ S +  N
Sbjct  537   LTNSCKAKQNTRPGKKVDRMHHPDNVNHHQDDGFAALSAGRRGLDIAGRPAKKHSFSSVN  596

Query  1987  LQKTE-PTQRKPLSPISSLSFNTSSANIMDKISESEEL--REMPA-SLLTTPIKNVSGIG  2154
              Q+ E P  RKP SPISS    +S ANI+D  + + E   + +P  +   TP K      
Sbjct  597   AQEAESPMLRKPFSPISSTG--SSKANILDVTTANTETSKKTLPTNNSFNTPSKTCLADE  654

Query  2155  GNATPKtmpipmpstpasaassiamQMGMTPAPVAATTPMVGHDGV----EYSYEEMRAG  2322
              N TPK   +P+P     +  S+ MQ  +TPA VA        D V    EYS+EE RAG
Sbjct  655   ENMTPK--AMPIPVPSTPSTLSVPMQTAVTPASVALLCGANPADEVVEVIEYSFEERRAG  712

Query  2323  FLLP  2334
             F+LP
Sbjct  713   FVLP  716



>ref|XP_004495425.1| PREDICTED: 65-kDa microtubule-associated protein 3-like [Cicer 
arietinum]
Length=726

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/733 (52%), Positives = 510/733 (70%), Gaps = 46/733 (6%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M + QND   + ETTC SLL ELQ IW+E+GE E +RD+ML +LEQECL  YRRKVDQA+
Sbjct  1     MSSPQNDPLSQAETTCGSLLYELQIIWDEVGEAEPDRDRMLLELEQECLAVYRRKVDQAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrkl  597
             RS AQLRQA+A+ EAELA IC+A+GE PV++RQ  +   SLK E   I+P LEEMK +K 
Sbjct  61    RSRAQLRQAIADCEAELAAICSAMGELPVHIRQCDQNAGSLKEEHARILPQLEEMKNKKF  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             ER++QF EV +QI S+  E+   ++ +  ++  DE+DLS+R+LE++   L +LQ EKSDR
Sbjct  121   ERRNQFIEVQEQIQSISIEIYGPKEYIPAVV--DETDLSMRKLEELHRQLNALQNEKSDR  178

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             LK++ +HL +LNSLC+VLG+DFK  +  IHP+LGD    KSVS  TI++L+ AI +LREV
Sbjct  179   LKKIQEHLYTLNSLCLVLGLDFKQIVLGIHPSLGDLEGPKSVSNNTIQQLAVAIQDLREV  238

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             K+QR+  LQ+LATT++ELWNLMD P+EEQQ+F NVT  IAASE E+TEPN LS+D +   
Sbjct  239   KLQRMQKLQDLATTMLELWNLMDTPIEEQQMFQNVTCNIAASEHEITEPNTLSVDFMNCV  298

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLA--IDDSIEFTDETIESGAIDPSHL  1311
             E+EVSRL+E+KSSKMKE++LKKR  LEE+CR+ HL   ID ++E+  E IESG +DP+ +
Sbjct  299   EVEVSRLEELKSSKMKELVLKKRTELEEICRKTHLVPEIDGAVEYAVEAIESGTVDPACV  358

Query  1312  LEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKR  1491
             LEQ+E Q+++VKEEA SRKEILEKVEKWLAAC+EESWLE+YNR++NRYN GRG HL LKR
Sbjct  359   LEQIERQVAHVKEEALSRKEILEKVEKWLAACDEESWLEEYNRDENRYNAGRGAHLTLKR  418

Query  1492  AEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQR  1671
             AEKAR LVNKIP M++ALTS+   WE E GV F YDG+ L SMLE+Y +L+QEKE ER+R
Sbjct  419   AEKARGLVNKIPAMVDALTSKTVAWEKENGVGFTYDGIRLFSMLEEYTILRQEKEQERRR  478

Query  1672  QRDQKKLQGQLMAEQEVLFGSKRSPS-----QSGKKNVVGGASNKRISVGGAMLQTPYTE  1836
             QRD KKLQGQ++AEQE L+GSK SPS     + G +   GGA+++R+S+GGAMLQTP  +
Sbjct  479   QRDLKKLQGQMIAEQEALYGSKPSPSKPQSVKKGSRMSTGGAASRRVSLGGAMLQTPKHD  538

Query  1837  RAPLSSHSLKKINPVKQ-QALANITQNYVALSSGRRE---SSMHAKQPSCNKSNLQKTE-  2001
                 +S +++K + V Q   L+ +      LSS RR    + +  K+ S   ++    E 
Sbjct  539   SKATTSRAMRKTDRVHQIDQLSYLDDGVSCLSSARRGLDIAGIPTKKQSFGAASAHGIES  598

Query  2002  PTQRKPLSPISSLSFNTSS-ANIMDKISE----SEELRE-MPAS--LLTTPIKNVSGIGG  2157
             P  R+P SPISS   N SS AN+ +  +E    SE+L++ MP +    T+P K  + +  
Sbjct  599   PMTRQPFSPISS---NVSSKANVANGANELGIQSEKLQKTMPLTNVPFTSPCKATTVVDE  655

Query  2158  N------------ATPKtmpipmpstpasaassiamQMGMTPAPVAATTPMVGHD---GV  2292
                          ATP T+ +PM        SS+ M + MTP P  A     G D    +
Sbjct  656   ENRTPKAMPIPVPATPSTISVPMNMVLTPVPSSVLMNVSMTPVPSPAP---FGRDLGQEI  712

Query  2293  EYSYEEMRAGFLL  2331
             EYS+EE R  ++L
Sbjct  713   EYSFEERRLAYML  725



>ref|XP_006348061.1| PREDICTED: 65-kDa microtubule-associated protein 3-like [Solanum 
tuberosum]
Length=745

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/760 (49%), Positives = 507/760 (67%), Gaps = 81/760 (11%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M   Q D   +METTC +LL ELQ IW+E+GE + ERDKML +LE+ECLE YRRKVDQA+
Sbjct  1     MTAAQGDPIQQMETTCGTLLYELQIIWDEVGESDTERDKMLYELERECLEVYRRKVDQAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSRSL---KTELQAIMPlleemkkrkl  597
             +S AQLRQA+A++EAELA IC+A+GE+PV++RQS +SL   K EL+ I+P LEEM+ RK 
Sbjct  61    KSRAQLRQAIADAEAELAAICSAMGERPVHIRQSDQSLGGLKAELRTILPELEEMRNRKS  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             +RK+QF EV  Q+  +  E+          + +D+SDLSLR+LE++ + L +LQKEK++R
Sbjct  121   DRKNQFIEVTKQLQKIRDEIFNPTGCTSTSVVVDKSDLSLRKLEELHAELQALQKEKNER  180

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             LKQVLDHL +LNSLC+VLG+DFK+T+ E+HP+LG+S   K++S +TI+ L+AAI  LREV
Sbjct  181   LKQVLDHLSTLNSLCLVLGMDFKHTVNEVHPSLGESEGTKNISNDTIQHLAAAIGRLREV  240

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             K+ R+  LQ LA++++ELWNLMD P+EEQQ F NVT  IAASE E+TEPN LS++ +   
Sbjct  241   KLLRMKRLQELASSMLELWNLMDTPIEEQQTFQNVTCKIAASEHEITEPNILSVEFINYV  300

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAI--DDSIEFTDETIESGAIDPSHL  1311
             E E+SRL+E+K+SKMKE++LKKR  LEE+CR+ H+    D++++   E IESGA+D + +
Sbjct  301   EGELSRLEELKASKMKELVLKKRSELEEICRKTHMVADSDNAMDVAIEAIESGAVDAASI  360

Query  1312  LEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKR  1491
             LEQ+E+QI+ VKEEAFSRKEIL+KVEKW+AACEEE WLE+YNR++NRYN GRG HL LKR
Sbjct  361   LEQIELQIAQVKEEAFSRKEILDKVEKWIAACEEECWLEEYNRDENRYNAGRGAHLTLKR  420

Query  1492  AEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQR  1671
             AEKAR LVNK+P M+EAL S+ K WE ERG+ F YDG+ LL+MLE+Y +L+QEKE ER+R
Sbjct  421   AEKARTLVNKLPAMVEALASKTKAWESERGIDFTYDGIRLLAMLEEYNILRQEKEEERKR  480

Query  1672  QRDQKKLQGQLMAEQEVLFGSKRSP-----SQSGKKNVVGGASNKRISVGGAMLQTP---  1827
             QRDQKKLQGQLMAE E ++GSK SP     ++ G++    GA+N+R+SVGG MLQTP   
Sbjct  481   QRDQKKLQGQLMAEHEAIYGSKPSPMKNQSAKKGRRMSCSGATNRRLSVGGTMLQTPKLS  540

Query  1828  -------------YTERAPLSSHSLKKINPVKQQALANITQN--YVALSSGRRESSMHA-  1959
                          ++ +A  ++H  KK +   Q+   N + +    ALS+GR+   +   
Sbjct  541   IGGTMPQTPKTEFHSTKATPNTHHTKKSDLFHQRDQFNYSNDDGLPALSAGRKGLDLAGL  600

Query  1960  ----KQPSCNKSNLQKTEPTQRKPLSPISSL-SFNTSSANIMDKISESEELREMPASLL-  2121
                 +  S N   ++KT    RKP SPISS  S   ++ NI++ ++      EM   +L 
Sbjct  601   PLKKQSNSVNGCEMEKT--MTRKPFSPISSTDSSKFNATNILEDLNRKHNHNEMVNKMLP  658

Query  2122  ------TTPIKNVSGI-GGNATPKtmpipmpstpasaassiamQMGMTPAPVAATTPMVG  2280
                   +TP+K +      N TP                     + +T  P+  + PM  
Sbjct  659   SSQIPFSTPVKTLYTTEEENRTP----------------LAVATIPVTSTPLTVSAPMQT  702

Query  2281  -----HDG----------------VEYSYEEMRAGFLLPR  2337
                  H+                 +EYS+EE R GF+LPR
Sbjct  703   AVTPIHNALVPYNYSKTVEEIPVEIEYSFEERRLGFVLPR  742



>ref|XP_008467287.1| PREDICTED: 65-kDa microtubule-associated protein 3-like [Cucumis 
melo]
 ref|XP_008467288.1| PREDICTED: 65-kDa microtubule-associated protein 3-like [Cucumis 
melo]
 ref|XP_008467289.1| PREDICTED: 65-kDa microtubule-associated protein 3-like [Cucumis 
melo]
 ref|XP_008467291.1| PREDICTED: 65-kDa microtubule-associated protein 3-like [Cucumis 
melo]
 ref|XP_008467292.1| PREDICTED: 65-kDa microtubule-associated protein 3-like [Cucumis 
melo]
Length=725

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/726 (53%), Positives = 514/726 (71%), Gaps = 34/726 (5%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M N +ND  L+METTC +LL ELQ IW+E+GE E  RDKML ++EQECLE YRRKVD A+
Sbjct  1     MTNVRNDPILQMETTCGTLLHELQIIWDEVGESEATRDKMLLEVEQECLEVYRRKVDHAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrkl  597
             R  AQLRQA+A+SEAELA IC+A+GE+PV+ RQ+ +   +LK E+  ++P +EEM+KRK+
Sbjct  61    RFRAQLRQAIADSEAELAAICSAMGERPVHTRQADQKTGTLKEEMARVLPQVEEMRKRKV  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHM-IALDESDLSLRRLEDMKSHLLSLQKEKSD  774
             +R++QF EVLDQI  +  E+  S+    H  +A+DE+DLSLR+LE+++  L +LQKEKSD
Sbjct  121   DRRNQFLEVLDQILKISYEIYGSK--FSHSSVAIDENDLSLRKLEELQEQLHTLQKEKSD  178

Query  775   RLKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELRE  954
             R   V +HL +LNSLC+VLG+DFK T+   HP LGD     S++ E+IE L+AAI  LRE
Sbjct  179   RQMVVQEHLHTLNSLCLVLGMDFKQTVNGFHPNLGDPEGTFSITNESIETLAAAITNLRE  238

Query  955   VKIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKS  1134
             VK++R+  LQ+LATT++ELW+LMD P EEQQLF NVT  IAASE E+ EPN+LS+D + S
Sbjct  239   VKLRRMQRLQDLATTLLELWHLMDTPTEEQQLFQNVTCNIAASEDEINEPNSLSVDAIDS  298

Query  1135  AEIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAI--DDSIEFTDETIESGAIDPSH  1308
              E EVSRL+E+KSSKMKE++LKK+  L+++CR+ HL +  D  +E+  ETI+SG +DP+ 
Sbjct  299   VEAEVSRLEELKSSKMKELVLKKKSELDDICRKTHLVLEEDKIVEYAIETIDSGEVDPAI  358

Query  1309  LLEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLK  1488
             +LEQ+E+QI  VKEEAF RKEILEKVEKWL AC+EE WLE+YNR++NRYN GRG HL+LK
Sbjct  359   ILEQIELQIGRVKEEAFVRKEILEKVEKWLTACDEECWLEEYNRDENRYNAGRGAHLILK  418

Query  1489  RAEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQ  1668
             RAEKARALVNK+PGM++ALTS+   WE ERG+ F YDGVSLLSMLE+Y +L+QEKE ER+
Sbjct  419   RAEKARALVNKLPGMVDALTSKTMAWEKERGIEFTYDGVSLLSMLEEYSVLRQEKEQERR  478

Query  1669  RQRDQKKLQGQLMAEQEVLFGSKRSPS--QSGKK----NVVGGASNKRISVGGAMLQTPY  1830
             R RDQKKLQGQL+AEQE L+GSK SPS  QS KK    +  G A++KR+S+GG M QTP 
Sbjct  479   RLRDQKKLQGQLIAEQEALYGSKPSPSKPQSVKKAPRSSAAGAANSKRLSLGGTMHQTP-  537

Query  1831  TERAPLSSHSLKKINPVKQQALANITQNYVALSSGRRESSMHAKQPSCNK---SNLQKTE  2001
               +A   S   +K + +  Q      + + AL +GRRE    + QP+ +    +N ++ E
Sbjct  538   --KATPQSRPSRKGDQLNDQNF-QYDEGFGALPAGRRELDF-SSQPASHINSLANAREPE  593

Query  2002  PTQRKPLSPISSL---SFNTSSANIMDKISESEELREM-PAS---LLTTPIKNVSGIGG-  2157
                RKP +PI+S      NT+S+      +  E L++  P S      TP+K +S     
Sbjct  594   LVIRKPFAPIASTVQPKTNTTSSIDNANTTSIEPLQKTNPTSNVPFTATPLKKISVATDE  653

Query  2158  --NATPKtmpipmpstpasaassiamQMGMTPAPVAATTPM--VGHDGVEYSYEEMRAGF  2325
               N TPK M IP+PSTP++ + ++        AP         +  D VEYS+EE RAGF
Sbjct  654   DQNMTPKAMSIPIPSTPSTLSVAMQTATTPAVAPPPPAFKAEEIPEDDVEYSFEERRAGF  713

Query  2326  LLPRLH  2343
             +LP+ H
Sbjct  714   VLPKTH  719



>ref|XP_010245134.1| PREDICTED: 65-kDa microtubule-associated protein 3-like isoform 
X2 [Nelumbo nucifera]
Length=753

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/751 (52%), Positives = 517/751 (69%), Gaps = 83/751 (11%)
 Frame = +1

Query  322   IWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAESEAELARICAALG  501
             IW+E+GE E ERDKML +LE+ECLE YRRKVDQA+R  AQLRQA+A++EAELA IC+A+G
Sbjct  2     IWDEVGESEAERDKMLLELERECLEVYRRKVDQANRCRAQLRQAIADNEAELATICSAMG  61

Query  502   EQPVNVRQSSRS---LKTELQAIMPlleemkkrklerkHQFSEVLDQIDSVLKELGKSRK  672
             E+PV++RQS ++   LK EL AI+P LEEM+KRK +R++QF EVL+QI  +  E+ KS  
Sbjct  62    ERPVHIRQSDQNSGRLKEELAAIIPQLEEMRKRKCDRRNQFLEVLEQIQRISNEICKSTD  121

Query  673   ELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESLNSLCIVLGIDFKNT  852
                  I +DE+DLS+R+ E++   L +LQKEKSDRLKQVLDHL +LNSLC+VLG+DFK T
Sbjct  122   YNSSKIVVDETDLSMRKFEELHRQLHALQKEKSDRLKQVLDHLSTLNSLCLVLGMDFKQT  181

Query  853   IGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQRLHMLQNLATTIVELWNLMDMP  1032
             I E+HP+L DS   K++S +TIER+ +AI +L EVKI+R+  LQ+LATT++ELWNLMD P
Sbjct  182   INEVHPSLNDSEGTKNISDDTIERMDSAIQKLLEVKIKRMRRLQDLATTMLELWNLMDTP  241

Query  1033  VEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQEMKSSKMKEVLLKKRIT  1212
             + EQQ+F NVT  IAASE E+TEPN LS + +   E EVS+L+++K+SKMKE++LKKR  
Sbjct  242   IGEQQIFQNVTCKIAASEQEITEPNILSEEFINYVEEEVSKLEDLKASKMKELVLKKRSE  301

Query  1213  LEELCRQAHLA--IDDSIEFTDETIESGAIDPSHLLEQLEIQISNVKEEAFSRKEILEKV  1386
             +EE+CR+ H+   ID+ +E+  E IESGA+DP+ +LEQ+E+QI+ VKEEAFSRKEILEKV
Sbjct  302   MEEICRRTHMVAEIDNGMEYAIEAIESGAVDPACILEQIELQIAKVKEEAFSRKEILEKV  361

Query  1387  EKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVNKIPGMLEALTSRAKGW  1566
             EKWLAACEEESWLE+YNR++NRYN GRG HL LKRAEKARA+VNK+P M++AL ++ + W
Sbjct  362   EKWLAACEEESWLEEYNRDENRYNAGRGAHLTLKRAEKARAVVNKLPAMIDALGTKVRTW  421

Query  1567  EIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQGQLMAEQEVLFGSKRSP  1746
             E ERG+ FLYDGV LLSMLE+Y +L+QEKE ER+RQRDQKKLQGQL+AEQE LFGSK SP
Sbjct  422   ERERGIEFLYDGVRLLSMLEEYNILRQEKEQERKRQRDQKKLQGQLIAEQEALFGSKPSP  481

Query  1747  S--QSGKKN---VVGGASNKRISVGGAMLQTPYTE---RAPLSSHSLKKINPVKQQALAN  1902
             S  QSGKK     +GGA+ +R+S+GGAMLQTP  +    A L+ H    + P K+  L +
Sbjct  482   SKPQSGKKGPRMSIGGANGRRLSLGGAMLQTPKPDLPHPAKLTPH----LRPSKKGGLLS  537

Query  1903  ITQN--YVALSSGRRE---SSMHAKQPSCNKSNLQKTE-PTQRKPLSPISSLSFNTSSAN  2064
               Q+   VALS+GRR    + +  K+ S N +N  + E P  RKP SP+S+      + N
Sbjct  538   HHQDDSCVALSAGRRGLDIAGLPVKKHSFNAANSHEIESPMTRKPFSPLSAAMLPKVNPN  597

Query  2065  IMDKISE---------------------------SEELR----EMPASLLTTP-------  2130
              ++ +++                            E+ R    +MP  + TTP       
Sbjct  598   FLEDLNKVQGGTMQKTLPNSNTPLATPSKLACVTDEDNRTPKEKMPIPMPTTPSTISVSM  657

Query  2131  -------------IKNVSGIGGNATPKtmpipmpstpasaassiamQMGMTPAPVAATTP  2271
                          +   + I  N TPK   +P+P     +  S+ MQ   TPAP  AT  
Sbjct  658   QTATTPAPAIATVLFGANKIEDNRTPK-EKMPIPVPTTPSTISVPMQTATTPAPAIATV-  715

Query  2272  MVG-------HDGVEYSYEEMRAGFLLPRLH  2343
             + G       H+ VEYS+EE RAGF++P+ H
Sbjct  716   LFGADKIEEMHEEVEYSFEERRAGFVIPKTH  746



>ref|XP_004234161.1| PREDICTED: 65-kDa microtubule-associated protein 3 [Solanum lycopersicum]
Length=741

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/743 (51%), Positives = 508/743 (68%), Gaps = 51/743 (7%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M   Q D   +METTC +LL ELQ IW+E+GE + ERDKML +LE+ECLE YRRKVDQA+
Sbjct  1     MTAAQGDPVQQMETTCGTLLYELQIIWDEVGESDTERDKMLYELERECLEVYRRKVDQAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSRSL---KTELQAIMPlleemkkrkl  597
             +S AQLRQA+A++EAELA IC+A+GE+PV++RQS +SL   K EL+ I+P LEEM  RK 
Sbjct  61    KSRAQLRQAIADAEAELAAICSAMGERPVHIRQSDQSLGGLKAELRTILPELEEMHNRKS  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             +RK+QF EV  Q+  +  E+ K        + +DESDLSLR+LE++ + L +LQKEKS+R
Sbjct  121   DRKNQFIEVTKQLQKIRDEIFKPTGCTSTAVVIDESDLSLRKLEELHAELQALQKEKSER  180

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             LKQVLDHL +LNSLC+VLG+DFK+T+ E+HP+LG+S   K++S +TI+ L+AAI  LREV
Sbjct  181   LKQVLDHLSTLNSLCLVLGMDFKSTVNEVHPSLGESEGTKNISNDTIQHLAAAIGRLREV  240

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             K+ R+  LQ LA++++ELWNLMD P+EEQQ F NVT  IAASE E+TEPN LS++ +   
Sbjct  241   KLLRMKRLQELASSMLELWNLMDTPIEEQQTFQNVTCKIAASEHEITEPNILSVEFINYV  300

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAI--DDSIEFTDETIESGAIDPSHL  1311
             E E+SRL+E+K+SKMKE++LKKR  LEE+CR+ H+    D++++   E IESGA+D + +
Sbjct  301   EGELSRLEELKASKMKELVLKKRSELEEICRKTHMVADSDNAMDVAIEAIESGAVDAASI  360

Query  1312  LEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKR  1491
             LEQ+E+Q++ VKEEAFSRKEIL+KVEKW+AACEEE WLE+YNR++NRYN GRG HL LKR
Sbjct  361   LEQIELQVAQVKEEAFSRKEILDKVEKWIAACEEECWLEEYNRDENRYNAGRGAHLTLKR  420

Query  1492  AEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQR  1671
             AEKAR LVNK+P M+EAL S+ K WE ERG+ F YDG+ LL+MLE+Y +L+QEKE ER+R
Sbjct  421   AEKARTLVNKLPVMVEALASKTKAWENERGIDFTYDGIRLLAMLEEYNILRQEKEEERKR  480

Query  1672  QRDQKKLQGQLMAEQEVLFGSKRSP-----SQSGKKNVVGGASNKRISVGGAMLQTP---  1827
             QRDQKKLQGQLMAE E ++GSK SP     ++ G++    GA+N+R+SVGG MLQTP   
Sbjct  481   QRDQKKLQGQLMAEHEAMYGSKPSPMKNQSAKKGRRMSCSGATNRRLSVGGTMLQTPKLS  540

Query  1828  -------------YTERAPLSSHSLKKINPVKQQALANITQNYVALSSGRRESSMHA---  1959
                          ++ +A  ++H+ KK + + Q   +N      ALSSGR+   +     
Sbjct  541   IGGTMPQTPKTEFHSTKATPNTHNTKKSD-LFQFNYSN-DDGLPALSSGRKGLDLAGLPL  598

Query  1960  --KQPSCNKSNLQKTEPTQRKPLSPISSL-SFNTSSANIMDKISESEELREMPASLL---  2121
               +  + N   L+KT    RKP SPISS  S   ++ NI++  +      EM   +L   
Sbjct  599   KKQSNTVNGCELEKT--MTRKPFSPISSTDSSKFNATNILEDQNRKHNQNEMANKMLPSS  656

Query  2122  ----TTPIKNVSGI-GGNATPKtmpipmpstpasaassiamQMGMTP-----APVAATTP  2271
                 +TP+K +      N TP      +P        S  MQ  +TP      P   + P
Sbjct  657   QIPFSTPVKTLYTTEEENRTP-LTVPIIPVPSTPLTVSAPMQTAITPVHNALVPYNYSKP  715

Query  2272  MVGHD-GVEYSYEEMRAGFLLPR  2337
             +      +EYS+EE R GF+LPR
Sbjct  716   VEEIPVEIEYSFEERRLGFVLPR  738



>gb|EYU30567.1| hypothetical protein MIMGU_mgv1a002283mg [Erythranthe guttata]
Length=691

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/713 (53%), Positives = 491/713 (69%), Gaps = 57/713 (8%)
 Frame = +1

Query  265   DQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQL  444
             D+  +M T C SLLSELQKIW+E+GE + ERDKML +LEQECL+AYRRKVD A+R   QL
Sbjct  7     DRHSQMATNCGSLLSELQKIWDEVGEVDNERDKMLSELEQECLDAYRRKVDHANRFRVQL  66

Query  445   RQAVAESEAELARICAALGEQPVNVRQSSRSLKTELQAIMPlleemkkrklerkHQFSEV  624
             RQAVA++EA++A IC+ALG++P ++ + S SLK ELQAIMP LE+MKK+K ERK QF+EV
Sbjct  67    RQAVADAEAQMADICSALGDRPAHIMKGSGSLKKELQAIMPQLEDMKKKKNERKGQFAEV  126

Query  625   LDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLE  804
             L QI+S+  EL  S+ E    + +DE+DLS++RL+D++  LL LQKEK +RLK V D L 
Sbjct  127   LRQINSISNELSGSKDENLSPMVIDENDLSMKRLDDLRKQLLILQKEKGERLKDVHDQLN  186

Query  805   SLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQRLHMLQ  984
              LN LC+VLG+DFK T+  +HP+L DS   +S+S  TIERLS  I +L++VK+QR+  LQ
Sbjct  187   VLNGLCVVLGMDFKLTVCGVHPSLDDSRGTRSISKNTIERLSGTICKLKDVKLQRMQNLQ  246

Query  985   NLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQE  1164
             +LA  + ELWNLMD PVEEQQ+F NVTR +A  E+E+TE N+LSL+ + +AE EV RLQE
Sbjct  247   DLAMAMAELWNLMDTPVEEQQMFQNVTRTLALEENEITEANSLSLEFINNAEAEVMRLQE  306

Query  1165  MKSSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHLLEQLEIQIS  1338
             MK+ K+KEVLLKK++ LEE+CR AH+ +  ++  + + E+IESGA  PS LLEQLE+QIS
Sbjct  307   MKTRKIKEVLLKKKLILEEICRGAHMVVGGNLGMDLSVESIESGATSPSDLLEQLEVQIS  366

Query  1339  NVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVN  1518
              V++EAFSRKEILEKV+KWLAACEEE WLE+YNR+DNRYN GRGTHLMLKRAEKAR LVN
Sbjct  367   KVQDEAFSRKEILEKVQKWLAACEEECWLEEYNRDDNRYNAGRGTHLMLKRAEKARLLVN  426

Query  1519  KIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQG  1698
             KIP M++ L S+AK WE ER + FLYDGV L SM++QY  LK  KE ERQ+QR+QKKLQG
Sbjct  427   KIPAMVDTLRSKAKAWEKERKIEFLYDGVGLRSMVDQYCELKHLKEQERQKQRNQKKLQG  486

Query  1699  QLMAEQEVLFGSKRSPSQSGKKNV--------VGGASNKRISVGGAMLQTPYTERAPLSS  1854
              LM EQE ++GSK SP++SG KN          GGA+NKR S+GGA LQ           
Sbjct  487   HLMTEQEAIYGSKPSPTKSGSKNYRPSTGGGGGGGAANKRFSLGGAALQNTL--------  538

Query  1855  HSLKKINPVKQQALANITQ--NYVALSSGRRESSMH-AKQPSCNKSNLQKTE-PTQ-RKP  2019
               +K  NP+K+Q  +NI     ++A SSG++ +S+   K  S N S+  ++  P+  RK 
Sbjct  539   --MKNNNPLKRQT-SNIHHQSGFLAHSSGKKNTSVGPMKHHSTNASSSTRSNGPSALRKA  595

Query  2020  LSPISSLSFNTSSANIMDKISESEELREMPASLLTTPIKNVSGIGGNATPKtmpipmpst  2199
             LSPISSL  N  S N  D+ +   E ++ P +   TP K                     
Sbjct  596   LSPISSLCSNIISCNFEDQNANINEFKD-PHTACKTPTK---------------------  633

Query  2200  pasaassiamQMGMTPAPVAATTPMV------GHDGVEYSYEEMRAGF-LLPR  2337
                   + A    ++ A   ATTP          + V+YSYEE RAGF ++P+
Sbjct  634   --MPVPTPATPPTVSNAMQTATTPFTPGVVRGNEEVVDYSYEERRAGFDIMPK  684



>ref|XP_007143898.1| hypothetical protein PHAVU_007G111500g [Phaseolus vulgaris]
 gb|ESW15892.1| hypothetical protein PHAVU_007G111500g [Phaseolus vulgaris]
Length=729

 Score =   629 bits (1622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/730 (52%), Positives = 511/730 (70%), Gaps = 38/730 (5%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M   +ND  L+ ET+C +LL ELQ IW+E+GE E +RD+ML +LEQECLE YRRKVD A+
Sbjct  1     MSKPRNDPLLQSETSCGTLLYELQIIWDEVGESETDRDRMLFELEQECLEVYRRKVDLAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrkl  597
             RS AQLRQA+A+ EAELA IC+++GE+PV++RQ+ +   SLK E   I+P LEEM+KRK 
Sbjct  61    RSRAQLRQAIADCEAELAAICSSMGERPVHIRQTDQNVGSLKEEHARILPQLEEMQKRKS  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             ER++QF EV +QI S+  E+   R+ +  +I  DE+DLS+R+LE++   L +LQ EKS R
Sbjct  121   ERRNQFVEVQEQIQSISIEIHGPREYIPAVI--DETDLSVRKLEELNRQLHALQIEKSSR  178

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             LKQV +HL +LNSLC+VLG+DFK TI  IHP+L +S   KSVS +TI++L+ AI ELREV
Sbjct  179   LKQVQEHLYTLNSLCLVLGLDFKQTINGIHPSLLESEGPKSVSNDTIQQLAIAIEELREV  238

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             K+QR+  LQ+LATT++ELWNLMD PVEEQQLF NVT  IAASE E+TEPN LS++ +   
Sbjct  239   KLQRMQKLQDLATTMLELWNLMDTPVEEQQLFQNVTCNIAASEHEVTEPNTLSMEFINLV  298

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLA--IDDSIEFTDETIESGAIDPSHL  1311
             E EV+RL+ +KSSKMKE++LKKR  LEE+CR+ HL   ID+++E+  E IESG++DP+ +
Sbjct  299   EEEVARLEMLKSSKMKELVLKKRTELEEICRKTHLIPEIDNAVEYAVEAIESGSVDPACV  358

Query  1312  LEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKR  1491
             LEQ+E+Q++ VKEEAFSRKEILEKVEKWLAAC+EESWLE+YNR+DNRYN GRG HL LKR
Sbjct  359   LEQIELQVAQVKEEAFSRKEILEKVEKWLAACDEESWLEEYNRDDNRYNAGRGAHLTLKR  418

Query  1492  AEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQR  1671
             AEKARALVNKIP +++ LTS+   WE E+GV F YDG+ LLSMLE+Y +L+QEKE ER+R
Sbjct  419   AEKARALVNKIPALVDGLTSKTIAWEKEKGVEFTYDGIRLLSMLEEYNILRQEKEQERRR  478

Query  1672  QRDQKKLQGQLMAEQEVLFGSKRSPS-----QSGKKNVVGGASNKRISVGGAMLQTPYTE  1836
             QRD KKLQGQ++AEQE L+GSK SPS     + G +   GGA+++R+S+GGAMLQTP  +
Sbjct  479   QRDLKKLQGQMIAEQEALYGSKPSPSKPQSVKKGPRMSTGGATSRRVSLGGAMLQTPKPD  538

Query  1837  RAPLSSHSLKKINPVKQ-QALANITQNYVALSSGRRE---SSMHAKQPSCNKSNLQKTEP  2004
                  S +++K     Q + L  +      LSS RR    + +  K+ S          P
Sbjct  539   SKATHSRAMRKNEKGHQIEHLNYLDDGISGLSSARRGLDIAGVPVKKHSFGAGTQIIESP  598

Query  2005  TQRKPLSPISS--LSFNTSSANIMDKISESEELREMPASL----LTTPIKNVSGIG-GNA  2163
               R+P SPISS  ++   + AN  D++++  E  +   SL     TTP K  + +   N 
Sbjct  599   LIRQPFSPISSNNVASKANVANATDELNKQGEKLQRTLSLNNVPFTTPSKTATLVDEENR  658

Query  2164  TPKtmpipmpstpasaassiamQMGMTPAPVA-----------ATTPMVGHD---GVEYS  2301
             TPK   +P+P     +  S+ M M MTPAP +            T+   G+D    +EYS
Sbjct  659   TPK-TIMPIPFPATPSTVSVPMNMAMTPAPSSIMKNINLNSTLTTSVPCGNDLIQEIEYS  717

Query  2302  YEEMRAGFLL  2331
             +EE R  F++
Sbjct  718   FEEKRLAFMM  727



>ref|XP_004143655.1| PREDICTED: 65-kDa microtubule-associated protein 3-like [Cucumis 
sativus]
 gb|KGN50373.1| hypothetical protein Csa_5G169090 [Cucumis sativus]
Length=725

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/726 (53%), Positives = 515/726 (71%), Gaps = 34/726 (5%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M N +ND  L+METTC +LL ELQ IW+E+GE E  RDKML ++EQECLE YRRKVD A+
Sbjct  1     MTNVRNDPILQMETTCGTLLHELQIIWDEVGESETTRDKMLLEVEQECLEVYRRKVDHAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrkl  597
             R  AQLRQA+A+SEAELA IC+A+GE+PV+ RQ+ +   +LK E+  ++P ++EM+KRK+
Sbjct  61    RFRAQLRQAIADSEAELAAICSAMGERPVHTRQADQKTGTLKEEMARVLPQVDEMRKRKV  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHM-IALDESDLSLRRLEDMKSHLLSLQKEKSD  774
             +R++QF EVLDQI  +  E+  S+    H  +A+DE+DLSLR+LE+++  L +LQKEKSD
Sbjct  121   DRRNQFLEVLDQILKISYEIYGSK--FSHSSVAIDENDLSLRKLEELQEQLHTLQKEKSD  178

Query  775   RLKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELRE  954
             R   V DHL +LN LC+VLG+DFK T+   HP LGD     S++ E+IE L+AAI  LRE
Sbjct  179   RQMVVQDHLHTLNLLCLVLGMDFKQTVNGFHPNLGDPDGTFSITNESIETLAAAITNLRE  238

Query  955   VKIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKS  1134
             VK++R+  LQ+LATT++ELW+LMD P+EEQQLF NVT  IAASE E+ EPN+LS+D + S
Sbjct  239   VKLRRMQRLQDLATTLLELWHLMDTPMEEQQLFQNVTCNIAASEDEINEPNSLSVDAIDS  298

Query  1135  AEIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAI--DDSIEFTDETIESGAIDPSH  1308
              E EVSRL+E+KSSKMKE++LKKR  L+E+CR+ HL +  D  +E+  ETI+SG +DP+ 
Sbjct  299   VEAEVSRLEELKSSKMKELVLKKRSELDEICRKTHLVLEEDKIVEYAIETIDSGEVDPAI  358

Query  1309  LLEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLK  1488
             +LEQ+E+QI+ VKEEAF RKEILE+VEKWL +C+EE WLE+YNR++NRYN GRG HL+LK
Sbjct  359   ILEQIELQIARVKEEAFVRKEILERVEKWLTSCDEECWLEEYNRDENRYNAGRGAHLILK  418

Query  1489  RAEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQ  1668
             RAEKARALVNK+PGM++ALTS+   WE ERG+ F YDGVSLLSMLE+Y +L+QEKE ER+
Sbjct  419   RAEKARALVNKLPGMVDALTSKTMAWEKERGIEFTYDGVSLLSMLEEYSVLRQEKEQERR  478

Query  1669  RQRDQKKLQGQLMAEQEVLFGSKRSPS--QSGKK----NVVGGASNKRISVGGAMLQTPY  1830
             R RDQKKLQGQL+AEQEVL+GSK SPS  QS KK    +  G A+++R+S+GG M QTP 
Sbjct  479   RLRDQKKLQGQLIAEQEVLYGSKPSPSKPQSVKKAPRASAAGAANSRRLSLGGTMHQTP-  537

Query  1831  TERAPLSSHSLKKINPVKQQALANITQNYVALSSGRRESSMHAKQPSCNKS--NLQKTEP  2004
               +A   S   +K + +  Q           + +GRRE     +  S N S  N ++ E 
Sbjct  538   --KATPQSRPSRKGDQLNDQNFQ--YDEGFGVPAGRRELDFSNQPASHNNSLANAREPEL  593

Query  2005  TQRKPLSPI-SSLSFNTSSANIMD--KISESEELREM-PAS----LLTTPIKNVSGIGG-  2157
               RKP +PI S++   T++ N +D    + SE L++  P S    + TTP+K +S     
Sbjct  594   VIRKPFAPIASTVQPKTNTTNSIDNANTASSEPLQKTNPTSTVPFITTTPLKKISVATDE  653

Query  2158  --NATPKtmpipmpstpasaassiamQMGMTPAPVAATTPM--VGHDGVEYSYEEMRAGF  2325
               N TPK M IP PSTP++ + ++        AP         +  D VEYS+EE RAGF
Sbjct  654   DQNMTPKAMSIPEPSTPSTLSVAMQTATTPAVAPPPPAFKAEEIPEDNVEYSFEERRAGF  713

Query  2326  LLPRLH  2343
             +LP+ H
Sbjct  714   VLPKTH  719



>ref|XP_004158108.1| PREDICTED: LOW QUALITY PROTEIN: 65-kDa microtubule-associated 
protein 3-like [Cucumis sativus]
Length=725

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/726 (53%), Positives = 514/726 (71%), Gaps = 34/726 (5%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M N +ND  L+METTC +LL ELQ IW+E+GE E  RDKML ++EQECLE YRRKVD A+
Sbjct  1     MTNVRNDPILQMETTCGTLLHELQIIWDEVGESETTRDKMLLEVEQECLEVYRRKVDHAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrkl  597
             R  AQLRQA+A+SEAELA IC+A+GE+PV+ RQ+ +   +LK E+  ++P ++EM+KRK+
Sbjct  61    RFRAQLRQAIADSEAELAAICSAMGERPVHTRQADQKTGTLKEEMARVLPQVDEMRKRKV  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHM-IALDESDLSLRRLEDMKSHLLSLQKEKSD  774
             +R++QF EVLDQI  +  E+  S+    H  +A+DE+DLSLR+LE+++  L +LQKEKSD
Sbjct  121   DRRNQFLEVLDQILKISYEIYGSK--FSHSSVAIDENDLSLRKLEELQEQLHTLQKEKSD  178

Query  775   RLKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELRE  954
             R   V DHL +LN LC+VLG+DFK T+   HP LGD     S++ E+IE L+AAI  LRE
Sbjct  179   RQMVVQDHLHTLNLLCLVLGMDFKQTVNGFHPNLGDPDGTFSITNESIETLAAAITNLRE  238

Query  955   VKIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKS  1134
             VK++R+  LQ+LATT++ELW+LMD P+EEQQLF NVT  IAASE E+ EPN+LS+D + S
Sbjct  239   VKLRRMQRLQDLATTLLELWHLMDTPMEEQQLFQNVTCNIAASEDEINEPNSLSVDAIDS  298

Query  1135  AEIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAI--DDSIEFTDETIESGAIDPSH  1308
              E EVSRL+E+KSSKMKE++LKKR  L+E+CR+ HL +  D  +E+  ETI+SG +DP+ 
Sbjct  299   VEAEVSRLEELKSSKMKELVLKKRSELDEICRKTHLVLEEDKIVEYAIETIDSGEVDPAI  358

Query  1309  LLEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLK  1488
             +LEQ+E+QI+ VKEEAF RKEILE+VEKWL +C+EE WLE+YNR++NRYN GRG HL+LK
Sbjct  359   ILEQIELQIARVKEEAFVRKEILERVEKWLTSCDEECWLEEYNRDENRYNAGRGAHLILK  418

Query  1489  RAEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQ  1668
             RAEKARALVNK+PGM++ALTS+   WE ERG+ F YDGVSLLSMLE+Y +L+QEKE ER+
Sbjct  419   RAEKARALVNKLPGMVDALTSKTMAWEKERGIEFTYDGVSLLSMLEEYSVLRQEKEQERR  478

Query  1669  RQRDQKKLQGQLMAEQEVLFGSKRSPS--QSGKK----NVVGGASNKRISVGGAMLQTPY  1830
             R RDQKKLQGQL+AEQEV +GSK SPS  QS KK    +  G A+++R+S+GG M QTP 
Sbjct  479   RLRDQKKLQGQLIAEQEVXYGSKPSPSKPQSVKKAPRASAAGAANSRRLSLGGTMHQTP-  537

Query  1831  TERAPLSSHSLKKINPVKQQALANITQNYVALSSGRRESSMHAKQPSCNKS--NLQKTEP  2004
               +A   S   +K + +  Q           + +GRRE     +  S N S  N ++ E 
Sbjct  538   --KATPQSRPSRKGDQLNDQNFQ--YDEGFGVPAGRRELDFSNQPASHNNSLANAREPEL  593

Query  2005  TQRKPLSPI-SSLSFNTSSANIMD--KISESEELREM-PAS----LLTTPIKNVSGIGG-  2157
               RKP +PI S++   T++ N +D    + SE L++  P S    + TTP+K +S     
Sbjct  594   VIRKPFAPIASTVQPKTNTTNSIDNANTASSEPLQKTNPTSTVPFITTTPLKKISVATDE  653

Query  2158  --NATPKtmpipmpstpasaassiamQMGMTPAPVAATTPM--VGHDGVEYSYEEMRAGF  2325
               N TPK M IP PSTP++ + ++        AP         +  D VEYS+EE RAGF
Sbjct  654   DQNMTPKAMSIPEPSTPSTLSVAMQTATTPAVAPPPPAFKAEEIPEDNVEYSFEERRAGF  713

Query  2326  LLPRLH  2343
             +LP+ H
Sbjct  714   VLPKTH  719



>ref|XP_004308160.1| PREDICTED: 65-kDa microtubule-associated protein 3-like [Fragaria 
vesca subsp. vesca]
Length=698

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/720 (53%), Positives = 498/720 (69%), Gaps = 49/720 (7%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M N Q +Q L+METTC SLL EL+ IW+E+GE + +RDKML +LEQECLE YRRKVDQA+
Sbjct  1     MSNIQTEQLLQMETTCGSLLCELKIIWDEVGETDKDRDKMLLELEQECLEIYRRKVDQAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSRS---LKTELQAIMPlleemkkrkl  597
             R  AQLRQA+A+SEAELA IC+A+GE+PV++RQS +S   LK EL  I+P LEEM+KRK+
Sbjct  61    RCRAQLRQAIADSEAELAAICSAMGERPVHIRQSDQSVGSLKEELSKIIPQLEEMQKRKV  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             ERK+QF EV++QI  +  E+  S   +   + +DE+DLSLRRLE++   L +LQ EKSDR
Sbjct  121   ERKNQFLEVVEQIQMISSEINGSTSCISSKVVVDETDLSLRRLEELHRQLHALQTEKSDR  180

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             LKQ+  HL +LNSLC+VLG+DFK TI EIHP+L +S   K +S + IERL+ AI + R+V
Sbjct  181   LKQIQAHLGTLNSLCLVLGMDFKQTISEIHPSLDNSEGCKDISLDLIERLATAIKKFRDV  240

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             KIQR+ MLQ+LATT++ELWNLMD P+EEQQ+F N+T  IAASE E+TEP+ LS+D +   
Sbjct  241   KIQRMQMLQDLATTMLELWNLMDTPIEEQQMFQNITCNIAASEHEITEPDTLSVDFINYV  300

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAI--DDSIEFTDETIESGAIDPSHL  1311
             E EVSRL+E+KSSKMKE++LKKR  LEE+CR+ H+ I  D +IE+  E IESG +DPS +
Sbjct  301   EAEVSRLEELKSSKMKELVLKKRTELEEICRKTHMVIEADSAIEYAIEAIESGVVDPSCV  360

Query  1312  LEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKR  1491
             L+Q+E+Q++ VKEEAFSRK+ILE+V+KWL AC+EE WLE+YNR++NRYN GRG HL LKR
Sbjct  361   LDQIEVQVAKVKEEAFSRKDILERVDKWLFACDEECWLEEYNRDENRYNAGRGAHLTLKR  420

Query  1492  AEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQR  1671
             AEKARALVNK+P M++AL S+   WE ERG  F YDGV LLSMLE+Y +L+ EKE ER+R
Sbjct  421   AEKARALVNKLPAMVDALASKTIAWEKERGTEFTYDGVRLLSMLEEYTILRDEKEQERRR  480

Query  1672  QRDQKKLQGQLMAEQEVLFGSKRSPSQS-----GKKNVVGGASNKRISVGGAMLQTPYTE  1836
             QRDQKKLQGQLMAEQE L+GSK SPS++     G +   GGASN+R+S+      + ++ 
Sbjct  481   QRDQKKLQGQLMAEQEALYGSKPSPSKTQSVKKGPRMSTGGASNRRLSMQAPKADSIHST  540

Query  1837  RAP---LSSHSLKKINPVKQQALANITQNYVALSSGRRESSMHAKQPSCNKSNLQKTEPT  2007
             R P   LS  S +K +   Q           AL++GRR  S +    S   S+ +   P 
Sbjct  541   RVPATPLSRPSSRKSDRGHQ---IEHDDGLTALATGRRNLSRN----SSFGSSYEPESPM  593

Query  2008  QRKPLSPISSLSFNTSSANIMDKISESEELREMPASLLTTPIKNVSGIGGNATPKtmpip  2187
              RKP +PIS  + N + A  M   +  EE          TP   +S +    TP+T+ +P
Sbjct  594   MRKPFAPISLPAENGTFATPMKSTNVPEE------DYTKTPKVIMSFVP--TTPQTVSVP  645

Query  2188  mpstpasaassiamQMGMTPAP--------VAATTPMVGHDGVEYSYEEMRAGFLLPRLH  2343
             M             Q  +TPAP         A     V  + VEYS+EE+RAGF+LP  H
Sbjct  646   M-------------QTAVTPAPPSHQPIPYAANVAKEVAPEEVEYSFEEIRAGFVLPSAH  692



>ref|XP_002513279.1| Protein regulator of cytokinesis, putative [Ricinus communis]
 gb|EEF49147.1| Protein regulator of cytokinesis, putative [Ricinus communis]
Length=724

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/724 (54%), Positives = 519/724 (72%), Gaps = 39/724 (5%)
 Frame = +1

Query  259   QNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCA  438
             QND  L++ETTC +LL ELQ IW+E+GE + ERDKML +LEQECLE YRRKVDQA+R+ A
Sbjct  5     QNDPLLQVETTCGTLLYELQIIWDEVGETDKERDKMLLELEQECLEVYRRKVDQANRNRA  64

Query  439   QLRQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrklerkH  609
             QLRQA+A+SEAELA IC+A+GE+PV++RQ+ +   SLK EL+ I+P LEEM KRK +R++
Sbjct  65    QLRQAIADSEAELAAICSAMGERPVHIRQADQNAGSLKEELRKILPQLEEMGKRKSDRRN  124

Query  610   QFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQV  789
             QF EVL++I  +  E+  S     H   +DE+DLSLR+LE++   L +LQKEKSDRLKQV
Sbjct  125   QFLEVLEEIKEISYEIYGS---ADHHFFIDETDLSLRKLEELHRQLHTLQKEKSDRLKQV  181

Query  790   LDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQR  969
              +HL++LNSLC VLG+DFKN + E+HP+ GD+   +++ST  I+ LS AI +LRE+K QR
Sbjct  182   QEHLDTLNSLCSVLGMDFKNILTEVHPSFGDTEGSRNISTVLIQNLSTAIIKLREIKRQR  241

Query  970   LHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEV  1149
             +  LQ+LATT++ELW+LMD P+EEQQ+F NVT  IAASE E+TEPN LS+D +   E EV
Sbjct  242   MQKLQDLATTMLELWHLMDTPIEEQQMFQNVTCNIAASEHEITEPNTLSVDFINYVEAEV  301

Query  1150  SRLQEMKSSKMKEVLLKKRITLEELCRQAHLA--IDDSIEFTDETIESGAIDPSHLLEQL  1323
             SRL+E+KSSKMK+++LKKR  LEE+CR+ H+    D +IE+  + IE G +DP+ +LEQ+
Sbjct  302   SRLEELKSSKMKDLVLKKRSELEEICRKTHMVPEADTAIEYAIDAIEFGNVDPASVLEQI  361

Query  1324  EIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKA  1503
             E+QI NVKEEAFSRKEILEKVEKWL ACEEE WLE+YNR++NRYN G+G HL LKRAEKA
Sbjct  362   ELQIGNVKEEAFSRKEILEKVEKWLTACEEECWLEEYNRDENRYNAGKGAHLTLKRAEKA  421

Query  1504  RALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQ  1683
             RALVNK+PG +EAL S+   WE ERG+ FLYDG+ LLSMLE+Y +L+QEKE ER+RQRDQ
Sbjct  422   RALVNKLPGTVEALASKTMAWEKERGIEFLYDGIRLLSMLEEYTILRQEKEEERRRQRDQ  481

Query  1684  KKLQGQLMAEQEVLFGSKRSPSQS-----GKKNVVGGASNKRISVGGAMLQTP-----YT  1833
             KKLQGQL+AEQE L+GSK SPS++       +   GGASN+R+S+GGAML  P      +
Sbjct  482   KKLQGQLIAEQEALYGSKPSPSKTQCVKKASRVSTGGASNRRLSLGGAMLPAPKLDLSNS  541

Query  1834  ERAPLSSHSLKKINPVKQQALANITQN--YVALSSGRRE---SSMHAKQPSCNKSNLQKT  1998
              +A   S   KK++ + Q    N  Q+  + ALS+GRR    + + AK+   +  N  + 
Sbjct  542   SKATTHSRPGKKLDRMHQHDPLNHRQDDGFAALSAGRRGLDIAGLPAKKHPFSTVNAHEP  601

Query  1999  E-PTQRKPLSPISSLSFNTSSANIMDKIS--ESEELREMPASLLTTPIKNVSGIGGNATP  2169
             E P  RKP SPISS    +S ANI++ ++    E ++++   + TTP K       N TP
Sbjct  602   ESPMLRKPFSPISSTG--SSKANILEDVTTAHGETIKKI---VTTTPSKTTMADEENWTP  656

Query  2170  KtmpipmpstpasaassiamQMGMTPA-PV-----AATTPMVGHDGVEYSYEEMRAGFLL  2331
             K   +P+P     +  S+ MQ  +TPA PV      AT      + VEYS+EE RAGF+L
Sbjct  657   K--TMPIPVPTTPSTLSVPMQTAITPAHPVPVPYGGATPKEEVPEEVEYSFEERRAGFVL  714

Query  2332  PRLH  2343
             PR H
Sbjct  715   PRTH  718



>ref|XP_007038465.1| Microtubule associated protein family protein isoform 4 [Theobroma 
cacao]
 gb|EOY22966.1| Microtubule associated protein family protein isoform 4 [Theobroma 
cacao]
Length=729

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/731 (54%), Positives = 512/731 (70%), Gaps = 45/731 (6%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M   +ND  L++ETTC +LL ELQ IW+E+GE + +RDKML +LEQECLE YRRKVDQA+
Sbjct  1     MSTPKNDPLLQVETTCGTLLYELQIIWDEVGETDSDRDKMLLELEQECLEVYRRKVDQAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQS---SRSLKTELQAIMPlleemkkrkl  597
             R  AQLRQ +A+SEAELA IC+A+GE+PV++RQS   S SLK EL+ I+P LEEM+KRK+
Sbjct  61    RCRAQLRQTIADSEAELAAICSAMGERPVHIRQSDQNSGSLKEELRKILPQLEEMRKRKV  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             ER++QF EVL+Q   +  E+  S + +     +DE+DLSLR+LE++   L  LQKEKSDR
Sbjct  121   ERRNQFIEVLEQTQKITNEIYGSTESVSLKTVVDETDLSLRKLEELHRQLHELQKEKSDR  180

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             LKQV DHL  LNSLC V+G+DFK T+ E+HP+LGDS  L+S+S  TIE+L+ AI +LREV
Sbjct  181   LKQVQDHLHMLNSLCSVMGMDFKLTVSEVHPSLGDSDGLRSISNNTIEKLAIAIKKLREV  240

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             KIQR+  LQ+LATT++ELWNLMD P+EEQQ+F NVT  IAASE E+TEPN LS+D +   
Sbjct  241   KIQRMQRLQDLATTMLELWNLMDTPIEEQQMFQNVTCNIAASEHEITEPNTLSVDFINYV  300

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLA--IDDSIEFTDETIESGAIDPSHL  1311
             E EVSRL+E+KSSKMKE++LKKR  LE++CR+ HL    D +IE   E IESGA+D + +
Sbjct  301   EAEVSRLEELKSSKMKELVLKKRSELEDICRKTHLVPDSDSAIEDAIEAIESGAVDAATI  360

Query  1312  LEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKR  1491
             LEQ+E+QI+ VKEEAFSRKEILEKVEKWL AC+EE WLE+YNR++NRYN G+G HL LKR
Sbjct  361   LEQIELQIAKVKEEAFSRKEILEKVEKWLTACDEECWLEEYNRDENRYNAGKGAHLTLKR  420

Query  1492  AEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQR  1671
             AEKAR+LVNK+PGM+EAL S+   WE ER + F+YDG+ LLSMLE+Y +L+QEKE ER+R
Sbjct  421   AEKARSLVNKLPGMVEALASKTLAWEKEREIKFMYDGIRLLSMLEEYTILRQEKEQERRR  480

Query  1672  QR--DQKKLQGQLMAEQEVLFGSKRSPS-----QSGKKNVVGGASNKRISVGGAMLQTPY  1830
              R  DQKKLQGQL+AEQE L+GSK SPS     + G +   GGASN+R+S+GGAML    
Sbjct  481   LRVWDQKKLQGQLIAEQEALYGSKPSPSKPQSVKKGSRFSTGGASNRRVSLGGAMLPN--  538

Query  1831  TERAPLSSHSLK---KINPVK--QQALANITQN-----YVALSSGRRESSMHAKQPSCNK  1980
                 P S HS K   +  P K  ++   N  Q+     Y A+  G   + +  ++ S + 
Sbjct  539   --HKPDSLHSAKATPQTRPSKKTERIFQNDLQDDALPAYSAVRRGLDIADIPVRKHSSSA  596

Query  1981  SNLQKTE-PTQRKPLSPISSLSFNTSSANIMDKISESEEL--REMPASLL--TTPIKNVS  2145
              N  + E P  RKP SPISS    +S AN+ + + ++ +   + +P   L  TTP+K  S
Sbjct  597   VNANELESPLVRKPFSPISSTV--SSKANMTNMLEDNGDTLQKTIPTKDLSYTTPLKTTS  654

Query  2146  GIG-GNATPKtmpipmpstpasaassiamQMGMTPAPVAATTPMVGH------DGVEYSY  2304
              +   N TPK   +P+P     + +SI MQ  MTPAP     P +        + +E S+
Sbjct  655   LVDEENTTPK--AMPIPVPSTPSTASIPMQTAMTPAP---PIPFITKPAEEMPEEIEQSF  709

Query  2305  EEMRAGFLLPR  2337
             EE R  FLL +
Sbjct  710   EERRLAFLLSK  720



>ref|XP_010035008.1| PREDICTED: LOW QUALITY PROTEIN: 65-kDa microtubule-associated 
protein 3-like [Eucalyptus grandis]
Length=728

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/725 (52%), Positives = 516/725 (71%), Gaps = 30/725 (4%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M   Q+D  L +ETTC +LL ELQ IW+E+GE +++RD+ML +LE+ECL+ Y RKVDQA+
Sbjct  1     MSRLQSDPLLEVETTCGTLLCELQIIWDEVGESDVDRDQMLLELEKECLQVYMRKVDQAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrkl  597
             R  AQLRQ +A+SEAELA IC+A+GE+PV++RQS +   SLK EL+ I+P LEEM+KRK 
Sbjct  61    RYRAQLRQKIADSEAELAAICSAMGERPVHIRQSDQNAGSLKEELKIILPQLEEMRKRKC  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             ER+ QF EVL+QI S++ EL +S++     + +DESDLSLR+LE++   L +LQ+EKS+R
Sbjct  121   ERRQQFLEVLEQIQSIINELHRSKEHTSSKVVVDESDLSLRKLEELHRQLHALQQEKSNR  180

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             LKQ+ D + +LNSLCIVLG+DFK+T+ E+H +LG++   K +S  TIE+L++ I  LREV
Sbjct  181   LKQIQDLMCTLNSLCIVLGLDFKHTVSEVHFSLGNAEGSKDISNRTIEQLASMIQNLREV  240

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             K+QR+  LQ+LAT ++ELWNLMD P+EEQQ+F NVT  +AASE E++EP+ALS+  +   
Sbjct  241   KLQRMQRLQDLATNLLELWNLMDTPLEEQQMFQNVTCNVAASEHEISEPDALSVASINHV  300

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAI--DDSIEFTDETIESGAIDPSHL  1311
             E EV+RL+E+K SKMKE++LKKR  LEE+CR+ HL    D ++++  E +ESGA D + +
Sbjct  301   EAEVARLEELKLSKMKELVLKKRSELEEICRKTHLIPEEDSTMKYIIEAMESGAADAACV  360

Query  1312  LEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKR  1491
             LEQ+E+ I+ VKEEAFSRKE+LEKVEKWLAAC+EE WLE+YNR++NRYN GRG HL+LKR
Sbjct  361   LEQIEVHIAKVKEEAFSRKELLEKVEKWLAACDEECWLEEYNRDENRYNAGRGAHLILKR  420

Query  1492  AEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQR  1671
             AEKAR+LVNK+P M+EAL+S+   WE ERG+ F YDG+ LLSML++Y LL+QEKE ER+R
Sbjct  421   AEKARSLVNKLPAMVEALSSKTVSWEKERGIEFTYDGIRLLSMLDEYNLLRQEKEQERRR  480

Query  1672  QRDQKKLQGQLMAEQEVLFGSKRSPS--QSGKKN---VVGGASNKRISVGGAMLQTPYTE  1836
              RDQKKL GQL+AEQE L+GSK SPS  Q+ KK      GGAS KR S+GGA LQTP  +
Sbjct  481   LRDQKKLHGQLVAEQEALYGSKPSPSKVQTTKKTPRISTGGASGKRXSLGGAALQTPKAD  540

Query  1837  RAPLSSHSLKKI---NPVKQQALANIT---QNYVALSSGRR--ESSMHAKQPSCNKSNLQ  1992
               PL  HSLK      P+K+           N   +S+GRR  + +  A + S   +   
Sbjct  541   --PL--HSLKATPHSRPIKKSERVQKNDRFNNQPDVSAGRRGLDGAGPAAKHSFGAATAH  596

Query  1993  KTE-PTQRKPLSPISSLSFNTSSANIMDKISESEELREMPA-SLLTTPIKNV--SGIGGN  2160
             + E P +RKP SPI+  +  T+S +  + I      +  P+ +  +TP+K    +    N
Sbjct  597   QPESPMRRKPFSPITLKAHRTNSLDNANVIHGEVLQKAFPSNNTFSTPLKKTLQTTDDEN  656

Query  2161  ATPKtmpipmpstpasaassiamQMG----MTPAPVAATTPMVGHDGVEYSYEEMRAGFL  2328
              TP+TMPI +P+TP++ +  +   M       P+ V   TP    + +EYS+EE RAGF+
Sbjct  657   MTPRTMPIHVPTTPSTVSVPMHTAMTPDLLNLPSSVGTMTPKEIPEVIEYSFEERRAGFV  716

Query  2329  LPRLH  2343
             LP+++
Sbjct  717   LPKMN  721



>ref|XP_006606398.1| PREDICTED: 65-kDa microtubule-associated protein 3-like [Glycine 
max]
 gb|KHN05039.1| 65-kDa microtubule-associated protein 3 [Glycine soja]
Length=727

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/733 (53%), Positives = 513/733 (70%), Gaps = 46/733 (6%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M   QND  ++ ETTC +LL ELQ IW+E+GE E +RD+ML +LEQECLE YRRKVD A+
Sbjct  1     MSKPQNDPLVQSETTCGTLLYELQIIWDEVGESESDRDRMLFELEQECLEVYRRKVDLAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrkl  597
             RS AQLRQA+A+ EAELA IC+++GE+PV++RQ+ +   SLK E   I+P LEEM+KRK+
Sbjct  61    RSRAQLRQAIADCEAELAAICSSMGERPVHIRQTDQNAGSLKEEHARILPQLEEMQKRKI  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIAL-DESDLSLRRLEDMKSHLLSLQKEKSD  774
             ER++QF E+ +QI S+  E+   R   +++ A+ DE+DLSLR+LE++   L +LQ EKS 
Sbjct  121   ERRNQFIEIQEQIQSISIEIYGPR---EYIPAVEDETDLSLRKLEELHRQLHALQIEKSS  177

Query  775   RLKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELRE  954
             RLKQV +HL +LNSLC+VLG DFK TI  IHP+L DS   KSVS +TI++L+ AI ELRE
Sbjct  178   RLKQVQEHLCTLNSLCLVLGFDFKQTINGIHPSLVDSKGSKSVSNDTIQQLAVAIQELRE  237

Query  955   VKIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKS  1134
             VK+QR+  LQ+LATT++ELWNLMD P+EEQQ+F NVT  IAASE E+TEPN LS+D +  
Sbjct  238   VKLQRMQKLQDLATTMLELWNLMDTPIEEQQMFQNVTCNIAASEHEVTEPNTLSVDFINL  297

Query  1135  AEIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLA--IDDSIEFTDETIESGAIDPSH  1308
              E+EV+RL+ +KSSKMKE++LKKR  LEE+CR+ HL   ID+++E   E IESG++DP+ 
Sbjct  298   VEVEVARLEALKSSKMKELVLKKRTELEEICRKTHLIPEIDNAVESAVEAIESGSVDPAF  357

Query  1309  LLEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLK  1488
             +LEQ+E+QIS VKEEA  RKEILEKVEKWLAAC+EESWLE+YNR+DNRYN GRG HL LK
Sbjct  358   VLEQIELQISQVKEEALGRKEILEKVEKWLAACDEESWLEEYNRDDNRYNAGRGAHLTLK  417

Query  1489  RAEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQ  1668
             RAEKARALVNKIP M++ LTS+   WE E+G+ F YDG+ LLSM+E+Y +L+QEKE ER+
Sbjct  418   RAEKARALVNKIPAMVDGLTSKTISWEKEKGIEFTYDGIRLLSMVEEYNILRQEKEQERR  477

Query  1669  RQRDQKKLQGQLMAEQEVLFGSKRSPS--QSGKK----NVVGGASNKRISVGGAMLQTPY  1830
             RQRD KKLQGQ++AEQE L+GSK SPS  QS KK    +  GGA+++R+S+GGAMLQTP 
Sbjct  478   RQRDLKKLQGQMIAEQEALYGSKPSPSKPQSVKKGPRMSTGGGAASRRVSLGGAMLQTPK  537

Query  1831  TERAPLSSHSLKKINPVKQ-QALANITQNYVALSSGRRE---SSMHAKQPSCNKSNLQKT  1998
              +     S +++K++ V Q + L  +      LS+ RR    +    K+ S         
Sbjct  538   PDSKSTHSRAMRKVDKVHQIEHLNYLDDGISGLSAARRGLDIAGAPVKKHSFGAGTQIIE  597

Query  1999  EPTQRKPLSPISSLSFNTSS--ANIMDKISESEELREMPASL----LTTPIKNVSGIGG-  2157
              P  R+P SPISS S ++ +  AN  D++S+  E  +   SL     TTP K V  +   
Sbjct  598   SPLIRQPFSPISSNSVSSKANVANATDELSKQNEKLQRTVSLNNGPFTTPSKTVPTVVDE  657

Query  2158  -NATPKtmpipmpstpasaassiamQMGMTPAPVAA-------TTPM---VGHDG----V  2292
              N TP      +P+    +  S+ M M MTP P +        +TP+    G++     V
Sbjct  658   ENRTPN-----IPAPATPSTVSVPMNMAMTPVPSSILKNVSLNSTPISVPYGNNDLVQEV  712

Query  2293  EYSYEEMRAGFLL  2331
             EYS+EE R  + +
Sbjct  713   EYSFEEKRLSYYM  725



>gb|KHG09945.1| 65-kDa microtubule-associated 3 -like protein [Gossypium arboreum]
Length=729

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/726 (52%), Positives = 490/726 (67%), Gaps = 40/726 (6%)
 Frame = +1

Query  265   DQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQL  444
             D  L++ETTC +LL ELQ IW+E+GE + +RDKML +LE+ECLE YRRKVDQA+R  AQL
Sbjct  7     DPLLQVETTCGTLLYELQIIWDEVGETDADRDKMLLELERECLEVYRRKVDQANRCRAQL  66

Query  445   RQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrklerkHQF  615
             RQ +A+SEAELA IC+A+GE+PV++RQS +   SLK EL  I+P LEEMKKRK+ER++QF
Sbjct  67    RQTIADSEAELAAICSAMGERPVHIRQSDQNAGSLKEELSKILPQLEEMKKRKIERRNQF  126

Query  616   SEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLD  795
              EVL+QI  +  E+  S +       +DE+DLSLR+LE++   L  LQ EKSDRLKQV D
Sbjct  127   VEVLEQIQKITNEIYGSTESFSSKTDVDETDLSLRKLEELHRQLHELQTEKSDRLKQVQD  186

Query  796   HLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQRLH  975
             +L  LN LC V+G+DFK T+ EIHPTLGD    +S+S  TIE+L+  I +LREVKIQR+ 
Sbjct  187   YLSMLNELCSVMGMDFKQTVDEIHPTLGDPKGFRSISNNTIEQLATLIKKLREVKIQRMQ  246

Query  976   MLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSR  1155
              LQ+LATT++ELWNLMD P+EEQQ+F NVT  +AASE E+TEPN LS+D +K  E EVSR
Sbjct  247   RLQDLATTMLELWNLMDTPIEEQQMFQNVTCNVAASEHEITEPNTLSVDFIKYVEAEVSR  306

Query  1156  LQEMKSSKMKEVLLKKRITLEELCRQAHLAIDDSIEFTDE--TIESGAIDPSHLLEQLEI  1329
             L+E+KSSKMKE++LKKR+ LEE+CR+ HL  D      D    IESG +D + +LEQ+E+
Sbjct  307   LEELKSSKMKELVLKKRLELEEICRKTHLVPDSECAIEDAIVAIESGLVDAATILEQIEL  366

Query  1330  QISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnryngg-rgTHLMLKRAEKAR  1506
             QI+ VKEEAFSRKEILEKVEKWL AC+EE WLE+YNR D       +G HL LKRAEKAR
Sbjct  367   QIAKVKEEAFSRKEILEKVEKWLTACDEECWLEEYNRVDENRYNAGKGAHLTLKRAEKAR  426

Query  1507  ALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQK  1686
             ALVNK+PGM+EAL S+   WE ERGV FLYDG+ LLSMLE+Y +L+QEKE ER+R RDQK
Sbjct  427   ALVNKLPGMVEALASKTVAWEKERGVEFLYDGIRLLSMLEEYTILRQEKEQERRRLRDQK  486

Query  1687  KLQGQLMAEQEVLFGSKRSPS-----QSGKKNVVGGASNKRISVGGAMLQTPYTERAPLS  1851
             KLQGQL+AEQE L+GSK SPS     + G +   GGASN+R+S+GGAM+        P S
Sbjct  487   KLQGQLIAEQEALYGSKPSPSKPQSVKKGPRYSTGGASNRRVSLGGAMVPA----HKPDS  542

Query  1852  SHSLK---KINPVKQQALANITQN-----YVALSSGRRESSMHAKQPSCNKSNLQKTEPT  2007
              HS K   K  P K+    N  Q+     + A+  G   +    ++ S   S +   EP 
Sbjct  543   LHSAKATPKTRPSKKSDHLNHRQDDGIPAFSAVRRGLDIAETPVRKHSSTPSAVNGKEPE  602

Query  2008  Q----RKPLSPI-SSLSFNTSSANIMDKISESEELREM--PASLL---TTPIKNVSGIG-  2154
                  RKP SPI S++S   +  N+++   + E   +M  P++ L   TTP+K +  I  
Sbjct  603   SPLLVRKPFSPIASAVSSKANMTNMLEVEDDGETSHKMLHPSNDLSHTTTPLKTIPLIDE  662

Query  2155  GNATPKtmpipmpstpasaassiamQMGMTPAPVAATTPMV---GHDGVEYSYEEMRAGF  2325
              N TPK            +  S+ MQ  MTPAP  A  P       + +E S+EE R  F
Sbjct  663   ENRTPK---AMPIIPSTPSTLSVPMQTAMTPAPPLAPIPFAITKPVEEIEQSFEERRLAF  719

Query  2326  LLPRLH  2343
             LL ++ 
Sbjct  720   LLSKIQ  725



>ref|XP_006487487.1| PREDICTED: 65-kDa microtubule-associated protein 3-like [Citrus 
sinensis]
Length=727

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/720 (52%), Positives = 504/720 (70%), Gaps = 30/720 (4%)
 Frame = +1

Query  262   NDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQ  441
             ND  L++ETT  SL+ +LQ IW+E+GE + ++DKML +LEQECL+ YRRKVD+A+R  A 
Sbjct  5     NDPFLQVETTSGSLIEQLQIIWDEVGETDTDKDKMLLELEQECLQVYRRKVDEANRCRAH  64

Query  442   LRQAVAESEAELARICAALGEQPVNVRQSSRS---LKTELQAIMPlleemkkrklerkHQ  612
             LRQ +A+ EAELA IC+A+ E PV+ RQS ++   LK EL+ I+P LEEM+KRK +RK Q
Sbjct  65    LRQTIADYEAELAAICSAMAEPPVHNRQSDQTAGNLKEELRNILPQLEEMRKRKSDRKEQ  124

Query  613   FSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVL  792
             F +VL+QI  +  E+ +S   +     +DE+DLSLR+LE+    L  LQKEKSDR+KQV 
Sbjct  125   FVQVLEQIQMIKNEIYRSTIYISSKTVVDETDLSLRKLEEFHRELHELQKEKSDRMKQVQ  184

Query  793   DHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQRL  972
             DHL +LNS C VLG+DFK T+ +IHP+ G+S   +S+S +TIE+L+ AI +LREVKIQR+
Sbjct  185   DHLNTLNSFCSVLGMDFKLTVSQIHPSFGNSDGSRSISDDTIEQLTIAIQKLREVKIQRM  244

Query  973   HMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVS  1152
               LQ+LATT++ELWNLMD P+EEQQ+F NVT  IAASE E+TE N LS+D +   E EV+
Sbjct  245   QKLQDLATTMLELWNLMDTPIEEQQMFQNVTCNIAASEREITERNTLSVDFIDHVEAEVT  304

Query  1153  RLQEMKSSKMKEVLLKKRITLEELCRQAHLAI--DDSIEFTDETIESGAIDPSHLLEQLE  1326
             RL+E+KSSKMKE++LKK+  LEE+CR+ H+    D S+E+T E IESG  DP+++LEQ+E
Sbjct  305   RLEELKSSKMKELVLKKQSELEEICRKNHMVPENDSSMEYTLEAIESGTTDPANVLEQIE  364

Query  1327  IQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKAR  1506
             +QI+  KEEAFSRK+ILEK++KWLAA EEESWLEDYNR++NRYN GRG+HL+LKRAEKAR
Sbjct  365   LQIAKAKEEAFSRKDILEKIDKWLAAREEESWLEDYNRDENRYNAGRGSHLILKRAEKAR  424

Query  1507  ALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQK  1686
             +LVNK+PGM+E L S+   WE ERGV FLYDGV L SML++Y +L+QEKE ER+RQRDQK
Sbjct  425   SLVNKLPGMVETLASKTSAWETERGVEFLYDGVRLHSMLDEYTILRQEKEQERRRQRDQK  484

Query  1687  KLQGQLMAEQEVLFGSKRSP--SQSGKK---NVVGGASNKRISVGGAMLQTPYTE-----  1836
             KL+ QL+AEQE L+GSK SP  +QS KK      GGA+N+R+ VGG MLQTP  +     
Sbjct  485   KLKEQLIAEQEALYGSKPSPLKAQSVKKVPRVSSGGANNRRLPVGGTMLQTPKPDSLGSI  544

Query  1837  RAPLSSHSLKKINPVKQQALANI--TQNYVALSSGRRESSMHAKQPSCNKSNL-QKTEPT  2007
             +A   SH +KKI+   Q   +N+         S+GRR   +  +      S+  ++  P 
Sbjct  545   KATPHSHPIKKIDRTLQHDPSNLHPDDGCATESAGRRGLDIPGEPKKKQSSDASEQDSPM  604

Query  2008  QRKPLSPISSLSFNTSSANIMDKISESEELREMPASL-LTTPIKNVSGIGG-NATPKtmp  2181
             +R+P S I+S    T+S+N ++   E+ +  + P  L  TTP    S I   N TPK+MP
Sbjct  605   KRRPFSAINS----TTSSNDVNPNGETVQKPDPPFDLSFTTPSNTNSFIDDENMTPKSMP  660

Query  2182  ipmpstpasaassiamQMGMTPA-----PVAATTPMVGHDGV-EYSYEEMRAGFLLPRLH  2343
             IP+P TP + +  +              P      +   +G+ EYS+EE RAGF+LP +H
Sbjct  661   IPVPPTPPTISVPMQTTTTTPAPADALIPFNVYQVVETAEGIDEYSFEERRAGFVLPEIH  720



>ref|XP_003536194.2| PREDICTED: 65-kDa microtubule-associated protein 3-like [Glycine 
max]
Length=745

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/747 (52%), Positives = 513/747 (69%), Gaps = 42/747 (6%)
 Frame = +1

Query  202   RFLSPPGLLGRIASDMYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLE  381
             +F+ P       +  M   QND  L+ ETTC +LL ELQ IW+E+GE E +RD+ML +LE
Sbjct  2     QFVDPLHCSDTKSPKMSKPQNDPLLQSETTCGTLLYELQIIWDEVGEAESDRDRMLFELE  61

Query  382   QECLEAYRRKVDQASRSCAQLRQAVAESEAELARICAALGEQPVNVRQSSR---SLKTEL  552
             QECLE YRRKVD A+RS AQLRQA+A+ EAELA IC+++GE+PV++RQ+ +   SLK E 
Sbjct  62    QECLEVYRRKVDLANRSRAQLRQAIADCEAELAAICSSMGERPVHIRQADQNAGSLKEEH  121

Query  553   QAIMPlleemkkrklerkHQFSEVLDQIDSVLKELGKSRKELQHMIAL-DESDLSLRRLE  729
               I+P LEEM+KRK+ER++QF EV +QI S+  E+   R   +++ A+ DE+DLSLR+LE
Sbjct  122   ARILPQLEEMQKRKIERRNQFIEVQEQIQSISIEIYGPR---EYIPAVEDETDLSLRKLE  178

Query  730   DMKSHLLSLQKEKSDRLKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVST  909
             ++   L +LQ EKS RLKQV +HL +LNSLC+VLG DFK TI  IHP+L DS   KSVS 
Sbjct  179   ELHRQLHALQIEKSSRLKQVQEHLYTLNSLCLVLGFDFKQTINGIHPSLLDSEGSKSVSN  238

Query  910   ETIERLSAAIHELREVKIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASES  1089
             +TI++L+ AI ELREVK+QR+  LQ+LATT++ELWNLMD P+EEQQ+F NVT  IAASE 
Sbjct  239   DTIQQLAVAIQELREVKLQRMQKLQDLATTMLELWNLMDTPIEEQQMFQNVTCNIAASEH  298

Query  1090  ELTEPNALSLDLLKSAEIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLA--IDDSIE  1263
             E+TEPN LS+D +   E EV+RL+ +KSSKMKE++LKKR  LEE+CR+ HL   ID+++E
Sbjct  299   EVTEPNTLSVDFINLVEAEVARLEALKSSKMKELVLKKRTELEEICRKTHLIPEIDNAVE  358

Query  1264  FTDETIESGAIDPSHLLEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrn  1443
                + IESG++DP+ +LEQ+E+QIS VKEEAF RKEILEKVEKWLAAC+EESWLE+YNR+
Sbjct  359   SAVDAIESGSVDPACILEQIELQISQVKEEAFGRKEILEKVEKWLAACDEESWLEEYNRD  418

Query  1444  dnrynggrgTHLMLKRAEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSML  1623
             DNRYN GRG HL LKRAEKARALVNKIP M++ LTS+   WE E+G+ F YDG+ LLSML
Sbjct  419   DNRYNAGRGAHLTLKRAEKARALVNKIPAMVDGLTSKTIAWEKEKGIEFTYDGIRLLSML  478

Query  1624  EQYGLLKQEKELERQRQRDQKKLQGQLMAEQEVLFGSKRSPS-----QSGKKNVVGGASN  1788
             E+Y +L+Q KE ER+RQRD KKLQGQ++AEQE L+GSK SPS     + G +   GGA++
Sbjct  479   EEYNILRQGKEQERRRQRDLKKLQGQMIAEQEALYGSKPSPSKPQSVKKGPRMSTGGAAS  538

Query  1789  KRISVGGAMLQTPYTERAPLSSHSLKKINPVKQQALANITQNYVA-LSSGRRE---SSMH  1956
             +R+S+GGAMLQTP  +     S + +KI+   Q    N   + +A LS+ RR    + + 
Sbjct  539   RRVSLGGAMLQTPKPDSKATHSRATRKIDKAHQIEHLNYLDDGIAGLSAARRGLDIAGVP  598

Query  1957  AKQPSCNKSNLQKTEPTQRKPL--SPISSLSFNTSSANIMDKISESEELREMPASL----  2118
              K+ S          P  R+P      +S+S  ++ AN  D+ ++  E  +   SL    
Sbjct  599   VKKHSFGAGTQIIESPLLRQPFSPISSNSVSSKSNVANATDEQNKQSEKLQRTLSLNNVP  658

Query  2119  LTTPIKNVSGIGG--NATPKtmpipmpstpasaassiamQMGMTPAP--------VAATT  2268
              TTP K  + +    N TPK   IP+P     +  S+ M M MTP P        + +TT
Sbjct  659   FTTPSKTATTVVDEENRTPK--AIPIPVPATPSTVSVPMNMAMTPVPSSIFKNISLNSTT  716

Query  2269  PMV---GHDGV---EYSYEEMRAGFLL  2331
             P     G+D V   EYS+EE R  + +
Sbjct  717   PTSVPHGNDMVQEAEYSFEEKRLSYYM  743



>gb|KHN30546.1| 65-kDa microtubule-associated protein 3 [Glycine soja]
Length=752

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/754 (51%), Positives = 516/754 (68%), Gaps = 49/754 (6%)
 Frame = +1

Query  202   RFLSPPGLLGRIASDMYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLE  381
             +F+ P       +  M   QND  L+ ETTC +LL ELQ IW+E+GE E +RD+ML +LE
Sbjct  2     QFVDPLHCSDTKSPKMSKPQNDPLLQSETTCGTLLYELQIIWDEVGEAESDRDRMLFELE  61

Query  382   QECLEAYRRKVDQASRSCAQLRQAVAESEAELARICAALGEQPVNVRQSSR---SLKTEL  552
             QECLE YRRKVD A+RS AQLRQA+A+ EAELA IC+++GE+PV++RQ+ +   SLK E 
Sbjct  62    QECLEVYRRKVDLANRSRAQLRQAIADCEAELAAICSSMGERPVHIRQADQNAGSLKEEH  121

Query  553   QAIMPlleemkkrklerkHQFSEVLDQIDSVLKELGKSRKELQHMIAL-DESDLSLRRLE  729
               I+P LEEM+KRK+ER++QF EV +QI S+  E+   R   +++ A+ DE+DLSLR+LE
Sbjct  122   ARILPQLEEMQKRKIERRNQFIEVQEQIQSISIEIYGPR---EYIPAVEDETDLSLRKLE  178

Query  730   DMKSHLLSLQKEKSDRLKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVST  909
             ++   L +LQ EKS RLKQV +HL +LNSLC+VLG DFK TI  IHP+L DS   KSVS 
Sbjct  179   ELHRQLHALQIEKSSRLKQVQEHLYTLNSLCLVLGFDFKQTINGIHPSLLDSEGSKSVSN  238

Query  910   ETIERLSAAIHELREVKIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASES  1089
             +TI++L+ AI ELREVK+QR+  LQ+LATT++ELWNLMD P+EEQQ+F NVT  IAASE 
Sbjct  239   DTIQQLAVAIQELREVKLQRMQKLQDLATTMLELWNLMDTPIEEQQMFQNVTCNIAASEH  298

Query  1090  ELTEPNALSLDLLKSAEIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLA--IDDSIE  1263
             E+TEPN LS+D +   E EV+RL+ +KSSKMKE++LKKR  LEE+CR+ HL   ID+++E
Sbjct  299   EVTEPNTLSVDFINLVEAEVARLEALKSSKMKELVLKKRTELEEICRKTHLIPEIDNAVE  358

Query  1264  FTDETIESGAIDPSHLLEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrn  1443
                + IESG++DP+ +LEQ+E+QIS VKEEAF RKEILEKVEKWLAAC+EESWLE+YNR+
Sbjct  359   SAVDAIESGSVDPACILEQIELQISQVKEEAFGRKEILEKVEKWLAACDEESWLEEYNRD  418

Query  1444  dnrynggrgTHLMLKRAEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSML  1623
             DNRYN GRG HL LKRAEKARALVNKIP M++ LTS+   WE E+G+ F YDG+ LLSML
Sbjct  419   DNRYNAGRGAHLTLKRAEKARALVNKIPAMVDGLTSKTIAWEKEKGIEFTYDGIRLLSML  478

Query  1624  EQYGLLKQEKELERQRQRDQKKLQGQLMAEQEVLFGSKRSPS-----QSGKKNVVGGASN  1788
             E+Y +L+Q KE ER+RQRD KKLQGQ++AEQE L+GSK SPS     + G +   GGA++
Sbjct  479   EEYNILRQGKEQERRRQRDLKKLQGQMIAEQEALYGSKPSPSKPQSVKKGPRMSTGGAAS  538

Query  1789  KRISVGGAMLQTPYTERAPLSSHSLKKINPVKQQALANITQNYVA-LSSGRRESSMHAKQ  1965
             +R+S+GGAMLQTP  +     S + +KI+   Q    N   + +A LS+G  +S + A +
Sbjct  539   RRVSLGGAMLQTPKPDSKATHSRATRKIDKAHQIEHLNYLDDGIAGLSAGGSQSHITAAR  598

Query  1966  PSCNKSNL----------QKTEPTQRKPL--SPISSLSFNTSSANIMDKISESEELREMP  2109
                + + +           +  P  R+P      +S+S  ++ AN  D+ ++  E  +  
Sbjct  599   RGLDIAGVPVKKHSFGAGTQESPLLRQPFSPISSNSVSSKSNVANATDEQNKQSEKLQRT  658

Query  2110  ASL----LTTPIKNVSGIGG--NATPKtmpipmpstpasaassiamQMGMTPAP------  2253
              SL     TTP K  + +    N TPK   IP+P     +  S+ M M MTP P      
Sbjct  659   LSLNNVPFTTPSKTATTVVDEENRTPK--AIPIPVPATPSTVSVPMNMAMTPVPSSIFKN  716

Query  2254  --VAATTPMV---GHDGV---EYSYEEMRAGFLL  2331
               + +TTP     G+D V   EYS+EE R  + +
Sbjct  717   ISLNSTTPTSVPHGNDMVQEAEYSFEEKRLSYYM  750



>ref|XP_002318272.2| hypothetical protein POPTR_0012s14340g [Populus trichocarpa]
 gb|EEE96492.2| hypothetical protein POPTR_0012s14340g [Populus trichocarpa]
Length=728

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/731 (53%), Positives = 517/731 (71%), Gaps = 47/731 (6%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M N Q+D+ L++ETTC +LL ELQ IWNE+GE + +RDKML +LEQECLE YRRKVDQA+
Sbjct  1     MSNVQSDRLLQVETTCGTLLYELQIIWNEVGETDTDRDKMLLELEQECLEVYRRKVDQAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrkl  597
             R+ AQLRQA+A+SEAELA IC+++GE+PV++RQ+ +   SLK EL  I+P LEEM+KRKL
Sbjct  61    RNRAQLRQAIADSEAELAVICSSMGERPVHIRQADQNAGSLKEELGRILPQLEEMRKRKL  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             +R+ QF EV++ I  +  E+  S     H I +DE+DLSLRRLE++   L  L+KEKSDR
Sbjct  121   DRRKQFHEVVEDIRKISSEIYGS---ADHNILVDEADLSLRRLEELHRQLHELEKEKSDR  177

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             LKQV  HL++LN+LC+VLG+DFK+T  E+H + GDS   + +S +TI+ L+AAIH+LREV
Sbjct  178   LKQVQQHLDTLNALCLVLGMDFKHTTSEVHTSFGDSGGSRDISNQTIQLLAAAIHKLREV  237

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             KI R+  LQ+LATT++ELWNLMD PVEEQQ F NVT  IAASE E+TEPN LSLD +K  
Sbjct  238   KIHRMQRLQDLATTMLELWNLMDTPVEEQQEFQNVTCNIAASEHEITEPNTLSLDFIKYV  297

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLA--IDDSIEFTDETIESGAIDPSHL  1311
             E EVSRL+E+KSSKMKE++LKKR  LEE+CR+ H+    D ++E+  E IESG +DP+ +
Sbjct  298   EAEVSRLEELKSSKMKELVLKKRSELEEICRKMHMIPEADAAVEYAVEAIESGNLDPASI  357

Query  1312  LEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKR  1491
             LEQ+E+QI+N+KEEAFSRKEILEKVEKWL ACEEESWLE+YNR+DNRYN GRGTHL+LKR
Sbjct  358   LEQIELQIANIKEEAFSRKEILEKVEKWLNACEEESWLEEYNRDDNRYNAGRGTHLILKR  417

Query  1492  AEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQR  1671
             AEKAR+LVNK+PGM+EAL S+   WE ERG  FLYDG+ LLSMLE+Y +L+QEKE ER+R
Sbjct  418   AEKARSLVNKMPGMVEALASKTMAWEKERGAEFLYDGIRLLSMLEEYTILRQEKEEERRR  477

Query  1672  QRDQKKLQGQLMAEQEVLFGSKRSPSQSGKKNV-----VGGASNKRISVGGAMLQT----  1824
             QRDQKKLQGQL+AEQE L+GSK SPS+            GGASN+R+S+GG MLQT    
Sbjct  478   QRDQKKLQGQLIAEQEALYGSKPSPSKPPSVKKTPRVSTGGASNRRLSLGGTMLQTPRPD  537

Query  1825  -PYTERAPLSSHSLKKINPVKQQALANITQN--YVALSSGRRE---SSMHAKQPSCNKSN  1986
              P++ +A     +  K++   Q       Q+  + ALS+GRR    + +  K+ +    N
Sbjct  538   LPHSSKATPHPRAGNKVDRTHQNDHLKPQQDDGFDALSAGRRGLDIAGLATKKHAFGAVN  597

Query  1987  LQKTE-PTQRKPLSPISSLSFNTSSANIMDKIS--ESEELREMPASLLTTPIKNVSGIGG  2157
              ++ + P  R+P SPISS    +S +NI+++ +   ++  ++      T PI +VS    
Sbjct  598   AREPQSPMLRQPFSPISSTV--SSKSNILEEATTPHNDTFKK------TLPINDVSF---  646

Query  2158  NATPKtmpipmpstpasaassiamQMGMTPAPVA---------ATTPMVGHDGVEYSYEE  2310
               TP                ++ + M MTP+ V+         A  P+   + +EYS+EE
Sbjct  647   -KTPSKTNTIADEENRRTPKAMPIPMPMTPSTVSVPMQTAMTPAVNPVETPEEIEYSFEE  705

Query  2311  MRAGFLLPRLH  2343
              RAGF+LP  H
Sbjct  706   RRAGFVLPNTH  716



>gb|KDO50061.1| hypothetical protein CISIN_1g004858mg [Citrus sinensis]
Length=727

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/722 (52%), Positives = 504/722 (70%), Gaps = 34/722 (5%)
 Frame = +1

Query  262   NDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQ  441
             ND  L+ ETT  SL+ +LQ IW+E+GE + ++DKML +LEQECL+ YRRKVD+A+R  A 
Sbjct  5     NDPFLQEETTSGSLIEQLQIIWDEVGETDTDKDKMLLELEQECLQVYRRKVDEANRCRAH  64

Query  442   LRQAVAESEAELARICAALGEQPVNVRQSSRS---LKTELQAIMPlleemkkrklerkHQ  612
             LRQ +A+ EAELA IC+A+ E PV+ RQS ++   LK EL+ I+P LEEM+KRK +RK Q
Sbjct  65    LRQTIADYEAELAAICSAMAEPPVHNRQSDQTAGNLKEELRNILPQLEEMRKRKSDRKEQ  124

Query  613   FSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVL  792
             F +VL+QI  +  E+ +S   +     +DE+ LSLR+LE+    L  LQKEKSDR+KQV 
Sbjct  125   FVQVLEQIQMIKNEIYRSTIYISSKTVVDETGLSLRKLEEFHRELHELQKEKSDRMKQVQ  184

Query  793   DHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQRL  972
             DHL +LNS C VLG+DFK T+ +IHP+ G+S   +S+S +TIE+L+ AI +LREVKIQR+
Sbjct  185   DHLNTLNSFCSVLGMDFKLTVSQIHPSFGNSEGSRSISDDTIEQLTTAIQKLREVKIQRM  244

Query  973   HMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVS  1152
               LQ+LATT++ELWNLMD P+EEQQ+F NVT  IAASE E+TE N LS+D +   E EV+
Sbjct  245   QKLQDLATTMLELWNLMDTPIEEQQMFQNVTCNIAASEREITERNTLSVDFIDHVEAEVT  304

Query  1153  RLQEMKSSKMKEVLLKKRITLEELCRQAHLA--IDDSIEFTDETIESGAIDPSHLLEQLE  1326
             RL+E+KSSKMKE++LKK+  LEE+CR+ H+    D S+E+T E IESG  DP+++LEQ+E
Sbjct  305   RLEELKSSKMKELVLKKQSELEEICRKNHMVPENDSSMEYTLEAIESGTTDPANVLEQIE  364

Query  1327  IQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKAR  1506
             +QI+  KEEAFSRK+ILEK++KWLAACEEESWLEDYNR++NRYN GRG+HL+LKRAEKAR
Sbjct  365   LQIAKAKEEAFSRKDILEKIDKWLAACEEESWLEDYNRDENRYNAGRGSHLILKRAEKAR  424

Query  1507  ALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQK  1686
             +LVNK+PGM+E L S+   WE ERGV FLYDGV L SML++Y +L+QEKE ER+RQRDQK
Sbjct  425   SLVNKLPGMVETLASKTIAWETERGVEFLYDGVRLHSMLDEYTILRQEKEQERRRQRDQK  484

Query  1687  KLQGQLMAEQEVLFGSKRSP--SQSGKK---NVVGGASNKRISVGGAMLQTPYTE-----  1836
             KL+ QL+AEQE L+GSK SP  +QS KK      GGA+N+R+ VGG MLQTP  +     
Sbjct  485   KLKEQLIAEQEALYGSKPSPLKAQSVKKVPRVSSGGANNRRLPVGGTMLQTPKPDSLGSI  544

Query  1837  RAPLSSHSLKKINPVKQQALAN--ITQNYVALSSGRRESSMHA---KQPSCNKSNLQKTE  2001
             +A   S  +KKI+   Q   +N  +       S+GRR   +     K+ S + S  ++  
Sbjct  545   KATPHSRPIKKIDRTLQHDPSNLHLDDGCATESAGRRGLDIPGEPKKKQSSDAS--EQDS  602

Query  2002  PTQRKPLSPISSLSFNTSSANIMDKISESEELREMPASL-LTTPIKNVSGIGG-NATPKt  2175
             P +R+P S I+S    T+S+N ++   E+ +  + P  L  TTP    S I   N TPK+
Sbjct  603   PMKRRPFSAINS----TTSSNDVNPNGETVQKPDPPFDLSFTTPSNTNSFIDDENMTPKS  658

Query  2176  mpipmpstpasaassiamQMGMTPA-----PVAATTPMVGHDGV-EYSYEEMRAGFLLPR  2337
             MPIP+P TP + +  +              P      +   +G+ EYS+EE RAGF+LP 
Sbjct  659   MPIPVPPTPPTISVPMQTTTTTPAPADAPIPFNVYQVVETAEGIDEYSFEERRAGFVLPE  718

Query  2338  LH  2343
             +H
Sbjct  719   IH  720



>ref|XP_006423735.1| hypothetical protein CICLE_v10027898mg [Citrus clementina]
 gb|ESR36975.1| hypothetical protein CICLE_v10027898mg [Citrus clementina]
Length=727

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/721 (52%), Positives = 501/721 (69%), Gaps = 30/721 (4%)
 Frame = +1

Query  259   QNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCA  438
              ND  L+ ETT  SL+ +LQ IW+E+GE + ++DKML +LEQECL+ YRRKVD+A+R  A
Sbjct  4     HNDPFLQEETTSGSLIEQLQIIWDEVGETDTDKDKMLLELEQECLQVYRRKVDEANRCRA  63

Query  439   QLRQAVAESEAELARICAALGEQPVNVRQSSRS---LKTELQAIMPlleemkkrklerkH  609
              LRQ +A+ EAELA IC+A+ E PV+ RQS ++   LK EL+ I+P LEEM+KRK +RK 
Sbjct  64    HLRQTIADYEAELAAICSAMAEPPVHNRQSDQTAGNLKEELRNILPQLEEMRKRKSDRKE  123

Query  610   QFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQV  789
             QF +VL+QI  +  E+ +S   +     +DE+ LSLR+LE+    L  LQKEKSDR+KQV
Sbjct  124   QFVQVLEQIQMIKNEIYRSTIYISSKTVVDETGLSLRKLEEFHRELHELQKEKSDRMKQV  183

Query  790   LDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQR  969
              DHL +LNS C VLG+DFK T+ +IHP+ G+S   +S+S +TIE+L+ AI +LREVKIQR
Sbjct  184   QDHLNTLNSFCSVLGMDFKLTVSQIHPSFGNSEGSRSISDDTIEQLTTAIQKLREVKIQR  243

Query  970   LHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEV  1149
             +  LQ+LATT++ELWNLMD P+EEQQ+F NVT  IAASE E+TE N LS+D +   E EV
Sbjct  244   MQKLQDLATTMLELWNLMDTPIEEQQMFQNVTCNIAASEREITEHNTLSVDFIDHVEAEV  303

Query  1150  SRLQEMKSSKMKEVLLKKRITLEELCRQAHLAI--DDSIEFTDETIESGAIDPSHLLEQL  1323
             +RL+E+KSSKMKE++LKK+  LEE+CR+ H+    D S+E+T E IESG  DP+++LE +
Sbjct  304   TRLEELKSSKMKELVLKKQSELEEICRKNHMVPENDSSMEYTLEAIESGTTDPANVLEHI  363

Query  1324  EIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKA  1503
             E+QI+  KEEAFSRK+ILEK++KWLAACEEESWLEDYNR++NRYN GRG+HL+LKRAEKA
Sbjct  364   ELQIAKAKEEAFSRKDILEKIDKWLAACEEESWLEDYNRDENRYNAGRGSHLILKRAEKA  423

Query  1504  RALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQ  1683
             R+LVNK+PGM+E L S+   WE ERGV FLYDGV L SML++Y +L+QEKE ER+RQRDQ
Sbjct  424   RSLVNKLPGMVETLASKTIAWETERGVEFLYDGVRLHSMLDEYTILRQEKEQERRRQRDQ  483

Query  1684  KKLQGQLMAEQEVLFGSKRSP--SQSGKK---NVVGGASNKRISVGGAMLQTPYTE----  1836
             KKL+ QL+AEQE L+GSK SP  +QS KK      GGA+N+R+ VGG MLQTP  +    
Sbjct  484   KKLKEQLIAEQEALYGSKPSPLKAQSVKKVPRVSSGGANNRRLPVGGTMLQTPKPDSLGS  543

Query  1837  -RAPLSSHSLKKINPVKQQALAN--ITQNYVALSSGRRESSMHAKQPSCNKSNL-QKTEP  2004
              +A   S  +KKI+   Q   +N  +       S+GRR   +  +      S+  ++  P
Sbjct  544   IKATPHSRPIKKIDRTLQHDPSNLHLDDGCATESAGRRGLDIPGEPKKKQSSDASEQDSP  603

Query  2005  TQRKPLSPISSLSFNTSSANIMDKISESEELREMPASL-LTTPIKNVSGIGG-NATPKtm  2178
              +R+P S I+S    T+S+N ++   E+ +  + P  L  TTP    S I   N TPK+M
Sbjct  604   MKRRPFSAINS----TTSSNDVNPNGETVQKPDPPFDLSFTTPSNTNSFIDDENMTPKSM  659

Query  2179  pipmpstpasaassiamQMGMTPA-----PVAATTPMVGHDGV-EYSYEEMRAGFLLPRL  2340
             PIP+P TP + +  +              P      +   +G+ EYS+EE RAGF+LP +
Sbjct  660   PIPVPPTPPTISVPMQTTTTTPAPADAPIPFNVYQVVETAEGIDEYSFEERRAGFVLPEI  719

Query  2341  H  2343
             H
Sbjct  720   H  720



>ref|XP_002267584.1| PREDICTED: 65-kDa microtubule-associated protein 3 [Vitis vinifera]
 ref|XP_010662377.1| PREDICTED: 65-kDa microtubule-associated protein 3 [Vitis vinifera]
 emb|CBI24513.3| unnamed protein product [Vitis vinifera]
Length=730

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/743 (53%), Positives = 507/743 (68%), Gaps = 64/743 (9%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M N Q+D  L++ETTC SLL ELQ IW+E+GE + +RDKML +LE+ECLE YRRKVDQA+
Sbjct  1     MSNVQSDPLLQVETTCGSLLYELQIIWDEVGESDTDRDKMLLELERECLEVYRRKVDQAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrkl  597
             R  AQLRQA+A+SEAELA IC+A+GE+PV++RQS +   SLK EL+AI+P LEEM KRK 
Sbjct  61    RCRAQLRQAIADSEAELAAICSAMGERPVHIRQSDQNAGSLKEELKAIIPQLEEMHKRKS  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             ER++QF EV+++I+ +  E+  S + +     +D++DLSLR+LE++   L +LQKEKSDR
Sbjct  121   ERRNQFFEVVEEIEKIKSEIYSSTEYIASKTVVDDTDLSLRKLEELHKQLQALQKEKSDR  180

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             LKQVLDHL +LNSLC+VLG+DF+ T+ E+HP+LGDS   K++S  TIE+L+AAI  LR V
Sbjct  181   LKQVLDHLSTLNSLCLVLGMDFQQTVNEVHPSLGDSDGRKNISNATIEQLAAAIKTLRGV  240

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             KIQR+  LQ+LA++++ELWNLMD P+EEQQLF NVT  IAASE E+ EPN LS+D +   
Sbjct  241   KIQRMQRLQDLASSMLELWNLMDTPIEEQQLFQNVTCNIAASEHEINEPNTLSVDFINYV  300

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLA--IDDSIEFTDETIESGAIDPSHL  1311
             E EVSRL+E+K+SKMKE++LKKR  LEE+CR+ H+    D ++++  E +ESGA+D S +
Sbjct  301   EAEVSRLEELKASKMKELVLKKRSELEEICRKTHMIPEADSALDYVIEAMESGAVDASCV  360

Query  1312  LEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKR  1491
             LEQ+E+Q++ VKEEAFSRKEILEKV+KWLAACEEESWLE+YNR+DNRYN GRG HL LKR
Sbjct  361   LEQIELQVAKVKEEAFSRKEILEKVDKWLAACEEESWLEEYNRDDNRYNAGRGAHLTLKR  420

Query  1492  AEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQR  1671
             AEKAR+LVNK+P M++AL S+   WE ERGV F YDG+ LLSMLE+Y  L+QEKE ER+R
Sbjct  421   AEKARSLVNKLPAMVDALASKTVAWEKERGVEFTYDGIRLLSMLEEYTFLRQEKEEERRR  480

Query  1672  QRDQKKLQGQLMAEQEVLFGSKRSPS--QSGKKN---VVGGASNKRISVGGAMLQTPYTE  1836
             QRDQKKLQGQL+AEQE LFGSK SPS  QS KK      G   ++R+SVGGAM+QTP   
Sbjct  481   QRDQKKLQGQLIAEQEALFGSKPSPSKPQSVKKASRVSTGSTGSRRLSVGGAMIQTP---  537

Query  1837  RAPLSSHSLKKI-NPVKQQALANITQ-------NYVALSSGRRE---SSMHAKQPSCNKS  1983
               P   HS K    P K+     I Q        + ALS+G R    + +  K+ S N  
Sbjct  538   -KPDPIHSTKATPRPGKKSDRYQIDQVRHCQDDGFTALSAGTRGLDIAGLPIKKQSFNPR  596

Query  1984  NLQKTEPTQRKPLSPISSLSFNTSSANIMDKISESEEL-REMPASLLTTPIKNVSGIGGN  2160
              +    P  RKP SPISS +  +S AN M      E+L R  P  L  T       +  N
Sbjct  597   EIDS--PMMRKPFSPISSTA--SSEANTM-----LEDLNRPQPKILHKT-------VSSN  640

Query  2161  ATPKtmpipmpstpasaassiamQMGMTPAPVAAT-----TPMVGH--------------  2283
               P T P      P SA           P PV +T      PM+                
Sbjct  641   NIPYTTPSKSQLPPPSATDEENRTPKTMPIPVPSTPSTVSVPMLTAMTPAPPPAPVPYNA  700

Query  2284  ---DGVEYSYEEMRAGFLLPRLH  2343
                +  EYS+EE RAGF+LP+ H
Sbjct  701   NPVEETEYSFEERRAGFVLPQAH  723



>gb|KCW46270.1| hypothetical protein EUGRSUZ_K00145 [Eucalyptus grandis]
Length=718

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/720 (51%), Positives = 509/720 (71%), Gaps = 30/720 (4%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M   Q+D  L +ETTC +LL ELQ IW+E+GE +++RD+ML +LE+ECL+ Y RKVDQA+
Sbjct  1     MSRLQSDPLLEVETTCGTLLCELQIIWDEVGESDVDRDQMLLELEKECLQVYMRKVDQAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrkl  597
             R  AQLRQ +A+SEAELA IC+A+GE+PV++RQS +   SLK EL+ I+P LEEM+KRK 
Sbjct  61    RYRAQLRQKIADSEAELAAICSAMGERPVHIRQSDQNAGSLKEELKIILPQLEEMRKRKC  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             ER+ QF EVL+QI S++ EL +S++     + +DESDLSLR+LE++   L +LQ+EKS+R
Sbjct  121   ERRQQFLEVLEQIQSIINELHRSKEHTSSKVVVDESDLSLRKLEELHRQLHALQQEKSNR  180

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             LKQ+ D + +LNSLCIVLG+DFK+T+ E+H +LG++   K +S  TIE+L++ I  LREV
Sbjct  181   LKQIQDLMCTLNSLCIVLGLDFKHTVSEVHFSLGNAEGSKDISNRTIEQLASMIQNLREV  240

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             K+QR+  LQ+LAT ++ELWNLMD P+EEQQ+F NVT  +AASE E++EP+ALS+  +   
Sbjct  241   KLQRMQRLQDLATNLLELWNLMDTPLEEQQMFQNVTCNVAASEHEISEPDALSVASINHV  300

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAI--DDSIEFTDETIESGAIDPSHL  1311
             E EV+RL+E+K SKMKE++LKKR  LEE+CR+ HL    D ++++  E +ESGA D + +
Sbjct  301   EAEVARLEELKLSKMKELVLKKRSELEEICRKTHLIPEEDSTMKYIIEAMESGAADAACV  360

Query  1312  LEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKR  1491
             LEQ+E+ I+ VKEEAFSRKE+LEKVEKWLAAC+EE WLE+YNR++NRYN GRG HL+LKR
Sbjct  361   LEQIEVHIAKVKEEAFSRKELLEKVEKWLAACDEECWLEEYNRDENRYNAGRGAHLILKR  420

Query  1492  AEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQR  1671
             AEKAR+LVNK+P M+EAL+S+   WE ERG+ F YDG+ LLSML++Y LL+QEKE ER+R
Sbjct  421   AEKARSLVNKLPAMVEALSSKTVSWEKERGIEFTYDGIRLLSMLDEYNLLRQEKEQERRR  480

Query  1672  QRDQKKLQGQLMAEQEVLFGSKRSPSQSGKKNVVGGASNKRISVGGAMLQTPYTERAPLS  1851
              RDQKKL GQL+AEQE L+GSK SPS+     V       RIS GGA LQTP  +  PL 
Sbjct  481   LRDQKKLHGQLVAEQEALYGSKPSPSK-----VQTTKKTPRISTGGATLQTPKAD--PL-  532

Query  1852  SHSLKKI---NPVKQQALANIT---QNYVALSSGRR--ESSMHAKQPSCNKSNLQKTE-P  2004
              HSLK      P+K+           N   +S+GRR  + +  A + S   +   + E P
Sbjct  533   -HSLKATPHSRPIKKSERVQKNDRFNNQPDVSAGRRGLDGAGPAAKHSFGAATAHQPESP  591

Query  2005  TQRKPLSPISSLSFNTSSANIMDKISESEELREMPA-SLLTTPIKNV--SGIGGNATPKt  2175
              +RKP SPI+  +  T+S +  + I      +  P+ +  +TP+K    +    N TP+T
Sbjct  592   MRRKPFSPITLKAHRTNSLDNANVIHGEVLQKAFPSNNTFSTPLKKTLQTTDDENMTPRT  651

Query  2176  mpipmpstpasaassiamQMG----MTPAPVAATTPMVGHDGVEYSYEEMRAGFLLPRLH  2343
             MPI +P+TP++ +  +   M       P+ V   TP    + +EYS+EE RAGF+LP+++
Sbjct  652   MPIHVPTTPSTVSVPMHTAMTPDLLNLPSSVGTMTPKEIPEVIEYSFEERRAGFVLPKMN  711



>ref|XP_007220225.1| hypothetical protein PRUPE_ppa002178mg [Prunus persica]
 gb|EMJ21424.1| hypothetical protein PRUPE_ppa002178mg [Prunus persica]
Length=705

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/726 (53%), Positives = 513/726 (71%), Gaps = 55/726 (8%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M N Q++Q L+METTC SLL ELQ IWNE+GE + +RDKML +LEQECLE YRRKVDQA+
Sbjct  1     MSNLQSEQLLQMETTCGSLLYELQIIWNEVGESDKDRDKMLLELEQECLEVYRRKVDQAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrkl  597
             R  AQLRQA+A+SEAELA IC+A+GE+PV++RQS +   SLK EL  I+P LEEMKKRKL
Sbjct  61    RCRAQLRQAIADSEAELAAICSAMGERPVHIRQSDQNAGSLKEELSKIVPQLEEMKKRKL  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             +RK+ F EVL++I  +  E+  S +       +DE+DLSLRRLE++   L +LQ EKSDR
Sbjct  121   DRKNNFLEVLEEIQIISSEINGSTEYSSSKTVVDETDLSLRRLEELHRQLHALQTEKSDR  180

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             LKQ+ DHL +LNSLC+VLG+DFK T  E+HP+L DS   K++S +TIERL+AAI +LREV
Sbjct  181   LKQIQDHLCTLNSLCLVLGMDFKQTSSEVHPSLDDSEGCKNISNDTIERLAAAIQKLREV  240

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             K+QR+  LQ+LA+T++ELWNLMD P+EEQQ+F N+T  IAASE E+TEPN LS+D +   
Sbjct  241   KLQRMQRLQDLASTMLELWNLMDTPIEEQQMFQNITCNIAASEHEITEPNTLSVDFINYV  300

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAI--DDSIEFTDETIESGAIDPSHL  1311
             E EVSRL+E+KSSKMKE++LKKR  LEE+CR+ H+ +  D +I++  E I+SG +DP+ +
Sbjct  301   EAEVSRLEELKSSKMKELVLKKRSELEEICRKTHMVLEADSAIDYVIEAIDSGDVDPACV  360

Query  1312  LEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKR  1491
             L+Q+E+Q++ VKEEAFSRKEILEKV+KWL AC+EE WLE+YNR++NRYN GRG HL LKR
Sbjct  361   LDQIELQVAKVKEEAFSRKEILEKVDKWLFACDEECWLEEYNRDENRYNAGRGAHLTLKR  420

Query  1492  AEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQR  1671
             AEKARALVNK+P M++AL S+   WE ERG+ F YDG+ LLSMLE+Y +L++EKE ER+R
Sbjct  421   AEKARALVNKLPAMVDALASKTIAWEKERGIDFTYDGIPLLSMLEEYTILREEKEQERRR  480

Query  1672  QRDQKKLQGQLMAEQEVLFGSKRSPS--QSGKKN---VVGGASNKRISVGGAMLQTPYTE  1836
             QRDQKK+QGQL+AEQE L+GSK SPS  QS KK      GGASN+R+S+        ++ 
Sbjct  481   QRDQKKIQGQLIAEQEALYGSKPSPSKPQSVKKAPRMSTGGASNRRLSMQAPKPDPLHSI  540

Query  1837  RA-PLSSHSLKKINPVKQ-QALAN-ITQNYVALSSGRRE---SSMHAKQPSCNKSNLQKT  1998
             +A P S  + +K + + Q + L+N +   + ALSSGRR    + +  K+ S   +N  + 
Sbjct  541   KATPHSRPTPRKADRIHQNEQLSNYLDDGFSALSSGRRGLDVAGLPVKKHSFGATNASEV  600

Query  1999  E-PTQRKPLSPISSLSFNTS------SANIMDKISESEELREMPASLLTTPIKNVSGIGG  2157
             E PT RKP SPIS  + N +      S N+ D+  E++  + MP  + TTP         
Sbjct  601   ETPTMRKPFSPISIPTENGAITTPLKSTNLADE--ENKTPKVMPIFVPTTP---------  649

Query  2158  NATPKtmpipmpstpasaassiamQMGMTPA----PVAATTPMVGHDGVEYSYEEMRAGF  2325
                              +  S+ MQ  MTPA    P AA       + +EYS+EE RAGF
Sbjct  650   -----------------STVSVPMQTAMTPAYPPIPFAANVVEEIPEEIEYSFEERRAGF  692

Query  2326  LLPRLH  2343
             +LP+ H
Sbjct  693   VLPKAH  698



>ref|XP_002322422.2| hypothetical protein POPTR_0015s14350g [Populus trichocarpa]
 gb|EEF06549.2| hypothetical protein POPTR_0015s14350g [Populus trichocarpa]
Length=730

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/725 (54%), Positives = 520/725 (72%), Gaps = 38/725 (5%)
 Frame = +1

Query  259   QNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCA  438
             Q+D  L++ETTC +LL ELQ IWNE+GE + +RDKML +LEQECLE YRRKVDQA+RS A
Sbjct  5     QSDPLLQVETTCGTLLYELQIIWNEVGETDTDRDKMLLELEQECLEVYRRKVDQANRSRA  64

Query  439   QLRQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrklerkH  609
             QLRQA+A+SEAELA IC+A+GE+PV++RQ+ +   SLK EL+  +P LEEM+KRKL+R+ 
Sbjct  65    QLRQAIADSEAELAAICSAMGERPVHIRQADQNIGSLKEELRKTIPQLEEMRKRKLDRRK  124

Query  610   QFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQV  789
             QF EVL+ I  V  E+  S     H + +DE+DLSL++LE++   L  L+KEKSDR+KQV
Sbjct  125   QFHEVLEGIQKVSSEIYGS---ADHNVFVDEADLSLKKLEELHRQLHELEKEKSDRMKQV  181

Query  790   LDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQR  969
               HL++LN+LC+VLG+DFK+T+ E+HP+ GDS  L+ +S  TI+ L+  IH+LREVKIQR
Sbjct  182   QQHLDTLNALCLVLGMDFKHTVSEVHPSFGDSGGLRDISNLTIQHLATTIHKLREVKIQR  241

Query  970   LHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEV  1149
             +  LQ+LATT++ELWNLMD P+EEQQ F NVT  IAASE E+TEPN LS++ +K  E EV
Sbjct  242   MQKLQDLATTMLELWNLMDTPIEEQQEFQNVTCNIAASEHEITEPNTLSVEFIKYVEAEV  301

Query  1150  SRLQEMKSSKMKEVLLKKRITLEELCRQAHLA--IDDSIEFTDETIESGAIDPSHLLEQL  1323
             SRL+E+KSSKMKE++LKKR  LEE+CR+ H+    D ++E+  E IESG +DP  +LEQ+
Sbjct  302   SRLEELKSSKMKELVLKKRSELEEICRKMHMIPETDAAVEYAVEAIESGNMDPESILEQI  361

Query  1324  EIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKA  1503
             E+QI+NVKEE+FSRKEILEKVEKWL ACEEESWLE+YNR+DNRYN GRG HL LKRAEKA
Sbjct  362   EVQIANVKEESFSRKEILEKVEKWLTACEEESWLEEYNRDDNRYNAGRGAHLTLKRAEKA  421

Query  1504  RALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQ  1683
             R LVNK+PGM+EAL S+   WE ERG  FLYDG+ LLSMLE+Y +L+QEKE ER+RQRDQ
Sbjct  422   RNLVNKMPGMVEALASKTMAWESERGTEFLYDGIRLLSMLEEYTILRQEKEEERRRQRDQ  481

Query  1684  KKLQGQLMAEQEVLFGSKRSPS--QSGKKN---VVGGASNKRISVGGAMLQTP------Y  1830
             KKLQGQL+AEQE L+GSK SPS  QS KK      GGA+N+R+S+GGA+LQTP      Y
Sbjct  482   KKLQGQLIAEQEALYGSKPSPSKPQSVKKASRVSTGGATNRRLSLGGAVLQTPRPDLPHY  541

Query  1831  TERAPLSSHSLKKINPVKQQALANITQN--YVALSSGRRE---SSMHAKQPSCNKSNLQK  1995
             ++  P  S    K++ + Q   +   Q+  +  LS+GRR    + +  K+ S    N ++
Sbjct  542   SKATP-HSRPGNKVDRMHQNDHSKPHQDDGFAGLSAGRRGLDIAGLPMKKHSFGAVNGRE  600

Query  1996  TE-PTQRKPLSPISSLSFNTSSANIMDKISESEEL--REMPASLLT--TPIK-NVSGIGG  2157
              + P  R+P SPISS    +S +N++++    ++   + +P + L+  TP K N      
Sbjct  601   PQSPMLRQPFSPISSTV--SSKSNMLEEAMTHDDTSKKTLPINDLSFKTPSKTNTVADEE  658

Query  2158  NATPKtmpipmpstpasaassiamQMGMTPAPVAATTPMVGH---DGVEYSYEEMRAGFL  2328
             N TPK   + +P     +  S+ MQ  MTPAP      +      + +EYS+EE RAGF+
Sbjct  659   NWTPK--AMLIPVPTTPSTVSVPMQTAMTPAPPPVPFVVNPVEIPEEIEYSFEERRAGFI  716

Query  2329  LPRLH  2343
             LP  H
Sbjct  717   LPNSH  721



>ref|XP_007038462.1| Microtubule associated protein family protein isoform 1 [Theobroma 
cacao]
 gb|EOY22963.1| Microtubule associated protein family protein isoform 1 [Theobroma 
cacao]
Length=697

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/726 (53%), Positives = 500/726 (69%), Gaps = 67/726 (9%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M   +ND  L++ETTC +LL ELQ IW+E+GE + +RDKML +LEQECLE YRRKVDQA+
Sbjct  1     MSTPKNDPLLQVETTCGTLLYELQIIWDEVGETDSDRDKMLLELEQECLEVYRRKVDQAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQS---SRSLKTELQAIMPlleemkkrkl  597
             R  AQLRQ +A+SEAELA IC+A+GE+PV++RQS   S SLK EL+ I+P LEEM+KRK+
Sbjct  61    RCRAQLRQTIADSEAELAAICSAMGERPVHIRQSDQNSGSLKEELRKILPQLEEMRKRKV  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             ER++QF EVL+Q   +  E+  S + +     +DE+DLSLR+LE++   L  LQKEKSDR
Sbjct  121   ERRNQFIEVLEQTQKITNEIYGSTESVSLKTVVDETDLSLRKLEELHRQLHELQKEKSDR  180

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             LKQV DHL  LNSLC V+G+DFK T+ E+HP+LGDS  L+S+S  TIE+L+ AI +LREV
Sbjct  181   LKQVQDHLHMLNSLCSVMGMDFKLTVSEVHPSLGDSDGLRSISNNTIEKLAIAIKKLREV  240

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             KIQR+  LQ+LATT++ELWNLMD P+EEQQ+F NVT  IAASE E+TEPN LS+D +   
Sbjct  241   KIQRMQRLQDLATTMLELWNLMDTPIEEQQMFQNVTCNIAASEHEITEPNTLSVDFINYV  300

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLA--IDDSIEFTDETIESGAIDPSHL  1311
             E EVSRL+E+KSSKMKE++LKKR  LE++CR+ HL    D +IE   E IESGA+D + +
Sbjct  301   EAEVSRLEELKSSKMKELVLKKRSELEDICRKTHLVPDSDSAIEDAIEAIESGAVDAATI  360

Query  1312  LEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKR  1491
             LEQ+E+QI+ VKEEAFSRKEILEKVEKWL AC+EE WLE+YNR++NRYN G+G HL LKR
Sbjct  361   LEQIELQIAKVKEEAFSRKEILEKVEKWLTACDEECWLEEYNRDENRYNAGKGAHLTLKR  420

Query  1492  AEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQR  1671
             AEKAR+LVNK+PGM+EAL S+   WE ER + F+YDG+ LLSMLE+Y +L+QEKE ER+R
Sbjct  421   AEKARSLVNKLPGMVEALASKTLAWEKEREIKFMYDGIRLLSMLEEYTILRQEKEQERRR  480

Query  1672  QRDQKKLQGQLMAEQEVLFGSKRSPSQ-----SGKKNVVGGASNKRISVGGAMLQTPYTE  1836
              RDQKKLQGQL+AEQE L+GSK SPS+      G +   GGASN+R+S+GGAML      
Sbjct  481   LRDQKKLQGQLIAEQEALYGSKPSPSKPQSVKKGSRFSTGGASNRRVSLGGAMLPN----  536

Query  1837  RAPLSSHSLK---KINPVK--QQALANITQN-----YVALSSGRRESSMHAKQPSCNKSN  1986
               P S HS K   +  P K  ++   N  Q+     Y A+  G   + +  ++ S +  N
Sbjct  537   HKPDSLHSAKATPQTRPSKKTERIFQNDLQDDALPAYSAVRRGLDIADIPVRKHSSSAVN  596

Query  1987  LQKTEPTQRKPLS--PISSLSFNTSSANIMDKISESEELREMPASLLTTPIKNVSGIGG-  2157
               + E     PL   P   LS+                         TTP+K  S +   
Sbjct  597   ANELE----SPLKTIPTKDLSY-------------------------TTPLKTTSLVDEE  627

Query  2158  NATPKtmpipmpstpasaassiamQMGMTPAPVAATTPMVGH------DGVEYSYEEMRA  2319
             N TPK MPIP+PSTP++A+  +  Q  MTPAP     P +        + +E S+EE R 
Sbjct  628   NTTPKAMPIPVPSTPSTASIPM--QTAMTPAP---PIPFITKPAEEMPEEIEQSFEERRL  682

Query  2320  GFLLPR  2337
              FLL +
Sbjct  683   AFLLSK  688



>ref|XP_010109100.1| hypothetical protein L484_012976 [Morus notabilis]
 gb|EXC20900.1| hypothetical protein L484_012976 [Morus notabilis]
Length=722

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/725 (52%), Positives = 511/725 (70%), Gaps = 36/725 (5%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M +RQ D   ++ETTC +LL ELQ IWNE+GE +++RDKML +LEQECLE YRRKVDQA+
Sbjct  1     MSSRQLDPLQQVETTCGTLLYELQIIWNEVGESDVDRDKMLLELEQECLEVYRRKVDQAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSRS---LKTELQAIMPlleemkkrkl  597
             R  AQLRQA+A++EAELA IC+A+GE+PV++RQS +S   LK EL+ I+P LEEM+KRK 
Sbjct  61    RLRAQLRQAIADAEAELAAICSAMGERPVHIRQSDQSTGNLKEELKKILPQLEEMRKRKS  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             ER++QF +VL++I ++  E+  S   +     +DE+DLSLR+LE++   L +LQKEK DR
Sbjct  121   ERRNQFLDVLEEIRNISNEIQGSTGYIPS-TTVDETDLSLRKLEELHRQLQALQKEKMDR  179

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             LKQV DHL +LNSLC+VLG+DFK TIGE+HP+LGDS    ++S  TIE L+AAI  LR V
Sbjct  180   LKQVQDHLCTLNSLCLVLGMDFKQTIGEVHPSLGDSEGSNNLSNGTIELLAAAIQRLRGV  239

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             KI+R+ MLQ+LAT+++ELWNLMD P+EEQQ+F NVT  +AASE E+TEPN LS+D +   
Sbjct  240   KIKRMQMLQDLATSMLELWNLMDTPIEEQQMFQNVTCNVAASEDEITEPNTLSVDFINYV  299

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAI--DDSIEFTDETIESGAIDPSHL  1311
             E EVSRL+E KSSKMKE+++KKR  LEE+CR+  + +  D ++E   E +ESGA+D + +
Sbjct  300   EAEVSRLEEFKSSKMKELVIKKRSELEEICRKTRMVLESDSALECAIEALESGAVDAAFI  359

Query  1312  LEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKR  1491
             LEQ+E+QI+ VKEEAFSRKEILEKVEKWLAAC+EE WLE+YNR++NRYN GRG HL LKR
Sbjct  360   LEQIELQIAKVKEEAFSRKEILEKVEKWLAACDEECWLEEYNRDENRYNAGRGAHLTLKR  419

Query  1492  AEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQR  1671
             AEKARALVNK+P M++ L S+   WE ++G+ F YDG+ LLSMLE+Y +L+QEKE ER+R
Sbjct  420   AEKARALVNKLPAMVDTLASKTVAWEKDKGIEFTYDGIRLLSMLEEYTILRQEKEQERRR  479

Query  1672  QRDQKKLQGQLMAEQEVLFGSKRSPSQSGKKNV----VGGASNKRISVGGAMLQTPYTER  1839
             QRDQKKLQGQL+AEQE L+GSK SPS+   K       GGASN+R+S+GGAM+QTP    
Sbjct  480   QRDQKKLQGQLIAEQEALYGSKPSPSKPSVKKAPRMSTGGASNRRLSIGGAMIQTP----  535

Query  1840  APLSSHSLKKINPVKQQALANITQNYVALSSGRRESSMHAKQPSCNKS--NLQKTEPTQR  2013
              P +S    + +   QQ   ++  ++    +GR+   + A  P  N S    +   P +R
Sbjct  536   KPATSRPSSRKSDRAQQNEHHVDDSF----TGRKGLDV-AGIPMRNHSFGAREMESPMKR  590

Query  2014  KPL--SPISSLSFNTSSANIMDKIS---ESEELREMPASL-LTTPIKNVSGI---GGNAT  2166
             KP      ++ S  T+  N  + ++    ++ + + P+++  TTP K  + +     N +
Sbjct  591   KPFSPISSTTSSSKTNITNFSEDLNIPHNNDTVEKTPSAMPFTTPSKVTTTVIEEENNVS  650

Query  2167  PKtmpipmpstpasaassiamQMGMTPAPVAATTPMVGH------DGVEYSYEEMRAGFL  2328
                  +P+P        S+ MQM +TPAP   + P   +      + +EYS+EE RAGF+
Sbjct  651   FTPKVMPIPVPTTPLTVSVPMQMVLTPAPPPQSIPYSSNIVEEIPEEIEYSFEERRAGFV  710

Query  2329  LPRLH  2343
             LP+ H
Sbjct  711   LPKTH  715



>ref|XP_008234352.1| PREDICTED: 65-kDa microtubule-associated protein 3 [Prunus mume]
Length=705

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/721 (54%), Positives = 515/721 (71%), Gaps = 45/721 (6%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M N Q++Q L+METTC SLL ELQ IWNE+GE + +RD+ML +LEQECLE YRRKVDQA+
Sbjct  1     MSNLQSEQLLQMETTCGSLLYELQIIWNEVGESDKDRDEMLLELEQECLEVYRRKVDQAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrkl  597
             R  AQLRQA+A+SEAELA IC+A+GE+PV++RQS +   SLK EL  I+P LEEMKKRKL
Sbjct  61    RCRAQLRQAIADSEAELAAICSAMGERPVHIRQSDQNAGSLKEELSKIVPQLEEMKKRKL  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             +RK++F EVL++I  +  E+  S +       +DE+DLSLRRLE++   L +LQ EKSDR
Sbjct  121   DRKNKFLEVLEEIQIISSEINGSTEYSSSKTVVDETDLSLRRLEELHRQLHALQTEKSDR  180

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             LKQ+ DHL +LNSLC+VLG+DFK T  E+HP+L DS   K++S +TIERL+AAI +LREV
Sbjct  181   LKQIQDHLCTLNSLCLVLGMDFKQTSSEVHPSLDDSEGCKNISNDTIERLAAAIQKLREV  240

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             K+QR+  LQ+LA+T++ELWNLMD P+EEQQ+F N+T  IAASE E+TEPN LS+D +   
Sbjct  241   KLQRMQRLQDLASTMLELWNLMDTPIEEQQMFQNITCNIAASEHEITEPNTLSVDFINYV  300

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAI--DDSIEFTDETIESGAIDPSHL  1311
             E EVSRL+E+KSSKMKE++LKKR  LEE+CR+ H+ +  D +I++  E I+SG +DP+ +
Sbjct  301   EAEVSRLEELKSSKMKELVLKKRSELEEICRKTHMVLEADSAIDYVIEAIDSGDVDPACV  360

Query  1312  LEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKR  1491
             L+Q+E+Q++ VKEEAFSRKEILEKV+KWL AC+EE WLE+YNR++NRYN GRG HL LKR
Sbjct  361   LDQIELQVAKVKEEAFSRKEILEKVDKWLFACDEECWLEEYNRDENRYNAGRGAHLTLKR  420

Query  1492  AEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQR  1671
             AEKARALVNK+P M++AL S+   WE ERG+ F YDG+ LLSMLE+Y +L++EKE ER+R
Sbjct  421   AEKARALVNKLPAMVDALASKTIAWEKERGIDFTYDGIRLLSMLEEYTILREEKEQERRR  480

Query  1672  QRDQKKLQGQLMAEQEVLFGSKRSPS--QSGKKN---VVGGASNKRISVGGAMLQTPYTE  1836
             QRDQKK+QGQL+AEQE L+GSK SPS  QS KK      GGASN+R+S+        ++ 
Sbjct  481   QRDQKKIQGQLIAEQEALYGSKPSPSKPQSVKKAPRMSTGGASNRRLSMQAPKPDPLHSI  540

Query  1837  RA-PLSSHSLKKINPVKQ-QALAN-ITQNYVALSSGRRE---SSMHAKQPSCNKSNLQKT  1998
             +A P S  + +K + + Q + L+N +   + ALSSGRR    + +  K+ S   +N  + 
Sbjct  541   KATPHSRPTPRKADRIHQNEQLSNYLDDGFSALSSGRRGLDVAGLPVKKHSFGATNASEV  600

Query  1999  E-PTQRKPLSPISSLSFNTSSANIMDKISESEELREMPASLLTTPIKNVS-GIGGNATPK  2172
             E PT RKP SPIS  + N +                     +TTP+K+ +     N TPK
Sbjct  601   ETPTMRKPFSPISIPTENGA---------------------MTTPLKSTNLADEENKTPK  639

Query  2173  tmpipmpstpasaassiamQMGMTPA----PVAATTPMVGHDGVEYSYEEMRAGFLLPRL  2340
                +P+ +    +  S+ MQ  MTPA    P AA       + +EYS+EE RAGF+LP+ 
Sbjct  640   --VMPIFAPTTPSTVSVPMQTAMTPAHPPIPFAANVVEEIPEEIEYSFEERRAGFVLPKA  697

Query  2341  H  2343
             H
Sbjct  698   H  698



>ref|XP_011029980.1| PREDICTED: 65-kDa microtubule-associated protein 3-like isoform 
X1 [Populus euphratica]
Length=741

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/739 (53%), Positives = 514/739 (70%), Gaps = 54/739 (7%)
 Frame = +1

Query  244   DMYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQA  423
             +M N Q+D  L++ETTC +LL ELQ IWNE+GE + +RDKML +LEQECLE YRRKVDQA
Sbjct  6     NMSNVQSDPLLQVETTCGTLLYELQIIWNEVGETDTDRDKMLLELEQECLEVYRRKVDQA  65

Query  424   SRSCAQLRQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrk  594
             +R+ AQLRQA+A+SEAELA IC+++GE+PV++RQ+ +   SLK EL  I+P LEEM+KRK
Sbjct  66    NRNRAQLRQAIADSEAELAVICSSMGERPVHIRQADQNAGSLKEELGRILPQLEEMRKRK  125

Query  595   lerkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSD  774
             L+R+ QF EV++ I  +  E+  S     H I +DE+DLSLRRLE++   L  L+KEKSD
Sbjct  126   LDRRKQFHEVVEDIRKISSEIYGS---ADHNILVDEADLSLRRLEELHRQLHELEKEKSD  182

Query  775   RLKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELRE  954
             RLKQV  HL++LN+LC+VLG+DFK+T  E+H + GDS   + +S  TI+ L+AAIH+LRE
Sbjct  183   RLKQVQQHLDTLNALCLVLGMDFKHTASEVHTSFGDSGGSRDISNHTIQLLAAAIHKLRE  242

Query  955   VKIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKS  1134
             VKI R+  LQ+LATT++ELWNLMD PVEEQQ F +VT  IAASE E+TEPN LSLD +K 
Sbjct  243   VKIHRMQRLQDLATTMLELWNLMDTPVEEQQEFQHVTCNIAASEHEITEPNTLSLDFIKY  302

Query  1135  AEIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLA--IDDSIEFTDETIESGAIDPSH  1308
              E EVSRL+E+KSSKMKE++LKKR  LEE+CR+ H+    D ++E+  E I SG +DP+ 
Sbjct  303   VEAEVSRLEELKSSKMKELVLKKRSELEEICRKMHMIPETDAAVEYAVEVIGSGNLDPAS  362

Query  1309  LLEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLK  1488
             +LEQ+E+QI+N+KEEAFSRKEILEKVEKWL ACEEESWLE+YNR+DNRYN GRGTHL+LK
Sbjct  363   ILEQIELQIANIKEEAFSRKEILEKVEKWLNACEEESWLEEYNRDDNRYNAGRGTHLILK  422

Query  1489  RAEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQ  1668
             RAEKAR+LVNK+PGM+EAL S+   WE ERG  FLYDG+ LLSMLE+Y +L+QEKE ER+
Sbjct  423   RAEKARSLVNKMPGMVEALASKTMAWEKERGAEFLYDGIRLLSMLEEYTILRQEKEEERR  482

Query  1669  RQRDQKKLQGQLMAEQEVLFGSKRSPSQSGKKNV-----VGGASNKRISVGGAMLQT---  1824
             RQRDQKKLQGQL+AEQE L+GSK SPS+            GGASN+R+S+GG MLQT   
Sbjct  483   RQRDQKKLQGQLIAEQEALYGSKPSPSKPPSVKKTPRVSTGGASNRRLSLGGTMLQTPRP  542

Query  1825  --PYTERAPLSSHSLKKINPVKQQALANITQN--YVALSSGRRE---SSMHAKQPSCNKS  1983
               P++ +A     +  K++   Q       Q+  + ALS+GRR    + +  K+ S    
Sbjct  543   DLPHSSKATPHPRAGNKVDRTHQNDHLKPQQDDGFDALSAGRRGLDIAGLATKKHSFGAV  602

Query  1984  NLQKTE-PTQRKPLSPISSLSFNTSSANIMDKIS--ESEELREMPASLLTTPIKNVSGIG  2154
             N ++ + P  R+P SPISS    +S +NI+++ +   ++  ++      T PI +VS   
Sbjct  603   NAREPQSPMLRQPFSPISSTV--SSKSNILEEATTPHNDTFKK------TLPINDVSF--  652

Query  2155  GNATPKtmpipmpstpasaassiamQMGMTPAPVAA----------------TTPMVGHD  2286
                TP                ++ + M MTP+ V+                   P+   +
Sbjct  653   --KTPSKTNTIADEENRRTPKAMPIPMPMTPSTVSVPMQTAMTPAPPPVPFAVNPVETPE  710

Query  2287  GVEYSYEEMRAGFLLPRLH  2343
              +EYS+EE RAGF+LP  H
Sbjct  711   EIEYSFEERRAGFVLPNTH  729



>ref|XP_011029981.1| PREDICTED: 65-kDa microtubule-associated protein 3-like isoform 
X2 [Populus euphratica]
Length=735

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/738 (53%), Positives = 513/738 (70%), Gaps = 54/738 (7%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M N Q+D  L++ETTC +LL ELQ IWNE+GE + +RDKML +LEQECLE YRRKVDQA+
Sbjct  1     MSNVQSDPLLQVETTCGTLLYELQIIWNEVGETDTDRDKMLLELEQECLEVYRRKVDQAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrkl  597
             R+ AQLRQA+A+SEAELA IC+++GE+PV++RQ+ +   SLK EL  I+P LEEM+KRKL
Sbjct  61    RNRAQLRQAIADSEAELAVICSSMGERPVHIRQADQNAGSLKEELGRILPQLEEMRKRKL  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             +R+ QF EV++ I  +  E+  S     H I +DE+DLSLRRLE++   L  L+KEKSDR
Sbjct  121   DRRKQFHEVVEDIRKISSEIYGS---ADHNILVDEADLSLRRLEELHRQLHELEKEKSDR  177

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             LKQV  HL++LN+LC+VLG+DFK+T  E+H + GDS   + +S  TI+ L+AAIH+LREV
Sbjct  178   LKQVQQHLDTLNALCLVLGMDFKHTASEVHTSFGDSGGSRDISNHTIQLLAAAIHKLREV  237

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             KI R+  LQ+LATT++ELWNLMD PVEEQQ F +VT  IAASE E+TEPN LSLD +K  
Sbjct  238   KIHRMQRLQDLATTMLELWNLMDTPVEEQQEFQHVTCNIAASEHEITEPNTLSLDFIKYV  297

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLA--IDDSIEFTDETIESGAIDPSHL  1311
             E EVSRL+E+KSSKMKE++LKKR  LEE+CR+ H+    D ++E+  E I SG +DP+ +
Sbjct  298   EAEVSRLEELKSSKMKELVLKKRSELEEICRKMHMIPETDAAVEYAVEVIGSGNLDPASI  357

Query  1312  LEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKR  1491
             LEQ+E+QI+N+KEEAFSRKEILEKVEKWL ACEEESWLE+YNR+DNRYN GRGTHL+LKR
Sbjct  358   LEQIELQIANIKEEAFSRKEILEKVEKWLNACEEESWLEEYNRDDNRYNAGRGTHLILKR  417

Query  1492  AEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQR  1671
             AEKAR+LVNK+PGM+EAL S+   WE ERG  FLYDG+ LLSMLE+Y +L+QEKE ER+R
Sbjct  418   AEKARSLVNKMPGMVEALASKTMAWEKERGAEFLYDGIRLLSMLEEYTILRQEKEEERRR  477

Query  1672  QRDQKKLQGQLMAEQEVLFGSKRSPSQSGKKNV-----VGGASNKRISVGGAMLQT----  1824
             QRDQKKLQGQL+AEQE L+GSK SPS+            GGASN+R+S+GG MLQT    
Sbjct  478   QRDQKKLQGQLIAEQEALYGSKPSPSKPPSVKKTPRVSTGGASNRRLSLGGTMLQTPRPD  537

Query  1825  -PYTERAPLSSHSLKKINPVKQQALANITQN--YVALSSGRRE---SSMHAKQPSCNKSN  1986
              P++ +A     +  K++   Q       Q+  + ALS+GRR    + +  K+ S    N
Sbjct  538   LPHSSKATPHPRAGNKVDRTHQNDHLKPQQDDGFDALSAGRRGLDIAGLATKKHSFGAVN  597

Query  1987  LQKTE-PTQRKPLSPISSLSFNTSSANIMDKIS--ESEELREMPASLLTTPIKNVSGIGG  2157
              ++ + P  R+P SPISS    +S +NI+++ +   ++  ++      T PI +VS    
Sbjct  598   AREPQSPMLRQPFSPISSTV--SSKSNILEEATTPHNDTFKK------TLPINDVSF---  646

Query  2158  NATPKtmpipmpstpasaassiamQMGMTPAPVAA----------------TTPMVGHDG  2289
               TP                ++ + M MTP+ V+                   P+   + 
Sbjct  647   -KTPSKTNTIADEENRRTPKAMPIPMPMTPSTVSVPMQTAMTPAPPPVPFAVNPVETPEE  705

Query  2290  VEYSYEEMRAGFLLPRLH  2343
             +EYS+EE RAGF+LP  H
Sbjct  706   IEYSFEERRAGFVLPNTH  723



>gb|EYU25004.1| hypothetical protein MIMGU_mgv1a001889mg [Erythranthe guttata]
Length=744

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/733 (52%), Positives = 502/733 (68%), Gaps = 50/733 (7%)
 Frame = +1

Query  277   RMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAV  456
             ++ETTC SLL ELQ IW+E+GE + +RD+ L +LEQECLE YRR+VDQA++S AQLRQA+
Sbjct  11    QLETTCGSLLYELQIIWDEVGESDADRDRTLLELEQECLEVYRRRVDQANKSRAQLRQAI  70

Query  457   AESEAELARICAALGEQPVNVRQSSRS---LKTELQAIMPlleemkkrklerkHQFSEVL  627
             A++EAELA IC+A+GE+PV++RQS +S   LK EL+AI+P +EEM++R+ ERK QF EV 
Sbjct  71    ADAEAELAAICSAMGERPVHIRQSDQSTGSLKAELRAILPQIEEMRRRRSERKSQFIEVK  130

Query  628   DQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLES  807
             +QI  +  E+        + +A+DE+DLSLR LE++   L +LQKEK +RLKQV++HL +
Sbjct  131   EQIQIIKSEIYSGGHCALNDMAVDETDLSLRNLEELHKELQTLQKEKCERLKQVVEHLNN  190

Query  808   LNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQRLHMLQN  987
             L S C VLG+DFK T+ EIHP+LG+S   K++S +TIE+L  +I  LREVKIQR+  LQ+
Sbjct  191   LFSCCSVLGLDFKQTVDEIHPSLGESEGPKNISNDTIEQLGKSILRLREVKIQRMQQLQD  250

Query  988   LATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQEM  1167
             L T+++ELWNLMD P+EEQQ+F  VT  IAASE E+TEP+ LS   +   + EVSRL+EM
Sbjct  251   LGTSLLELWNLMDTPIEEQQIFQKVTCNIAASEDEITEPDMLSAQFIDHVKAEVSRLEEM  310

Query  1168  KSSKMKEVLLKKRITLEELCRQAHLA--IDDSIEFTDETIESGAIDPSHLLEQLEIQISN  1341
             K+SKMKE+++KK+  LE++CR+ HL    + S+    + +ESGAID S++LEQ+E+QIS 
Sbjct  311   KASKMKELVMKKKSELEDICRKTHLNPESNSSVSLAVDAVESGAIDASYVLEQIELQISR  370

Query  1342  VKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVNK  1521
             VKEEA SRKEILEKVEKW+ ACEEESWLE+YNR++NRY+ GRG HL LKRAEKARALVNK
Sbjct  371   VKEEALSRKEILEKVEKWMTACEEESWLEEYNRDENRYSAGRGAHLTLKRAEKARALVNK  430

Query  1522  IPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQGQ  1701
             +PGM++ L S+   WE E GV F YDGV LLSMLE Y +L+QEKELER+RQRD+KKLQGQ
Sbjct  431   LPGMVDMLASKTAAWENENGVYFTYDGVRLLSMLEGYTVLRQEKELERKRQRDEKKLQGQ  490

Query  1702  LMAEQEVLFGSKRSP--SQSGKKN---VVGG----ASNKRISVGGAMLQTPYTERAPLSS  1854
             L+ EQE L+GSK SP  +QS KK      GG    ASN+R+S+GG M   P      L  
Sbjct  491   LLTEQEALYGSKPSPMKNQSAKKGPRLSCGGGGAAASNRRLSLGGHMTHNP-----KLDM  545

Query  1855  HSLKKINPVKQQALANITQN--------YVALSSGRRE---SSMHAKQPSCNKSNLQKTE  2001
             H   K  P  + A  N   N        + ALSSGRR    +    KQ S N  N+++TE
Sbjct  546   HHSSKFTPNTRNAKKNERANQDCHRDDGFAALSSGRRGLDLAGFPVKQHSQNMQNVRETE  605

Query  2002  P-TQRKPLSPISSLSFNTSS-ANIMDKISESEELREMPASLLT-----TPIKNVSGIGG-  2157
                QR P SPISS   + S+  NI++ +++  ++ +   +  T     TP K VS +G  
Sbjct  606   SHMQRNPFSPISSTDSSKSNITNILEDLNKKHDILQKALATNTNTPYSTPSKMVSTVGAE  665

Query  2158  --NATPKtmpipmpstpasaassiamQMGMTPA--------PVAATTPMVGHDG-VEYSY  2304
               N TP+     M      +  SI MQM +TPA          A +  +   DG +EYS+
Sbjct  666   VENRTPR-AMSIMSVPSTPSTVSIPMQMAITPAVPKHMAIVAAAPSAAVKTVDGEIEYSF  724

Query  2305  EEMRAGFLLPRLH  2343
             EE RAGF+LPR H
Sbjct  725   EERRAGFVLPRSH  737



>ref|XP_009625234.1| PREDICTED: 65-kDa microtubule-associated protein 3 [Nicotiana 
tomentosiformis]
Length=732

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/674 (53%), Positives = 479/674 (71%), Gaps = 38/674 (6%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M   QND  ++ ETTC  LL ELQ IW+E+GE + ERDKML ++E+ECLE YRRKVDQA+
Sbjct  1     MSTPQNDPLMQTETTCGLLLHELQIIWDEVGECDTERDKMLFEIERECLEVYRRKVDQAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSRS---LKTELQAIMPlleemkkrkl  597
             RS AQLRQA+A+SEAELA IC+A+GE+PV+++QS ++   LK EL+AI+P LEEM+KRK 
Sbjct  61    RSRAQLRQAIADSEAELAAICSAMGERPVHIKQSDQNKGGLKAELRAIVPALEEMRKRKS  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             +RK+Q  EV +QI  +  E+ +        + +DESDLSLR+LE++ + L +LQKEKS+R
Sbjct  121   DRKNQIIEVTEQIQKIKNEIFRF---TSTSMVVDESDLSLRKLEELHTELHALQKEKSER  177

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             LKQVLDHL +LNSLC VLG+DFK+TI E+ P+LG+S  +K++S +TI  L+ AI  L+EV
Sbjct  178   LKQVLDHLGTLNSLCSVLGMDFKHTISEVDPSLGESEEIKNISNDTIHNLAVAIQRLQEV  237

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             K+QR+  LQ+L T+++ELWNLMD P+EEQ +F NVTR IAA E E+TEP+ LS++ +   
Sbjct  238   KLQRMQRLQDLTTSMLELWNLMDTPIEEQNIFQNVTRKIAAKEHEITEPDMLSVEFIAHV  297

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAI--DDSIEFTDETIESGAIDPSHL  1311
             E EVSRL+E+K+SKMKE++LKKR  LEE+ R+ H+    D ++    E IESGA++ + +
Sbjct  298   EGEVSRLEELKASKMKELVLKKRSELEEIYRKTHIVADSDSAMSIAIEAIESGAVNAASV  357

Query  1312  LEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKR  1491
             LEQ+E+QI+  KEEAFSRK+IL+KVEKW+ ACEEE WLE+YNR++NRYN GRGTHL LKR
Sbjct  358   LEQIELQIAQAKEEAFSRKDILDKVEKWIVACEEECWLEEYNRDENRYNAGRGTHLTLKR  417

Query  1492  AEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQR  1671
             AEKARALVNK+P M+EAL S+ K WE ERG  F YDG+ +L+MLE+Y +L++EKELER+R
Sbjct  418   AEKARALVNKLPAMVEALASKTKAWENERGTLFTYDGIRVLAMLEEYTILREEKELERKR  477

Query  1672  QRDQKKLQGQLMAEQEVLFGSKRSP--SQSGKK----NVVGGASNKRISVGGAMLQT---  1824
             QRDQKKLQGQLMAEQE  +GSK SP  +QS KK    +  G  SNKR+S+GG M QT   
Sbjct  478   QRDQKKLQGQLMAEQEARYGSKPSPMKNQSAKKGPKLSCGGTPSNKRLSLGGTMQQTCKT  537

Query  1825  --PYTERAPLSSHSLKKINPVKQQALANITQN--YVALSSGRRESSMHAKQPS-------  1971
               P++ +A  ++   KK     Q    N +++  +   S+GRR      + PS       
Sbjct  538   ELPHSTKATPNTRQAKKSELFHQLDQFNHSKDDGFAERSAGRRGGLGIDEHPSKKHPISA  597

Query  1972  CNKSNLQKTEPTQRKPLSPISSL-SFNTSSANIMDKISESEELREMPASL------LTTP  2130
              N S ++ +    RKP SPIS+  S NT++ NI+  ++  +    M   L       +TP
Sbjct  598   LNGSEVETS--MMRKPFSPISTTDSSNTNATNILGDVNRKQNETVMKTLLSNHTTPFSTP  655

Query  2131  IKNVSGI-GGNATP  2169
             +K +S +   N TP
Sbjct  656   VKTISTVEEENRTP  669



>gb|KEH42819.1| microtubule associated protein, MAP65/ASE1 family protein [Medicago 
truncatula]
Length=729

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/735 (52%), Positives = 510/735 (69%), Gaps = 48/735 (7%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M N QND   + ETTC SLL ELQ IW+E+GE E +RD+ML +LEQECLE YRRKVDQA+
Sbjct  1     MANPQNDPLSQAETTCGSLLYELQIIWDEVGEAEPDRDRMLFELEQECLEVYRRKVDQAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrkl  597
             +S AQLRQ +A+ EAELA IC+A+GE+PV++RQS +   SLK E   I+P LEEMKK+KL
Sbjct  61    KSRAQLRQLIADCEAELAAICSAMGERPVHIRQSDQNAGSLKEEYARILPQLEEMKKQKL  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             ER++QF+EV +QI S+  E+   ++    ++  DE+DLSLR+ ED+   L +LQ EK  R
Sbjct  121   ERRNQFTEVQEQIQSLSMEIYGPKEYGPSVV--DETDLSLRKFEDLHRQLNALQSEKIGR  178

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             LK V +HL +LNSLC+VLG DFK T+  IHP+LGD    KSVS +TI++L+AAI +LRE+
Sbjct  179   LKTVQEHLCTLNSLCLVLGFDFKQTVLGIHPSLGDEGP-KSVSNDTIQQLAAAIQQLREI  237

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             K+QR+  LQ+LATT++ELWNLMD P+EEQQ+F NVT  IAASE E+TEPN LS D +   
Sbjct  238   KLQRMQKLQDLATTMLELWNLMDTPIEEQQMFQNVTCNIAASEDEITEPNTLSEDFINCV  297

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLA--IDDSIEFTDETIESGAIDPSHL  1311
             E+EVSRL+E+KSSKMKE++LKKR  LEE+CR+ HL   ID ++E+  E IESG +DP+ +
Sbjct  298   EVEVSRLEELKSSKMKELVLKKRTELEEICRKTHLVPEIDGAVEYAVEAIESGIVDPACV  357

Query  1312  LEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKR  1491
             LEQ E Q++ VKEEA  RK+ILEKVEKWLAAC EESWLE+YNR+DNRYN GRG HL LKR
Sbjct  358   LEQFERQVAQVKEEALGRKDILEKVEKWLAACNEESWLEEYNRDDNRYNAGRGAHLTLKR  417

Query  1492  AEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQR  1671
             AEKAR LVNKIPGM++ALTS+   WE E+G  F YDGV LLSM+E+Y +L++EKE ER+R
Sbjct  418   AEKARGLVNKIPGMVDALTSKTIAWEKEKGFEFTYDGVRLLSMIEEYNILREEKEQERRR  477

Query  1672  QRDQKKLQGQLMAEQEVLFGSKRSPS-----QSGKKNVVGGASNKRISVGGAMLQTPYTE  1836
             QRD KKLQGQ++AEQE L+GSK SPS     + G +   GGA+++R+S+GGAMLQTP  +
Sbjct  478   QRDLKKLQGQMIAEQEALYGSKPSPSKPQSVKKGPRMSTGGAASRRVSLGGAMLQTPKPD  537

Query  1837  RAPLSSHSLKKINPVKQ-QALANITQNYVALSSGRRE---SSMHAKQPSCNKSNLQKTE-  2001
                  S +++K++ V Q   L+        LSS RR    + + AK+ S   ++  + E 
Sbjct  538   SKATHSRAMRKVDKVPQFDQLSYPDDGVSCLSSARRGLDIAGIPAKKHSLGAASAYELES  597

Query  2002  PTQRKPLSPISSLSF-------NTSSANIM--DKISESEELREMPASLLTTPIKNVSGIG  2154
             P  R+P SP+SS +        N ++ +IM  +K  ++  L  +P     +P K ++   
Sbjct  598   PLTRQPFSPLSSNNVSSKANVANAANEHIMQSEKFPKTMALNNVP---FVSPCKAMTVTD  654

Query  2155  G-NATPKtmpipmpstpasaassiamQMGMTPAPVA-----ATTPM-----VGHD-----  2286
               N TPK   +P+P  P  +  SI M M +TP P +     A TP+     VG +     
Sbjct  655   QENKTPK--AMPIPIPPTPSTVSIPMNMAVTPVPSSVSMNVAVTPVPSSATVGCNVIPVQ  712

Query  2287  GVEYSYEEMRAGFLL  2331
              +EYS+EE R  + +
Sbjct  713   EIEYSFEERRLAYYM  727



>ref|XP_011041686.1| PREDICTED: 65-kDa microtubule-associated protein 3 [Populus euphratica]
 ref|XP_011041687.1| PREDICTED: 65-kDa microtubule-associated protein 3 [Populus euphratica]
Length=730

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/725 (54%), Positives = 517/725 (71%), Gaps = 38/725 (5%)
 Frame = +1

Query  259   QNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCA  438
             Q+D  L++ETTC +LL ELQ IWNE+GE + +RDKML +LEQECLE YRRKVDQA+RS A
Sbjct  5     QSDPLLQVETTCGTLLYELQIIWNEVGETDTDRDKMLLELEQECLEVYRRKVDQANRSRA  64

Query  439   QLRQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrklerkH  609
             QLRQA+A+SEAELA IC+A+GE+PV++RQ+ +   SLK EL+ I+P LEEM+KRKL+R+ 
Sbjct  65    QLRQAIADSEAELAAICSAMGERPVHIRQADQNIGSLKEELRKIIPQLEEMRKRKLDRRK  124

Query  610   QFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQV  789
             QF EVL+ I  +  E+  S     H + +DE+DLSL++LE++   L  L+KEKSDR+KQV
Sbjct  125   QFHEVLEGIRKISSEIYGS---ADHNVFVDEADLSLKKLEELHRQLHELEKEKSDRMKQV  181

Query  790   LDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQR  969
               HL++LN+LC+VLG+DFK+T+ E+HP+ GDS  L+ +S  TI+ L+  IH+LR+VKIQR
Sbjct  182   QQHLDTLNALCLVLGMDFKHTVSEVHPSFGDSGGLRDISNLTIQHLATTIHKLRKVKIQR  241

Query  970   LHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEV  1149
             +  LQ+LATT++ELWNLMD P+EEQQ F NVT  IAASE E+TEPN  S++ +K  E EV
Sbjct  242   MQKLQDLATTMLELWNLMDTPIEEQQEFQNVTCNIAASEHEITEPNTPSVEFIKYVEAEV  301

Query  1150  SRLQEMKSSKMKEVLLKKRITLEELCRQAHLA--IDDSIEFTDETIESGAIDPSHLLEQL  1323
             SRL+E+KSSKMKE++LKKR  LEE+CR+ H+    D ++E+  E IESG ++P  +LEQ+
Sbjct  302   SRLEELKSSKMKELVLKKRSELEEICRKMHMIPETDAAVEYAVEAIESGNMNPESILEQI  361

Query  1324  EIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKA  1503
             E+QI+NVKEE+FSRKEILEKVEKWL ACEEESWLE+YNR+DNRYN GRG HL LKRAEKA
Sbjct  362   EVQIANVKEESFSRKEILEKVEKWLTACEEESWLEEYNRDDNRYNAGRGAHLTLKRAEKA  421

Query  1504  RALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQ  1683
             R LVNK+PGM+EAL S+   WE ERG  FLYDG+ LLSMLE+Y +L+QEKE ER+RQRDQ
Sbjct  422   RNLVNKMPGMVEALASKTMAWESERGTEFLYDGIRLLSMLEEYTILRQEKEEERRRQRDQ  481

Query  1684  KKLQGQLMAEQEVLFGSKRSPS--QSGKKN---VVGGASNKRISVGGAMLQTP------Y  1830
             KKLQGQL+AEQE L+GSK SPS  QS KK      GGA+N+R+S+GGA LQTP      Y
Sbjct  482   KKLQGQLIAEQEALYGSKPSPSKPQSVKKASRVSTGGATNRRLSLGGAGLQTPRPDLPHY  541

Query  1831  TERAPLSSHSLKKINPVKQQALANITQN--YVALSSGRRE---SSMHAKQPSCNKSNLQK  1995
             ++  P  S    K+  + Q   +   Q+     LS+GRR    + +  K+ S    N ++
Sbjct  542   SKATP-HSRPGNKVERLHQNDHSKPHQDDGVAGLSAGRRGLDIAGLPMKKHSFGAVNGRE  600

Query  1996  TE-PTQRKPLSPISSLSFNTSSANIMDKISESEEL--REMPASLLT--TPIK-NVSGIGG  2157
              + P  R+P SPISS    +S +N++++    ++   + +P + L+  TP K N      
Sbjct  601   PQSPMLRQPFSPISSTV--SSKSNMLEEAMTHDDTSKKTLPINDLSFKTPSKTNTVADEE  658

Query  2158  NATPKtmpipmpstpasaassiamQMGMT---PAPVAATTPMVGHDGVEYSYEEMRAGFL  2328
             N TPK   + +P     +  S+ MQ  MT   P    A  P+   + +EYS+EE RAGF+
Sbjct  659   NWTPK--AMLIPVPTTPSTVSVPMQTAMTPAPPPVPFAVNPVEIPEDIEYSFEERRAGFI  716

Query  2329  LPRLH  2343
             LP  H
Sbjct  717   LPSSH  721



>ref|XP_006340370.1| PREDICTED: 65-kDa microtubule-associated protein 3-like [Solanum 
tuberosum]
Length=734

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/739 (51%), Positives = 501/739 (68%), Gaps = 46/739 (6%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M   QND  L+ ETTC  LL ELQ IW+E+GE + ERD+ML ++E+ECLE YRRKVDQA+
Sbjct  1     MSTPQNDPLLQTETTCGLLLHELQIIWDEVGECDTERDRMLFEIERECLEVYRRKVDQAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSRS---LKTELQAIMPlleemkkrkl  597
             +S AQLRQA+A+SEAELA IC+A+GE+PV+++QS +S   LK EL+A++P LEEM+KRK 
Sbjct  61    KSRAQLRQAIADSEAELAAICSAMGERPVHIKQSDKSQGGLKAELRAVLPELEEMRKRKS  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             +RK+QF EV+ QI  +  E+ +        + +DESDLSLR+LE++ + L +LQKEKS+R
Sbjct  121   DRKNQFIEVMKQITKIKNEIYRF---TSASLVVDESDLSLRKLEELHTELHTLQKEKSER  177

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             LKQVL+HL +LNSLC VLG+DFK+T+ E+ P+LG+S   K++   TI+ L+A I  L+EV
Sbjct  178   LKQVLNHLGTLNSLCSVLGMDFKHTVNEVDPSLGESEETKNICDGTIQNLAATIQRLQEV  237

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             K+QR+  LQ+L T+++ELWNLMD P+EEQQ+F NVT  IAA E E+TEPN LS++ +   
Sbjct  238   KLQRMQRLQDLTTSMLELWNLMDTPIEEQQMFQNVTCKIAAKEHEITEPNMLSMEFITYV  297

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLA--IDDSIEFTDETIESGAI-DPSH  1308
             E EV RL+E+K+SKMKE++LKK+  LEE+ R+ H+    D ++    E IESGA+ D   
Sbjct  298   EEEVDRLEELKASKMKELVLKKKSELEEIYRKTHMVGDSDGAMNIAIEDIESGAVNDADA  357

Query  1309  LLEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLK  1488
             +LEQ+E++I+ VKEEAFSRK+IL++VEKW+AACEEE WLE+YNR++NRYN GRGTHL LK
Sbjct  358   VLEQIELRIAQVKEEAFSRKDILDRVEKWIAACEEECWLEEYNRDENRYNAGRGTHLTLK  417

Query  1489  RAEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQ  1668
             RAEKARALVNK+P M+EAL S+ K WE ERG  F YDG+ LLSMLE+Y +L++EKELER+
Sbjct  418   RAEKARALVNKLPAMMEALASKTKAWENERGTQFSYDGIPLLSMLEEYTILREEKELERK  477

Query  1669  RQRDQKKLQGQLMAEQEVLFGSKRSP--SQSGKKN---VVGGA-SNKRISVGGAMLQT--  1824
             +QRDQKKLQGQLMAEQE L+GSK SP  +QS KK      GGA SN+R+S+GG M QT  
Sbjct  478   KQRDQKKLQGQLMAEQESLYGSKPSPMKNQSAKKGPKLSCGGAPSNRRLSLGGTMQQTCK  537

Query  1825  ---PYTERAPLSSHSLKKINPVKQQALAN--ITQNYVALSSGRR-----ESSMHAKQPSC  1974
                P++ +A  ++   KK     Q    N      + ALS+GRR     +     KQP  
Sbjct  538   TELPHSTKATPNTRQAKKSERFHQLDQFNHPTDDGFGALSTGRRGGLGIDELPSKKQPIS  597

Query  1975  NKSNLQKTEPTQRKPLSPISSLSFNTSSA-NIMDKIS--ESEELREMPASLLTTPIKN-V  2142
               +  +      RKP SPISS   + S+A NI+  ++   +E + + P S  TTP+   V
Sbjct  598   ALNGSEVETAVMRKPFSPISSKGSSKSNATNILGDMNRKHNETMIKTPLSNHTTPVSTPV  657

Query  2143  SGIGG----NATPKtmpipmpstpasaassiamQMGMTPAPVAATTPMVGH--------D  2286
               I      N TP          P++ ++        TP P A  TP            +
Sbjct  658   KSISTYEEENRTP--AKAMPIPVPSTPSTVSVPMQTTTPGP-AVVTPYNSKLVENTHVVE  714

Query  2287  GVEYSYEEMRAGFLLPRLH  2343
              +EYS+EE R  F L R H
Sbjct  715   EIEYSFEESRLEFYLQRTH  733



>ref|XP_003622331.1| Protein regulator of cytokinesis [Medicago truncatula]
Length=729

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/735 (52%), Positives = 508/735 (69%), Gaps = 48/735 (7%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M N QND   + ETTC SLL ELQ IW+E+GE E +RD+ML +LEQECLE YRRKVDQA+
Sbjct  1     MANPQNDPLSQAETTCGSLLYELQIIWDEVGEAEPDRDRMLFELEQECLEVYRRKVDQAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrkl  597
             +S AQLRQ +A+ EAELA IC+A+GE+PV++RQS +   SLK E   I+P LEEMKK+KL
Sbjct  61    KSRAQLRQLIADCEAELAAICSAMGERPVHIRQSDQNAGSLKEEYARILPQLEEMKKQKL  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             ER++QF+EV +QI S+  E+   ++    ++  DE+DLSLR+ ED+   L +LQ EK  R
Sbjct  121   ERRNQFTEVQEQIQSLSMEIYGPKEYGPSVV--DETDLSLRKFEDLHRQLNALQSEKIGR  178

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             LK V +HL +LNSLC+VLG DFK T+  IHP+LGD    KSVS +TI++L+AAI +LRE+
Sbjct  179   LKTVQEHLCTLNSLCLVLGFDFKQTVLGIHPSLGDEGP-KSVSNDTIQQLAAAIQQLREI  237

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             K+QR+  LQ+LATT++ELWNLMD P+EEQQ+F NVT  IAASE E+TEPN LS D +   
Sbjct  238   KLQRMQKLQDLATTMLELWNLMDTPIEEQQMFQNVTCNIAASEDEITEPNTLSEDFINCV  297

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLA--IDDSIEFTDETIESGAIDPSHL  1311
             E+EVSRL+E+KSSKMKE++LKKR  LEE+CR+ HL   ID ++E+  E IESG +DP+ +
Sbjct  298   EVEVSRLEELKSSKMKELVLKKRTELEEICRKTHLVPEIDGAVEYAVEAIESGIVDPACV  357

Query  1312  LEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKR  1491
             LEQ E Q++ VKEEA  RK+ILEKVEKWLAAC EESWLE+YNR+DNRYN GRG HL LKR
Sbjct  358   LEQFERQVAQVKEEALGRKDILEKVEKWLAACNEESWLEEYNRDDNRYNAGRGAHLTLKR  417

Query  1492  AEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQR  1671
             AEKAR LVNKIPGM++ALTS+   WE E+G  F YDGV LLSM+E+Y +L++EKE ER+R
Sbjct  418   AEKARGLVNKIPGMVDALTSKTIAWEKEKGFEFTYDGVRLLSMIEEYNILREEKEQERRR  477

Query  1672  QRDQKKLQGQLMAEQEVLFGSKRSPS-----QSGKKNVVGGASNKRISVGGAMLQTPYTE  1836
             QRD KKLQGQ++AEQE L+GSK SPS     + G +   GGA+++R+S+GGAMLQTP  +
Sbjct  478   QRDLKKLQGQMIAEQEALYGSKPSPSKPQSVKKGPRMSTGGAASRRVSLGGAMLQTPKPD  537

Query  1837  RAPLSSHSLKKINPVKQ-QALANITQNYVALSSGRRE---SSMHAKQPSCN-KSNLQKTE  2001
                  S +++K++ V Q   L+        LSS RR    + + AK+ S    S  +   
Sbjct  538   SKATHSRAMRKVDKVPQFDQLSYPDDGVSCLSSARRGLDIAGIPAKKHSLGAASAYELXS  597

Query  2002  PTQRKPLSPISSLSF-------NTSSANIM--DKISESEELREMPASLLTTPIKNVSGIG  2154
             P  R+P SP+SS +        N ++ +IM  +K  ++  L  +P     +P K ++   
Sbjct  598   PLTRQPFSPLSSNNVSSKANVANAANEHIMQSEKFPKTMALNNVP---FVSPCKAMTVTD  654

Query  2155  G-NATPKtmpipmpstpasaassiamQMGMTPAPVA-----ATTPM-----VGHD-----  2286
               N TPK   +P+P  P  +  SI M M +TP P +     A TP+     VG +     
Sbjct  655   QENKTPK--AMPIPIPPTPSTVSIPMNMAVTPVPSSVSMNVAVTPVPSSATVGCNVIPVQ  712

Query  2287  GVEYSYEEMRAGFLL  2331
              +EYS+EE R  + +
Sbjct  713   EIEYSFEERRLAYYM  727



>ref|XP_007038464.1| Microtubule associated protein family protein isoform 3, partial 
[Theobroma cacao]
 gb|EOY22965.1| Microtubule associated protein family protein isoform 3, partial 
[Theobroma cacao]
Length=645

 Score =   597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/550 (62%), Positives = 428/550 (78%), Gaps = 14/550 (3%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M   +ND  L++ETTC +LL ELQ IW+E+GE + +RDKML +LEQECLE YRRKVDQA+
Sbjct  33    MSTPKNDPLLQVETTCGTLLYELQIIWDEVGETDSDRDKMLLELEQECLEVYRRKVDQAN  92

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQS---SRSLKTELQAIMPlleemkkrkl  597
             R  AQLRQ +A+SEAELA IC+A+GE+PV++RQS   S SLK EL+ I+P LEEM+KRK+
Sbjct  93    RCRAQLRQTIADSEAELAAICSAMGERPVHIRQSDQNSGSLKEELRKILPQLEEMRKRKV  152

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             ER++QF EVL+Q   +  E+  S + +     +DE+DLSLR+LE++   L  LQKEKSDR
Sbjct  153   ERRNQFIEVLEQTQKITNEIYGSTESVSLKTVVDETDLSLRKLEELHRQLHELQKEKSDR  212

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             LKQV DHL  LNSLC V+G+DFK T+ E+HP+LGDS  L+S+S  TIE+L+ AI +LREV
Sbjct  213   LKQVQDHLHMLNSLCSVMGMDFKLTVSEVHPSLGDSDGLRSISNNTIEKLAIAIKKLREV  272

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             KIQR+  LQ+LATT++ELWNLMD P+EEQQ+F NVT  IAASE E+TEPN LS+D +   
Sbjct  273   KIQRMQRLQDLATTMLELWNLMDTPIEEQQMFQNVTCNIAASEHEITEPNTLSVDFINYV  332

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLA--IDDSIEFTDETIESGAIDPSHL  1311
             E EVSRL+E+KSSKMKE++LKKR  LE++CR+ HL    D +IE   E IESGA+D + +
Sbjct  333   EAEVSRLEELKSSKMKELVLKKRSELEDICRKTHLVPDSDSAIEDAIEAIESGAVDAATI  392

Query  1312  LEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKR  1491
             LEQ+E+QI+ VKEEAFSRKEILEKVEKWL AC+EE WLE+YNR++NRYN G+G HL LKR
Sbjct  393   LEQIELQIAKVKEEAFSRKEILEKVEKWLTACDEECWLEEYNRDENRYNAGKGAHLTLKR  452

Query  1492  AEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQR  1671
             AEKAR+LVNK+PGM+EAL S+   WE ER + F+YDG+ LLSMLE+Y +L+QEKE ER+R
Sbjct  453   AEKARSLVNKLPGMVEALASKTLAWEKEREIKFMYDGIRLLSMLEEYTILRQEKEQERRR  512

Query  1672  QRDQKKLQGQLMAEQEVLFGSKRSPS-----QSGKKNVVGGASNKRISVGGAMLQTPYTE  1836
              RDQKKLQGQL+AEQE L+GSK SPS     + G +   GGASN+R+S+GGAML      
Sbjct  513   LRDQKKLQGQLIAEQEALYGSKPSPSKPQSVKKGSRFSTGGASNRRVSLGGAMLPN----  568

Query  1837  RAPLSSHSLK  1866
               P S HS K
Sbjct  569   HKPDSLHSAK  578



>ref|XP_009758362.1| PREDICTED: 65-kDa microtubule-associated protein 3 [Nicotiana 
sylvestris]
Length=733

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/672 (53%), Positives = 480/672 (71%), Gaps = 34/672 (5%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M   QND   + ETTC  LL ELQ IW+E+GE + ERDKML ++E+ECLE YRRKVDQA+
Sbjct  1     MSTPQNDPLQQTETTCGLLLHELQIIWDEVGECDTERDKMLFEIERECLEVYRRKVDQAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSRS---LKTELQAIMPlleemkkrkl  597
             RS AQLRQA+A+SEAELA IC+A+GE PV+++QS ++   LK EL+AI+P LEEM+KRK 
Sbjct  61    RSRAQLRQAIADSEAELAAICSAIGECPVHIKQSDQNKGGLKAELRAIVPALEEMRKRKS  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             +RK+QF EV +QI  +  E+ +        + +DESDLSLR+LE++ S L SLQKEKS+R
Sbjct  121   DRKNQFIEVTEQIQKIKNEIFRF---TSTSMVVDESDLSLRKLEELHSELHSLQKEKSER  177

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             LKQVLDHL +LNSLC VLG+DFK+++ E+ P+LG+S  +K++S +TI+ L+AAIH L+EV
Sbjct  178   LKQVLDHLGTLNSLCSVLGMDFKHSVSEVDPSLGESEEIKNISNDTIQNLAAAIHRLQEV  237

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             K+QR+  LQ+L T+++ELWNLMD P+EEQ++F NVT  IAA E E+TEP+ LS++ +   
Sbjct  238   KLQRMQQLQDLTTSMLELWNLMDTPIEEQKIFQNVTCKIAAKEHEITEPDMLSVEFIAHV  297

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAI--DDSIEFTDETIESGAIDPSHL  1311
             E EVSRL+E+K+SKMKE++LKKR  LEE+ R+ H+    D ++    E IESGA++ + +
Sbjct  298   EGEVSRLEELKASKMKELVLKKRSELEEIYRKTHIVADSDSAMSIAIEAIESGAVNAASV  357

Query  1312  LEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKR  1491
             LEQ+E+QI+  KEEAFSRK+IL+KVEKW+AACEEE WLE+YNR++NRYN GRGTHL LKR
Sbjct  358   LEQIELQIAQAKEEAFSRKDILDKVEKWIAACEEECWLEEYNRDENRYNAGRGTHLTLKR  417

Query  1492  AEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQR  1671
             AEKARALVNK+P M+EAL S+ K WE ERG  F YDG+ +LSMLE+Y +L++EKELER+R
Sbjct  418   AEKARALVNKLPAMVEALASKTKAWENERGTLFTYDGIRVLSMLEEYTILREEKELERKR  477

Query  1672  QRDQKKLQGQLMAEQEVLFGSKRSP--SQSGKK----NVVGGASNKRISVGGAMLQT---  1824
             QRDQKKLQGQLMAEQE  +GSK SP  +QS KK    +  G  SN+R+S+GG M QT   
Sbjct  478   QRDQKKLQGQLMAEQEARYGSKPSPMKNQSAKKGPKLSCGGTPSNRRLSLGGTMQQTCKT  537

Query  1825  --PYTERAPLSSHSLKKINPVKQQALANITQN--YVALSSGRRES----SMHAKQPSCNK  1980
               P++ +A  ++   KK     Q    N  ++  +   S+G R       + +K+   + 
Sbjct  538   EFPHSTKATPNTRQAKKSELFHQLDQFNHPKDDGFAERSAGGRGGLGIDELPSKKHPISA  597

Query  1981  SNLQKTEPT-QRKPLSPISSL-SFNTSSANIMDKISESEELREMPASL------LTTPIK  2136
              N  + E T  RKP SPIS+  S  T++ NI+  ++  +    M   L       +TP+K
Sbjct  598   LNGSEVETTMMRKPFSPISTTDSSKTNATNILGDVNRKQNETVMKTLLSNHTTPFSTPVK  657

Query  2137  NVSGI-GGNATP  2169
              +S +   N TP
Sbjct  658   TISTVEEENRTP  669



>ref|XP_010924154.1| PREDICTED: 65-kDa microtubule-associated protein 3-like [Elaeis 
guineensis]
Length=693

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/714 (52%), Positives = 491/714 (69%), Gaps = 48/714 (7%)
 Frame = +1

Query  262   NDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQ  441
             +DQ L+METTC SLL ELQ IW+E+GE + ERDK+L +LEQECLE YRRKVDQA+R  AQ
Sbjct  6     SDQLLQMETTCGSLLYELQMIWDEVGESDAERDKLLLELEQECLEVYRRKVDQANRCRAQ  65

Query  442   LRQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrklerkHQ  612
             LRQA+A++EAELA IC+A+GE+PV++RQS++   SLK EL+ I+P LEEM+KRK +R +Q
Sbjct  66    LRQAIADAEAELAAICSAMGERPVHIRQSNQKAGSLKEELKEIIPQLEEMRKRKNDRWNQ  125

Query  613   FSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVL  792
             F EV++QI  +  E+ +  +     +A+DESDLS RRLE++   L S QKEK+DRLKQV+
Sbjct  126   FLEVIEQIRRISIEI-RPAEYTPSKVAMDESDLSTRRLEELHRQLQSFQKEKTDRLKQVM  184

Query  793   DHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQRL  972
             DHL +LNSLC+VLGIDF+ T+ E+HP+L ++   K+ S +TIE L++AI  LREVKIQR+
Sbjct  185   DHLNTLNSLCLVLGIDFRQTVHEVHPSLDETEGSKNFSNDTIESLASAIQRLREVKIQRM  244

Query  973   HMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVS  1152
               LQ+LA+T++ELWNLMD PVEEQQLF NVT  IAASE E+TEPN LS+D +   E EV 
Sbjct  245   QKLQDLASTMLELWNLMDTPVEEQQLFQNVTCNIAASEHEITEPNTLSMDFINYVEAEVL  304

Query  1153  RLQEMKSSKMKEVLLKKRITLEELCRQAHLAIDDS--IEFTDETIESGAIDPSHLLEQLE  1326
             RL+++K+SKMKE++LKK+  LEEL R+ HL  + S   EF  E IE+GA+DPS +LEQ+E
Sbjct  305   RLEQLKASKMKELVLKKKTELEELRRRTHLVAEASSETEFAIEAIEAGAVDPSLMLEQIE  364

Query  1327  IQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKAR  1506
             +Q+S VKEEAFSRK+ILEKVEKW AA +EESWLE+YNR++NRY+  RG HLMLKRAEKAR
Sbjct  365   VQVSKVKEEAFSRKDILEKVEKWFAARDEESWLEEYNRDENRYSAVRGAHLMLKRAEKAR  424

Query  1507  ALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQK  1686
             ALVNKIP M++AL ++   WE +RG+ F YDGV LLSMLE+Y +++QEKE ER+RQRDQK
Sbjct  425   ALVNKIPAMVDALAAKITAWENDRGIEFTYDGVRLLSMLEEYTIVRQEKEQERKRQRDQK  484

Query  1687  KLQGQLMAEQEVLFGSKRSPSQ--SGKK--NVVGGASNKRISVGGAMLQTPYTE-RAPLS  1851
             KLQ QL+ E+E  FGS+ SPS+  S KK      G S++R+S+GGA++  P  +   P S
Sbjct  485   KLQDQLITEKEARFGSQPSPSKAHSAKKIPRTSTGGSSRRLSLGGAVMHPPKPDLLHPKS  544

Query  1852  SHSLKKINPVKQQALANITQNYVALSSGRRE---SSMHAKQPSCNKSNLQKTEPTQRKPL  2022
             + S KK             ++  ALS  RR    + +  K+ S N  N        R+P 
Sbjct  545   TRSTKK------------AEDMSALSPARRGIDIAGLPVKKLSFNTMNAPCEVEMPRRPF  592

Query  2023  S---PISSLSFNTSSANIMDKISESEELREMPASLLTTPI--KNVSGIGGNATPKtmpip  2187
             +   P++S+    S  NIM           +  S+L+TP   KN      N TPK   +P
Sbjct  593   TPLVPVNSIPSTPSQPNIM-----------LTPSILSTPSQPKNNDVEEENRTPK--IMP  639

Query  2188  mpstpasaassiamQMGMTPAPVA----ATTPMVGHDGVEYSYEEMRAGFLLPR  2337
             + +         +MQM  TPAP      A       + +EYS+EE R  F L R
Sbjct  640   ISTPKTPVTVPASMQMATTPAPTCLVYEAAVTKAPLEEMEYSFEERRLAFYLKR  693



>gb|AAT40494.2| Putative microtubule-associated protein, identical [Solanum demissum]
Length=722

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/728 (51%), Positives = 497/728 (68%), Gaps = 47/728 (6%)
 Frame = +1

Query  280   METTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVA  459
             METTC  LL ELQ IW+E+GE + ERD+ML ++E+ECLE YRRKVDQA++S AQLRQA+A
Sbjct  1     METTCGLLLHELQIIWDEVGECDTERDRMLFEIERECLEVYRRKVDQANKSRAQLRQAIA  60

Query  460   ESEAELARICAALGEQPVNVRQSSRS---LKTELQAIMPlleemkkrklerkHQFSEVLD  630
             +SEAELA IC+A+GE+PV+++QS +S   LK EL+A++P LEEM+KRK +RK+QF EV+ 
Sbjct  61    DSEAELAAICSAMGERPVHIKQSDKSQGGLKAELRAVLPELEEMRKRKSDRKNQFIEVMK  120

Query  631   QIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESL  810
             QI  +  E+ +        + +DESDLSLR+LE++ + L +LQKEKS+RLKQVL+HL +L
Sbjct  121   QITKIKNEIYRF---TSASLVVDESDLSLRKLEELHTELHTLQKEKSERLKQVLNHLGTL  177

Query  811   NSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQRLHMLQNL  990
             NSLC VLG+DFK+TI E+ P LG+S   K++  +TI+ L+A I  L+EVK+QR+  LQ+L
Sbjct  178   NSLCSVLGMDFKHTINEVDPNLGESEEAKNICDDTIQNLAATIQRLQEVKLQRMQRLQDL  237

Query  991   ATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQEMK  1170
              T+++ELWNLMD P+EEQQ+F NVT  IAA E E+TEPN LS++ +   E EV RL+E+K
Sbjct  238   TTSMLELWNLMDTPIEEQQMFQNVTCKIAAKEHEITEPNMLSMEFITYVEEEVDRLEELK  297

Query  1171  SSKMKEVLLKKRITLEELCRQAHLA--IDDSIEFTDETIESGAI-DPSHLLEQLEIQISN  1341
             +SKMKE++LKK+  LEE+ R+ H+    D ++    E IESGA+ D   +LEQ+E++I+ 
Sbjct  298   ASKMKELVLKKKSELEEIYRKTHMVGDSDGAMNIAIEAIESGAVNDADAVLEQIELRIAQ  357

Query  1342  VKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVNK  1521
             VKEEAFSRK+IL++VEKW+AACEEE WLE+YNR++NRYN GRGTHL LKRAEKARALVNK
Sbjct  358   VKEEAFSRKDILDRVEKWIAACEEECWLEEYNRDENRYNAGRGTHLTLKRAEKARALVNK  417

Query  1522  IPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQGQ  1701
             +P M+EAL S+ K WE ERG  F YDG+ LLSMLE+Y +L++EKELER++QRDQKKLQGQ
Sbjct  418   LPAMVEALASKTKAWENERGTQFSYDGIPLLSMLEEYTILREEKELERKKQRDQKKLQGQ  477

Query  1702  LMAEQEVLFGSKRSP--SQSGKKN---VVGGA-SNKRISVGGAMLQT-----PYTERAPL  1848
             LMAEQE L+GSK SP  +QS KK      GGA SN+R+S+GG M QT     P++ +A  
Sbjct  478   LMAEQESLYGSKPSPMKNQSAKKGPKLSCGGAPSNRRLSLGGTMQQTCKTELPHSTKATP  537

Query  1849  SSHSLKKINPVKQQALANITQN--YVALSSGRR-----ESSMHAKQPSCNKSNLQKTEPT  2007
             ++   KK     Q    N   N  + ALS+GRR     +     KQP    +  +     
Sbjct  538   NTRQAKKSERFHQLDQFNHPTNDGFGALSAGRRGGLGIDELPSKKQPISALNGSEVETAV  597

Query  2008  QRKPLSPISSLSFNTSSA-NIMDKISESEELREMPASLL-------TTPIKNVSGI-GGN  2160
              RKP SPISS   + S+A NI+  ++       M  +LL       +TP+K++S     N
Sbjct  598   MRKPFSPISSKGSSKSNATNILGDMNRKHN-ESMIKTLLSNHTTPVSTPVKSISTCEEEN  656

Query  2161  ATPKtmpipmpstpasaassiamQMGMTPAPVAATTPMVGH-------DGVEYSYEEMRA  2319
              TP          P++ ++        TP P A  TP           + +EYS+EE R 
Sbjct  657   RTP--AKAMPIPVPSTPSTVSVPMQTTTPGP-AVVTPYNSKLVENTHVEEIEYSFEESRL  713

Query  2320  GFLLPRLH  2343
              F L R H
Sbjct  714   EFYLQRTH  721



>ref|XP_004251251.1| PREDICTED: 65-kDa microtubule-associated protein 3-like [Solanum 
lycopersicum]
 ref|XP_010313506.1| PREDICTED: 65-kDa microtubule-associated protein 3-like [Solanum 
lycopersicum]
 ref|XP_010313507.1| PREDICTED: 65-kDa microtubule-associated protein 3-like [Solanum 
lycopersicum]
Length=734

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/739 (51%), Positives = 498/739 (67%), Gaps = 46/739 (6%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M   QND  L+ ETTC  LL ELQ IW+E+GE + ERD+ML ++E+ECLE YRRKVDQA+
Sbjct  1     MSTPQNDPLLQTETTCGLLLHELQIIWDEVGECDTERDRMLFEIERECLEVYRRKVDQAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSRS---LKTELQAIMPlleemkkrkl  597
             +S AQLRQA+A+SEAELA IC+A+GE+PV+++QS +S   LK EL+A++P LEEM+KRK 
Sbjct  61    KSRAQLRQAIADSEAELAAICSAMGERPVHMKQSDKSQGGLKAELRAVLPELEEMRKRKS  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             +RK+QF EV  QI  +  E+ +        + +DESDLSLR+LE+    L +LQKEKS+R
Sbjct  121   DRKNQFIEVFKQIQMIKNEISRL---TSASLVVDESDLSLRKLEEFHMELHALQKEKSER  177

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             L  VLDHL +L SLC VLG+DF++TI E+ P+ G+S   K++  +TI+ L+A I  L+EV
Sbjct  178   LTLVLDHLGALKSLCSVLGMDFEHTINEVDPSFGESEEAKNICNDTIQNLAATIQRLQEV  237

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             K+QR+  LQ+L T+++ELWNLMD P+EEQQLF NVT  IAA E E+TEPN LS++ +   
Sbjct  238   KLQRMQRLQDLTTSMLELWNLMDTPIEEQQLFHNVTCKIAAKEHEITEPNMLSMEFITYV  297

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLA--IDDSIEFTDETIESGAIDPSH-  1308
             E EV RL+E+K+SKMKE++LKK+  LEE+ R+ H+    D ++    E IESGA+D +  
Sbjct  298   EEEVGRLEELKASKMKELVLKKKSELEEIYRKTHMVGDSDSALNIAIEAIESGAVDDADA  357

Query  1309  LLEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLK  1488
             +LEQ+E+QI+ VKEEAFSRK+IL++VEKW+AACEEE WLE+YNR++NRYN GRGTHL LK
Sbjct  358   VLEQIELQIAQVKEEAFSRKDILDRVEKWIAACEEECWLEEYNRDENRYNAGRGTHLTLK  417

Query  1489  RAEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQ  1668
             RAEKARALVNK+P M+EAL S+ K WE ERG  F YDG+ LLSMLE+Y +L++EKELER+
Sbjct  418   RAEKARALVNKLPAMVEALASKTKAWENERGTQFSYDGIPLLSMLEEYTILREEKELERK  477

Query  1669  RQRDQKKLQGQLMAEQEVLFGSKRSP--SQSGKKN---VVGGA-SNKRISVGGAMLQT--  1824
             +QRDQKKLQGQLMAEQE L+GSK SP  +QS KK      GGA SN+R+S+GG M QT  
Sbjct  478   KQRDQKKLQGQLMAEQESLYGSKPSPMKNQSAKKGPKLSCGGAPSNRRLSLGGTMQQTCK  537

Query  1825  ---PYTERAPLSSHSLKKINPVKQQALAN--ITQNYVALSSGRRESSMHAKQPSCNK--S  1983
                PY+ +A  ++   KK     Q    N      + ALS+GRR      + PS  +  S
Sbjct  538   TELPYSTKATPNTRQAKKSERFHQLDQFNHPTDDGFGALSTGRRGGLGIDELPSKKQLIS  597

Query  1984  NLQKTE---PTQRKPLSPISSLSFNTSSA-NIMDKIS--ESEELREMPASLLTTPIKN-V  2142
              L  +E      RKP SPISS   + S+A NI+  ++   +E + + P S  TTP+   V
Sbjct  598   ALNGSEVETAVMRKPFSPISSKGSSKSNATNILGDMNRKHNETMTKTPLSNHTTPVSTPV  657

Query  2143  SGIGG----NATPKtmpipmpstpasaassiamQMGMTPAPVAATTPMVG--------HD  2286
               I      N TP          P++ ++        TP P A  TP            +
Sbjct  658   KSISTYEEENRTP--AKAMPIPVPSTPSTVSVPMQTTTPGP-AVVTPYNSKLVENTHVKE  714

Query  2287  GVEYSYEEMRAGFLLPRLH  2343
              +EYS+EE R  F L R H
Sbjct  715   EIEYSFEESRLEFYLQRTH  733



>ref|XP_008376372.1| PREDICTED: 65-kDa microtubule-associated protein 3-like [Malus 
domestica]
Length=709

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/736 (51%), Positives = 501/736 (68%), Gaps = 71/736 (10%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M N Q++Q L+METTC SLL ELQ IWNE+GE + +RDKML +LEQECLE YRRKVD+A+
Sbjct  1     MSNLQSEQLLQMETTCGSLLYELQIIWNEVGESDKDRDKMLLELEQECLEVYRRKVDKAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrkl  597
             R  AQLRQA+A+SEAELA IC+A+GE+PV++RQS +   SLK EL  I+P LEEMKKRK 
Sbjct  61    RCRAQLRQAIADSEAELAAICSAMGERPVHIRQSDQNAGSLKEELSKIIPQLEEMKKRKC  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             +RK+ F EVL++I  +  E+  S        A+DE+DLSLRRLE++  HL  LQ EKSDR
Sbjct  121   DRKNNFLEVLEEIRKISSEINGSTDYSSSTPAVDETDLSLRRLEELHRHLHGLQTEKSDR  180

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             LKQ+ DHL +LNSLC VLG+D+K TI E+HP+L DS   K++S +TI+RL+AAI +LREV
Sbjct  181   LKQIQDHLCTLNSLCSVLGMDYKQTISEVHPSLVDSEGSKNISNDTIQRLAAAIQKLREV  240

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             K+QR+  LQ+LATT++ELWNLMD P+EEQQ+F N+T  IAASE E+TEPN LS+D +   
Sbjct  241   KLQRMQRLQDLATTMLELWNLMDTPIEEQQMFQNITCNIAASEHEITEPNTLSVDFINYV  300

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAI--DDSIEFTDETIESGAIDPSHL  1311
             E EVSRL+E+KSSKMKE++LKKR  LEE+CR+ H+ +  D +I++  E IESG +DP+ +
Sbjct  301   EAEVSRLEELKSSKMKELVLKKRSELEEICRKTHMVLEADSAIDYVIEAIESGDVDPACV  360

Query  1312  LEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKR  1491
             L+Q+E+Q++ VKEEAFSRK+ILE+VEKWL AC+EE WLE+YNR++NRYN GRG HL LKR
Sbjct  361   LDQIELQVAKVKEEAFSRKDILERVEKWLFACDEECWLEEYNRDENRYNAGRGAHLTLKR  420

Query  1492  AEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQR  1671
             AEKARALVNK+P M++AL S+   WE ERG+ F YDG+ LLSMLE+Y +L++EKE ER+R
Sbjct  421   AEKARALVNKLPAMVDALASKTISWEKERGIEFTYDGIRLLSMLEEYTILREEKEQERRR  480

Query  1672  QRDQKKLQGQLMAEQEVLFGSKRSPS--QSGKKN---VVGGASNKRISVGGAMLQTPYTE  1836
             QRDQKK+QGQL+AEQEVL+GSK SPS  QS KK      GGASN+R+S+        ++ 
Sbjct  481   QRDQKKIQGQLIAEQEVLYGSKPSPSKPQSVKKAPRMSTGGASNRRLSMQAPKPDPLHSV  540

Query  1837  RAPLSSHSLKKINPVKQQALANITQNYVALSSGRRE-----SSMHAKQPSCNKSNLQKTE  2001
             +    S    ++NP  +Q   ++   + +LS+GRR      + +  K+ S   +N  + E
Sbjct  541   KGTPRSRKSDRVNP-NEQLNNHLDDGFSSLSTGRRGLGLDVAGLSVKKHSFGAANPSEVE  599

Query  2002  -PTQRKPLSPISSLSFNTSSANIMDKISESEELREMPASLLTTPIK-NVSGIGGNATPKt  2175
              PT RKP SPI S+  +  S N+               +  TTP+K        N TPK 
Sbjct  600   TPTIRKPFSPI-SVPVSIPSENV---------------AFGTTPLKPRTVADEENKTPKV  643

Query  2176  mpipmpstpasaassiamQMGMTPAPVAATTPMVGH--------------------DGVE  2295
             MP                 + +   P   + PM                       + +E
Sbjct  644   MP-----------------IFVPTTPSMVSVPMQTAMTPAPPPPVPFATNLVQEIPEEIE  686

Query  2296  YSYEEMRAGFLLPRLH  2343
             YS+EE RAGF+LP+ H
Sbjct  687   YSFEERRAGFVLPKTH  702



>ref|XP_009374532.1| PREDICTED: 65-kDa microtubule-associated protein 3 isoform X1 
[Pyrus x bretschneideri]
Length=709

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/736 (51%), Positives = 501/736 (68%), Gaps = 71/736 (10%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M N Q++Q L+METTC SLL ELQ IWNE+GE + +RDKML +LEQECLE YRRKVD+A+
Sbjct  1     MSNLQSEQLLQMETTCGSLLYELQIIWNEVGESDKDRDKMLLELEQECLEVYRRKVDKAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrkl  597
             R  AQLRQA+A+SEAELA IC+A+GE+PV++RQS +   SLK EL  I+P LEEMKKRK 
Sbjct  61    RCRAQLRQAIADSEAELAAICSAMGERPVHIRQSDQNAGSLKEELSKIIPQLEEMKKRKY  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             +RK+ F EVL++I  +  E+  S      + A+DE+DLSLRRLE+++ HL  LQ EKSDR
Sbjct  121   DRKNNFLEVLEEIQKISSEINGSTDYSSSIPAVDETDLSLRRLEELQRHLHGLQTEKSDR  180

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             LKQ+ DHL +LNSLC VLG+D+K TI E+HP+L DS   K++S +TI+RL+AAI +LREV
Sbjct  181   LKQIQDHLCTLNSLCSVLGMDYKQTISEVHPSLVDSEGSKNISNDTIQRLAAAIQKLREV  240

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             K+QR+  LQ+LATT++ELWNLMD P+EEQQ+F N+T  IAASE E+TEPN LS+D +   
Sbjct  241   KLQRMQRLQDLATTMLELWNLMDTPIEEQQMFQNITCNIAASEHEITEPNTLSVDFINYV  300

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAI--DDSIEFTDETIESGAIDPSHL  1311
             E EVSRL+E+KSSKMKE++LKKR  LEE+CR+ H+ +  D +I++    IESG +DP+ +
Sbjct  301   EAEVSRLEELKSSKMKELVLKKRSELEEICRKTHMVLEADSAIDYVIAAIESGDVDPACV  360

Query  1312  LEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKR  1491
             L+Q+E+Q++ VKEEAFSRK+ILE+VEKWL AC+EE WLE+YNR++NRYN GRG HL LKR
Sbjct  361   LDQIELQVAKVKEEAFSRKDILERVEKWLFACDEECWLEEYNRDENRYNAGRGAHLTLKR  420

Query  1492  AEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQR  1671
             AEKARALVNK+P M++AL S+   WE ERG+ F YDG+ LLSMLE+Y +L++EKE ER+R
Sbjct  421   AEKARALVNKLPAMVDALASKTISWEKERGIEFTYDGIRLLSMLEEYTILREEKEQERRR  480

Query  1672  QRDQKKLQGQLMAEQEVLFGSKRSPS--QSGKKN---VVGGASNKRISVGGAMLQTPYTE  1836
             QRDQKK+QGQL+AEQEVL+GSK SPS  QS KK      GGASN+R+S+        ++ 
Sbjct  481   QRDQKKIQGQLIAEQEVLYGSKPSPSKPQSVKKAPRMSTGGASNRRLSMQAPKPDPLHSI  540

Query  1837  RAPLSSHSLKKINPVKQQALANITQNYVALSSGRRE-----SSMHAKQPSCNKSNLQKTE  2001
             +    S    ++NP  +Q   ++   + +LS+GRR      + +  K+ S    N  + E
Sbjct  541   KGTPRSRKSDRVNP-NEQLNNHLDDGFSSLSTGRRGLGLDVAGLSVKKHSFGAPNPSEVE  599

Query  2002  -PTQRKPLSPISSLSFNTSSANIMDKISESEELREMPASLLTTPIK-NVSGIGGNATPKt  2175
              PT RKP SPI S+  +  S N+               +  TTP+K        N TPK 
Sbjct  600   TPTIRKPFSPI-SVPVSIPSENV---------------AFGTTPLKPRTVADEENKTPKV  643

Query  2176  mpipmpstpasaassiamQMGMTPAPVAATTPMVGH--------------------DGVE  2295
             MP                 + +   P   + PM                       + +E
Sbjct  644   MP-----------------IFVPTTPSTVSVPMQTAMTPAPPPPVPFATNLVQEIPEEIE  686

Query  2296  YSYEEMRAGFLLPRLH  2343
             YS+EE RAGF+LP+ H
Sbjct  687   YSFEERRAGFVLPKTH  702



>ref|XP_010682846.1| PREDICTED: 65-kDa microtubule-associated protein 3-like [Beta 
vulgaris subsp. vulgaris]
Length=729

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/728 (52%), Positives = 499/728 (69%), Gaps = 49/728 (7%)
 Frame = +1

Query  259   QNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCA  438
             Q+D   ++ETTC SLL ELQ IW+E+GE E  RDKML +LEQECLE YRRKVDQA+R  A
Sbjct  5     QSDPLTQLETTCGSLLYELQIIWDEVGETETSRDKMLLELEQECLEVYRRKVDQANRCRA  64

Query  439   QLRQAVAESEAELARICAALGEQPVNVR---QSSRSLKTELQAIMPlleemkkrklerkH  609
             QLRQA+A+SEAELA IC+ +GE P+++R   Q+  SLK EL  I+P LEEM+K K+ER++
Sbjct  65    QLRQAIADSEAELAAICSTMGELPLHIRPTEQTLGSLKEELDTILPQLEEMRKSKIERRN  124

Query  610   QFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQV  789
             QF +V+ QI  V  E+  S         LDE+DLSLRRL+++++ L  LQKEKSDRLKQV
Sbjct  125   QFLDVIGQIQKVSTEIYGSAGNGSSTAVLDENDLSLRRLDELQNQLQFLQKEKSDRLKQV  184

Query  790   LDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQR  969
             ++HL  L+SLC VLG+DFK T+ E+HP+L DS    S+ST+T+++L  AI  LRE+K+QR
Sbjct  185   IEHLNVLSSLCSVLGLDFKETVRELHPSLADSEESHSISTDTLKQLETAIFRLRELKLQR  244

Query  970   LHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEV  1149
             +  LQ+LAT ++ELWNLMD P EEQQ F NVT  +AASE E+TEPN LS D +K  E EV
Sbjct  245   MQRLQDLATMLLELWNLMDTPYEEQQAFQNVTCNLAASEDEITEPNILSTDFIKYVEAEV  304

Query  1150  SRLQEMKSSKMKEVLLKKRITLEELCRQAHLA--IDDSIEFTDETIESGAIDPSHLLEQL  1323
             SRL+E+KSSKMKE++LKKR  LEE+CR+ HL    D   E     IESG +DP+ +LEQ+
Sbjct  305   SRLEELKSSKMKELVLKKRTELEEICRKTHLVPEADCETEHLMAAIESGTLDPASILEQI  364

Query  1324  EIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKA  1503
             E+++S VKEEAFSRKE+LEKVEKWL+A EEE WLE YN+++NRYN GRG HL LKRAEKA
Sbjct  365   EMEVSKVKEEAFSRKELLEKVEKWLSAREEEEWLEQYNQDENRYNPGRGAHLTLKRAEKA  424

Query  1504  RALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQ  1683
             R+LVNK+PGM+EAL ++A  WE ERGV F+YDGV  LSMLE+Y +L+QEKELE++RQR+Q
Sbjct  425   RSLVNKLPGMVEALAAKALNWENERGVVFMYDGVRFLSMLEEYMILRQEKELEKKRQREQ  484

Query  1684  KKLQGQLMAEQEVLFGSKRSPSQSGKKNV----VGGA--SNKRISVGGAMLQTPYTERAP  1845
             KKLQGQLMAEQE LFGSK SP +S KK      +GGA  +++R+S+GG M QTP     P
Sbjct  485   KKLQGQLMAEQEALFGSKPSPLKSAKKPCRRMSMGGAGGNSRRLSLGGNMHQTPR----P  540

Query  1846  LSSHSLKKI---NPVKQQALANITQNYVALSSGRRESSMHAKQPSCNKS-NLQKTEPT-Q  2010
              SSHS +      P+++        N    S+ RR   + A  PS N + + +++EPT  
Sbjct  541   DSSHSSRATPNSRPIRKD------DNAGGQSTARRALDI-AILPSKNYTFSGRESEPTVA  593

Query  2011  RKPLSPISSLSFNTSSANIMD---------------KISESEELREMPASLLTTPIKNVS  2145
             R+P SPISS++ + ++A+  D               K    +++  +  +  TTP K + 
Sbjct  594   RRPFSPISSVASSRANADFNDDQNILQNNSVQKPLTKNETPQKIVSLSNTSFTTPSKKMH  653

Query  2146  GIG-GNATPKtmpipmpstpasaassiamQMGMTPAPVAATTP--MVGH--DGVEYSYEE  2310
                  N TP    + + +       S  MQ  MTPAP+       MV    + +EYS+EE
Sbjct  654   AADEENHTPN--TMLIQAPITPLTVSAPMQTSMTPAPLKLLNGDNMVEDIAEDIEYSFEE  711

Query  2311  MRAGFLLP  2334
              RAGF+LP
Sbjct  712   RRAGFVLP  719



>ref|XP_008800929.1| PREDICTED: 65-kDa microtubule-associated protein 3 isoform X2 
[Phoenix dactylifera]
Length=698

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/719 (52%), Positives = 493/719 (69%), Gaps = 47/719 (7%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M N  +DQ L+METTC SLL ELQ IW+E+GE + ERDK+L +LEQECLE YRRKVDQA+
Sbjct  1     MANLVSDQLLQMETTCGSLLYELQMIWDEVGESDTERDKLLLELEQECLEVYRRKVDQAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrkl  597
             R  AQLRQA+A++EAELA IC+A+GE+PV++RQS++   SLK EL+ I+P LEEM+KRK 
Sbjct  61    RCRAQLRQAIADAEAELAAICSAMGERPVHIRQSNQKAGSLKEELKEIIPQLEEMRKRKN  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             +R +QF EV++QI  +  E+ +  +     +A+DESDLS RRLE++   L SLQKEK++R
Sbjct  121   DRWNQFLEVIEQIRRISIEI-RPAEYTPSKVAMDESDLSTRRLEELHRQLQSLQKEKTER  179

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             LKQV+DHL +LNSLC+VLGIDF+ T+ E+HP+L ++   K++S +TIE L++AI  LREV
Sbjct  180   LKQVMDHLNTLNSLCLVLGIDFRQTVHEVHPSLDETDGSKNISNDTIESLASAIQRLREV  239

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             KIQR+  LQ+LA+T++ELWNLMD PVEEQQLF NVT  IAASE E+TEPN LS+D +   
Sbjct  240   KIQRMQKLQDLASTMLELWNLMDTPVEEQQLFQNVTCNIAASEHEITEPNTLSMDFINYV  299

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAID--DSIEFTDETIESGAIDPSHL  1311
             E EV RL+++K+SKMKE++LKK++ LEEL R+ HL     +  EF  E IE+GAID S +
Sbjct  300   EAEVLRLEQLKTSKMKELVLKKKMELEELRRRTHLVAQAGNETEFAIEAIEAGAIDASLM  359

Query  1312  LEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKR  1491
             LEQ+EI +S VKEEAFSRK+ILEKVEKWLAAC EESWLE+YNR++NRY+  RG HL LKR
Sbjct  360   LEQIEILVSKVKEEAFSRKDILEKVEKWLAACNEESWLEEYNRDENRYSAVRGAHLTLKR  419

Query  1492  AEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQR  1671
             AEKARALVNKIP M++AL ++   WE +RG+ F YDGV LLSMLE+Y +++QEKE ER+R
Sbjct  420   AEKARALVNKIPAMVDALAAKITAWENDRGIEFTYDGVRLLSMLEEYTIVRQEKEQERKR  479

Query  1672  QRDQKKLQGQLMAEQEVLFGSKRSPS--QSGKK--NVVGGASNKRISVGGAMLQTPYTE-  1836
             QRDQK+LQGQL+AEQE LFGSK SPS  QS KK        S++R S+GGA++     + 
Sbjct  480   QRDQKRLQGQLIAEQEALFGSKPSPSKPQSAKKVARTSTSGSSRRQSLGGAIMHPSKPDL  539

Query  1837  RAPLSSHSLKKINPVKQQALANITQNYVALSSGRRE---SSMHAKQPSCNKSNLQKTEPT  2007
               P S+ S KK + +             ALS GRR    + +  K+ S N +     E  
Sbjct  540   LHPKSTRSTKKGDDI------------AALSPGRRGLDIAGLPVKKLSFNNTMNAPCEVE  587

Query  2008  QRK----PLSPISSLSFNTSSANIMDKISESEELREMPASLLT-TPIKNVSGIGGNATPK  2172
               +    PL P++S+    S  NIM            P+ LLT +  KN      N TPK
Sbjct  588   MPRRPFAPLVPVNSIPSTPSQPNIMS----------TPSILLTPSQPKNNDVEEENRTPK  637

Query  2173  tmpipmpstpasaassiamQMGMTPAPVA----ATTPMVGHDGVEYSYEEMRAGFLLPR  2337
                +P+ +         +MQM  TPAP +    A       + +EYS+EE R    L R
Sbjct  638   --IMPISTPKTPGTVPASMQMATTPAPTSIVYEAAVAKAPLEEIEYSFEERRLASYLKR  694



>ref|XP_007038463.1| Microtubule associated protein family protein isoform 2, partial 
[Theobroma cacao]
 gb|EOY22964.1| Microtubule associated protein family protein isoform 2, partial 
[Theobroma cacao]
Length=647

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/552 (61%), Positives = 428/552 (78%), Gaps = 16/552 (3%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M   +ND  L++ETTC +LL ELQ IW+E+GE + +RDKML +LEQECLE YRRKVDQA+
Sbjct  33    MSTPKNDPLLQVETTCGTLLYELQIIWDEVGETDSDRDKMLLELEQECLEVYRRKVDQAN  92

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQS---SRSLKTELQAIMPlleemkkrkl  597
             R  AQLRQ +A+SEAELA IC+A+GE+PV++RQS   S SLK EL+ I+P LEEM+KRK+
Sbjct  93    RCRAQLRQTIADSEAELAAICSAMGERPVHIRQSDQNSGSLKEELRKILPQLEEMRKRKV  152

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             ER++QF EVL+Q   +  E+  S + +     +DE+DLSLR+LE++   L  LQKEKSDR
Sbjct  153   ERRNQFIEVLEQTQKITNEIYGSTESVSLKTVVDETDLSLRKLEELHRQLHELQKEKSDR  212

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             LKQV DHL  LNSLC V+G+DFK T+ E+HP+LGDS  L+S+S  TIE+L+ AI +LREV
Sbjct  213   LKQVQDHLHMLNSLCSVMGMDFKLTVSEVHPSLGDSDGLRSISNNTIEKLAIAIKKLREV  272

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             KIQR+  LQ+LATT++ELWNLMD P+EEQQ+F NVT  IAASE E+TEPN LS+D +   
Sbjct  273   KIQRMQRLQDLATTMLELWNLMDTPIEEQQMFQNVTCNIAASEHEITEPNTLSVDFINYV  332

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLA--IDDSIEFTDETIESGAIDPSHL  1311
             E EVSRL+E+KSSKMKE++LKKR  LE++CR+ HL    D +IE   E IESGA+D + +
Sbjct  333   EAEVSRLEELKSSKMKELVLKKRSELEDICRKTHLVPDSDSAIEDAIEAIESGAVDAATI  392

Query  1312  LEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKR  1491
             LEQ+E+QI+ VKEEAFSRKEILEKVEKWL AC+EE WLE+YNR++NRYN G+G HL LKR
Sbjct  393   LEQIELQIAKVKEEAFSRKEILEKVEKWLTACDEECWLEEYNRDENRYNAGKGAHLTLKR  452

Query  1492  AEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQR  1671
             AEKAR+LVNK+PGM+EAL S+   WE ER + F+YDG+ LLSMLE+Y +L+QEKE ER+R
Sbjct  453   AEKARSLVNKLPGMVEALASKTLAWEKEREIKFMYDGIRLLSMLEEYTILRQEKEQERRR  512

Query  1672  QR--DQKKLQGQLMAEQEVLFGSKRSPS-----QSGKKNVVGGASNKRISVGGAMLQTPY  1830
              R  DQKKLQGQL+AEQE L+GSK SPS     + G +   GGASN+R+S+GGAML    
Sbjct  513   LRVWDQKKLQGQLIAEQEALYGSKPSPSKPQSVKKGSRFSTGGASNRRVSLGGAMLPN--  570

Query  1831  TERAPLSSHSLK  1866
                 P S HS K
Sbjct  571   --HKPDSLHSAK  580



>ref|XP_008376463.1| PREDICTED: 65-kDa microtubule-associated protein 3 isoform X1 
[Malus domestica]
Length=710

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/728 (53%), Positives = 510/728 (70%), Gaps = 54/728 (7%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M N Q++Q L+METTC SLL ELQ IWNE+GE + +RDKML +LEQECLE YRRKVDQA+
Sbjct  1     MSNLQSEQLLQMETTCGSLLYELQIIWNEVGETDKDRDKMLLELEQECLEVYRRKVDQAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSRS---LKTELQAIMPlleemkkrkl  597
             R  AQLRQA+A+SEAELA IC+A+GE+PV++RQS +S   LK EL  I+P LEEMKKRK 
Sbjct  61    RCRAQLRQAIADSEAELAAICSAMGERPVHIRQSDQSAGSLKEELSKIIPQLEEMKKRKC  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             +RK+ F EVL++I  +  E+  S         +DE+DLSLRRLE++  HL +LQ EKSDR
Sbjct  121   DRKNNFLEVLEEIRKISSEINGSTDYSSSKPGVDETDLSLRRLEELHRHLHALQTEKSDR  180

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             LKQ+ DHL +LNS C VLG+D+K TI E+HP+L DS   K++S +TI+RL AAI +LREV
Sbjct  181   LKQIQDHLCTLNSFCSVLGMDYKQTISEVHPSLVDSEGSKNISNDTIQRLLAAIQKLREV  240

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             K+QR+  LQ+LATT++ELWNLMD P+EEQQ+F N+T  IAASE E+TEPN LS+D +   
Sbjct  241   KLQRMQKLQDLATTMLELWNLMDTPIEEQQMFQNITCNIAASEHEITEPNTLSVDFINYV  300

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAI--DDSIEFTDETIESGAIDPSHL  1311
             E EVSRL+E+KSSKMKE++LKKR  LEE+CR+ H+ +  D +I++  E IESG +DP+ +
Sbjct  301   EAEVSRLEELKSSKMKELVLKKRSELEEICRKTHMVLEADSAIDYIIEAIESGDVDPACV  360

Query  1312  LEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKR  1491
             L+Q+E+Q+S VKEEAFSRK+ILEKVEKWL AC+EE WLE+YNR++NRYN GRG HL LKR
Sbjct  361   LDQIELQVSKVKEEAFSRKDILEKVEKWLFACDEECWLEEYNRDENRYNAGRGAHLTLKR  420

Query  1492  AEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQR  1671
             AEKARALVNK+P M++AL S+   WE ERG+ F YDG+ LLSMLE+Y +L++EKE ER+R
Sbjct  421   AEKARALVNKLPAMVDALASKTISWEKERGIEFTYDGIRLLSMLEEYTILREEKEQERRR  480

Query  1672  QRDQKKLQGQLMAEQEVLFGSKRSPS-----QSGKKNVVGGASNKRISVGGAMLQTPYTE  1836
             QRDQKK+QGQL+AEQE L+GSK SPS     + G +   GGASN+R+S     +Q P  +
Sbjct  481   QRDQKKIQGQLIAEQEALYGSKPSPSKPQSVKKGPRMSTGGASNRRLS-----MQAPKPD  535

Query  1837  RAPLSSHSLK--------KINPVKQQALAN--ITQNYVALSSGRRE---SSMHAKQPSCN  1977
               PL  HS+K        K + V Q    N  +  ++ +LS+GRR    + +  K+ S  
Sbjct  536   --PL--HSVKGTPRPRSRKGDRVHQNEQLNNQLDDSFSSLSTGRRGLDVAGLPVKKHSFG  591

Query  1978  KSNLQKTE-PTQRKPLSPISSLSFNTSSANIMDKISESEELREMPASLLTTPIK-NVSGI  2151
               N  + E PT RKP SPI S+  +  + N+               +  TTP+K      
Sbjct  592   APNASEVETPTTRKPFSPI-SVPVSIPTENV---------------AFATTPLKPRTVAD  635

Query  2152  GGNATPKtmpipmpstpasaassiamQMGMTPAPVAA--TTPMVGH--DGVEYSYEEMRA  2319
               N TPK MPI +P+TP++ +  +   +   P P      T +V    + +EYS+EE RA
Sbjct  636   EANKTPKVMPIFVPTTPSTVSVPMQTAITPAPPPPPIPFATNLVQEIPEEIEYSFEERRA  695

Query  2320  GFLLPRLH  2343
             GF+LPR H
Sbjct  696   GFVLPRTH  703



>ref|XP_009400357.1| PREDICTED: 65-kDa microtubule-associated protein 3-like [Musa 
acuminata subsp. malaccensis]
Length=741

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/556 (62%), Positives = 422/556 (76%), Gaps = 15/556 (3%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M    +DQ L++ET C S+L ELQ IW+E+GE + ERDKML +LEQECL+ YRRKVDQA+
Sbjct  1     MARLSSDQLLQLETACGSILYELQIIWDEVGESDAERDKMLLELEQECLDVYRRKVDQAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrkl  597
             R  AQLRQA+A+SEAELA IC+ALGE PV++RQS+    SLK EL++I P LEEM+KRK+
Sbjct  61    RCRAQLRQAIADSEAELAAICSALGEPPVHIRQSNHRTGSLKEELKSIGPQLEEMRKRKV  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             ER +QF EV++QI  +  E+  S    Q  +A+DESDLS RRLED+   L SLQKEKSDR
Sbjct  121   ERWNQFLEVIEQIRKISFEITSSEGN-QSKLAVDESDLSARRLEDLYRQLESLQKEKSDR  179

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             LKQV++HL +LN+LC VLG+DFK T+ EIHP+L +S   KSVS  TIERLS AI  LRE+
Sbjct  180   LKQVMEHLSTLNALCSVLGVDFKETVREIHPSLDESEVPKSVSNATIERLSIAIGRLREI  239

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             K++R+  LQ+LA+T++ELWNLMD P+EEQ+LF NVT  IAASESE+TE N LS D L   
Sbjct  240   KVERMQKLQDLASTMLELWNLMDTPIEEQRLFQNVTSNIAASESEITEANTLSPDFLNFV  299

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLA--IDDSIEFTDETIESGAIDPSHL  1311
             E EV RL+++K SKMKE++LKK+  LEEL R+AHL    ++  E     IESGAID S +
Sbjct  300   EAEVLRLEQLKVSKMKELVLKKKTELEELRRRAHLVAEAENDAELAISAIESGAIDASLI  359

Query  1312  LEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKR  1491
             LEQ+E QIS VKEEAFSRK+ILE+VEKWL ACEEE+WLE+YNR++NRYN GRG HL LKR
Sbjct  360   LEQIEDQISTVKEEAFSRKDILERVEKWLPACEEEAWLEEYNRDENRYNAGRGAHLALKR  419

Query  1492  AEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQR  1671
             AEKARALVNKIP M+E L ++   WE ERGV F YDGV LLSMLE+Y +++QEKE ER+R
Sbjct  420   AEKARALVNKIPAMIETLAAKITQWEKERGVEFTYDGVRLLSMLEEYTIVRQEKEQERKR  479

Query  1672  QRDQKKLQGQLMAEQEVLFGSKRSP--SQSGKK--NVVGGASNKRISVGGAMLQTP----  1827
             QRDQKKLQGQL+AEQE L+GSK SP   QS KK      G  ++R+S+GGA +Q P    
Sbjct  480   QRDQKKLQGQLIAEQEALYGSKPSPLKPQSAKKLHRTSNGGPSRRLSLGGAAMQPPPKPD  539

Query  1828  YTERAPLSSHSLKKIN  1875
             Y   A  S  S KKI+
Sbjct  540   YLHSAK-SGRSTKKID  554



>gb|KHG27998.1| 65-kDa microtubule-associated 3 -like protein [Gossypium arboreum]
Length=731

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/726 (52%), Positives = 500/726 (69%), Gaps = 39/726 (5%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M    +D  L++ETTC +LL ELQ IW+E+GE + +RD+ML +LE+ECLE YRRKVDQA+
Sbjct  1     MSTTPSDPLLQVETTCGTLLYELQIIWDEVGETDTDRDEMLLELERECLEVYRRKVDQAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrkl  597
             R  AQLRQ +A+SEAELA IC+A+GE+PV++RQS +   SLK EL  I+P LEEMKKRK+
Sbjct  61    RCRAQLRQTIADSEAELAAICSAMGERPVHIRQSDQNAGSLKEELSKILPQLEEMKKRKI  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             ER++QF +VL QI  +  E+  S K +     +DESDLSLR+LE++   L  L+KEK+DR
Sbjct  121   ERRNQFVQVLQQIQIITNEIYGSAKLVSSKAVVDESDLSLRKLEELHRQLNELEKEKNDR  180

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             LKQV DHL  LNSLC+V+GIDFK T+ E+HP+LGDS    S+S  TIE+L+  I +L+EV
Sbjct  181   LKQVEDHLTMLNSLCLVMGIDFKLTVTEVHPSLGDSEGFWSISNNTIEQLATLIKKLQEV  240

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             KI+R+  LQ+L TT+++LW LMD P+EEQQ+F NVT  IAASE E+ EP  LS+D +K  
Sbjct  241   KIERMQRLQDLGTTMLKLWKLMDTPIEEQQMFQNVTCNIAASEHEIAEPTTLSVDFIKYV  300

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAID--DSIEFTDETIESGAIDPSHL  1311
             E EVSRL+E+KSSKMKE++L KR+ LEE+CR+ HL  D   ++E   E IESGA+  + +
Sbjct  301   EAEVSRLEELKSSKMKELVLNKRLELEEICRKTHLVPDSQSAVEDAIEAIESGAVGAATI  360

Query  1312  LEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKR  1491
             LEQ+E+QI+ VKEEAFSR+EILE+VEKWL AC+EE WLE+YNR++NRYN G+G HL LKR
Sbjct  361   LEQIELQIAKVKEEAFSRREILERVEKWLMACDEECWLEEYNRDENRYNAGKGAHLTLKR  420

Query  1492  AEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQR  1671
             AEKAR+LVNK+PGM+EAL S+   WE E  V FLYDG+ LLSMLE+Y +L+QEKE ER+R
Sbjct  421   AEKARSLVNKLPGMVEALASKTLAWEKETEVEFLYDGIRLLSMLEEYTILRQEKEQERRR  480

Query  1672  QRDQKKLQGQLMAEQEVLFGSKRSPS-----QSGKKNVVGGASNKRISVGGAMLQTPYTE  1836
              RDQKKLQGQLMAEQE L+GSK SPS     + G ++  GGAS++R+S+GGAML T    
Sbjct  481   LRDQKKLQGQLMAEQEALYGSKPSPSKPLSVKKGPRHSTGGASSRRVSLGGAMLPT----  536

Query  1837  RAPLSSHSLKKINPVKQQALANITQN-------------YVALSSGRRESSMHAKQPSCN  1977
               P S HS K       +    + QN             + A+  G   + +  ++ S N
Sbjct  537   HKPDSLHSEKATPQTLHKRTERMFQNDHLNHRHDDAIPAFSAIRRGLDIADIPVRKHSFN  596

Query  1978  KSNLQKTE-PTQRKPLSPISSLSFNTSSANIMDKI-SESEELREM-PASL-LTTPIKNVS  2145
               N  + E P  RKP SPISS+   +S ANI + +  + E L++M P +   TTP K   
Sbjct  597   VVNANELESPLVRKPFSPISSMV--SSKANITNTLEDDGETLQKMQPVNFPYTTPSKTTL  654

Query  2146  GIG-GNATPKtmpipmpstpasaassiamQMGMTPAP--VAATTPMVG-HDGVEYSYEEM  2313
              +   N TPK   + + +   ++  SI MQ  MTPAP  +    P+    + +E S+EE 
Sbjct  655   LVDEENRTPK--AMCIAAMTPASTVSIPMQTAMTPAPLIIPFGKPVQEISEEIEQSFEER  712

Query  2314  RAGFLL  2331
             R  F+L
Sbjct  713   RLAFVL  718



>ref|XP_007220182.1| hypothetical protein PRUPE_ppa015556mg [Prunus persica]
 gb|EMJ21381.1| hypothetical protein PRUPE_ppa015556mg [Prunus persica]
Length=717

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/731 (49%), Positives = 477/731 (65%), Gaps = 64/731 (9%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M +R ++Q + +ET    LL ELQKIW+E+G P++ERD M+  +EQEC+E +R KVD A 
Sbjct  1     MTHRSSNQFVHLETKFEFLLQELQKIWDEVGVPDVERDTMILTIEQECMEVFRTKVDDAK  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSR-SLKTELQAIMPlleemkkrkler  603
             +  A L+Q +A  EAEL  IC+ALGEQP +  Q++R SLK +L+ I+P L +MK RK+ER
Sbjct  61    KCKALLQQEIASYEAELVDICSALGEQPPHFDQNARGSLKKKLETIIPQLGDMKMRKVER  120

Query  604   kHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLK  783
             + +F  VLDQ+  +  ++ +  ++  + + ++E+DLSL+RLE+++  LL  Q EK +R+ 
Sbjct  121   RDEFLVVLDQLQKISIQICRFTEDSLYKMVVEETDLSLKRLEELRRQLLDYQDEKRNRVN  180

Query  784   QVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKI  963
              V+DHL  LNSLC+VLG+DFK+TI EIHPTL DS   K V+  T++ L+  I  LR+VKI
Sbjct  181   LVMDHLNILNSLCLVLGMDFKHTIHEIHPTLDDSEGEKDVTNNTVDSLANLIQRLRKVKI  240

Query  964   QRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEI  1143
             QR   LQN A+ ++E+WNLMD P+E+Q  F NVTR IAASESE+TEPN LS D L   E 
Sbjct  241   QRWQTLQNHASALLEMWNLMDTPIEQQTKFQNVTRHIAASESEITEPNMLSTDFLNHVEE  300

Query  1144  EVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAID--DSIEFTDETIESGAIDPSHLLE  1317
             EVSRLQ++KSSK+KE+  KKR+ LEE+CRQ+H+  +   ++E+++E +ESG +DP+ LLE
Sbjct  301   EVSRLQQLKSSKLKEIFQKKRLELEEICRQSHMVTETLSAMEYSNEVLESGTVDPACLLE  360

Query  1318  QLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAE  1497
             Q+E+QI+  KEEA SRKEILEK EKWL AC+EE WLE+YNR+DNRYN GRG HL LKRAE
Sbjct  361   QIELQITRAKEEALSRKEILEKFEKWLGACQEECWLEEYNRDDNRYNAGRGAHLTLKRAE  420

Query  1498  KARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQR  1677
             KARALVNKIPG++EALTS+   WE ERG+ FLYDG  LLSML +Y  L+QEKE E+QRQR
Sbjct  421   KARALVNKIPGLVEALTSKTTAWEGERGLEFLYDGGRLLSMLTEYSTLRQEKEQEKQRQR  480

Query  1678  DQKKLQGQLMAEQEVLFGSKRSPSQSGKKNVVGGASNKRISVGGAMLQTPYTERAPLSSH  1857
             D K+ QGQ++AEQEVL+GSKRSPS+SGKK     ASN+++S+GGA++Q    E+A     
Sbjct  481   DMKRFQGQVLAEQEVLYGSKRSPSKSGKK-----ASNRKMSLGGALIQNQNFEKATPLVR  535

Query  1858  SLKKINPVKQQALANITQNYVALSSGRR--ESSMHA--KQPSCNKSNLQKTEPTQRKPLS  2025
               KK N + + +         ALSSGRR  E S H+  K PS     L+   P  RKPLS
Sbjct  536   PTKKGNCLNRSSSHQRYGGVDALSSGRRISEISGHSVKKHPSSAGKALELDSPLIRKPLS  595

Query  2026  PI-SSLSFNTSSANIMDKISESEELREMPASLLT-----TPIKNV-SGIGGNATPKtmpi  2184
             P+ S +S   + AN  +     ++     A L +     TP K V  G   N TPKT   
Sbjct  596   PVLSEVSSKVNIANFQEGQKTQQKTNMQAAHLFSEMPIMTPSKPVFVGDEENRTPKT---  652

Query  2185  pmpstpasaassiamQMGMTPAPVAATTPM---------------------VGHDG--VE  2295
                                TP PV  T                        V   G  VE
Sbjct  653   -------------------TPIPVPLTPKTMSVQMLTATTPATPFTSGAYKVEKSGQPVE  693

Query  2296  YSYEEMRAGFL  2328
             YS+EE+RAGF+
Sbjct  694   YSFEEVRAGFI  704



>ref|XP_008800928.1| PREDICTED: 65-kDa microtubule-associated protein 3 isoform X1 
[Phoenix dactylifera]
Length=699

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/720 (52%), Positives = 494/720 (69%), Gaps = 48/720 (7%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M N  +DQ L+METTC SLL ELQ IW+E+GE + ERDK+L +LEQECLE YRRKVDQA+
Sbjct  1     MANLVSDQLLQMETTCGSLLYELQMIWDEVGESDTERDKLLLELEQECLEVYRRKVDQAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrkl  597
             R  AQLRQA+A++EAELA IC+A+GE+PV++RQS++   SLK EL+ I+P LEEM+KRK 
Sbjct  61    RCRAQLRQAIADAEAELAAICSAMGERPVHIRQSNQKAGSLKEELKEIIPQLEEMRKRKN  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             +R +QF EV++QI  +  E+ +  +     +A+DESDLS RRLE++   L SLQKEK++R
Sbjct  121   DRWNQFLEVIEQIRRISIEI-RPAEYTPSKVAMDESDLSTRRLEELHRQLQSLQKEKTER  179

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             LKQV+DHL +LNSLC+VLGIDF+ T+ E+HP+L ++   K++S +TIE L++AI  LREV
Sbjct  180   LKQVMDHLNTLNSLCLVLGIDFRQTVHEVHPSLDETDGSKNISNDTIESLASAIQRLREV  239

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             KIQR+  LQ+LA+T++ELWNLMD PVEEQQLF NVT  IAASE E+TEPN LS+D +   
Sbjct  240   KIQRMQKLQDLASTMLELWNLMDTPVEEQQLFQNVTCNIAASEHEITEPNTLSMDFINYV  299

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAID--DSIEFTDETIESGAIDPSHL  1311
             E EV RL+++K+SKMKE++LKK++ LEEL R+ HL     +  EF  E IE+GAID S +
Sbjct  300   EAEVLRLEQLKTSKMKELVLKKKMELEELRRRTHLVAQAGNETEFAIEAIEAGAIDASLM  359

Query  1312  LEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKR  1491
             LEQ+EI +S VKEEAFSRK+ILEKVEKWLAAC EESWLE+YNR++NRY+  RG HL LKR
Sbjct  360   LEQIEILVSKVKEEAFSRKDILEKVEKWLAACNEESWLEEYNRDENRYSAVRGAHLTLKR  419

Query  1492  AEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQR  1671
             AEKARALVNKIP M++AL ++   WE +RG+ F YDGV LLSMLE+Y +++QEKE ER+R
Sbjct  420   AEKARALVNKIPAMVDALAAKITAWENDRGIEFTYDGVRLLSMLEEYTIVRQEKEQERKR  479

Query  1672  QRDQKKLQGQLMAEQEVLFGSKRSPS--QSGKK--NVVGGASNKRISVGGAMLQTPYTE-  1836
             QRDQK+LQGQL+AEQE LFGSK SPS  QS KK        S++R S+GGA++     + 
Sbjct  480   QRDQKRLQGQLIAEQEALFGSKPSPSKPQSAKKVARTSTSGSSRRQSLGGAIMHPSKPDL  539

Query  1837  RAPLSSHSLKKINPVKQQALANITQNYVALS-SGRRE---SSMHAKQPSCNKSNLQKTEP  2004
               P S+ S KK + +             ALS +GRR    + +  K+ S N +     E 
Sbjct  540   LHPKSTRSTKKGDDI------------AALSPAGRRGLDIAGLPVKKLSFNNTMNAPCEV  587

Query  2005  TQRK----PLSPISSLSFNTSSANIMDKISESEELREMPASLLT-TPIKNVSGIGGNATP  2169
                +    PL P++S+    S  NIM            P+ LLT +  KN      N TP
Sbjct  588   EMPRRPFAPLVPVNSIPSTPSQPNIMS----------TPSILLTPSQPKNNDVEEENRTP  637

Query  2170  KtmpipmpstpasaassiamQMGMTPAPVA----ATTPMVGHDGVEYSYEEMRAGFLLPR  2337
             K   +P+ +         +MQM  TPAP +    A       + +EYS+EE R    L R
Sbjct  638   K--IMPISTPKTPGTVPASMQMATTPAPTSIVYEAAVAKAPLEEIEYSFEERRLASYLKR  695



>ref|XP_009372918.1| PREDICTED: 65-kDa microtubule-associated protein 3-like [Pyrus 
x bretschneideri]
Length=709

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/745 (51%), Positives = 503/745 (68%), Gaps = 89/745 (12%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M N Q++Q L+METTC SLL ELQ IWNE+GE + +RDKML +LE+ECLE YRRKVDQA+
Sbjct  1     MSNLQSEQLLQMETTCGSLLYELQIIWNEVGETDKDRDKMLLELERECLEVYRRKVDQAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrkl  597
             R  AQLRQA+A+SEAELA IC+A+GE+PV++RQS +   SLK EL  I+P LEEMKKRK 
Sbjct  61    RCRAQLRQAIADSEAELAAICSAMGERPVHIRQSDQNAGSLKEELSKIIPQLEEMKKRKC  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             +RK+ F EVL++I  +  E+  S  +      +DE+DLSLRRLE++   L +LQ EKSDR
Sbjct  121   DRKNNFLEVLEEIRKISSEINGS-IDYSSKPGVDETDLSLRRLEELHRQLHALQTEKSDR  179

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             LKQ+ DHL +LNS C VLG+D+K TI E+HP+L DS+  K++S +TI+RL+AAI +LREV
Sbjct  180   LKQIQDHLCTLNSFCSVLGMDYKQTISEVHPSLVDSAGSKNISNDTIQRLAAAIQKLREV  239

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             K+QR+  LQ+LATT++ELWNLMD P+EEQQ+F N+T  IAASE E+TEPN LS+D +   
Sbjct  240   KLQRMQRLQDLATTMLELWNLMDTPIEEQQMFQNITCNIAASEHEITEPNTLSVDFINYV  299

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAI--DDSIEFTDETIESGAIDPSHL  1311
             E EVSRL+E+KSSKMKE++LKKR  LEE+CR+ H+ +  D++I++  E IESG +DP+ +
Sbjct  300   EAEVSRLEELKSSKMKELVLKKRSELEEICRKTHMVLEADNAIDYVIEAIESGDVDPACV  359

Query  1312  LEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKR  1491
             L+Q+E+Q+S VKEEAFSRK+ILEKVEKWL AC+EE WLE+YNR++NRYN GRG HL LKR
Sbjct  360   LDQIELQVSKVKEEAFSRKDILEKVEKWLFACDEECWLEEYNRDENRYNAGRGAHLTLKR  419

Query  1492  AEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQR  1671
             AEKARALVNK+P M++AL S+   WE ERG+ F YDG+ LLSMLE+Y +L++EKE ER+R
Sbjct  420   AEKARALVNKLPAMVDALASKTISWEKERGIEFTYDGIRLLSMLEEYTILREEKEQERRR  479

Query  1672  QRDQKKLQGQLMAEQEVLFGSKRSPS-----QSGKKNVVGGASNKRISVGGAMLQTPYTE  1836
             QRDQKK+QGQL+AEQE L+GSK SPS     + G +   GGASN+R+S     +Q P  +
Sbjct  480   QRDQKKIQGQLIAEQEALYGSKPSPSKPQSVKKGSRMSTGGASNRRLS-----MQAPKPD  534

Query  1837  RAPLSSHSLK--------KINPVKQQALAN--ITQNYVALSSGRRE---SSMHAKQPSCN  1977
               PL  HS+K        K + V Q    N  +  ++ +LS+GRR    + +  K+ S  
Sbjct  535   --PL--HSVKGTPRPRSRKGDRVHQNEQLNNHLDDSFSSLSTGRRGLDVAGLPVKKHSFG  590

Query  1978  KSNLQKTE-PTQRKPLSPISSLSFNTSSANIMDKISESEELREMPASLLTTPIK-NVSGI  2151
               N  + E PT RKP SPI S+  +  + N+               +  TTP+K      
Sbjct  591   APNASEVETPTTRKPFSPI-SVPVSIPTENV---------------TFATTPLKPRTVAE  634

Query  2152  GGNATPKtmpipmpstpasaassiamQMGMTPAPVAATTPMVGH----------------  2283
               N TPK MP                 + +   P   + PM                   
Sbjct  635   EANKTPKVMP-----------------IFVPTTPSTVSVPMQTAMTPAPPPPPIPFATNL  677

Query  2284  -----DGVEYSYEEMRAGFLLPRLH  2343
                  + +EYS+EE RAGF+LP+ H
Sbjct  678   VQEIPEEIEYSFEERRAGFVLPKTH  702



>gb|KDP37892.1| hypothetical protein JCGZ_05774 [Jatropha curcas]
Length=728

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/733 (53%), Positives = 528/733 (72%), Gaps = 49/733 (7%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M N QND  L++ETTC SLL ELQ IWNE+GE + ERDKML +LEQECLE YRRKVDQA+
Sbjct  1     MSNLQNDPLLQVETTCGSLLYELQIIWNEVGESDAERDKMLLELEQECLEVYRRKVDQAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrkl  597
             R+ AQLRQA+A+SEAELA IC+A+GE+PV++RQ+ +   SLK ELQ I+P LEEM+KRKL
Sbjct  61    RNRAQLRQAIADSEAELAAICSAMGERPVHIRQADQNVGSLKKELQKILPQLEEMQKRKL  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             +R++QF EVL +I  +  E+  S     HM+ +DE+DLSL++LE++   L + QKEKSDR
Sbjct  121   DRRNQFLEVLAEIQKISNEIYGS---ADHMV-VDETDLSLKKLEELHRQLHAHQKEKSDR  176

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             LKQ+ DHL++LNSLC+VLG+D+K+T+ EIH + G+S   ++++   I++L+AAIH+L+E+
Sbjct  177   LKQIQDHLDTLNSLCLVLGMDYKHTVSEIHASFGNSEVSRNITNYAIQQLAAAIHKLQEI  236

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             K++R+  LQ+LATT++ELWNLMD P+EEQQ+F NVT  IAASE E+TEPN LS++ +   
Sbjct  237   KMERMQKLQDLATTMLELWNLMDTPIEEQQMFQNVTCNIAASEHEITEPNILSVEFINHV  296

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLA--IDDSIEFTDETIESGAIDPSHL  1311
             E EV RL+E+KSSKMK+++LKKR  LE++CR+ H+    D +I++    IESG +DP+ +
Sbjct  297   EAEVCRLEELKSSKMKDLVLKKRSELEDICRKTHMIPEADTAIDYAIRAIESGNVDPAGV  356

Query  1312  LEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKR  1491
             L+Q+E+QI+NVKEEAFSRKEILEKVEKW+AACEEE WLE+YNR++NRYN GRG HL LKR
Sbjct  357   LQQIELQIANVKEEAFSRKEILEKVEKWVAACEEECWLEEYNRDENRYNAGRGAHLTLKR  416

Query  1492  AEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQR  1671
             AEKAR+LVNK+PGM+EAL S+   WE ERG+ FLYDG+ LLSMLE+Y LL+QEKE ER+R
Sbjct  417   AEKARSLVNKLPGMVEALASKTMAWEKERGIDFLYDGIRLLSMLEEYALLRQEKEEERRR  476

Query  1672  QRDQKKLQGQLMAEQEVLFGSKRSPSQSGKKNV-------VGGASNKRISVGGAMLQTPY  1830
             QRDQKKLQGQL+AEQE L+GSK SPS++  +NV        GGA+ +R+S+G A+LQT  
Sbjct  477   QRDQKKLQGQLIAEQEALYGSKPSPSKT--QNVKKAPRVSTGGATTRRLSLGVAVLQTTK  534

Query  1831  TE-----RAPLSSHSLKKINPVKQQALANITQN--YVALSSGRRE---SSMHAKQPSCNK  1980
              +     +A  ++   KK+  V Q   +   Q+   VALS+GRR    + + AK+   + 
Sbjct  535   PDLTNSCKATPNTRPGKKVERVHQNDHSTHRQDDGLVALSAGRRGLDIAGLPAKKHPFSF  594

Query  1981  SNLQKTE-PTQRKPLSPISSLSFNTSSANIMDKISES--EELRE-MPASLLT----TPIK  2136
              N  + E P  RKP S  S  S  +S ANI++ ++ +  E  ++ +P + L+    TP+K
Sbjct  595   VNAPEPESPMLRKPFS--SISSTGSSKANILEDVTTTNGETFKKTLPTNELSTTTTTPLK  652

Query  2137  NVSGIGGNATPKtmpipmpstpasaassiamQMGMTPAPVAATTPMVGHDG------VEY  2298
                    N TPK   +P+P     +  S+ MQ  MTPAP+    P   +        +EY
Sbjct  653   TCVLDEENRTPK--AMPIPVPSTPSTLSVPMQTVMTPAPL--LVPYCANQAEEVPEEIEY  708

Query  2299  SYEEMRAGFLLPR  2337
             S+EE RAGF +PR
Sbjct  709   SFEERRAGF-VPR  720



>ref|XP_009346944.1| PREDICTED: 65-kDa microtubule-associated protein 3-like [Pyrus 
x bretschneideri]
Length=709

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/745 (51%), Positives = 501/745 (67%), Gaps = 89/745 (12%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M N Q++Q L+METTC SLL ELQ IWNE+GE + +RDKML +LEQE LE YRRKVDQA+
Sbjct  1     MSNLQSEQLLQMETTCGSLLYELQIIWNEVGETDKDRDKMLLELEQEXLEVYRRKVDQAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrkl  597
             R  AQLRQA+A+SEAELA IC+A+GE+PV++RQS +   SLK EL  I+P LEEMKKRK 
Sbjct  61    RCRAQLRQAIADSEAELAAICSAMGERPVHIRQSDQNAGSLKEELSKIIPQLEEMKKRKC  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             +RK+ F EVL++I  +  E+  S  +      +DE+DLSLRRLE++   L +LQ EKSDR
Sbjct  121   DRKNNFLEVLEEIRKISSEINGS-IDYSSKPGVDETDLSLRRLEELHRQLHALQTEKSDR  179

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             LKQ+ DHL +LNS C VLG+D+K TI E+HP+L DS+  K++S +TI+RL+AAI +LREV
Sbjct  180   LKQIQDHLCTLNSFCSVLGMDYKQTISEVHPSLVDSAGSKNISNDTIQRLAAAIQKLREV  239

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             K+QR+  LQ+LATT++ELWNLMD P+EEQQ+F N+T  IAASE E+TEPN LS+D +   
Sbjct  240   KLQRMQRLQDLATTMLELWNLMDTPIEEQQMFQNITCNIAASEHEITEPNTLSVDFINYV  299

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAI--DDSIEFTDETIESGAIDPSHL  1311
             E EVSRL+E+KSSKMKE++LKKR  LEE+CR+ H+ +  D +I++  E IESG +DP+ +
Sbjct  300   EAEVSRLEELKSSKMKELVLKKRSELEEICRKTHMVLEADSAIDYVIEAIESGDVDPACV  359

Query  1312  LEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKR  1491
             L+Q+E+Q+S VKEEAFSRK+ILEKVEKWL AC+EE WLE+YNR++NRYN GRG HL LKR
Sbjct  360   LDQIELQVSKVKEEAFSRKDILEKVEKWLFACDEECWLEEYNRDENRYNAGRGAHLTLKR  419

Query  1492  AEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQR  1671
             AEKARALVNK+P M++AL S+   WE ERG+ F YDG+ LLSMLE+Y +L++EKE ER+R
Sbjct  420   AEKARALVNKLPAMVDALASKTISWEKERGIEFTYDGIRLLSMLEEYTILREEKEQERRR  479

Query  1672  QRDQKKLQGQLMAEQEVLFGSKRSPS-----QSGKKNVVGGASNKRISVGGAMLQTPYTE  1836
             QRDQKK+QGQL+AEQE L+GSK SPS     + G +   GGASN+R+S     +Q P  +
Sbjct  480   QRDQKKIQGQLIAEQEALYGSKPSPSKPQSVKKGSRMSTGGASNRRLS-----MQAPKPD  534

Query  1837  RAPLSSHSLK--------KINPVKQQALAN--ITQNYVALSSGRRE---SSMHAKQPSCN  1977
               PL  HS+K        K + V Q    N  +  ++ +LS+GRR    + +  K+ S  
Sbjct  535   --PL--HSVKGTPRPRSRKGDRVHQNEQLNNHLDDSFSSLSTGRRGLDVAGLPVKKHSFG  590

Query  1978  KSNLQKTE-PTQRKPLSPISSLSFNTSSANIMDKISESEELREMPASLLTTPIK-NVSGI  2151
               N  + E PT RKP SPI S+  +  + N+               +  TTP+K      
Sbjct  591   APNASEVETPTNRKPFSPI-SVPVSIPTENV---------------TFATTPLKPRTVAE  634

Query  2152  GGNATPKtmpipmpstpasaassiamQMGMTPAPVAATTPMVGH----------------  2283
               N TPK MP                 + +   P   + PM                   
Sbjct  635   EANKTPKVMP-----------------IFVPTTPSTVSVPMQTAMTPAPPPPPIPFATNL  677

Query  2284  -----DGVEYSYEEMRAGFLLPRLH  2343
                  + +EYS+EE RAGF+LP+ H
Sbjct  678   VQEIPEEIEYSFEERRAGFVLPKTH  702



>ref|XP_007038467.1| Microtubule associated protein (MAP65/ASE1) family protein isoform 
6 [Theobroma cacao]
 gb|EOY22968.1| Microtubule associated protein (MAP65/ASE1) family protein isoform 
6 [Theobroma cacao]
Length=557

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/526 (62%), Positives = 415/526 (79%), Gaps = 10/526 (2%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M   +ND  L++ETTC +LL ELQ IW+E+GE + +RDKML +LEQECLE YRRKVDQA+
Sbjct  1     MSTPKNDPLLQVETTCGTLLYELQIIWDEVGETDSDRDKMLLELEQECLEVYRRKVDQAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQS---SRSLKTELQAIMPlleemkkrkl  597
             R  AQLRQ +A+SEAELA IC+A+GE+PV++RQS   S SLK EL+ I+P LEEM+KRK+
Sbjct  61    RCRAQLRQTIADSEAELAAICSAMGERPVHIRQSDQNSGSLKEELRKILPQLEEMRKRKV  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             ER++QF EVL+Q   +  E+  S + +     +DE+DLSLR+LE++   L  LQKEKSDR
Sbjct  121   ERRNQFIEVLEQTQKITNEIYGSTESVSLKTVVDETDLSLRKLEELHRQLHELQKEKSDR  180

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             LKQV DHL  LNSLC V+G+DFK T+ E+HP+LGDS  L+S+S  TIE+L+ AI +LREV
Sbjct  181   LKQVQDHLHMLNSLCSVMGMDFKLTVSEVHPSLGDSDGLRSISNNTIEKLAIAIKKLREV  240

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             KIQR+  LQ+LATT++ELWNLMD P+EEQQ+F NVT  IAASE E+TEPN LS+D +   
Sbjct  241   KIQRMQRLQDLATTMLELWNLMDTPIEEQQMFQNVTCNIAASEHEITEPNTLSVDFINYV  300

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLA--IDDSIEFTDETIESGAIDPSHL  1311
             E EVSRL+E+KSSKMKE++LKKR  LE++CR+ HL    D +IE   E IESGA+D + +
Sbjct  301   EAEVSRLEELKSSKMKELVLKKRSELEDICRKTHLVPDSDSAIEDAIEAIESGAVDAATI  360

Query  1312  LEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKR  1491
             LEQ+E+QI+ VKEEAFSRKEILEKVEKWL AC+EE WLE+YNR++NRYN G+G HL LKR
Sbjct  361   LEQIELQIAKVKEEAFSRKEILEKVEKWLTACDEECWLEEYNRDENRYNAGKGAHLTLKR  420

Query  1492  AEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQR  1671
             AEKAR+LVNK+PGM+EAL S+   WE ER + F+YDG+ LLSMLE+Y +L+QEKE ER+R
Sbjct  421   AEKARSLVNKLPGMVEALASKTLAWEKEREIKFMYDGIRLLSMLEEYTILRQEKEQERRR  480

Query  1672  QRDQKKLQGQLMAEQEVLFGSKRSPS-----QSGKKNVVGGASNKR  1794
              RDQKKLQGQL+AEQE L+GSK SPS     + G +   GGASN+R
Sbjct  481   LRDQKKLQGQLIAEQEALYGSKPSPSKPQSVKKGSRFSTGGASNRR  526



>ref|XP_010536522.1| PREDICTED: 65-kDa microtubule-associated protein 3 isoform X1 
[Tarenaya hassleriana]
Length=728

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/729 (53%), Positives = 504/729 (69%), Gaps = 42/729 (6%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M N QND  L++ETTC SLL ELQ IW+E+GE E E+DKML +LE+ECLE YRRKVDQA+
Sbjct  1     MSNVQNDPLLQVETTCGSLLYELQIIWDEVGETETEKDKMLLELERECLEVYRRKVDQAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrkl  597
             R  AQLRQA+A+SEA+LA IC+A+GE+PV++RQS +   SLK EL  I+P LEEM+KRK 
Sbjct  61    RCRAQLRQAIADSEAQLATICSAMGERPVHIRQSDQNAGSLKEELGMILPQLEEMQKRKS  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             ER++QF EVL+QID +  E+    + L     +DE+DLSLR+LE++   L  LQKEKSDR
Sbjct  121   ERRNQFVEVLEQIDKISNEINGQLEHLSSEALIDETDLSLRKLEELHVQLCILQKEKSDR  180

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             L+++ +HL +L SLC VLG+DFK  +G++  TL D    +S++  TIE+L  A+ +L+E+
Sbjct  181   LEKIQEHLGTLYSLCSVLGMDFKQIVGQVDRTLSDPEGPRSINNHTIEQLGTAVQKLQEI  240

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             KIQR+  LQ+LA+ ++ELWNLMD P+EEQQ F +VT  IAASE E+TEPN+LS D LK  
Sbjct  241   KIQRMQRLQDLASAMLELWNLMDTPIEEQQEFQHVTCNIAASEHEITEPNSLSEDFLKYV  300

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAI--DDSIEFTDETIESGAIDPSHL  1311
             E EV+RL E+KSSKMKE++LKKR  LEE+CR+ HL    D +++ T E IESG +D + +
Sbjct  301   ETEVARLDEVKSSKMKELVLKKRSELEEICRKTHLVPVSDSAMDHTIEAIESGVLDATTV  360

Query  1312  LEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKR  1491
             LEQ+E+QIS +KEE+ SRKE+LEKVEKWLAAC+EESWLE+YNR+DNRYN GRG HL LKR
Sbjct  361   LEQIELQISKIKEESLSRKEVLEKVEKWLAACDEESWLEEYNRDDNRYNAGRGAHLALKR  420

Query  1492  AEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQR  1671
             AEKAR LVNK+PGM+EAL S+   WE E+G+ FLYDG+ LLSMLE+Y +L+QEKE ER+R
Sbjct  421   AEKARNLVNKLPGMVEALASKTIVWEQEKGIEFLYDGIRLLSMLEEYTILRQEKEEERRR  480

Query  1672  QRDQKKLQGQLMAEQEVLFGSKRSPSQS-GKKN---VVGGASNKRISVGGAMLQTPYTER  1839
             QRDQKKLQGQL+AEQE L+GSK SPS+  GKK      GGA+N+R+SVGG M+QTP   +
Sbjct  481   QRDQKKLQGQLIAEQEALYGSKPSPSKPLGKKAPRMSTGGATNRRLSVGGGMIQTPKPNK  540

Query  1840  APLSSHSLKKINPVKQQALANITQNYVALSSGRRE---SSMHAKQPSCNKSNLQKTEPTQ  2010
                       +N  +Q           ALSSGRR    + +  ++ S N  + Q   P  
Sbjct  541   KSDQILERNHVNNHRQ------IDGVAALSSGRRGLDIAGIPTRKLSINSYD-QLQSPLV  593

Query  2011  RKPLSPISSLSFNTSSANIM----DKISESEELRE--MPA----SLLTTPIKNVSGI---  2151
             RKP SPIS+     S ANI      KI+    L++  +P     +  TTP+KN S     
Sbjct  594   RKPFSPISTAV--ASKANITAPPNPKINREPPLQKTLIPPTNDNTPFTTPLKNSSKTLLE  651

Query  2152  GGNATPKtmpipmpstpasaassiamQMGMTPAPVA--ATTPMVGHDG-----VEYSYEE  2310
                 TPK     +P     A  S+ MQ  +TPAP+   A+TP     G     VEYS+EE
Sbjct  652   EEKHTPK-NVPVIPVPCTPATVSVPMQTAVTPAPIPLHASTPFPARLGEEPEEVEYSFEE  710

Query  2311  MRAGFLLPR  2337
              R GF++ R
Sbjct  711   RRLGFVVQR  719



>ref|XP_010692266.1| PREDICTED: 65-kDa microtubule-associated protein 3 [Beta vulgaris 
subsp. vulgaris]
Length=709

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/710 (51%), Positives = 486/710 (68%), Gaps = 32/710 (5%)
 Frame = +1

Query  256   RQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSC  435
             RQ++  LRMETTC SLL EL++IW+E+GE E  RD ML ++EQECLE Y RKVDQA +  
Sbjct  4     RQSNVFLRMETTCESLLCELKEIWDEVGESESGRDTMLLEIEQECLEIYTRKVDQAYQIR  63

Query  436   AQLRQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrklerk  606
             AQLRQA+A++EAELA I ++LGE+P+N+RQ  +    LK EL  I+P LEEM+K++ ERK
Sbjct  64    AQLRQAIADAEAELAHIFSSLGERPMNIRQPDQKVIGLKEELNMIIPSLEEMRKKRSERK  123

Query  607   HQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQ  786
              QF EVLDQI  +  E+  S +       +DE+DLSLRRL+++ S LL+LQKEKSDRLKQ
Sbjct  124   KQFVEVLDQICDISSEIYGSAENSLSQRTVDENDLSLRRLDELHSQLLALQKEKSDRLKQ  183

Query  787   VLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQ  966
             VLD+L +L+SLC VLGIDFK+ I  IH TL  S+  K++S + +ERLS AI  LRE KI+
Sbjct  184   VLDNLNTLSSLCTVLGIDFKDQIQNIHLTLDGSNGTKNISDDAMERLSIAIQNLRESKIE  243

Query  967   RLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIE  1146
             RL  LQ+LA+ ++ELWNLMD P +EQ+ F NVT  IAASE E+TEPN LSL  +   E E
Sbjct  244   RLQKLQDLASMMLELWNLMDTPQDEQRTFHNVTSKIAASEPEITEPNCLSLHFISYVEAE  303

Query  1147  VSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAID-DSIE-FTDETIESGAIDPSHLLEQ  1320
             V RL  +KSSKMKE++LKK+  LEE+CRQ H+ I+  S+  F  E IESGA+D S++LEQ
Sbjct  304   VMRLDNLKSSKMKELILKKKSELEEICRQTHMTIEAQSLNCFAVEAIESGALDLSYMLEQ  363

Query  1321  LEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEK  1500
             +E+QIS  KEEAFSRK++LE+VEKW AAC+EE WLE+YNR++ RY GGRG HL LKRAEK
Sbjct  364   IELQISMAKEEAFSRKDVLERVEKWKAACDEECWLEEYNRDECRYYGGRGGHLSLKRAEK  423

Query  1501  ARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRD  1680
             AR LV+KIP M+E+LTS+ + WE ERG  F YDGVSLLS+LE Y +L++EKE ERQRQRD
Sbjct  424   ARILVSKIPAMVESLTSKIQAWEKERGAAFFYDGVSLLSLLEDYSILREEKEKERQRQRD  483

Query  1681  QKKLQGQLMAEQEVLFGSKRSPSQSGKK----NVVG-GASNKRISVGGAMLQTPY--TER  1839
             QKKLQG+L+AEQE LFGSK SP+++ KK    ++ G GA ++R S+ G+MLQ  +   ER
Sbjct  484   QKKLQGRLLAEQEALFGSKPSPTKTTKKAPRHSLSGAGAVSRRYSLSGSMLQRQHLKPER  543

Query  1840  APLSSHSLKKINPVKQQALANITQNYVALSSGRRESSMHAKQPSCNKSNLQKTEPTQRKP  2019
             + L SH + K++ ++     N T      ++G+    +  KQ            P +RKP
Sbjct  544   SALHSHPINKLSQLQDGGKRNNT------TTGQ----LQKKQAKVTNPR-DFGSPKKRKP  592

Query  2020  LSPISSLSFNTSSANIMDKISESEELREMPASLLT---TPIKNVSGIGGNATPKtmpipm  2190
              + I     +  SA  +   +  E+    P++ L+   TP K +      +TPK+    +
Sbjct  593   FTVIR----DAVSATPVHLKNTPEKQNMTPSTTLSAGNTPTK-LKSDEKVSTPKSFTQVI  647

Query  2191  pstpasaassiamQMGMTPAPVAATTPMVGHDG-VEYSYEEMRAGFLLPR  2337
               +P   + S   +      PV+     V  DG +EYS+EE+RAG++LP+
Sbjct  648   HPSPVKVSPSTLPRSASPYTPVSVRFEEVATDGNIEYSFEEIRAGYVLPQ  697



>gb|KHN27850.1| 65-kDa microtubule-associated protein 3 [Glycine soja]
Length=694

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/703 (52%), Positives = 491/703 (70%), Gaps = 34/703 (5%)
 Frame = +1

Query  274   LRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQA  453
             L+ +TTC SLL ELQ IWNE+GE E E+D+M+ ++E+ECLE YRRKVD+A+RS AQLRQ 
Sbjct  8     LQTKTTCGSLLDELQIIWNEVGESETEKDRMVFEIEEECLEVYRRKVDKANRSRAQLRQE  67

Query  454   VAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrklerkHQFSEV  624
             +A+SEAELA IC A+GE+PV+VRQ  +   SLK EL  +   LEEM+KRK  R++QF EV
Sbjct  68    IADSEAELASICLAMGERPVHVRQFDQKAVSLKQELARVRQELEEMQKRKSGRRNQFIEV  127

Query  625   LDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLE  804
              +QI S+  E+  S   +     +DE+DLSLR+LE++   LL+LQKEKS+RLK+V DHL 
Sbjct  128   QEQIQSISNEISPSITAI-----VDETDLSLRKLEELHRQLLALQKEKSERLKKVQDHLY  182

Query  805   SLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQRLHMLQ  984
             +LNSLC VLG+DFK T+  +HP+LG+S   KSV+ +TI +L+  I  LR+VK++R+  LQ
Sbjct  183   TLNSLCSVLGLDFKQTVSGVHPSLGNSEGPKSVNNDTINQLAIGIQGLRKVKLKRMQRLQ  242

Query  985   NLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQE  1164
             +LA+T++ELWNLMD P+EEQQ+F NVT  IAASE E+TEPN+LS + + + E EVSRL+E
Sbjct  243   DLASTMLELWNLMDTPIEEQQVFQNVTCNIAASEHEVTEPNSLSENFIYNVEAEVSRLEE  302

Query  1165  MKSSKMKEVLLKKRITLEELCRQAHLA--IDDSIEFTDETIESGAIDPSHLLEQLEIQIS  1338
             +KSSK+KE++LKKR+ LEE+C++ HL   I  ++++  E IESG++DP+ +LEQ+E++I+
Sbjct  303   LKSSKIKELVLKKRVELEEICQKTHLIPEIGSAMKYPVEAIESGSVDPACVLEQIELRIA  362

Query  1339  NVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVN  1518
              VKEEAF RKEILEKVEKWL+AC+EESWLE+YNR++NRYN GRG+H+ LKRAEKARALVN
Sbjct  363   RVKEEAFFRKEILEKVEKWLSACDEESWLEEYNRDENRYNAGRGSHITLKRAEKARALVN  422

Query  1519  KIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQG  1698
             K+P M++ALTS+    E ++G+ F YDG  LLSMLE Y L +QEKE ER+RQR+ KKLQG
Sbjct  423   KLPAMVDALTSKTVASEKDKGIEFTYDGTCLLSMLENYSLSRQEKEQERRRQRELKKLQG  482

Query  1699  QLMAEQEVLFGSKRSPS--QSGKKN---VVGGASNKRISVGGAMLQTPYTERAPLSSHSL  1863
             Q++ E+EVL+GSK SPS  QS KK         S+KRIS+G    QTP ++     S S 
Sbjct  483   QIIVEKEVLYGSKPSPSKAQSVKKAPRLSTRSTSSKRISLG---CQTPKSDSKATQSFST  539

Query  1864  KKINPVKQ-QALANITQNYVALSSGRRESSMHA----KQPSCNKSNLQKTEPTQRKPLSP  2028
              K + V Q + L N+  +   LSS RR   +      K  +   S L    P  R+P SP
Sbjct  540   GKTDKVHQNEQLNNLDDDVSCLSSARRGLDIAGVPLRKYSTGAGSVLDMVSPLTRQPFSP  599

Query  2029  IS-SLSFNTSSANIMDKISESEELREMPASLLTTPIKNVSGIGGNATPKtmpipmpstpa  2205
             IS +LS   + AN  +  +++E+L++   +  TT + N      N TPK   +P+P    
Sbjct  600   ISLTLSSKANVANAAND-TQNEKLQKTLTTSKTTTVANEE----NKTPK--AVPIPDPTT  652

Query  2206  saassiamQMGMTPAPVAATTPM-VGHDGVEYSYEEMRAGFLL  2331
                    M M MTP P  A+ P  V    +EYS+EE R GF+L
Sbjct  653   PLKLLNPMNMSMTPGP--ASVPYGVSAQEIEYSFEERRLGFVL  693



>ref|XP_007052040.1| Microtubule associated protein family protein, putative isoform 
1 [Theobroma cacao]
 gb|EOX96197.1| Microtubule associated protein family protein, putative isoform 
1 [Theobroma cacao]
Length=719

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/722 (50%), Positives = 491/722 (68%), Gaps = 31/722 (4%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M N +++Q  R+ETTC SLL ELQKIW+E+GE + ERD  L  LEQECL+ Y RKVD+A 
Sbjct  1     MLNHKSEQLARIETTCGSLLCELQKIWDEVGEADDERDTTLLDLEQECLKVYTRKVDEAK  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVR----QSSRSLKTELQAIMPlleemkkrk  594
                 +L + +A ++AE++ +CA++GE PV+V     +   +LK EL+ I PLLE+M+++K
Sbjct  61    ECRTKLHRDIAIAKAEISDVCASIGENPVHVSAPDLKPGGNLKEELETIGPLLEDMRRKK  120

Query  595   lerkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSD  774
             +ER +QF  V+DQI  +  E+   +++  + + +DE++LSLRRLE++   L  LQ EK +
Sbjct  121   VERINQFIGVIDQIQKISNEILGFKEQDGNKLLVDETNLSLRRLEELHRELHELQNEKIN  180

Query  775   RLKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELRE  954
             RL QV  HL ++NSLC VLG+DF  TI  IHPTL DS+  K VS  TI RL+A I  L+E
Sbjct  181   RLNQVQGHLNTINSLCTVLGMDFIQTICRIHPTLDDSNGAKDVSNNTIARLAAQIQSLQE  240

Query  955   VKIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKS  1134
             +KI+R+  +Q LA+T++ELW+LMD P EEQ +F NVT  IAASE E+TEPN LS+D +K+
Sbjct  241   LKIKRMQKIQELASTLLELWHLMDTPAEEQHMFLNVTSKIAASEPEITEPNMLSIDCIKN  300

Query  1135  AEIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAIDD--SIEFTDETIESGAIDPSH  1308
              E EVSRL+++K+SKMKE++LKK++ LE++CR+ H+ ++   S +++ E +ESGAIDP +
Sbjct  301   VEEEVSRLEQLKTSKMKEIVLKKKVELEDMCRRTHMVLEALISTDYSIEAMESGAIDPLY  360

Query  1309  LLEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLK  1488
             LLEQ+++QIS V+EEAFSRKE+LEKVEKWLAACEEESWLE+YNR+DNRYN GRG HL LK
Sbjct  361   LLEQIDLQISKVREEAFSRKEVLEKVEKWLAACEEESWLEEYNRDDNRYNAGRGAHLSLK  420

Query  1489  RAEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQ  1668
             RAEKARA+VNKIP M+EALT +   WE ER   FLYDG  LLS+LE Y  L+QEKELERQ
Sbjct  421   RAEKARAVVNKIPAMVEALTLKTTAWERERETEFLYDGRRLLSVLEDYSSLRQEKELERQ  480

Query  1669  RQRDQKKLQGQLMAEQEVLFGSKRSPSQSGKKN---VVGGASNKRISVGGAMLQTPYTER  1839
             RQRD KK  GQL+AEQE L+GSK SPS SGKK       GAS++++S+GGAMLQ    E+
Sbjct  481   RQRDHKKFHGQLIAEQEALYGSKPSPSISGKKAPRMPTVGASDRKLSLGGAMLQQVKPEK  540

Query  1840  APLSSHSLKKINPVKQQALANITQNY-VALSSGRRESSMHA----KQPSCNKSNLQKTEP  2004
                  H  KK + + Q +  N  ++   A +S +R S +      KQP       +   P
Sbjct  541   PATRLHPNKKADYLNQNSFLNHQRSSGFAANSVKRNSEVPGRVIKKQPLSAAKVRENESP  600

Query  2005  TQRKPLSPISSLSFNTSSANIMD------KISESEELREMPASLLTTPIK-NVSGIGGNA  2163
               RKPLSP+ S + N S ANI++      K+   + L     +    P K  + G   N 
Sbjct  601   AVRKPLSPV-SFAVN-SKANIVNFTEDQKKVKNGQRLNPGCQTPTAVPAKPTLIGDDENR  658

Query  2164  TPKtmpipmpstpasaassiamQMGMTPAPVAATTPMVGHD------GVEYSYEEMRAGF  2325
             TPK MPIPMP+TP++ ++ +   M MTPA  A        +       VEYS+EE+RAGF
Sbjct  659   TPKAMPIPMPTTPSTVSAPML--MAMTPATPATLGAYKVENVLERVQQVEYSFEELRAGF  716

Query  2326  LL  2331
              L
Sbjct  717   FL  718



>ref|XP_006490933.1| PREDICTED: 65-kDa microtubule-associated protein 4-like isoform 
X1 [Citrus sinensis]
 ref|XP_006490934.1| PREDICTED: 65-kDa microtubule-associated protein 4-like isoform 
X2 [Citrus sinensis]
 ref|XP_006490935.1| PREDICTED: 65-kDa microtubule-associated protein 4-like isoform 
X3 [Citrus sinensis]
Length=714

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/720 (50%), Positives = 494/720 (69%), Gaps = 35/720 (5%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M N   ++  R+ETTC SLL ELQKIW+E+GE + ERDKM+ ++EQECL  Y RK+D A 
Sbjct  1     MLNHHPNEFARLETTCGSLLCELQKIWDEVGESDNERDKMILEIEQECLAVYGRKIDDAK  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSR-SLKTELQAIMPlleemkkrkler  603
              S AQL +A+A SEAE+A IC+ LGEQP +   ++  +L+ +L+ I PLLE+M++RK++R
Sbjct  61    ISRAQLLRAIALSEAEVADICSTLGEQPGHCDWTAGGNLRDKLKTITPLLEDMRQRKIDR  120

Query  604   kHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLK  783
             K+QF +VL+Q+  +  E+    K+  + I  DE+DLS +RL++++S L  LQ+EKS RL+
Sbjct  121   KNQFLQVLNQLQIISNEI--CPKDNMYKIIEDEADLSEQRLKELRSQLAYLQEEKSSRLR  178

Query  784   QVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKI  963
             +V+ HL ++NSLC+VLG+DFK+T+ +IHPTL D  A K VS +TIE+++  I  L+EVKI
Sbjct  179   KVMKHLSNVNSLCMVLGLDFKDTVCKIHPTLNDPKASKDVSNDTIEKMATTIQSLQEVKI  238

Query  964   QRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEI  1143
             QR+  LQ+LAT++VELWNLMD P+EEQ++F N+T  IAA E E+TEPN LS++ +K  E 
Sbjct  239   QRMQKLQHLATSLVELWNLMDTPLEEQEMFHNITSKIAALEPEITEPNFLSMNNIKYVEG  298

Query  1144  EVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAIDDSIEFTDETIESGAIDPSHLLEQL  1323
             EVSRL+++KSSKMKE++LKK++ L E+ R+ H   +   +F+ E IESG++D   LLEQ+
Sbjct  299   EVSRLEQLKSSKMKELVLKKKLELAEILRKMHTVTETVGDFSIEAIESGSMDFMDLLEQI  358

Query  1324  EIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKA  1503
             ++QI+  KEEA SRKEILEKVEKW  A EEESWLE+YNR+DNRYN GRG+HL LKRAEKA
Sbjct  359   DLQIAKAKEEASSRKEILEKVEKWFTAREEESWLEEYNRDDNRYNAGRGSHLSLKRAEKA  418

Query  1504  RALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQ  1683
             R LVNKIP M+EALT +   WE E G  F YDGV L+SMLE Y  ++QEKELERQRQ+D 
Sbjct  419   RVLVNKIPAMVEALTCKVTAWEKETGTEFSYDGVRLISMLEDYSCMRQEKELERQRQKDH  478

Query  1684  KKLQGQLMAEQEVLFGSKRSPSQSGKK---NVVGGASNKRISVGGAMLQTPYTERAPLSS  1854
             +KLQ QL+AEQE ++GSK SPS+SG+K    + G ASN+++S+GG MLQ    E+  L  
Sbjct  479   RKLQVQLIAEQEAIYGSKPSPSKSGRKTSTTLTGIASNRKLSLGGVMLQNLKPEKEALCV  538

Query  1855  HSLKKINPVKQQALANITQNY-VALSSGRRESSM--HAKQPSCNK--SNLQKTEP-TQRK  2016
             HS KKI+ + + +     Q+  +A  SGRR S +  +    SC+   +  +K E  + RK
Sbjct  539   HSNKKIDGLYRNSPFGRPQSVSLAAGSGRRNSEIPGNVVNKSCSSVAAKARKVESKSARK  598

Query  2017  PLSPIS-SLSFNTSSANIMD---KISESEELREMPASLLTTPIKNVSGIG-GNATPKtmp  2181
             PLSP+S ++S   + AN ++   +      L+ +P S+  TP K +     GN  P TMP
Sbjct  599   PLSPVSLAISSKANIANFLEDKKRTHNGTSLKAVP-SVAVTPSKQIVACNEGNKAPNTMP  657

Query  2182  ipmpstpasaassiamQMGMTPAPVAATTPMVG---------HDGVEYSYEEMRAGFLLP  2334
                 +     A  +   M MTPA     TP V           D +EYS+EE+RAGF+ P
Sbjct  658   SVPKTPSTFTAPML---MAMTPA-----TPCVSLGAKANERTGDKIEYSFEEVRAGFICP  709



>ref|XP_008232725.1| PREDICTED: 65-kDa microtubule-associated protein 9 [Prunus mume]
Length=721

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/714 (50%), Positives = 485/714 (68%), Gaps = 26/714 (4%)
 Frame = +1

Query  247   MYN-RQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQA  423
             M+N R ++Q + +ET    LL ELQKIW+E+G P++ERD M+  +EQEC+E +R KVD A
Sbjct  1     MFNQRSSNQFVHLETKFEFLLQELQKIWDEVGVPDVERDTMILTIEQECMEVFRTKVDDA  60

Query  424   SRSCAQLRQAVAESEAELARICAALGEQPVNVRQ-SSRSLKTELQAIMPlleemkkrkle  600
              +  A L+Q +A  EAEL  IC+ALGEQP +  Q +S SLK +L+ I+P LE MK RK+E
Sbjct  61    KKCKALLQQEIASYEAELVDICSALGEQPPHFDQNASGSLKKKLETIIPQLENMKMRKVE  120

Query  601   rkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRL  780
             R+ +F  VLDQ+  +  ++ +  ++  + + ++E+DLSL+RLE+++  LL  Q EK +R+
Sbjct  121   RRDEFFVVLDQLQKISIQICRFTEDSLYKMVVEETDLSLKRLEELRRQLLDYQDEKRNRV  180

Query  781   KQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVK  960
               V+DH   LNSLC+VLG+DFK+TI EIHPTL DS   K V+  T++ L+  I  LR+VK
Sbjct  181   NLVMDHRNILNSLCLVLGMDFKHTIHEIHPTLDDSEGEKDVTNNTVDSLANLIQRLRKVK  240

Query  961   IQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAE  1140
             IQR  MLQN  + ++E+WNLMD P+E+Q  F NVTR IAASESE+TEPN LS D L   E
Sbjct  241   IQRWQMLQNHVSALLEMWNLMDTPIEQQTKFQNVTRHIAASESEITEPNMLSTDFLNHVE  300

Query  1141  IEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLA--IDDSIEFTDETIESGAIDPSHLL  1314
              EVSRLQ++KSSK+KE+  KKR+ LEE+CRQ+H+   I  ++E+++E +ESG +DP+ +L
Sbjct  301   EEVSRLQQLKSSKLKEIFQKKRLELEEICRQSHMVTEILSAMEYSNEALESGTVDPACVL  360

Query  1315  EQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRA  1494
             EQ+E+QI+  KEEA SRKEILEK EKWLAAC+EE WLE+YNR+DNRYN GRG HL LK A
Sbjct  361   EQIELQITRAKEEALSRKEILEKFEKWLAACQEECWLEEYNRDDNRYNAGRGAHLTLKHA  420

Query  1495  EKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQ  1674
             EKARALVNKIPG++EALTS+ K WE ERG+ FLYDG  +LSML +Y  L+QEKE E+QRQ
Sbjct  421   EKARALVNKIPGLVEALTSKTKAWERERGLEFLYDGGRILSMLTEYSTLRQEKEQEKQRQ  480

Query  1675  RDQKKLQGQLMAEQEVLFGSKRSPSQSGKKNVVGGASNKRISVGGAMLQTPYTERAPLSS  1854
             RD K+ QGQ++AEQEVL+GSKRS S+SGKK     ASN++IS+GGA+++    E+A    
Sbjct  481   RDMKRFQGQVLAEQEVLYGSKRSASKSGKK-----ASNRKISLGGALIRNQNFEKATPLV  535

Query  1855  HSLKKINPVKQQALANITQNYVA---LSSGRR--ESSMHA--KQPSCNKSNLQKTEPTQR  2013
             H  KK N + + +       +++    ++GRR  E S H+  K PS     L+   P  R
Sbjct  536   HPTKKGNCLNRSSSHQRYGGFMSRHKFNAGRRISEISGHSVKKHPSSAGKALELDSPLIR  595

Query  2014  KPLSPI-SSLSFNTSSANIMDKISESEELREMPASLLT-----TPIKNV-SGIGGNATPK  2172
             KPLSP+ S +S   + AN  +     ++     A L +     TP K V  G   N TPK
Sbjct  596   KPLSPVLSEVSSKVNIANFQEGQKTQQKTNMQAAHLFSEMPIMTPSKPVFVGDEENRTPK  655

Query  2173  tmpipmpstpasaassiamQMGMTPAPVAATTPMVGHDG--VEYSYEEMRAGFL  2328
             TMPIP+P TP + +  +           +     V   G  VEYS+EE+RAGF+
Sbjct  656   TMPIPVPLTPKTMSVQMLTATTPATPFTSGAYK-VEKSGQPVEYSFEEVRAGFI  708



>ref|XP_009374533.1| PREDICTED: 65-kDa microtubule-associated protein 3 isoform X2 
[Pyrus x bretschneideri]
Length=678

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/598 (57%), Positives = 451/598 (75%), Gaps = 11/598 (2%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M N Q++Q L+METTC SLL ELQ IWNE+GE + +RDKML +LEQECLE YRRKVD+A+
Sbjct  1     MSNLQSEQLLQMETTCGSLLYELQIIWNEVGESDKDRDKMLLELEQECLEVYRRKVDKAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrkl  597
             R  AQLRQA+A+SEAELA IC+A+GE+PV++RQS +   SLK EL  I+P LEEMKKRK 
Sbjct  61    RCRAQLRQAIADSEAELAAICSAMGERPVHIRQSDQNAGSLKEELSKIIPQLEEMKKRKY  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             +RK+ F EVL++I  +  E+  S      + A+DE+DLSLRRLE+++ HL  LQ EKSDR
Sbjct  121   DRKNNFLEVLEEIQKISSEINGSTDYSSSIPAVDETDLSLRRLEELQRHLHGLQTEKSDR  180

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             LKQ+ DHL +LNSLC VLG+D+K TI E+HP+L DS   K++S +TI+RL+AAI +LREV
Sbjct  181   LKQIQDHLCTLNSLCSVLGMDYKQTISEVHPSLVDSEGSKNISNDTIQRLAAAIQKLREV  240

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             K+QR+  LQ+LATT++ELWNLMD P+EEQQ+F N+T  IAASE E+TEPN LS+D +   
Sbjct  241   KLQRMQRLQDLATTMLELWNLMDTPIEEQQMFQNITCNIAASEHEITEPNTLSVDFINYV  300

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAI--DDSIEFTDETIESGAIDPSHL  1311
             E EVSRL+E+KSSKMKE++LKKR  LEE+CR+ H+ +  D +I++    IESG +DP+ +
Sbjct  301   EAEVSRLEELKSSKMKELVLKKRSELEEICRKTHMVLEADSAIDYVIAAIESGDVDPACV  360

Query  1312  LEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKR  1491
             L+Q+E+Q++ VKEEAFSRK+ILE+VEKWL AC+EE WLE+YNR++NRYN GRG HL LKR
Sbjct  361   LDQIELQVAKVKEEAFSRKDILERVEKWLFACDEECWLEEYNRDENRYNAGRGAHLTLKR  420

Query  1492  AEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQR  1671
             AEKARALVNK+P M++AL S+   WE ERG+ F YDG+ LLSMLE+Y +L++EKE ER+R
Sbjct  421   AEKARALVNKLPAMVDALASKTISWEKERGIEFTYDGIRLLSMLEEYTILREEKEQERRR  480

Query  1672  QRDQKKLQGQLMAEQEVLFGSKRSPS--QSGKKN---VVGGASNKRISVGGAMLQTPYTE  1836
             QRDQKK+QGQL+AEQEVL+GSK SPS  QS KK      GGASN+R+S+        ++ 
Sbjct  481   QRDQKKIQGQLIAEQEVLYGSKPSPSKPQSVKKAPRMSTGGASNRRLSMQAPKPDPLHSI  540

Query  1837  RAPLSSHSLKKINPVKQQALANITQNYVALSSGRRESSMHAKQPSCNKSNLQKTEPTQ  2010
             +    S    ++NP  +Q   ++   + +LS+GRR   +     S  K +     P++
Sbjct  541   KGTPRSRKSDRVNP-NEQLNNHLDDGFSSLSTGRRGLGLDVAGLSVKKHSFGAPNPSE  597



>gb|KCW90811.1| hypothetical protein EUGRSUZ_A02875 [Eucalyptus grandis]
Length=838

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/766 (49%), Positives = 515/766 (67%), Gaps = 53/766 (7%)
 Frame = +1

Query  181   SLSSHTSRFLS-----PPGLLGRIASD----MYNRQNDQSLRMETTCCSLLSELQKIWNE  333
             SL++   RF S     P G + R+A      M N  ND   + ETTC +LL ELQ IW+E
Sbjct  74    SLNAVADRFASESPSSPAGTIRRLARSSSLVMSNLLNDPLFQKETTCGTLLYELQIIWDE  133

Query  334   IGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAESEAELARICAALGEQPV  513
             IGE + +RDKML +LEQECLE YRRKVD++++S A+LRQA+A+SEAELA IC+ALGE+P+
Sbjct  134   IGESDADRDKMLQELEQECLEVYRRKVDKSNQSRARLRQAIADSEAELAAICSALGERPL  193

Query  514   NVRQSSR---SLKTELQAIMPlleemkkrklerkHQFSEVLDQIDSVLKELGKSRKELQH  684
             + +Q  +   SLK E + I+P LEEM++ K ER++QF +VL+QI  V  E+  S      
Sbjct  194   HTKQPDQNVGSLKEEFKKILPQLEEMRRMKCERRNQFLDVLEQIQRVKAEICGSLDHTPP  253

Query  685   MIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESLNSLCIVLGIDFKNTIGEI  864
                LDE+DLS R+LE++   L  LQ EK++RL+ V DHL ++N+LC+VL +DFK    E+
Sbjct  254   KTRLDETDLSSRKLEELHRELYELQTEKTERLRLVQDHLFTVNALCLVLDLDFKQIASEV  313

Query  865   HPTLGDSSALKSVSTETIERLSAAIHELREVKIQRLHMLQNLATTIVELWNLMDMPVEEQ  1044
             H +L D    K +S  TIE+L+ AIH+LREVK+QR+  LQ+LATT++ELWNLMD P EEQ
Sbjct  314   HASLADPEGPKDISNSTIEKLATAIHKLREVKLQRMQRLQDLATTMLELWNLMDTPTEEQ  373

Query  1045  QLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQEMKSSKMKEVLLKKRITLEEL  1224
             Q+F ++T  IAASE E+TEP  LS D++     EV+RL+E K SKMKE++LKKR  LEE+
Sbjct  374   QMFQSITSNIAASEHEITEPKMLSEDIINFVAAEVARLEEFKLSKMKELVLKKRSELEEI  433

Query  1225  CRQAHLA--IDDSIEFTDETIESGAIDPSHLLEQLEIQISNVKEEAFSRKEILEKVEKWL  1398
             CR+ HL    D  +E+  E +ESGA+D + +LEQ+E++I+ VKEEA +RKE+LEKVEKWL
Sbjct  434   CRKTHLIPEADTGMEYAIEAVESGAVDAACILEQIELRIAEVKEEALNRKELLEKVEKWL  493

Query  1399  AACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVNKIPGMLEALTSRAKGWEIER  1578
             AAC+EE WLE+YNR++NRYN GRG HL LKRAEKARALV+K+P M+E LTS+   WE ER
Sbjct  494   AACDEECWLEEYNRDENRYNAGRGAHLTLKRAEKARALVSKLPAMVETLTSKTVAWEKER  553

Query  1579  GVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQGQLMAEQEVLFGSKRSPSQS-  1755
             G+ F YDG+ LLSMLE+Y +L+QE+E ER+R RDQKKLQGQL+AEQE L+GSK SPS++ 
Sbjct  554   GIEFSYDGLRLLSMLEEYSILRQEREQERRRLRDQKKLQGQLIAEQEALYGSKPSPSKTQ  613

Query  1756  ----GKKNVVGGASNKRISVGGAMLQTPYTERAPLSSHSLK------------KINPVKQ  1887
                   +   GGAS++R+S+GGA L TP  +  PL  HS+K            ++N V Q
Sbjct  614   LVKKAPRMSTGGASSRRLSLGGATLHTPKPD--PL--HSMKATPNARPHRKSDRVNQVDQ  669

Query  1888  QALANITQN-YVALSSGRRE---SSMHAKQPSCNKSNLQKTE-PTQRKPLSPIS-SLSFN  2049
               L +   N   ALS+ RR    + +  K+ S + +   + + P  RKP SP+S ++S  
Sbjct  670   --LNHYKDNGQAALSASRRGLDVAGLPLKKHSLDAALASEPDSPMIRKPFSPVSPAVSTK  727

Query  2050  TSSANIMDKIS--ESEELREM-PASLLTTPIKNVS-GIGGNATPKtmpipmpstpasaas  2217
              S  N+MD  +  + E L+++   ++ +TP+K  +     N TPK   + +P     +  
Sbjct  728   MSLTNVMDNAAARQDEPLQKIFSGNMFSTPLKTTNMNDEENRTPK--VMAIPVPTTPSTI  785

Query  2218  siamQMGMTPA----PVAATTPMVGHDGVEYSYEEMRAGFLLPRLH  2343
             S+ MQ  MTPA    P+AA       + +EYS+EE RAGF+LPR +
Sbjct  786   SMPMQTAMTPALVSQPLAANLVKEIAEEIEYSFEERRAGFVLPRAY  831



>ref|XP_008343706.1| PREDICTED: 65-kDa microtubule-associated protein 3-like [Malus 
domestica]
Length=581

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/573 (59%), Positives = 441/573 (77%), Gaps = 11/573 (2%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M N Q++Q L+METTC SLL ELQ IWNE+GE + +RDKML +LEQECLE YRRKVD+A+
Sbjct  1     MSNLQSEQLLQMETTCGSLLYELQIIWNEVGESDKDRDKMLLELEQECLEVYRRKVDKAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrkl  597
             R  AQLRQA+A+SEAELA IC+A+GE+PV++RQS +   SLK EL  I+P LEEMKKRK 
Sbjct  61    RCRAQLRQAIADSEAELAAICSAMGERPVHIRQSDQNAGSLKEELSKIIPQLEEMKKRKC  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             +RK+ F EVL++I  +  E+  S        A+DE+DLSLRRLE++  HL  LQ EKSDR
Sbjct  121   DRKNNFLEVLEEIRKISSEINGSTDYSSSTPAVDETDLSLRRLEELHRHLHGLQTEKSDR  180

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             LKQ+ DHL +LNSLC VLG+D+K TI E+HP+L DS   K++S +TI+RL+AAI +LREV
Sbjct  181   LKQIQDHLCTLNSLCSVLGMDYKQTISEVHPSLVDSEGSKNISNDTIQRLAAAIQKLREV  240

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             K+QR+  LQ+LATT++ELWNLMD P+EEQQ+F N+T  IAASE E+TEPN LS+D +   
Sbjct  241   KLQRMQRLQDLATTMLELWNLMDTPIEEQQMFQNITCNIAASEHEITEPNTLSVDFINYV  300

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAI--DDSIEFTDETIESGAIDPSHL  1311
             E EVSRL+E+KSSKMKE++LKKR  LEE+CR+ H+ +  D +I++  E IESG +DP+ +
Sbjct  301   EAEVSRLEELKSSKMKELVLKKRSELEEICRKTHMVLEADSAIDYVIEAIESGDVDPACV  360

Query  1312  LEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKR  1491
             L+Q+E+Q++ VKEEAFSRK+ILE+VEKWL AC+EE WLE+YNR++NRYN GRG HL LKR
Sbjct  361   LDQIELQVAKVKEEAFSRKDILERVEKWLFACDEECWLEEYNRDENRYNAGRGAHLTLKR  420

Query  1492  AEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQR  1671
             AEKARALVNK+P M++AL S+   WE ERG+ F YDG+ LLSMLE+Y +L++EKE ER+R
Sbjct  421   AEKARALVNKLPAMVDALASKTISWEKERGIEFTYDGIRLLSMLEEYTILREEKEQERRR  480

Query  1672  QRDQKKLQGQLMAEQEVLFGSKRSPS--QSGKKN---VVGGASNKRISVGGAMLQTPYTE  1836
             QRDQKK+QGQL+AEQEVL+GSK SPS  QS KK      GGASN+R+S+        ++ 
Sbjct  481   QRDQKKIQGQLIAEQEVLYGSKPSPSKPQSVKKAPRMSTGGASNRRLSMQAPKPDPLHSV  540

Query  1837  RAPLSSHSLKKINPVKQQALANITQNYVALSSG  1935
             +    S    ++NP  +Q   ++   + +LS+G
Sbjct  541   KGTPRSRKSDRVNP-NEQLNNHLDDGFSSLSTG  572



>ref|XP_009374534.1| PREDICTED: 65-kDa microtubule-associated protein 3 isoform X3 
[Pyrus x bretschneideri]
Length=581

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/573 (59%), Positives = 442/573 (77%), Gaps = 11/573 (2%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M N Q++Q L+METTC SLL ELQ IWNE+GE + +RDKML +LEQECLE YRRKVD+A+
Sbjct  1     MSNLQSEQLLQMETTCGSLLYELQIIWNEVGESDKDRDKMLLELEQECLEVYRRKVDKAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrkl  597
             R  AQLRQA+A+SEAELA IC+A+GE+PV++RQS +   SLK EL  I+P LEEMKKRK 
Sbjct  61    RCRAQLRQAIADSEAELAAICSAMGERPVHIRQSDQNAGSLKEELSKIIPQLEEMKKRKY  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             +RK+ F EVL++I  +  E+  S      + A+DE+DLSLRRLE+++ HL  LQ EKSDR
Sbjct  121   DRKNNFLEVLEEIQKISSEINGSTDYSSSIPAVDETDLSLRRLEELQRHLHGLQTEKSDR  180

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             LKQ+ DHL +LNSLC VLG+D+K TI E+HP+L DS   K++S +TI+RL+AAI +LREV
Sbjct  181   LKQIQDHLCTLNSLCSVLGMDYKQTISEVHPSLVDSEGSKNISNDTIQRLAAAIQKLREV  240

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             K+QR+  LQ+LATT++ELWNLMD P+EEQQ+F N+T  IAASE E+TEPN LS+D +   
Sbjct  241   KLQRMQRLQDLATTMLELWNLMDTPIEEQQMFQNITCNIAASEHEITEPNTLSVDFINYV  300

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAI--DDSIEFTDETIESGAIDPSHL  1311
             E EVSRL+E+KSSKMKE++LKKR  LEE+CR+ H+ +  D +I++    IESG +DP+ +
Sbjct  301   EAEVSRLEELKSSKMKELVLKKRSELEEICRKTHMVLEADSAIDYVIAAIESGDVDPACV  360

Query  1312  LEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKR  1491
             L+Q+E+Q++ VKEEAFSRK+ILE+VEKWL AC+EE WLE+YNR++NRYN GRG HL LKR
Sbjct  361   LDQIELQVAKVKEEAFSRKDILERVEKWLFACDEECWLEEYNRDENRYNAGRGAHLTLKR  420

Query  1492  AEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQR  1671
             AEKARALVNK+P M++AL S+   WE ERG+ F YDG+ LLSMLE+Y +L++EKE ER+R
Sbjct  421   AEKARALVNKLPAMVDALASKTISWEKERGIEFTYDGIRLLSMLEEYTILREEKEQERRR  480

Query  1672  QRDQKKLQGQLMAEQEVLFGSKRSPS--QSGKKN---VVGGASNKRISVGGAMLQTPYTE  1836
             QRDQKK+QGQL+AEQEVL+GSK SPS  QS KK      GGASN+R+S+        ++ 
Sbjct  481   QRDQKKIQGQLIAEQEVLYGSKPSPSKPQSVKKAPRMSTGGASNRRLSMQAPKPDPLHSI  540

Query  1837  RAPLSSHSLKKINPVKQQALANITQNYVALSSG  1935
             +    S    ++NP  +Q   ++   + +LS+G
Sbjct  541   KGTPRSRKSDRVNP-NEQLNNHLDDGFSSLSTG  572



>ref|XP_010062006.1| PREDICTED: 65-kDa microtubule-associated protein 3-like [Eucalyptus 
grandis]
Length=734

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/735 (50%), Positives = 502/735 (68%), Gaps = 44/735 (6%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M N  ND   + ETTC +LL ELQ IW+EIGE + +RDKML +LEQECLE YRRKVD+++
Sbjct  1     MSNLLNDPLFQKETTCGTLLYELQIIWDEIGESDADRDKMLQELEQECLEVYRRKVDKSN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrkl  597
             +S A+LRQA+A+SEAELA IC+ALGE+P++ +Q  +   SLK E + I+P LEEM++ K 
Sbjct  61    QSRARLRQAIADSEAELAAICSALGERPLHTKQPDQNVGSLKEEFKKILPQLEEMRRMKC  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             ER++QF +VL+QI  V  E+  S         LDE+DLS R+LE++   L  LQ EK++R
Sbjct  121   ERRNQFLDVLEQIQRVKAEICGSLDHTPPKTRLDETDLSSRKLEELHRELYELQTEKTER  180

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             L+ V DHL ++N+LC+VL +DFK    E+H +L D    K +S  TIE+L+ AIH+LREV
Sbjct  181   LRLVQDHLFTVNALCLVLDLDFKQIASEVHASLADPEGPKDISNSTIEKLATAIHKLREV  240

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             K+QR+  LQ+LATT++ELWNLMD P EEQQ+F ++T  IAASE E+TEP  LS D++   
Sbjct  241   KLQRMQRLQDLATTMLELWNLMDTPTEEQQMFQSITSNIAASEHEITEPKMLSEDIINFV  300

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLA--IDDSIEFTDETIESGAIDPSHL  1311
               EV+RL+E K SKMKE++LKKR  LEE+CR+ HL    D  +E+  E +ESGA+D + +
Sbjct  301   AAEVARLEEFKLSKMKELVLKKRSELEEICRKTHLIPEADTGMEYAIEAVESGAVDAACI  360

Query  1312  LEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKR  1491
             LEQ+E++I+ VKEEA +RKE+LEKVEKWLAAC+EE WLE+YNR++NRYN GRG HL LKR
Sbjct  361   LEQIELRIAEVKEEALNRKELLEKVEKWLAACDEECWLEEYNRDENRYNAGRGAHLTLKR  420

Query  1492  AEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQR  1671
             AEKARALV+K+P M+E LTS+   WE ERG+ F YDG+ LLSMLE+Y +L+QE+E ER+R
Sbjct  421   AEKARALVSKLPAMVETLTSKTVAWEKERGIEFSYDGLRLLSMLEEYSILRQEREQERRR  480

Query  1672  QRDQKKLQGQLMAEQEVLFGSKRSPSQS-----GKKNVVGGASNKRISVGGAMLQTPYTE  1836
              RDQKKLQGQL+AEQE L+GSK SPS++       +   GGAS++R+S+GGA L TP  +
Sbjct  481   LRDQKKLQGQLIAEQEALYGSKPSPSKTQLVKKAPRMSTGGASSRRLSLGGATLHTPKPD  540

Query  1837  RAPLSSHSLK------------KINPVKQQALANITQN-YVALSSGRRE---SSMHAKQP  1968
               PL  HS+K            ++N V Q  L +   N   ALS+ RR    + +  K+ 
Sbjct  541   --PL--HSMKATPNARPHRKSDRVNQVDQ--LNHYKDNGQAALSASRRGLDVAGLPLKKH  594

Query  1969  SCNKSNLQKTE-PTQRKPLSPIS-SLSFNTSSANIMDKIS--ESEELREM-PASLLTTPI  2133
             S + +   + + P  RKP SP+S ++S   S  N+MD  +  + E L+++   ++ +TP+
Sbjct  595   SLDAALASEPDSPMIRKPFSPVSPAVSTKMSLTNVMDNAAARQDEPLQKIFSGNMFSTPL  654

Query  2134  KNVS-GIGGNATPKtmpipmpstpasaassiamQMGMTPA----PVAATTPMVGHDGVEY  2298
             K  +     N TPK   + +P     +  S+ MQ  MTPA    P+AA       + +EY
Sbjct  655   KTTNMNDEENRTPK--VMAIPVPTTPSTISMPMQTAMTPALVSQPLAANLVKEIAEEIEY  712

Query  2299  SYEEMRAGFLLPRLH  2343
             S+EE RAGF+LPR +
Sbjct  713   SFEERRAGFVLPRAY  727



>gb|AES75903.2| 65-kDa microtubule-associated-like protein [Medicago truncatula]
Length=710

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/722 (50%), Positives = 493/722 (68%), Gaps = 40/722 (6%)
 Frame = +1

Query  247   MYNRQNDQSL-RMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQA  423
             M+   ND  L + ETTC SLL ELQ IW+E+GE E E+D+ML +LEQECLE YRRKVD+A
Sbjct  1     MHKPHNDHPLPQAETTCGSLLQELQIIWHEVGESESEKDRMLYELEQECLEVYRRKVDKA  60

Query  424   SRSCAQLRQAVAESEAELARICAALGEQPVNVRQS---SRSLKTELQAIMPlleemkkrk  594
             + S AQLRQ +A+SEAEL  IC+ +GE+PV+ RQS   +RSLK EL  I+P LEEM+KRK
Sbjct  61    NCSRAQLRQEIADSEAELTAICSEMGERPVHSRQSGQKARSLKEELAMILPELEEMQKRK  120

Query  595   lerkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSD  774
              ER++QF EV +QI S+  E+    + +   + +DE+DLSLR+LE++   L +LQKEKSD
Sbjct  121   YERRNQFKEVQEQIHSISNEISGPSENVP--LVVDETDLSLRKLEELHRQLHTLQKEKSD  178

Query  775   RLKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELRE  954
             RLK+V D+L +L+SLC VLG+DFK T+ E+HP+LG+S   +SV+ +TI +L+ +I ELR 
Sbjct  179   RLKKVQDNLHTLSSLCSVLGLDFKQTVSEVHPSLGNSEGSRSVNNDTISQLALSIQELRG  238

Query  955   VKIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKS  1134
             VK+QR+  LQ+LAT+++ELWNLMD P+EEQQ+F NVT  IAASE E+TEPN LS + +  
Sbjct  239   VKLQRMQKLQDLATSLLELWNLMDTPIEEQQVFQNVTCNIAASEHEVTEPNTLSEEFINH  298

Query  1135  AEIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAIDDSIEFTDETIESGAIDPSHLL  1314
              E EVSRL+++KSSKMKE++ KKR  LEE+CR+ HL + +S    ++ IESG++DP+++L
Sbjct  299   VEAEVSRLEDLKSSKMKELVWKKRAELEEICRKTHL-VQESDAAIEKAIESGSVDPAYVL  357

Query  1315  EQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRA  1494
             EQ+E QIS VKEEAFSR EILE VEKWL+AC+EESWLE+Y+R++NRYN GRGTHL LKRA
Sbjct  358   EQIERQISQVKEEAFSRIEILENVEKWLSACDEESWLEEYSRDENRYNAGRGTHLNLKRA  417

Query  1495  EKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQ  1674
             EKAR LVNKIP M + LTS+A  WE ++   F+YDGV L+SMLE Y LL+QEKE ER+RQ
Sbjct  418   EKARILVNKIPAMTDKLTSKAVAWEKDKSTEFVYDGVRLVSMLEDYILLRQEKEQERRRQ  477

Query  1675  RDQKKLQGQLMAEQEVLFGSKRSPS--QSGKK---NVVGGASNKRISVGGAMLQTPYTER  1839
             RD KKLQ Q++AEQEVL+GSK SPS  QS +K      G A+N+R + GG++L+      
Sbjct  478   RDLKKLQVQMIAEQEVLYGSK-SPSKAQSARKAPRTPNGSAANRRGTFGGSVLKPDSKAT  536

Query  1840  APLSSHSLKKINPVKQQALANITQNYVALSSGRRE---SSMHAKQPSCNKSNLQKTE-PT  2007
                S+    K+N ++Q    N+       SS RR    +    ++ S     ++  E P 
Sbjct  537   QSSSTRKTDKVNQIEQ--TNNLDDAISCFSSARRGFDIADFPTRKYSFGAGIVRDIESPL  594

Query  2008  QRKPLSPISS-LSFNTSSANIMDKISESEELREMPASLLTTPIKNVSGIGG--------N  2160
              R+P + ISS +S   +  N  D+ S  ++  +   +    P+   + I          N
Sbjct  595   TRQPFTTISSTISSLENVENAADEFSMQKQNLQKTLAANNLPLTTTTTISKTDAVVDEEN  654

Query  2161  ATPKtmpipmpstpasaassiamQM--GMTPAPVAATTPMVGHD---GVEYSYEEMRAGF  2325
              TPK  PIP+ +T  +   ++++ M   MTPA         G D    +EYS+EE+R GF
Sbjct  655   RTPKENPIPVSTTTTTTPKTVSIPMNTAMTPA-------HFGGDLIQDIEYSFEEIRLGF  707

Query  2326  LL  2331
             LL
Sbjct  708   LL  709



>ref|XP_010671976.1| PREDICTED: 65-kDa microtubule-associated protein 3 [Beta vulgaris 
subsp. vulgaris]
Length=719

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/728 (50%), Positives = 491/728 (67%), Gaps = 45/728 (6%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M   QND   +++TTC SLL EL+ IW+E+GE E  RDKML +LEQECLE YRR+VD A+
Sbjct  1     MGGLQNDPLSQLKTTCGSLLYELEIIWDEVGESEAARDKMLYELEQECLEVYRRRVDVAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQS---SRSLKTELQAIMPlleemkkrkl  597
             RS A LRQA+A+SEAE A IC+A+GE PV++RQ+   +RSLK E   I+  LEEM+KRK+
Sbjct  61    RSRALLRQAIADSEAEFAAICSAMGELPVHIRQTEQKARSLKEEFNTILSQLEEMRKRKV  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             +RK+QF EV+ QI +V  E+  S         +DE+DL+LR+LE+++  L SLQKEKS R
Sbjct  121   DRKNQFLEVIGQIQNVFSEIYGSDGYDSSKAVVDENDLTLRKLEELQKELQSLQKEKSGR  180

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             LKQVL+ L  L+SLC VLG+DFK T+ E+HP+L DS    S+ST T+++L +AI  LRE+
Sbjct  181   LKQVLEDLTVLSSLCSVLGLDFKETVRELHPSLADSEGNHSISTLTLQQLESAIKRLREL  240

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             K+QR   LQ+LAT ++ELWNLMD PVEEQQ F +VT  IAAS+ E+T+PN LS D ++  
Sbjct  241   KLQRRQRLQDLATMLLELWNLMDTPVEEQQAFQHVTCNIAASDDEMTDPNMLSDDFIEYV  300

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLA--IDDSIEFTDETIESGAIDPSHL  1311
             E EVSRL+E+KSSKMKE++LKKR  L+E+CR+ HL   +D   E+  + IESGA+DP+ +
Sbjct  301   EAEVSRLEELKSSKMKELVLKKRAELDEICRKTHLVPELDGETEYLIQAIESGALDPASV  360

Query  1312  LEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKR  1491
             LEQ+E+++  VKE+AFSRK+ILEKVEKWL+A EEE WLE+YN ++NRYN G+G+HL+LKR
Sbjct  361   LEQIELEVGKVKEQAFSRKDILEKVEKWLSAREEEEWLEEYNMDENRYNAGKGSHLILKR  420

Query  1492  AEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQR  1671
             AEKAR LVNK+PGM+EAL ++ + WE ERG+ F+YDG+ LLSMLE++ +L+QEKE +++R
Sbjct  421   AEKARTLVNKLPGMVEALAAKTQTWEGERGLKFMYDGIHLLSMLEEHIILRQEKEQQKKR  480

Query  1672  QRDQKKLQGQLMAEQEVLFGSKRSPSQSGKKN---VVGGASNKRISVGGAMLQTPYTERA  1842
              R+QKKLQGQL+ EQEVLFGSK SP +S KK+     GG +++R+SVGG  +QT      
Sbjct  481   HREQKKLQGQLIKEQEVLFGSKPSPMKSAKKSSRMSTGGGNSRRVSVGGNTVQTAR----  536

Query  1843  PLSSHSLKKI---NPVKQQALANITQNYVALSSGRRESSMHAKQPSCNKSNLQKTE-PTQ  2010
             P SS S +      P K+             ++G  +S++          N ++TE    
Sbjct  537   PDSSQSARGTPSSRPSKKDD-----------NTGTPQSTVRRVLDKNFTFNGRETESAVV  585

Query  2011  RKPLSPISSLSFNTSSANIMD--KISESEELREMPAS-------LLTTPIKNVSGIG-GN  2160
             R+P SPISS +   +  +  D   I+E+  + +   S       +  TP K +   G  N
Sbjct  586   RRPFSPISSTASTRAHEDFCDDENIAENNTMHQQIVSKNDTSQQIYNTPSKIIPSAGEEN  645

Query  2161  ATPKtmpipmpstpasaassiamQMGMTPAPV-------AATTPMVGHDGVEYSYEEMRA  2319
              TPK +      T   +  S  M   MTPAP+       A     V  + VEYS+EE RA
Sbjct  646   CTPK-VMHISAPTTTPSTVSAPMHTSMTPAPLRQPDFHEADNFVEVIDEEVEYSFEERRA  704

Query  2320  GFLLPRLH  2343
             GF+LP  H
Sbjct  705   GFVLPNTH  712



>ref|XP_010661645.1| PREDICTED: 65-kDa microtubule-associated protein 3 isoform X2 
[Vitis vinifera]
Length=722

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/732 (54%), Positives = 513/732 (70%), Gaps = 46/732 (6%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M N  +D+  ++ETTC SLL +LQ IW+E+GEP IERD+ML +LEQECLEAY+RKV  A 
Sbjct  1     MNNHHSDRLQQIETTCASLLKDLQSIWDEVGEPNIERDEMLLELEQECLEAYKRKVSHAK  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSRS-LKTELQAIMPlleemkkrkler  603
             +S AQLRQA+A+SEAELA IC+A+GE PVNVRQ++   LK EL+ I+  LEEM+K K ER
Sbjct  61    KSRAQLRQAIADSEAELADICSAMGEGPVNVRQNAGGGLKEELKTIVSTLEEMRKLKCER  120

Query  604   kHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLK  783
             K QF EVLDQ+ ++ KEL K R++    I +DE+DLSL+RL ++   LL LQ EKS+R+K
Sbjct  121   KKQFVEVLDQLLNISKELCKPREDNLCKIVMDETDLSLKRLHELHRLLLELQDEKSNRVK  180

Query  784   QVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKI  963
             QVL HL++L+SLC VLG+DFK+T+ EIHP++ DS  LK++S++TI++L+A I  LREVK 
Sbjct  181   QVLAHLKTLDSLCKVLGLDFKHTVVEIHPSMDDSIGLKNLSSDTIDKLAATILSLREVKT  240

Query  964   QRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEI  1143
             QR+H L++LA +++ELW+LMD P++EQQ+F NVT  IAASE E+TEPN LSLD +   E 
Sbjct  241   QRMHKLRDLAASMLELWSLMDTPIKEQQMFQNVTSNIAASEHEITEPNTLSLDFINYVEA  300

Query  1144  EVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAIDD--SIEFTDETIESGAIDPSHLLE  1317
             EVSRL+++KSSKMKE++LKKR  LEE+C + H+  +    IE + E IESGA++P++LLE
Sbjct  301   EVSRLEQLKSSKMKELILKKRTELEEICSRIHVVSEAYIPIEHSIEAIESGAMEPTYLLE  360

Query  1318  QLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAE  1497
             Q+E+QI+ VKEEAFSRKEIL+KV KWLAAC+EE WLE+YNR+ NRYN GRG H+ LKRAE
Sbjct  361   QVELQIAKVKEEAFSRKEILDKVVKWLAACDEECWLEEYNRDGNRYNAGRGAHVHLKRAE  420

Query  1498  KARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQR  1677
             KARALV+KIP M EALT +AK WE ERG+ FLYDGV LLSML+QY  L+QEKE ERQRQR
Sbjct  421   KARALVSKIPAMTEALTLKAKAWEEERGIEFLYDGVQLLSMLDQYNFLRQEKEQERQRQR  480

Query  1678  DQKKLQGQLMAEQEVLFGSKRSPSQSGKK---NVVGGASNKRISVGGAMLQTPYTERAPL  1848
             +QK+LQGQL+AEQE LFGSK SPS+SGKK       GA+N+R S GG MLQ P  E+A L
Sbjct  481   EQKRLQGQLIAEQEALFGSKPSPSKSGKKLSRISTIGAANRRFSHGGMMLQAPNPEKAAL  540

Query  1849  SSHSLKKINPVKQQ-ALANITQNYVA-LSSGRRESSMH---AKQPSCNKSNLQKTEPTQ-  2010
              S   KK   VKQ  +L +   N  A LSSGR +  +     K+     +N  + E +  
Sbjct  541   HSCPTKKDGCVKQNNSLKHQQYNGSAVLSSGRTKLGIAFKPVKKHFTKDTNACEIESSVI  600

Query  2011  RKPLSPISSLSFNTSSANIMDKISESEE----------LREMPASLLTTPIKNVSGIGG-  2157
             RKPLSPIS        A + DKIS  +E           R +P S   TP  + S +   
Sbjct  601   RKPLSPISP-------AVVSDKISSIQEGQDRTPKRTLQRTIPPS--KTPTASPSKLISI  651

Query  2158  ----NATPKtmpipmpstpasaassiamQMGMTPAPVAATTPMVGHDG------VEYSYE  2307
                 N TPK +PIP+P+TP + +      M     P     P V +        +EYS+E
Sbjct  652   DDLENKTPKNIPIPLPTTPPTVSLP----MQTASTPGTPCIPFVANQAEGRVKVIEYSFE  707

Query  2308  EMRAGFLLPRLH  2343
             E RA F+LP  +
Sbjct  708   ERRAAFMLPEAY  719



>ref|XP_003569581.1| PREDICTED: 65-kDa microtubule-associated protein 3 [Brachypodium 
distachyon]
Length=688

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/709 (51%), Positives = 480/709 (68%), Gaps = 65/709 (9%)
 Frame = +1

Query  292   CCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAESEA  471
             C  LL EL+ IW+E+GEP+  RDK L +LEQECL+ YRRKVDQA+R  AQLRQ++AE+EA
Sbjct  12    CDKLLLELKVIWDEVGEPDTARDKTLLELEQECLDVYRRKVDQANRCRAQLRQSIAEAEA  71

Query  472   ELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrklerkHQFSEVLDQIDS  642
             ELA IC+A+GE PV+VRQS++    L+ EL AI+P LEEMK +K+ER +QF  V+++I  
Sbjct  72    ELAGICSAIGEPPVHVRQSNQKLHGLREELNAIVPYLEEMKTKKVERWNQFVHVIEEIKK  131

Query  643   VLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESLNSLC  822
             +  E+  S   L     +D+SDLSLR+LE++   L SLQKEKSDR+KQV++HL +L+SLC
Sbjct  132   ISSEIRPS-DFLPFKKPVDQSDLSLRKLEELTKELESLQKEKSDRVKQVMEHLNTLHSLC  190

Query  823   IVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQRLHMLQNLATTI  1002
              VLGIDFK TI E+HP+L ++   K++S  TI+RL++A++ LRE+KIQR+  LQ+ A+T+
Sbjct  191   EVLGIDFKQTIHEVHPSLDEADGSKNLSNTTIDRLASAVNRLREMKIQRMQKLQDFASTM  250

Query  1003  VELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQEMKSSKM  1182
             +ELWNLMD P+EEQQ+F NVT  IAASE E+TEPN LS+D L   E EV RL+++K SKM
Sbjct  251   LELWNLMDTPIEEQQMFQNVTCNIAASEHEITEPNILSIDFLGYVESEVIRLEQLKGSKM  310

Query  1183  KEVLLKKRITLEELCRQAHLAIDD--SIEFTDETIESGAIDPSHLLEQLEIQISNVKEEA  1356
             K+++LKK+  LEE  R+AHL  ++  S EF  E IESGAIDP+ +LEQ+E  I+ VK+EA
Sbjct  311   KDLVLKKKSELEEHRRRAHLIGEEGYSDEFNIEAIESGAIDPALVLEQIEAHIATVKDEA  370

Query  1357  FSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVNKIPGML  1536
             FSRK+ILEKVE++L ACEEE+WLEDYN++DNRYN GRG HL LKRAEKAR LVNKIPGM+
Sbjct  371   FSRKDILEKVERFLNACEEEAWLEDYNKDDNRYNAGRGAHLTLKRAEKARILVNKIPGMV  430

Query  1537  EALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQGQLMAEQ  1716
             + L+S+   WE ERG  F YDGV L+SML++Y +++QEKE E++RQRDQKK+Q QL AEQ
Sbjct  431   DVLSSKIIAWENERGKEFTYDGVRLISMLDEYMIVRQEKEQEKKRQRDQKKVQDQLKAEQ  490

Query  1717  EVLFGSKRSPS--QSGKK---NVVGGASNKRISVGGAMLQTPYTERAPLSSHSLKKINPV  1881
             E L+GSK SPS  QS KK   N +GGA N+R+SVGGA  Q P T+   L S +++     
Sbjct  491   EALYGSKPSPSKPQSTKKAPRNSIGGA-NRRLSVGGAPFQVPKTD--ILHSKTVRA----  543

Query  1882  KQQALANITQNYVALSSGRRE---SSMHAKQPSCNKSNLQKTEPTQRKPLSPISSLSFNT  2052
                  A  T++   LS G R    + +  K+ S N S L++TE T RKP + I       
Sbjct  544   -----AKRTEDIATLSPGSRGIDIADLPIKKLSFNASALRETE-TPRKPFAQI-------  590

Query  2053  SSANIMDKISESEELREMPASLL-TTPIKNVSGI--GGNATPKtmpipmpstpasaassi  2223
                              MPAS + +TP++ ++      N TP        +       + 
Sbjct  591   -----------------MPASSVPSTPVRPITNDMEDENRTPNPKTFGALNPKTPMTVAA  633

Query  2224  amQMGMTPA---PVAATTPMVGHDG--------VEYSYEEMRAGFLLPR  2337
              MQ+ MTPA    VAAT   + ++         +EYS+EE R    L R
Sbjct  634   PMQLAMTPAVGNKVAATPVSLVYEKPELALPEEIEYSFEERRLAAYLAR  682



>ref|XP_010924160.1| PREDICTED: 65-kDa microtubule-associated protein 3-like [Elaeis 
guineensis]
Length=690

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/712 (51%), Positives = 476/712 (67%), Gaps = 47/712 (7%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M N  +DQ LRMET C SLL ELQ +W+E+GE + ERDK+L +LEQECLEAYRRKVDQA+
Sbjct  1     MTNLLSDQLLRMETACESLLYELQIVWDEVGESDAERDKLLLELEQECLEAYRRKVDQAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrkl  597
             R  AQLRQA+A++EAELA IC+ +GE+PV++R+S++   SLK EL+ I+P LEEM+KRK 
Sbjct  61    RCRAQLRQAIADAEAELAAICSIMGERPVHIRESNQKAGSLKEELKDIIPQLEEMRKRKN  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             +R +QF EVL+QI  +L E+  +      M A+ ESDLS RRLE++   L SLQKEK++R
Sbjct  121   DRWNQFLEVLEQIQKILMEIRLAEYTPSKM-AVYESDLSTRRLEELHRQLHSLQKEKTER  179

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             LKQ++D L +LNSLC+VLGIDFK T+ E+HP+  ++   K++S ++IE L+ AI  LREV
Sbjct  180   LKQLMDLLNTLNSLCLVLGIDFKQTVHEVHPSFVETEGSKNISNDSIEGLANAIQRLREV  239

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             KIQR+  LQ+LATT++ELWNLMD P EEQQLF NVT  IAASE E+ EPN LS D +   
Sbjct  240   KIQRMQKLQDLATTMLELWNLMDTPAEEQQLFQNVTCNIAASEHEIMEPNMLSTDFINCV  299

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAI--DDSIEFTDETIESGAIDPSHL  1311
             E EV RL+++K+SKMKE++LKK+  +EEL R+ HL    +   EF  + IE+GAIDPS +
Sbjct  300   EAEVLRLEQLKASKMKELVLKKKTEVEELRRRTHLVTEANSETEFATDAIEAGAIDPSLV  359

Query  1312  LEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKR  1491
             LEQ+E+QIS VKEEAFSRK++LEK+EKWLAAC EESWLE+YNR++NRY+  RG HL LK 
Sbjct  360   LEQIEVQISTVKEEAFSRKDVLEKIEKWLAACNEESWLEEYNRDENRYSAVRGAHLTLKH  419

Query  1492  AEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQR  1671
             AEKARALVNKIP M++AL ++   WE +RG+ F YDGV LLSMLE+Y +++QEKE ER+R
Sbjct  420   AEKARALVNKIPAMVDALAAKIAAWEKDRGIEFAYDGVRLLSMLEEYTIVRQEKEKERKR  479

Query  1672  QRDQKKLQGQLMAEQEVLFGSKRSPS--QSGKK--NVVGGASNKRISVGGAMLQTPYTER  1839
              RDQK+ QGQL+AEQE LFGSK SPS  QS KK      G S++R+S+GGA++  P  E 
Sbjct  480   NRDQKRRQGQLIAEQEALFGSKPSPSKPQSAKKVPRTSTGGSSRRLSLGGAIMHPPKPEL  539

Query  1840  APLSSHSLKKINPVKQQALANITQNYVALSSGRRE---SSMHAKQPSCNKSNLQKTEPTQ  2010
               L S S +                   LS G R    + + AK+ S N  N        
Sbjct  540   --LHSKSTR-------------GDEMGVLSPGTRGLDIAGLPAKKLSFNTLNAPSEVEIP  584

Query  2011  RKP---LSPISSLSFNTSSANIMDKISESEELREMPASLLTTPIKNVSGIGGNATPKtmp  2181
             RKP   L P++S+    S +NIM            P  LLT      + +  N TP    
Sbjct  585   RKPFALLVPVNSIPSTQSQSNIM----------LTPRILLTPSQPRNNDVEENRTP--GT  632

Query  2182  ipmpstpasaassiamQMGMTPAPVA----ATTPMVGHDGVEYSYEEMRAGF  2325
             +P+ +     A    MQM  TPAP      A       + +EYS+EE R   
Sbjct  633   MPISTPQIPMAVYAPMQMAKTPAPTCIVYEAAVTKAPLEAIEYSFEERRFAL  684



>ref|XP_002273473.2| PREDICTED: 65-kDa microtubule-associated protein 3 isoform X1 
[Vitis vinifera]
 ref|XP_010661644.1| PREDICTED: 65-kDa microtubule-associated protein 3 isoform X1 
[Vitis vinifera]
Length=725

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/735 (54%), Positives = 512/735 (70%), Gaps = 49/735 (7%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M N  +D+  ++ETTC SLL +LQ IW+E+GEP IERD+ML +LEQECLEAY+RKV  A 
Sbjct  1     MNNHHSDRLQQIETTCASLLKDLQSIWDEVGEPNIERDEMLLELEQECLEAYKRKVSHAK  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQ----SSRSLKTELQAIMPlleemkkrk  594
             +S AQLRQA+A+SEAELA IC+A+GE PVNVRQ    +   LK EL+ I+  LEEM+K K
Sbjct  61    KSRAQLRQAIADSEAELADICSAMGEGPVNVRQFDQNAGGGLKEELKTIVSTLEEMRKLK  120

Query  595   lerkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSD  774
              ERK QF EVLDQ+ ++ KEL K R++    I +DE+DLSL+RL ++   LL LQ EKS+
Sbjct  121   CERKKQFVEVLDQLLNISKELCKPREDNLCKIVMDETDLSLKRLHELHRLLLELQDEKSN  180

Query  775   RLKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELRE  954
             R+KQVL HL++L+SLC VLG+DFK+T+ EIHP++ DS  LK++S++TI++L+A I  LRE
Sbjct  181   RVKQVLAHLKTLDSLCKVLGLDFKHTVVEIHPSMDDSIGLKNLSSDTIDKLAATILSLRE  240

Query  955   VKIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKS  1134
             VK QR+H L++LA +++ELW+LMD P++EQQ+F NVT  IAASE E+TEPN LSLD +  
Sbjct  241   VKTQRMHKLRDLAASMLELWSLMDTPIKEQQMFQNVTSNIAASEHEITEPNTLSLDFINY  300

Query  1135  AEIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAIDD--SIEFTDETIESGAIDPSH  1308
              E EVSRL+++KSSKMKE++LKKR  LEE+C + H+  +    IE + E IESGA++P++
Sbjct  301   VEAEVSRLEQLKSSKMKELILKKRTELEEICSRIHVVSEAYIPIEHSIEAIESGAMEPTY  360

Query  1309  LLEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLK  1488
             LLEQ+E+QI+ VKEEAFSRKEIL+KV KWLAAC+EE WLE+YNR+ NRYN GRG H+ LK
Sbjct  361   LLEQVELQIAKVKEEAFSRKEILDKVVKWLAACDEECWLEEYNRDGNRYNAGRGAHVHLK  420

Query  1489  RAEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQ  1668
             RAEKARALV+KIP M EALT +AK WE ERG+ FLYDGV LLSML+QY  L+QEKE ERQ
Sbjct  421   RAEKARALVSKIPAMTEALTLKAKAWEEERGIEFLYDGVQLLSMLDQYNFLRQEKEQERQ  480

Query  1669  RQRDQKKLQGQLMAEQEVLFGSKRSPSQSGKK---NVVGGASNKRISVGGAMLQTPYTER  1839
             RQR+QK+LQGQL+AEQE LFGSK SPS+SGKK       GA+N+R S GG MLQ P  E+
Sbjct  481   RQREQKRLQGQLIAEQEALFGSKPSPSKSGKKLSRISTIGAANRRFSHGGMMLQAPNPEK  540

Query  1840  APLSSHSLKKINPVKQQ-ALANITQNYVA-LSSGRRESSMH---AKQPSCNKSNLQKTEP  2004
             A L S   KK   VKQ  +L +   N  A LSSGR +  +     K+     +N  + E 
Sbjct  541   AALHSCPTKKDGCVKQNNSLKHQQYNGSAVLSSGRTKLGIAFKPVKKHFTKDTNACEIES  600

Query  2005  TQ-RKPLSPISSLSFNTSSANIMDKISESEE----------LREMPASLLTTPIKNVSGI  2151
             +  RKPLSPIS        A + DKIS  +E           R +P S   TP  + S +
Sbjct  601   SVIRKPLSPISP-------AVVSDKISSIQEGQDRTPKRTLQRTIPPS--KTPTASPSKL  651

Query  2152  GG-----NATPKtmpipmpstpasaassiamQMGMTPAPVAATTPMVGHDG------VEY  2298
                    N TPK +PIP+P+TP + +      M     P     P V +        +EY
Sbjct  652   ISIDDLENKTPKNIPIPLPTTPPTVSLP----MQTASTPGTPCIPFVANQAEGRVKVIEY  707

Query  2299  SYEEMRAGFLLPRLH  2343
             S+EE RA F+LP  +
Sbjct  708   SFEERRAAFMLPEAY  722



>gb|KDP28747.1| hypothetical protein JCGZ_14518 [Jatropha curcas]
Length=706

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/709 (50%), Positives = 489/709 (69%), Gaps = 27/709 (4%)
 Frame = +1

Query  262   NDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQ  441
             ND+S  +ETTC  LL ELQKIW+E+GE + +RDKML ++E+ECLE YRRKV +A++S ++
Sbjct  6     NDRSANIETTCGLLLLELQKIWDEVGENDAQRDKMLFEIEEECLEVYRRKVFEANKSRSE  65

Query  442   LRQAVAESEAELARICAALGEQPVNV-RQSSRSLKTELQAIMPlleemkkrklerkHQFS  618
             L+  +A +EAE+  IC+ L E+PV    +++++L  ++Q I PLLEEM+KRK ERK QF+
Sbjct  66    LQGEIALAEAEIENICSELSEKPVRYEHKANKNLNEKIQIINPLLEEMRKRKAERKKQFA  125

Query  619   EVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDH  798
             EVLD + ++ K++  S K+  + +++D +DLSL+RLE++++ L  LQ EKS+RL+Q+L  
Sbjct  126   EVLDALKNISKDIFGSAKDNLYEMSMDGADLSLKRLEELQNQLRDLQIEKSNRLRQLLGL  185

Query  799   LESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQRLHM  978
             L++LNSLC VLG+DFK  + EIHPTL DS   K ++  TIE L+AAI  LR+VKI+R+  
Sbjct  186   LDTLNSLCEVLGMDFKYILHEIHPTLDDSKESKDITDYTIEGLTAAIQSLRDVKIERMRR  245

Query  979   LQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRL  1158
             LQ L T ++ELWNLMD P+EEQQ+F +VT ++ A E  +TEPN LS+DL+   E EV RL
Sbjct  246   LQGLGTVLLELWNLMDTPIEEQQVFQDVTSSVFALEPAITEPNMLSMDLINHVEDEVVRL  305

Query  1159  QEMKSSKMKEVLLKKRITLEELCRQAHLA--IDDSIEFTDETIESGAIDPSHLLEQLEIQ  1332
              ++KSSK+KE++LKKR+ LEE+CR AH+   +  + E+++E      +DP HLLE++E++
Sbjct  306   NQLKSSKVKELVLKKRLELEEICRNAHMVAQVFSATEYSNE----AGVDPVHLLEEMELE  361

Query  1333  ISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARAL  1512
             I  VKEEA SRKEIL+KVEKWL ACEEESWLE+YNR++NRYN GRG HL L+RAEKARA 
Sbjct  362   IVKVKEEASSRKEILDKVEKWLTACEEESWLEEYNRDNNRYNAGRGAHLTLQRAEKARAA  421

Query  1513  VNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKL  1692
             VNKIP ++EALTS+ K WE  RG+ FLYDG  LLS LEQY  L++EKE ER RQRDQKKL
Sbjct  422   VNKIPALMEALTSKIKAWEKGRGIQFLYDGERLLSRLEQYSNLRKEKERERIRQRDQKKL  481

Query  1693  QGQLMAEQEVLFGSKRSPSQSGKK---NVVGGASNKRISVGGAMLQTPYTERAPLSSHSL  1863
             Q QL+ EQE LFG+K SPS SG+K     V  ASN+++S+GGAMLQ    E+     H+ 
Sbjct  482   QDQLIVEQEALFGAKPSPSNSGRKVSRTSVEFASNRKLSLGGAMLQNLKAEKTSACVHAN  541

Query  1864  KKINPVKQQALANITQNYVALSSGRRESSM--HAKQPSCNKSNLQKTEPTQRKPLSPISS  2037
             KK+N + Q    +  QN     SGRR S +  H  +   +    Q      RKPLSPI  
Sbjct  542   KKVNCLNQNNYLSYQQNG---GSGRRNSEIAGHLVKKDSSAKPRQTDSRLIRKPLSPI-P  597

Query  2038  LSFNTSSANIMDKISESEELR----EMPASLLTTPI----KNVSGIG-GNATPKtmpipm  2190
             L+  +S ANI + + E + L+    E  A  + TPI    K VSG+G  N TPKT+P  +
Sbjct  598   LTM-SSQANIANFLEEQKGLQDGTSETAAPCIKTPIRTPTKPVSGVGEENRTPKTLPTIV  656

Query  2191  pstpasaassiamQMGMTP-APVAATTPMVGHDGVEYSYEEMRAGFLLP  2334
             P+TP + ++ + M    TP    +  T     + +EYS+EE+R G   P
Sbjct  657   PTTPTTTSAPMLMSTPSTPYVSSSVKTARSVAERIEYSFEELRVGLTCP  705



>ref|XP_008675177.1| PREDICTED: 65-kDa microtubule-associated protein 3-like [Zea 
mays]
 tpg|DAA58077.1| TPA: hypothetical protein ZEAMMB73_690019 [Zea mays]
Length=706

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/707 (50%), Positives = 484/707 (68%), Gaps = 44/707 (6%)
 Frame = +1

Query  265   DQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQL  444
             DQ  +M TT  SLL EL  IW+E+GEP++ RD+ML +LEQE L+ YRRKVDQA+R  AQL
Sbjct  7     DQLQQMSTTYDSLLLELNMIWDEVGEPDMARDRMLLELEQEWLDVYRRKVDQANRCRAQL  66

Query  445   RQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrklerkHQF  615
             RQA+A++EAELA IC+A+ E P++VRQS++    L+ EL AI+P LEEM+K+K+ER  QF
Sbjct  67    RQAIADAEAELAGICSAMSEPPIHVRQSNQKLHGLREELNAIVPYLEEMRKKKVERWDQF  126

Query  616   SEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLD  795
              +V++QI  V  E+  S   +  +I +D+SDLSLR+L+++   L SLQKEKSDRLKQV++
Sbjct  127   VDVIEQIKKVASEIRPS-DFVPFIIPVDQSDLSLRKLDELTKELQSLQKEKSDRLKQVME  185

Query  796   HLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQRLH  975
             HL +L+ LC VLG+DFK T+ E+HP+LG++   K++S  TIERL++A++ LRE+K+QR+ 
Sbjct  186   HLSTLHLLCEVLGVDFKQTVYEVHPSLGEADGSKNLSNSTIERLASAVNRLRELKVQRMQ  245

Query  976   MLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSR  1155
              LQ+LA++++ELWNLMD P+EEQQ+F N+T  IAASE E+T PN LS D L   E EV R
Sbjct  246   KLQDLASSMLELWNLMDTPLEEQQMFQNLTCNIAASEHEITGPNTLSTDFLSYVESEVLR  305

Query  1156  LQEMKSSKMKEVLLKKRITLEELCRQAHLAIDD--SIEFTDETIESGAIDPSHLLEQLEI  1329
             L+++K+SKMK+++LKK+  LE+  R+AHL  ++  + EF+DE IE+GA+DP+ +LEQ+E 
Sbjct  306   LEQLKASKMKDLVLKKKTELEDHRRRAHLIGEEGYAAEFSDEAIEAGAVDPALVLEQIEA  365

Query  1330  QISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARA  1509
              I+ VKEEAFSRK+ILEKVE+WL ACEEE+WLEDYN++DNRYN GRG HL LKRAEKAR 
Sbjct  366   HIATVKEEAFSRKDILEKVERWLNACEEEAWLEDYNKDDNRYNAGRGAHLTLKRAEKARI  425

Query  1510  LVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKK  1689
             LVNKIPG+++ LT++   WE ERG  F YDGV L SMLE Y +++QEKELE++RQRDQKK
Sbjct  426   LVNKIPGLVDVLTTKIVAWETERGKEFTYDGVRLRSMLEDYIIIRQEKELEKKRQRDQKK  485

Query  1690  LQGQLMAEQEVLFGSKRSPS--QSGKK---NVVGGASNKRISVGGAMLQTPYTERAPLSS  1854
             +Q QL AEQE L+GSK SPS  QS KK     +GGA N+R+S+GGA  Q P T+      
Sbjct  486   IQDQLKAEQEALYGSKPSPSKTQSTKKVPRQSMGGA-NRRLSLGGATTQAPKTD------  538

Query  1855  HSLKKINPVKQQALANITQNYVALSSGRRE---SSMHAKQPSCNKSNLQKTEPTQRKPLS  2025
                  I   K    A   ++  ALS   R    + +  K+ S N S L++ E T RKP +
Sbjct  539   -----IMHSKTARAAKKAEDLGALSPSSRGLDIAGLPIKKLSFNASTLREAE-TPRKPFA  592

Query  2026  PISSLSFNTSSANIMDKISESEELREMPASLLTTPIKNVSGIGGNATPKtmpipmpstpa  2205
              I     N SS       +++EE  + P        K  +G+     PKT          
Sbjct  593   QIMP-GNNVSSMPARPISNDTEEENKTP--------KTFAGLN----PKTPVTVTAPMQL  639

Query  2206  saassiamQMGMTPAPV---AATTPMVGHDGVEYSYEEMRAGFLLPR  2337
             +   ++A ++  TPA +    A +P +  D +EYS+EE R    L R
Sbjct  640   AVTPAVANKVIATPATLFQEKAESPALPGD-IEYSFEERRLAVYLAR  685



>ref|XP_008376464.1| PREDICTED: 65-kDa microtubule-associated protein 3 isoform X2 
[Malus domestica]
Length=679

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/585 (59%), Positives = 443/585 (76%), Gaps = 29/585 (5%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M N Q++Q L+METTC SLL ELQ IWNE+GE + +RDKML +LEQECLE YRRKVDQA+
Sbjct  1     MSNLQSEQLLQMETTCGSLLYELQIIWNEVGETDKDRDKMLLELEQECLEVYRRKVDQAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSRS---LKTELQAIMPlleemkkrkl  597
             R  AQLRQA+A+SEAELA IC+A+GE+PV++RQS +S   LK EL  I+P LEEMKKRK 
Sbjct  61    RCRAQLRQAIADSEAELAAICSAMGERPVHIRQSDQSAGSLKEELSKIIPQLEEMKKRKC  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             +RK+ F EVL++I  +  E+  S         +DE+DLSLRRLE++  HL +LQ EKSDR
Sbjct  121   DRKNNFLEVLEEIRKISSEINGSTDYSSSKPGVDETDLSLRRLEELHRHLHALQTEKSDR  180

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             LKQ+ DHL +LNS C VLG+D+K TI E+HP+L DS   K++S +TI+RL AAI +LREV
Sbjct  181   LKQIQDHLCTLNSFCSVLGMDYKQTISEVHPSLVDSEGSKNISNDTIQRLLAAIQKLREV  240

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             K+QR+  LQ+LATT++ELWNLMD P+EEQQ+F N+T  IAASE E+TEPN LS+D +   
Sbjct  241   KLQRMQKLQDLATTMLELWNLMDTPIEEQQMFQNITCNIAASEHEITEPNTLSVDFINYV  300

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAI--DDSIEFTDETIESGAIDPSHL  1311
             E EVSRL+E+KSSKMKE++LKKR  LEE+CR+ H+ +  D +I++  E IESG +DP+ +
Sbjct  301   EAEVSRLEELKSSKMKELVLKKRSELEEICRKTHMVLEADSAIDYIIEAIESGDVDPACV  360

Query  1312  LEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKR  1491
             L+Q+E+Q+S VKEEAFSRK+ILEKVEKWL AC+EE WLE+YNR++NRYN GRG HL LKR
Sbjct  361   LDQIELQVSKVKEEAFSRKDILEKVEKWLFACDEECWLEEYNRDENRYNAGRGAHLTLKR  420

Query  1492  AEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQR  1671
             AEKARALVNK+P M++AL S+   WE ERG+ F YDG+ LLSMLE+Y +L++EKE ER+R
Sbjct  421   AEKARALVNKLPAMVDALASKTISWEKERGIEFTYDGIRLLSMLEEYTILREEKEQERRR  480

Query  1672  QRDQKKLQGQLMAEQEVLFGSKRSPS-----QSGKKNVVGGASNKRISVGGAMLQTPYTE  1836
             QRDQKK+QGQL+AEQE L+GSK SPS     + G +   GGASN+R+S     +Q P  +
Sbjct  481   QRDQKKIQGQLIAEQEALYGSKPSPSKPQSVKKGPRMSTGGASNRRLS-----MQAPKPD  535

Query  1837  RAPLSSHSLK--------KINPVKQQALAN--ITQNYVALSSGRR  1941
               PL  HS+K        K + V Q    N  +  ++ +LS+GRR
Sbjct  536   --PL--HSVKGTPRPRSRKGDRVHQNEQLNNQLDDSFSSLSTGRR  576



>ref|XP_004148126.1| PREDICTED: 65-kDa microtubule-associated protein 3-like [Cucumis 
sativus]
 ref|XP_004160877.1| PREDICTED: 65-kDa microtubule-associated protein 3-like [Cucumis 
sativus]
Length=730

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/723 (51%), Positives = 500/723 (69%), Gaps = 32/723 (4%)
 Frame = +1

Query  259   QNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCA  438
             QND  L++ETTC SLL ELQ IW+E+GE E ERD+ML +LEQECLE YRRKVDQA+ S A
Sbjct  5     QNDPLLQVETTCGSLLYELQIIWDEVGEGEAERDRMLLELEQECLEVYRRKVDQANHSRA  64

Query  439   QLRQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrklerkH  609
              LRQA+A+SEA+LA IC+A+GE+PV +RQS +   SLK EL+ I PLL+EM+K K ER +
Sbjct  65    HLRQAIADSEAQLAAICSAMGERPVQIRQSDQKAVSLKDELKQIHPLLDEMRKMKSERSN  124

Query  610   QFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQV  789
             QF EVL +I  V  EL          IALDE+DLSL++L+++   L +LQ+EKSDR+K V
Sbjct  125   QFLEVLQEIQKVSDELNGCEHSASK-IALDETDLSLKKLDELTRQLHALQQEKSDRMKLV  183

Query  790   LDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQR  969
              +H+ +L+SLC+VLG+D K    E+HP+LGD     +++  TI++L+A I +LR++K+QR
Sbjct  184   HNHMRTLDSLCLVLGMDSKQIAIEVHPSLGDFEGPTNITIHTIKQLAAMIEKLRDIKLQR  243

Query  970   LHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEV  1149
             +  LQ+LA+T+ +LW LMD P EEQQ+F N+T  +AASE E+ EPNAL+ D++   E EV
Sbjct  244   MQKLQDLASTMFDLWELMDTPDEEQQMFQNITCNVAASEHEIIEPNALATDVIIYVEAEV  303

Query  1150  SRLQEMKSSKMKEVLLKKRITLEELCRQAHL--AIDDSIEFTDETIESGAIDPSHLLEQL  1323
             SRL+E+KSS+MKE++LKKR+ LEE+CRQ H+  A D +IE+  + I+ G++DP+ +LEQ+
Sbjct  304   SRLEELKSSRMKELVLKKRLELEEMCRQLHVVPAEDSAIEYVIDAIDCGSLDPACVLEQI  363

Query  1324  EIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKA  1503
             + QI  +KEEAF RKEILEKVE+WL ACEEE WLE+YNR++NRYN GRG HL LKRAEKA
Sbjct  364   DSQIHKLKEEAFDRKEILEKVERWLGACEEECWLEEYNRDENRYNAGRGAHLTLKRAEKA  423

Query  1504  RALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQ  1683
             RALVNK+PGM+ ALTS+   WE ERG+ F YDGV LLSMLE+Y +L+QEKE E++RQRDQ
Sbjct  424   RALVNKLPGMVSALTSKTMSWEKERGIEFTYDGVRLLSMLEEYTILRQEKEQEQRRQRDQ  483

Query  1684  KKLQGQLMAEQEVLFGSKRSPS--QSGKKN---------VVGGASNKRISVGGAMLQTPY  1830
             KKLQGQL+AEQE L+GSK SPS  QS KK           V G  ++R S+GGA+LQTP 
Sbjct  484   KKLQGQLIAEQEALYGSKPSPSKPQSVKKGPRMSTGGAGAVAGTGSRRFSLGGALLQTPK  543

Query  1831  TERAPLSSHSLKKINPVKQQALANITQNYV-ALSSGRR--ESSMHAKQPSCNKSNLQKTE  2001
              +   L             QA  ++ + +V ALS+G+R  +  +  K+ S   +  +   
Sbjct  544   PDHKGLRPGRKSDRGHQNNQAF-HLDEGFVEALSAGKRGLDGLLPVKKHSLGANAGEGES  602

Query  2002  P-TQRKPLSPISSLS--FNTSSANIMDKISESEELREMPASLLTTPIKNVSGIGGNATPK  2172
             P   RKP +PI + +  F+ S+ +       +E+L+++  S   TPIK  S      TPK
Sbjct  603   PMVVRKPFAPIPTPTALFSNSANSSNSLNDLNEKLQKLNMSSSKTPIKTTSISEEVITPK  662

Query  2173  tmpipmpstpasaassiamQMGMTPA---PVAATTPMVGH--DGVEYSYEEMRAGFLLPR  2337
                IP+P     +  S+ MQ  MTPA   PV  T  +     + VEYS+EE RAGF+LP+
Sbjct  663   --IIPIPLPSTPSTVSVPMQTAMTPALPHPVDLTARISEDISEVVEYSFEERRAGFVLPK  720

Query  2338  -LH  2343
              LH
Sbjct  721   ALH  723



>ref|XP_004514978.1| PREDICTED: 65-kDa microtubule-associated protein 3-like isoform 
X1 [Cicer arietinum]
 ref|XP_004514979.1| PREDICTED: 65-kDa microtubule-associated protein 3-like isoform 
X2 [Cicer arietinum]
Length=695

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/711 (50%), Positives = 481/711 (68%), Gaps = 33/711 (5%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M    ND     ETTC  LL ELQ IWNE+GE + ++D+++ +++QECLE YRRKVD A+
Sbjct  1     MSKPHNDPLPPTETTCGLLLQELQIIWNEVGESDTDKDRIMFEIDQECLEVYRRKVDTAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQS---SRSLKTELQAIMPlleemkkrkl  597
             RS AQLRQ +++SEAEL  IC+A+GE+P + RQS   +RSLK EL  I+P LEEM+KRK 
Sbjct  61    RSRAQLRQEISDSEAELTIICSAMGERPAHSRQSDEKARSLKEELAMILPELEEMQKRKY  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             ER+ QF +V +QI S+  E+    + +  ++  DE+DLSLR+LE++   L +LQKEKSDR
Sbjct  121   ERRKQFIDVQEQIQSISNEIYGPGENVSFIV--DETDLSLRKLEELHRQLHTLQKEKSDR  178

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             LK+V DHL SL+SLC VLG+DFK T+ EIHP+LG+S   KSV+ +TI +L+ AI ELR+V
Sbjct  179   LKKVQDHLYSLSSLCSVLGLDFKPTVSEIHPSLGNSEGPKSVNNDTIGQLALAIQELRDV  238

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             K+QR+  LQ+LATT++ELWNLMD P+EEQQ F +VT  IAASE E+TE N+LS + +   
Sbjct  239   KLQRMQKLQDLATTMLELWNLMDTPIEEQQAFQSVTCNIAASEHEVTETNSLSDEFINHV  298

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHL--AIDDSIEFTDETIESGAIDPSHL  1311
             E EVSRL+++KSSKMKE++LKKR  LEE+CR+ HL   ID ++E+T E +ESG++DP+ +
Sbjct  299   EAEVSRLEDLKSSKMKELVLKKRAELEEICRKTHLIPQIDGAVEYTIEAVESGSVDPACV  358

Query  1312  LEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKR  1491
             LEQ+E+QIS  KEEAFSR EILEKVEKWL+AC+EESWLE+Y+R++NRYN GRGTHL LKR
Sbjct  359   LEQIELQISQCKEEAFSRIEILEKVEKWLSACDEESWLEEYSRDENRYNTGRGTHLNLKR  418

Query  1492  AEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQR  1671
             AEKAR LVNK+P M + LTS+   WE ++G  F+YDGV LLSMLE Y LL+QEKE ER+R
Sbjct  419   AEKARVLVNKLPAMTDKLTSKTVAWEKDKGTEFIYDGVGLLSMLEDYILLRQEKEQERRR  478

Query  1672  QRDQKKLQGQLMAEQEVLFG-----SKRSPSQSGKKNVVGGASNKRISVGGAMLQTPYTE  1836
             QR  KKLQGQL+AEQEVL+G     SK   ++   +   G ++++R++ GG+ L+    +
Sbjct  479   QRGLKKLQGQLIAEQEVLYGSKSSPSKPQSARKAPRTPNGSSASRRVTFGGSTLK---PD  535

Query  1837  RAPLSSHSLKKINPVKQQALANITQNYVA-LSSGRRE---SSMHAKQPSCNKSNLQKTE-  2001
                  S S +K + ++Q    N   + ++ LSS RR    + +  ++ S     ++  E 
Sbjct  536   SKATQSSSTRKTDKLRQIDQTNYLDDGISCLSSDRRGLDIAGIPMRKYSIGAGIVRDIES  595

Query  2002  PTQRKPLSPISSLSFNTSSANIMDKISESEELREMPASLLTT-PIKNVSGIGGNATPKtm  2178
             P  R P + ISS     S  N+ +    ++EL     +L  T PI N        T K  
Sbjct  596   PLTRHPFTTISSTVL--SQENVENA---ADELNVQKHNLQKTLPINNFPFTN---TSKIE  647

Query  2179  pipmpstpasaassiamQMGMTPAPVAATTPMVGHDGVEYSYEEMRAGFLL  2331
              +         A  I M M  TPAP      +V    +EYS+EE R GF+L
Sbjct  648   TVIDEENRTLKAMPIPMNMSKTPAPFGGD--LVQE--IEYSFEERRLGFVL  694



>ref|NP_001130355.1| uncharacterized protein LOC100191450 [Zea mays]
 gb|ACF78545.1| unknown [Zea mays]
 gb|AFW83595.1| hypothetical protein ZEAMMB73_552543 [Zea mays]
 gb|AFW83596.1| hypothetical protein ZEAMMB73_552543 [Zea mays]
Length=689

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/721 (50%), Positives = 486/721 (67%), Gaps = 71/721 (10%)
 Frame = +1

Query  265   DQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQL  444
             DQ  +M TTC SLL EL  IW+E+GEP++ RD+ML +LEQECL+ Y+RKVDQA+R  AQL
Sbjct  7     DQLQQMSTTCDSLLLELNVIWDEVGEPDMARDRMLLELEQECLDVYKRKVDQANRCRAQL  66

Query  445   RQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrklerkHQF  615
             RQA+AE+EAELA IC+A+GE P++VRQS++    L+  L AI+P LEEM+K+K+ER  QF
Sbjct  67    RQAIAEAEAELAGICSAMGEPPIHVRQSNQKLQGLREVLNAIVPYLEEMRKKKVERWDQF  126

Query  616   SEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLD  795
              +V++QI  V  E+ +    +   I +D+SDLSLR+LE++   L SLQKEKSDRLKQV++
Sbjct  127   VDVIEQIKKVASEI-RPADFVPFRIPVDQSDLSLRKLEELTKELQSLQKEKSDRLKQVME  185

Query  796   HLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQRLH  975
             HL +L+SLC VLG+DFK T+ E+HP+LG++   K++S  TIE L++A   LRE+K+QR+ 
Sbjct  186   HLNTLHSLCEVLGVDFKQTVNEVHPSLGEADGSKNLSNCTIESLASAASRLRELKVQRMQ  245

Query  976   MLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSR  1155
              LQ+LA++++ELWNLMD P+EEQQ+F NVT  IAASE E+TEPN LS+D L   E EV R
Sbjct  246   KLQDLASSMLELWNLMDTPLEEQQMFQNVTCNIAASEHEITEPNTLSIDFLSYVESEVLR  305

Query  1156  LQEMKSSKMKEVLLKKRITLEELCRQAHLAIDD--SIEFTDETIESGAIDPSHLLEQLEI  1329
             L+++K+SKMK+++LKK+  LEE  R+AHL  ++  + EF+DE IE+GA+DPS +LEQ+E 
Sbjct  306   LEQLKASKMKDLVLKKKTELEEHRRRAHLIGEEGYAAEFSDEAIEAGAVDPSLVLEQIEA  365

Query  1330  QISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARA  1509
              I+ VKEEAFSRK+ILEKVE+WL ACEEE+WLEDYN++DNRYN GRG HL LKRAEKAR 
Sbjct  366   HIATVKEEAFSRKDILEKVERWLNACEEEAWLEDYNKDDNRYNAGRGAHLTLKRAEKARI  425

Query  1510  LVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKK  1689
             LVNKIPG+++ LT++   WE ERG  F YDGV L+SMLE+Y +++QEKEL+++RQRDQKK
Sbjct  426   LVNKIPGLVDVLTTKIVAWEAERGKEFTYDGVRLMSMLEEYMIVRQEKELQKKRQRDQKK  485

Query  1690  LQGQLMAEQEVLFGSKRSPS--QSGKK---NVVGGASNKRISVGGAMLQTPYTE------  1836
             +Q QL AEQE L+GSK SPS  QS KK   + +GGA N+R+S+GGA +Q P T+      
Sbjct  486   IQDQLKAEQEALYGSKPSPSKPQSTKKAPRHSMGGA-NRRLSLGGATMQAPKTDILHSKT  544

Query  1837  -RAPLSSHSLKKINPVKQQALANITQNYVALSSGRRESSMHAKQPSCNKSNLQKTEPTQR  2013
              RA   +  L  ++P                S G   + +  K+ S N S L++ E T R
Sbjct  545   ARAAKKAEDLGALSPS---------------SRGLDIAGLPIKKLSFNASTLREAE-TPR  588

Query  2014  KPLSPISSLSFNTSSANIMDKISESEELREMPASLLTTPIKNVSGIGGNATPKtmpipmp  2193
             KP + I  +  N  S      IS + E          TP   V G+    TP        
Sbjct  589   KPFAQI--MPGNNVSPMPTRPISSATEEEN------KTPRTFVGGLNAK-TP--------  631

Query  2194  stpasaassiamQMGMTPA--------PVA-----ATTPMVGHDGVEYSYEEMRAGFLLP  2334
                  A  +  MQM MTPA        P       A +P +  D +EYS+EE R    L 
Sbjct  632   -----ATVTAPMQMAMTPAVANKVIATPATLFQEKADSPALPAD-IEYSFEERRLAVYLA  685

Query  2335  R  2337
             R
Sbjct  686   R  686



>ref|XP_002456163.1| hypothetical protein SORBIDRAFT_03g031480 [Sorghum bicolor]
 gb|EES01283.1| hypothetical protein SORBIDRAFT_03g031480 [Sorghum bicolor]
Length=687

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/706 (51%), Positives = 486/706 (69%), Gaps = 43/706 (6%)
 Frame = +1

Query  265   DQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQL  444
             DQ  +M TTC SLL EL  IW+E+GEP++ RD+ML +LEQECL+ YRRKVDQA+R  AQL
Sbjct  7     DQLQQMSTTCDSLLLELNVIWDEVGEPDMARDRMLLELEQECLDVYRRKVDQANRCRAQL  66

Query  445   RQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrklerkHQF  615
             RQA+AE+EAELA IC+A+GE P++VRQS++    L+ EL AI+P LEEM+K+K+ER  QF
Sbjct  67    RQAIAEAEAELAGICSAMGEPPIHVRQSNKKLHGLREELNAIVPYLEEMRKKKVERWDQF  126

Query  616   SEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLD  795
              +V++QI  V  E+ +    +   I +D+SDLSLR+LE++   L SLQKEKSDRLKQV++
Sbjct  127   LDVIEQIKKVASEI-RPADFVPFRIPVDQSDLSLRKLEELTKELQSLQKEKSDRLKQVME  185

Query  796   HLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQRLH  975
             HL +L+SLC VLG+DFK T+ E+HP+LG++   K++S  TIE L++A++ LRE+K+QR+ 
Sbjct  186   HLNTLHSLCEVLGVDFKQTVYEVHPSLGETDGSKNLSNSTIESLASAVNRLRELKVQRMQ  245

Query  976   MLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSR  1155
              LQ+LA++++ELWNLMD P+EEQQ+F NVT  IAASE E+TEPN LS D L   E EV R
Sbjct  246   KLQDLASSMLELWNLMDTPLEEQQMFQNVTCNIAASEHEITEPNTLSTDFLSYVESEVLR  305

Query  1156  LQEMKSSKMKEVLLKKRITLEELCRQAHLAIDD--SIEFTDETIESGAIDPSHLLEQLEI  1329
             L+++K+SKMK+++LKK+  LEE  R+AHL  ++  + EF+DE IE+GA+DP+ +LEQ+E 
Sbjct  306   LEQLKASKMKDLVLKKKTELEEHRRRAHLIGEEGYAAEFSDEAIEAGAVDPALVLEQIEA  365

Query  1330  QISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARA  1509
              I+ VKEEAFSRK+ILEKVE+WL ACEEE+WLEDYN++DNRYN GRG HL LKRAEKAR 
Sbjct  366   HIATVKEEAFSRKDILEKVERWLNACEEEAWLEDYNKDDNRYNAGRGAHLTLKRAEKARI  425

Query  1510  LVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKK  1689
             LVNKIPG+++ LT++   WE ERG  F YDGV LLSMLE+Y +++QEKELE++RQRDQKK
Sbjct  426   LVNKIPGLVDVLTTKIVAWETERGKEFTYDGVRLLSMLEEYMIVRQEKELEKKRQRDQKK  485

Query  1690  LQGQLMAEQEVLFGSKRSPS--QSGKK---NVVGGASNKRISVGGAMLQTPYTERAPLSS  1854
             +Q QL AEQE L+GSK SPS  QS KK   + +GGA N+R+S+GG     P T+      
Sbjct  486   IQDQLKAEQEALYGSKPSPSKPQSTKKAPRHSMGGA-NRRLSLGGPTTHAPKTD------  538

Query  1855  HSLKKINPVKQQALANITQNYVALSSGRRE---SSMHAKQPSCNKSNLQKTEPTQRKPLS  2025
                  I   K    A   ++  ALS   R    + +  K+   N S L++ E T RKP +
Sbjct  539   -----IMHSKTARAAKKAEDLGALSPSSRGLDIAGLPVKKLCFNASTLREAE-TPRKPFA  592

Query  2026  PISSLSFNTSSANIMDKISESEELREMPASLLTTPIKNVSGIGGNATPKtmpipmpstpa  2205
              I     N SS       +++EE  + P        K  +G+     PKT          
Sbjct  593   QIMP-GNNVSSIPARPISNDTEEENKTP--------KTFAGLN----PKTPATVTAPMQM  639

Query  2206  saassiamQMGMTPAPV--AATTPMVGHDGVEYSYEEMRAGFLLPR  2337
             +A  ++A ++  TP  +   A  P +  D +EYS+EE R    + R
Sbjct  640   AATPAVANKVVATPETLFQKAELPALPAD-IEYSFEERRLALYVAR  684



>ref|XP_008439114.1| PREDICTED: 65-kDa microtubule-associated protein 3-like [Cucumis 
melo]
Length=731

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/724 (51%), Positives = 501/724 (69%), Gaps = 33/724 (5%)
 Frame = +1

Query  259   QNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCA  438
             QND  L++ETTC SLL ELQ IW+E+GE E ERD+ML +LEQECLE YRRKVDQA+ S A
Sbjct  5     QNDPLLQVETTCGSLLYELQIIWDEVGEGEAERDRMLLELEQECLEVYRRKVDQANHSRA  64

Query  439   QLRQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrklerkH  609
              LRQA+A+SEA+LA IC+A+GE+PV +RQS +   SLK EL+ I+PLL+EM+KRK ER +
Sbjct  65    HLRQAIADSEAQLAAICSAMGERPVQIRQSDQKAVSLKDELKQIVPLLDEMRKRKSERSN  124

Query  610   QFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQV  789
             QF EVL +I  +  EL          +ALDE+DLSL++L+++   L +LQ+EKSDR+K V
Sbjct  125   QFLEVLQEIQKISDELNGCEHSASK-VALDETDLSLKKLDELTRQLHALQQEKSDRMKLV  183

Query  790   LDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQR  969
              +H+ +L+SLC+VLG+D K    E+HP+LGD     +++   I++L+A I +LR++K+QR
Sbjct  184   HNHVRTLDSLCLVLGMDSKQIAVEVHPSLGDFEGPTNITIHIIKQLAAMIEKLRDIKLQR  243

Query  970   LHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEV  1149
             +  LQ+LA+T+ +LW LMD P EEQQ+F N+T  +AASE E+ EPNAL+ D++   E EV
Sbjct  244   MQKLQDLASTMFDLWELMDTPDEEQQMFQNITCNVAASEHEIIEPNALATDVITYVEAEV  303

Query  1150  SRLQEMKSSKMKEVLLKKRITLEELCRQAHL--AIDDSIEFTDETIESGAIDPSHLLEQL  1323
             SRL+E+KSS+MKE++LKKR+ LEE+CR+ H+  A D +IE+  + I+ G++DP+ +LEQ+
Sbjct  304   SRLEELKSSRMKELVLKKRLELEEMCRKLHIVPAEDSAIEYVIDAIDYGSLDPACVLEQI  363

Query  1324  EIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKA  1503
             + QI  VKEEAF RKEILEKVE+WL ACEEE WLE+YNR++NRYN GRG HL LKRAEKA
Sbjct  364   DSQIHKVKEEAFDRKEILEKVERWLGACEEECWLEEYNRDENRYNAGRGAHLTLKRAEKA  423

Query  1504  RALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQ  1683
             RALVNK+PGM+ ALTS+   WE ERG+ F YDGV LLSMLE+Y +L+QEKE E++RQRDQ
Sbjct  424   RALVNKLPGMVSALTSKTMSWEKERGIEFTYDGVRLLSMLEEYTILRQEKEQEQRRQRDQ  483

Query  1684  KKLQGQLMAEQEVLFGSKRSPS--QSGKKN---------VVGGASNKRISVGGAMLQTPY  1830
             KKLQGQL+AEQE L+GSK SPS  QS KK           V GA ++R S+GGA+LQTP 
Sbjct  484   KKLQGQLIAEQEALYGSKPSPSKPQSVKKGPRMSTGGAGAVAGAGSRRFSLGGALLQTPK  543

Query  1831  TERAPLSSHSLKKINPVKQQALANITQNYV-ALSSGRRE-SSMHAKQPSCNKSNLQKTEP  2004
              +         K     +      + + +V ALS+G+R    +  K+ S   +  +   P
Sbjct  544   PDPNKGLRPGRKSDRGHQNNQAFQLDEGFVEALSAGKRGLDGLPVKKHSLGANGGEGESP  603

Query  2005  -TQRKPLSPISSLS--FNTSSANIMDKISESEELREMPASLLTTPIKNVSGIGGN-ATPK  2172
                RKP +PI + +  F+ S+ +       SE+L+++  S   TPIK  S    N  TPK
Sbjct  604   MVVRKPFAPIPTPTALFSNSTNSSNSLNDLSEKLQKLNMS-SKTPIKTTSISEENIKTPK  662

Query  2173  tmpipmpstpasaassiamQMGMTPA---PVAATTPMVGH--DGVEYSYEEMRAGF-LLP  2334
                IPMP     +  S+ MQ  MTPA   PV  T+ +     + VEYS+EE RAGF +LP
Sbjct  663   --IIPMPVPSTPSTVSVPMQTAMTPALPHPVDLTSRISEDISEVVEYSFEERRAGFVVLP  720

Query  2335  R-LH  2343
             + LH
Sbjct  721   KALH  724



>emb|CDM83899.1| unnamed protein product [Triticum aestivum]
Length=690

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/703 (49%), Positives = 469/703 (67%), Gaps = 51/703 (7%)
 Frame = +1

Query  292   CCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAESEA  471
             C SLL EL  IW+E+GEP+  RDK L +LEQECL+ YRRKVDQA+R  AQLRQ++AE+EA
Sbjct  15    CDSLLLELNVIWDEVGEPDTVRDKTLLELEQECLDVYRRKVDQANRCRAQLRQSIAEAEA  74

Query  472   ELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrklerkHQFSEVLDQIDS  642
             ELA IC+A+GE PV+VRQS++    L+ EL AI+P LEEM+ +K+ER +QF  VL++I  
Sbjct  75    ELAGICSAIGEPPVHVRQSNQKLHGLREELNAIIPYLEEMRTKKVERWNQFVHVLEEIKK  134

Query  643   VLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESLNSLC  822
             +  E+  S   +     +D+SDLSLR+ E++   L SLQKEK +RLKQV+DHL +L+SLC
Sbjct  135   ISSEIRPS-DFVPFKTPVDQSDLSLRKFEELTKELESLQKEKRERLKQVVDHLNTLHSLC  193

Query  823   IVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQRLHMLQNLATTI  1002
              VLGIDFK T+ E+HP+L ++   K++S  TIERL++++  LRE+KIQR+  LQ+ A+T+
Sbjct  194   EVLGIDFKQTVHEVHPSLDEAEGSKNLSNTTIERLASSVDRLREIKIQRMQKLQDFASTM  253

Query  1003  VELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQEMKSSKM  1182
             +ELWNLMD P+EEQQ+F NVT  IAASE E+TEPN LS+D L   E EV RL+++K SKM
Sbjct  254   LELWNLMDTPIEEQQMFQNVTCNIAASEHEITEPNTLSIDFLSYVEAEVLRLEQLKGSKM  313

Query  1183  KEVLLKKRITLEELCRQAHLAIDD--SIEFTDETIESGAIDPSHLLEQLEIQISNVKEEA  1356
             K+++LKK+  LEE  R+AHL  ++  S EF  E IESGAIDP+ +LEQ+E  I+ VK+EA
Sbjct  314   KDLVLKKKSELEEHRRRAHLIGEEGYSDEFNIEAIESGAIDPALVLEQIEAHIATVKDEA  373

Query  1357  FSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVNKIPGML  1536
             FSRK+ILEKVE++L ACEEE+WLEDYN++DNRYN G+G HL LKRAEKAR LVNKIPGM+
Sbjct  374   FSRKDILEKVERFLNACEEEAWLEDYNKDDNRYNAGKGAHLTLKRAEKARILVNKIPGMV  433

Query  1537  EALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQGQLMAEQ  1716
             + LT++   WE ERG  F YDGV LLSML++Y +++QEKE E++RQRDQKKL  QL AEQ
Sbjct  434   DVLTTKIIAWENERGKEFTYDGVRLLSMLDEYMIVRQEKEQEKKRQRDQKKLHDQLKAEQ  493

Query  1717  EVLFGSKRSPS--QSGKK---NVVGGASNKRISVGGAMLQTPYTERAPLSSHSLKKINPV  1881
             E L+GSK SPS  QS KK   + +GG  N+R+S+GGA +Q P T+   L S +++     
Sbjct  494   EALYGSKPSPSKPQSIKKAPRHSMGGV-NRRVSMGGATMQAPKTD--ILHSKNVRAAK--  548

Query  1882  KQQALANITQNYVALSSGRRESSMHAKQPSCNKSNLQKTEPTQRKPLSPISSLSFNTSSA  2061
             + + +A+++     L  G     +  K+ S N + L++TE T RKP + I     +  S 
Sbjct  549   RTEDIAHLSPASRGLDIG----DLPIKKLSFNATALRETE-TPRKPFAQIMPPPSSVPST  603

Query  2062  NIMDKISESEELREMPASLLTTPIKNVSGIGGNATPKtmpipmpstpasaassiamQMGM  2241
                   +++E+    P         N+      A P                   MQ+ M
Sbjct  604   PARSVTNDTEDENRTPNPKTFGAALNLKTPMTVAAP-------------------MQLAM  644

Query  2242  TPA----PVAATTPMVGH-------DGVEYSYEEMRAGFLLPR  2337
             TPA      AA   +V         + +EYS+EE R    L R
Sbjct  645   TPAVASKVTAAPVSLVYEKPEPTLPEAIEYSFEERRLAVYLSR  687



>ref|XP_011101133.1| PREDICTED: 65-kDa microtubule-associated protein 3-like [Sesamum 
indicum]
 ref|XP_011101134.1| PREDICTED: 65-kDa microtubule-associated protein 3-like [Sesamum 
indicum]
Length=733

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/725 (50%), Positives = 494/725 (68%), Gaps = 49/725 (7%)
 Frame = +1

Query  277   RMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAV  456
             RMETTC +LL ELQ IW+E+GE   ERD+ML +LEQECLE YRRKVDQA+R   QLRQA+
Sbjct  11    RMETTCGALLYELQIIWDEVGESVAERDRMLLELEQECLEVYRRKVDQANRYRVQLRQAI  70

Query  457   AESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrklerkHQFSEVL  627
             A++EAELA IC+ALGE+PV++RQS +   SLK EL AI+P +EEM+ R+++RK+QF +VL
Sbjct  71    ADAEAELAAICSALGERPVHIRQSDQNCGSLKAELLAILPQIEEMRNRRIDRKNQFIKVL  130

Query  628   DQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLES  807
             ++I S+  E+ +S +   +  A+DE+DLS+++LE+++  + +LQ EKS+RLK VLD ++ 
Sbjct  131   EEIHSIKNEIYRSDRFASNGPAVDEADLSIKKLEELQREMQALQSEKSERLKLVLDRMKY  190

Query  808   LNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQRLHMLQN  987
             L+SLCIVLG+DFK  +GEIHP+L +++  K++S   IE+L  AI  LRE+KIQR+  LQ+
Sbjct  191   LDSLCIVLGLDFKKIVGEIHPSLAEAAGSKNISNSIIEQLGTAIQNLRELKIQRMQQLQD  250

Query  988   LATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQEM  1167
             L T+++ELW+LMD P+EEQQ F   T  +AASE E+TEP+ LS++ +   + EVSRL+ +
Sbjct  251   LTTSLLELWDLMDTPIEEQQTFQKFTCHLAASEDEMTEPDILSINYINCVKTEVSRLEGL  310

Query  1168  KSSKMKEVLLKKRITLEELCRQAHLA--IDDSIEFTDETIESGAIDPSHLLEQLEIQISN  1341
             K SK+KE++LKK+  LE LCR+ HL    D ++E   + I+SGA+D + +LEQ+E+QI+ 
Sbjct  311   KESKIKELILKKKAELEVLCRKTHLIPDSDSAMEIAIDAIDSGAVDATFVLEQIELQIAR  370

Query  1342  VKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVNK  1521
             VKEEA  RKEILEKVEKW+AAC+EESWLE+YNR+DNRYN GRG H+MLKRAEKARALVNK
Sbjct  371   VKEEALGRKEILEKVEKWMAACDEESWLEEYNRDDNRYNAGRGAHVMLKRAEKARALVNK  430

Query  1522  IPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQGQ  1701
             +P M+ AL S+   WE E+G+ F YDGV LLSMLEQY +L+QEKE ER+RQRDQKKLQGQ
Sbjct  431   LPAMVGALASKVIVWENEKGIAFTYDGVRLLSMLEQYMVLRQEKEQERKRQRDQKKLQGQ  490

Query  1702  LMAEQEVLFGSKRSP--SQSGKK---NVVGGASNKRISVGGAMLQTPYTERAPLSSHSLK  1866
             L+ EQE ++GSK SP  + S KK   +  GGASN+ +S+GG  LQTP  E  P S+ +  
Sbjct  491   LLTEQEAIYGSKPSPVKNHSVKKRPRSSCGGASNRTLSLGGPTLQTPKREMPP-SAKATP  549

Query  1867  KINPVKQQALANITQ----NYVALSSGRRESSMH---AKQPSCNKSNL-QKTEPTQRKPL  2022
              I   K+  + N  +         SSGRR   M    AK  S N  N  Q+  P  RKP 
Sbjct  550   NIRNSKKNEIINKYRPKDDGLAPPSSGRRVVGMAGHPAKHQSPNLVNARQRESPVVRKPF  609

Query  2023  SPISSLSF-NTSSANIMDKISE-----SEELREMPAS--LLTTPIKNVS-----------  2145
                SS+SF N+S  N+ + + +      E+L +   +    TTP K +S           
Sbjct  610   ---SSISFTNSSKTNVTNTLEDRNKRHKEKLHKTQTNNKPFTTPPKTISIAEQENRTPQT  666

Query  2146  -GIGGNATPKtmpipmpstpasaassiamQMGMTPAPVAATTPMVGHDGVEYSYEEMRAG  2322
              GI   +TP T  +P+ +          +        V +T   V  + +EYS+EE RAG
Sbjct  667   MGISVASTPSTSSVPVQTPTTPPPLQTTITP------VPSTKKTVPEE-IEYSFEERRAG  719

Query  2323  FLLPR  2337
             F+LPR
Sbjct  720   FVLPR  724



>ref|XP_007052041.1| Microtubule associated protein (MAP65/ASE1) family protein, putative 
isoform 2, partial [Theobroma cacao]
 gb|EOX96198.1| Microtubule associated protein (MAP65/ASE1) family protein, putative 
isoform 2, partial [Theobroma cacao]
Length=569

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/558 (55%), Positives = 413/558 (74%), Gaps = 6/558 (1%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M N +++Q  R+ETTC SLL ELQKIW+E+GE + ERD  L  LEQECL+ Y RKVD+A 
Sbjct  1     MLNHKSEQLARIETTCGSLLCELQKIWDEVGEADDERDTTLLDLEQECLKVYTRKVDEAK  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVR-QSSRSLKTELQAIMPlleemkkrkler  603
                 +L + +A ++AE++ +CA++GE PV+   +   +LK EL+ I PLLE+M+++K+ER
Sbjct  61    ECRTKLHRDIAIAKAEISDVCASIGENPVHPDLKPGGNLKEELETIGPLLEDMRRKKVER  120

Query  604   kHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLK  783
              +QF  V+DQI  +  E+   +++  + + +DE++LSLRRLE++   L  LQ EK +RL 
Sbjct  121   INQFIGVIDQIQKISNEILGFKEQDGNKLLVDETNLSLRRLEELHRELHELQNEKINRLN  180

Query  784   QVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKI  963
             QV  HL ++NSLC VLG+DF  TI  IHPTL DS+  K VS  TI RL+A I  L+E+KI
Sbjct  181   QVQGHLNTINSLCTVLGMDFIQTICRIHPTLDDSNGAKDVSNNTIARLAAQIQSLQELKI  240

Query  964   QRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEI  1143
             +R+  +Q LA+T++ELW+LMD P EEQ +F NVT  IAASE E+TEPN LS+D +K+ E 
Sbjct  241   KRMQKIQELASTLLELWHLMDTPAEEQHMFLNVTSKIAASEPEITEPNMLSIDCIKNVEE  300

Query  1144  EVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAIDD--SIEFTDETIESGAIDPSHLLE  1317
             EVSRL+++K+SKMKE++LKK++ LE++CR+ H+ ++   S +++ E +ESGAIDP +LLE
Sbjct  301   EVSRLEQLKTSKMKEIVLKKKVELEDMCRRTHMVLEALISTDYSIEAMESGAIDPLYLLE  360

Query  1318  QLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAE  1497
             Q+++QIS V+EEAFSRKE+LEKVEKWLAACEEESWLE+YNR+DNRYN GRG HL LKRAE
Sbjct  361   QIDLQISKVREEAFSRKEVLEKVEKWLAACEEESWLEEYNRDDNRYNAGRGAHLSLKRAE  420

Query  1498  KARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQR  1677
             KARA+VNKIP M+EALT +   WE ER   FLYDG  LLS+LE Y  L+QEKELERQRQR
Sbjct  421   KARAVVNKIPAMVEALTLKTTAWERERETEFLYDGRRLLSVLEDYSSLRQEKELERQRQR  480

Query  1678  DQKKLQGQLMAEQEVLFGSKRSPSQSGKKN---VVGGASNKRISVGGAMLQTPYTERAPL  1848
             D KK  GQL+AEQE L+GSK SPS SGKK       GAS++++S+GGAMLQ    E+   
Sbjct  481   DHKKFHGQLIAEQEALYGSKPSPSISGKKAPRMPTVGASDRKLSLGGAMLQQVKPEKPAT  540

Query  1849  SSHSLKKINPVKQQALAN  1902
               H  KK + + Q +  N
Sbjct  541   RLHPNKKADYLNQNSFLN  558



>ref|XP_002865869.1| hypothetical protein ARALYDRAFT_495230 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42128.1| hypothetical protein ARALYDRAFT_495230 [Arabidopsis lyrata subsp. 
lyrata]
Length=707

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/723 (51%), Positives = 495/723 (68%), Gaps = 51/723 (7%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M + Q D  L++ETTC SLL ELQ IW+E+GE E +RDKML +LE+ECLE YRRKVDQA+
Sbjct  1     MASIQKDPILQVETTCGSLLYELQIIWDEVGETETDRDKMLLELERECLEVYRRKVDQAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSRS---LKTELQAIMPlleemkkrkl  597
             R  AQLRQA+A++EAELA IC+A+GE+PV++RQ+ +S   LK EL  I+P LEEM+KRK+
Sbjct  61    RCRAQLRQAIADAEAELAAICSAMGERPVHIRQTDQSVGSLKQELGRILPELEEMQKRKI  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIAL-DESDLSLRRLEDMKSHLLSLQKEKSD  774
             ER++QF  VL++IDS+  ++ + + EL H   L DE+DLS+R+LED+   L +LQKEK D
Sbjct  121   ERRNQFIVVLEEIDSITNDI-RGQGELVHSKPLIDETDLSMRKLEDLHCQLQALQKEKID  179

Query  775   RLKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELRE  954
             R++ +  HL +L S C VLG+DF   +G+++PTL D    +S+S  TIE+L AA+ +LRE
Sbjct  180   RVETIRKHLCTLYSHCSVLGMDFNEVVGQVNPTLSDPEGPRSLSDHTIEKLGAAVQKLRE  239

Query  955   VKIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKS  1134
             VKIQR+  LQ+LATT++ELWNLMD P+EEQQ + ++T  IAASE E+TE N+LS D +K 
Sbjct  240   VKIQRMQRLQDLATTMLELWNLMDTPIEEQQEYQHITCNIAASEQEITEANSLSEDFIKY  299

Query  1135  AEIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHL--AIDDSIEFTDETIESGAIDPSH  1308
              E EV RL E+K+SKMKE++LKKR  LE++CR+ HL    D +I+ T   IESG +D + 
Sbjct  300   VEAEVVRLDEVKASKMKELVLKKRSELEDICRKTHLLPVSDSAIDQTIAAIESGIVDATM  359

Query  1309  LLEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLK  1488
             +LE LE  IS +KEEA SRK+ILE+VEKWL+AC+EESWLE+YNR+DNRYN GRG HL LK
Sbjct  360   VLEHLEQHISKIKEEALSRKDILERVEKWLSACDEESWLEEYNRDDNRYNAGRGAHLTLK  419

Query  1489  RAEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQ  1668
             RAEKAR LVNK+PGM+EAL S+   WE E+G  FLYDG+ LLSMLE+Y LL+QE+E E +
Sbjct  420   RAEKARNLVNKLPGMVEALASKTIVWEQEKGTEFLYDGIRLLSMLEEYNLLRQEREEEHR  479

Query  1669  RQRDQKKLQGQLMAEQEVLFGSKRSPSQ--SGKKN---VVGGASNKRISVGGAMLQTPYT  1833
             RQRDQKKLQGQL+AEQE L+GSK SPS+   GKK      GGA+N+R+S+G AM QTP  
Sbjct  480   RQRDQKKLQGQLIAEQEALYGSKPSPSKPLGGKKAPRMSTGGATNRRLSLGAAMHQTP--  537

Query  1834  ERAPLSSHSLKKINPVKQQALANITQNYVALSSGRRE---SSMHAKQPSCNKSNLQKTEP  2004
                           P K+   A+  QN  ALS+GRR    + + +++ S N S + ++ P
Sbjct  538   -------------KPNKK---ADHRQNDGALSNGRRGLDIAGLPSRKQSMNPSEVLQS-P  580

Query  2005  TQRKPLSPISSLSFNTSSANI----MDKISESEELREMPASLLTTPIKNVSGIGG-----  2157
               RKP SPIS++    S ANI      ++ ++  + E+  S   TP+KN++ I       
Sbjct  581   LVRKPFSPISTMVV-ASKANIATTTQQQLPKNNAVNEI--SSFATPVKNINSIRNLEEEK  637

Query  2158  -----NATPKtmpipmpstpasaassiamQMGMTPAPVAATTPMVGHDGVEYSYEEMRAG  2322
                    TPK +   +P     A  S+ M    TP    A       + VEYS+EE R  
Sbjct  638   MMTMMMQTPKNVAAMIPIPSTPATVSVPMHTAPTPFTDNARLMSEKPEVVEYSFEERRLA  697

Query  2323  FLL  2331
             F+L
Sbjct  698   FML  700



>ref|XP_011034440.1| PREDICTED: 65-kDa microtubule-associated protein 4-like isoform 
X1 [Populus euphratica]
Length=720

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/723 (48%), Positives = 491/723 (68%), Gaps = 32/723 (4%)
 Frame = +1

Query  247   MYNRQND--QSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQ  420
             MYN  N+  Q  R+ETTC  LL+EL+KIW+E+GE + ERDK++ ++EQEC+E YRRKV  
Sbjct  1     MYNHSNNSNQFSRIETTCSLLLTELKKIWSEVGEADTERDKLVYEIEQECVEVYRRKVIA  60

Query  421   ASRSCAQLRQAVAESEAELARICAALGEQPVNVRQS--SRSLKTELQAIMPlleemkkrk  594
             A++  ++L+  +A +EAE+  I + LGE+PV   +   S SL+ E  AI+  +EEM+ +K
Sbjct  61    ANKRRSELQHLIALAEAEIQNIRSVLGEEPVKSEEEKVSVSLREEHGAIVQRVEEMRNKK  120

Query  595   lerkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSD  774
              ER+  F EV++++  V  E+  S       + +D +DLS+++L+ ++  LL L+  KS+
Sbjct  121   EERRKLFVEVVEKLQKVSSEIFGS----TEGVIMDGTDLSMKKLDGLEKRLLELENNKSN  176

Query  775   RLKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELRE  954
             RLKQ++D ++ L S+C VLG+DFK TI +IHP+L DS  +K ++ +TI++L+A I  LRE
Sbjct  177   RLKQIVDRVDGLKSICGVLGMDFKQTIHDIHPSLDDSQGVKDLTDDTIKKLTAEIQRLRE  236

Query  955   VKIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKS  1134
             VKIQR+  L+ LATT+VELWNLMD P+EEQ+LFDNVT  IAASESE++EPN LS+D +  
Sbjct  237   VKIQRMQKLRVLATTLVELWNLMDTPMEEQRLFDNVTSKIAASESEISEPNTLSVDFINH  296

Query  1135  AEIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAID--DSIEFTDETIESGAIDPSH  1308
              E EVSRL+++KSSK+KE++LKKR+ LEE+C + HL ++   + +++ E + SG  DP H
Sbjct  297   VEEEVSRLEKLKSSKVKELVLKKRLELEEICWKTHLVLEAYTAAKYSTEAVASGVEDPMH  356

Query  1309  LLEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLK  1488
             LLE++E+ I+ VKEEA SRK+IL+KVEKWL AC+EESWLE+YNR++NRY+ GRG HL LK
Sbjct  357   LLEEIELDIAMVKEEASSRKDILDKVEKWLTACDEESWLEEYNRDENRYSYGRGAHLTLK  416

Query  1489  RAEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQ  1668
             RAEKAR +VNKIP M+EALTS+   WE ERG+PF YDG  LLS LEQY  LKQEKE ER 
Sbjct  417   RAEKARVMVNKIPAMVEALTSKTMAWERERGIPFFYDGGQLLSRLEQYSSLKQEKEQERI  476

Query  1669  RQRDQKKLQGQLMAEQEVLFGSKRSPSQSGKK---NVVGGASNKRISVGGAMLQTPYTER  1839
             RQRDQKKL  QL+AEQE LFGSK SPSQSG+K     VG A N+++S+ GAM+      +
Sbjct  477   RQRDQKKLHVQLIAEQEALFGSKPSPSQSGRKPSRTSVGVAINQKLSLAGAMVPNYRCGK  536

Query  1840  APLSSHSLKKINPVKQQALANITQN-YVALSSGRRESS----MHAKQPSCNKSNLQKTEP  2004
                  +  KK N + + +     Q+   A  SGRR S     +  K+ + + +   K E 
Sbjct  537   TSPFVNPNKKGNVLDRCSYLRYGQHGGFASQSGRRNSEIVGHLGKKRHATSAAKACKNES  596

Query  2005  T-QRKPLSPIS-SLSFNTSSANIMD--KISESEELREMP---ASLLTTPIKNVSGIGG-N  2160
             +  RKPLSP+S S+S   +  N M+  K S+S  L+ MP    + + TP K+V  +   N
Sbjct  597   SLVRKPLSPVSLSMSSRANIVNFMEDQKSSQSGTLKTMPPYNKTSMDTPSKSVKAVDDEN  656

Query  2161  ATPKtmpipmpstpasaassiamQMGMTPA-PVAATTPMVGHDGVE---YSYEEMRAGFL  2328
               P T+P+P+ STP + +  +     +TPA P  +  P      +E   +S+EE+RAGF+
Sbjct  657   RNPNTLPVPVASTPPTTSVPMLT--ALTPATPCVSCAPKTARKILEQEDHSFEELRAGFV  714

Query  2329  LPR  2337
              PR
Sbjct  715   CPR  717



>ref|XP_004514980.1| PREDICTED: 65-kDa microtubule-associated protein 3-like isoform 
X3 [Cicer arietinum]
Length=580

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/577 (55%), Positives = 425/577 (74%), Gaps = 15/577 (3%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M    ND     ETTC  LL ELQ IWNE+GE + ++D+++ +++QECLE YRRKVD A+
Sbjct  1     MSKPHNDPLPPTETTCGLLLQELQIIWNEVGESDTDKDRIMFEIDQECLEVYRRKVDTAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQS---SRSLKTELQAIMPlleemkkrkl  597
             RS AQLRQ +++SEAEL  IC+A+GE+P + RQS   +RSLK EL  I+P LEEM+KRK 
Sbjct  61    RSRAQLRQEISDSEAELTIICSAMGERPAHSRQSDEKARSLKEELAMILPELEEMQKRKY  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             ER+ QF +V +QI S+  E+    + +  ++  DE+DLSLR+LE++   L +LQKEKSDR
Sbjct  121   ERRKQFIDVQEQIQSISNEIYGPGENVSFIV--DETDLSLRKLEELHRQLHTLQKEKSDR  178

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             LK+V DHL SL+SLC VLG+DFK T+ EIHP+LG+S   KSV+ +TI +L+ AI ELR+V
Sbjct  179   LKKVQDHLYSLSSLCSVLGLDFKPTVSEIHPSLGNSEGPKSVNNDTIGQLALAIQELRDV  238

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             K+QR+  LQ+LATT++ELWNLMD P+EEQQ F +VT  IAASE E+TE N+LS + +   
Sbjct  239   KLQRMQKLQDLATTMLELWNLMDTPIEEQQAFQSVTCNIAASEHEVTETNSLSDEFINHV  298

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHL--AIDDSIEFTDETIESGAIDPSHL  1311
             E EVSRL+++KSSKMKE++LKKR  LEE+CR+ HL   ID ++E+T E +ESG++DP+ +
Sbjct  299   EAEVSRLEDLKSSKMKELVLKKRAELEEICRKTHLIPQIDGAVEYTIEAVESGSVDPACV  358

Query  1312  LEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKR  1491
             LEQ+E+QIS  KEEAFSR EILEKVEKWL+AC+EESWLE+Y+R++NRYN GRGTHL LKR
Sbjct  359   LEQIELQISQCKEEAFSRIEILEKVEKWLSACDEESWLEEYSRDENRYNTGRGTHLNLKR  418

Query  1492  AEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQR  1671
             AEKAR LVNK+P M + LTS+   WE ++G  F+YDGV LLSMLE Y LL+QEKE ER+R
Sbjct  419   AEKARVLVNKLPAMTDKLTSKTVAWEKDKGTEFIYDGVGLLSMLEDYILLRQEKEQERRR  478

Query  1672  QRDQKKLQGQLMAEQEVLFG-----SKRSPSQSGKKNVVGGASNKRISVGGAMLQTPYTE  1836
             QR  KKLQGQL+AEQEVL+G     SK   ++   +   G ++++R++ GG+ L+    +
Sbjct  479   QRGLKKLQGQLIAEQEVLYGSKSSPSKPQSARKAPRTPNGSSASRRVTFGGSTLK---PD  535

Query  1837  RAPLSSHSLKKINPVKQQALANITQNYVALSSGRRES  1947
                  S S +K + ++Q    N   + ++  S   +S
Sbjct  536   SKATQSSSTRKTDKLRQIDQTNYLDDGISCLSSEEDS  572



>ref|XP_002320728.2| hypothetical protein POPTR_0014s06560g [Populus trichocarpa]
 gb|EEE99043.2| hypothetical protein POPTR_0014s06560g [Populus trichocarpa]
Length=723

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/727 (48%), Positives = 496/727 (68%), Gaps = 38/727 (5%)
 Frame = +1

Query  247   MYNRQND--QSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQ  420
             MYN  N+  Q  R+ETTC  LL+EL+KIW+E+GE + ERDK++ ++EQEC+E YRRKV  
Sbjct  1     MYNHSNNSNQFSRIETTCSLLLTELKKIWSEVGEADTERDKLVYEIEQECVEVYRRKVIA  60

Query  421   ASRSCAQLRQAVAESEAELARICAALGEQPVNVRQSSR--SLKTELQAIMPlleemkkrk  594
             A++  ++L+Q++A +E+E+  I + LGE+PV   +     SL+ E  AI+P +EEM+ +K
Sbjct  61    ANKRRSELQQSIALAESEIENIRSVLGEEPVKSEEEKVRVSLREEHGAIVPRVEEMRNKK  120

Query  595   lerkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSD  774
              ER+  F EV+ ++  V  E+  S       + +D +DLS+++L+ ++  LL L+  KS+
Sbjct  121   EERRKLFVEVVGKLQKVSSEIFGS----TEGVIMDGTDLSMKKLDALEKRLLELENNKSN  176

Query  775   RLKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELRE  954
             RLKQ++D ++ L S+C VLG+DFK TI +IHP+L DS  +K ++ +TI++L++ I  LRE
Sbjct  177   RLKQIVDRVDGLKSICGVLGMDFKQTIHDIHPSLDDSQGVKDLTDDTIKKLTSEIQRLRE  236

Query  955   VKIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKS  1134
             VKIQR+  L+ LATT+VELWNLMD P+EEQ++FDNVT  IAASESE++EPN LS+D +  
Sbjct  237   VKIQRMQKLRVLATTLVELWNLMDTPMEEQRMFDNVTSKIAASESEISEPNKLSMDFINH  296

Query  1135  AEIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAID--DSIEFTDETIESGAIDPSH  1308
              E EVSRL+++KSSK+KE++LKKR+ LEE+C + HL ++   + +++ E + SG  DP H
Sbjct  297   VEEEVSRLEKLKSSKVKELVLKKRLELEEICWKTHLVLEAYTAAKYSTEAVASGVEDPMH  356

Query  1309  LLEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLK  1488
             LLE++E+ I+ VKEEA SRK+IL+KVEKWL AC+EESWLE+YNR++NRY+ GRG HL LK
Sbjct  357   LLEEIELDIAMVKEEASSRKDILDKVEKWLTACDEESWLEEYNRDENRYSYGRGAHLTLK  416

Query  1489  RAEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQ  1668
             RAEKAR +VNKIP M+EALTS+   WE ERG+PF YDG  LLS LEQY  LKQEKE ER 
Sbjct  417   RAEKARVMVNKIPAMVEALTSKTMAWEKERGIPFFYDGGRLLSRLEQYSSLKQEKEQERI  476

Query  1669  RQRDQKKLQGQLMAEQEVLFGSKRSPSQSGKK---NVVGGASNKRISVGGAMLQTPYTER  1839
             RQRDQKKLQ QL+AEQE LFGSK SPSQSG+K     VG A N+++S+GGAM+    + +
Sbjct  477   RQRDQKKLQVQLIAEQEALFGSKPSPSQSGRKPSRTSVGVAINQKLSLGGAMVPNYRSGK  536

Query  1840  APLSSHSLKKINPVKQQALANITQN--YVALSS-----GRRESS----MHAKQPSCNKSN  1986
                  +  KK N + + +     QN  + + S+     GRR S     +  K+ + + + 
Sbjct  537   TSPFVNPNKKGNVLDRCSYLRYGQNGGFASQSAEKNFVGRRNSEIVGHLGKKRHATSAAK  596

Query  1987  LQKTEPT-QRKPLSPIS-SLSFNTSSANIMD--KISESEELREMPA---SLLTTPIKNVS  2145
               K E +  RKPLSP+S S+S   +  N M+  K S+S  L+ MP    + + TP K+V+
Sbjct  597   ACKNESSLVRKPLSPVSLSMSSRANIVNFMEDQKSSQSGTLKAMPPYNRTPMDTPSKSVN  656

Query  2146  GIGG-NATPKtmpipmpstpasaassiamQMGMTPA-PVAATTPMVGHDGVE---YSYEE  2310
              +   N  P T+P+P+ STP + +  +     +TPA P  +  P      +E   +S+EE
Sbjct  657   AVDDENRIPNTLPVPVASTPPTTSVPMLT--ALTPATPCVSCAPKTARKILEQEDHSFEE  714

Query  2311  MRAGFLL  2331
             +RAGF+ 
Sbjct  715   LRAGFIF  721



>gb|EYU19490.1| hypothetical protein MIMGU_mgv1a002138mg [Erythranthe guttata]
Length=709

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/718 (49%), Positives = 472/718 (66%), Gaps = 51/718 (7%)
 Frame = +1

Query  277   RMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAV  456
             R++TTC SLL ELQ IW+E+G  + ER+++L ++EQEC E +R+KVD A+RS AQLRQA+
Sbjct  12    RLDTTCGSLLYELQLIWDEVGVSDAERERILLEIEQECSEVFRKKVDHANRSRAQLRQAI  71

Query  457   AESEAELARICAALGEQPVNVRQS---SRSLKTELQAIMPlleemkkrklerkHQFSEVL  627
             A++EAELA IC+A+GE+PV++RQS   S SLK EL+A +P +EEM+KR+ ERK+QF EVL
Sbjct  72    ADTEAELATICSAMGERPVHIRQSDQSSESLKAELRANLPQIEEMRKRRTERKNQFIEVL  131

Query  628   DQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLES  807
             + I S+  E+ +S        A+DE+DLS+++LE++   L  LQKEKS+RL  V D L  
Sbjct  132   ENIQSIKNEINRSDGFNLSDSAIDETDLSMKKLEELHRELQGLQKEKSERLALVQDGLNF  191

Query  808   LNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQRLHMLQN  987
             L SLC+VLG D      EIHP+LG++   KS+S  TI++L   I +LRE+K+QR+ MLQ+
Sbjct  192   LYSLCVVLGFDSTKMASEIHPSLGETEGSKSISNSTIDQLGTVIRKLRELKLQRMQMLQD  251

Query  988   LATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQEM  1167
             LA +++ELWNLMD P EEQQ+F   T  + ASE E+TEP  LSL  +   + EVSRL+++
Sbjct  252   LAASLLELWNLMDTPTEEQQIFQKATCKLVASEDEITEPEMLSLCYINYVKAEVSRLEDL  311

Query  1168  KSSKMKEVLLKKRITLEELCRQAHLAID-DSIEFTDETIESGAIDPSHLLEQLEIQISNV  1344
             K+SKMKE++L+K+  LE +CR+  L  D D +E + + IESGAID + +LEQ+E+QI+ V
Sbjct  312   KASKMKELVLRKKAELEVICRKTRLIPDIDGVETSIDAIESGAIDAACVLEQIELQIARV  371

Query  1345  KEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVNKI  1524
             KEEA SRKEILEKVEKW++ACEEESWLE+YNR+DNRYN GRG HL LKRAEKARALVNK+
Sbjct  372   KEEALSRKEILEKVEKWISACEEESWLEEYNRDDNRYNAGRGAHLTLKRAEKARALVNKL  431

Query  1525  PGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQGQL  1704
             P M + L S+   W+ E G+ F YDGV LLSMLE+Y +L+QEKELER+RQRDQKKLQGQL
Sbjct  432   PAMADTLASKIIAWQNENGIKFTYDGVCLLSMLEEYKVLRQEKELERKRQRDQKKLQGQL  491

Query  1705  MAEQEVLFGSKRSPSQSGKKNVVGGASNKRISVGGAMLQTPYTERAPLSSHSLKKINPVK  1884
             +AEQE L+GSK  PS           SN+R+S+G  M+QTP  +  P       K  P  
Sbjct  492   LAEQETLYGSK--PS----------TSNRRLSLGVPMVQTPKRDVRPSM-----KATPNT  534

Query  1885  QQALANITQN--------YVALSSGRRESSMHA---KQPSCNKSNLQKTE--PTQRKPLS  2025
             ++A  N+ +N          ALSSGRR   M     KQ S N +N  +    P  RKP S
Sbjct  535   RKAKTNVVKNRDRLKDDGLSALSSGRRRLDMTGLPVKQNSLNSTNAHEKRELPLTRKPFS  594

Query  2026  PISSLSFNTSSA--NIMDKISESEELREMPASLLT----------TPIKNVSGIGG--NA  2163
             PISS + +  +A  N+ D   +  E+      L+           TP + +       N 
Sbjct  595   PISSKNSSKPNAANNLEDANKKQNEMLMRKTQLIVSNNNNNSTPLTPPRRICSTADVENR  654

Query  2164  TPKtmpipmpstpasaassiamQMGMTPAPVAATTPMVGHDGVEYSYEEMRAGFLLPR  2337
             TP  +   +      +  S+ MQ  +TP P   TT        EYS+EE RA F++PR
Sbjct  655   TPPQIKTIIDLPKTPSTVSVPMQTAVTPVPFTQTTVEEEI---EYSFEEKRARFVMPR  709



>ref|NP_001043901.1| Os01g0685900 [Oryza sativa Japonica Group]
 dbj|BAD82523.1| microtubule-associated protein-like [Oryza sativa Japonica Group]
 dbj|BAF05815.1| Os01g0685900 [Oryza sativa Japonica Group]
 dbj|BAG88970.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC71292.1| hypothetical protein OsI_03306 [Oryza sativa Indica Group]
 gb|EEE55197.1| hypothetical protein OsJ_03043 [Oryza sativa Japonica Group]
Length=689

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/713 (51%), Positives = 484/713 (68%), Gaps = 55/713 (8%)
 Frame = +1

Query  265   DQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQL  444
             DQ  +M TTC SLL EL  IW+E+GEP+  RD+ML +LEQECLE YRRKVDQA+RS AQL
Sbjct  7     DQLHQMSTTCDSLLLELNVIWDEVGEPDTTRDRMLLELEQECLEVYRRKVDQANRSRAQL  66

Query  445   RQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrklerkHQF  615
             R+A+AE EAELA IC+A+GE PV+VRQS++    L+ EL AI+P LEEMKK+K+ER +QF
Sbjct  67    RKAIAEGEAELAGICSAMGEPPVHVRQSNQKLHGLREELNAIVPYLEEMKKKKVERWNQF  126

Query  616   SEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLD  795
               V++QI  +  E+ +    +   + +D+SDLSLR+L+++   L SLQKEKSDRLKQV++
Sbjct  127   VHVIEQIKKISSEI-RPADFVPFKVPVDQSDLSLRKLDELTKDLESLQKEKSDRLKQVIE  185

Query  796   HLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQRLH  975
             HL SL+SLC VLGIDFK T+ E+HP+L ++   K++S  TIERL+AA + LRE+KIQR+ 
Sbjct  186   HLNSLHSLCEVLGIDFKQTVYEVHPSLDEAEGSKNLSNTTIERLAAAANRLREMKIQRMQ  245

Query  976   MLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSR  1155
              LQ+ A++++ELWNLMD P+EEQQ+F N+T  IAASE E+TEPN LS D L   E EV R
Sbjct  246   KLQDFASSMLELWNLMDTPLEEQQMFQNITCNIAASEQEITEPNTLSTDFLNYVESEVLR  305

Query  1156  LQEMKSSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHLLEQLEI  1329
             L+++K+SKMK+++LKK+  LEE  R+AHL  ++    EF+ E IE+GAIDPS +LEQ+E 
Sbjct  306   LEQLKASKMKDLVLKKKAELEEHRRRAHLVGEEGYAEEFSIEAIEAGAIDPSLVLEQIEA  365

Query  1330  QISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARA  1509
              I+ VKEEAFSRK+ILEKVE+W  ACEEE+WLEDYN++DNRYN GRG HL LKRAEKAR 
Sbjct  366   HIATVKEEAFSRKDILEKVERWQNACEEEAWLEDYNKDDNRYNAGRGAHLTLKRAEKART  425

Query  1510  LVNKIPGMLEALTSRAKGWEIERGV-PFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQK  1686
             LVNKIPGM++ L ++   W+ ERG   F YDGVSL SML++Y  ++QEKE E++RQRDQK
Sbjct  426   LVNKIPGMVDVLRTKIAAWKNERGKEDFTYDGVSLSSMLDEYMFVRQEKEQEKKRQRDQK  485

Query  1687  KLQGQLMAEQEVLFGSKRSPSQ--SGKK---NVVGGASNKRISVGGAMLQTPYTERAPLS  1851
             KLQ QL AEQE L+GSK SPS+  S KK   + +GGA N+R+S+GGA +Q P T+   L 
Sbjct  486   KLQDQLKAEQEALYGSKPSPSKPLSTKKAPRHSMGGA-NRRLSLGGATMQPPKTD--ILH  542

Query  1852  SHSLKKINPVKQQALANITQNYVALSSGRRESSMHAKQPSCNKSNLQKTEPTQRKPLSPI  2031
             S S++     K + +  ++ +    S G   + +  K+ S N S L++TE T RKP + I
Sbjct  543   SKSVRAAK--KTEEIGTLSPS----SRGLDIAGLPIKKLSFNASTLRETE-TPRKPFAQI  595

Query  2032  SSLSFNTSSANIMDKISESEELREMPASLLTTPIKNVSGIGGNATPKtmpipmpstpasa  2211
             +  +  +S+                       PI N +    N TPK       +     
Sbjct  596   TPGNSVSSTP--------------------VRPITNNTEDDENRTPK--TFTALNPKTPM  633

Query  2212  assiamQMGMTPA---PVAATTPMVGHD--------GVEYSYEEMRAGFLLPR  2337
               +  MQM MTP+    V+AT   + +D         ++YS+EE R    L R
Sbjct  634   TVTAPMQMAMTPSLANKVSATPVSLVYDKPEVTLQEDIDYSFEERRLAIYLAR  686



>ref|XP_003619685.1| Protein regulator of cytokinesis [Medicago truncatula]
Length=795

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/755 (48%), Positives = 495/755 (66%), Gaps = 73/755 (10%)
 Frame = +1

Query  247   MYNRQNDQSL-RMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQA  423
             M+   ND  L + ETTC SLL ELQ IW+E+GE E E+D+ML +LEQECLE YRRKVD+A
Sbjct  1     MHKPHNDHPLPQAETTCGSLLQELQIIWHEVGESESEKDRMLYELEQECLEVYRRKVDKA  60

Query  424   SRSCAQLRQAVAESEAELARICAALGEQPVNVRQS---SRSLKTELQAIMPlleemkkrk  594
             + S AQLRQ +A+SEAEL  IC+ +GE+PV+ RQS   +RSLK EL  I+P LEEM+KRK
Sbjct  61    NCSRAQLRQEIADSEAELTAICSEMGERPVHSRQSGQKARSLKEELAMILPELEEMQKRK  120

Query  595   lerkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSD  774
              ER++QF EV +QI S+  E+    + +   + +DE+DLSLR+LE++   L +LQKEKSD
Sbjct  121   YERRNQFKEVQEQIHSISNEISGPSENVP--LVVDETDLSLRKLEELHRQLHTLQKEKSD  178

Query  775   RLKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELRE  954
             RLK+V D+L +L+SLC VLG+DFK T+ E+HP+LG+S   +SV+ +TI +L+ +I ELR 
Sbjct  179   RLKKVQDNLHTLSSLCSVLGLDFKQTVSEVHPSLGNSEGSRSVNNDTISQLALSIQELRG  238

Query  955   VKIQRLH-----------MLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTE  1101
             VK+QR+             LQ+LAT+++ELWNLMD P+EEQQ+F NVT  IAASE E+TE
Sbjct  239   VKLQRMQKVETYKLIMIWQLQDLATSLLELWNLMDTPIEEQQVFQNVTCNIAASEHEVTE  298

Query  1102  PNALSLDLLKSAEIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAIDDSIEFTDETI  1281
             PN LS + +   E EVSRL+++KSSKMKE++ KKR  LEE+CR+ HL + +S    ++ I
Sbjct  299   PNTLSEEFINHVEAEVSRLEDLKSSKMKELVWKKRAELEEICRKTHL-VQESDAAIEKAI  357

Query  1282  ESGAIDPSHLLEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnryng  1461
             ESG++DP+++LEQ+E QIS VKEEAFSR EILE VEKWL+AC+EESWLE+Y+R++NRYN 
Sbjct  358   ESGSVDPAYVLEQIERQISQVKEEAFSRIEILENVEKWLSACDEESWLEEYSRDENRYNA  417

Query  1462  grgTHLMLKRAEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVS-----------  1608
             GRGTHL LKRAEKAR LVNKIP M + LTS+A  WE ++   F+YDGVS           
Sbjct  418   GRGTHLNLKRAEKARILVNKIPAMTDKLTSKAVAWEKDKSTEFVYDGVSTPLRDTYNITS  477

Query  1609  --LLSMLEQYGLLKQEKELERQRQRDQKKLQGQLMAEQEVLFGSKRSPS--QSGKK---N  1767
               L+SMLE Y LL+QEKE ER+RQRD KKLQ Q++AEQEVL+GSK SPS  QS +K    
Sbjct  478   VRLVSMLEDYILLRQEKEQERRRQRDLKKLQVQMIAEQEVLYGSK-SPSKAQSARKAPRT  536

Query  1768  VVGGASNKRISVGGAMLQTPYTERAPLSSHSLKKINPVKQQALANITQNYVALSSGRRES  1947
               G A+N+R + GG++L+         S+    K+N ++Q    N+       SSG  +S
Sbjct  537   PNGSAANRRGTFGGSVLKPDSKATQSSSTRKTDKVNQIEQ--TNNLDDAISCFSSGGGQS  594

Query  1948  SMHAKQPSCNKSNLQKTE-------------PTQRKPLSPISS-LSFNTSSANIMDKISE  2085
              + A +   + ++    +             P  R+P + ISS +S   +  N  D+ S 
Sbjct  595   HISAARRGFDIADFPTRKYSFGAGIVRDIESPLTRQPFTTISSTISSLENVENAADEFSM  654

Query  2086  SEELREMPASLLTTPIKNVSGIGG--------NATPKtmpipmpstpasaassiamQM--  2235
              ++  +   +    P+   + I          N TPK  PIP+ +T  +   ++++ M  
Sbjct  655   QKQNLQKTLAANNLPLTTTTTISKTDAVVDEENRTPKENPIPVSTTTTTTPKTVSIPMNT  714

Query  2236  GMTPAPVAATTPMVGHD---GVEYSYEEMRAGFLL  2331
              MTPA         G D    +EYS+EE+R GFLL
Sbjct  715   AMTPA-------HFGGDLIQDIEYSFEEIRLGFLL  742



>gb|EPS73877.1| hypothetical protein M569_00872, partial [Genlisea aurea]
Length=691

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/713 (50%), Positives = 485/713 (68%), Gaps = 49/713 (7%)
 Frame = +1

Query  277   RMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAV  456
             +METTC SLL+ELQ IW+E+GE + E+DKML +LE+ECLE YRRKVDQA+R+ AQLRQA+
Sbjct  1     QMETTCGSLLNELQIIWDEVGESDAEKDKMLLELEKECLEVYRRKVDQANRNRAQLRQAI  60

Query  457   AESEAELARICAALGEQPVNVRQSSRS---LKTELQAIMPlleemkkrklerkHQFSEVL  627
             AE+EAELA ICA++GE+PV++RQ+ +    LK EL+AI+P LEEM+KRK +R+ QF +VL
Sbjct  61    AEAEAELASICASMGERPVHIRQADKGNEPLKAELKAIIPQLEEMRKRKSDRRTQFIKVL  120

Query  628   DQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLES  807
             + I+ +  E+ +S    Q+ + ++E+DLSLR+ E+M+  L  L+KEK++RLK+VLD LE 
Sbjct  121   ENIEIIKNEIYRSGVYAQNNVVVEETDLSLRKFEEMQRELQELEKEKNERLKKVLDRLEF  180

Query  808   LNSLCIVLGIDFKNTIGEIHPTLG-DSSALKSVSTETIERLSAAIHELREVKIQRLHMLQ  984
             L+S C+VLG+DFK T+ EIHP+LG +S   K++S  TIE L++ I +LR +KIQR+  LQ
Sbjct  181   LHSCCLVLGMDFKKTVSEIHPSLGGESEGSKNISDNTIELLASTIQKLRTIKIQRMQQLQ  240

Query  985   NLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQE  1164
             +LAT+++ELWNLMD P EEQQ+F  VT  IAASE E+TEPN LSLD +   + EV RL+E
Sbjct  241   DLATSMLELWNLMDTPAEEQQMFQKVTCNIAASEDEITEPNMLSLDFIAYVKAEVFRLEE  300

Query  1165  MKSSKMKEVLLKKRITLEELCRQAHLAI--DDSIEFTDETIESGAIDPSHLLEQLEIQIS  1338
             +K SKMKE++LKK++ LE+LCR+ HL +  D S+E   E +ESGAID S  L Q E++I+
Sbjct  301   LKVSKMKELVLKKKVELEDLCRKTHLNLEADGSVELALEAVESGAIDASSALAQFEVKIA  360

Query  1339  NVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVN  1518
              VKE+A  RK+ILEKV+KW+A+CEEESWLE+YNR+DNRYN GRG HL LKRAEKARALV 
Sbjct  361   EVKEDALRRKDILEKVDKWMASCEEESWLEEYNRDDNRYNAGRGAHLTLKRAEKARALVG  420

Query  1519  KIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQG  1698
             K+P M +AL S+   WE E G  F YDGV LLSML+ Y +L+QEKE+E ++QR+QKKLQG
Sbjct  421   KLPAMADALASKTAAWENEHGTYFTYDGVRLLSMLDNYKVLRQEKEIELKKQREQKKLQG  480

Query  1699  QLMAEQEVLFGSKRSP--SQSGKKN--VVGGASNKRISVGGAML--QTPYTERAPLSSHS  1860
             QL+ EQE L+GSK SP  +Q  KK   + G ASNKR+S+G  ++  QTP     P    +
Sbjct  481   QLLTEQEALYGSKPSPLKNQCTKKGPRLSGAASNKRLSLGAPVVLQQTPKVCIVP---PA  537

Query  1861  LKKINPVKQQA----LANITQN-----YVALSSGRRESSMHAKQPSCNKSNLQKTEPTQR  2013
             L K  P  + A      N+  N       A+SS RR   +       N  +++   P +R
Sbjct  538   LVKTTPTMRDAKKIERGNVDNNRDDVLIAAISSSRRGLDLQ------NARDIES--PLKR  589

Query  2014  KPLSPISSLSFNTSSANIMDKISESEELREMPASLL--TTPIKNVSGIGGNATPKtmpip  2187
             KP SPISS+  ++S +N    ++ S++L      ++  TTP          +TP  +   
Sbjct  590   KPFSPISSM--DSSKSNAAASLNNSQDLNRKHDVVIHKTTPF---------STPSKLLPS  638

Query  2188  mpstpasaassiamQMGMTPAPVAATTPMVGHDGV----EYSYEEMRAGFLLP  2334
               +   +     A      P   AA TP+     V    EYS+EE RAGF+LP
Sbjct  639   SAADVENRTPQQAPPTPSVPMLAAAITPVCPGKSVEQEIEYSFEEKRAGFVLP  691



>ref|XP_007152403.1| hypothetical protein PHAVU_004G127100g [Phaseolus vulgaris]
 gb|ESW24397.1| hypothetical protein PHAVU_004G127100g [Phaseolus vulgaris]
Length=588

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/575 (55%), Positives = 424/575 (74%), Gaps = 17/575 (3%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M   Q D  ++  TTC  LL+ELQ IWNE+GE E E+ +ML +LE+EC+E YRRKVD+A+
Sbjct  1     MAKPQKDLLIQPNTTCECLLNELQIIWNEVGESETEKGRMLYELEEECVEVYRRKVDKAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrkl  597
             RS AQLRQ +A+SEAELA IC+ +GE+PV+ RQ  +   SLK EL  + P L+EM+KRK 
Sbjct  61    RSRAQLRQEIADSEAELACICSTMGERPVHFRQFDKEAGSLKEELSRVHPELDEMRKRKF  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             ER++QF EV +QI S+  E+  + + +  ++   E+DLSLR+LE++   LL+LQKEKS+R
Sbjct  121   ERRNQFIEVQEQIQSISDEIYSTGEYITAIVV--ENDLSLRKLEELHRELLALQKEKSER  178

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             LK+V + + +LNSLC VLG+DFK T+  +HP+LG S   +S ++ETI +L+ AI ELR+V
Sbjct  179   LKKVQEQMYTLNSLCSVLGLDFKQTVSGVHPSLGISEGPRSANSETINQLAIAIQELRKV  238

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             K+QR+  LQ+LA+T++ELWNLMD P+EEQQ+F NVT  IAASE E+TEPN+LS + +   
Sbjct  239   KLQRMQRLQDLASTMLELWNLMDTPIEEQQMFQNVTCNIAASEHEVTEPNSLSENFINYV  298

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHL--AIDDSIEFTDETIESGAIDPSHL  1311
             E EVSRL+E+KSSKMKE++LKKR  LEE+C++ HL   +D ++E+  E IESG +DP+ +
Sbjct  299   EAEVSRLEELKSSKMKELVLKKRAELEEICQKTHLIPKLDSAVEYAVEAIESGCVDPACV  358

Query  1312  LEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKR  1491
             LEQLE+QI++ KEEAF RKEI+EKVEKWLAA +EESWLE+YN ++NRYN GRG+HL LKR
Sbjct  359   LEQLELQIASAKEEAFVRKEIIEKVEKWLAALDEESWLEEYNMDENRYNAGRGSHLTLKR  418

Query  1492  AEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQR  1671
             AEKAR LV K+P M+EALTS+   WE ++G+ F YDG  LLSMLE Y L +QEKE ER++
Sbjct  419   AEKARGLVCKLPAMVEALTSKTASWEKDKGIEFTYDGTCLLSMLENYSLSRQEKEQERRK  478

Query  1672  QRDQKKLQGQLMAEQEVLFGSKRSPS--QSGKKN---VVGGASNKRISVGGAMLQTPYTE  1836
             QR+ KKLQGQ++ E+EVL+GSK SPS  QS KK      G  +++RIS G    QT  +E
Sbjct  479   QRELKKLQGQIIVEKEVLYGSKPSPSKAQSAKKTPRISTGSPASRRISFG---CQTSKSE  535

Query  1837  RAPLSSHSLKKINPVKQQALANITQNYVALSSGRR  1941
                  S S +K +  K   L N+  +   LSS RR
Sbjct  536   LKYSQSFSKRKTD--KAHRLNNLDDDASCLSSARR  568



>emb|CBI38858.3| unnamed protein product [Vitis vinifera]
Length=599

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/550 (62%), Positives = 432/550 (79%), Gaps = 9/550 (2%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M N  +D+  ++ETTC SLL +LQ IW+E+GEP IERD+ML +LEQECLEAY+RKV  A 
Sbjct  1     MNNHHSDRLQQIETTCASLLKDLQSIWDEVGEPNIERDEMLLELEQECLEAYKRKVSHAK  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSRS----LKTELQAIMPlleemkkrk  594
             +S AQLRQA+A+SEAELA IC+A+GE PVNVRQ  ++    LK EL+ I+  LEEM+K K
Sbjct  61    KSRAQLRQAIADSEAELADICSAMGEGPVNVRQFDQNAGGGLKEELKTIVSTLEEMRKLK  120

Query  595   lerkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSD  774
              ERK QF EVLDQ+ ++ KEL K R++    I +DE+DLSL+RL ++   LL LQ EKS+
Sbjct  121   CERKKQFVEVLDQLLNISKELCKPREDNLCKIVMDETDLSLKRLHELHRLLLELQDEKSN  180

Query  775   RLKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELRE  954
             R+KQVL HL++L+SLC VLG+DFK+T+ EIHP++ DS  LK++S++TI++L+A I  LRE
Sbjct  181   RVKQVLAHLKTLDSLCKVLGLDFKHTVVEIHPSMDDSIGLKNLSSDTIDKLAATILSLRE  240

Query  955   VKIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKS  1134
             VK QR+H L++LA +++ELW+LMD P++EQQ+F NVT  IAASE E+TEPN LSLD +  
Sbjct  241   VKTQRMHKLRDLAASMLELWSLMDTPIKEQQMFQNVTSNIAASEHEITEPNTLSLDFINY  300

Query  1135  AEIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAIDDS--IEFTDETIESGAIDPSH  1308
              E EVSRL+++KSSKMKE++LKKR  LEE+C + H+  +    IE + E IESGA++P++
Sbjct  301   VEAEVSRLEQLKSSKMKELILKKRTELEEICSRIHVVSEAYIPIEHSIEAIESGAMEPTY  360

Query  1309  LLEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLK  1488
             LLEQ+E+QI+ VKEEAFSRKEIL+KV KWLAAC+EE WLE+YNR+ NRYN GRG H+ LK
Sbjct  361   LLEQVELQIAKVKEEAFSRKEILDKVVKWLAACDEECWLEEYNRDGNRYNAGRGAHVHLK  420

Query  1489  RAEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQ  1668
             RAEKARALV+KIP M EALT +AK WE ERG+ FLYDGV LLSML+QY  L+QEKE ERQ
Sbjct  421   RAEKARALVSKIPAMTEALTLKAKAWEEERGIEFLYDGVQLLSMLDQYNFLRQEKEQERQ  480

Query  1669  RQRDQKKLQGQLMAEQEVLFGSKRSPSQSGKK---NVVGGASNKRISVGGAMLQTPYTER  1839
             RQR+QK+LQGQL+AEQE LFGSK SPS+SGKK       GA+N+R S GG MLQ P  E+
Sbjct  481   RQREQKRLQGQLIAEQEALFGSKPSPSKSGKKLSRISTIGAANRRFSHGGMMLQAPNPEK  540

Query  1840  APLSSHSLKK  1869
             A L S   KK
Sbjct  541   AALHSCPTKK  550



>gb|EMT05504.1| hypothetical protein F775_31522 [Aegilops tauschii]
Length=727

 Score =   548 bits (1412),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 342/696 (49%), Positives = 463/696 (67%), Gaps = 51/696 (7%)
 Frame = +1

Query  313   LQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAESEAELARICA  492
              Q IW+E+GEP+  RDK L +LEQECL+ YRRKVDQA+R  AQLRQ++AE+EAE+A IC+
Sbjct  59    FQVIWDEVGEPDTVRDKTLLELEQECLDVYRRKVDQANRCRAQLRQSIAEAEAEVAGICS  118

Query  493   ALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrklerkHQFSEVLDQIDSVLKELGK  663
             A+GE PV+VRQS++    L+ EL AI+P LEEM+ +K+ER +QF  VL++I  +  E+  
Sbjct  119   AIGEPPVHVRQSNQKLHGLREELNAIIPYLEEMRTKKVERWNQFVHVLEEIKKISSEIRP  178

Query  664   SRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESLNSLCIVLGIDF  843
             S   +     +D+SDLSLR+ E++   L SLQKEK +RLKQV+DHL +L+SLC VLGIDF
Sbjct  179   S-DFVPFKTPVDQSDLSLRKFEELTKELESLQKEKRERLKQVMDHLNTLHSLCEVLGIDF  237

Query  844   KNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQRLHMLQNLATTIVELWNLM  1023
             K T+ E+HP+L ++   K++S  TIERL+ A+  LRE+KIQR+  LQ+ A+T++ELWNLM
Sbjct  238   KQTVHEVHPSLDEAEGSKNLSNTTIERLALAVDRLREIKIQRMQKLQDFASTMLELWNLM  297

Query  1024  DMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQEMKSSKMKEVLLKK  1203
             D P+EEQQ+F NVT  IAASE E+TEPN LS+D L   E EV RL+++K SKMK+++LKK
Sbjct  298   DTPIEEQQMFQNVTCNIAASEHEITEPNTLSIDFLSYVEAEVLRLEQLKGSKMKDLVLKK  357

Query  1204  RITLEELCRQAHLAIDD--SIEFTDETIESGAIDPSHLLEQLEIQISNVKEEAFSRKEIL  1377
             +  LEE  R+AHL  ++  S EF  E IESGAIDP+ +LEQ+E  I+ VK+EAFSRK+IL
Sbjct  358   KSELEEHRRRAHLIGEEGYSDEFNIEAIESGAIDPALVLEQIEAHIATVKDEAFSRKDIL  417

Query  1378  EKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVNKIPGMLEALTSRA  1557
             EKVE++L ACEEE+WLEDYN++DNRYN G+G HL LKRAEKAR LVNKIPGM++ LT++ 
Sbjct  418   EKVERFLNACEEEAWLEDYNKDDNRYNAGKGAHLTLKRAEKARILVNKIPGMVDVLTTKI  477

Query  1558  KGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQGQLMAEQEVLFGSK  1737
               WE ERG  F YDGV LLSML++Y +++QEKE E++RQRDQKKL  QL AEQE L+GSK
Sbjct  478   IAWENERGKEFTYDGVRLLSMLDEYMIVRQEKEQEKKRQRDQKKLHDQLKAEQEALYGSK  537

Query  1738  RSPS--QSGKK---NVVGGASNKRISVGGAMLQTPYTERAPLSSHSLKKINPVKQQALAN  1902
              SPS  QS KK   + +GG  N+R+S+GGA +Q P T+   L S +++     + + +A+
Sbjct  538   PSPSKPQSIKKAPRHSMGGV-NRRVSMGGATMQAPKTD--ILHSKNVRAAK--RTEDIAH  592

Query  1903  ITQNYVALSSGRRESSMHAKQPSCNKSNLQKTEPTQRKPLSPISSLSFNTSSANIMDKIS  2082
             ++     L  G     +  K+ S N + L++TE T RKP + I     +  S       +
Sbjct  593   LSPASRGLDIG----DLPIKKLSFNATALRETE-TPRKPFAQIMPPPSSVPSTPARSVTN  647

Query  2083  ESEELREMPASLLTTPIKNVSGIGGNATPKtmpipmpstpasaassiamQMGMTPA----  2250
             ++E+    P         N+      A P                   MQ+ MTPA    
Sbjct  648   DTEDENRTPNPKTFGAALNLKTPMTVAAP-------------------MQLAMTPAVANK  688

Query  2251  PVAATTPMVGH-------DGVEYSYEEMRAGFLLPR  2337
               AA   +V         + +EYS+EE R    L R
Sbjct  689   VTAAPVSLVYEKPEPTLPEAIEYSFEERRLAVYLSR  724



>ref|XP_007152402.1| hypothetical protein PHAVU_004G127100g [Phaseolus vulgaris]
 gb|ESW24396.1| hypothetical protein PHAVU_004G127100g [Phaseolus vulgaris]
Length=578

 Score =   541 bits (1394),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 312/570 (55%), Positives = 420/570 (74%), Gaps = 17/570 (3%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M   Q D  ++  TTC  LL+ELQ IWNE+GE E E+ +ML +LE+EC+E YRRKVD+A+
Sbjct  1     MAKPQKDLLIQPNTTCECLLNELQIIWNEVGESETEKGRMLYELEEECVEVYRRKVDKAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrkl  597
             RS AQLRQ +A+SEAELA IC+ +GE+PV+ RQ  +   SLK EL  + P L+EM+KRK 
Sbjct  61    RSRAQLRQEIADSEAELACICSTMGERPVHFRQFDKEAGSLKEELSRVHPELDEMRKRKF  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             ER++QF EV +QI S+  E+  + + +  ++   E+DLSLR+LE++   LL+LQKEKS+R
Sbjct  121   ERRNQFIEVQEQIQSISDEIYSTGEYITAIVV--ENDLSLRKLEELHRELLALQKEKSER  178

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             LK+V + + +LNSLC VLG+DFK T+  +HP+LG S   +S ++ETI +L+ AI ELR+V
Sbjct  179   LKKVQEQMYTLNSLCSVLGLDFKQTVSGVHPSLGISEGPRSANSETINQLAIAIQELRKV  238

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             K+QR+  LQ+LA+T++ELWNLMD P+EEQQ+F NVT  IAASE E+TEPN+LS + +   
Sbjct  239   KLQRMQRLQDLASTMLELWNLMDTPIEEQQMFQNVTCNIAASEHEVTEPNSLSENFINYV  298

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHL--AIDDSIEFTDETIESGAIDPSHL  1311
             E EVSRL+E+KSSKMKE++LKKR  LEE+C++ HL   +D ++E+  E IESG +DP+ +
Sbjct  299   EAEVSRLEELKSSKMKELVLKKRAELEEICQKTHLIPKLDSAVEYAVEAIESGCVDPACV  358

Query  1312  LEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKR  1491
             LEQLE+QI++ KEEAF RKEI+EKVEKWLAA +EESWLE+YN ++NRYN GRG+HL LKR
Sbjct  359   LEQLELQIASAKEEAFVRKEIIEKVEKWLAALDEESWLEEYNMDENRYNAGRGSHLTLKR  418

Query  1492  AEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQR  1671
             AEKAR LV K+P M+EALTS+   WE ++G+ F YDG  LLSMLE Y L +QEKE ER++
Sbjct  419   AEKARGLVCKLPAMVEALTSKTASWEKDKGIEFTYDGTCLLSMLENYSLSRQEKEQERRK  478

Query  1672  QRDQKKLQGQLMAEQEVLFGSKRSPS--QSGKKN---VVGGASNKRISVGGAMLQTPYTE  1836
             QR+ KKLQGQ++ E+EVL+GSK SPS  QS KK      G  +++RIS G    QT  +E
Sbjct  479   QRELKKLQGQIIVEKEVLYGSKPSPSKAQSAKKTPRISTGSPASRRISFG---CQTSKSE  535

Query  1837  RAPLSSHSLKKINPVKQQALANITQNYVAL  1926
                  S S +K +  K   L N+  +   L
Sbjct  536   LKYSQSFSKRKTD--KAHRLNNLDDDASCL  563



>ref|XP_007052042.1| Microtubule associated protein family protein, putative isoform 
3, partial [Theobroma cacao]
 gb|EOX96199.1| Microtubule associated protein family protein, putative isoform 
3, partial [Theobroma cacao]
Length=554

 Score =   539 bits (1389),  Expect = 9e-179, Method: Compositional matrix adjust.
 Identities = 298/558 (53%), Positives = 401/558 (72%), Gaps = 21/558 (4%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M N +++Q  R+ETTC SLL ELQKIW+E+GE + ERD  L  LEQECL+ Y RKVD+A 
Sbjct  1     MLNHKSEQLARIETTCGSLLCELQKIWDEVGEADDERDTTLLDLEQECLKVYTRKVDEAK  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVR-QSSRSLKTELQAIMPlleemkkrkler  603
                 +L + +A ++AE++ +CA++GE PV+   +   +LK EL+ I PLLE+M+++K+ER
Sbjct  61    ECRTKLHRDIAIAKAEISDVCASIGENPVHPDLKPGGNLKEELETIGPLLEDMRRKKVER  120

Query  604   kHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLK  783
              +QF  V+DQI  +  E+   +++  + + +DE++LSLRRLE++   L  LQ EK +RL 
Sbjct  121   INQFIGVIDQIQKISNEILGFKEQDGNKLLVDETNLSLRRLEELHRELHELQNEKINRLN  180

Query  784   QVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKI  963
             QV  HL ++NSLC VLG+DF  TI  IHPTL DS+  K VS  TI RL+A I  L+E+KI
Sbjct  181   QVQGHLNTINSLCTVLGMDFIQTICRIHPTLDDSNGAKDVSNNTIARLAAQIQSLQELKI  240

Query  964   QRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEI  1143
             +R+  +Q LA+T++ELW+LMD P EEQ +F NVT  IAASE E+TEPN LS+D +K+ E 
Sbjct  241   KRMQKIQELASTLLELWHLMDTPAEEQHMFLNVTSKIAASEPEITEPNMLSIDCIKNVEE  300

Query  1144  EVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAIDD--SIEFTDETIESGAIDPSHLLE  1317
             EVSRL+++K+SKMKE++LKK++ LE++CR+ H+ ++   S +++ E +ESGAIDP +LLE
Sbjct  301   EVSRLEQLKTSKMKEIVLKKKVELEDMCRRTHMVLEALISTDYSIEAMESGAIDPLYLLE  360

Query  1318  QLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAE  1497
             Q+++QIS V+EEAFSRKE+LEKVEKWLAACEEESWLE+YNR               KRAE
Sbjct  361   QIDLQISKVREEAFSRKEVLEKVEKWLAACEEESWLEEYNR---------------KRAE  405

Query  1498  KARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQR  1677
             KARA+VNKIP M+EALT +   WE ER   FLYDG  LLS+LE Y  L+QEKELERQRQR
Sbjct  406   KARAVVNKIPAMVEALTLKTTAWERERETEFLYDGRRLLSVLEDYSSLRQEKELERQRQR  465

Query  1678  DQKKLQGQLMAEQEVLFGSKRSPSQSGKKN---VVGGASNKRISVGGAMLQTPYTERAPL  1848
             D KK  GQL+AEQE L+GSK SPS SGKK       GAS++++S+GGAMLQ    E+   
Sbjct  466   DHKKFHGQLIAEQEALYGSKPSPSISGKKAPRMPTVGASDRKLSLGGAMLQQVKPEKPAT  525

Query  1849  SSHSLKKINPVKQQALAN  1902
               H  KK + + Q +  N
Sbjct  526   RLHPNKKADYLNQNSFLN  543



>ref|XP_010443482.1| PREDICTED: 65-kDa microtubule-associated protein 3 [Camelina 
sativa]
Length=711

 Score =   545 bits (1403),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 361/726 (50%), Positives = 487/726 (67%), Gaps = 53/726 (7%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M + Q D  L++ETTC SLL ELQ IW+E+GE E +RDKML +LE+ECLE YRRKVDQA+
Sbjct  1     MASIQKDPILQVETTCGSLLYELQIIWDEVGETETDRDKMLLELERECLEVYRRKVDQAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSRS---LKTELQAIMPlleemkkrkl  597
             R  AQLRQA+A++EAELA IC+A+GE+PV++RQS +S   LK EL  I+P LEEM+KRK+
Sbjct  61    RCRAQLRQAIADAEAELATICSAMGERPVHIRQSDQSVGSLKQELGTILPELEEMQKRKI  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             ER++QF  VL++IDS+  ++    + +     +DE+DLS+R+LE++   L +LQKEKSDR
Sbjct  121   ERRNQFVVVLEEIDSIANDIKGQGEHVHSKPLIDETDLSMRKLEELHCQLQALQKEKSDR  180

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             ++ + +HL +L S C VLG+DF   +G+++PTL D    +S+S  TIE+L AA+ +LREV
Sbjct  181   VEMIRNHLCTLYSHCSVLGMDFNEVVGQVNPTLSDPEGPRSLSDHTIEKLGAAVQKLREV  240

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             KIQR+  LQ+LATT++ELWNLMD P+EEQQ + ++T  IAASE E+TE N+LS + +K  
Sbjct  241   KIQRMQRLQDLATTMLELWNLMDTPIEEQQEYQHITCNIAASEHEITEANSLSEEFIKYV  300

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHL--AIDDSIEFTDETIESGAIDPSHL  1311
             E EV RL  +K+SKMKE++LKKR  LE++CR+ HL    D +I+ T   IESG +D + +
Sbjct  301   EAEVVRLDAVKTSKMKELVLKKRSELEDICRKTHLLPVSDSAIDQTIAAIESGIVDATMV  360

Query  1312  LEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKR  1491
             LE LE  IS +KEEA SRKEILE+VEKWL+AC+EESWLE+YNR+DNRYN GRG HL LKR
Sbjct  361   LEHLEQHISKIKEEALSRKEILERVEKWLSACDEESWLEEYNRDDNRYNAGRGAHLTLKR  420

Query  1492  AEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQR  1671
             AEKAR LVNK+PGM+EAL S+   WE E+G+ FLYDG+ LLSMLE+Y LL+QE+E E +R
Sbjct  421   AEKARNLVNKLPGMVEALASKTIVWEQEKGIEFLYDGIRLLSMLEEYNLLRQEREEEHRR  480

Query  1672  QRDQKKLQGQLMAEQEVLFGSKRSPSQ--SGKKN---VVGGASNKRISVGGAMLQTPYTE  1836
             QRDQKKLQGQL+AEQE L+GSK SPS+   GKK      GGA+N+R+S+G  M QTP   
Sbjct  481   QRDQKKLQGQLIAEQEALYGSKPSPSKPLGGKKAPRMSTGGATNRRLSLGAGMHQTP---  537

Query  1837  RAPLSSHSLKKINPVKQQALANITQNYVALSSGRRE---SSMHAKQPSCNKSNLQKTEPT  2007
                          P K+   A+  QN  ALS+GRR    + +  ++ S N S L ++ P 
Sbjct  538   ------------KPNKK---ADHRQNDGALSNGRRGLDIAGLPTRKQSMNPSELLQS-PL  581

Query  2008  QRKPLSPISSLSFNTSSANIMDKISES---EELREMPASLLTTPIKNVSGIGGNATPKtm  2178
              RKP SPI + +   S ANI     +      + EM  S   TP+KN +        +  
Sbjct  582   VRKPFSPIPT-TVVASKANIATTTQQHLKHNAVNEM--SSFATPVKNNNNNNILRNLEEE  638

Query  2179  pipmpstpasaassiamQMGMTPAPVA-----ATTPMVGH----------DGVEYSYEEM  2313
              +           +  + +  TPA ++     A TP   +          + +EYS+EE 
Sbjct  639   KMMTMMMQTPKNVAAMIPVPSTPATISVPMHTAPTPFTTNARSMSMSEKPEVLEYSFEER  698

Query  2314  RAGFLL  2331
             R  F+L
Sbjct  699   RLAFML  704



>ref|XP_010555626.1| PREDICTED: 65-kDa microtubule-associated protein 3-like [Tarenaya 
hassleriana]
Length=736

 Score =   545 bits (1403),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 376/732 (51%), Positives = 503/732 (69%), Gaps = 62/732 (8%)
 Frame = +1

Query  274   LRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQA  453
             L++ETTC SLL ELQ IW+E+GE E ERDKML +LE+ECLE YRRKVD A+R  AQLRQA
Sbjct  10    LQLETTCGSLLYELQIIWDEVGETEAERDKMLLELERECLEVYRRKVDHANRCRAQLRQA  69

Query  454   VAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrklerkHQFSEV  624
             +A+SEA+LA IC+A+GE+PV++RQS +   SLK EL+ I+P LEEM+KRK ER+++    
Sbjct  70    IADSEAQLAAICSAMGERPVHIRQSDQNAGSLKEELELILPQLEEMQKRKSERRNRQKPF  129

Query  625   LDQIDSVLKEL-------GKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLK  783
             L++     K +         +++       +DE+DLSLR+L+++   L +LQKEK DRL+
Sbjct  130   LEEEKQTPKNIPIIPLPCTPAQEHRSSTALIDETDLSLRKLDELHVQLRTLQKEKIDRLE  189

Query  784   QVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKI  963
             ++ +HL +L SLC VLG+DFK+ +G+++PTL D    +++S  TIE+L+ A+ +L EVKI
Sbjct  190   KIQEHLGTLYSLCSVLGMDFKDVVGQVNPTLADPEGPRNISNHTIEQLATAVQKLWEVKI  249

Query  964   QRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEI  1143
             QR+  LQ+LAT ++ELWNLMD P+EEQQ F +VT  +AASE E+TEPN+LS D LK  E 
Sbjct  250   QRMQRLQDLATAMLELWNLMDTPIEEQQEFQHVTCNVAASEHEITEPNSLSEDFLKYVEA  309

Query  1144  EVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAI--DDSIEFTDETIESGAIDPSHLLE  1317
             EV+RL E+KSSKMKE++LKK+  LEE+CR+ HL +  D++I+ T E +ESG +D + +LE
Sbjct  310   EVARLDEVKSSKMKELVLKKKSELEEICRKIHLVLVSDNAIDHTIEAMESGVLDATMILE  369

Query  1318  QLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAE  1497
             QLE QIS +KEEA SRK+ILEKVEKWL AC+EESWLE+YNR+DNRYN GRG HL LKRAE
Sbjct  370   QLEQQISKIKEEALSRKDILEKVEKWLVACDEESWLEEYNRDDNRYNAGRGAHLTLKRAE  429

Query  1498  KARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQR  1677
             KAR LVNK+PGM+EAL S+   WE E G+ FLYDG+ LLSMLE+Y +L+QEKE ER+RQR
Sbjct  430   KARNLVNKLPGMVEALASKTITWEQEMGIEFLYDGIRLLSMLEEYTILRQEKEEERRRQR  489

Query  1678  DQKKLQGQLMAEQEVLFGSKRSPSQS-GKK----NVVGGASNKRISVGGAMLQTPYTERA  1842
             DQKKLQGQL+AEQE L+GSK SPS+  GKK    +  G  +N+R+SVGG M+QTP     
Sbjct  490   DQKKLQGQLIAEQEALYGSKPSPSKPLGKKAPRMSTGGATANRRLSVGGGMIQTP-----  544

Query  1843  PLSSHSLKKINPVKQQALANITQNY------VALSSGRR---ESSMHAKQPSCNKSNLQK  1995
                     K N    Q+L     NY       ALS+G+R    + +  ++ S N S  Q 
Sbjct  545   --------KPNKKADQSLDRNHVNYHQSDGASALSTGKRCLDIAGVSTRKQSIN-SYEQL  595

Query  1996  TEPTQRKPLSPISSLSFNTSSANIM---DKISESEELRE--MPA----SLLTTPIKNVSG  2148
               P  RKP S ISS     S ANI    +  + S+ L++  +P     +  TTP+KN + 
Sbjct  596   QSPLVRKPFSSISSAV--ASKANITAPPNPKNSSDPLQKTLIPTMNENTPFTTPLKNSNT  653

Query  2149  I--GGNATPKtmpipmps-tpasaassiamQMGMTPAPV---AATTPMVGH-----DGVE  2295
             +      TPK +PI     TPAS + S++MQ  +TPAPV   A+  P+        + VE
Sbjct  654   VLEEEKQTPKNIPIIPLPCTPASVSVSVSMQTAITPAPVPSLASAAPLSARLAEETEEVE  713

Query  2296  YSYEEMRAGFLL  2331
             YS+EE R GF++
Sbjct  714   YSFEERRLGFVV  725



>ref|XP_009391119.1| PREDICTED: 65-kDa microtubule-associated protein 3-like [Musa 
acuminata subsp. malaccensis]
Length=675

 Score =   542 bits (1396),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 360/714 (50%), Positives = 467/714 (65%), Gaps = 66/714 (9%)
 Frame = +1

Query  262   NDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQ  441
             NDQ L++ETTC SLL ELQ IW+E+GE + ERDKML +LEQECLE YRRKVDQA+R  AQ
Sbjct  6     NDQLLQLETTCGSLLYELQIIWDEVGESDAERDKMLLELEQECLEVYRRKVDQANRCRAQ  65

Query  442   LRQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrklerkHQ  612
             LRQA+A+SEAELA IC+A+GE PV+ RQS++   SLK EL++I P LEEM+ +K+ER + 
Sbjct  66    LRQAIADSEAELAAICSAMGEPPVHTRQSNQRAGSLKEELESITPQLEEMRMKKVERLNH  125

Query  613   FSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVL  792
             F EV++QI  +  E+  S      M+A+DESDLS RRLED+   L  LQKEKSDRLKQV+
Sbjct  126   FIEVIEQIRKISLEIMPSGCN-PLMLAVDESDLSTRRLEDLYRQLELLQKEKSDRLKQVM  184

Query  793   DHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQRL  972
             DHL SLN+LC VLG+DFK TI EIHP L ++   K VS  TIERL+ AI  LR++KI+R+
Sbjct  185   DHLSSLNALCSVLGVDFKETIREIHPNLDETEVSKCVSNTTIERLAMAIGRLRDIKIERM  244

Query  973   HMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVS  1152
               LQ+LA+T++ELWNLMD P+EEQQLF NVT  IAASE E+TE N LS+DLL   E EV 
Sbjct  245   KKLQDLASTMLELWNLMDTPIEEQQLFQNVTCNIAASEQEITEANTLSVDLLNYVEAEVL  304

Query  1153  RLQEMKSSKMKEVLLKKRITLEELCRQAHLA--IDDSIEFTDETIESGAIDPSHLLEQLE  1326
             RL+++K SKMKE++LKK+  L+EL  + HL    ++  EF    IESGAID + +LEQ+E
Sbjct  305   RLEQLKVSKMKELVLKKKTELKELRWRVHLVAEAENQEEFEISAIESGAIDATLILEQIE  364

Query  1327  IQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKAR  1506
              QI+ VKEEAFSRK+ILE+VEKW AAC+EE+WLE+YNR++NRYN GRG HL LKRAEKAR
Sbjct  365   FQIATVKEEAFSRKDILERVEKWFAACQEEAWLEEYNRDENRYNAGRGAHLSLKRAEKAR  424

Query  1507  ALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQK  1686
             ALVNKIP ++E L ++   WE ERG+ F YDGV LLSMLE+Y +++QEKE ER+RQRDQK
Sbjct  425   ALVNKIPAIVETLAAKITQWEKERGIEFTYDGVRLLSMLEEYTIVRQEKEQERKRQRDQK  484

Query  1687  KLQGQLMAEQEVLFG----------SKRSPSQSGKKNVVGGASNKRISVGGAMLQTPYTE  1836
             +LQGQ++AEQE L+G          +K+ P  S       G  ++R+S  GA  Q P  +
Sbjct  485   RLQGQIIAEQEALYGSKPSPSKSQSAKKIPRTS------AGCPSRRLS--GAT-QPPKLD  535

Query  1837  RAPLSSHSLKKINPVKQQALANITQNYVALSSGRRESSMHA---KQPSCNKSNLQKTEPT  2007
                   HS K +   K+      T +   LS G R + +     K+ + N     +    
Sbjct  536   HL----HSAKPVRSAKK------TDDLGILSPGARGADIAGLPVKKLTYNAMTTHQEVGV  585

Query  2008  QRKPLSPISSLSF--NTSSANIMDKISESEELREMPASLLT--TPIKNVSGIGGNATPKt  2175
              RKP +PI  ++    T S +I++   E++     P  +LT  TP+   + +    TP  
Sbjct  586   PRKPFAPILPVNNMPTTPSKHIVNTFEENKS----PNVMLTPKTPMAVQAPMQVADTP--  639

Query  2176  mpipmpstpasaassiamQMGMTPAPVAATTPMVGHDGVEYSYEEMRAGFLLPR  2337
                            I   +    APV  T         EYS+EE R  F L R
Sbjct  640   ---------VPPTCLIDKAVAKVVAPVEQT---------EYSFEERRLVFYLSR  675



>ref|XP_006646215.1| PREDICTED: 65-kDa microtubule-associated protein 3-like [Oryza 
brachyantha]
Length=689

 Score =   541 bits (1395),  Expect = 9e-178, Method: Compositional matrix adjust.
 Identities = 363/715 (51%), Positives = 486/715 (68%), Gaps = 60/715 (8%)
 Frame = +1

Query  265   DQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQL  444
             DQ  +M TTC SLL EL  IW+E+GEP+  RD+ML +LEQECLE YRRKVDQA+RS AQL
Sbjct  7     DQLQQMSTTCDSLLLELNVIWDEVGEPDTARDRMLLELEQECLEVYRRKVDQANRSRAQL  66

Query  445   RQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrklerkHQF  615
             RQA+AE+EAELA IC+++GE PV+VRQS++    L+ EL AI+P LEEM+K+K+ER +QF
Sbjct  67    RQAIAEAEAELAGICSSMGEPPVHVRQSNQKLHGLREELNAIVPYLEEMRKKKVERWNQF  126

Query  616   SEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLD  795
              ++++QI  +  E+ +    +   + +D+SD+SLR+++++   L SLQKEKSDRLKQV++
Sbjct  127   VDIIEQIKKISSEI-RPADFVPFKVPVDQSDMSLRKIDELTKDLESLQKEKSDRLKQVIE  185

Query  796   HLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQRLH  975
             HL +L+SLC VLGIDFK T+ E+HP+L ++   K++S  TIE L+AA++ LRE+KIQR+ 
Sbjct  186   HLNTLHSLCEVLGIDFKQTVYEVHPSLDEAEGSKNLSNTTIEMLAAAVNRLREIKIQRMQ  245

Query  976   MLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSR  1155
              LQ+ A++++ELWNLMD P+EEQQ+F N+T  IAASE E+TEPN LS D L   E EV R
Sbjct  246   KLQDFASSMLELWNLMDTPLEEQQMFQNITCNIAASEQEITEPNTLSTDFLNYVESEVLR  305

Query  1156  LQEMKSSKMKEVLLKKRITLEELCRQAHLAIDD--SIEFTDETIESGAIDPSHLLEQLEI  1329
             L+++K+SKMK+++LKK+  LEE  R+AHL  ++  + EF+ E IE+GAIDPS +LEQ+E 
Sbjct  306   LEQLKASKMKDLVLKKKAELEEHRRRAHLIGEEGYAAEFSIEAIEAGAIDPSLVLEQIEA  365

Query  1330  QISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARA  1509
              IS VKEEAFSRK+ILEKVE+W  ACEEE+WLEDYN++DNRYN GRG HL LKRAEKAR 
Sbjct  366   HISTVKEEAFSRKDILEKVERWRNACEEEAWLEDYNKDDNRYNAGRGAHLTLKRAEKARI  425

Query  1510  LVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKK  1689
             LVNKIPGM++ L ++   WE ER   F YDGVSLL+MLE+Y +++QEKE E++RQRDQKK
Sbjct  426   LVNKIPGMVDVLRTKIVAWEHERQKEFTYDGVSLLTMLEEYLIVRQEKEQEKKRQRDQKK  485

Query  1690  LQGQLMAEQEVLFGSKRSPS--QSGKK---NVVGGASNKRISVGGAMLQTPYTERAPLSS  1854
             +Q QL AEQE L+GSK SPS  QS KK   + +GGA N+R+S+GGA LQ P T+      
Sbjct  486   IQDQLKAEQEALYGSKPSPSKPQSTKKAPRHSMGGA-NRRLSLGGATLQPPKTDIL----  540

Query  1855  HSLKKINPVKQQALANITQNYVALSSGRRE---SSMHAKQPSCNKSNLQKTEPTQRKPLS  2025
             HS K +  VK+      T+    LS G R    + +  K+ S N S L++ E T RKP +
Sbjct  541   HS-KSVRAVKK------TEEIGTLSPGSRGLDIAGLPIKKLSFNASTLREME-TPRKPFA  592

Query  2026  PISSLSFNTSSANIMDKISESEELREMPASLLTTPIKNVSGIGGNATPKtmpipmpstpa  2205
              I      T   N+              +S    PI N +    N TPK       +   
Sbjct  593   QI------TPGCNV--------------SSTPVRPITNSTEEDENRTPK--TFTALNPKT  630

Query  2206  saassiamQMGMTPA---PVAATTPMVGH--------DGVEYSYEEMRAGFLLPR  2337
                 +  MQM MTP     V+AT   + +        D +EYS+EE R    L +
Sbjct  631   PMTVTAPMQMAMTPGLANKVSATPVSLVYDKPEVTLPDDIEYSFEERRLAIYLAK  685



>ref|NP_199973.1| microtubule associated protein MAP65-3 [Arabidopsis thaliana]
 sp|Q9FHM4.1|MA653_ARATH RecName: Full=65-kDa microtubule-associated protein 3; Short=AtMAP65-3; 
AltName: Full=Protein PLEIADE [Arabidopsis thaliana]
 dbj|BAB08676.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED96102.1| microtubule associated protein MAP65-3 [Arabidopsis thaliana]
Length=707

 Score =   542 bits (1396),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 370/724 (51%), Positives = 491/724 (68%), Gaps = 53/724 (7%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M + Q D  L++ETTC SLL ELQ IW+E+GE E +RD+ML +LE+ECLE YRRKVDQA+
Sbjct  1     MASVQKDPILQVETTCGSLLFELQIIWDEVGETETDRDQMLLELERECLEVYRRKVDQAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSRS---LKTELQAIMPlleemkkrkl  597
             R  AQLRQA+A++EA+LA IC+A+GE+PV++RQS +S   LK EL  I+P LEEM+KRK+
Sbjct  61    RCRAQLRQAIADAEAQLAAICSAMGERPVHIRQSDQSVGSLKQELGRILPELEEMQKRKV  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIAL-DESDLSLRRLEDMKSHLLSLQKEKSD  774
             ER++QF  V++QIDS+  ++ K + EL H   L DE++LS+R+LE++   L  LQKEK D
Sbjct  121   ERRNQFIVVMEQIDSITNDI-KGQGELVHSEPLIDETNLSMRKLEELHCQLQVLQKEKID  179

Query  775   RLKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELRE  954
             R++ +  HL +L S C VLG+DF   +G+++PTL D    +S+S  TIE+L AA+ +L E
Sbjct  180   RVETIRKHLCTLYSHCSVLGMDFNEVVGQVNPTLSDPEGPRSLSDHTIEKLGAAVQKLME  239

Query  955   VKIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKS  1134
             VKIQR+  LQ+LATT++ELWNLMD P+EEQQ + ++T  IAASE E+TE N+LS D +K 
Sbjct  240   VKIQRMQRLQDLATTMLELWNLMDTPIEEQQEYQHITCNIAASEHEITEANSLSEDFIKY  299

Query  1135  AEIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHL--AIDDSIEFTDETIESGAIDPSH  1308
              E EV RL E+K+SKMKE++LKKR  LEE+CR+ HL    D +I+ T   IESG +D + 
Sbjct  300   VEAEVVRLDEVKASKMKELVLKKRSELEEICRKTHLLPVSDSAIDQTIVAIESGIVDATM  359

Query  1309  LLEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLK  1488
             +LE LE  IS +KEEA SRKEILE+VEKWL+AC+EESWLE+YNR+DNRYN GRG HL LK
Sbjct  360   VLEHLEQHISKIKEEALSRKEILERVEKWLSACDEESWLEEYNRDDNRYNAGRGAHLTLK  419

Query  1489  RAEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQ  1668
             RAEKAR LV K+PGM+EAL S+   WE E G+ FLYDG+ LLSMLE+Y +L+QE+E E +
Sbjct  420   RAEKARNLVTKLPGMVEALASKTIVWEQENGIEFLYDGIRLLSMLEEYNILRQEREEEHR  479

Query  1669  RQRDQKKLQGQLMAEQEVLFGSKRSPSQ--SGKKN---VVGGASNKRISVGGAMLQTPYT  1833
             RQRDQKKLQGQL+AEQE L+GSK SPS+   GKK      GGASN+R+S+G AM QTP  
Sbjct  480   RQRDQKKLQGQLIAEQEALYGSKPSPSKPLGGKKAPRMSTGGASNRRLSLGAAMHQTP--  537

Query  1834  ERAPLSSHSLKKINPVKQQALANITQNYVALSSGRRE---SSMHAKQPSCNKSNLQKTEP  2004
                           P K+   A+   N  ALS+GRR    + + +++ S N S + ++ P
Sbjct  538   -------------KPNKK---ADHRHNDGALSNGRRGLDIAGLPSRKQSMNPSEMLQS-P  580

Query  2005  TQRKPLSPISSLSFNTSSANI----MDKISESEELREMPASLLTTPIKNVSGIGGN----  2160
               RKP SPIS+ +   S ANI      ++ ++  + E+  S   TPIKN + I  N    
Sbjct  581   LVRKPFSPIST-TVVASKANIATTTTQQLPKNNAVNEI--SSFATPIKN-NNILRNLEEE  636

Query  2161  -------ATPKtmpipmpstpasaassiamQMGMTPAPVAATTPMVGHDGVEYSYEEMRA  2319
                     TPK +   +P     A  S+ M    TP    A       + VEYS+EE R 
Sbjct  637   KMMTMMMQTPKNVAAMIPIPSTPATVSVPMHTAPTPFTNNARLMSEKPEVVEYSFEERRL  696

Query  2320  GFLL  2331
              F+L
Sbjct  697   AFML  700



>ref|XP_010536523.1| PREDICTED: 65-kDa microtubule-associated protein 3 isoform X2 
[Tarenaya hassleriana]
Length=689

 Score =   540 bits (1392),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 355/679 (52%), Positives = 464/679 (68%), Gaps = 42/679 (6%)
 Frame = +1

Query  397   AYRRKVDQASRSCAQLRQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMP  567
              YRRKVDQA+R  AQLRQA+A+SEA+LA IC+A+GE+PV++RQS +   SLK EL  I+P
Sbjct  12    VYRRKVDQANRCRAQLRQAIADSEAQLATICSAMGERPVHIRQSDQNAGSLKEELGMILP  71

Query  568   lleemkkrklerkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHL  747
              LEEM+KRK ER++QF EVL+QID +  E+    + L     +DE+DLSLR+LE++   L
Sbjct  72    QLEEMQKRKSERRNQFVEVLEQIDKISNEINGQLEHLSSEALIDETDLSLRKLEELHVQL  131

Query  748   LSLQKEKSDRLKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERL  927
               LQKEKSDRL+++ +HL +L SLC VLG+DFK  +G++  TL D    +S++  TIE+L
Sbjct  132   CILQKEKSDRLEKIQEHLGTLYSLCSVLGMDFKQIVGQVDRTLSDPEGPRSINNHTIEQL  191

Query  928   SAAIHELREVKIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPN  1107
               A+ +L+E+KIQR+  LQ+LA+ ++ELWNLMD P+EEQQ F +VT  IAASE E+TEPN
Sbjct  192   GTAVQKLQEIKIQRMQRLQDLASAMLELWNLMDTPIEEQQEFQHVTCNIAASEHEITEPN  251

Query  1108  ALSLDLLKSAEIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAI--DDSIEFTDETI  1281
             +LS D LK  E EV+RL E+KSSKMKE++LKKR  LEE+CR+ HL    D +++ T E I
Sbjct  252   SLSEDFLKYVETEVARLDEVKSSKMKELVLKKRSELEEICRKTHLVPVSDSAMDHTIEAI  311

Query  1282  ESGAIDPSHLLEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnryng  1461
             ESG +D + +LEQ+E+QIS +KEE+ SRKE+LEKVEKWLAAC+EESWLE+YNR+DNRYN 
Sbjct  312   ESGVLDATTVLEQIELQISKIKEESLSRKEVLEKVEKWLAACDEESWLEEYNRDDNRYNA  371

Query  1462  grgTHLMLKRAEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLL  1641
             GRG HL LKRAEKAR LVNK+PGM+EAL S+   WE E+G+ FLYDG+ LLSMLE+Y +L
Sbjct  372   GRGAHLALKRAEKARNLVNKLPGMVEALASKTIVWEQEKGIEFLYDGIRLLSMLEEYTIL  431

Query  1642  KQEKELERQRQRDQKKLQGQLMAEQEVLFGSKRSPSQS-GKKN---VVGGASNKRISVGG  1809
             +QEKE ER+RQRDQKKLQGQL+AEQE L+GSK SPS+  GKK      GGA+N+R+SVGG
Sbjct  432   RQEKEEERRRQRDQKKLQGQLIAEQEALYGSKPSPSKPLGKKAPRMSTGGATNRRLSVGG  491

Query  1810  AMLQTPYTERAPLSSHSLKKINPVKQQALANITQNYVALSSGRRE---SSMHAKQPSCNK  1980
              M+QTP   +          +N  +Q           ALSSGRR    + +  ++ S N 
Sbjct  492   GMIQTPKPNKKSDQILERNHVNNHRQ------IDGVAALSSGRRGLDIAGIPTRKLSINS  545

Query  1981  SNLQKTEPTQRKPLSPISSLSFNTSSANIM----DKISESEELRE--MPA----SLLTTP  2130
              + Q   P  RKP SPIS+     S ANI      KI+    L++  +P     +  TTP
Sbjct  546   YD-QLQSPLVRKPFSPISTAV--ASKANITAPPNPKINREPPLQKTLIPPTNDNTPFTTP  602

Query  2131  IKNVSGI---GGNATPKtmpipmpstpasaassiamQMGMTPAPVA--ATTPMVGHDG--  2289
             +KN S         TPK     +P     A  S+ MQ  +TPAP+   A+TP     G  
Sbjct  603   LKNSSKTLLEEEKHTPK-NVPVIPVPCTPATVSVPMQTAVTPAPIPLHASTPFPARLGEE  661

Query  2290  ---VEYSYEEMRAGFLLPR  2337
                VEYS+EE R GF++ R
Sbjct  662   PEEVEYSFEERRLGFVVQR  680



>ref|XP_006401934.1| hypothetical protein EUTSA_v10012827mg [Eutrema salsugineum]
 gb|ESQ43387.1| hypothetical protein EUTSA_v10012827mg [Eutrema salsugineum]
Length=701

 Score =   540 bits (1391),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 362/717 (50%), Positives = 482/717 (67%), Gaps = 45/717 (6%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M + + D  L++ETTC SLL ELQ IW+E+GE E ERDKML +LE+ECLE YRRKVDQA+
Sbjct  1     MASAKKDPILQVETTCGSLLYELQIIWDEVGETETERDKMLLELERECLEVYRRKVDQAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSRS---LKTELQAIMPlleemkkrkl  597
             R  AQLRQA+A++EAELA IC+A+GE+PV++RQS +S   LK EL  I+P LEEM+KRK+
Sbjct  61    RCRAQLRQAIADAEAELAAICSAMGERPVHIRQSDQSVGSLKQELGTILPELEEMQKRKI  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             ERK+QF  VL++I ++  ++    + +     +DE+DLS+R+LE++   L +LQKEKSDR
Sbjct  121   ERKNQFVVVLEEIQNITNDIKGQGEHVPSKPLIDETDLSMRKLEELHCQLQALQKEKSDR  180

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             ++ +  HL SL S C VLG+DF + +G+++PTL D    +S+S  TIE+L AA+ +LR+V
Sbjct  181   VETIRKHLCSLYSHCSVLGMDFNDVVGQVNPTLSDPEGPRSLSDHTIEKLGAAVQKLRDV  240

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             KIQR+  LQ+LATT++ELWNLMD PVEEQQ + ++T  IAASE E+TE N+LS D +K  
Sbjct  241   KIQRMQRLQDLATTMLELWNLMDTPVEEQQEYQHITCNIAASEHEITEANSLSEDFIKYV  300

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHL--AIDDSIEFTDETIESGAIDPSHL  1311
             E EV RL E+K+SKMKE++LKKR  LE++CR+ H+    D +I+ T   IESG +D + +
Sbjct  301   EAEVVRLDEVKASKMKELVLKKRSELEDICRKTHMLPVSDSAIDQTIVAIESGIVDATMV  360

Query  1312  LEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKR  1491
             LE LE  IS +KEEA SRKEILEKVEKWL+AC+EESWLE+YNR+DNRYN GRG HL LKR
Sbjct  361   LEHLEQHISKIKEEALSRKEILEKVEKWLSACDEESWLEEYNRDDNRYNAGRGAHLTLKR  420

Query  1492  AEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQR  1671
             AEKAR LVNK+PGM+EAL S+   WE E+G+ FLYDG+ LLSMLE+Y LL+QE+E E +R
Sbjct  421   AEKARNLVNKLPGMVEALASKTIVWEQEKGIEFLYDGIRLLSMLEEYNLLRQEREEEHRR  480

Query  1672  QRDQKKLQGQLMAEQEVLFGSKRSPSQ--SGKK----NVVGGASNKRISVGGAMLQTPYT  1833
             QRD KKLQGQL+AEQE L+GSK SPS+   GKK    +  G A+N+R+S+G  M QTP  
Sbjct  481   QRDHKKLQGQLIAEQEALYGSKPSPSKPLGGKKAPRMSTGGAATNRRLSLGAGMHQTP--  538

Query  1834  ERAPLSSHSLKKINPVKQQALANITQNYVALSSGRRE---SSMHAKQPSCNKSNLQKTEP  2004
                           P K+   A+   N  ALS+GRR    + +  ++ S N    Q   P
Sbjct  539   -------------KPNKK---ADHRHNDGALSTGRRGLDVAGLPTRKQSMNPCE-QLQSP  581

Query  2005  TQRKPLSPISSLSFNTSSANIMDKISESEELREMPASLLTTPIKNVSGIGGNATPKtmpi  2184
               RKP SPIS+ +   S ANI    + +++L   P        +    +    TPK +  
Sbjct  582   LVRKPFSPIST-TVVASKANIATTTTTTQQLLATPVKNKNLEEEKKMMMMMMQTPKNVAA  640

Query  2185  pmpstpasaassiamQMGMTP--------APVAATTPMVGHDGVEYSYEEMRAGFLL  2331
              +P     A  S+ MQ   TP        A +    P    + VEYS+EE R  F+L
Sbjct  641   MIPIPSTPATVSVPMQTAATPLNNNNTTNAKLVLEKP---EEVVEYSFEERRLAFML  694



>ref|XP_009400493.1| PREDICTED: 65-kDa microtubule-associated protein 3-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009400494.1| PREDICTED: 65-kDa microtubule-associated protein 3-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009400495.1| PREDICTED: 65-kDa microtubule-associated protein 3-like [Musa 
acuminata subsp. malaccensis]
Length=627

 Score =   537 bits (1384),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 303/533 (57%), Positives = 396/533 (74%), Gaps = 7/533 (1%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M    ND   ++ETTC SLL+ELQ IW+E+GE + E+DKML +LEQECL  YRRKVDQA+
Sbjct  1     MARNPNDPLPQVETTCESLLNELQVIWDELGESDAEKDKMLLELEQECLNVYRRKVDQAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSRSLKTELQAIMPlleemkkrklerk  606
                AQL+Q +A+SEAE+A IC+++GE+PV++RQS   LK +L+A    LEEM KRK ER 
Sbjct  61    LYRAQLQQQIADSEAEIAAICSSMGERPVHIRQSPGFLKEQLKATALKLEEMHKRKSERL  120

Query  607   HQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQ  786
             +QF EVLDQI  +  E+  +  +     A+D SDLS+R LED+++ L SLQKEKS+RL+Q
Sbjct  121   NQFLEVLDQIQKISTEICPTEYD-PSKFAIDGSDLSVRILEDLQTQLQSLQKEKSERLRQ  179

Query  787   VLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQ  966
             V+DHL +L  LC+V+GIDFK TI E+ P+L      K++S  TIE L++AI  +R+VKI+
Sbjct  180   VMDHLNTLKKLCLVVGIDFKETIREVQPSLDQDEGSKNISNSTIESLASAIENMRKVKIK  239

Query  967   RLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIE  1146
             R+  LQ+LAT ++ELWNLMD P EEQQ F  VT  IAASE E TEPNALS+D +   E E
Sbjct  240   RMQKLQDLATAMLELWNLMDTPNEEQQQFQKVTCNIAASEQEFTEPNALSMDFINYVEAE  299

Query  1147  VSRLQEMKSSKMKEVLLKKRITLEELCRQAHLA--IDDSIEFTDETIESGAIDPSHLLEQ  1320
             V RL+++K+SK+KE++L+K+  LEE+ R+ HL    D   EF+ + +E+GA D S +LE 
Sbjct  300   VLRLEQLKASKLKELVLRKKTELEEIRRRTHLVAEADYEPEFSIDAVEAGATDASLVLEH  359

Query  1321  LEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEK  1500
             +E QIS  KEEAFSRK+ILE+VEKWLAACEEE+WLE+YNR++NRY+ GRG HL LKRAEK
Sbjct  360   IEAQISTAKEEAFSRKDILERVEKWLAACEEEAWLEEYNRDENRYSAGRGAHLTLKRAEK  419

Query  1501  ARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRD  1680
             ARALV+KIP M++ L ++   WE ERG  F+YDG  LLSMLEQY  + QEKE ER+RQRD
Sbjct  420   ARALVSKIPAMVDTLENKVTAWEKERGTEFIYDGAPLLSMLEQYITVSQEKEQERKRQRD  479

Query  1681  QKKLQGQLMAEQEVLFGSKRSPS--QSGKKN--VVGGASNKRISVGGAMLQTP  1827
             QKKLQGQL AE+EVL+GSK SP+  QS KK    +  + ++RIS+G A   +P
Sbjct  480   QKKLQGQLTAEKEVLYGSKPSPAKLQSFKKTHKTLTLSPSQRISLGAAATNSP  532



>ref|XP_007038466.1| Microtubule associated protein (MAP65/ASE1) family protein isoform 
5 [Theobroma cacao]
 gb|EOY22967.1| Microtubule associated protein (MAP65/ASE1) family protein isoform 
5 [Theobroma cacao]
Length=485

 Score =   532 bits (1370),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 300/481 (62%), Positives = 384/481 (80%), Gaps = 5/481 (1%)
 Frame = +1

Query  259   QNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCA  438
             +ND  L++ETTC +LL ELQ IW+E+GE + +RDKML +LEQECLE YRRKVDQA+R  A
Sbjct  5     KNDPLLQVETTCGTLLYELQIIWDEVGETDSDRDKMLLELEQECLEVYRRKVDQANRCRA  64

Query  439   QLRQAVAESEAELARICAALGEQPVNVRQS---SRSLKTELQAIMPlleemkkrklerkH  609
             QLRQ +A+SEAELA IC+A+GE+PV++RQS   S SLK EL+ I+P LEEM+KRK+ER++
Sbjct  65    QLRQTIADSEAELAAICSAMGERPVHIRQSDQNSGSLKEELRKILPQLEEMRKRKVERRN  124

Query  610   QFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQV  789
             QF EVL+Q   +  E+  S + +     +DE+DLSLR+LE++   L  LQKEKSDRLKQV
Sbjct  125   QFIEVLEQTQKITNEIYGSTESVSLKTVVDETDLSLRKLEELHRQLHELQKEKSDRLKQV  184

Query  790   LDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQR  969
              DHL  LNSLC V+G+DFK T+ E+HP+LGDS  L+S+S  TIE+L+ AI +LREVKIQR
Sbjct  185   QDHLHMLNSLCSVMGMDFKLTVSEVHPSLGDSDGLRSISNNTIEKLAIAIKKLREVKIQR  244

Query  970   LHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEV  1149
             +  LQ+LATT++ELWNLMD P+EEQQ+F NVT  IAASE E+TEPN LS+D +   E EV
Sbjct  245   MQRLQDLATTMLELWNLMDTPIEEQQMFQNVTCNIAASEHEITEPNTLSVDFINYVEAEV  304

Query  1150  SRLQEMKSSKMKEVLLKKRITLEELCRQAHLA--IDDSIEFTDETIESGAIDPSHLLEQL  1323
             SRL+E+KSSKMKE++LKKR  LE++CR+ HL    D +IE   E IESGA+D + +LEQ+
Sbjct  305   SRLEELKSSKMKELVLKKRSELEDICRKTHLVPDSDSAIEDAIEAIESGAVDAATILEQI  364

Query  1324  EIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKA  1503
             E+QI+ VKEEAFSRKEILEKVEKWL AC+EE WLE+YNR++NRYN G+G HL LKRAEKA
Sbjct  365   ELQIAKVKEEAFSRKEILEKVEKWLTACDEECWLEEYNRDENRYNAGKGAHLTLKRAEKA  424

Query  1504  RALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQ  1683
             R+LVNK+PGM+EAL S+   WE ER + F+YDG+ LLSMLE+Y +L+QEKE ER+R R +
Sbjct  425   RSLVNKLPGMVEALASKTLAWEKEREIKFMYDGIRLLSMLEEYTILRQEKEQERRRLRGK  484

Query  1684  K  1686
             +
Sbjct  485   R  485



>gb|KHG02023.1| 65-kDa microtubule-associated 4 -like protein [Gossypium arboreum]
Length=709

 Score =   538 bits (1387),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 336/721 (47%), Positives = 483/721 (67%), Gaps = 39/721 (5%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M N  ++   RME TC SLL ELQ++W+E+GE + + +  L ++EQECL+ Y +K+ +A 
Sbjct  1     MSNHYSEHFTRMEATCGSLLCELQRLWDEVGETDGQWETTLLEIEQECLKVYMKKIQEAK  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVR-QSSRSLKTELQAIMPlleemkkrkler  603
                 +L++ +A + AEL+ I  ++GE  V    +   +LK EL+AI+PLLE+M+++K+ER
Sbjct  61    ECRTKLQRDIATAMAELSDIFTSMGESSVQRDLKPGGNLKEELEAIIPLLEDMRRKKVER  120

Query  604   kHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLK  783
              +QF  V++QI  +  ++   +++  + + +DE++LSLRRLE++ S L  LQ EK +RL 
Sbjct  121   INQFVGVVEQIQKLSIDIFGVKEQNGNKVFVDETNLSLRRLEELHSELHELQHEKINRLN  180

Query  784   QVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKI  963
             QV  HL+++NSLC VLG++FK TI  +HP L D +  K VS  TI RL+A I  L+E+K+
Sbjct  181   QVQGHLDTINSLCTVLGMNFKQTICRVHPALDDLNGAKDVSNSTIARLAAQIQSLQELKL  240

Query  964   QRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEI  1143
             +R+  +Q+LA+ ++E W+LMDMPVEEQQ+F NVT  I ASE E TEP+ LS+D ++  E 
Sbjct  241   KRMQKIQDLASALLEFWHLMDMPVEEQQMFLNVTCKITASEPEFTEPDLLSVDSIEKVED  300

Query  1144  EVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAIDD--SIEFTDETIESGAIDPSHLLE  1317
             EVSRL+++K+S+MKE++LKK++ LE++CR+ H+ ++   S +++ E +ESGAIDP +LLE
Sbjct  301   EVSRLEQLKTSRMKEIVLKKKVELEDMCRRTHMVMEALISTDYSIEAMESGAIDPLYLLE  360

Query  1318  QLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAE  1497
             Q+++QIS V+EEA SRKEILEKVEKWLAACEEESWLE+YNR+DNRYN GRG HL+LKRAE
Sbjct  361   QIDLQISKVREEAVSRKEILEKVEKWLAACEEESWLEEYNRDDNRYNAGRGAHLILKRAE  420

Query  1498  KARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQR  1677
             KAR +VNKIP ++EAL  + K WE ERG  FLYDG  LL+MLE Y  L+QEKE +RQRQR
Sbjct  421   KARTVVNKIPALVEALALKTKAWEKERGAEFLYDGGRLLTMLEDYSSLRQEKETQRQRQR  480

Query  1678  DQKKLQGQLMAEQEVLFGSKRSPSQSGKK---NVVGGASNKRISVGGAMLQTPYTERAPL  1848
             +QKKL GQL+AEQE L+GSK SP+ + KK        ASN+++S GGAMLQ    E+   
Sbjct  481   NQKKLHGQLIAEQEALYGSKPSPTMTAKKASRTPTTAASNRKLSFGGAMLQQIKPEKPTS  540

Query  1849  SSHSLKKINPVKQQALANITQNYVALS-SGRRESSMHA----KQPSCNKSNLQKTEPTQR  2013
               H  KK + + + + AN  ++    S SGRR S +      KQP       +   P  R
Sbjct  541   RFHPNKKADSLNENSFANHHRSSGFTSHSGRRSSEVSGHVVKKQPLSAAKMREMESPAVR  600

Query  2014  KPLSPISSLSFNTSSANIMDKISESEELR---------EMPASLLTTPIKNVSGIGGNAT  2166
             KPLS +S         N+++ I E E+++         + P +  + P   V+G   N T
Sbjct  601   KPLSSVS---------NVVNPIVEQEKVQKGQRLSPGCKTPMAKASKP--TVNGEDQNRT  649

Query  2167  PKtmpipmpstpasaassiamQMGMTPA-PVAATTPMVGH-----DGVEYSYEEMRAGFL  2328
             PK MPIP+P+TP++ ++ +   M +TPA P    T            +EYS+EE+RAGF 
Sbjct  650   PKAMPIPVPTTPSTISAPML--MAITPATPATLGTYKFEKILEQVQQIEYSFEEVRAGFF  707

Query  2329  L  2331
             +
Sbjct  708   M  708



>gb|EYU19491.1| hypothetical protein MIMGU_mgv1a018733mg [Erythranthe guttata]
Length=531

 Score =   531 bits (1368),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 291/504 (58%), Positives = 388/504 (77%), Gaps = 4/504 (1%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M   +N+   R++TTC SLL ELQ IW+E+G  + ER+++L ++EQEC E +R+KVD A+
Sbjct  1     MLTSKNNLFSRLDTTCGSLLYELQLIWDEVGVSDAERERILLEIEQECSEVFRKKVDHAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQS---SRSLKTELQAIMPlleemkkrkl  597
             RS AQLRQA+A++EAELA IC+A+GE+PV++RQS   S SLK EL+AI+P +EEM+KR+ 
Sbjct  61    RSRAQLRQAIADTEAELATICSAMGERPVHIRQSDQSSESLKAELRAILPQIEEMRKRRT  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             ERK+QF EVL+ I S+  E+ +S        A++E+DLS+++LE++   L  LQKEKS+R
Sbjct  121   ERKNQFIEVLENIQSIKNEINRSDGFNLSDSAINETDLSMKKLEELHRELQGLQKEKSER  180

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             LK V D L SL SLC+VLG D K    EIHP+LG++   KS+S  TI++L   I + RE+
Sbjct  181   LKLVQDGLNSLYSLCVVLGFDSKKMASEIHPSLGETEGSKSISNSTIDQLGTVIRKQREL  240

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             K+QR+ MLQ+LA +++ELWNLMD P EEQQ+F  VTR +AASE E+TEP+ LSL  +   
Sbjct  241   KLQRMQMLQDLAASLLELWNLMDTPTEEQQIFQKVTRKLAASEDEITEPDMLSLGYINYV  300

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAID-DSIEFTDETIESGAIDPSHLL  1314
             + EVSRL+++K+SKMKE++L+K+  LE +CR+ HL  D D +E + + IESGA D +++L
Sbjct  301   KAEVSRLEDLKASKMKELVLRKKAELEVICRKTHLIPDTDRVEISIDAIESGATDAAYVL  360

Query  1315  EQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRA  1494
             EQ+E+QI+ VKEEA SRKEILEKVEKW +ACEEESWLE+YNR++NRYN GRGTHL LKRA
Sbjct  361   EQIELQIARVKEEALSRKEILEKVEKWKSACEEESWLEEYNRDNNRYNAGRGTHLTLKRA  420

Query  1495  EKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQ  1674
             EKARALVNK+P M + L S+   W+ E G+ F YDG  LLSMLE+Y +L+QEKELER+RQ
Sbjct  421   EKARALVNKLPAMADTLASKIIAWQNENGIKFTYDGGFLLSMLEEYKVLRQEKELERKRQ  480

Query  1675  RDQKKLQGQLMAEQEVLFGSKRSP  1746
             RDQ+KLQGQL+A QE L GSK SP
Sbjct  481   RDQRKLQGQLLAGQETLHGSKSSP  504



>ref|XP_006655570.1| PREDICTED: 65-kDa microtubule-associated protein 3-like [Oryza 
brachyantha]
Length=698

 Score =   536 bits (1382),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 354/715 (50%), Positives = 475/715 (66%), Gaps = 62/715 (9%)
 Frame = +1

Query  256   RQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSC  435
             R  ++ L MET C S++ ELQ IW+E+GEPE  RD+ML +LEQECLE YRRKVDQA+RS 
Sbjct  18    RSKERLLPMETMCGSIMRELQAIWDEVGEPEAARDRMLLELEQECLEVYRRKVDQANRSR  77

Query  436   AQLRQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrklerk  606
             AQLRQA+A+SEAELA +C+A+GE P++ +QS++    L+ EL AI+P LEEMK++K ER 
Sbjct  78    AQLRQAIAQSEAELAAVCSAMGEPPIHFKQSNQKACGLREELCAILPYLEEMKRKKAERW  137

Query  607   HQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQ  786
             +QF +V+ +I  +  E+ +    +   + +D+SD+SLR+LE+++  L SL+KEKS+RLKQ
Sbjct  138   NQFLDVVGRIKKISSEI-RPENFMPFEVPVDQSDISLRKLEELRVELQSLEKEKSERLKQ  196

Query  787   VLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQ  966
             V+++L++L+SLC VLGI+FK TI EIHP+L ++    ++S  TIE L+ AI  L E K+Q
Sbjct  197   VMEYLKTLHSLCEVLGINFKQTISEIHPSLDEAEGPMNISNTTIEMLALAIQRLCETKMQ  256

Query  967   RLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIE  1146
             R+  LQ+LA+T++ELWNLMD P+EEQQ F NVT  IAASESELTE N LS++ L   E E
Sbjct  257   RMQKLQDLASTMLELWNLMDTPIEEQQAFQNVTCNIAASESELTEHNTLSIEFLNYVEAE  316

Query  1147  VSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAIDD--SIEFTDETIESGAIDPSHLLEQ  1320
             V RL+++KSSKMKE++LKK   LEE  R+AHL  ++  + +FT E IE+GAIDPS LLEQ
Sbjct  317   VLRLEQLKSSKMKELVLKKNTELEEHRRRAHLIGEEGYATQFTIEAIEAGAIDPSMLLEQ  376

Query  1321  LEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEK  1500
             +E  IS VKEEAFSRK+ILE+VEKWL ACEEE+WLEDYN++DNRYN GRG H+MLKRAEK
Sbjct  377   IEAYISTVKEEAFSRKDILERVEKWLNACEEEAWLEDYNKDDNRYNAGRGAHIMLKRAEK  436

Query  1501  ARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRD  1680
             AR LVNKIPGM++ L ++   WE ERG  F YDG+ L+SMLE+Y ++++EKE ER+RQRD
Sbjct  437   ARVLVNKIPGMVDVLETKTIVWENERGNEFTYDGIRLISMLEEYMIVREEKEQERKRQRD  496

Query  1681  QKKLQGQLMAEQEVLFGSKRSPSQ--SGKK---NVVGGASNKRISVGGA-MLQTPYTERA  1842
             QKKLQ Q   EQE L+GSK SPS+  S KK   N   G S +R+S+GGA  +Q P +E  
Sbjct  497   QKKLQDQRKTEQEALYGSKPSPSKPHSTKKVPRNSTAGGS-RRLSLGGASSVQPPKSE--  553

Query  1843  PLSSHSL---KKINPVKQQALANITQNYVALSSGRRESSMHAKQPSCNKSNLQKTEPTQR  2013
              L S ++   K+   +   + A+   + V L           K+ S N S L + E T R
Sbjct  554   ILHSETVRVTKRTEDISSPSPAHKGLDTVGLP---------IKKLSFNSSTLHEME-TPR  603

Query  2014  KPLSPISSLSFNTSSANIMDKISESEELREMPASLLTTPIKNVS-GIGGNATPKtmpipm  2190
             KP S I+  +                       S+ +TP++ +S G   N TPK   +  
Sbjct  604   KPFSQITPGN-----------------------SITSTPVRLISAGTEENKTPK--TLAA  638

Query  2191  pstpasaassiamQMGMTPAPVAATTPMVGHD--------GVEYSYEEMRAGFLL  2331
             P+          MQ  MTP       P++ +D          EYSYEE R    L
Sbjct  639   PTMLTPMTVRAHMQTAMTPVLTPKAVPVLAYDESELTSQEDTEYSYEERRLAVYL  693



>emb|CAN67461.1| hypothetical protein VITISV_024292 [Vitis vinifera]
Length=709

 Score =   535 bits (1379),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 367/694 (53%), Positives = 467/694 (67%), Gaps = 77/694 (11%)
 Frame = +1

Query  316   QKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAESEAELARICAA  495
             Q IW+E+GEP IERD+ML +LEQECLEAY+RKV  A +S AQLRQA+A+SEAELA IC+A
Sbjct  72    QSIWDEVGEPNIERDEMLLELEQECLEAYKRKVSHAKKSRAQLRQAIADSEAELADICSA  131

Query  496   LGEQPVNVRQ----SSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQIDSVLKELGK  663
             +GE PVNVRQ    +   LK EL+ I+  LEEM+K K ERK QF EVLDQ+ ++ KEL K
Sbjct  132   MGEGPVNVRQFDQNAGGGLKEELKTIVSXLEEMRKLKCERKKQFVEVLDQLLNISKELCK  191

Query  664   SRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESLNSLCIVLGIDF  843
              R++    I +DE+DLSL+RL ++   LL LQ EKS+R+KQVL HL++L+SLC VLG+DF
Sbjct  192   PREDNLCKIVMDETDLSLKRLHELHRLLLELQDEKSNRVKQVLAHLKTLDSLCKVLGLDF  251

Query  844   KNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQRLH---MLQNLATTIVELW  1014
             K+T+ EIHP++ DS  LK++S++TI++L+A I  LREVK QR+H    L++LA +++ELW
Sbjct  252   KHTVXEIHPSMDDSIGLKNLSSDTIDKLAATILSLREVKTQRMHKLCQLRDLAASMLELW  311

Query  1015  NLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQEMKSSKMKEVL  1194
             +LMD P++EQQ+F NVT  IAASE E+TEPN LSLD +   E EVSRL+++KSSKMKE++
Sbjct  312   SLMDTPIKEQQMFQNVTSNIAASEHEITEPNTLSLDFINYVEAEVSRLEQLKSSKMKELI  371

Query  1195  LKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHLLEQLEIQISNVKEEAFSRK  1368
             LKKR  LEE+C + H+  +  I  E + E IESGA++P++LLEQ+E+QI+ VKEEAFSRK
Sbjct  372   LKKRTELEEICSRIHVVSEAYIPIEHSIEAIESGAMEPTYLLEQVELQIAKVKEEAFSRK  431

Query  1369  EILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVNKIPGMLEALT  1548
             EIL+KV KWLAAC+EE WLE+YNR+ NRYN GRG H+ LKRAEKARALV+KIP M EALT
Sbjct  432   EILDKVVKWLAACDEECWLEEYNRDGNRYNAGRGAHVHLKRAEKARALVSKIPAMTEALT  491

Query  1549  SRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQGQLMAEQEVLF  1728
              +AK WE ERG+ FLYDGV LLSML+QY  L+QEKE ERQRQR+QK+LQGQL+AEQE LF
Sbjct  492   LKAKAWEEERGIEFLYDGVRLLSMLDQYNFLRQEKEQERQRQREQKRLQGQLIAEQEALF  551

Query  1729  GSKRSPSQSGKK---NVVGGASNKRISVGGAMLQTPYTERAPLSSHSLKKINPVKQ-QAL  1896
             GSK SPS+SGKK       GA+N+R S GG MLQ P  E+A L S   KK   VKQ  +L
Sbjct  552   GSKPSPSKSGKKLSRISTIGAANRRFSHGGMMLQAPNPEKAALHSCPTKKDGCVKQNNSL  611

Query  1897  ANITQNYVA-LSSGRRESSMH---AKQPSCNKSNLQKTEPTQ-RKPLSPISSLSFNTSSA  2061
              +   N  A LSSGR +  +     K+     +N  + E +  RKPLSPIS         
Sbjct  612   KHQQYNGSAVLSSGRTKLGIAFKPVKKHFTKDTNACEIESSVIRKPLSPIS---------  662

Query  2062  NIMDKISESEELREMPASLLTTPIKNVSGIGGNATPKtmpipmpstpasaassiamQMGM  2241
                            PA   +TP                                   G 
Sbjct  663   ---------------PAVTASTP-----------------------------------GT  672

Query  2242  TPAPVAATTPMVGHDGVEYSYEEMRAGFLLPRLH  2343
                P  A         +EYS+EE RA F+LP  +
Sbjct  673   PCIPFVANQAEGRVKVIEYSFEERRAAFMLPEAY  706



>ref|XP_011034447.1| PREDICTED: 65-kDa microtubule-associated protein 3-like isoform 
X2 [Populus euphratica]
Length=601

 Score =   529 bits (1362),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 308/601 (51%), Positives = 423/601 (70%), Gaps = 24/601 (4%)
 Frame = +1

Query  247   MYNRQND--QSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQ  420
             MYN  N+  Q  R+ETTC  LL+EL+KIW+E+GE + ERDK++ ++EQEC+E YRRKV  
Sbjct  1     MYNHSNNSNQFSRIETTCSLLLTELKKIWSEVGEADTERDKLVYEIEQECVEVYRRKVIA  60

Query  421   ASRSCAQLRQAVAESEAELARICAALGEQPVNVRQS--SRSLKTELQAIMPlleemkkrk  594
             A++  ++L+  +A +EAE+  I + LGE+PV   +   S SL+ E  AI+  +EEM+ +K
Sbjct  61    ANKRRSELQHLIALAEAEIQNIRSVLGEEPVKSEEEKVSVSLREEHGAIVQRVEEMRNKK  120

Query  595   lerkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSD  774
              ER+  F EV++++  V  E+  S       + +D +DLS+++L+ ++  LL L+  KS+
Sbjct  121   EERRKLFVEVVEKLQKVSSEIFGS----TEGVIMDGTDLSMKKLDGLEKRLLELENNKSN  176

Query  775   RLKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELRE  954
             RLKQ++D ++ L S+C VLG+DFK TI +IHP+L DS  +K ++ +TI++L+A I  LRE
Sbjct  177   RLKQIVDRVDGLKSICGVLGMDFKQTIHDIHPSLDDSQGVKDLTDDTIKKLTAEIQRLRE  236

Query  955   VKIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKS  1134
             VKIQR+  L+ LATT+VELWNLMD P+EEQ+LFDNVT  IAASESE++EPN LS+D +  
Sbjct  237   VKIQRMQKLRVLATTLVELWNLMDTPMEEQRLFDNVTSKIAASESEISEPNTLSVDFINH  296

Query  1135  AEIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAID--DSIEFTDETIESGAIDPSH  1308
              E EVSRL+++KSSK+KE++LKKR+ LEE+C + HL ++   + +++ E + SG  DP H
Sbjct  297   VEEEVSRLEKLKSSKVKELVLKKRLELEEICWKTHLVLEAYTAAKYSTEAVASGVEDPMH  356

Query  1309  LLEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLK  1488
             LLE++E+ I+ VKEEA SRK+IL+KVEKWL AC+EESWLE+YNR++NRY+ GRG HL LK
Sbjct  357   LLEEIELDIAMVKEEASSRKDILDKVEKWLTACDEESWLEEYNRDENRYSYGRGAHLTLK  416

Query  1489  RAEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQ  1668
             RAEKAR +VNKIP M+EALTS+   WE ERG+PF YDG  LLS LEQY  LKQEKE ER 
Sbjct  417   RAEKARVMVNKIPAMVEALTSKTMAWERERGIPFFYDGGQLLSRLEQYSSLKQEKEQERI  476

Query  1669  RQRDQKKLQGQLMAEQEVLFGSKRSPSQSGKK---NVVGGASNKRISVGGAMLQTPYTER  1839
             RQRDQKKL  QL+AEQE LFGSK SPSQSG+K     VG A N+++S+ GAM+      +
Sbjct  477   RQRDQKKLHVQLIAEQEALFGSKPSPSQSGRKPSRTSVGVAINQKLSLAGAMVPNYRCGK  536

Query  1840  APLSSHSLKKINPVKQQALANITQN-YVALSSGRRESSM--------HAKQP--SCNKSN  1986
                  +  KK N + + +     Q+   A  SGRR S +        HA     +C K N
Sbjct  537   TSPFVNPNKKGNVLDRCSYLRYGQHGGFASQSGRRNSEIVGHLGKKRHATSAAKACKKMN  596

Query  1987  L  1989
             L
Sbjct  597   L  597



>ref|XP_009110219.1| PREDICTED: 65-kDa microtubule-associated protein 3 [Brassica 
rapa]
Length=708

 Score =   529 bits (1362),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 358/719 (50%), Positives = 480/719 (67%), Gaps = 52/719 (7%)
 Frame = +1

Query  265   DQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQL  444
             D  L++ETTC SLL ELQ IW+E+GE E +RDKML +LE+ECLE YRRKVDQA+R  AQL
Sbjct  4     DPILQVETTCGSLLYELQIIWDEVGETETDRDKMLLELERECLEVYRRKVDQANRCRAQL  63

Query  445   RQAVAESEAELARICAALGEQPVNVRQSSRSL---KTELQAIMPlleemkkrklerkHQF  615
             RQA+A++EAELA IC+A+GE+PV+ RQS +SL   K EL  I+P LEEM+KRK ER++QF
Sbjct  64    RQAIADAEAELAAICSAMGERPVHTRQSDQSLGSLKQELGTILPELEEMQKRKTERRNQF  123

Query  616   SEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLD  795
               VL++I+++  ++    + +     +DE+DLSLR+LE++  HL +LQKEKSDR++ +  
Sbjct  124   LFVLEEIENITNDIKGQGQLVLPKPPIDETDLSLRKLEELHCHLQALQKEKSDRVETIRK  183

Query  796   HLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQRLH  975
             HL +L S C VLG+DF   + +++PTL D    +S+S  TI+ L AA+ +LREVKIQR+ 
Sbjct  184   HLCTLYSHCSVLGMDFNEVVSQVNPTLTDPEGPRSLSDHTIDTLDAAVQKLREVKIQRMQ  243

Query  976   MLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSR  1155
              LQ+LATT++ELWNLMD P+EEQQ + ++T  IAASE E+T+ N+LS D +K  E EV R
Sbjct  244   KLQDLATTMLELWNLMDTPIEEQQEYQHITCNIAASEHEITQANSLSEDFIKYVEAEVVR  303

Query  1156  LQEMKSSKMKEVLLKKRITLEELCRQAHL--AIDDSIEFTDETIESGAIDPSHLLEQLEI  1329
             L E+K+SKMKE+++KKR  LEE+CR+ H+    D +++ T   IESG +D + +LE LE 
Sbjct  304   LGEVKASKMKELVMKKRSELEEICRKTHMLPVSDSAMDQTIVAIESGIVDATLVLEHLEQ  363

Query  1330  QISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARA  1509
              IS VKEEA SRKEILEKVEKWL+AC+EESWLE+YNR+DNRYN GRG HL LKRAEKAR 
Sbjct  364   HISKVKEEALSRKEILEKVEKWLSACDEESWLEEYNRDDNRYNAGRGAHLTLKRAEKARN  423

Query  1510  LVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKK  1689
             LVNK+P M+EAL S+   WE E+G+ FLYDG+ LLSMLE+Y LL+QE+E E +RQRD KK
Sbjct  424   LVNKLPVMVEALASKTIVWEQEKGIEFLYDGIRLLSMLEEYNLLRQEREEEHRRQRDHKK  483

Query  1690  LQGQLMAEQEVLFGSKRSPSQ--SGKK----NVVGGASNKRISVGGAMLQTPYTERAPLS  1851
             LQGQL+AEQE L+GSK SPS+   GKK    +  G A+N+R+S+G  M QTP        
Sbjct  484   LQGQLIAEQEALYGSKPSPSKPLGGKKAPRMSTGGAATNRRLSLGAGMHQTP--------  535

Query  1852  SHSLKKINPVKQQALANITQNYVALSSGRRE---SSMHAKQPSCNKSNLQKTEPTQRKPL  2022
                     P K+   A+  Q   ALS+GRR    + + +++ S N    Q   P  RKP 
Sbjct  536   -------KPNKK---ADQRQAEGALSTGRRGLDVAGLPSRKQSMNPCE-QLQSPLVRKPF  584

Query  2023  SPISSLSFNTSSANI-----MDKISESEELREMPASLLTTPIKNVSGIGGNATPKtmpip  2187
             SPIS+ +   S ANI     +   S+S  + E+  S   TP+KN + I      K M + 
Sbjct  585   SPIST-TVVASKANIATPQQLVPSSKSNAVNEI--SSFATPVKNNNIIKNLEEEKIMMMM  641

Query  2188  mpstpasaassiamQMGMTPAPV-AATTPMVGHDG----------VEYSYEEMRAGFLL  2331
                   +A   I         P+  A TP+  ++           +EYS+EE R  F+L
Sbjct  642   QTPKNVAAMIPIPSTPATISVPMQTAPTPLNNNNNARFLPEKAEVIEYSFEERRLAFML  700



>ref|XP_009107313.1| PREDICTED: 65-kDa microtubule-associated protein 3-like [Brassica 
rapa]
Length=707

 Score =   527 bits (1358),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 354/723 (49%), Positives = 478/723 (66%), Gaps = 61/723 (8%)
 Frame = +1

Query  265   DQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQL  444
             D  L++ETTC SLL ELQ IW+E+GE E +RDKML +LE+ECLE YRRKVD A+   AQL
Sbjct  4     DPILQVETTCGSLLYELQIIWDEVGETETDRDKMLLELERECLEVYRRKVDHANGCRAQL  63

Query  445   RQAVAESEAELARICAALGEQPVNVRQSSRS---LKTELQAIMPlleemkkrklerkHQF  615
             RQA+A++EAELA IC+A+GE+PV++RQS +S   LK EL  I+P LEEM+KRK ER++QF
Sbjct  64    RQAIADAEAELAAICSAMGERPVHIRQSDQSVGSLKQELGTILPELEEMQKRKTERRNQF  123

Query  616   SEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLD  795
               VL++I+++  ++    + +     +DE+DLS+R+LE++  HL +LQKEKSDR++ +  
Sbjct  124   LFVLEEIENITNDIKGQGQLVLPKPPIDETDLSMRKLEELHCHLQALQKEKSDRVETIRK  183

Query  796   HLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQRLH  975
             HL +L S C VLG+DF   + +++PTL D    +S+S  TI+ L AA+ +LREVKIQR+ 
Sbjct  184   HLCTLYSHCSVLGMDFNEVVSQVNPTLTDPEGPRSLSDHTIDTLDAAVQKLREVKIQRMQ  243

Query  976   MLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSR  1155
              LQ+LATT++ELWNLMD P+EEQQ + ++T  IAASE E+T+ N+LS D +K  E EV R
Sbjct  244   KLQDLATTMLELWNLMDTPIEEQQEYQHITCNIAASEHEITQANSLSEDFIKYVEAEVVR  303

Query  1156  LQEMKSSKMKEVLLKKRITLEELCRQAHL--AIDDSIEFTDETIESGAIDPSHLLEQLEI  1329
             L E+K+SKMKE+++KKR  LEE+CR+ H+    D +++ T   IESG +D + +LE LE 
Sbjct  304   LGEVKASKMKELVMKKRSELEEICRKTHMLPVSDSAMDQTIVAIESGIVDATLVLEHLEQ  363

Query  1330  QISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARA  1509
              IS VKEEA SRKEILEKVEKWL+AC+EESWLE+YNR+DNRYN GRG HL LKRAEKAR 
Sbjct  364   HISKVKEEALSRKEILEKVEKWLSACDEESWLEEYNRDDNRYNAGRGAHLTLKRAEKARN  423

Query  1510  LVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKK  1689
             LVNK+P M+EAL S+   WE E+G+ FLYDG+ LLSMLE+Y LL+QE+E E +RQRD KK
Sbjct  424   LVNKLPVMVEALASKTIVWEQEKGIEFLYDGIRLLSMLEEYNLLRQEREEEHRRQRDHKK  483

Query  1690  LQGQLMAEQEVLFGSKRSPSQ--SGKK----NVVGGASNKRISVGGAMLQTPYTERAPLS  1851
             LQGQL+AEQE L+GSK SPS+   GKK    +  G A+N+R+S+G  M QTP        
Sbjct  484   LQGQLIAEQEALYGSKPSPSKPLGGKKAPRMSTGGAATNRRLSLGAGMHQTP--------  535

Query  1852  SHSLKKINPVKQQALANITQNYVALSSGRRE---SSMHAKQPSCNKSNLQKTEPTQRKPL  2022
                       K    A+  Q   ALS+GRR    + + +++ S N    Q   P  RKP 
Sbjct  536   ----------KPNKKADQRQAEGALSTGRRGLDVAGLPSRKQSMNPCE-QLQSPLVRKPF  584

Query  2023  SPISSLSFNTSSANI-----MDKISESEELREMPASLLTTPIKNVSGIGGNATPKtmpip  2187
             SPIS+ +   S ANI     +  IS+S  + E+  S   TP+KN      N         
Sbjct  585   SPIST-TVVASKANIATPQQLVPISKSNAVNEI--SSFATPVKN-----NNIIKNLEEEK  636

Query  2188  mpstpasaassiamQMGMTPAPVA-----ATTPMVGHDG----------VEYSYEEMRAG  2322
             M         +  + +  TPA ++     A TP+  ++           +EYS+EE R  
Sbjct  637   MMMMQTPKNVAAMIPIPSTPATISVPMQTAPTPLHNNNDARFLPEKAEVIEYSFEERRLA  696

Query  2323  FLL  2331
             F+L
Sbjct  697   FML  699



>gb|KGN57292.1| hypothetical protein Csa_3G176870 [Cucumis sativus]
Length=691

 Score =   526 bits (1355),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 340/677 (50%), Positives = 462/677 (68%), Gaps = 32/677 (5%)
 Frame = +1

Query  397   AYRRKVDQASRSCAQLRQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMP  567
              YRRKVDQA+ S A LRQA+A+SEA+LA IC+A+GE+PV +RQS +   SLK EL+ I P
Sbjct  12    VYRRKVDQANHSRAHLRQAIADSEAQLAAICSAMGERPVQIRQSDQKAVSLKDELKQIHP  71

Query  568   lleemkkrklerkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHL  747
             LL+EM+K K ER +QF EVL +I  V  EL          IALDE+DLSL++L+++   L
Sbjct  72    LLDEMRKMKSERSNQFLEVLQEIQKVSDELNGCEHSASK-IALDETDLSLKKLDELTRQL  130

Query  748   LSLQKEKSDRLKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERL  927
              +LQ+EKSDR+K V +H+ +L+SLC+VLG+D K    E+HP+LGD     +++  TI++L
Sbjct  131   HALQQEKSDRMKLVHNHMRTLDSLCLVLGMDSKQIAIEVHPSLGDFEGPTNITIHTIKQL  190

Query  928   SAAIHELREVKIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPN  1107
             +A I +LR++K+QR+  LQ+LA+T+ +LW LMD P EEQQ+F N+T  +AASE E+ EPN
Sbjct  191   AAMIEKLRDIKLQRMQKLQDLASTMFDLWELMDTPDEEQQMFQNITCNVAASEHEIIEPN  250

Query  1108  ALSLDLLKSAEIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHL--AIDDSIEFTDETI  1281
             AL+ D++   E EVSRL+E+KSS+MKE++LKKR+ LEE+CRQ H+  A D +IE+  + I
Sbjct  251   ALATDVIIYVEAEVSRLEELKSSRMKELVLKKRLELEEMCRQLHVVPAEDSAIEYVIDAI  310

Query  1282  ESGAIDPSHLLEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnryng  1461
             + G++DP+ +LEQ++ QI  +KEEAF RKEILEKVE+WL ACEEE WLE+YNR++NRYN 
Sbjct  311   DCGSLDPACVLEQIDSQIHKLKEEAFDRKEILEKVERWLGACEEECWLEEYNRDENRYNA  370

Query  1462  grgTHLMLKRAEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLL  1641
             GRG HL LKRAEKARALVNK+PGM+ ALTS+   WE ERG+ F YDGV LLSMLE+Y +L
Sbjct  371   GRGAHLTLKRAEKARALVNKLPGMVSALTSKTMSWEKERGIEFTYDGVRLLSMLEEYTIL  430

Query  1642  KQEKELERQRQRDQKKLQGQLMAEQEVLFGSKRSPS--QSGKKN---------VVGGASN  1788
             +QEKE E++RQRDQKKLQGQL+AEQE L+GSK SPS  QS KK           V G  +
Sbjct  431   RQEKEQEQRRQRDQKKLQGQLIAEQEALYGSKPSPSKPQSVKKGPRMSTGGAGAVAGTGS  490

Query  1789  KRISVGGAMLQTPYTERAPLSSHSLKKINPVKQQALANITQNYV-ALSSGRR--ESSMHA  1959
             +R S+GGA+LQTP  +   L             QA  ++ + +V ALS+G+R  +  +  
Sbjct  491   RRFSLGGALLQTPKPDHKGLRPGRKSDRGHQNNQAF-HLDEGFVEALSAGKRGLDGLLPV  549

Query  1960  KQPSCNKSNLQKTEP-TQRKPLSPISSLS--FNTSSANIMDKISESEELREMPASLLTTP  2130
             K+ S   +  +   P   RKP +PI + +  F+ S+ +       +E+L+++  S   TP
Sbjct  550   KKHSLGANAGEGESPMVVRKPFAPIPTPTALFSNSANSSNSLNDLNEKLQKLNMSSSKTP  609

Query  2131  IKNVSGIGGNATPKtmpipmpstpasaassiamQMGMTPA---PVAATTPMVGH--DGVE  2295
             IK  S      TPK   IP+P     +  S+ MQ  MTPA   PV  T  +     + VE
Sbjct  610   IKTTSISEEVITPK--IIPIPLPSTPSTVSVPMQTAMTPALPHPVDLTARISEDISEVVE  667

Query  2296  YSYEEMRAGFLLPR-LH  2343
             YS+EE RAGF+LP+ LH
Sbjct  668   YSFEERRAGFVLPKALH  684



>ref|XP_004972100.1| PREDICTED: uncharacterized protein LOC101763014 [Setaria italica]
Length=1349

 Score =   540 bits (1390),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 333/599 (56%), Positives = 446/599 (74%), Gaps = 21/599 (4%)
 Frame = +1

Query  265   DQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQL  444
             +Q  +M TTC SLL EL  IW+E+GEP   RD+ML +LEQECLE YRRKVD A+R  AQL
Sbjct  666   EQLQQMSTTCDSLLLELNVIWDEVGEPHSARDRMLLELEQECLEVYRRKVDMANRCRAQL  725

Query  445   RQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrklerkHQF  615
             RQA+AE+EAELA IC+A+GE P++VRQS++    L+ EL AI+P LEEM+K+K+ER  QF
Sbjct  726   RQAIAEAEAELAGICSAMGEPPIHVRQSNQKLQGLREELNAIVPYLEEMRKKKVERWDQF  785

Query  616   SEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLD  795
              +V+DQI  V  E+ +    +     +D+SDLS+R+LE++   L SLQKEKSDRLKQV++
Sbjct  786   VDVIDQIKKVASEI-RPADFVPFKFPVDQSDLSVRKLEELTKELQSLQKEKSDRLKQVME  844

Query  796   HLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQRLH  975
             HL +L+SLC VLGIDFK T+ ++HP+LG++   K++S  TIERL++A++ LRE+K+QR+ 
Sbjct  845   HLNTLHSLCEVLGIDFKQTVHDVHPSLGEADGSKNLSNSTIERLASAVNGLREMKVQRMQ  904

Query  976   MLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSR  1155
              LQ+LA++++ELWNLMD P+EEQQ+F NVT  IAASE E+TEPN LS+D L   E EV R
Sbjct  905   KLQDLASSMLELWNLMDTPLEEQQMFQNVTCNIAASEHEITEPNTLSVDYLSYVESEVLR  964

Query  1156  LQEMKSSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHLLEQLEI  1329
             L+++K+SKMK+++LKK+  LEE  R+AHL  ++    EF+ E IE+GA+DP+ +LEQ+E 
Sbjct  965   LEQLKASKMKDLVLKKKTELEEHRRRAHLIGEEGYAAEFSTEAIEAGAVDPALVLEQIEA  1024

Query  1330  QISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARA  1509
              I+ VKEEAFSRK+ILEKVE+WL ACEEE+WLEDYN++DNRYN GRG HL LKRAEKAR 
Sbjct  1025  HIATVKEEAFSRKDILEKVERWLNACEEEAWLEDYNKDDNRYNAGRGAHLTLKRAEKARI  1084

Query  1510  LVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKK  1689
             LVNKIPGM++ LT++   W+ ER   F YDGV LLSMLE+Y +++QEKELE++RQRDQKK
Sbjct  1085  LVNKIPGMVDVLTTKILAWQKEREKEFTYDGVRLLSMLEEYMIVRQEKELEKKRQRDQKK  1144

Query  1690  LQGQLMAEQEVLFGSKRSPS--QSGKK---NVVGGASNKRISVGGAMLQTPYTERAPLSS  1854
             +Q Q+ AEQE L+GSK SPS  QS KK   N +GGA N+R+S+GGA +Q P T+      
Sbjct  1145  IQDQIKAEQEALYGSKPSPSKPQSTKKVPRNSMGGA-NRRLSLGGATMQAPKTDIL----  1199

Query  1855  HSLKKINPVKQQALANITQNYVALSSGRRESSMHAKQPSCNKSNLQKTEPTQRKPLSPI  2031
             HS       K + L  ++ +    S G   + +  K+ + N S L++TE T RKP + I
Sbjct  1200  HSKTARAAKKTEELGTLSPS----SRGLDIAGLPIKKLTFNASTLRETE-TPRKPFAQI  1253



>emb|CAN77019.1| hypothetical protein VITISV_039795 [Vitis vinifera]
Length=1029

 Score =   530 bits (1365),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 330/629 (52%), Positives = 434/629 (69%), Gaps = 62/629 (10%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M N Q+D  L++ETTC SLL ELQ IW+E+GE + +RDKML +LE+ECLE YRRKVDQA+
Sbjct  1     MSNVQSDPLLQVETTCGSLLYELQIIWDEVGESDTDRDKMLLELERECLEVYRRKVDQAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrkl  597
             R  AQLRQA+A+SEAELA IC+A+GE+PV++RQS +   SLK EL+AI+P LEEM KRK 
Sbjct  61    RCRAQLRQAIADSEAELAAICSAMGERPVHIRQSDQNAGSLKEELKAIIPQLEEMHKRKS  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             ER++QF EV+++I+ +  E+  S + +     +D++DLSLR+LE++   L +LQKEKSDR
Sbjct  121   ERRNQFFEVVEEIEKIKSEIYSSTEYIASKTVVDDTDLSLRKLEELHKQLQALQKEKSDR  180

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             LKQVLDHL +LNSLC+VLG+DF+ T+ E+HP+LGDS   K++S  TIE+L+AAI  LR V
Sbjct  181   LKQVLDHLSTLNSLCLVLGMDFQQTVNEVHPSLGDSDGRKNISNATIEQLAAAIKTLRGV  240

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             KIQR+  LQ+LA++++ELWNLMD P+EEQQLF NVT  IAASE E+ EPN LS+D +   
Sbjct  241   KIQRMQRLQDLASSMLELWNLMDTPIEEQQLFQNVTCNIAASEHEINEPNTLSVDFINYV  300

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLA--IDDSIEFTDETIESGAIDPSHL  1311
             E EVSRL+E+K+SKMKE++LKKR  LEE+CR+ H+    D ++++  E +ESGA+D S +
Sbjct  301   EAEVSRLEELKASKMKELVLKKRSELEEICRKTHMIPEADSALDYVIEAMESGAVDASCV  360

Query  1312  LEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKR  1491
             LEQ+E+Q++  K++            ++ A                     RG HL LKR
Sbjct  361   LEQIELQVA--KDD-----------NRYNAG--------------------RGAHLTLKR  387

Query  1492  AEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQR  1671
             AEKAR+LVNK+P M++AL S+   WE ERGV F YDG+ LLSMLE+Y  L+QEKE ER+R
Sbjct  388   AEKARSLVNKLPAMVDALASKTVAWEKERGVEFTYDGIRLLSMLEEYTFLRQEKEEERRR  447

Query  1672  QRDQKKLQGQLMAEQEVLFGSKRSPS--QSGKKN---VVGGASNKRISVGGAMLQTPYTE  1836
             QRDQKKLQGQL+AEQE LFGSK SPS  QS KK      G   ++R+SVGGAM+QTP   
Sbjct  448   QRDQKKLQGQLIAEQEALFGSKPSPSKPQSVKKASRVSTGSTGSRRLSVGGAMIQTP---  504

Query  1837  RAPLSSHSLKKI-NPVKQQALANITQ-------NYVALSSGRRE---SSMHAKQPSCNKS  1983
               P   HS K    P K+     I Q        + ALS+G R    + +  K+ S N  
Sbjct  505   -KPDPIHSTKATPRPGKKSDRYQIDQVRHCQDDGFTALSAGTRGLDIAGLPIKKQSFNPR  563

Query  1984  NLQKTEPTQRKPLSPISSLSFNTSSANIM  2070
              +    P  RKP SPISS +  +S AN M
Sbjct  564   EIDS--PMMRKPFSPISSTA--SSEANTM  588



>ref|XP_002511727.1| PLE, putative [Ricinus communis]
 gb|EEF50396.1| PLE, putative [Ricinus communis]
Length=725

 Score =   518 bits (1333),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 347/721 (48%), Positives = 482/721 (67%), Gaps = 42/721 (6%)
 Frame = +1

Query  247   MYNRQND-QSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQA  423
             MYNR +D  +  ++TTC  LL ELQKIW+E+GE ++ERDKM+ ++EQEC E Y+ KV++A
Sbjct  1     MYNRNHDGHAASIKTTCRLLLLELQKIWDEVGENDVERDKMVFEIEQECAEVYKGKVNEA  60

Query  424   SRSCAQLRQAVAESEAELARICAALGEQPVNVRQ-----SSRSLKTELQAIMPlleemkk  588
             +R  ++L++ +A +EAE+  I +ALG+  ++V+        ++L  +LQ + P+LEEM+K
Sbjct  61    NRCRSELQRQIALAEAEIETILSALGDD-LHVKDEQKDDGRKNLHEKLQIVNPMLEEMRK  119

Query  589   rklerkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEK  768
             RK ERK QF EV+ +++++ KE+     E+   I  D +DLSL+RL ++++ L  LQ +K
Sbjct  120   RKSERKKQFVEVVHELNTISKEIFGPNPEI---IVDDGTDLSLKRLVELQNQLHELQNDK  176

Query  769   SDRLKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHEL  948
             S+R+KQVL  +E+L SL +VLG+DFK+ +  IHPT  DS   K ++  TIERL+ A+  L
Sbjct  177   SNRVKQVLGLMETLKSLSVVLGVDFKHIMHNIHPTFDDSDRSKDITDGTIERLTTALQSL  236

Query  949   REVKIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLL  1128
              +VKIQR+  L+ L   ++ELW+LM  PVEEQ +F  VT +IAASE E+TEPN LS+DL+
Sbjct  237   HDVKIQRIKRLRGLGAVLLELWDLMGTPVEEQLMFQKVTSSIAASECEITEPNMLSIDLI  296

Query  1129  KSAEIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAID--DSIEFTDETIESGAIDP  1302
                E EV RL+++KSSK+KE++LKKR+ LEE+CR  H+  +   + EF+ E + SGA+DP
Sbjct  297   NQVEDEVFRLKQLKSSKVKELVLKKRLELEEICRNIHMVTEALGAPEFSVEVLASGAVDP  356

Query  1303  SHLLEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLM  1482
              HLLE++E++I  VKEEAFSRKEIL+KVEKWLAA EEE WLE+YNR+DNRYN GRG HL 
Sbjct  357   MHLLEEIELEIERVKEEAFSRKEILDKVEKWLAAREEECWLEEYNRDDNRYNAGRGAHLT  416

Query  1483  LKRAEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELE  1662
             LKRAE+ARA+VNKIP M+EALTS+   WE ERG  FLYDG  LLS LE+Y  L++EKE E
Sbjct  417   LKRAERARAVVNKIPAMVEALTSKTIVWEKERGTQFLYDGERLLSRLEEYNYLRKEKEQE  476

Query  1663  RQRQRDQKKLQGQLMAEQEVLFGSKRSPSQSGKK---NVVGGASNKRISVGGAMLQTPYT  1833
             R RQRDQKK Q QL+ EQE LFG+K SPS+SGKK     +G A N+R+S+GGAMLQ    
Sbjct  477   RIRQRDQKKRQVQLIVEQEALFGAKPSPSKSGKKPSRTSIGVARNQRLSLGGAMLQNLKA  536

Query  1834  ERAPLSSHSLKKINPVKQQALANITQN-YVALSSGRRESSM--HAKQPSCNKSNLQKTEP  2004
             + A      L KI         ++ QN Y+    GRR S +  H  + + +    Q    
Sbjct  537   QNASCDYVDLNKIGD-------SVNQNSYL----GRRTSEIAGHLVKKNSSAKVRQSESD  585

Query  2005  TQRKPLSPIS-SLSFNTSSANIM-DKISESEELREMPASLLTTPIKN-----VSGIGGNA  2163
               RKPLSPI  +LS+  + AN + D+     E  +     + TPI+       +G     
Sbjct  586   LIRKPLSPIPLTLSYKANIANFVEDQKGMGNEKLQTADPCIKTPIRTPTRPISAGDAVTT  645

Query  2164  TPKtmpipmpstpasaassiamQMGMTPAP----VAATTPMVGHDGVEYSYEEMRAGFLL  2331
             TPKT+PIP+P+TP + ++ +   M  TPA      AA+T     + +EYS+EE+R G L 
Sbjct  646   TPKTLPIPVPTTPTTISTPML--MASTPATPCVSSAASTAEKVVEQIEYSFEEVRVGILY  703

Query  2332  P  2334
             P
Sbjct  704   P  704



>gb|EEC79661.1| hypothetical protein OsI_20904 [Oryza sativa Indica Group]
Length=665

 Score =   514 bits (1323),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 342/705 (49%), Positives = 462/705 (66%), Gaps = 66/705 (9%)
 Frame = +1

Query  280   METTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVA  459
             M+T C SL+ ELQ IW+E+GEPE  RD+ML +LEQECLE YRRKVDQA+RS AQLRQA+A
Sbjct  1     MKTICGSLMHELQVIWDEVGEPEAARDRMLLELEQECLEVYRRKVDQANRSRAQLRQAIA  60

Query  460   ESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrklerkHQFSEVLD  630
             +SEAELA IC+A+GE  V+VRQS++    L+ EL AI+P LEEMK++K+ER +QF +V+ 
Sbjct  61    QSEAELAAICSAMGETTVHVRQSNQKACGLRDELGAILPYLEEMKRKKVERWNQFLDVVG  120

Query  631   QIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESL  810
             +I  +  E+  +  +    +++D+SDLSLR+LE+++  L SL+KEK +R+KQV+++L++L
Sbjct  121   RIKKISSEIRPANFD-SFKVSVDQSDLSLRKLEELRVELKSLEKEKGERVKQVMEYLKTL  179

Query  811   NSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQRLH---ML  981
             +SLC+VLG+DFK TI EIHP+L ++   +++S  TIE L+ AI  LRE K+QR+     L
Sbjct  180   HSLCVVLGVDFKKTISEIHPSLDEAEGPRNISNTTIEMLALAIQRLRETKMQRMQKLCQL  239

Query  982   QNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQ  1161
             Q+LA+T++ELWNLMD P EEQQ + N+T  IAASE+ELTE N LS++ L   E EV RL+
Sbjct  240   QDLASTLLELWNLMDTPFEEQQAYQNITCNIAASEAELTEQNTLSIEFLNYVEAEVLRLE  299

Query  1162  EMKSSKMKEVLLKKRITLEELCRQAHLAIDD--SIEFTDETIESGAIDPSHLLEQLEIQI  1335
             + K+SKMKE++LKK+  LEE  R+AHL  ++  + +FT E IE+GAIDPS LLEQ+E  I
Sbjct  300   QHKASKMKELVLKKKTELEEHRRRAHLVGEEGYATQFTIEAIEAGAIDPSLLLEQIEAYI  359

Query  1336  SNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALV  1515
             S VKEEAFSRK+ILE+VEKWL A EEE+WLEDYN++DNRYN GRG H+MLKRAEKAR LV
Sbjct  360   STVKEEAFSRKDILERVEKWLNAREEEAWLEDYNKDDNRYNAGRGAHIMLKRAEKARVLV  419

Query  1516  NKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQ  1695
             +KIPGM++ L ++ + WE ERG  F YDGV L+ MLE+Y +++QEKE ER+RQRDQKKLQ
Sbjct  420   SKIPGMVDVLETKTRAWETERGNKFTYDGVRLILMLEEYMVVRQEKEQERKRQRDQKKLQ  479

Query  1696  GQLMAEQEVLFGSKRSPSQSGKKNVVGGASNKRISVGGAMLQTPYTERAPLSSHSL---K  1866
              Q  AEQE L+GSK + S+S     V      R S  G  +Q P +E   L S ++   K
Sbjct  480   DQRKAEQEALYGSKPTSSKSRSTKKV-----PRNSTPG--VQPPKSE--ILHSKTIRATK  530

Query  1867  KINPVKQQALANITQNYVALSSGRRESSMHAKQPSCNKSNLQKTEPTQRKPLSPISSLSF  2046
             K   +   +  +   + V L        +    PS N S L + E T RKP S I+    
Sbjct  531   KTEDINTPSPGHKGLDTVGL-------PIRKLFPSSNSSTLLEME-TPRKPFSQIT----  578

Query  2047  NTSSANIMDKISESEELREMPASLLTTPIKNVS--GIGGNATPKtmpipmpstpasaass  2220
                                 P ++ + P++ +S  G   N TPK      P        S
Sbjct  579   --------------------PGNISSAPVRPISTGGTEENRTPK---TFAPVPTTPMTVS  615

Query  2221  iamQMGMTPAPVAATTPMVGHD--------GVEYSYEEMRAGFLL  2331
               MQM +TP   A    ++ +D          EYS+EE R    L
Sbjct  616   PHMQMAVTPVLTAKAVSVLSYDEPELTSQEDTEYSFEEKRLAVYL  660



>ref|XP_009347040.1| PREDICTED: 65-kDa microtubule-associated protein 9-like [Pyrus 
x bretschneideri]
Length=711

 Score =   514 bits (1324),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 348/716 (49%), Positives = 468/716 (65%), Gaps = 38/716 (5%)
 Frame = +1

Query  247   MYNRQNDQSL-RMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQA  423
             M+++Q       MET   SLL ELQKIW+E+G P++ERD M  ++EQEC+E  RRKVD+A
Sbjct  1     MFSQQGSNHFAHMETKFESLLQELQKIWDEVGVPDVERDAMFLKIEQECMEVSRRKVDEA  60

Query  424   SRSCAQLRQAVAESEAELARICAALGEQPVNVRQ-SSRSLKTELQAIMPlleemkkrkle  600
                 AQL Q +A  + EL  ICAALGEQP  + Q +S SLK EL+ I+  LE+MK RK+E
Sbjct  61    KNCKAQLLQEIANHKVELVDICAALGEQPQQLDQKASGSLKKELETIIQQLEDMKMRKME  120

Query  601   rkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRL  780
             R+++F  VLDQ+  +   +GK  K+  + + ++E+DLSL+RLE+++  LL  Q EK  RL
Sbjct  121   RRNEFFVVLDQLQKISNAIGKCMKDSLYKMVVEETDLSLKRLEELRRRLLEYQDEKRSRL  180

Query  781   KQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVK  960
               ++D+L  ++SLC+VLG+DFK TI EIHPTL DS   K +S  TI+ L  ++  LR++K
Sbjct  181   NLIMDYLNMISSLCLVLGMDFKQTIHEIHPTLIDSEGAKDISNNTIDGLDNSLQSLRKLK  240

Query  961   IQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAE  1140
              QR   LQ+ A+ ++ELWNLMD P+EEQ  F NVT  I A ESE+T+PN LS D+L   E
Sbjct  241   NQRWQRLQDHASALLELWNLMDTPIEEQNKFQNVTSHITALESEITDPNILSTDVLNHVE  300

Query  1141  IEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAID--DSIEFTDETIESGAIDPSHLL  1314
              EVSRLQ++KSSK+KE+  KK++ LEE+C+++H+  +   ++E + E +ESG  D + LL
Sbjct  301   AEVSRLQQLKSSKLKEISQKKKLELEEICKRSHMVTETFSAMEHSIEAVESGTADTACLL  360

Query  1315  EQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRA  1494
             EQ+++QI+  KEEA SRKEILEKVEKWLAA +EE WLE+YNR++NRYN GRG HL LKRA
Sbjct  361   EQIDLQITRAKEEASSRKEILEKVEKWLAARQEECWLEEYNRDENRYNAGRGAHLTLKRA  420

Query  1495  EKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQ  1674
             EKARALVNKIPGMLEALTS+A  WE ERG  FLYDG  LLSML QY  L+QEKE E+QRQ
Sbjct  421   EKARALVNKIPGMLEALTSKATAWERERGTEFLYDGGKLLSMLNQYSTLRQEKEQEQQRQ  480

Query  1675  RDQKKLQGQLMAEQEVLFGSKRSPSQSGKKNVVGGASNKRISVGGAMLQTPYTERAPLSS  1854
             RD KK QGQ++ EQE  +GSKRSPS+SGKK     ASN+++S+GG ++++   E+     
Sbjct  481   RDMKKFQGQVLVEQEAFYGSKRSPSKSGKK-----ASNRKMSLGGVLIRSQKNEKVTPPL  535

Query  1855  HSLKKINPVKQQALANITQNYVALSSGRRESSMHA----KQPSCNKSNLQKTEPTQRKPL  2022
             H  KK + + + +         A S GRR S ++     K+P+     L+   P  RKPL
Sbjct  536   HPTKKGDFLHRSSSRQQYSGVEAPSFGRRTSEIYGHSVKKRPTSAAKALEMESPLIRKPL  595

Query  2023  SPI-SSLSFNTSSANIMD--------KISESEELREMPASLLTTPIKNVSGIGGNATPKt  2175
             SP+ S +S   + AN  +         I  S    E P    + P KN      N TPKT
Sbjct  596   SPVYSEVSSMANIANYFEGQKRQQETNIQASHLFSEKPIMTPSKP-KNACDDEENRTPKT  654

Query  2176  mpipmpstpasaassiamQMGMTPAPVAATTPMVGHDG--------VEYSYEEMRA  2319
              PIP+P TP++ +  +     MTPA     TP    D         ++YS+EE+RA
Sbjct  655   KPIPVPPTPSTISIHMLT--AMTPA-----TPFTSGDYKVEKADQRLKYSFEEVRA  703



>ref|XP_008790070.1| PREDICTED: 65-kDa microtubule-associated protein 3-like [Phoenix 
dactylifera]
Length=561

 Score =   508 bits (1309),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 310/541 (57%), Positives = 410/541 (76%), Gaps = 9/541 (2%)
 Frame = +1

Query  268   QSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLR  447
             QSL+ME+T  SLL EL+ IW+E+GE E ER+KML +LEQECLE YRRKVDQA+RS AQLR
Sbjct  8     QSLQMESTHGSLLHELKIIWDEVGESEAERNKMLLELEQECLELYRRKVDQANRSKAQLR  67

Query  448   QAVAESEAELARICAALGEQPVNV---RQSSRSLKTELQAIMPlleemkkrklerkHQFS  618
             QA+A++EAE+A IC+A+GE PV+V    Q++ SLK EL+AI+P LEEMKKRK +RK+Q  
Sbjct  68    QAIADAEAEIAAICSAMGEPPVHVWQWNQNAGSLKEELKAIIPHLEEMKKRKNDRKNQIL  127

Query  619   EVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDH  798
             EV++QI  +L E+  +  +L   +A DES LS+RR+E+++  L  LQ+EK+DRL++V+DH
Sbjct  128   EVVEQIREILIEIRPTGYDLS-TVAADESALSVRRVEELRGQLQLLQEEKADRLRKVMDH  186

Query  799   LESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQRLHM  978
             L +LNSLC+VLG DFK  + E+ P L ++   K+ S +TIERL++AI  LR++K QR+  
Sbjct  187   LNTLNSLCLVLGKDFKQMVSEVDPNLNETGGCKNTSDDTIERLTSAIQRLRDIKRQRMEK  246

Query  979   LQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRL  1158
             LQ+LA+T++ELWNLMD P EEQ  F NVT  IAASE E+TEP+ALS+D +K  E EV RL
Sbjct  247   LQDLASTMLELWNLMDTPTEEQLNFQNVTCNIAASEHEITEPDALSVDFIKHVEAEVLRL  306

Query  1159  QEMKSSKMKEVLLKKRITLEELCRQAHLAI--DDSIEFTDETIESGAIDPSHLLEQLEIQ  1332
             +E+K+SKMKE++L+K+  LEE+ R+AHL    D   EF  E +E+G  DPS +L Q+E Q
Sbjct  307   EELKNSKMKELVLRKKSELEEIRRRAHLVAEGDTETEFAYEAVETGDADPSLILGQIEFQ  366

Query  1333  ISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARAL  1512
             +S  KEEAFSRK++LE+VEKWLAACEEESWLE+YNR+++RY+ GRGTHL LKRAEKAR L
Sbjct  367   VSAAKEEAFSRKDMLERVEKWLAACEEESWLEEYNRDESRYSAGRGTHLALKRAEKARTL  426

Query  1513  VNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKL  1692
             V+KIP M+EAL+ +   WE ERG  F+YDGV LLSMLE Y  ++QEKE ER+R RDQ++L
Sbjct  427   VSKIPAMVEALSVKTTAWEKERGNEFIYDGVRLLSMLEDYTTMRQEKEQERKRHRDQRRL  486

Query  1693  QGQLMAEQEVLFGSKRSPSQSGKK--NVVGGASNKRISVGGAMLQTPYTERAPLSSHSLK  1866
             QGQL+A QE LFGSK SP ++ KK         ++R S  GA  Q+   + A  SSH+ +
Sbjct  487   QGQLIAAQEALFGSKPSPLKNMKKVTRTFSSGPSRRPSTPGATSQSDMPQSAK-SSHAHR  545

Query  1867  K  1869
             K
Sbjct  546   K  546



>gb|AAT85198.1| unknown protein [Oryza sativa Japonica Group]
Length=662

 Score =   509 bits (1310),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 342/702 (49%), Positives = 461/702 (66%), Gaps = 63/702 (9%)
 Frame = +1

Query  280   METTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVA  459
             M+T C SL+ ELQ IW+E+GEPE  RD+ML +LEQECLE YRRKVDQA+RS AQLRQA+A
Sbjct  1     MKTICGSLMHELQVIWDEVGEPEAARDRMLLELEQECLEVYRRKVDQANRSRAQLRQAIA  60

Query  460   ESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrklerkHQFSEVLD  630
             + EAELA IC+A+GE  V+VRQS++    L+ EL AI+P LEEMK++K+ER +QF +V+ 
Sbjct  61    QYEAELAAICSAIGETTVHVRQSNQKACGLRDELGAILPYLEEMKRKKVERWNQFLDVVG  120

Query  631   QIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESL  810
             +I  +  E+  +  +    +++D+SDLSLR+LE+++  L SL+KEK +R+KQV+++L++L
Sbjct  121   RIKKISSEIRPANFD-PFKVSVDQSDLSLRKLEELRVELKSLEKEKGERVKQVMEYLKTL  179

Query  811   NSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQRLHMLQNL  990
             +SLC+VLG+DFK TI EIHP+L ++   +++S  TIE L+ AI  LRE K+QR+  LQ+L
Sbjct  180   HSLCVVLGVDFKKTISEIHPSLDEAEGPRNISNTTIEMLAWAIQRLRETKMQRMQKLQDL  239

Query  991   ATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQEMK  1170
             A+T++ELWNLMD P EEQQ + N+T  IAASE+ELTE N LS++ L   E EV RL++ K
Sbjct  240   ASTLLELWNLMDTPFEEQQAYQNITCNIAASEAELTEQNTLSIEFLNYVEAEVLRLEQHK  299

Query  1171  SSKMKEVLLKKRITLEELCRQAHLAIDD--SIEFTDETIESGAIDPSHLLEQLEIQISNV  1344
             +SKMKE++LKK+  LEE  R+AHL  ++  + +FT E IE+GAIDPS LLEQ+E  IS V
Sbjct  300   ASKMKELVLKKKTELEEHRRRAHLVGEEGYATQFTIEAIEAGAIDPSLLLEQIEAYISTV  359

Query  1345  KEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVNKI  1524
             KEEAFSRK+ILE+VEKWL A EEE+WLEDYN++DNRYN GRG H+MLKRAEKAR LV+KI
Sbjct  360   KEEAFSRKDILERVEKWLNAREEEAWLEDYNKDDNRYNAGRGAHIMLKRAEKARVLVSKI  419

Query  1525  PGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQGQL  1704
             PGM++ L ++ + WE ERG  F YDGV L+ MLE+Y +++QEKE ER+RQRDQKKLQ Q 
Sbjct  420   PGMVDVLETKTRAWETERGNEFTYDGVRLILMLEEYMVVRQEKEQERKRQRDQKKLQDQR  479

Query  1705  MAEQEVLFGSKRSPSQSGKKNVVGGASNKRISVGGAMLQTPYTERAPLSSHSL---KKIN  1875
              AEQE L+GSK S S+S     V      R S  G  +Q P +E   L S ++   KK  
Sbjct  480   KAEQEALYGSKPSSSKSHSTKKV-----PRNSTPG--VQPPKSE--ILHSKTIRATKKTE  530

Query  1876  PVKQQALANITQNYVALSSGRRESSMHAKQPSCNKSNLQKTEPTQRKPLSPISSLSFNTS  2055
              +   +  +   + V L        +    PS N S L + E T RKP S I+       
Sbjct  531   DINTPSPGHKGLDTVGL-------PIRKLFPSSNSSTLLEME-TPRKPFSQIT-------  575

Query  2056  SANIMDKISESEELREMPASLLTTPIKNVS--GIGGNATPKtmpipmpstpasaassiam  2229
                              P ++ + P++ +S  G   N TPK      P        S  M
Sbjct  576   -----------------PGNISSAPVRPISTGGTEENRTPK---TFAPVPTTPMTVSPHM  615

Query  2230  QMGMTPAPVAATTPMVGHD--------GVEYSYEEMRAGFLL  2331
             QM +TP   A    ++ +D          EYS+EE R    L
Sbjct  616   QMAVTPVLTAKAVSVLSYDEPELTSQEDTEYSFEEKRLAVYL  657



>ref|XP_006402536.1| hypothetical protein EUTSA_v10005817mg [Eutrema salsugineum]
 gb|ESQ43989.1| hypothetical protein EUTSA_v10005817mg [Eutrema salsugineum]
Length=696

 Score =   508 bits (1308),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 331/724 (46%), Positives = 461/724 (64%), Gaps = 57/724 (8%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M     +Q  R+ETTC  LL +LQ+IWNE+GE E E+D  L  +E+ECL  Y++KV++AS
Sbjct  1     MMRNSAEQFSRIETTCGILLRQLQEIWNEMGETEDEKDAALADIEKECLSVYKQKVEEAS  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVR-QSSRSLKTELQAIMPlleemkkrkler  603
             +  A L + +A   AE+A I +++G Q ++   +   +LK EL+ +   LE ++K+K ER
Sbjct  61    KCKANLLKEIAMGRAEIAAIGSSMGGQEIHSNSRVGENLKEELENVNVQLEGLRKKKTER  120

Query  604   kHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLK  783
               +F EV+DQ+ ++  +LG     L+   A +E+D+SL++LE+++  L  LQ EKS RL+
Sbjct  121   MDRFKEVIDQLLTLSFQLGNPTDYLKKFAA-EETDISLQKLEELRRQLAELQNEKSKRLE  179

Query  784   QVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKI  963
             +V   LE+LN LC VLG DFK  I  IHP+L DS+  + VS  T+++L   I  LREVK+
Sbjct  180   EVERLLETLNLLCSVLGEDFKEMIRGIHPSLVDSNT-RDVSRSTLDKLDMMIENLREVKL  238

Query  964   QRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEI  1143
             Q++  +Q+LA +++ELWNL+D P EEQ++F NVT +IA SESE+TE N LS+  +K  E 
Sbjct  239   QKMQKVQDLAVSLLELWNLLDTPAEEQKIFHNVTCSIALSESEITEANILSVASIKRVED  298

Query  1144  EVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLA--IDDSIEFTDETIESGAIDPSHLLE  1317
             EV RL ++K++K+KEV+L+K++ LEE+ R+ H+A  +  S  F+ E IESG  DP  LLE
Sbjct  299   EVIRLSKLKTTKIKEVILRKKLVLEEISRKMHMAPQVLKSENFSVEAIESGFKDPEQLLE  358

Query  1318  QLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAE  1497
             Q++ +I+ VKEEA  RKEILEKVEKW++ACEEESWLE+YNR+DNRYN GRG HL LKRAE
Sbjct  359   QIDSEIAKVKEEASRRKEILEKVEKWMSACEEESWLEEYNRDDNRYNAGRGAHLTLKRAE  418

Query  1498  KARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQR  1677
             KAR LVNK+PGM+EALT++   WE ERG  FLYDGV +LSMLEQY  L +EKE E+QRQR
Sbjct  419   KARILVNKLPGMVEALTAKVNAWEDERGNEFLYDGVRVLSMLEQYKTLWEEKEFEKQRQR  478

Query  1678  DQKKLQGQLMAEQEVLFGSKRSPSQSGKKNV---VGGASNKRISVGGAMLQTPYTERAPL  1848
             D KKL GQL+ EQE L+GSK SPS+SGKK +   V    N+++S+GGAMLQ    E+A  
Sbjct  479   DLKKLNGQLITEQEALYGSKPSPSKSGKKPLRTPVAAGMNRKLSLGGAMLQGMKPEKA--  536

Query  1849  SSHSLKKINPVKQQALANITQNYVALSSGRRESSMHAKQ-PSCNKSNLQKT------EPT  2007
             ++ + KK N   Q A      + +   SGRR S +  ++  S N S   K        P 
Sbjct  537   TTFNSKKYNFFDQNA-NRRRDSTLPNPSGRRNSELPGQRLRSKNVSAAGKAVTNKGRSPM  595

Query  2008  QRKPLSPISSL----------SFNTSSANIMDKI-----SESEELREMPASLLTTPIKNV  2142
              RKPLSP++S           ++ T S++I ++I     +E      +P S+ TTP  +V
Sbjct  596   LRKPLSPVTSNILNSPEDHKDAYTTKSSSIEERILTPTTNEVNRKPAVPISVPTTPAASV  655

Query  2143  SGIGGNATPKtmpipmpstpasaassiamQMGMTPAPVAATTPMVGHDGVEYSYEEMRAG  2322
             + +    TP                        TP+  A    M   D VEYS+EE+RAG
Sbjct  656   A-MTEVTTP-----------------------FTPSFAAVEKRMGEEDVVEYSFEEVRAG  691

Query  2323  FLLP  2334
             F  P
Sbjct  692   FAKP  695



>ref|NP_001056260.2| Os05g0552900 [Oryza sativa Japonica Group]
 dbj|BAF18174.2| Os05g0552900, partial [Oryza sativa Japonica Group]
Length=731

 Score =   509 bits (1310),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 343/704 (49%), Positives = 462/704 (66%), Gaps = 63/704 (9%)
 Frame = +1

Query  274   LRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQA  453
             L M+T C SL+ ELQ IW+E+GEPE  RD+ML +LEQECLE YRRKVDQA+RS AQLRQA
Sbjct  68    LPMKTICGSLMHELQVIWDEVGEPEAARDRMLLELEQECLEVYRRKVDQANRSRAQLRQA  127

Query  454   VAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrklerkHQFSEV  624
             +A+ EAELA IC+A+GE  V+VRQS++    L+ EL AI+P LEEMK++K+ER +QF +V
Sbjct  128   IAQYEAELAAICSAIGETTVHVRQSNQKACGLRDELGAILPYLEEMKRKKVERWNQFLDV  187

Query  625   LDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLE  804
             + +I  +  E+  +  +    +++D+SDLSLR+LE+++  L SL+KEK +R+KQV+++L+
Sbjct  188   VGRIKKISSEIRPANFD-PFKVSVDQSDLSLRKLEELRVELKSLEKEKGERVKQVMEYLK  246

Query  805   SLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQRLHMLQ  984
             +L+SLC+VLG+DFK TI EIHP+L ++   +++S  TIE L+ AI  LRE K+QR+  LQ
Sbjct  247   TLHSLCVVLGVDFKKTISEIHPSLDEAEGPRNISNTTIEMLAWAIQRLRETKMQRMQKLQ  306

Query  985   NLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQE  1164
             +LA+T++ELWNLMD P EEQQ + N+T  IAASE+ELTE N LS++ L   E EV RL++
Sbjct  307   DLASTLLELWNLMDTPFEEQQAYQNITCNIAASEAELTEQNTLSIEFLNYVEAEVLRLEQ  366

Query  1165  MKSSKMKEVLLKKRITLEELCRQAHLAIDD--SIEFTDETIESGAIDPSHLLEQLEIQIS  1338
              K+SKMKE++LKK+  LEE  R+AHL  ++  + +FT E IE+GAIDPS LLEQ+E  IS
Sbjct  367   HKASKMKELVLKKKTELEEHRRRAHLVGEEGYATQFTIEAIEAGAIDPSLLLEQIEAYIS  426

Query  1339  NVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVN  1518
              VKEEAFSRK+ILE+VEKWL A EEE+WLEDYN++DNRYN GRG H+MLKRAEKAR LV+
Sbjct  427   TVKEEAFSRKDILERVEKWLNAREEEAWLEDYNKDDNRYNAGRGAHIMLKRAEKARVLVS  486

Query  1519  KIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQG  1698
             KIPGM++ L ++ + WE ERG  F YDGV L+ MLE+Y +++QEKE ER+RQRDQKKLQ 
Sbjct  487   KIPGMVDVLETKTRAWETERGNEFTYDGVRLILMLEEYMVVRQEKEQERKRQRDQKKLQD  546

Query  1699  QLMAEQEVLFGSKRSPSQSGKKNVVGGASNKRISVGGAMLQTPYTERAPLSSHSL---KK  1869
             Q  AEQE L+GSK S S+S     V      R S  G  +Q P +E   L S ++   KK
Sbjct  547   QRKAEQEALYGSKPSSSKSHSTKKV-----PRNSTPG--VQPPKSE--ILHSKTIRATKK  597

Query  1870  INPVKQQALANITQNYVALSSGRRESSMHAKQPSCNKSNLQKTEPTQRKPLSPISSLSFN  2049
                +   +  +   + V L        +    PS N S L + E T RKP S I+     
Sbjct  598   TEDINTPSPGHKGLDTVGL-------PIRKLFPSSNSSTLLEME-TPRKPFSQIT-----  644

Query  2050  TSSANIMDKISESEELREMPASLLTTPIKNVS--GIGGNATPKtmpipmpstpasaassi  2223
                                P ++ + P++ +S  G   N TPK      P        S 
Sbjct  645   -------------------PGNISSAPVRPISTGGTEENRTPK---TFAPVPTTPMTVSP  682

Query  2224  amQMGMTPAPVAATTPMVGHD--------GVEYSYEEMRAGFLL  2331
              MQM +TP   A    ++ +D          EYS+EE R    L
Sbjct  683   HMQMAVTPVLTAKAVSVLSYDEPELTSQEDTEYSFEEKRLAVYL  726



>gb|EEE64623.1| hypothetical protein OsJ_19475 [Oryza sativa Japonica Group]
Length=665

 Score =   504 bits (1297),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 342/705 (49%), Positives = 461/705 (65%), Gaps = 66/705 (9%)
 Frame = +1

Query  280   METTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVA  459
             M+T C SL+ ELQ IW+E+GEPE  RD+ML +LEQECLE YRRKVDQA+RS AQLRQA+A
Sbjct  1     MKTICGSLMHELQVIWDEVGEPEAARDRMLLELEQECLEVYRRKVDQANRSRAQLRQAIA  60

Query  460   ESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrklerkHQFSEVLD  630
             + EAELA IC+A+GE  V+VRQS++    L+ EL AI+P LEEMK++K+ER +QF +V+ 
Sbjct  61    QYEAELAAICSAIGETTVHVRQSNQKACGLRDELGAILPYLEEMKRKKVERWNQFLDVVG  120

Query  631   QIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESL  810
             +I  +  E+  +  +    +++D+SDLSLR+LE+++  L SL+KEK +R+KQV+++L++L
Sbjct  121   RIKKISSEIRPANFD-PFKVSVDQSDLSLRKLEELRVELKSLEKEKGERVKQVMEYLKTL  179

Query  811   NSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQRLH---ML  981
             +SLC+VLG+DFK TI EIHP+L ++   +++S  TIE L+ AI  LRE K+QR+     L
Sbjct  180   HSLCVVLGVDFKKTISEIHPSLDEAEGPRNISNTTIEMLAWAIQRLRETKMQRMQKLCQL  239

Query  982   QNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQ  1161
             Q+LA+T++ELWNLMD P EEQQ + N+T  IAASE+ELTE N LS++ L   E EV RL+
Sbjct  240   QDLASTLLELWNLMDTPFEEQQAYQNITCNIAASEAELTEQNTLSIEFLNYVEAEVLRLE  299

Query  1162  EMKSSKMKEVLLKKRITLEELCRQAHLAIDD--SIEFTDETIESGAIDPSHLLEQLEIQI  1335
             + K+SKMKE++LKK+  LEE  R+AHL  ++  + +FT E IE+GAIDPS LLEQ+E  I
Sbjct  300   QHKASKMKELVLKKKTELEEHRRRAHLVGEEGYATQFTIEAIEAGAIDPSLLLEQIEAYI  359

Query  1336  SNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALV  1515
             S VKEEAFSRK+ILE+VEKWL A EEE+WLEDYN++DNRYN GRG H+MLKRAEKAR LV
Sbjct  360   STVKEEAFSRKDILERVEKWLNAREEEAWLEDYNKDDNRYNAGRGAHIMLKRAEKARVLV  419

Query  1516  NKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQ  1695
             +KIPGM++ L ++ + WE ERG  F YDGV L+ MLE+Y +++QEKE ER+RQRDQKKLQ
Sbjct  420   SKIPGMVDVLETKTRAWETERGNEFTYDGVRLILMLEEYMVVRQEKEQERKRQRDQKKLQ  479

Query  1696  GQLMAEQEVLFGSKRSPSQSGKKNVVGGASNKRISVGGAMLQTPYTERAPLSSHSL---K  1866
              Q  AEQE L+GSK S S+S     V      R S  G  +Q P +E   L S ++   K
Sbjct  480   DQRKAEQEALYGSKPSSSKSHSTKKV-----PRNSTPG--VQPPKSE--ILHSKTIRATK  530

Query  1867  KINPVKQQALANITQNYVALSSGRRESSMHAKQPSCNKSNLQKTEPTQRKPLSPISSLSF  2046
             K   +   +  +   + V L        +    PS N S L + E T RKP S I+    
Sbjct  531   KTEDINTPSPGHKGLDTVGL-------PIRKLFPSSNSSTLLEME-TPRKPFSQIT----  578

Query  2047  NTSSANIMDKISESEELREMPASLLTTPIKNVS--GIGGNATPKtmpipmpstpasaass  2220
                                 P ++ + P++ +S  G   N TPK      P        S
Sbjct  579   --------------------PGNISSAPVRPISTGGTEENRTPK---TFAPVPTTPMTVS  615

Query  2221  iamQMGMTPAPVAATTPMVGHD--------GVEYSYEEMRAGFLL  2331
               MQM +TP   A    ++ +D          EYS+EE R    L
Sbjct  616   PHMQMAVTPVLTAKAVSVLSYDEPELTSQEDTEYSFEEKRLAVYL  660



>emb|CDY62713.1| BnaC04g55380D [Brassica napus]
Length=684

 Score =   502 bits (1292),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 328/713 (46%), Positives = 452/713 (63%), Gaps = 50/713 (7%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M     +Q  R+ETTC  LL +LQ+IW+E+GE E E+D  L  +E+ECL  Y+RKV++AS
Sbjct  1     MIRNSTEQFSRIETTCGLLLRQLQEIWSEMGENEDEKDAALADIEKECLLVYKRKVEEAS  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVR-QSSRSLKTELQAIMPlleemkkrkler  603
             R  A L + +A   AE+A I +++G Q ++   +   +LK EL+ +   LEE++++K ER
Sbjct  61    RCKANLLKEIALGRAEIAAIGSSMGGQEIHCNGRVGENLKEELENVTVQLEELRRKKAER  120

Query  604   kHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLK  783
              ++F EV+DQ+ S+  +LG S   L+ + A +E+DLSL +LED++  L  LQ EKS RL+
Sbjct  121   MNRFKEVIDQLLSLSFQLGDSTDYLKKLGA-EEADLSLHKLEDLRRQLAELQNEKSKRLE  179

Query  784   QVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKI  963
             +V   LE+L  LC VLG D K+    IHP+L DS+  + VS  T+++L   I  LR VK+
Sbjct  180   EVERLLETLKLLCSVLGEDLKDLTRGIHPSLVDSNT-RDVSRSTLDKLDFMIGNLRGVKL  238

Query  964   QRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEI  1143
             QR+H +Q+LA +++ELWNL+D P EEQ+ F NVT +IA SESE+TE N LS+  +K+ E 
Sbjct  239   QRMHKIQDLAVSLLELWNLLDTPAEEQKTFHNVTCSIALSESEITEANILSVASIKNVED  298

Query  1144  EVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLA--IDDSIEFTDETIESGAIDPSHLLE  1317
             EV RL ++K +K+KEV+L+K++ LEE+ R+ H+A  +  S  F+ E IESG  DP  LLE
Sbjct  299   EVIRLSKLKITKIKEVILRKKLELEEISRKVHMAPQVLKSENFSIEAIESGVKDPEQLLE  358

Query  1318  QLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAE  1497
             Q++ +I+ V+EE+ SRKEILEKVEKW+ ACEEESWLE+YNR+DNRYN GRG HL LKRAE
Sbjct  359   QIDSEIAKVREESSSRKEILEKVEKWMTACEEESWLEEYNRDDNRYNAGRGAHLTLKRAE  418

Query  1498  KARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQR  1677
             KAR LVNK+PGM+E LT++   WE ERG  FLYDGV +LSMLEQY  L +EKE E+QRQR
Sbjct  419   KARILVNKLPGMVETLTAKVNAWEDERGHAFLYDGVRVLSMLEQYKTLWEEKEFEKQRQR  478

Query  1678  DQKKLQGQLMAEQEVLFGSKRSPSQSGKK----NVVGGASNKRISVGGAMLQTPYTERAP  1845
             D KKL GQ + EQE L+GSK SP +SGKK     +   A N+++S+GGA LQ+   E+A 
Sbjct  479   DLKKLHGQHITEQEALYGSKPSPGKSGKKPLRTALPSSAMNRKLSLGGATLQSSKPEKAT  538

Query  1846  LSSHSLKKINPVKQQALANITQNYVALSSGRRESS----MHAKQ-PSCNKSNLQKTE-PT  2007
             L+S   KK     Q A +   ++ +   SGRR S     + AK  P   K+ + K   P 
Sbjct  539   LNS---KKTTYYDQNAPSR-RESTIPNPSGRRNSELPGRLRAKNVPGAGKAVMNKGRSPM  594

Query  2008  QRKPLSPISSLSFNTSS-------ANIMDKISESEELREMPASLLTTPIKNVSGIGGNAT  2166
              RKPLSP++S   N+              K +E      +P S  TTP  +V+ +    T
Sbjct  595   LRKPLSPVTSNILNSPEDHKDAYPTKSSPKTNEENRGAAVPISEPTTPAASVA-MSEATT  653

Query  2167  PKtmpipmpstpasaassiamQMGMTPAPVAATTPMVGHDGVEYSYEEMRAGF  2325
             P                        TPA  A    +   +GVEYS+EE+RAGF
Sbjct  654   P-----------------------FTPASKAVKKRLDNAEGVEYSFEEVRAGF  683



>ref|XP_009138809.1| PREDICTED: LOW QUALITY PROTEIN: 65-kDa microtubule-associated 
protein 4 [Brassica rapa]
Length=685

 Score =   498 bits (1282),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 326/714 (46%), Positives = 449/714 (63%), Gaps = 51/714 (7%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M     +Q  R+ETTC  LL +LQ+IW+E+GE E E+D  L  +E+ECL  Y+RKV++AS
Sbjct  1     MIRNSTEQFSRIETTCGLLLRQLQEIWSEMGENEDEKDAALADIEKECLLVYKRKVEEAS  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVR-QSSRSLKTELQAIMPlleemkkrkler  603
             R  A L + +A   AE+A I +++G Q ++   +   +LK EL+ +   LEE++++K ER
Sbjct  61    RCKANLLKEIAMGRAEIAAIGSSMGGQEIHSNGRVGENLKEELENVTVQLEELRRKKSER  120

Query  604   kHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLK  783
              ++F EV+D++ S+  +LG S   L+ M+  +E+DLSL +LE+++  L  LQ EKS RL+
Sbjct  121   MNRFKEVIDELLSLSFQLGDSTDYLK-MLGAEEADLSLHKLEELRRQLAQLQNEKSKRLE  179

Query  784   QVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKI  963
             +V   LE+L  LC VLG D K+ I  IHP+L DS+  + VS  T+++L   I  LR VK+
Sbjct  180   EVERLLETLTLLCSVLGEDLKDLIRGIHPSLVDSNT-RDVSRSTLDKLDLMIGNLRGVKL  238

Query  964   QRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEI  1143
             QR+  +Q+LA +++ELWNL+D P EEQ+ F NVT +IA SESE+TE N LS+  +K+ E 
Sbjct  239   QRMQKIQDLAVSLLELWNLLDTPAEEQKTFHNVTCSIALSESEITEANILSVASIKNVED  298

Query  1144  EVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLA--IDDSIEFTDETIESGAIDPSHLLE  1317
             EV RL ++K +K+KEV+L+K++ LEE+ R+ H+A  +  S  F+ E IESG  DP  LLE
Sbjct  299   EVIRLSKLKITKIKEVILRKKLELEEISRKVHMAPQVLRSXNFSIEAIESGVKDPEQLLE  358

Query  1318  QLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAE  1497
             Q++ +I+ VKEEA SRKEILEKVEKW+ ACEEESWLE+YNR+DNRYN  R  HL LKRAE
Sbjct  359   QIDSEIAKVKEEASSRKEILEKVEKWMTACEEESWLEEYNRDDNRYNAEREAHLTLKRAE  418

Query  1498  KARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQR  1677
             KAR LVNK+PGM+E LT++   WE ERG  FLYDGV +LSMLEQY  L +EKE E+QRQR
Sbjct  419   KARILVNKLPGMVETLTAKVNAWEDERGHAFLYDGVRVLSMLEQYKTLWEEKEFEKQRQR  478

Query  1678  DQKKLQGQLMAEQEVLFGSKRSPSQSGKK----NVVGGASNKRISVGGAMLQTPYTERAP  1845
             D KKL GQ + EQE L+GSK SP +SGKK     +   A N+++S+GGAMLQ+   E+A 
Sbjct  479   DLKKLHGQHITEQEALYGSKPSPGKSGKKPLRTALPSSAMNRKLSLGGAMLQSSKPEKAT  538

Query  1846  LSSHSLKKINPVKQQALANITQNYVALSSGRRESSMHAK-----QPSCNKS--NLQKTEP  2004
             LSS   KK     Q A +    + +   SGRR S +  +      P+  K+  N +   P
Sbjct  539   LSS---KKTTYYDQNAPSR-RDSTIPNPSGRRNSELPGRLKAKNVPAAGKAVMNNKGRSP  594

Query  2005  TQRKPLSPISSLSFN-------TSSANIMDKISESEELREMPASLLTTPIKNVSGIGGNA  2163
               RKPLSP++S   N       T +     K +E      +P S  TT   +V  +    
Sbjct  595   MLRKPLSPVTSNILNSPEDHKDTYTTKSSPKTNEENRRTAVPISASTTTAASVV-MSEAT  653

Query  2164  TPKtmpipmpstpasaassiamQMGMTPAPVAATTPMVGHDGVEYSYEEMRAGF  2325
             TP                        TPA  A    +   +GVEYS+EE+RAGF
Sbjct  654   TP-----------------------FTPASKAVKKRLDNAEGVEYSFEEVRAGF  684



>sp|Q9LZY0.2|MA654_ARATH RecName: Full=65-kDa microtubule-associated protein 4; Short=AtMAP65-4 
[Arabidopsis thaliana]
Length=677

 Score =   496 bits (1276),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 334/705 (47%), Positives = 454/705 (64%), Gaps = 41/705 (6%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M     +Q  R+ETTC  LL +LQ+IWNE+GE E E+D  L  +E+ECL  Y+RKV++AS
Sbjct  1     MIRNSTEQFSRIETTCGLLLRQLQEIWNEMGETEDEKDASLADIEKECLSVYKRKVEEAS  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrkl  597
             R  A L + +A   AE+A I +++G Q ++   +SR   +LK EL+ +   L+ ++KRK 
Sbjct  61    RGKANLLKEIAVGRAEIAAIGSSMGGQEIH--SNSRLGENLKEELENVNVQLDGLRKRKA  118

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             ER  +F+EV+DQ+  +  +LG     L+   A +E+DLSL+RLE+++S L  LQ EKS R
Sbjct  119   ERMIRFNEVIDQLLKLSLQLGNPTDYLKKFAA-EETDLSLQRLEELRSQLGELQNEKSKR  177

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             L++V   L++LNSLC VLG DFK  I  IH +L DS+  + VS  T+++L   I  LRE 
Sbjct  178   LEEVECLLKTLNSLCSVLGEDFKGMIRGIHSSLVDSNT-RDVSRSTLDKLDMMIVNLREA  236

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             K+QR+  +Q+LA +++ELWNL+D P EEQ++F NVT +IA +ESE+TE N LS+  +K  
Sbjct  237   KLQRMQKVQDLAVSLLELWNLLDTPAEEQKIFHNVTCSIALTESEITEANILSVASIKRV  296

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAID--DSIEFTDETIESGAIDPSHL  1311
             E EV RL ++K +K+KEV+L+KR+ LEE+ R+ H+A +   S  F+ E IESG  DP  L
Sbjct  297   EDEVIRLSKIKITKIKEVILRKRLELEEISRKMHMATEVLKSENFSVEAIESGVKDPEQL  356

Query  1312  LEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKR  1491
             LEQ++ +I+ VKEEA SRKEILEKVEKW++ACEEESWLE+YNR+DNRYN GRG HL LKR
Sbjct  357   LEQIDSEIAKVKEEASSRKEILEKVEKWMSACEEESWLEEYNRDDNRYNAGRGAHLTLKR  416

Query  1492  AEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQR  1671
             AEKAR LVNK+PGM+EALT++   WE ERG  FLYDGV +LSML QY  + +EKE E+QR
Sbjct  417   AEKARLLVNKLPGMVEALTAKVTAWENERGNEFLYDGVRVLSMLGQYKTVWEEKEHEKQR  476

Query  1672  QRDQKKLQGQLMAEQEVLFGSKRSPSQSGKKNV---VGGASNKRISVGGAML-QTPYTER  1839
             QRD KKL GQL+ EQE L+GSK SP++SGKK +   V  A N+++S+GGAML Q+   E+
Sbjct  477   QRDMKKLHGQLITEQEALYGSKPSPNKSGKKPLRTPVNAAMNRKLSLGGAMLHQSLKHEK  536

Query  1840  APLSSHSLKKINPVKQQALANITQNYVALSSGRRESSMHAKQPSCNKSNLQKT--EPTQR  2013
             A L+S   K+     Q A +        L SGRR S +  +  S N     K    P  R
Sbjct  537   ATLNS---KRTKYYDQNATSRRDSALPTL-SGRRNSELPGRIRSKNVPVAGKAARSPMLR  592

Query  2014  KPLSPISSLSFNTSSANIMDKISESEELREMPASLLTTPIKNVSGIGGNATPKtmpipmp  2193
             KPLSP++S   N+   +  D  +  E +                      TPKT      
Sbjct  593   KPLSPVTSNILNSPEDHHKDAYTTKERI---------------------LTPKTNEEKKR  631

Query  2194  stpasaassiamQMGMTPAPVAATTPMVGHDG-VEYSYEEMRAGF  2325
             + P + A+S+AM    TP   A    M   D  VEYS+EE+RAGF
Sbjct  632   AVPTTPAASVAMTEATTPFTPAVEKRMDEEDVIVEYSFEEVRAGF  676



>ref|XP_010512415.1| PREDICTED: 65-kDa microtubule-associated protein 4 isoform X1 
[Camelina sativa]
 ref|XP_010512416.1| PREDICTED: 65-kDa microtubule-associated protein 4 isoform X2 
[Camelina sativa]
Length=685

 Score =   492 bits (1267),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 322/716 (45%), Positives = 459/716 (64%), Gaps = 55/716 (8%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M     +Q  R+ETTC  LL +LQ+IWNE+GE E E+D  L  +E+ECL  Y+RKV++AS
Sbjct  1     MMRNSTEQFSRIETTCGLLLRQLQEIWNEMGETEDEKDTALADIEKECLSVYKRKVEEAS  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQS-SRSLKTELQAIMPlleemkkrkler  603
             R  A L + +A   +E+A I +++G Q ++       +LK EL+ +   L+ ++K+K ER
Sbjct  61    RCKANLLKEIALGRSEIAAIGSSMGGQEIHFNSRLGENLKEELENVNVQLDGLRKKKAER  120

Query  604   kHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLK  783
              ++F EV+DQ+  +  +LG     L+   A +E+DLSL++LE+++  L  LQ EKS RL+
Sbjct  121   MNRFREVIDQLLKLSSQLGNPTDYLKKFAA-EETDLSLQKLEELRRQLAELQNEKSKRLE  179

Query  784   QVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKI  963
             +V   L++LNSLC VLG DFK+ +  IH +L DS+  + V+  T+++L   I  LREVK+
Sbjct  180   EVERLLKTLNSLCSVLGEDFKDMLRGIHSSLVDSNT-RDVNRSTLDKLDMMIVNLREVKL  238

Query  964   QRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEI  1143
             QR+  +Q+LA +++ELWNL+D P EEQ++F NVT +IA SE E+TE N LS+  +K  + 
Sbjct  239   QRMQKVQDLAVSLLELWNLLDTPAEEQKIFHNVTCSIALSEPEITEDNILSVASIKRVDD  298

Query  1144  EVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAID--DSIEFTDETIESGAIDPSHLLE  1317
             EV+RL ++K +K+KEV+L+K++ LEE+ R+ H+A +   S  F+ E IESG  DP  LLE
Sbjct  299   EVTRLSKLKITKIKEVILRKKLELEEISRKMHMATEVLKSENFSVEAIESGVKDPEQLLE  358

Query  1318  QLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAE  1497
             Q++ +I+ VKEEA SRKEILEKVEKW++ACEEESWLE+YNR+DNRYN GRG HL LKRAE
Sbjct  359   QIDSEIAKVKEEASSRKEILEKVEKWMSACEEESWLEEYNRDDNRYNAGRGAHLTLKRAE  418

Query  1498  KARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQR  1677
             KAR LVNK+PGM+EALT++   WE ERG  FLYDGV +LSML+QY  L  EKE E+QRQR
Sbjct  419   KARVLVNKLPGMVEALTAKVTAWEAERGNEFLYDGVRVLSMLDQYKTLWGEKEHEKQRQR  478

Query  1678  DQKKLQGQLMAEQEVLFGSKRSPSQSGKKNV---VGGASNKRISVGGAML-QTPYTERAP  1845
             D KKL GQL+ EQE L+GSK SP++SGKK +   V  A N+++S+GGAML Q+   E+A 
Sbjct  479   DLKKLHGQLITEQEALYGSKPSPNKSGKKPLRTPVNAAMNRKLSLGGAMLNQSLKPEKAT  538

Query  1846  LSSHSLKKINPVKQQALANITQNYVALSSGRRESSMHAKQPSCNKSNLQKT------EPT  2007
              +    K+ +   Q A +    + +   SGRR S +  +  S N S   KT       P 
Sbjct  539   FNG---KRSSYYDQNATSR-RDSTLPTPSGRRNSELPGRLRSKNVSVSGKTVTNKGRSPM  594

Query  2008  QRKPLSPISSL----------SFNTSSANIMDKISESEELREMPASLLTTPIKNVSGIGG  2157
              RKPLSP++S           ++ T  +++ ++I   +   E    + TTP  +V+ +  
Sbjct  595   LRKPLSPVTSNILNSPEDHRDAYTTKPSSLEERILTPKTNEENERVVPTTPAASVAMMEA  654

Query  2158  NATPKtmpipmpstpasaassiamQMGMTPAPVAATTPMVGHDGVEYSYEEMRAGF  2325
               TP                + A++  M  APVA          +EYS+EE+RAGF
Sbjct  655   -TTP---------------FTPAVEKRMDEAPVA----------LEYSFEEVRAGF  684



>ref|XP_010446032.1| PREDICTED: 65-kDa microtubule-associated protein 3-like [Camelina 
sativa]
Length=824

 Score =   497 bits (1279),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 337/689 (49%), Positives = 451/689 (65%), Gaps = 64/689 (9%)
 Frame = +1

Query  361   KMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAESEAELARICAALGEQPVNVRQSSRS-  537
             K LC L         RKVDQA+R  AQLRQA+A++EAELA IC+A+GE+PV++RQS +S 
Sbjct  161   KHLCTL---------RKVDQANRCRAQLRQAIADAEAELATICSAMGERPVHIRQSDQSV  211

Query  538   --LKTELQAIMPlleemkkrklerkHQFSEVLDQIDSVLKELGKSRKELQHMIAL-DESD  708
               LK EL  I+P LEEM+KRK+ER++QF  VL++IDS+  ++ K + EL H   L DE+D
Sbjct  212   GSLKQELGTILPELEEMQKRKIERRNQFVVVLEEIDSIANDI-KGQGELVHSKPLIDETD  270

Query  709   LSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSS  888
             LS+R+LE++   L +LQKEKSDR++ +  HL +L S C VLG+DF   +G+++PTL D  
Sbjct  271   LSMRKLEELHCQLQALQKEKSDRVEMIRKHLCTLYSHCSVLGMDFNEVVGQVNPTLSDPE  330

Query  889   ALKSVSTETIERLSAAIHELREVKIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTR  1068
               +S+S  TIE+L AA+ +LREVKIQR+  LQ+LATT++ELWNLMD P+EEQQ + ++T 
Sbjct  331   GPRSLSDHTIEKLGAAVQKLREVKIQRMQRLQDLATTMLELWNLMDTPIEEQQEYQHITC  390

Query  1069  AIAASESELTEPNALSLDLLKSAEIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHL--  1242
              IAASE E+TE N+LS D +K  E EV RL  +K+SKMKE++ KKR  LE++CR+ HL  
Sbjct  391   NIAASEHEITEGNSLSEDFIKYVEAEVVRLDAVKTSKMKELVFKKRSELEDICRKTHLLP  450

Query  1243  AIDDSIEFTDETIESGAIDPSHLLEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESW  1422
               D +I+ T   IESG +D + +LE LE  IS +KEEA SRKEILE+VEKWL+AC+EESW
Sbjct  451   VSDSAIDQTVAAIESGIVDATMVLEHLEQHISKIKEEALSRKEILERVEKWLSACDEESW  510

Query  1423  LEdynrndnrynggrgTHLMLKRAEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDG  1602
             LE+YNR+DNRYN GRG HL LKRAEKAR LVNK+PGM+EAL S+   WE E+G+ FLYDG
Sbjct  511   LEEYNRDDNRYNAGRGAHLTLKRAEKARNLVNKLPGMVEALASKTIVWEQEKGIGFLYDG  570

Query  1603  VSLLSMLEQYGLLKQEKELERQRQRDQKKLQGQLMAEQEVLFGSKRSPSQ--SGKKN---  1767
             + LLSMLE+Y LL+QE+E E +RQRDQKKLQGQL+AEQE L+GSK SPS+   GKK    
Sbjct  571   IRLLSMLEEYNLLRQEREEEHRRQRDQKKLQGQLIAEQEALYGSKPSPSKPLGGKKAPRM  630

Query  1768  VVGGASNKRISVGGAMLQTPYTERAPLSSHSLKKINPVKQQALANITQNYVALSSGRRE-  1944
               GGA+N+R+S+G  M QTP                P K+   A+  QN  ALS+GRR  
Sbjct  631   STGGATNRRLSLGAGMHQTP---------------KPNKK---ADHRQNDGALSNGRRGL  672

Query  1945  --SSMHAKQPSCNKSNLQKTEPTQRKPLSPISSLSFNTSSANIMDKISES---EELREMP  2109
               + +  ++ S N S L ++ P  RKP SPI + +   S ANI     +      + EM 
Sbjct  673   DIAGLPTRKQSMNPSELLQS-PLVRKPFSPIPT-TVVASKANIATTTQQHLKHNAVNEM-  729

Query  2110  ASLLTTPIKNVSGIGGNATPKtmpipmpstpasaassiamQMGMTPAPVA-----ATTPM  2274
              S   TP+KN +        +   +           +  + +  TPA ++     A TP 
Sbjct  730   -SSFATPVKNNNNNNILRNLEEEKMMTMMMQTPKNVAAMIPVPSTPATISVPMHTAPTPF  788

Query  2275  VGH----------DGVEYSYEEMRAGFLL  2331
               +          + +EYS+EE R  F+L
Sbjct  789   TTNARSMSMSEKPEVLEYSFEERRLAFML  817


 Score =   132 bits (332),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 132/405 (33%), Positives = 207/405 (51%), Gaps = 66/405 (16%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M   Q D  L++ETTC SLL ELQ                            RRKVDQA+
Sbjct  1     MATIQKDPILQVETTCGSLLYELQVFG-------------------------RRKVDQAN  35

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrkl  597
             R  AQLRQA+A++EAELA IC+A+GE+PV++RQS +   SLK EL  I+P LEEM+KRK+
Sbjct  36    RCRAQLRQAIADAEAELATICSAMGERPVHIRQSDQSVGSLKQELGTILPELEEMQKRKI  95

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIAL-DESDLSLRRLEDMKSHLLSLQKEKSD  774
             ER++QF  VL++IDS+  ++ K + EL H   L DE+DLS+R+LE++   L +LQKEKSD
Sbjct  96    ERRNQFVVVLEEIDSIANDI-KGQGELVHSKPLIDETDLSMRKLEELHCQLQALQKEKSD  154

Query  775   RLKQVLDHLESLNSLCIVLGIDFKNTI-GEIHPTLGDSSA-LKSVSTETIERLSAAIHEL  948
             R++ +  H      LC +  +D  N    ++   + D+ A L ++ +   ER    +H +
Sbjct  155   RVEMIRKH------LCTLRKVDQANRCRAQLRQAIADAEAELATICSAMGER---PVH-I  204

Query  949   REVKIQRLHMLQNLATTIVELWNLMDMPVEEQQLF-------DNVTRAIAAS-----ESE  1092
             R+       + Q L T + EL  +    +E +  F       D++   I           
Sbjct  205   RQSDQSVGSLKQELGTILPELEEMQKRKIERRNQFVVVLEEIDSIANDIKGQGELVHSKP  264

Query  1093  LTEPNALSLDLLKSAEIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAIDDSIEFTD  1272
             L +   LS+  L+    ++  LQ+ KS ++ E++ K   TL   C    +  ++ +   +
Sbjct  265   LIDETDLSMRKLEELHCQLQALQKEKSDRV-EMIRKHLCTLYSHCSVLGMDFNEVVGQVN  323

Query  1273  ETIESGAIDP-------SHLLEQLEIQISNVKEEAFSRKEILEKV  1386
              T+     DP        H +E+L   +  ++E    R + L+ +
Sbjct  324   PTLS----DPEGPRSLSDHTIEKLGAAVQKLREVKIQRMQRLQDL  364



>ref|XP_010413509.1| PREDICTED: 65-kDa microtubule-associated protein 4-like [Camelina 
sativa]
Length=685

 Score =   491 bits (1264),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 324/716 (45%), Positives = 458/716 (64%), Gaps = 55/716 (8%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M     +Q  R+ETTC  LL +LQ+IWNE+GE E E+D  L  +E+ECL  Y+RKV++AS
Sbjct  1     MMRNSTEQFSRIETTCGLLLRQLQEIWNEMGETEDEKDTALADIEKECLSVYKRKVEEAS  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQS-SRSLKTELQAIMPlleemkkrkler  603
             R  A L + +A   +E+A I +++G Q ++       +LK EL+ +   LE ++K+K ER
Sbjct  61    RCKANLLKEIAFGRSEIAAIGSSMGGQEIHFNSRLGENLKEELENVNVQLEGLRKKKAER  120

Query  604   kHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLK  783
              ++F+EV+DQ+  +  +LG     L+   A +E+DLSL++LE+++  L  LQ EKS RL+
Sbjct  121   MYRFNEVIDQLLKLSSQLGNPTDYLKK-FASEETDLSLQKLEELRRQLAELQNEKSKRLE  179

Query  784   QVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKI  963
             +V   L++LNSLC VLG DFK+    IH +L DS+  + V+  T+++L   I  LREVK+
Sbjct  180   EVERLLKTLNSLCSVLGEDFKDMRRGIHSSLVDSNT-RDVNRSTLDKLDMMIVNLREVKL  238

Query  964   QRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEI  1143
             QR+  +Q+LA +++ELWNL+D P EEQ++F NVT +IA SE E+TE N LS+  +K  + 
Sbjct  239   QRMQKVQDLAVSLLELWNLLDTPAEEQKIFHNVTCSIALSEPEITEANILSVASIKRVDD  298

Query  1144  EVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAID--DSIEFTDETIESGAIDPSHLLE  1317
             EV RL ++K +K+KEV+L+K++ LEE+ R+ H+A +   S  F+ E IESG  DP  LLE
Sbjct  299   EVIRLSKLKITKIKEVILRKKLELEEISRKMHMATEVLKSENFSVEAIESGVKDPEQLLE  358

Query  1318  QLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAE  1497
             +++ +I+ VKEEA SRKEILEKVEKW++ACEEESWLE+YNR+DNRYN GRG HL LKRAE
Sbjct  359   KIDSEIAKVKEEASSRKEILEKVEKWMSACEEESWLEEYNRDDNRYNAGRGAHLTLKRAE  418

Query  1498  KARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQR  1677
             KAR LVNK+PGM+EALT++   WE ERG  FLYDGV +LSML+QY  L  EKE E+QRQR
Sbjct  419   KARLLVNKLPGMVEALTAKVTAWEAERGNEFLYDGVRVLSMLDQYKTLWGEKEHEKQRQR  478

Query  1678  DQKKLQGQLMAEQEVLFGSKRSPSQSGKKNV---VGGASNKRISVGGAML-QTPYTERAP  1845
             D KKL GQL+ EQE L+GSK SP++SGKK +   V  A N+++S+GGAML Q+   E+A 
Sbjct  479   DLKKLHGQLITEQEALYGSKPSPNKSGKKPLRTPVNAAMNRKLSLGGAMLNQSLKPEKAT  538

Query  1846  LSSHSLKKINPVKQQALANITQNYVALSSGRRESSMHAKQPSCNKSNLQKT------EPT  2007
              +    KK N   Q A +    + +   SGRR S +  +  S N S   KT       P 
Sbjct  539   FNG---KKNNYYDQNATSR-RDSTLPTPSGRRNSELPGRLRSKNFSVSGKTVTNKGRSPM  594

Query  2008  QRKPLSPISSL----------SFNTSSANIMDKISESEELREMPASLLTTPIKNVSGIGG  2157
              RKPLSP++S           ++ T  +++ ++I   +   E    + TTP  +V+ +  
Sbjct  595   LRKPLSPVTSNILNSPEDHRDAYTTKPSSLEERILTHKTNEENERVVPTTPAASVAMMEA  654

Query  2158  NATPKtmpipmpstpasaassiamQMGMTPAPVAATTPMVGHDGVEYSYEEMRAGF  2325
               TP                + A++  M  APVA          +EYS+EE+RAGF
Sbjct  655   -TTP---------------FTPAVEKRMDEAPVA----------LEYSFEEVRAGF  684



>ref|XP_010231054.1| PREDICTED: 65-kDa microtubule-associated protein 3-like [Brachypodium 
distachyon]
Length=683

 Score =   487 bits (1253),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 335/711 (47%), Positives = 460/711 (65%), Gaps = 62/711 (9%)
 Frame = +1

Query  265   DQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQL  444
             D  L+MET C +L+ ELQ IW+E+GE + ERD+ML +LEQECLE YR KVDQA+R  AQL
Sbjct  8     DPLLQMETPCGALMRELQVIWDEVGEKDAERDRMLLELEQECLEVYRSKVDQANRCRAQL  67

Query  445   RQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrklerkHQF  615
             RQA+AE+EAELA IC+A+ E  V+VRQ ++    L+ EL AI+P LE MKKRK+ER +Q 
Sbjct  68    RQAIAEAEAELAAICSAMSEPAVHVRQPNQKACGLREELDAIIPYLEVMKKRKVERWNQI  127

Query  616   SEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLD  795
              +V+ +I  +   + +    +   + +D+SDLS R+LE+++  L SL+KEKS+RLKQV++
Sbjct  128   LDVVGKIKKISSNI-RPVDFVPFKVPVDQSDLSCRKLEELRLELQSLEKEKSERLKQVME  186

Query  796   HLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQRLH  975
             +L SL+SLC VLGIDFK T+ ++HP+L +    +++S  TI++L+  I  LRE+KI+R+ 
Sbjct  187   YLSSLHSLCEVLGIDFKQTLSDVHPSLDEDEVPRNISNTTIQKLALTIKRLRELKIERMQ  246

Query  976   MLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSR  1155
              LQ+L++T++ELWNLMD P+EEQQ F N+T  IAA+E E+TE N LS+D L   E EV R
Sbjct  247   KLQDLSSTMLELWNLMDTPIEEQQAFRNITCNIAATEPEITEANILSIDFLNYVEAEVLR  306

Query  1156  LQEMKSSKMKEVLLKKRITLEELCRQAHLAIDD--SIEFTDETIESGAIDPSHLLEQLEI  1329
             L+ +K+S+MKE++LKK+  LEE  R+AHL  ++    +F+ E IE+GAIDPS LLEQ+E 
Sbjct  307   LEHLKASRMKELVLKKQTELEEHRRRAHLVGEELCVTQFSIEAIEAGAIDPSLLLEQIEA  366

Query  1330  QISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARA  1509
              I+ VKE+AFSRK+ILE+VE+WL AC+EE+WLEDYN++DNRYN GRG H+MLKRAEKAR 
Sbjct  367   YIATVKEDAFSRKDILERVERWLNACQEEAWLEDYNKDDNRYNAGRGAHIMLKRAEKARV  426

Query  1510  LVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKK  1689
             LVNKI G+++ LT++   WE ER   F YDGV LLSMLE+Y  +++EKE  ++RQRDQKK
Sbjct  427   LVNKIQGIVDVLTNKVIAWEKERSTEFTYDGVRLLSMLEEYMAVREEKEHAKKRQRDQKK  486

Query  1690  LQGQLMAEQEVLFGSKRSPSQ--SGKKNVV---GGASNKRISVGGAMLQTPYTERAPLSS  1854
             LQ Q  AEQE L+GSK SPS+  S KK V     G++N+R+S+GG  +Q P + RA   +
Sbjct  487   LQDQFKAEQETLYGSKPSPSKTNSAKKKVTTNSTGSANRRLSLGGTPIQPPKSVRATKKT  546

Query  1855  HSLKKINPVKQQALANITQNYVALSSGRRESSMHAKQPSCNKSNLQKTEPTQRKPLSPIS  2034
                   +PV               S G   +S+  K+ S   S L +TE T RKP + I+
Sbjct  547   EDTSTPSPVTG-------------SRGLDVASLPIKKLSFKASTLGETE-TPRKPFAQIT  592

Query  2035  SLSFNTSSANIMDKISESEELREMPASLLTTPIKNVSGIG--GNATPKtmpipmpstpas  2208
                                    +  S+ +TP++ +S      N TPK   +   +    
Sbjct  593   -----------------------LGNSIPSTPMRPISNGNEDKNRTPK--TLVALTPQTP  627

Query  2209  aassiamQMGMTPAPVAATTPMVGHD----------GVEYSYEEMRAGFLL  2331
                S  MQM  TPA        V  D           +EYS EE R  F L
Sbjct  628   MIVSAPMQMATTPAITTTRDVHVCLDYDKPELTLLEDMEYSVEERRLAFYL  678



>emb|CDX89081.1| BnaA04g01050D [Brassica napus]
Length=686

 Score =   485 bits (1248),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 327/716 (46%), Positives = 450/716 (63%), Gaps = 54/716 (8%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M     +Q  R+ETTC  L  +LQ+IW+E+GE E E+D  L  +E+ECL  Y+RKV++AS
Sbjct  1     MIRNSTEQFSRIETTCGLLPRQLQEIWSEMGENEDEKDAALADIEKECLLVYKRKVEEAS  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleemkkrkl  597
             R  A L + +A   AE+A I +++G Q   +  + R   +LK EL+ +   LEE++++K 
Sbjct  61    RCKANLLKEIAMGRAEIAAIGSSMGGQE-EIHSNGRVGENLKEELENVTVQLEELRRKKS  119

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             ER ++F EV+D++ S+  +L  S   L+ M+  +E+DLSL +LE+++  L  LQ EKS R
Sbjct  120   ERMNRFKEVIDELLSLSFQLEDSTDYLK-MLGAEEADLSLHKLEELRRQLAQLQNEKSTR  178

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             L++V   LE L  LC VLG D K+ I  IHP+L DS+  + VS  T+++L   I  L+ V
Sbjct  179   LEEVERLLEKLKLLCSVLGEDLKDLIRGIHPSLVDSNT-RDVSRSTLDKLDLMIGNLQGV  237

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             K+QR+  +Q+LA +++ELWNL+D P EEQ+ F NVT +IA SESE+TE N LS+  +K+ 
Sbjct  238   KLQRMQKIQDLAVSLLELWNLLDTPAEEQKTFHNVTCSIALSESEITEANILSVASIKNV  297

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLA--IDDSIEFTDETIESGAIDPSHL  1311
             E EV RL ++K +K+KEV+L+K++ LEE+ R+ H+A  +  S  F+ E IESG  DP  L
Sbjct  298   EDEVIRLSKLKITKIKEVILRKKLELEEISRKVHMAPQVLRSENFSIEAIESGVKDPEQL  357

Query  1312  LEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKR  1491
             LEQ++ +I+ VKEEA SRK+ILEKVEKW+ ACEEESWLE+YNR+DNRYN GRG HL LKR
Sbjct  358   LEQIDSEIAKVKEEASSRKKILEKVEKWMTACEEESWLEEYNRDDNRYNAGRGAHLTLKR  417

Query  1492  AEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQR  1671
             AEKAR LVNK+PGM+E LT++   WE ERG  FLYDGV +LSMLEQY  L +EKE E+QR
Sbjct  418   AEKARILVNKLPGMVEVLTAKVNAWEDERGHAFLYDGVRVLSMLEQYKNLWEEKEFEKQR  477

Query  1672  QRDQKKLQGQLMAEQEVLFGSKRSPSQSGKK----NVVGGASNKRISVGGAMLQTPYTER  1839
             QRD KKL GQ + EQE L+GSK SP +SGKK     +   A N+++S+GGAMLQ+   E+
Sbjct  478   QRDLKKLHGQHITEQEALYGSKPSPGKSGKKPLRTALPSSAMNRKLSLGGAMLQSSKPEK  537

Query  1840  APLSSHSLKKINPVKQQALANITQNYVALSSGRRESS----MHAKQ-PSCNKS--NLQKT  1998
             A L+S   KK     Q A +    + +   SGRR S     + AK  P+  K+  N +  
Sbjct  538   ATLNS---KKTTYYDQNAPSR-RDSTIPNPSGRRNSELPGRLRAKNVPAAGKAVMNNKGR  593

Query  1999  EPTQRKPLSPISSLSFN-------TSSANIMDKISESEELREMPASLLTTPIKNVSGIGG  2157
              P  RKPLSP++S   N       T +     K +E      +P S  TTP  +V  +  
Sbjct  594   SPMLRKPLSPVTSNILNSPEDHKDTYTTKSSPKTNEENRRTAVPISAPTTPAASVV-MSE  652

Query  2158  NATPKtmpipmpstpasaassiamQMGMTPAPVAATTPMVGHDGVEYSYEEMRAGF  2325
               TP                        TPA  A    +   +GVEYS+EE+RAGF
Sbjct  653   ATTP-----------------------FTPASKAVKKRLDNAEGVEYSFEEVRAGF  685



>ref|XP_006290680.1| hypothetical protein CARUB_v10016774mg [Capsella rubella]
 gb|EOA23578.1| hypothetical protein CARUB_v10016774mg [Capsella rubella]
Length=682

 Score =   481 bits (1238),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 316/714 (44%), Positives = 437/714 (61%), Gaps = 54/714 (8%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M     +Q  R+ETTC  LL +LQ+IWNE+GE E E+D  L  +E+ECL  Y+RKV++AS
Sbjct  1     MMRNSTEQFSRIETTCGLLLRQLQEIWNEMGETEDEKDAALADIEKECLSVYKRKVEEAS  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQS-SRSLKTELQAIMPlleemkkrkler  603
             R  A L + +A   AE+A I +++G Q  +       +LK EL+ +   LE ++K K ER
Sbjct  61    RCKANLLKEIALGRAEIAAIGSSMGGQETHSNSRLGENLKEELENVNVQLEGLRKMKAER  120

Query  604   kHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLK  783
              ++F+EV++Q+  +  +LG    +L    A +E+DLSL++LE+++  L  LQ EKS RL+
Sbjct  121   MNRFNEVIEQLLKLSSQLGNPTDDLNKFAA-EETDLSLQKLEELRRQLAELQNEKSKRLE  179

Query  784   QVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKI  963
             +V     +L SLC VLG DFK+ +  IH +L DS+  + VS  T+++L   I  LREVK+
Sbjct  180   EVERLQNTLTSLCSVLGEDFKDMLRGIHSSLVDSNT-RDVSRSTLDKLDMMILNLREVKL  238

Query  964   QRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEI  1143
             QR+  +Q+LA +++ELWNL+D P EEQ +F NVT +IA SE E+TE N LS+  +K  E 
Sbjct  239   QRMQKVQDLAVSLLELWNLLDTPAEEQNIFHNVTCSIALSEPEITEANILSVASIKRVED  298

Query  1144  EVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAID--DSIEFTDETIESGAIDPSHLLE  1317
             EV+RL ++K +K+KEV+L+K++ LEE+ R+ H+A +   S  F+ E IESG  DP  LL+
Sbjct  299   EVTRLSKLKITKIKEVILRKKLELEEISRKMHMATEVLKSENFSVEAIESGFKDPEQLLD  358

Query  1318  QLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAE  1497
             Q++ +I+ VKEEA SRKEILEKVEKW++ CEEESWLE+YNR+DNRYN GRG HL LKRAE
Sbjct  359   QIDSEIAKVKEEASSRKEILEKVEKWMSVCEEESWLEEYNRDDNRYNAGRGAHLTLKRAE  418

Query  1498  KARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQR  1677
             KAR LVNK+PGM+EALT++   WE ERG  FLYDGV +L+ML+QY  L +EKE E+QRQR
Sbjct  419   KARVLVNKLPGMVEALTAKVTAWEDERGNDFLYDGVRVLTMLDQYKTLWEEKEHEKQRQR  478

Query  1678  DQKKLQGQLMAEQEVLFGSKRSPSQSGKKNV---VGGASNKRISVGGAMLQTPYTERAPL  1848
             D KKL GQL+ EQE L+GSK SP++SGKK +   V  A N+++S+GGAML         L
Sbjct  479   DLKKLHGQLITEQEALYGSKPSPNKSGKKPLRTPVNAAMNRKLSLGGAMLN------QRL  532

Query  1849  SSHSLKKINPVKQQALANITQNYVALSSGRRESSMHAKQPSCNKSNLQKT------EPTQ  2010
                  K  +    Q       + +   SGRR S +  +  S N S   KT       P  
Sbjct  533   KPEKAKTQSSYYDQNTTGRRDSTLPAPSGRRNSELPGRLRSKNVSVSGKTVTSKGRSPML  592

Query  2011  RKPLSPISSLSFNTSSANIMDKISESEELREMPASLLTTPIKNVSGIGGNATPKtmpipm  2190
             RKPLSP++S   N+   +     ++   L E    +LT      +      TP       
Sbjct  593   RKPLSPVTSNILNSPEGHRDTYTTKPSSLEE---RILTPKTNEENKRAVPTTP-------  642

Query  2191  pstpasaassiamQMGMTPAPVAATTPMV---------GHDGVEYSYEEMRAGF  2325
                            G + A + ATTP               VEYS+EE+RAGF
Sbjct  643   ---------------GASVAMMEATTPFTPAVEKRMEEEAVAVEYSFEEVRAGF  681



>gb|EMS68430.1| hypothetical protein TRIUR3_15650 [Triticum urartu]
Length=689

 Score =   481 bits (1239),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 321/699 (46%), Positives = 436/699 (62%), Gaps = 87/699 (12%)
 Frame = +1

Query  412   VDQASRSCAQLRQAVAESEAELARICAALGEQPVNVRQSSR---SLKTELQAIMPlleem  582
             +DQA+R  AQLRQ++AE+EAELA IC+A+GE PV+VRQS++    L+ EL AI+P LEEM
Sbjct  19    IDQANRCRAQLRQSIAEAEAELAGICSAIGEPPVHVRQSNQKLHGLREELNAIIPYLEEM  78

Query  583   kkrklerkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQK  762
             + +K+ER  QF  VL++I  +  E+  S   +     +D+SDLSLR+ E++   L SLQK
Sbjct  79    RTKKVERWSQFVHVLEEIKKISSEIRPS-DFVPFKTPVDQSDLSLRKFEELTKELESLQK  137

Query  763   EKSDRLKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIH  942
             EK +RLKQV+DHL +L+SLC VLGIDFK T+ E+HP+L ++   K++S  TIERL+ A+ 
Sbjct  138   EKRERLKQVMDHLNTLHSLCEVLGIDFKQTVHEVHPSLDEAEGSKNLSNTTIERLALAVD  197

Query  943   ELREVKIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLD  1122
              LRE+KIQR+  LQ+ A+T++ELWNLMD P+EEQQ+F NVT  IAASE E+TEPN LS+D
Sbjct  198   RLREIKIQRMQKLQDFASTMLELWNLMDTPIEEQQMFQNVTCNIAASEHEITEPNTLSID  257

Query  1123  LLKSAEIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAIDD--SIEFTDETIESG--  1290
              L   E EV RL+++K SKMK+++LKK+  LEE  R+AHL  ++  S EF  E IESG  
Sbjct  258   FLSYVEAEVLRLEQLKGSKMKDLVLKKKSELEEHRRRAHLIGEEGYSDEFNIEAIESGKF  317

Query  1291  ----------------------------------AIDPSHLLEQLEIQISNVKEEAFSRK  1368
                                               AIDP+ +LEQ+E  I+ VK+EAFSRK
Sbjct  318   ICRLLDILCLVRCAPCLQIIRQTTSSTFALYSTGAIDPALVLEQIEAHIATVKDEAFSRK  377

Query  1369  EILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVNKIPGMLEALT  1548
             +ILEKVE++L ACEEE+WLEDYN++DNRYN G+G HL LKRAEKAR LVNKIPGM++ LT
Sbjct  378   DILEKVERFLNACEEEAWLEDYNKDDNRYNAGKGAHLTLKRAEKARILVNKIPGMVDVLT  437

Query  1549  SRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQGQLMAEQEVLF  1728
             ++   WE ERG  F YDGV LLSML++Y +++QEKE E++RQRDQKKL  QL AEQE L+
Sbjct  438   TKIIAWENERGKEFTYDGVRLLSMLDEYMIVRQEKEQEKKRQRDQKKLHDQLKAEQEALY  497

Query  1729  GSKRSPS--QSGKK---NVVGGASNKRISVGGAMLQTPYTERAPLSSHSLKKINPVKQQA  1893
             GSK SPS  QS KK   + +GG  N+R+S+GGA +Q P T+   L S +++     + + 
Sbjct  498   GSKPSPSKPQSIKKAPRHSMGGV-NRRVSMGGATMQAPKTD--ILHSKNVRAAK--RTED  552

Query  1894  LANITQNYVALSSGRRESSMHAKQPSCNKSNLQKTEPTQRKPLSPISSLSFNTSSANIMD  2073
             +A+++     L  G     +  K+ S N + L++TE T RKP + I     +  S     
Sbjct  553   IAHLSPASRGLDIG----DLPIKKLSFNATALRETE-TPRKPFAQIMPPPSSVPSTPARS  607

Query  2074  KISESEELREMPASLLTTPIKNVSGIGGNATPKtmpipmpstpasaassiamQMGMTPA-  2250
               +++E+    P         N+      A P                   MQ+ MTPA 
Sbjct  608   VTNDTEDENRTPNPKTFGAALNLKTPMTVAAP-------------------MQLAMTPAV  648

Query  2251  ---PVAATTPMVGH-------DGVEYSYEEMRAGFLLPR  2337
                  AA   +V         + +EYS+EE R    L R
Sbjct  649   ASKVTAAPVSLVYEKPEPTLPEAIEYSFEERRLAVYLSR  687



>ref|XP_010934514.1| PREDICTED: 65-kDa microtubule-associated protein 3-like [Elaeis 
guineensis]
Length=524

 Score =   469 bits (1208),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 287/511 (56%), Positives = 379/511 (74%), Gaps = 11/511 (2%)
 Frame = +1

Query  364   MLCQLEQECLEAYRRKVDQASRSCAQLRQAVAESEAELARICAALGEQPVNVRQSSR---  534
             ML ++EQECLE YRRKV QA+ S AQLRQA+A++EAE+A IC+A+GE PV+VRQ ++   
Sbjct  1     MLLEIEQECLEVYRRKVYQANMSRAQLRQAIADAEAEIAAICSAMGEPPVHVRQCNQNAG  60

Query  535   SLKTELQAIMPlleemkkrklerkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLS  714
             SLK EL+AI+P LEEMKKRK +RK+Q  EV++QI  +L E+     +L   +A+DES LS
Sbjct  61    SLKEELKAIIPELEEMKKRKNDRKNQILEVVEQIKEILIEIRPPGYDLS-TVAVDESALS  119

Query  715   LRRLEDMKSHLLSLQKEKSDRLKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSAL  894
             +R LE++   L  LQ+EK+DRL++V +HL +L+SLC+VL IDFK  +GE+ P L ++   
Sbjct  120   VRMLEELHGQLQLLQEEKADRLRKVQEHLSTLSSLCLVLSIDFKQMVGEVDPNLNETGGF  179

Query  895   KSVSTETIERLSAAIHELREVKIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAI  1074
             K+ S +TIERL+ AIH LRE+K QR+  LQ+LA+T++ELWNLMD P EEQQ F +VT  I
Sbjct  180   KNTSDDTIERLTCAIHRLREIKRQRMEKLQDLASTMLELWNLMDTPTEEQQSFQSVTCNI  239

Query  1075  AASESELTEPNALSLDLLKSAEIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAIDD  1254
             AASE E+ EP+ALS+D +K  E EV RL+E K+SKMKE++L+K+  LEE+ R+AHL  + 
Sbjct  240   AASEHEIIEPDALSVDFIKHVEAEVLRLEEQKNSKMKELVLRKKSELEEIRRRAHLVAEG  299

Query  1255  S--IEFTDETIESGA--IDPSHLLEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESW  1422
                 EF  E +E+G   +D S +L Q+E  IS  KE+AFSRK+ILE+VEKWLAACEEESW
Sbjct  300   GSETEFAYEAVENGISDVDSSLVLGQMEFLISEAKEQAFSRKDILERVEKWLAACEEESW  359

Query  1423  LEdynrndnrynggrgTHLMLKRAEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDG  1602
             LE+YNR++NRY+ GRGTHL LKRAEKAR LV+KIP M+EAL+++   WE E+G  F YDG
Sbjct  360   LEEYNRDENRYSAGRGTHLALKRAEKARILVSKIPAMVEALSAKTTAWEKEKGNEFKYDG  419

Query  1603  VSLLSMLEQYGLLKQEKELERQRQRDQKKLQGQLMAEQEVLFGSKRSPSQSGKK--NVVG  1776
             VSLLSMLE Y   +QEKE ER+RQRDQ++LQGQL A QE LFGSK SP ++  K      
Sbjct  420   VSLLSMLEDYTTTRQEKEQERKRQRDQRRLQGQLTAAQEALFGSKPSPLKNVNKVTRTFS  479

Query  1777  GASNKRISVGGAMLQTPYTERAPLSSHSLKK  1869
                ++R S  GA  Q+  + R+  SSH+ +K
Sbjct  480   SGPSRRPSTPGATSQSD-SPRSAKSSHAYRK  509



>ref|XP_002878351.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54610.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=649

 Score =   473 bits (1218),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 318/685 (46%), Positives = 437/685 (64%), Gaps = 58/685 (8%)
 Frame = +1

Query  334   IGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAESEAELARICAALGEQPV  513
             +GE E E+D  L  +E+ECL  Y+RKV++ASR  A L + +A   AE+A I +++G Q +
Sbjct  1     MGETEDEKDSALADIEKECLSVYKRKVEEASRCKANLLKEIAVGRAEIAAIGSSMGGQEI  60

Query  514   NVRQSSR---SLKTELQAIMPlleemkkrklerkHQFSEVLDQIDSVLKELGKSRKELQH  684
             +   +SR   +LK EL+ +   LE ++K+K ER  +F+EV+DQ+  +  +LG     L+ 
Sbjct  61    HESSNSRLGENLKEELENVNVQLEGLRKKKAERMTRFNEVIDQLLKLSFQLGNPTDYLKK  120

Query  685   MIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESLNSLCIVLGIDFKNTIGEI  864
               A +E+D+SL++LE+++S L  LQ EKS RL++V   L++LNSLC VLG DF + I  I
Sbjct  121   FAA-EETDISLQKLEELRSQLGELQNEKSKRLEEVECLLKTLNSLCSVLGEDFMDMIRGI  179

Query  865   HPTLGDSSALKSVSTETIERLSAAIHELREVKIQRLHMLQNLATTIVELWNLMDMPVEEQ  1044
             H +L DS+  + VS  T+++L   I  LREVK+QR+  +Q+LA +++ELWNL+D P EEQ
Sbjct  180   HLSLVDSNT-RDVSRSTLDKLDMMIVNLREVKLQRMQKVQDLAVSLLELWNLLDTPAEEQ  238

Query  1045  QLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQEMKSSKMKEVLLKKRITLEEL  1224
             ++F NVT +IA +ESE+TE N LS+  +K AE EV RL ++K +K+KEV+L+K++ LEE+
Sbjct  239   KIFHNVTCSIALTESEITEANILSVASIKRAEDEVIRLSKLKITKIKEVILRKKLELEEI  298

Query  1225  CRQAHLAID--DSIEFTDETIESGAIDPSHLLEQLEIQISNVKEEAFSRKEILEKVEKWL  1398
              R+ H+A +   S  F  E IESG  DP  LLEQ++ +I+ VKEEA SRKEILEKVEKW+
Sbjct  299   SRKMHMATEVLKSENFLFEAIESGVKDPEQLLEQIDSEIAKVKEEASSRKEILEKVEKWM  358

Query  1399  AACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVNKIPGMLEALTSRAKGWEIER  1578
             +ACEEESWLE+YNR+DNRYN GRG HL LKRAEKAR LVNK+PGM+EALT++   WE ER
Sbjct  359   SACEEESWLEEYNRDDNRYNAGRGAHLTLKRAEKARVLVNKLPGMVEALTTKVTAWEDER  418

Query  1579  GVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQGQLMAEQEVLFGSKRSPSQSG  1758
             G  FLYDGV +LSML+QY  L +EKE E+QRQRD KKL GQL+ EQE L+GSK SP++SG
Sbjct  419   GNEFLYDGVRVLSMLDQYKTLWEEKEHEKQRQRDLKKLHGQLITEQEALYGSKPSPNKSG  478

Query  1759  KKNV---VGGASNKRISVGGAML-QTPYTERAPLSSHSLKKINPVKQQALANITQNYVAL  1926
             KK +   V  A N+++S+GGAML Q+   E+A L+S   ++ N   Q A  N   + +  
Sbjct  479   KKPLRTPVNAAMNRKLSLGGAMLHQSLKPEKATLNS---RRSNYYDQNA-TNRRDSALPT  534

Query  1927  SSGRRESSMHAKQPSCNKSNLQKT--EPTQRKPLSPISSLSFN---------TSSANIMD  2073
              SGRR S +  +  S N S   K    P  RKPLSP++S   N         T+   I+ 
Sbjct  535   PSGRRNSELPGRIRSKNVSVAGKAARSPMLRKPLSPVTSNILNSPEDHKDAYTTKERILT  594

Query  2074  KISESEELREMPASLLTTPIKNVSGIGGNATPKtmpipmpstpasaassiamQMGMTPAP  2253
               +  E  R +P    TTP  +V+                           M    TP  
Sbjct  595   PKTNEENKRAVP----TTPAASVA---------------------------MTEATTPFT  623

Query  2254  VAATTPMVGHDGV-EYSYEEMRAGF  2325
              A    M   D V EYS+EE+RAGF
Sbjct  624   PAVEKRMDEEDVVVEYSFEEVRAGF  648



>ref|XP_006280317.1| hypothetical protein CARUB_v10026240mg [Capsella rubella]
 gb|EOA13215.1| hypothetical protein CARUB_v10026240mg [Capsella rubella]
Length=513

 Score =   466 bits (1199),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 272/470 (58%), Positives = 360/470 (77%), Gaps = 5/470 (1%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M + Q D  L++ETTC SLL ELQ IW+E+GE E +RDKML +LE+ECLE YRRKVDQA+
Sbjct  1     MASVQKDPILQLETTCGSLLYELQIIWDEVGETETDRDKMLLELERECLEVYRRKVDQAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSRS---LKTELQAIMPlleemkkrkl  597
             R  AQLRQA+A++EAELA IC+A+GE+PV++RQS +S   LK EL  I+P LEEM+KRK+
Sbjct  61    RCRAQLRQAIADAEAELASICSAMGERPVHIRQSDQSVGSLKQELGTILPELEEMQKRKI  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             ER++QF  VL++IDS+  ++    +       ++E+DLS+R+LE++   L +LQKEKSDR
Sbjct  121   ERRNQFIVVLEEIDSITNDVKGQGEHAHSKPLINETDLSMRKLEELHCQLQALQKEKSDR  180

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             ++ +  HL +L S C VLG+DF   +G+++PTL D    +S+S  TIE+L  A+ +LRE+
Sbjct  181   VETIRKHLCTLYSHCSVLGMDFNEVVGQVNPTLSDPEGPRSLSDHTIEKLGNAVQKLREI  240

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             KIQR+  LQ+LATT++ELWNLMD P+EEQQ + ++T  IAASE E+TE N+LS D +K  
Sbjct  241   KIQRMQRLQDLATTMLELWNLMDTPIEEQQEYQHITCNIAASEHEITEANSLSEDFIKYV  300

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHL--AIDDSIEFTDETIESGAIDPSHL  1311
             E EV RL  +K+SKMKE++LKKR  LEE+CR+ HL    D +I+ T   IESG +D + +
Sbjct  301   EAEVVRLDAVKTSKMKELVLKKRSELEEICRKTHLLPVSDSAIDQTIAAIESGIVDATMV  360

Query  1312  LEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKR  1491
             LE LE  IS +KEEA SRKEILE+VEKWL+AC+EESWLE+YNR+DNRYN GRG HL LKR
Sbjct  361   LEHLEQHISKIKEEALSRKEILERVEKWLSACDEESWLEEYNRDDNRYNAGRGAHLTLKR  420

Query  1492  AEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLL  1641
             AEKAR+LVNK+PGM+EAL S+   WE E+G+ FLYDG+ LLSMLE+Y LL
Sbjct  421   AEKARSLVNKLPGMVEALASKTIVWEQEKGIEFLYDGIRLLSMLEEYNLL  470



>ref|XP_002277391.2| PREDICTED: LOW QUALITY PROTEIN: 65-kDa microtubule-associated 
protein 1-like [Vitis vinifera]
Length=582

 Score =   466 bits (1198),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 263/517 (51%), Positives = 371/517 (72%), Gaps = 13/517 (3%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             ETTC SLL +LQ+IW+E+GE + ERDKML QLEQECL+ Y+RKVDQA +S A L QA+A+
Sbjct  13    ETTCGSLLQKLQQIWDEVGESDEERDKMLLQLEQECLDVYKRKVDQAVKSRAHLLQALAD  72

Query  463   SEAELARICAALGEQP-VNV-RQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQI  636
             ++ EL+R+ +ALGE+  V +  ++S ++K +L AI P LE++ K+K ER  +FS+V  QI
Sbjct  73    AQLELSRLLSALGEKSFVGIPDKTSGTIKEQLAAIAPTLEQLWKQKEERVKEFSDVQTQI  132

Query  637   DSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESLNS  816
               +  E+      L  +  +DE+DLSL++L++ +  L  LQKEKSDRL +VL+ + +++ 
Sbjct  133   QKICGEIA-GNSNLSEVPVVDEADLSLKKLDEFQGQLQELQKEKSDRLHKVLEFVSTVHD  191

Query  817   LCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHMLQNL  990
             LC VLG+DF NT+ E+HP+L DS+ +  KS+S +T+ RL+  +  L+E K QRL  LQ L
Sbjct  192   LCAVLGMDFFNTVTEVHPSLNDSTGVQSKSISNDTLSRLAKTVLALKEDKKQRLQKLQEL  251

Query  991   ATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQEMK  1170
             AT +++LWNLMD P EE+ LFD+VT  I+AS  E+T P AL+LDL++ AE+EV RL ++K
Sbjct  252   ATQLIDLWNLMDTPEEERSLFDHVTCNISASVDEVTIPGALALDLIEQAEVEVERLDQLK  311

Query  1171  SSKMKEVLLKKRITLEELCRQAHLAIDDSIEFTD--ETIESGAIDPSHLLEQLEIQISNV  1344
             +S+MKE+  K++  LEE+  +AH+ ID           I+SG ++PS LL  ++ QI+  
Sbjct  312   ASRMKEIAFKRQAELEEIFARAHIEIDPEAARAKIMSLIDSGDVEPSELLADMDNQITKA  371

Query  1345  KEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVNKI  1524
             KEEAFSRK+IL+KVEKW++ACEEESWLEDYNR++NRYN  RG HL LKRAEKAR LVNKI
Sbjct  372   KEEAFSRKDILDKVEKWMSACEEESWLEDYNRDENRYNSSRGAHLNLKRAEKARILVNKI  431

Query  1525  PGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQGQL  1704
             P +++ L ++   WE + G+PF YDGV LL+ML++Y +L+ ++E E++R RDQKK    L
Sbjct  432   PALVDTLVAKTGAWEEDHGIPFTYDGVPLLAMLDEYAMLRHDREEEKRRMRDQKKFHELL  491

Query  1705  MAEQEVLFGSKRSPSQS-GKKNVVGGASNKRISVGGA  1812
               EQE +FGS+ SP +  G K VVG  +N     GGA
Sbjct  492   NTEQEAIFGSRPSPGRPLGPKKVVGPRAN-----GGA  523



>ref|NP_191643.1| microtubule-associated protein 65-4 [Arabidopsis thaliana]
 emb|CAB82688.1| putative protein [Arabidopsis thaliana]
 gb|AEE80116.1| microtubule-associated protein 65-4 [Arabidopsis thaliana]
Length=648

 Score =   468 bits (1203),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 317/674 (47%), Positives = 432/674 (64%), Gaps = 37/674 (5%)
 Frame = +1

Query  334   IGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAESEAELARICAALGEQPV  513
             +GE E E+D  L  +E+ECL  Y+RKV++ASR  A L + +A   AE+A I +++G Q +
Sbjct  1     MGETEDEKDASLADIEKECLSVYKRKVEEASRGKANLLKEIAVGRAEIAAIGSSMGGQEI  60

Query  514   NVRQS-SRSLKTELQAIMPlleemkkrklerkHQFSEVLDQIDSVLKELGKSRKELQHMI  690
             +       +LK EL+ +   L+ ++KRK ER  +F+EV+DQ+  +  +LG     L+   
Sbjct  61    HSNSRLGENLKEELENVNVQLDGLRKRKAERMIRFNEVIDQLLKLSLQLGNPTDYLKKFA  120

Query  691   ALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESLNSLCIVLGIDFKNTIGEIHP  870
             A +E+DLSL+RLE+++S L  LQ EKS RL++V   L++LNSLC VLG DFK  I  IH 
Sbjct  121   A-EETDLSLQRLEELRSQLGELQNEKSKRLEEVECLLKTLNSLCSVLGEDFKGMIRGIHS  179

Query  871   TLGDSSALKSVSTETIERLSAAIHELREVKIQRLHMLQNLATTIVELWNLMDMPVEEQQL  1050
             +L DS+  + VS  T+++L   I  LRE K+QR+  +Q+LA +++ELWNL+D P EEQ++
Sbjct  180   SLVDSNT-RDVSRSTLDKLDMMIVNLREAKLQRMQKVQDLAVSLLELWNLLDTPAEEQKI  238

Query  1051  FDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQEMKSSKMKEVLLKKRITLEELCR  1230
             F NVT +IA +ESE+TE N LS+  +K  E EV RL ++K +K+KEV+L+KR+ LEE+ R
Sbjct  239   FHNVTCSIALTESEITEANILSVASIKRVEDEVIRLSKIKITKIKEVILRKRLELEEISR  298

Query  1231  QAHLAID--DSIEFTDETIESGAIDPSHLLEQLEIQISNVKEEAFSRKEILEKVEKWLAA  1404
             + H+A +   S  F+ E IESG  DP  LLEQ++ +I+ VKEEA SRKEILEKVEKW++A
Sbjct  299   KMHMATEVLKSENFSVEAIESGVKDPEQLLEQIDSEIAKVKEEASSRKEILEKVEKWMSA  358

Query  1405  CEEESWLEdynrndnrynggrgTHLMLKRAEKARALVNKIPGMLEALTSRAKGWEIERGV  1584
             CEEESWLE+YNR+DNRYN GRG HL LKRAEKAR LVNK+PGM+EALT++   WE ERG 
Sbjct  359   CEEESWLEEYNRDDNRYNAGRGAHLTLKRAEKARLLVNKLPGMVEALTAKVTAWENERGN  418

Query  1585  PFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQGQLMAEQEVLFGSKRSPSQSGKK  1764
              FLYDGV +LSML QY  + +EKE E+QRQRD KKL GQL+ EQE L+GSK SP++SGKK
Sbjct  419   EFLYDGVRVLSMLGQYKTVWEEKEHEKQRQRDMKKLHGQLITEQEALYGSKPSPNKSGKK  478

Query  1765  NV---VGGASNKRISVGGAML-QTPYTERAPLSSHSLKKINPVKQQALANITQNYVALSS  1932
              +   V  A N+++S+GGAML Q+   E+A L+S   K+     Q A +        L S
Sbjct  479   PLRTPVNAAMNRKLSLGGAMLHQSLKHEKATLNS---KRTKYYDQNATSRRDSALPTL-S  534

Query  1933  GRRESSMHAKQPSCNKSNLQKT--EPTQRKPLSPISSLSFNTSSANIMDKISESEELREM  2106
             GRR S +  +  S N     K    P  RKPLSP++S   N+   +  D  +  E +   
Sbjct  535   GRRNSELPGRIRSKNVPVAGKAARSPMLRKPLSPVTSNILNSPEDHHKDAYTTKERI---  591

Query  2107  PASLLTTPIKNVSGIGGNATPKtmpipmpstpasaassiamQMGMTPAPVAATTPMVGHD  2286
                                TPKT      + P + A+S+AM    TP   A    M   D
Sbjct  592   ------------------LTPKTNEEKKRAVPTTPAASVAMTEATTPFTPAVEKRMDEED  633

Query  2287  G-VEYSYEEMRAGF  2325
               VEYS+EE+RAGF
Sbjct  634   VIVEYSFEEVRAGF  647



>ref|XP_006839047.1| hypothetical protein AMTR_s00090p00059550 [Amborella trichopoda]
 gb|ERN01616.1| hypothetical protein AMTR_s00090p00059550 [Amborella trichopoda]
Length=582

 Score =   462 bits (1190),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 280/578 (48%), Positives = 395/578 (68%), Gaps = 22/578 (4%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             ETTC SLL +LQ+IW+E+GE + ERDKML QLEQ+CL+ Y++KVDQAS+S A+L Q++A+
Sbjct  13    ETTCGSLLQQLQQIWDEVGESDEERDKMLLQLEQDCLDVYKKKVDQASKSRARLLQSLAD  72

Query  463   SEAELARICAALGEQP-VNV-RQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQI  636
             S+AELA + +ALGE+  V +  +S+ ++K +L AI P+LE++ ++K ER  +F++V  QI
Sbjct  73    SKAELANLLSALGEKTFVGLPDKSTGTIKEQLAAIAPILEQLWQQKEERIKEFADVQLQI  132

Query  637   DSVLKELGKSRKELQHMIA---LDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLES  807
               +  E+  + K L   +    +DE+DLS+++L++  S L  LQKEKS+RL +VLD + +
Sbjct  133   QKICGEISGTLK-LNEQVGTPKVDENDLSIKKLDEFHSQLQELQKEKSERLHKVLDFVST  191

Query  808   LNSLCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHML  981
             ++ LC VLG+DF  TI E+HP+L DS  +  KS+S +T+ RL+  +  L+E K QRL  L
Sbjct  192   VHDLCAVLGMDFFGTITEVHPSLDDSVGVQSKSISDDTLSRLAKMVESLKEDKKQRLQKL  251

Query  982   QNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQ  1161
             Q LA+ + +LWNLMD P+EE+  FD+VT  I+AS  E+T P AL+LDL++ AE+EV RL 
Sbjct  252   QELASQLSDLWNLMDTPMEERSFFDHVTCNISASVDEVTVPGALALDLIEQAEVEVERLD  311

Query  1162  EMKSSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHLLEQLEIQI  1335
              +K+S+MKE+  KK+  LE++   AH+ ID  +  E     I+SG I+PS LL  ++ QI
Sbjct  312   MLKASRMKEIAFKKQAELEDIYHLAHIEIDPEVAREKIMALIDSGNIEPSELLADMDNQI  371

Query  1336  SNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALV  1515
              N KEEA SRKEILEKVEKW++ACEEESWLEDYNR++NRYN  RG H+ LKRAEKAR LV
Sbjct  372   VNAKEEALSRKEILEKVEKWMSACEEESWLEDYNRDENRYNSSRGAHINLKRAEKARILV  431

Query  1516  NKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQ  1695
             NKIP +++ L ++ + WE +R + F YDGV LL+ML++Y +L+Q++E E++R RDQK+  
Sbjct  432   NKIPALVDTLIAKTRAWEEDRRISFTYDGVPLLAMLDEYAMLRQDREEEKRRLRDQKRFH  491

Query  1696  GQLMAEQEVLFGSKRSPSQS-GKKNVVGGASNKRISVGGAMLQTPYTERAPLSSHSLKKI  1872
              QL  EQE LFGS+ SP++  G K VVG  +N     GG    TP   R  L   S  K 
Sbjct  492   EQLTTEQETLFGSRPSPNKPLGPKKVVGPRAN-----GGTANGTP-NRRLSLGVRSASKD  545

Query  1873  NPVKQQALANITQNYVALSSGRRESSMHAKQPSCNKSN  1986
                +         NYVA+S  + + S H    S N SN
Sbjct  546   GGKRDNQRPEAPVNYVAIS--KEDVSSHI---SANDSN  578



>gb|EMS51834.1| hypothetical protein TRIUR3_03672 [Triticum urartu]
Length=848

 Score =   469 bits (1208),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 298/626 (48%), Positives = 402/626 (64%), Gaps = 73/626 (12%)
 Frame = +1

Query  220   GLLGRIASDMYNRQNDQSLRMETTCCSLLSELQK-------------------IWNEIGE  342
             G L         R  DQ L+MET C +L+ ELQ+                   IW+EIGE
Sbjct  144   GALAGTGMSGGRRPGDQLLQMETACGALMRELQERAPPAPSITYRGGVILRRVIWDEIGE  203

Query  343   PEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAESEAELARICAALGEQPVNVR  522
                 RD ML +L+QECL+AYRRKVDQASR  AQLRQA+A+++A LA +C+A+ E PV VR
Sbjct  204   QGAARDTMLLELQQECLDAYRRKVDQASRCPAQLRQAIADAQAALAAVCSAMAEPPVLVR  263

Query  523   QSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQIDSVLKELGKSRKELQHMIALDE  702
             Q    L+ EL AI+P LEEMKKRK+ER +Q  +V+ +I  +  E+ +    +     +D+
Sbjct  264   QKGCGLREELSAIVPYLEEMKKRKVERWNQILDVIGKIKKISSEI-RPADFVPFKAPVDQ  322

Query  703   SDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGD  882
             SDLS RRLE+++  L  L+KEKS+RLKQV+D+L +L+SLC VL +DFK TI ++HP+L +
Sbjct  323   SDLSCRRLEELRMELQFLEKEKSERLKQVMDYLNTLHSLCKVLAVDFKQTISDVHPSLDE  382

Query  883   SSALKSVSTETIERLSAAIHELREVKIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNV  1062
                  ++S  TIERL+ AI  LRE KI+R+  LQ+L++T++ELWNLMD P+EEQQ F N+
Sbjct  383   DGVPMNISNTTIERLALAIQRLRESKIERMQKLQDLSSTMLELWNLMDTPIEEQQSFQNI  442

Query  1063  TRAIAASESELTEPNALSLDLLKSAEIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHL  1242
             T  IAASE E+TE NALS+D++   E EV RL+++K SKMK+++LKK+  LEE  R+AHL
Sbjct  443   TCNIAASEPEITEANALSIDVMNFVEAEVLRLEQLKVSKMKDLVLKKQTELEEHRRRAHL  502

Query  1243  AIDDSIEF-----TDETIESGAIDPSHLLEQLEIQISNVKEEAFSRKEILEKVEKWLAAC  1407
               D+  E        E IE+GAIDPS LLEQ+E  I+ VKE+AFSRK+ILE+VE+WL AC
Sbjct  503   VGDEHYETQFNIEAIEAIEAGAIDPSLLLEQIEAYIATVKEDAFSRKDILERVERWLNAC  562

Query  1408  EEESWLEdynrndnrynggrgTHLMLKRAEKARALVNKIPGMLEALTSRAKGWEIERGVP  1587
             EEE+WLEDY+++DNRYN GRG H+MLKRAEKAR LVNKIPG+++ LT++   WE ERG  
Sbjct  563   EEEAWLEDYSKDDNRYNAGRGAHIMLKRAEKARVLVNKIPGIVDVLTNKVIAWEKERGTE  622

Query  1588  FLYDGVS-------LLSMLEQYGLLKQEKELERQRQR-----------------------  1677
             F YDGV        L+  ++ + ++++EKE E++RQR                       
Sbjct  623   FTYDGVCIRNFTAILVHAIQHFRIVREEKEQEKKRQRVFIFCLTFSALASVFICGWYLMG  682

Query  1678  ----DQKKLQGQLMAEQEVLFGSKRSP---SQSGKK---NVVGGASN--------KRISV  1803
                 DQKKL+ Q  AEQE+L+GSK SP   S SGKK   N   G+ +        K++S 
Sbjct  683   ERLQDQKKLEDQFKAEQEMLYGSKPSPSSRSNSGKKLTRNPSAGSRSKGTASPPIKKLSF  742

Query  1804  GGAMLQTPYTERAPLSSHSLKKINPV  1881
               + L    T R P +  +    NP 
Sbjct  743   KASTLGETETPRKPFTQIAPGNSNPA  768



>ref|XP_006587884.1| PREDICTED: 65-kDa microtubule-associated protein 3-like isoform 
X1 [Glycine max]
 ref|XP_006587885.1| PREDICTED: 65-kDa microtubule-associated protein 3-like isoform 
X2 [Glycine max]
 gb|KHN29445.1| 65-kDa microtubule-associated protein 3 [Glycine soja]
Length=700

 Score =   464 bits (1194),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 341/727 (47%), Positives = 456/727 (63%), Gaps = 57/727 (8%)
 Frame = +1

Query  247   MY-NRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQA  423
             MY NR + Q  + ETTC  LL ELQ IW+E+GE +  RD ML ++E +CL+ YR++VD+A
Sbjct  1     MYSNRTSSQFGQQETTCHLLLKELQIIWDEVGESDSRRDAMLREIEHKCLDLYRKEVDEA  60

Query  424   SRSCAQLRQAVAESEAELARICAALGEQPVNVR-QSSRSLKTELQAIMPlleemkkrkle  600
                 AQ++Q +A++ AE+A ICAA+GEQP++   +S  SLK   + ++  LEEM+K K +
Sbjct  61    KLCRAQIQQEIADNVAEIAGICAAMGEQPLHFDPKSCGSLKKARETVVSQLEEMRKLKTK  120

Query  601   rkHQFSEVLDQIDSVLKELGKSRKELQHMIA---LDESDLSLRRLEDMKSHLLSLQKEKS  771
             RK QFSEVL  + ++  EL  S      M+A   L+E++LSL+RLE+++  LL LQ EK+
Sbjct  121   RKKQFSEVLYHLKNISSELYGS------MVANAYLEENNLSLKRLEELQKQLLQLQNEKA  174

Query  772   DRLKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELR  951
              RLKQV D L +LNSLC+VLG+D K+ I EI PT+ +S+  K VS  TI+ L++ I  LR
Sbjct  175   SRLKQVSDQLNALNSLCLVLGLDVKDKICEICPTMVNSTVTKDVSDNTIKNLTSEIQSLR  234

Query  952   EVKIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLK  1131
             EVKI R+  LQ+ A  ++E+W+LMD P+EEQQ F +VT  I A ESE TE   LS+D + 
Sbjct  235   EVKIHRMQKLQSFAAALLEMWDLMDTPMEEQQKFHHVTSKITALESEFTESKILSIDSVI  294

Query  1132  SAEIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAIDDSIEFTDETIESGAIDPSHL  1311
               E EV RLQ +KS+KMKE+L KK++ LEE+CR+ HL        T +T+        H 
Sbjct  295   YLEKEVERLQVLKSTKMKELLRKKKLELEEICRKTHL--------TTQTV----FQSQHS  342

Query  1312  LE-----QLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTH  1476
             LE     Q+E  I+  KEEA +RKEILEKVEKWL AC+EESWLE+YNR+DNRYN GRG H
Sbjct  343   LELLDYDQIEHLITKTKEEALNRKEILEKVEKWLVACQEESWLEEYNRDDNRYNAGRGAH  402

Query  1477  LMLKRAEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKE  1656
             L LKRAEKARAL++KIPG++E +  + K WE ERG  F+YDG  LLS+LE Y  L+QEKE
Sbjct  403   LTLKRAEKARALLSKIPGIVETIILKVKAWEKERGQEFMYDGSRLLSILEDYSTLRQEKE  462

Query  1657  LERQRQRDQKKLQGQLMAEQEVLFGSKRSPS-QSGKKNVVGGASNKRISVGGAMLQTPYT  1833
              ERQ QRDQKKLQGQLMAE E LFGSK SP+ +SG K  V   S    S+   MLQ P  
Sbjct  463   NERQLQRDQKKLQGQLMAEHETLFGSKPSPAFKSGYK--VSRCSTGIPSI--TMLQDP--  516

Query  1834  ERAPLSSHSLKKINPVKQQA--LANITQNYVALSSGRRESSM--HAKQPSCNKSNLQKTE  2001
               A L   S KK N   Q+   L N    +   SSG+  S    H+ +     S+ +K  
Sbjct  517   RHASLIHQSNKKGNVTNQKGSILRNKNIYHSTQSSGKDNSKAIGHSVKLKKTASSAEKGT  576

Query  2002  PTQ----RKPLSPISSLSFNTSSANIMD-----KISESEELREMPASLLTTPIKN--VSG  2148
               Q    RKPLSP+S      S ANI +     + S++   ++    L  TP     ++G
Sbjct  577   EIQSSLTRKPLSPVSPAVL--SKANISNFQEDHRKSQNVATQQKSQMLTATPPSRPYIAG  634

Query  2149  IGGNATPKtmpipmpstpasaassiamQMGMTPAPVAA--TTPMVGHDGVEYSYEEMRAG  2322
                N TPK M +P+P+TP ++   +     +TP  V +  T         EYS+EE+RAG
Sbjct  635   DEENMTPKNMALPVPTTPLTSVPMLT---AITPDSVYSGPTAASKTSQSFEYSFEEVRAG  691

Query  2323  FLLPRLH  2343
             F+LP+ +
Sbjct  692   FMLPKTY  698



>ref|XP_010913972.1| PREDICTED: 65-kDa microtubule-associated protein 1-like [Elaeis 
guineensis]
 ref|XP_010913973.1| PREDICTED: 65-kDa microtubule-associated protein 1-like [Elaeis 
guineensis]
 ref|XP_010913974.1| PREDICTED: 65-kDa microtubule-associated protein 1-like [Elaeis 
guineensis]
Length=589

 Score =   459 bits (1181),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 278/565 (49%), Positives = 388/565 (69%), Gaps = 22/565 (4%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             ETTC SLL +LQ IW+E+GE + ERDKML QLEQECL+ Y+RKVDQASRS A L QA+A+
Sbjct  13    ETTCGSLLQQLQVIWDEVGESDEERDKMLLQLEQECLDVYKRKVDQASRSRALLLQALAD  72

Query  463   SEAELARICAALGEQP-VNV-RQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQI  636
             S  ELAR+ + LGE+  V +  +SS ++K +L AI P LE+++++K +R  +F++VL QI
Sbjct  73    SRVELARLLSVLGEKSFVGIPDKSSGTIKEQLAAIAPALEQLRQQKEDRIKEFADVLSQI  132

Query  637   DSVLKELGKSRK--ELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESL  810
               +  E+  + K  E +   A+DE DLSL++L++    L  LQKEKSDRL  VLD + ++
Sbjct  133   QKMQGEIAGTLKIGEQKGTPAVDEEDLSLKKLDEYHCQLQELQKEKSDRLHNVLDFVSTV  192

Query  811   NSLCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHMLQ  984
             + LC VLG+DF +TI E+HP+L DS  +  KS+S +T+ +LS  +  L E K  RL  LQ
Sbjct  193   HDLCAVLGMDFFSTITEVHPSLNDSVGVQSKSISNDTLLKLSKMVIALEEDKRMRLQKLQ  252

Query  985   NLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQE  1164
              LA  + ELWNLMD P EE+ LF++VT  I+A+  E+  P AL+LDL++ AE+EV RL +
Sbjct  253   ELAAQLTELWNLMDTPTEERSLFNHVTCNISATVDEVMVPGALALDLIEQAEVEVERLDQ  312

Query  1165  MKSSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHLLEQLEIQIS  1338
             +K+SKMKE+ LKK+  LE++  +AH+ ID +   E     I+SG ++PS LL  ++ QI 
Sbjct  313   LKASKMKEIALKKQTELEDIYVRAHVEIDSAAAREKIMSLIDSGNVEPSELLTDMDNQIL  372

Query  1339  NVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVN  1518
               KEEA  RKEILEK+EKW++ACEEESWLEDYNR++NRYN  RG HL LKRAEKAR LVN
Sbjct  373   KAKEEALCRKEILEKIEKWMSACEEESWLEDYNRDENRYNASRGAHLNLKRAEKARILVN  432

Query  1519  KIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQG  1698
             KIP +++ L ++ + WE +RG+ F YDGV LL+ML++Y +L+Q++E E++R RDQK+   
Sbjct  433   KIPALVDTLVAKTRAWEEDRGMSFTYDGVPLLAMLDEYTMLRQDREEEKRRLRDQKRFHE  492

Query  1699  QLMAEQEVLFGSKRSPSQS-GKKNVVGGASNKRISVGGAMLQTPYTERAPLSSH--SLKK  1869
             QL  EQE LFGS+ SP++  G K VVG  +N   S G     TP + R  L++H  S   
Sbjct  493   QLNTEQEALFGSRPSPARPLGPKKVVGPRANTGASNG-----TP-SRRLSLNTHHGSSNG  546

Query  1870  INPVKQQALANITQ-----NYVALS  1929
             +  V +     + +     NYVA++
Sbjct  547   VRSVSRDGKREVGRPAAPVNYVAIA  571



>ref|XP_006587886.1| PREDICTED: 65-kDa microtubule-associated protein 3-like isoform 
X3 [Glycine max]
Length=689

 Score =   462 bits (1189),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 337/719 (47%), Positives = 452/719 (63%), Gaps = 52/719 (7%)
 Frame = +1

Query  247   MY-NRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQA  423
             MY NR + Q  + ETTC  LL ELQ IW+E+GE +  RD ML ++E +CL+ YR++VD+A
Sbjct  1     MYSNRTSSQFGQQETTCHLLLKELQIIWDEVGESDSRRDAMLREIEHKCLDLYRKEVDEA  60

Query  424   SRSCAQLRQAVAESEAELARICAALGEQPVNVR-QSSRSLKTELQAIMPlleemkkrkle  600
                 AQ++Q +A++ AE+A ICAA+GEQP++   +S  SLK   + ++  LEEM+K K +
Sbjct  61    KLCRAQIQQEIADNVAEIAGICAAMGEQPLHFDPKSCGSLKKARETVVSQLEEMRKLKTK  120

Query  601   rkHQFSEVLDQIDSVLKELGKSRKELQHMIA---LDESDLSLRRLEDMKSHLLSLQKEKS  771
             RK QFSEVL  + ++  EL  S      M+A   L+E++LSL+RLE+++  LL LQ EK+
Sbjct  121   RKKQFSEVLYHLKNISSELYGS------MVANAYLEENNLSLKRLEELQKQLLQLQNEKA  174

Query  772   DRLKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELR  951
              RLKQV D L +LNSLC+VLG+D K+ I EI PT+ +S+  K VS  TI+ L++ I  LR
Sbjct  175   SRLKQVSDQLNALNSLCLVLGLDVKDKICEICPTMVNSTVTKDVSDNTIKNLTSEIQSLR  234

Query  952   EVKIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLK  1131
             EVKI R+  LQ+ A  ++E+W+LMD P+EEQQ F +VT  I A ESE TE   LS+D + 
Sbjct  235   EVKIHRMQKLQSFAAALLEMWDLMDTPMEEQQKFHHVTSKITALESEFTESKILSIDSVI  294

Query  1132  SAEIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAIDDSIEFTDETIESGAIDPSHL  1311
               E EV RLQ +KS+KMKE+L KK++ LEE+CR+ HL        T +T+        H 
Sbjct  295   YLEKEVERLQVLKSTKMKELLRKKKLELEEICRKTHL--------TTQTV----FQSQHS  342

Query  1312  LE-----QLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTH  1476
             LE     Q+E  I+  KEEA +RKEILEKVEKWL AC+EESWLE+YNR+DNRYN GRG H
Sbjct  343   LELLDYDQIEHLITKTKEEALNRKEILEKVEKWLVACQEESWLEEYNRDDNRYNAGRGAH  402

Query  1477  LMLKRAEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKE  1656
             L LKRAEKARAL++KIPG++E +  + K WE ERG  F+YDG  LLS+LE Y  L+QEKE
Sbjct  403   LTLKRAEKARALLSKIPGIVETIILKVKAWEKERGQEFMYDGSRLLSILEDYSTLRQEKE  462

Query  1657  LERQRQRDQKKLQGQLMAEQEVLFGSKRSPS-QSGKKNVVGGASNKRISVGGAMLQTPYT  1833
              ERQ QRDQKKLQGQLMAE E LFGSK SP+ +SG K  V   S    S+   MLQ P  
Sbjct  463   NERQLQRDQKKLQGQLMAEHETLFGSKPSPAFKSGYK--VSRCSTGIPSI--TMLQDP--  516

Query  1834  ERAPLSSHSLKKINPVKQQALANITQNYVALSSGRRESSMHAKQPSCNKSNLQKTEPTQR  2013
               A L   S KK N   Q+   +I +N     S +    +     S  K    ++  T R
Sbjct  517   RHASLIHQSNKKGNVTNQK--GSILRNKNIYHSTQSSVKLKKTASSAEKGTEIQSSLT-R  573

Query  2014  KPLSPISSLSFNTSSANIMD-----KISESEELREMPASLLTTPIKN--VSGIGGNATPK  2172
             KPLSP+S      S ANI +     + S++   ++    L  TP     ++G   N TPK
Sbjct  574   KPLSPVSPAVL--SKANISNFQEDHRKSQNVATQQKSQMLTATPPSRPYIAGDEENMTPK  631

Query  2173  tmpipmpstpasaassiamQMGMTPAPVAA--TTPMVGHDGVEYSYEEMRAGFLLPRLH  2343
              M +P+P+TP ++   +     +TP  V +  T         EYS+EE+RAGF+LP+ +
Sbjct  632   NMALPVPTTPLTSVPMLT---AITPDSVYSGPTAASKTSQSFEYSFEEVRAGFMLPKTY  687



>ref|XP_011007613.1| PREDICTED: 65-kDa microtubule-associated protein 1-like [Populus 
euphratica]
Length=582

 Score =   456 bits (1174),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 259/530 (49%), Positives = 378/530 (71%), Gaps = 13/530 (2%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             ETTC +LL +LQ+IW+E+GE + +RDKML Q+EQECL+ Y++KV+QA++S AQL +A+++
Sbjct  13    ETTCGTLLQKLQEIWDEVGESDEDRDKMLIQIEQECLDVYKKKVEQATKSRAQLLEALSD  72

Query  463   SEAELARICAALGEQPVNV--RQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQI  636
             +  ELAR+ +ALGE+       ++S ++K +L AI P+LE++ ++K ER  +FS+V  QI
Sbjct  73    ARIELARLLSALGEKCFAGFPEKASGTIKEQLAAIAPILEQLWEQKAERVKEFSDVQTQI  132

Query  637   DSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESLNS  816
               +  E+  +   +     +D++DLSL++L++  + L  LQKEKSDRL +VL+ +  ++ 
Sbjct  133   QKICGEIAGNLN-INDNPTVDDADLSLKKLDEYHAQLQELQKEKSDRLHKVLEFVSCVHD  191

Query  817   LCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQRLHMLQNLAT  996
             LC VLG+DF +T+ ++HP+L DS+ ++S+S +T+ RL+  +  L+E K QRLH LQ LA 
Sbjct  192   LCAVLGMDFFSTVTDVHPSLNDSTGMQSISNDTLARLAKTVLALKEEKKQRLHKLQELAN  251

Query  997   TIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQEMKSS  1176
              +++LWNLMD P+EE++LFD+VTR + AS  E+T P AL+LDL++ AE+EV RL  +K+S
Sbjct  252   QLMDLWNLMDTPMEERKLFDHVTRNMLASVDEVTVPKALALDLIEQAEVEVERLDLLKAS  311

Query  1177  KMKEVLLKKRITLEELCRQAHLAI--DDSIEFTDETIESGAIDPSHLLEQLEIQISNVKE  1350
             +MKE+  KK+  LEE+   AH+ I  D + E     I+SG ++P+ LL  ++ QIS  KE
Sbjct  312   RMKEIAFKKQAELEEIYAHAHVEIAPDVAREKIMALIDSGNVEPAELLADMDNQISRAKE  371

Query  1351  EAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVNKIPG  1530
             E  SRKEIL+KVEKW++ACEEESWLEDYNR++NRYN  RG HL LKRAEKAR LVNKIP 
Sbjct  372   EGLSRKEILDKVEKWMSACEEESWLEDYNRDENRYNASRGAHLNLKRAEKARILVNKIPA  431

Query  1531  MLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQGQLMA  1710
             +++ L ++ + WE +RG+ F YDGV LL+ML++Y +L+QE+E E+QR RDQKK   Q   
Sbjct  432   LVDTLVAKTRAWEEDRGIQFAYDGVPLLAMLDEYAMLRQEREEEKQRMRDQKKFHEQQST  491

Query  1711  EQEVLFGSKRSPS-QSGKKNVVGGASNKRISVGGAMLQTPYTERAPLSSH  1857
             EQE  FGS+ SP+ Q   K V G  +N     GGA   TP + R  L++H
Sbjct  492   EQEASFGSRPSPARQVSTKKVAGSRAN-----GGAN-GTP-SRRLSLNAH  534



>ref|XP_008776645.1| PREDICTED: 65-kDa microtubule-associated protein 1-like [Phoenix 
dactylifera]
Length=589

 Score =   454 bits (1168),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 267/517 (52%), Positives = 366/517 (71%), Gaps = 9/517 (2%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             ETTC SLL +LQ IW+E+GE + ERDKML QLEQECL+ Y+RKVDQAS+S   L QA+A+
Sbjct  13    ETTCGSLLQQLQLIWDEVGESDEERDKMLLQLEQECLDVYKRKVDQASKSRVLLLQALAD  72

Query  463   SEAELARICAALGEQP-VNV-RQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQI  636
             S  ELAR  + LGE   +++  +SS ++K +L AI P LE+++K+K ER  +F++VL QI
Sbjct  73    SRVELARFLSVLGENSFIDIPDKSSGTIKEQLAAIAPALEQLRKQKEERIKEFADVLSQI  132

Query  637   DSVLKELGKSRK--ELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESL  810
               +  E+  + K  E +   A+DE DLSL++L++  S L  LQKEKSDRL +VLD + ++
Sbjct  133   HKIRGEITGTLKIGEQKGTPAVDEEDLSLKKLDEYHSQLQELQKEKSDRLHKVLDFVSTV  192

Query  811   NSLCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHMLQ  984
             + LC VLG+DF +TI E+HP+L DS  +  KS+S +T+ +LS  +  L E K  RL  LQ
Sbjct  193   HDLCAVLGMDFFSTITEVHPSLNDSVGVQSKSISNDTLSKLSKMVMALEEDKKMRLQKLQ  252

Query  985   NLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQE  1164
              LA  + +LWNLMD   EE+ LF++VT  I+A+  E+  P AL+LDL++ AE+EV RL E
Sbjct  253   ELAARLTDLWNLMDTLTEERSLFNHVTCNISATVDEVMVPGALALDLIEQAEVEVERLDE  312

Query  1165  MKSSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHLLEQLEIQIS  1338
             +K+SKMKE+ LKK+  LE++  +AH+ ID +   E     I+S  ++PS LL  ++ QI 
Sbjct  313   LKASKMKEIALKKQTELEDIYARAHIEIDSAAAREKIMSLIDSENVEPSELLADMDNQIL  372

Query  1339  NVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVN  1518
               KEEA  RKEILEK+EKW++ACEEESWLEDYNR++NRYN  RG HL LKRAEKAR LVN
Sbjct  373   KAKEEALCRKEILEKIEKWMSACEEESWLEDYNRDENRYNASRGAHLNLKRAEKARILVN  432

Query  1519  KIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQG  1698
             KIP +++ LT++ + WE +RG  F+YDGV LL+ML++Y +L+Q++E E++R RDQK+   
Sbjct  433   KIPALVDTLTAKTQAWEEDRGTSFVYDGVPLLAMLDEYTMLRQDREEEKRRLRDQKRFHE  492

Query  1699  QLMAEQEVLFGSKRSPSQS-GKKNVVGGASNKRISVG  1806
             QL  EQE LFGSK SP++  G K VVG   N   S G
Sbjct  493   QLNTEQEALFGSKPSPARPLGPKKVVGPRGNAGASNG  529



>ref|XP_009588990.1| PREDICTED: 65-kDa microtubule-associated protein 1-like [Nicotiana 
tomentosiformis]
 emb|CAC17794.1| microtubule-associated protein MAP65-1a [Nicotiana tabacum]
Length=580

 Score =   454 bits (1168),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 267/561 (48%), Positives = 394/561 (70%), Gaps = 23/561 (4%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             ETTC SLL +LQ+IW+E+GE + ERD ML Q++QECL+ Y+RKVDQA +S A L QA+A+
Sbjct  13    ETTCGSLLQKLQQIWDEVGETDDERDNMLLQIDQECLDVYKRKVDQAVKSRAHLLQALAD  72

Query  463   SEAELARICAALGEQP-VNV-RQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQI  636
             ++ EL+R+ +ALGE+  V +  ++S ++K +L AI P LE++ ++K +R  +F +V  QI
Sbjct  73    AKVELSRLLSALGEKTYVGIPEKTSGTIKEQLAAIAPALEKLWEQKDDRIKEFFDVQSQI  132

Query  637   DSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESLNS  816
               +  E+  +R++++ +  +DESDLSL++L++ ++ L  LQKEKS+RL++VL+ + +++ 
Sbjct  133   QKISSEIAGTREQVESL-TVDESDLSLKKLDEFQAQLQELQKEKSERLQKVLELVSTVHD  191

Query  817   LCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHMLQNL  990
             LC VLG+DF +T+ E+HP+L DS+ +  KS+S +T+  L+  +  L+E K QRLH LQ L
Sbjct  192   LCAVLGMDFFSTVTEVHPSLNDSTGVQSKSISNDTLSSLAKTVLVLKEDKKQRLHKLQEL  251

Query  991   ATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQEMK  1170
             AT +++LWNLMD P EE+ LFD+VT  I+AS  E+  P AL+LDL++ AE+EV RL ++K
Sbjct  252   ATQLIDLWNLMDTPEEERSLFDHVTCNISASVDEVAIPGALALDLIEQAEVEVERLDQLK  311

Query  1171  SSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHLLEQLEIQISNV  1344
             +SKMKE+  K++  LE++  +AH+ ID     E     I+SG +DP+ LL  ++ QI N 
Sbjct  312   ASKMKEIAFKRQAELEDIYARAHVEIDTEAAREKIMALIDSGNVDPAELLADMDNQIVNA  371

Query  1345  KEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVNKI  1524
             KEEA SRKEIL+KVEKW+AACEEESWLEDYNR+DNRYN  RG HL LKRAEKAR LVNKI
Sbjct  372   KEEAHSRKEILDKVEKWMAACEEESWLEDYNRDDNRYNASRGAHLNLKRAEKARILVNKI  431

Query  1525  PGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQGQL  1704
             P ++++L ++ + WE ER   F YDGV LL+ML++Y +L+ ++E E++R RDQKK   Q+
Sbjct  432   PALVDSLVAKTRAWEQERDTTFTYDGVPLLAMLDEYMMLRHDREEEKRRLRDQKKFHEQI  491

Query  1705  MAEQEVLFGSKRSPSQS-GKKNVVGGASNKRISVGGAMLQTPYTERAPLSSH-----SLK  1866
              +++E +FGS  SP++  G K V G  +N     G A    P + R  L+SH     S  
Sbjct  492   -SKEETVFGSTPSPARPLGPKKVTGPRAN-----GSA--NGPTSRRLSLNSHQNGSRSTN  543

Query  1867  KINPVKQQALANITQNYVALS  1929
             K      + +A +  NYVA++
Sbjct  544   KDGKRDTRPIAPL--NYVAMT  562



>ref|XP_003623742.1| NAD(P)H-quinone oxidoreductase chain [Medicago truncatula]
Length=994

 Score =   466 bits (1200),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 332/733 (45%), Positives = 447/733 (61%), Gaps = 85/733 (12%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M+ +++ Q    ET C SLL ELQ IW+E+GE +  +D ML ++EQ CL+ Y++KVD+A 
Sbjct  311   MFGKRSSQLSHQETMCESLLKELQVIWDELGESDSHKDAMLLEIEQMCLDLYKKKVDEAK  370

Query  427   RSCAQLRQAVAESEAELARICAALGEQ-PVNVRQSSRSLKTELQAIMPlleemkkrkler  603
                AQL+  +A+ E E+A ICAA+GEQ P+   +S  SLK E +A++  LEEM+K K+ER
Sbjct  371   LHKAQLQHQIADYEEEIAGICAAIGEQSPLFEPKSCGSLKKEREAVISQLEEMRKLKMER  430

Query  604   kHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLK  783
             K QF E+L Q+  +  EL  S     +   LDE +LS  +LE++K  LL  Q EK+ RLK
Sbjct  431   KKQFVEILHQLQKISSELHGSAGVNAN---LDEKNLSFEKLEELKMQLLQFQNEKASRLK  487

Query  784   QVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKI  963
              V + L+SL+SLC+VLG+D K+ I EI PT+  S+A K VS  T++ LS+ +  LREVK+
Sbjct  488   HVSELLDSLSSLCLVLGLDVKDKICEICPTM-TSTATKDVSDLTLKSLSSEVLSLREVKM  546

Query  964   QRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEI  1143
             QR+  LQ+ AT+++ELWNLMD P+EEQQ F N+T  IAA E E+TEPN LS+D +   E 
Sbjct  547   QRMQKLQSCATSLLELWNLMDTPLEEQQKFHNMTSKIAALEYEITEPNILSIDNIVYVER  606

Query  1144  EVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAIDDSIEFTD--ETIESGAIDPSHLLE  1317
             EV RL++ KS+KMKE++ +K++ LEE+CR+ HL +          E+I+S + +  H+LE
Sbjct  607   EVKRLEQFKSTKMKELVQRKKMELEEICRKTHLTLQTVFPSGHPIESIDSESANHEHMLE  666

Query  1318  QLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAE  1497
             Q+E QIS  KEEAFSRKEILEKVEKWLAA +EESWLE+YNR+DNRYN GRGTHL LKRAE
Sbjct  667   QIEDQISKTKEEAFSRKEILEKVEKWLAAIQEESWLEEYNRDDNRYNAGRGTHLALKRAE  726

Query  1498  KARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQR  1677
             KAR L+NKIPGM+EALT +   WE ER V F YDG  LLSM+E Y  L+QEKE ERQ+Q+
Sbjct  727   KARVLLNKIPGMVEALTLKVAAWEEERAVEFSYDGTRLLSMVEDYNTLRQEKENERQKQK  786

Query  1678  DQKKLQGQLMAEQEVLFGSKRSPSQSGKKN---VVGGASNKRISVGGAMLQTPYTERAPL  1848
             D+K+L+GQL+AE E LFGSK SPS+SG K      G  + ++ SVGGAMLQ     ++ L
Sbjct  787   DEKRLKGQLLAEHETLFGSKPSPSKSGIKAPRCSTGVPNTRKFSVGGAMLQD--RRQSTL  844

Query  1849  SSHSLKKINPVKQQALANITQNYVALSSGRRESSMH---AKQPSCNKSNLQKTEPTQRKP  2019
                S KK                     G+  S ++   AK+   +   +    P  RKP
Sbjct  845   IQQSNKK---------------------GKGTSKVYDHSAKKTPQSAKRIGIQSPLTRKP  883

Query  2020  LSPISSLSFNTSSA----------NIMDK--ISESEELREMPASLLTTPIKNVSGIGGNA  2163
             LSP+SS   + +S           N+  K  + +SE L   P S    P   ++G   N 
Sbjct  884   LSPVSSTVLSKASIKNSQGPKKILNVATKPILQKSEMLIGTPPS---KPF--IAGDEENM  938

Query  2164  TPKtmpipmpstpasaassiamQMGMTPAPVAATTPMVG-------------HDGVEYSY  2304
              P                     MG +      T PM+                  EYS+
Sbjct  939   NPN-------------------NMGPSVPSTPLTVPMLTVATPDTSKAAAKIAQSFEYSF  979

Query  2305  EEMRAGFLLPRLH  2343
             EE+RAGF+ P+ H
Sbjct  980   EELRAGFVEPKTH  992



>ref|XP_011095467.1| PREDICTED: 65-kDa microtubule-associated protein 1 [Sesamum indicum]
Length=581

 Score =   453 bits (1166),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 259/524 (49%), Positives = 372/524 (71%), Gaps = 16/524 (3%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             + TC SLL +LQ+IW+E+GE + ERDKML QLEQECL+ Y+RKVD A +S A L Q +A+
Sbjct  13    QITCGSLLQQLQQIWDEVGESDEERDKMLLQLEQECLDVYKRKVDLAVKSRAHLLQTLAD  72

Query  463   SEAELARICAALGEQP-VNV-RQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQI  636
             +  EL  + +ALGE+  V +  ++S ++K +L AI P LE++ K+K ER  +FS+V  QI
Sbjct  73    ARVELTNLLSALGEKTYVGIPEKTSGTIKEQLAAIAPALEKLWKQKDERIKEFSDVQSQI  132

Query  637   DSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESLNS  816
               +  E+  +  +++   A++ESDLSL++L++  + L  LQKEKSDRL +VL+ + +++ 
Sbjct  133   QKICAEIAGTSDKVESP-AVNESDLSLKKLDEFHAQLQELQKEKSDRLHKVLEFVSTVHD  191

Query  817   LCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHMLQNL  990
             LC VLG+DF  T+ E+HP+L DS+ +  KS+S ET+ RL+  +  L+E K QRL  LQ L
Sbjct  192   LCAVLGMDFLTTVTEVHPSLNDSTGVQSKSISNETLSRLAETVLALKEDKKQRLQKLQEL  251

Query  991   ATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQEMK  1170
             AT +++LWNLMD P EE+ LFD+VT  I+AS  E+T P AL+LDL++ AE+EV RL ++K
Sbjct  252   ATQLIDLWNLMDTPPEERSLFDHVTCNISASVDEVTIPGALALDLIEQAEVEVERLDQLK  311

Query  1171  SSKMKEVLLKKRITLEELCRQAHLAIDDSIEFTD--ETIESGAIDPSHLLEQLEIQISNV  1344
             +S+MKE+  K++  LEE+  QAH+ ID           I+SG ++P+ LL  ++ QI   
Sbjct  312   ASRMKEIAFKRQSELEEIFAQAHIEIDTEAARAKILSLIDSGNVEPAELLADMDNQIVKA  371

Query  1345  KEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVNKI  1524
             KEEA SRKEIL+KVEKW++ACEEESWLEDYNR++NRYN  RG HL LKRAEKAR LVNKI
Sbjct  372   KEEALSRKEILDKVEKWMSACEEESWLEDYNRDENRYNASRGAHLNLKRAEKARILVNKI  431

Query  1525  PGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQGQL  1704
             P ++++L ++ + WE ERG+ F YDGV LL+ML++Y +L+Q++E E++R RDQKK   Q+
Sbjct  432   PALVDSLVAKTRAWEQERGITFTYDGVPLLAMLDEYAMLRQDREEEKKRLRDQKKFHEQM  491

Query  1705  MAEQEVLFGSKRSPS-QSGKKNVVG--------GASNKRISVGG  1809
               EQE +FG+  SP+ Q   K VVG        G+S++R+S+  
Sbjct  492   SKEQESMFGATPSPARQPSTKKVVGPRANGSANGSSSRRLSLNA  535



>ref|XP_002316774.2| hypothetical protein POPTR_0011s09500g [Populus trichocarpa]
 gb|EEE97386.2| hypothetical protein POPTR_0011s09500g [Populus trichocarpa]
Length=581

 Score =   453 bits (1166),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 261/530 (49%), Positives = 381/530 (72%), Gaps = 14/530 (3%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             ETTC +LL +LQ+IW+E+GE + ERDKML Q+EQECL+ Y++KV+QA++S AQL +A+++
Sbjct  13    ETTCGTLLQKLQEIWDEVGESDEERDKMLIQIEQECLDVYKKKVEQAAKSRAQLLEALSD  72

Query  463   SEAELARICAALGEQPVNV--RQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQI  636
             +  ELAR+ +ALGE+       ++S ++K +L AI P+LE++ ++K ER  +FS+V  QI
Sbjct  73    ARIELARLLSALGEKCFAGLPEKASGTIKEQLAAIAPILEQLWEQKAERVKEFSDVQTQI  132

Query  637   DSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESLNS  816
               +  E+  +   +     +D++DLSL++L++  + L  LQKEKSDRL +VL+ + S++ 
Sbjct  133   QKICGEIAGNLN-INGNPTVDDADLSLKKLDEYHAQLQELQKEKSDRLHKVLEFVSSVHD  191

Query  817   LCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQRLHMLQNLAT  996
             LC VLG+DF +T+ ++HP+L DS+ ++S+S +T+ RL+  +  L+E K QRLH  + LA 
Sbjct  192   LCAVLGMDFFSTVTDVHPSLNDSTGMQSISNDTLARLAKTVLALKEEKKQRLHKAK-LAN  250

Query  997   TIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQEMKSS  1176
              +++LWNLMD P+EE++LFD+VTR + AS  E+T P AL+LDL++ AE+EV RL  +K+S
Sbjct  251   QLMDLWNLMDTPMEERKLFDHVTRNMLASVDEVTVPKALALDLIEQAEVEVERLDLLKAS  310

Query  1177  KMKEVLLKKRITLEELCRQAHLAI--DDSIEFTDETIESGAIDPSHLLEQLEIQISNVKE  1350
             +MKE+  KK+  LEE+  +AH+ I  D + E     I+SG ++P+ LL  ++ QIS  KE
Sbjct  311   RMKEIAFKKQAELEEIYARAHVEIAPDVAREKIMALIDSGNVEPAELLADMDNQISRAKE  370

Query  1351  EAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVNKIPG  1530
             EA SRKEIL+KVEKW++ACEEESWLEDYNR++NRYN  RG HL LKRAEKAR LVNKIP 
Sbjct  371   EALSRKEILDKVEKWMSACEEESWLEDYNRDENRYNASRGAHLNLKRAEKARILVNKIPA  430

Query  1531  MLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQGQLMA  1710
             +++ L ++ + WE +RG+ F YDGV LL+ML++Y +L+QE+E E+QR RDQKK   Q   
Sbjct  431   LVDTLVAKTRAWEEDRGIQFAYDGVPLLAMLDEYAMLRQEREEEKQRMRDQKKFHEQQNT  490

Query  1711  EQEVLFGSKRSPS-QSGKKNVVGGASNKRISVGGAMLQTPYTERAPLSSH  1857
             EQE  FGS+ SP+ Q   K VVG  +N     GGA   TP + R  L++H
Sbjct  491   EQESSFGSRPSPARQVSTKKVVGSRAN-----GGAN-GTP-SRRLSLNAH  533



>gb|AES79960.2| microtubule associated protein, MAP65/ASE1 family protein [Medicago 
truncatula]
Length=994

 Score =   466 bits (1199),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 332/733 (45%), Positives = 447/733 (61%), Gaps = 85/733 (12%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M+ +++ Q    ET C SLL ELQ IW+E+GE +  +D ML ++EQ CL+ Y++KVD+A 
Sbjct  311   MFGKRSSQLSHQETMCESLLKELQVIWDELGESDSHKDAMLLEIEQMCLDLYKKKVDEAK  370

Query  427   RSCAQLRQAVAESEAELARICAALGEQ-PVNVRQSSRSLKTELQAIMPlleemkkrkler  603
                AQL+  +A+ E E+A ICAA+GEQ P+   +S  SLK E +A++  LEEM+K K+ER
Sbjct  371   LHKAQLQHQIADYEEEIAGICAAIGEQSPLFEPKSCGSLKKEREAVISQLEEMRKLKMER  430

Query  604   kHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLK  783
             K QF E+L Q+  +  EL  S     +   LDE +LS  +LE++K  LL  Q EK+ RLK
Sbjct  431   KKQFVEILHQLQKISSELHGSAGVNAN---LDEKNLSFEKLEELKMQLLQFQNEKASRLK  487

Query  784   QVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKI  963
              V + L+SL+SLC+VLG+D K+ I EI PT+  S+A K VS  T++ LS+ +  LREVK+
Sbjct  488   HVSELLDSLSSLCLVLGLDVKDKICEICPTM-TSTATKDVSDLTLKSLSSEVLSLREVKM  546

Query  964   QRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEI  1143
             QR+  LQ+ AT+++ELWNLMD P+EEQQ F N+T  IAA E E+TEPN LS+D +   E 
Sbjct  547   QRMQKLQSCATSLLELWNLMDTPLEEQQKFHNMTSKIAALEYEITEPNILSIDNIVYVER  606

Query  1144  EVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAIDDSIEFTD--ETIESGAIDPSHLLE  1317
             EV RL++ KS+KMKE++ +K++ LEE+CR+ HL +          E+I+S + +  H+LE
Sbjct  607   EVKRLEQFKSTKMKELVQRKKMELEEICRKTHLTLQTVFPSGHPIESIDSESANHEHMLE  666

Query  1318  QLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAE  1497
             Q+E QIS  KEEAFSRKEILEKVEKWLAA +EESWLE+YNR+DNRYN GRGTHL LKRAE
Sbjct  667   QIEDQISKTKEEAFSRKEILEKVEKWLAAIQEESWLEEYNRDDNRYNAGRGTHLALKRAE  726

Query  1498  KARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQR  1677
             KAR L+NKIPGM+EALT +   WE ER V F YDG  LLSM+E Y  L+QEKE ERQ+Q+
Sbjct  727   KARVLLNKIPGMVEALTLKVAAWEEERAVEFSYDGTRLLSMVEDYNTLRQEKENERQKQK  786

Query  1678  DQKKLQGQLMAEQEVLFGSKRSPSQSGKKN---VVGGASNKRISVGGAMLQTPYTERAPL  1848
             D+K+L+GQL+AE E LFGSK SPS+SG K      G  + ++ SVGGAMLQ     ++ L
Sbjct  787   DEKRLKGQLLAEHETLFGSKPSPSKSGIKAPRCSTGVPNTRKFSVGGAMLQD--RRQSTL  844

Query  1849  SSHSLKKINPVKQQALANITQNYVALSSGRRESSMH---AKQPSCNKSNLQKTEPTQRKP  2019
                S KK                     G+  S ++   AK+   +   +    P  RKP
Sbjct  845   IQQSNKK---------------------GKGTSKVYDHSAKKTPQSAKRIGIQSPLTRKP  883

Query  2020  LSPISSLSFNTSSA----------NIMDK--ISESEELREMPASLLTTPIKNVSGIGGNA  2163
             LSP+SS   + +S           N+  K  + +SE L   P S    P   ++G   N 
Sbjct  884   LSPVSSTVLSKASIKNSQGPKKILNVATKPILQKSEMLIGTPPS---KPF--IAGDEENM  938

Query  2164  TPKtmpipmpstpasaassiamQMGMTPAPVAATTPMVG-------------HDGVEYSY  2304
              P                     MG +      T PM+                  EYS+
Sbjct  939   NPN-------------------NMGPSVPSTPLTVPMLTVATPDTSKAAAKIAQSFEYSF  979

Query  2305  EEMRAGFLLPRLH  2343
             EE+RAGF+ P+ H
Sbjct  980   EELRAGFVEPKTH  992



>ref|XP_008227010.1| PREDICTED: 65-kDa microtubule-associated protein 1 isoform X2 
[Prunus mume]
Length=581

 Score =   452 bits (1164),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 263/532 (49%), Positives = 380/532 (71%), Gaps = 15/532 (3%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             E TC SLL +LQ+IWNE+GE + ERDKML QLEQECL+ Y+RKV+ A+ S AQL QA+++
Sbjct  13    EITCGSLLQKLQEIWNEVGESDEERDKMLLQLEQECLDVYKRKVELAAMSRAQLLQALSD  72

Query  463   SEAELARICAALGEQP-VNV-RQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQI  636
             ++ EL+ + +ALGE+  V V  ++S ++K +L AI P+LE++ K+K +R  +FS+V  QI
Sbjct  73    AKLELSSLVSALGEKSFVGVPEKTSGTIKEQLAAIAPVLEQLWKQKEDRVKEFSDVQSQI  132

Query  637   DSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESLNS  816
               +  E+  +   L    A+DESDLSL++L++ +S L  LQKEKS+RL +VL+ + +++ 
Sbjct  133   QKICGEIAGNLN-LSESPAVDESDLSLKKLDEYQSQLHDLQKEKSERLHKVLEFVSTVHD  191

Query  817   LCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHMLQNL  990
             LC VLG+DF +T+ E+HP+L DS+ +  KS+S +T+ RL+  +  L+E K QRLH LQ  
Sbjct  192   LCAVLGLDFLSTVTEVHPSLNDSTGVQSKSISNDTLSRLAKTVLALKEDKKQRLHKLQES  251

Query  991   ATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQEMK  1170
             AT +++LWNLMD P EE+  +D+VT  I+AS  E+T P AL+ DL++  E+EV RL ++K
Sbjct  252   ATQLLDLWNLMDTPDEERGFYDHVTCNISASVDEVTVPGALAWDLIEQTEVEVERLDQLK  311

Query  1171  SSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHLLEQLEIQISNV  1344
             SS+MKE+  KK+  LEE+  +AH+ ID     E   E I+SG ++P+ LL  ++ QI+  
Sbjct  312   SSRMKEIAFKKQSELEEIFTRAHIEIDPEAAREKIMELIDSGNVEPTELLADMDDQIAKA  371

Query  1345  KEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVNKI  1524
             ++EA SRK+IL+KVEKW++ACEEESWLEDYNR++NRYN  RG HL LKRAEKAR LVNKI
Sbjct  372   RDEALSRKDILDKVEKWMSACEEESWLEDYNRDENRYNASRGAHLNLKRAEKARILVNKI  431

Query  1525  PGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQGQL  1704
             P +++ L ++ +GWE +RG+ F YDGV LL+ML++Y +L+Q++E E++R RDQKK Q   
Sbjct  432   PALVDTLVAKTRGWEEDRGISFTYDGVPLLAMLDEYAMLRQDREEEKRRMRDQKKYQELQ  491

Query  1705  MAEQEVLFGSKRSPSQS-GKKNVVGGASNKRISVGGAMLQTPYTERAPLSSH  1857
               EQE +FGSK SP++  G K VVG  +N      G    TP + R  L++H
Sbjct  492   HTEQETIFGSKPSPARPVGTKKVVGPRAN------GGPNGTP-SRRLSLNAH  536



>ref|XP_008782921.1| PREDICTED: 65-kDa microtubule-associated protein 1-like [Phoenix 
dactylifera]
 ref|XP_008782923.1| PREDICTED: 65-kDa microtubule-associated protein 1-like [Phoenix 
dactylifera]
 ref|XP_008782924.1| PREDICTED: 65-kDa microtubule-associated protein 1-like [Phoenix 
dactylifera]
 ref|XP_008782925.1| PREDICTED: 65-kDa microtubule-associated protein 1-like [Phoenix 
dactylifera]
 ref|XP_008782926.1| PREDICTED: 65-kDa microtubule-associated protein 1-like [Phoenix 
dactylifera]
 ref|XP_008782927.1| PREDICTED: 65-kDa microtubule-associated protein 1-like [Phoenix 
dactylifera]
 ref|XP_008782928.1| PREDICTED: 65-kDa microtubule-associated protein 1-like [Phoenix 
dactylifera]
 ref|XP_008782929.1| PREDICTED: 65-kDa microtubule-associated protein 1-like [Phoenix 
dactylifera]
Length=589

 Score =   452 bits (1164),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 281/565 (50%), Positives = 396/565 (70%), Gaps = 22/565 (4%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             ETTC SLL +LQ IW+E+GE E ERD++L QLEQECL+ Y+RKVDQAS+S A L QA+A+
Sbjct  13    ETTCGSLLQQLQLIWSEVGESEEERDRILLQLEQECLDVYKRKVDQASKSRALLLQALAD  72

Query  463   SEAELARICAALGEQP-VNV-RQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQI  636
             S  ELAR+ +ALGE+  V +  +SS ++K +L AI P LE++ K+K ER   F++VL QI
Sbjct  73    SRVELARLLSALGEKSFVGIPDKSSGTIKEQLAAIAPALEQLCKQKEERIKDFADVLSQI  132

Query  637   DSVLKELGKSRKELQHM--IALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESL  810
               +  E+  + K  + M   A+DE DLSL++L++  S L  LQKEKS+RL +VL+ + ++
Sbjct  133   QKIQGEIAGTLKNGEKMGTSAVDEEDLSLKKLDEYHSQLQELQKEKSERLHKVLNFVSTV  192

Query  811   NSLCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHMLQ  984
             + LC VLG+DF +TI E+HP+L DS  +  KS+S +T+ +LS  + EL+E K  RL  LQ
Sbjct  193   HDLCAVLGMDFFSTITEVHPSLNDSVGVQSKSISNDTLSKLSKMVIELKEDKRMRLRKLQ  252

Query  985   NLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQE  1164
              LA  + +LWNLMD P+EEQ LF++VT  I+A+  ++T P AL+LDL++ AE+EV RL +
Sbjct  253   ELAAQLTDLWNLMDTPMEEQSLFNHVTCNISATVDDVTVPGALALDLIEQAEVEVERLDQ  312

Query  1165  MKSSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHLLEQLEIQIS  1338
             +K+SKMKE+ LK++  LE++  +AH+ ID +   E     I+SG ++PS LL  ++ QI 
Sbjct  313   LKASKMKEIALKRQTELEDIYARAHIEIDSAAAREKIISLIDSGNLEPSELLTDMDNQIL  372

Query  1339  NVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVN  1518
               KEEA SRKEILE+VEKW++ACEEESWLEDYNR+ NRYN  RG HL LKRAEKAR LVN
Sbjct  373   KAKEEALSRKEILERVEKWMSACEEESWLEDYNRDQNRYNASRGAHLNLKRAEKARILVN  432

Query  1519  KIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQG  1698
             KIP +++AL ++ + WE  RG+ F+YDGV LL+ML++Y +L+QE+E E++R RDQK+ Q 
Sbjct  433   KIPALVDALVAKTRAWEDSRGMSFMYDGVPLLAMLDEYTMLRQEREEEKRRLRDQKRFQE  492

Query  1699  QLMAEQEVLFGSKRSPSQS-GKKNVVGGASNKRISVGGAMLQTPYTERAPLSSH--SLKK  1869
             Q+  EQE LFGS+ SP++  G K +VG   N     GGA   TP + R  L++H  S   
Sbjct  493   QVNTEQEALFGSRPSPAKPLGPKKMVGPRGN-----GGASNGTP-SRRLSLNTHHGSGNG  546

Query  1870  INPVKQQALANITQ-----NYVALS  1929
             +  V +     +++     NYVA++
Sbjct  547   VRSVSRDGKREVSRPAAPANYVAIA  571



>ref|XP_010550565.1| PREDICTED: 65-kDa microtubule-associated protein 9 isoform X3 
[Tarenaya hassleriana]
 ref|XP_010550566.1| PREDICTED: 65-kDa microtubule-associated protein 9 isoform X3 
[Tarenaya hassleriana]
 ref|XP_010550567.1| PREDICTED: 65-kDa microtubule-associated protein 9 isoform X3 
[Tarenaya hassleriana]
Length=558

 Score =   451 bits (1160),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 284/552 (51%), Positives = 389/552 (70%), Gaps = 14/552 (3%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M   QN + LR+ET   SLL ELQ  W+E+GE E ER+K + ++E EC E Y+RK+D   
Sbjct  1     MSESQNARVLRIETMYASLLDELQMAWDEVGEMEEEREKTMLEIENECREVYKRKIDGVK  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQS---SRSLKTELQAIMPlleemkkrkl  597
                 +LR A+A+SEA+L  IC+A+GE P+  RQS    RSLK E+  I+  +E+M+KRK 
Sbjct  61    EEMTRLRHAIADSEAKLMSICSAMGESPLYGRQSEQSGRSLKEEMGRILQQIEDMQKRKS  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             ER++QF +VL  I  V  E+    +++     +DESDLSLR+LE++   L +LQ++K  R
Sbjct  121   ERRNQFIQVLCDIQCVSDEINGRSEDISSDPEVDESDLSLRKLEELHRQLYTLQEQKRTR  180

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             L+Q+ DHL +L SLC+VLG+DF+ T  +IHP+L +S   K +S E + +L++++ +L E 
Sbjct  181   LRQIQDHLRNLESLCLVLGLDFRQTAFQIHPSLVESEGSKCISNEALNQLASSVQQLYET  240

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             KIQR+  LQ+L  T++E WNLMD PVEEQQ F N+T  IAA+ SE+TEPN+LSL+LL+  
Sbjct  241   KIQRMQDLQDLLMTMLEYWNLMDTPVEEQQRFRNITSNIAATVSEITEPNSLSLELLEQV  300

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHL  1311
               E+ RL+E+K SKMKE++LKKR  L+E+CR+ H+ ++  I  E   E IESG ++P ++
Sbjct  301   RTELCRLEEVKWSKMKELVLKKRSELQEICRKTHIVLEPDIVDENVMEAIESGEVNPENI  360

Query  1312  LEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKR  1491
             LEQ+E++ + VKEEA SRK+ILEKVEKW +  EEE+WLE+YN+++NRYN G+GTHL+LKR
Sbjct  361   LEQIELEAAKVKEEALSRKDILEKVEKWFSTREEENWLEEYNQDENRYNTGKGTHLILKR  420

Query  1492  AEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQR  1671
             AEKAR LVNKIPGM+EAL S+   WE ER   FLYDG  LLSMLE+Y  L+QE+E ER+R
Sbjct  421   AEKARILVNKIPGMVEALVSKTAAWESERKAEFLYDGCRLLSMLEEYTELRQEREQERRR  480

Query  1672  QRDQKKLQGQLMAEQEVLFGSKRS---PSQSGKKNVVGGASNKRISVGGAMLQTPYTERA  1842
             +RDQKKLQGQL  EQE + GS  S   P+ SGKK+ +   +NKR+    A +  P T R 
Sbjct  481   KRDQKKLQGQLPVEQEAITGSNTSPLKPAASGKKS-LKVTTNKRV----ASVSLPQTPR-  534

Query  1843  PLSSHSLKKINP  1878
             P S  S K   P
Sbjct  535   PGSPQSAKSNTP  546



>gb|KDO85848.1| hypothetical protein CISIN_1g045523mg, partial [Citrus sinensis]
Length=634

 Score =   453 bits (1165),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 298/688 (43%), Positives = 427/688 (62%), Gaps = 89/688 (13%)
 Frame = +1

Query  319   KIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAESEAELARICAAL  498
             KIW+E+GE + ERDKM+ ++EQECL  Y RK+D A  S AQL +A+A SEAE+A IC+ L
Sbjct  12    KIWDEVGESDNERDKMILEIEQECLAVYGRKIDDAKISRAQLLRAIALSEAEVADICSTL  71

Query  499   GEQPVNVRQSSR-SLKTELQAIMPlleemkkrklerkHQFSEVLDQIDSVLKELGKSRKE  675
             GEQP +   ++  +L+ +L+ I PLLE+M++RK++RK+QF +VL+Q+  +  E+    K+
Sbjct  72    GEQPGHCDWTAGGNLRDKLKTITPLLEDMRQRKIDRKNQFLQVLNQLQIISNEI--CPKD  129

Query  676   LQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESLNSLCIVLGIDFKNTI  855
               + I  DE+DLS +RL++++S L  LQ+EKS RL++V+ HL ++NSLC+VLG+DFK+T+
Sbjct  130   NMYKIIEDEADLSEQRLKELRSQLAYLQEEKSSRLRKVMKHLSNVNSLCMVLGLDFKDTV  189

Query  856   GEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQRLHMLQNLATTIVELWNLMDMPV  1035
              +IHPTL D  A K VS +TIE+++  I  L+EVKIQR+  LQ+LAT++VELWNLMD P+
Sbjct  190   CKIHPTLNDPKASKDVSNDTIEKMATTIQSLQEVKIQRMQKLQHLATSLVELWNLMDTPL  249

Query  1036  EEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQEMKSSKMKEVLLKKRITL  1215
             EEQ++F N+T  IAA E E+TEPN LS++ +K  E EVSRL+++KSSKMKE++LKK++ L
Sbjct  250   EEQEMFHNITSKIAALEPEITEPNFLSMNNIKYVEGEVSRLEQLKSSKMKELVLKKKLEL  309

Query  1216  EELCRQAHLAIDDSIEFTDETIESGAIDPSHLLEQLEIQISNVKEEAFSRKEILEKVEKW  1395
              E+ R+ H   +   +F+ E IESG++D   LLEQ+++QI+  KEEA SRKEILEKVEKW
Sbjct  310   AEILRKMHTVTETVGDFSIEAIESGSMDFMDLLEQIDLQIAKAKEEASSRKEILEKVEKW  369

Query  1396  LAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVNKIPGMLEALTSRAKGWEIE  1575
               A EEESWLE+                            N++                 
Sbjct  370   FTAREEESWLEE---------------------------YNRV-----------------  385

Query  1576  RGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQGQLMAEQEVLFGSKRSPSQS  1755
             R +  L D          Y  ++QEKELERQRQ+D +KLQ QL+AEQE ++GSK SPS+S
Sbjct  386   RLISMLED----------YSCMRQEKELERQRQKDHRKLQVQLIAEQEAIYGSKPSPSKS  435

Query  1756  GKK---NVVGGASNKRISVGGAMLQTPYTERAPLSSHSLKKINPVKQQALANITQNY-VA  1923
             G+K    + G ASN+++S+GG MLQ    E+  L  HS KKI+ + + +     Q+  +A
Sbjct  436   GRKTSTTLTGIASNRKLSLGGVMLQNLKPEKEALCVHSNKKIDGLYRNSPFGRPQSVSLA  495

Query  1924  LSSGRRESSM--HAKQPSCNK--SNLQKTE-PTQRKPLSPIS-SLSFNTSSANIMD---K  2076
               SGRR S +  +    SC+   +  +K E  + RKPLSP+S ++S   + AN ++   +
Sbjct  496   AGSGRRNSEIPGNVVNKSCSSVAAKARKVESKSARKPLSPVSLAISSKANIANFLEDKKR  555

Query  2077  ISESEELREMPASLLTTPIKNVSGIG-GNATPKtmpipmpstpasaassiamQMGMTPAP  2253
                   L+ +P S+  TP K +     GN  P TMP    +     A  +   M MTPA 
Sbjct  556   THNGTSLKAVP-SVAVTPSKQIVACNEGNKAPNTMPSVPKTPSTFTAPML---MAMTPA-  610

Query  2254  VAATTPMVG---------HDGVEYSYEE  2310
                 TP V           D +EYS+EE
Sbjct  611   ----TPCVSLGAKANERTGDKIEYSFEE  634



>ref|XP_010550561.1| PREDICTED: 65-kDa microtubule-associated protein 9 isoform X1 
[Tarenaya hassleriana]
 ref|XP_010550562.1| PREDICTED: 65-kDa microtubule-associated protein 9 isoform X1 
[Tarenaya hassleriana]
 ref|XP_010550563.1| PREDICTED: 65-kDa microtubule-associated protein 9 isoform X2 
[Tarenaya hassleriana]
 ref|XP_010550564.1| PREDICTED: 65-kDa microtubule-associated protein 9 isoform X1 
[Tarenaya hassleriana]
Length=598

 Score =   451 bits (1160),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 284/552 (51%), Positives = 389/552 (70%), Gaps = 14/552 (3%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M   QN + LR+ET   SLL ELQ  W+E+GE E ER+K + ++E EC E Y+RK+D   
Sbjct  41    MSESQNARVLRIETMYASLLDELQMAWDEVGEMEEEREKTMLEIENECREVYKRKIDGVK  100

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQS---SRSLKTELQAIMPlleemkkrkl  597
                 +LR A+A+SEA+L  IC+A+GE P+  RQS    RSLK E+  I+  +E+M+KRK 
Sbjct  101   EEMTRLRHAIADSEAKLMSICSAMGESPLYGRQSEQSGRSLKEEMGRILQQIEDMQKRKS  160

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             ER++QF +VL  I  V  E+    +++     +DESDLSLR+LE++   L +LQ++K  R
Sbjct  161   ERRNQFIQVLCDIQCVSDEINGRSEDISSDPEVDESDLSLRKLEELHRQLYTLQEQKRTR  220

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             L+Q+ DHL +L SLC+VLG+DF+ T  +IHP+L +S   K +S E + +L++++ +L E 
Sbjct  221   LRQIQDHLRNLESLCLVLGLDFRQTAFQIHPSLVESEGSKCISNEALNQLASSVQQLYET  280

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             KIQR+  LQ+L  T++E WNLMD PVEEQQ F N+T  IAA+ SE+TEPN+LSL+LL+  
Sbjct  281   KIQRMQDLQDLLMTMLEYWNLMDTPVEEQQRFRNITSNIAATVSEITEPNSLSLELLEQV  340

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHL  1311
               E+ RL+E+K SKMKE++LKKR  L+E+CR+ H+ ++  I  E   E IESG ++P ++
Sbjct  341   RTELCRLEEVKWSKMKELVLKKRSELQEICRKTHIVLEPDIVDENVMEAIESGEVNPENI  400

Query  1312  LEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKR  1491
             LEQ+E++ + VKEEA SRK+ILEKVEKW +  EEE+WLE+YN+++NRYN G+GTHL+LKR
Sbjct  401   LEQIELEAAKVKEEALSRKDILEKVEKWFSTREEENWLEEYNQDENRYNTGKGTHLILKR  460

Query  1492  AEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQR  1671
             AEKAR LVNKIPGM+EAL S+   WE ER   FLYDG  LLSMLE+Y  L+QE+E ER+R
Sbjct  461   AEKARILVNKIPGMVEALVSKTAAWESERKAEFLYDGCRLLSMLEEYTELRQEREQERRR  520

Query  1672  QRDQKKLQGQLMAEQEVLFGSKRS---PSQSGKKNVVGGASNKRISVGGAMLQTPYTERA  1842
             +RDQKKLQGQL  EQE + GS  S   P+ SGKK+ +   +NKR+    A +  P T R 
Sbjct  521   KRDQKKLQGQLPVEQEAITGSNTSPLKPAASGKKS-LKVTTNKRV----ASVSLPQTPR-  574

Query  1843  PLSSHSLKKINP  1878
             P S  S K   P
Sbjct  575   PGSPQSAKSNTP  586



>gb|KHG07371.1| 65-kDa microtubule-associated 1 -like protein [Gossypium arboreum]
Length=583

 Score =   451 bits (1159),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 256/515 (50%), Positives = 370/515 (72%), Gaps = 7/515 (1%)
 Frame = +1

Query  265   DQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQL  444
             D  L  E TC SLL +LQ+IW+E+GE + ERDKML Q+EQECL+ Y+RKV+QA++S AQL
Sbjct  7     DNPLVGEITCGSLLQKLQEIWDEVGESDEERDKMLLQIEQECLDVYKRKVEQAAKSRAQL  66

Query  445   RQAVAESEAELARICAALGEQP-VNVRQSS-RSLKTELQAIMPlleemkkrklerkHQFS  618
              QA+++++ EL+ + +ALG++  +++ +++  ++  +L AI P LE++ K+K ER  +FS
Sbjct  67    LQALSDAKLELSTLVSALGDKSFISIPETTLGTINEQLAAIAPALEQLLKQKEERVKEFS  126

Query  619   EVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDH  798
             +V  QI  +  E+  +  E     A+DESDLSL++L + +  L  LQKEKSDRL +VL+ 
Sbjct  127   DVQSQIQKICGEIAGNDSEQTGAPAVDESDLSLKKLNEYQVKLQELQKEKSDRLHKVLEF  186

Query  799   LESLNSLCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRL  972
             + +++ LC VLG+DF +T+ E+HP+L D++ +  KS+S +T+ RL+  +  L E K QRL
Sbjct  187   VSTVHDLCAVLGMDFLSTVTEVHPSLDDTTGVQSKSISNDTLLRLAETVSALNEDKKQRL  246

Query  973   HMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVS  1152
             H LQ LAT +++LWNLMD P EE+ L D+VT   +AS   +T P AL+LDL++ AE+EV 
Sbjct  247   HKLQELATQLIDLWNLMDTPEEERILLDHVTCHTSASVDGVTVPGALALDLIEQAEVEVE  306

Query  1153  RLQEMKSSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHLLEQLE  1326
             RL ++K+S+MKE+  KK++ LEE+   AH+ ID     E     I+SG ++P+ LL  ++
Sbjct  307   RLDQLKASRMKEIAFKKQVELEEIFACAHIEIDPEAAREKIMALIDSGNVEPTELLADMD  366

Query  1327  IQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKAR  1506
              QI+  KEE  SRKEIL++VEKW++ACEEESWLEDYNR++NRYN  RG HL LKRAEKAR
Sbjct  367   NQIAKAKEEVLSRKEILDRVEKWMSACEEESWLEDYNRDENRYNSSRGAHLNLKRAEKAR  426

Query  1507  ALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQK  1686
              LVNKIPGM++ L ++ + WE +RG  F YDGV LL+ML++Y +L+QE+E E+++ RDQK
Sbjct  427   ILVNKIPGMVDTLVAKTRAWEEDRGTSFSYDGVPLLAMLDEYAMLRQEREEEKRKLRDQK  486

Query  1687  KLQGQLMAEQEVLFGSKRSPSQ-SGKKNVVGGASN  1788
             K   Q   EQE +FGSK SP++ SG K VVG  +N
Sbjct  487   KYGEQQNTEQEAIFGSKPSPARPSGTKKVVGPRAN  521



>ref|XP_007020696.1| Microtubule-associated proteins 65-1 isoform 1 [Theobroma cacao]
 ref|XP_007020700.1| Microtubule-associated proteins 65-1 isoform 1 [Theobroma cacao]
 gb|EOY12221.1| Microtubule-associated proteins 65-1 isoform 1 [Theobroma cacao]
 gb|EOY12225.1| Microtubule-associated proteins 65-1 isoform 1 [Theobroma cacao]
Length=583

 Score =   449 bits (1156),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 261/517 (50%), Positives = 376/517 (73%), Gaps = 12/517 (2%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             ETTC SLL +LQ+IW+E+GE + ERDKML Q+EQECL+ Y+RKV+QA++S AQL QA+++
Sbjct  13    ETTCGSLLQKLQEIWDEVGESDEERDKMLLQIEQECLDVYKRKVEQAAKSRAQLLQALSD  72

Query  463   SEAELARICAALGEQPVNV--RQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQI  636
             ++ EL+ + +ALG++       ++S ++K +L AI P LE++ K+K ER   FS+V  QI
Sbjct  73    AKLELSTLVSALGDKNFGGIPEKASGTIKEQLAAIAPALEQLWKQKEERVKDFSDVQSQI  132

Query  637   DSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESLNS  816
               +  E+  +  E     A+DESDLSL++L++ ++    LQKEKSDRL +VL+ + +++ 
Sbjct  133   QKICGEIAGNVSEQTGSPAVDESDLSLKKLDEYQAKFQELQKEKSDRLHKVLEFVSTVHD  192

Query  817   LCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHMLQNL  990
             LC VLG+DF +T+ E+HP+L DS+ +  KS+S +T+ RL+  +  L + K QRLH LQ L
Sbjct  193   LCAVLGMDFFSTVTEVHPSLDDSTGVQSKSISNDTLLRLAKTVSALNQDKKQRLHKLQEL  252

Query  991   ATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQEMK  1170
             AT +++LWNLMD P EE++LFD+VT  I+AS  E+T P AL+LDL++ AE+EV RL ++K
Sbjct  253   ATQLIDLWNLMDTPEEERKLFDHVTCNISASVDEVTVPGALALDLIEQAEVEVERLDQLK  312

Query  1171  SSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHLLEQLEIQISNV  1344
             SS+MKE+  K+++ LEE+  +AH+ ID     E     I+SG ++P+ LL  ++ QI+  
Sbjct  313   SSRMKEIAFKRQVELEEIFARAHIEIDPEAAREKIMSLIDSGNVEPAELLADMDNQIAKA  372

Query  1345  KEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVNKI  1524
             KEEA SRKEIL++VEKW++ACEEESWLEDYNR++NRYN  RG HL LKRAEKAR LVNKI
Sbjct  373   KEEALSRKEILDRVEKWMSACEEESWLEDYNRDENRYNASRGAHLNLKRAEKARILVNKI  432

Query  1525  PGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQGQL  1704
             PGM++ L ++ + WE +RG+ F YDGV LL+ML++Y +L+QE+E E++R RDQKK   Q 
Sbjct  433   PGMVDTLVAKTRAWEEDRGISFAYDGVPLLAMLDEYAMLRQEREEEKRRLRDQKKYHEQQ  492

Query  1705  MAEQEVLFGSKRSPSQ-SGKKNVVGGASNKRISVGGA  1812
               EQE +FGS+ SP++ +  K VVG  +N     GGA
Sbjct  493   NTEQEAIFGSRPSPARPANTKKVVGPRAN-----GGA  524



>emb|CDP13779.1| unnamed protein product [Coffea canephora]
Length=576

 Score =   449 bits (1155),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 269/577 (47%), Positives = 390/577 (68%), Gaps = 33/577 (6%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             ETTC  L      IW+E+GE + ERDKML QLEQECL+ Y+RKVDQA++S A L QA+A+
Sbjct  13    ETTCVQL------IWDEVGETDEERDKMLLQLEQECLDVYKRKVDQAAKSRAHLLQALAD  66

Query  463   SEAELARICAALGEQP-VNV-RQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQI  636
             ++ EL+ + +ALGE+  V +  +++ ++K +L AI P LE++ K K ER  +FS+V   I
Sbjct  67    AKVELSSLLSALGEKSFVGIPEKTTGTIKEQLAAIAPALEKLMKLKEERIKEFSDVQSHI  126

Query  637   DSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESLNS  816
               +  E+  + ++++   ++DE DLSL++L++  +HL  LQKEKS+RL +VL+ + +++ 
Sbjct  127   QKICGEIAGTTEQVERQ-SVDEFDLSLKKLDEFHAHLQELQKEKSERLHKVLEFVSTVHD  185

Query  817   LCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHMLQNL  990
             LC VLG+DF +T+ E+HP+L DS+ +  KS+S +T+ RL+  +  L+E K QRLH LQ L
Sbjct  186   LCAVLGMDFFSTVTEVHPSLNDSTGVQCKSISNDTLSRLAKTVLALKEDKRQRLHKLQEL  245

Query  991   ATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQEMK  1170
             AT + +LWNLMD P EE+ LFD+VT  I+AS  E+T P AL+LDL++ AE+EV RL ++K
Sbjct  246   ATQLTDLWNLMDTPEEERSLFDHVTCNISASVDEVTIPGALALDLIEQAEVEVERLDQLK  305

Query  1171  SSKMKEVLLKKRITLEELCRQAHLAIDDSIEFTDET---IESGAIDPSHLLEQLEIQISN  1341
             +S+MKE+  K++  LEE+  +AH+ ID S    D+    I+SG ++P+ LL  ++ QI+ 
Sbjct  306   ASRMKEIAFKRQAELEEIFARAHIEID-SEAARDKIMALIDSGNVEPADLLADMDNQIAK  364

Query  1342  VKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVNK  1521
              K+EA SRKEIL+KVEKW++ACEEESWLEDYNR+DNRYN  RG HL LKRAEKAR LVNK
Sbjct  365   AKDEALSRKEILDKVEKWMSACEEESWLEDYNRDDNRYNASRGAHLNLKRAEKARVLVNK  424

Query  1522  IPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQGQ  1701
             IP +++ L ++ + WE +RG+ F YDGV LL+ML++Y +L+ ++E E++R RDQKK   Q
Sbjct  425   IPALVDTLVTKTRAWEEDRGISFTYDGVPLLAMLDEYAMLRHDREEEKRRLRDQKKFHEQ  484

Query  1702  LMAEQEVLFGSKRSPS-QSGKKNVVGGASNKRIS-VGGAMLQTPYTERAPLSSH------  1857
             L  EQE +FG+  SP+ Q G K VVG  +N   +   G  L  P  +    S +      
Sbjct  485   LSKEQEAMFGTTPSPARQVGVKKVVGPRANGGANGTAGRRLSLPAHQNGSRSINKDGKRD  544

Query  1858  SLKKINPVKQQALANITQNYVALSSGRRESSMHAKQP  1968
             S + I PV          NYVA+S     S +   +P
Sbjct  545   SSRPIAPV----------NYVAISKEDATSHISGTEP  571



>ref|XP_007020697.1| Microtubule-associated proteins 65-1 isoform 2, partial [Theobroma 
cacao]
 gb|EOY12222.1| Microtubule-associated proteins 65-1 isoform 2, partial [Theobroma 
cacao]
Length=528

 Score =   447 bits (1150),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 261/517 (50%), Positives = 376/517 (73%), Gaps = 12/517 (2%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             ETTC SLL +LQ+IW+E+GE + ERDKML Q+EQECL+ Y+RKV+QA++S AQL QA+++
Sbjct  13    ETTCGSLLQKLQEIWDEVGESDEERDKMLLQIEQECLDVYKRKVEQAAKSRAQLLQALSD  72

Query  463   SEAELARICAALGEQPVNV--RQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQI  636
             ++ EL+ + +ALG++       ++S ++K +L AI P LE++ K+K ER   FS+V  QI
Sbjct  73    AKLELSTLVSALGDKNFGGIPEKASGTIKEQLAAIAPALEQLWKQKEERVKDFSDVQSQI  132

Query  637   DSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESLNS  816
               +  E+  +  E     A+DESDLSL++L++ ++    LQKEKSDRL +VL+ + +++ 
Sbjct  133   QKICGEIAGNVSEQTGSPAVDESDLSLKKLDEYQAKFQELQKEKSDRLHKVLEFVSTVHD  192

Query  817   LCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHMLQNL  990
             LC VLG+DF +T+ E+HP+L DS+ +  KS+S +T+ RL+  +  L + K QRLH LQ L
Sbjct  193   LCAVLGMDFFSTVTEVHPSLDDSTGVQSKSISNDTLLRLAKTVSALNQDKKQRLHKLQEL  252

Query  991   ATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQEMK  1170
             AT +++LWNLMD P EE++LFD+VT  I+AS  E+T P AL+LDL++ AE+EV RL ++K
Sbjct  253   ATQLIDLWNLMDTPEEERKLFDHVTCNISASVDEVTVPGALALDLIEQAEVEVERLDQLK  312

Query  1171  SSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHLLEQLEIQISNV  1344
             SS+MKE+  K+++ LEE+  +AH+ ID     E     I+SG ++P+ LL  ++ QI+  
Sbjct  313   SSRMKEIAFKRQVELEEIFARAHIEIDPEAAREKIMSLIDSGNVEPAELLADMDNQIAKA  372

Query  1345  KEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVNKI  1524
             KEEA SRKEIL++VEKW++ACEEESWLEDYNR++NRYN  RG HL LKRAEKAR LVNKI
Sbjct  373   KEEALSRKEILDRVEKWMSACEEESWLEDYNRDENRYNASRGAHLNLKRAEKARILVNKI  432

Query  1525  PGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQGQL  1704
             PGM++ L ++ + WE +RG+ F YDGV LL+ML++Y +L+QE+E E++R RDQKK   Q 
Sbjct  433   PGMVDTLVAKTRAWEEDRGISFAYDGVPLLAMLDEYAMLRQEREEEKRRLRDQKKYHEQQ  492

Query  1705  MAEQEVLFGSKRSPSQ-SGKKNVVGGASNKRISVGGA  1812
               EQE +FGS+ SP++ +  K VVG  +N     GGA
Sbjct  493   NTEQEAIFGSRPSPARPANTKKVVGPRAN-----GGA  524



>emb|CAN73840.1| hypothetical protein VITISV_007561 [Vitis vinifera]
Length=623

 Score =   450 bits (1157),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 271/570 (48%), Positives = 386/570 (68%), Gaps = 20/570 (4%)
 Frame = +1

Query  292   CCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAESEA  471
             CC LL   Q IW+E+GE + ERDKML QLEQECL+ Y+RKVDQA +S A L QA+A+++ 
Sbjct  58    CCFLLVSKQ-IWDEVGESDEERDKMLLQLEQECLDVYKRKVDQAVKSRAHLLQALADAQL  116

Query  472   ELARICAALGEQP-VNV-RQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQIDSV  645
             EL+R+ +ALGE+  V +  ++S ++K +L AI P LE++ K+K ER  +FS+V  QI  +
Sbjct  117   ELSRLLSALGEKSFVGIPDKTSGTIKEQLAAIAPTLEQLWKQKEERVKEFSDVQTQIQKI  176

Query  646   LKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESLNSLCI  825
               E+      L  +  +DE+DLSL++L++ +  L  LQKEKSDRL +VL+ + +++ LC 
Sbjct  177   CGEIA-GNSNLSEVPVVDEADLSLKKLDEFQGQLQELQKEKSDRLHKVLEFVSTVHDLCA  235

Query  826   VLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHMLQNLATT  999
             VLG+DF +T+ E+HP+L DS+ +  KS+S +T+ RL+  +  L+E K QRL  LQ LAT 
Sbjct  236   VLGMDFFSTVTEVHPSLNDSTGVQSKSISNDTLSRLAKTVLALKEDKKQRLQKLQELATQ  295

Query  1000  IVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQEMKSSK  1179
             +++LWNLMD P EE+ LFD+VT  I+AS  E+T P AL+LDL++ AE+EV RL ++K+S+
Sbjct  296   LIDLWNLMDTPEEERSLFDHVTCNISASVDEVTIPGALALDLIEQAEVEVERLDQLKASR  355

Query  1180  MKEVLLKKRITLEELCRQAHLAIDDSIEFTD--ETIESGAIDPSHLLEQLEIQISNVKEE  1353
             MKE+  K++  LEE+  +AH+ ID           I+SG ++PS LL  ++ QI+  KEE
Sbjct  356   MKEIAFKRQAELEEIFARAHIEIDPEAARAKIMSLIDSGDVEPSELLADMDNQITKAKEE  415

Query  1354  AFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVNKIPGM  1533
             AFSRK+IL+KVEKW++ACEEESWLEDYNR++NRYN  RG HL LKRAEKAR LVNKIP +
Sbjct  416   AFSRKDILDKVEKWMSACEEESWLEDYNRDENRYNSSRGAHLNLKRAEKARILVNKIPAL  475

Query  1534  LEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQGQLMAE  1713
             ++ L ++   WE + G+PF YDGV LL+ML++Y +L+ ++E E++R RDQKK    L  E
Sbjct  476   VDTLVAKTGAWEEDHGIPFTYDGVPLLAMLDEYAMLRHDREEEKRRMRDQKKFHELLNTE  535

Query  1714  QEVLFGSKRSPSQS-GKKNVVGGASNKRISVGGAMLQTPYTERAPLSSHSLKKINPVKQQ  1890
             QE +FGS+ SP +  G K VVG  +N     GGA   TP + R  L+++     +  K  
Sbjct  536   QEAIFGSRPSPGRPLGPKKVVGPRAN-----GGAN-GTP-SRRLSLNANQNGARSTSKDG  588

Query  1891  ALANITQ----NYVALSSGRRESSMHAKQP  1968
                N       NYVA+S     S +   +P
Sbjct  589   KRDNTRPVAPVNYVAISKEDAASHVSGTEP  618



>ref|XP_002981583.1| hypothetical protein SELMODRAFT_21452, partial [Selaginella moellendorffii]
 gb|EFJ17398.1| hypothetical protein SELMODRAFT_21452, partial [Selaginella moellendorffii]
Length=569

 Score =   448 bits (1152),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 271/566 (48%), Positives = 393/566 (69%), Gaps = 20/566 (4%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             E+TC SLL ELQ IW+EIGE + ERD+ML QLEQECLE YRRKVDQAS   A+LRQA+A+
Sbjct  1     ESTCGSLLRELQHIWDEIGEDDTERDRMLMQLEQECLEVYRRKVDQASHVRAKLRQALAD  60

Query  463   SEAELARICAALGEQPVNVR---QSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQ  633
             SEAEL  + +ALGE P   R   ++S +L+ +++ + P LEE++ +K ER   F+E+  Q
Sbjct  61    SEAELQTLHSALGEHPTFTRGEKKASGTLREQVKGVAPQLEELRVKKDERLKHFNEISSQ  120

Query  634   IDSVLKEL-GKSRKELQHM-IALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLES  807
             I  +  E+ G +  +L +  I  +  DLS RRLE+ ++ L +LQKEKS+RL +VL+++ S
Sbjct  121   IQKISGEIVGSATSQLANGDIKAEFEDLSQRRLEEYQAQLHALQKEKSNRLHKVLEYVNS  180

Query  808   LNSLCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHML  981
             ++ LC  LG++F   I E+HP+L DS ++  +S++ ET++RL+  I  L E K +R+  L
Sbjct  181   VHDLCAELGLEFFKIITEVHPSLDDSHSVQSRSITNETLDRLANTIQSLEEEKKRRIKKL  240

Query  982   QNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQ  1161
             Q L T +V+LWNLM+ P EEQQLF ++T  +A+SE     P +L+ D+++ AE+EV RL+
Sbjct  241   QELGTKLVDLWNLMETPKEEQQLFRHLTCNVASSE---CVPGSLAFDIIEEAEVEVERLE  297

Query  1162  EMKSSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHLLEQLEIQI  1335
              +K+SKMKE++++KR+ LEE+CRQ H+  D+S   + T+  I+SG +DPS LL ++E QI
Sbjct  298   RLKASKMKELVMRKRLELEEICRQTHMEPDNSTSQDKTNALIDSGMVDPSELLSRIEEQI  357

Query  1336  SNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALV  1515
             +  KE+A SR++IL+K+E+W+ ACEEESWL+DYN++ NRY GGRG HL LKRAE+AR  V
Sbjct  358   AYAKEDAVSRRDILDKIERWMGACEEESWLDDYNKDQNRYAGGRGAHLNLKRAERARVTV  417

Query  1516  NKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQ  1695
              K+P ++E+L +R + WE ER   F+YDGV LL+MLE+Y LL+ E++ E++R RDQKKLQ
Sbjct  418   TKLPALVESLIARTRSWEEERSQLFMYDGVRLLAMLEEYNLLRHERDEEKRRMRDQKKLQ  477

Query  1696  GQLMAEQEVLFGSK-----RSPSQSGKKNVVGGASNKRISVGGAMLQTPYTERAPLSSHS  1860
              QL+ EQE +FGSK     RS S    +    G  ++R+S+GGA+LQ    E    + H 
Sbjct  478   DQLLTEQESIFGSKPSSTPRSSSIKKAQPRSNGMMSRRLSLGGALLQPVSPETPRTNGHR  537

Query  1861  LKK---INPVKQQALANITQNYVALS  1929
             L      N    + LA +  N+VA+S
Sbjct  538   LSTPGGNNRRDSRPLATVPLNFVAVS  563



>ref|XP_002963209.1| hypothetical protein SELMODRAFT_21497, partial [Selaginella moellendorffii]
 gb|EFJ35080.1| hypothetical protein SELMODRAFT_21497, partial [Selaginella moellendorffii]
Length=570

 Score =   447 bits (1151),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 271/567 (48%), Positives = 393/567 (69%), Gaps = 21/567 (4%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             E+TC SLL ELQ IW+EIGE + ERD+ML QLEQECLE YRRKVDQAS   A+LRQA+A+
Sbjct  1     ESTCGSLLRELQHIWDEIGEDDTERDRMLMQLEQECLEVYRRKVDQASHVRAKLRQALAD  60

Query  463   SEAELARICAALGEQPVNVR----QSSRSLKTELQAIMPlleemkkrklerkHQFSEVLD  630
             SEAEL  + +ALGE P   R    ++S +L+ +++ + P LEE++ +K ER   F+E+  
Sbjct  61    SEAELQTLHSALGEHPTFTRVSPSKASGTLREQVKGVAPQLEELRVKKDERLKHFNEISS  120

Query  631   QIDSVLKEL-GKSRKELQHM-IALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLE  804
             QI  +  E+ G +  +L +  I  +  DLS RRLE+ ++ L +LQKEKS+RL +VL+++ 
Sbjct  121   QIQKISGEIVGSATSQLANGDIKAEFEDLSQRRLEEYQAQLHALQKEKSNRLHKVLEYVN  180

Query  805   SLNSLCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHM  978
             S++ LC  LG++F   I E+HP+L DS ++  +S++ ET++RL+  I  L E K +R+  
Sbjct  181   SVHDLCAELGLEFFKIITEVHPSLDDSHSVQSRSITNETLDRLANTIQSLEEEKKRRIKK  240

Query  979   LQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRL  1158
             LQ L T +V+LWNLM+ P EEQQLF ++T  +A+SE     P +L+ D+++ AE+EV RL
Sbjct  241   LQELGTKLVDLWNLMETPKEEQQLFRHLTCNVASSE---CVPGSLAFDIIEEAEVEVERL  297

Query  1159  QEMKSSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHLLEQLEIQ  1332
             + +K+SKMKE++++KR+ LEE+CRQ H+  D+S   + T+  I+SG +DPS LL ++E Q
Sbjct  298   ERLKASKMKELVMRKRLELEEICRQTHMEPDNSTSQDKTNALIDSGMVDPSELLSRIEEQ  357

Query  1333  ISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARAL  1512
             I+  KE+A SR++IL+K+E+W+ ACEEESWL+DYN++ NRY GGRG HL LKRAE+AR  
Sbjct  358   IAYAKEDAVSRRDILDKIERWMGACEEESWLDDYNKDQNRYAGGRGAHLNLKRAERARVT  417

Query  1513  VNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKL  1692
             V K+P ++E+L +R + WE ER   F+YDGV LL+MLE+Y LL+ E++ E++R RDQKKL
Sbjct  418   VTKLPALVESLIARTRSWEEERSQLFMYDGVRLLAMLEEYNLLRHERDEEKRRMRDQKKL  477

Query  1693  QGQLMAEQEVLFGSK-----RSPSQSGKKNVVGGASNKRISVGGAMLQTPYTERAPLSSH  1857
             Q QL+ EQE +FGSK     RS S    +    G  ++R+S+GGA+LQ    E    + H
Sbjct  478   QDQLLTEQESIFGSKPSSTPRSSSIKKAQPRSNGMMSRRLSLGGALLQPVSPETPRTNGH  537

Query  1858  SLKK---INPVKQQALANITQNYVALS  1929
              L      N    + LA +  N+VA+S
Sbjct  538   RLSTPGGNNRRDSRPLATVPLNFVAVS  564



>ref|XP_009398767.1| PREDICTED: 65-kDa microtubule-associated protein 1-like [Musa 
acuminata subsp. malaccensis]
Length=586

 Score =   448 bits (1152),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 270/535 (50%), Positives = 381/535 (71%), Gaps = 17/535 (3%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             ETTC SLL +LQ IW+E+GE + ERD+ML QLEQECLE Y+RKV+QAS++   L Q++A+
Sbjct  13    ETTCGSLLQQLQLIWDEVGESDEERDRMLLQLEQECLEVYKRKVEQASKTRVLLLQSLAD  72

Query  463   SEAELARICAALGEQPVNV--RQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQI  636
             S+AEL R+ +ALGE+  +    +SS ++K +L AI PLLE++ K+K +R  +F++V  QI
Sbjct  73    SKAELLRLLSALGEKSFDGIPDKSSGTIKEQLAAIAPLLEQLCKQKEDRIREFADVQLQI  132

Query  637   DSVLKELGKSR--KELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESL  810
             + +  E+  +    E      +DE DLSL++L++ +  L  LQKEKSDRL ++LD + ++
Sbjct  133   EKIRGEIAGTSIIGEQMRTPTVDEEDLSLKKLDEYQQQLQELQKEKSDRLHKILDFVSTV  192

Query  811   NSLCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHMLQ  984
             + LC VLG+DF +TI E+HP+L DS ++  KS+S +T+ +LS  +  L+E K  RL  LQ
Sbjct  193   HDLCAVLGLDFFSTITEVHPSLNDSVSVQSKSISNDTLSKLSGMVMVLKEDKKMRLKKLQ  252

Query  985   NLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQE  1164
              LA  + +LWNLMD P+EEQ LF +VT  ++A+  E+T P AL+LDL++ AE+EV RL +
Sbjct  253   ELAAQLTDLWNLMDTPMEEQSLFSHVTSNMSATVDEVTVPGALALDLIEQAEVEVERLDQ  312

Query  1165  MKSSKMKEVLLKKRITLEELCRQAHLAIDDSIEFTDET---IESGAIDPSHLLEQLEIQI  1335
             +K+SKMKE+  KK+  LE++   AH+ ID S    D+    I+SG ++PS LL +++ QI
Sbjct  313   LKASKMKEIAFKKQTELEDIYTHAHVDID-SAAARDKILALIDSGNVEPSDLLAEMDNQI  371

Query  1336  SNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALV  1515
                KEEA SRKEILEKVEKW++ACEEESWLEDYNR+DNRYN  RG HL LKRAEKAR LV
Sbjct  372   LKAKEEAMSRKEILEKVEKWMSACEEESWLEDYNRDDNRYNSSRGAHLNLKRAEKARVLV  431

Query  1516  NKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQ  1695
             NKIP +++ L ++ + WE +RG+PF YDGV LL+ML++Y +L+QE+E E+++QRDQK++ 
Sbjct  432   NKIPALVDMLVAKTRTWEEDRGMPFTYDGVPLLAMLDEYTMLRQEREGEKRKQRDQKRIH  491

Query  1696  GQLMAEQEVLFGSKRSPSQS-GKKNVVGGASNKRISVGGAMLQTPYTERAPLSSH  1857
              QL  EQE LFGS+ SP++  G K VVG   N   S G     TP + R  L++H
Sbjct  492   EQLATEQEALFGSRPSPARPLGPKKVVGPRPNGSTSNG-----TP-SRRLSLNAH  540



>ref|XP_006346185.1| PREDICTED: 65-kDa microtubule-associated protein 1-like [Solanum 
tuberosum]
Length=581

 Score =   447 bits (1150),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 270/572 (47%), Positives = 387/572 (68%), Gaps = 19/572 (3%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             ETTC +LL +LQ+IW+E+GE + ERDKML Q++QECL+ Y+RKVD A +S A L QA+A+
Sbjct  14    ETTCGTLLQKLQQIWDEVGETDDERDKMLLQIDQECLDVYKRKVDHAVKSRAHLLQALAD  73

Query  463   SEAELARICAALGEQP-VNV-RQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQI  636
             ++ EL+R+ +ALGE+  V +  ++S ++K +L AI P LE++ K+K +R   F +V  QI
Sbjct  74    AKVELSRLLSALGEKTYVGIPEKTSGTIKEQLAAIAPTLEKLWKQKDDRIKDFFDVQSQI  133

Query  637   DSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESLNS  816
               +  E+    ++++ +  +DESDLS+++L++    L  LQKEKSDRL +VLD + +++ 
Sbjct  134   QKISSEIAGDSEQVESL-TVDESDLSVKKLDEFHVQLQELQKEKSDRLHKVLDLVSTVHD  192

Query  817   LCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHMLQNL  990
             LC VLG+DF +T+ E+HP+L DS+ +  KS+S +T+  L+  +  L+E K QRL  LQ L
Sbjct  193   LCAVLGMDFFSTVTEVHPSLDDSTGVQSKSISNDTLSNLANTVLVLKEDKKQRLLKLQEL  252

Query  991   ATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQEMK  1170
             AT +++LWNLMD P EE+ LFD+VT  I+AS  E+  P AL+LDL++ AE+EV RL ++K
Sbjct  253   ATQLIDLWNLMDTPEEERSLFDHVTCNISASVDEVAIPGALALDLIEQAEVEVERLDQLK  312

Query  1171  SSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHLLEQLEIQISNV  1344
             +SKMKE+  K++  LE++  +AH+ ID     E     I+SG +DP+ LL  ++ QI N 
Sbjct  313   ASKMKEISFKRQAELEDIYARAHVEIDTEAAREKIMGLIDSGNVDPAELLADMDNQIVNA  372

Query  1345  KEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVNKI  1524
             KEEA SRKEILEKVEKW+AACEEESWLEDYNR+DNRYN  RG HL LKRAEKAR LVNKI
Sbjct  373   KEEAHSRKEILEKVEKWMAACEEESWLEDYNRDDNRYNASRGAHLNLKRAEKARILVNKI  432

Query  1525  PGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQGQL  1704
             P ++++L ++ + WE ER   F YDGV LL+ML++Y +L+ ++E E++R RDQKK   Q+
Sbjct  433   PALVDSLVAKTRAWEQERDTTFTYDGVPLLAMLDEYMMLRHDREEEKRRLRDQKKFHEQM  492

Query  1705  MAEQEVLFGSKRSPSQS-GKKNVVGGASNKRISVGGAMLQTPYTERAPLSSH---SLKKI  1872
               + EV FGS  SP +  G K V G  +N     G A    P + R  L+SH   S    
Sbjct  493   SKDPEV-FGSTPSPVRPLGPKKVTGPRAN-----GSA--NGPASRRLSLNSHQNGSRSTS  544

Query  1873  NPVKQQALANITQNYVALSSGRRESSMHAKQP  1968
                K+ A  +   NYVA++     S +   +P
Sbjct  545   KDGKRDARLSAPVNYVAMTKDDAASHISGTEP  576



>ref|XP_006445240.1| hypothetical protein CICLE_v10019629mg [Citrus clementina]
 gb|ESR58480.1| hypothetical protein CICLE_v10019629mg [Citrus clementina]
Length=539

 Score =   444 bits (1143),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 269/539 (50%), Positives = 363/539 (67%), Gaps = 32/539 (6%)
 Frame = +1

Query  790   LDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQR  969
             + HL ++NSLC+VLG+DFK+T+ +IHPTL D  A K VS +TIE+++  I  L+EVKIQR
Sbjct  1     MKHLSNVNSLCMVLGLDFKDTVCKIHPTLNDPKASKDVSNDTIEKMATTIQSLQEVKIQR  60

Query  970   LHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEV  1149
             +  LQ+LAT++VELWNLMD P+EEQ++F N+T  IAA E E+TEPN LS++ +K  E EV
Sbjct  61    MQKLQHLATSLVELWNLMDTPLEEQEMFHNITSKIAALEPEITEPNFLSMNNIKYVEGEV  120

Query  1150  SRLQEMKSSKMKEVLLKKRITLEELCRQAHLAIDDSIEFTDETIESGAIDPSHLLEQLEI  1329
             SRL+++KSSKMKE++LKK++ L E+ R+ H   +   +F+ E IESG++D   LLEQ+++
Sbjct  121   SRLEQLKSSKMKELVLKKKLELAEILRKMHTVTETVGDFSIEAIESGSMDFMDLLEQIDL  180

Query  1330  QISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARA  1509
             QI+  KEEA SRKEILEKVEKW  A EEESWLE+YNR+DNRYN GRG+HL LKRAEKAR 
Sbjct  181   QIAKAKEEASSRKEILEKVEKWFTAREEESWLEEYNRDDNRYNAGRGSHLSLKRAEKARV  240

Query  1510  LVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKK  1689
             LVNKIP M+EALT +   WE E G  F YDGV L+SMLE Y  ++QEKELERQRQ+D +K
Sbjct  241   LVNKIPAMVEALTCKVTAWEKETGTEFSYDGVRLISMLEDYSCMRQEKELERQRQKDHRK  300

Query  1690  LQGQLMAEQEVLFGSKRSPSQSGKK---NVVGGASNKRISVGGAMLQTPYTERAPLSSHS  1860
             LQ QL+AEQE ++GSK SPS+SG+K    + G ASN+++S+GG MLQ    E+  L  HS
Sbjct  301   LQVQLIAEQEAIYGSKPSPSKSGRKTSTTLTGIASNRKLSLGGVMLQNLKPEKEALCVHS  360

Query  1861  LKKINPVKQQALANITQNY-VALSSGRRESSM--HAKQPSCNK--SNLQKTEP-TQRKPL  2022
              KKI+ + + +     Q+  +A  SGRR S +  +    SC+   +  +K E  + RKPL
Sbjct  361   NKKIDGLYRNSPFGRPQSVSLAAGSGRRNSEIPGNVVNKSCSSVAAKARKVESKSARKPL  420

Query  2023  SPIS-SLSFNTSSANIMD---KISESEELREMPASLLTTPIKNVSGIG-GNATPKtmpip  2187
             SP+S ++S   + AN ++   +      L+ +P S+  TP K +     GN  P TMP  
Sbjct  421   SPVSLAISSKANIANFLEDKKRTHNGTSLKAVP-SVAVTPSKQIVACNEGNKAPNTMPSV  479

Query  2188  mpstpasaassiamQMGMTPAPVAATTPMVG---------HDGVEYSYEEMRAGFLLPR  2337
               +     A  +   M MTPA     TP V           D +EYS+EE+RAGF+ P+
Sbjct  480   PKTPSTFTAPML---MAMTPA-----TPCVSLGAKANERTGDKIEYSFEEVRAGFICPK  530



>ref|XP_010227508.1| PREDICTED: 65-kDa microtubule-associated protein 1-like [Brachypodium 
distachyon]
Length=580

 Score =   446 bits (1146),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 262/560 (47%), Positives = 381/560 (68%), Gaps = 24/560 (4%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             ETTC SLL +LQ IW+E+GE + +RDKML QLEQECL+ YRRKVDQAS S A+L Q +A 
Sbjct  13    ETTCGSLLQKLQLIWDEVGESDDDRDKMLLQLEQECLDVYRRKVDQASTSRARLLQQLAN  72

Query  463   SEAELARICAALGEQPVNV----RQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLD  630
             S++EL R+ ++LGE  ++      +++ ++K +L A  P LE++ ++K +R  +F++V  
Sbjct  73    SKSELTRLLSSLGELSISGVIIPDKTTGTIKEQLAATSPFLEQLCQKKEKRVKEFADVQL  132

Query  631   QIDSVLKELGKSRKELQH--MIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLE  804
             QI ++  E+  S +   H  M  +DE DLS+++L +    L +LQKEKS+RL+++LD + 
Sbjct  133   QIQTIRGEIAGSLQVGDHLEMPHVDEDDLSMKKLNEYLFELQALQKEKSNRLQKILDFVS  192

Query  805   SLNSLCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHM  978
             S++ LC VLG+DF +T+  +HP+L DS     KS+S ETI RLS  + EL+E K++RL  
Sbjct  193   SVHDLCSVLGMDFLSTVTAVHPSLNDSVGADSKSISDETISRLSKMVIELKEEKVKRLDK  252

Query  979   LQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRL  1158
             +Q LA+ + +LWNLMD  VEE+Q FD+VT  ++++   +T P AL+LD+++ AE+EV RL
Sbjct  253   IQALASQLTDLWNLMDTTVEERQHFDHVTCHMSSTSDRVTVPGALALDVIEQAELEVERL  312

Query  1159  QEMKSSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHLLEQLEIQ  1332
              ++K+S+MK++  K++  LE++  +AH+A+D S   +     I+S   +PS LL  +E Q
Sbjct  313   DQLKASRMKDIAFKRQTELEDIYARAHIAVDTSAARDRILSVIDSSMFEPSELLADMENQ  372

Query  1333  ISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARAL  1512
             I   KEEAFSRK+ILEKV++W+ ACEEESWLEDYNR+DNRY+  RG HL LKRAEKAR L
Sbjct  373   ILKAKEEAFSRKDILEKVDRWMLACEEESWLEDYNRDDNRYSATRGAHLNLKRAEKARVL  432

Query  1513  VNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKL  1692
             VNKIPG+++ L ++   WE E    F YDG++LL+ML++Y +L+QEKE E++R RDQKK+
Sbjct  433   VNKIPGIVDTLVTKTHAWEKEHRTTFTYDGIALLAMLDEYRILRQEKEEEKRRMRDQKKI  492

Query  1693  QGQLMAEQEVLFGSKRSPS--QSGKKNVVG---------GASNKRISVGGAMLQTPYTER  1839
               QL AEQE LFGSK SP+  QS  K   G         G  N+R+S   A+   P +  
Sbjct  493   NDQLAAEQEKLFGSKPSPARPQSSTKKAAGPRANGAAVNGTPNRRLS---ALQNNPRSAS  549

Query  1840  APLSSHSLKKINPVKQQALA  1899
                   +++ + PV   ALA
Sbjct  550   RDGGRDNVRPVAPVNYVALA  569



>ref|XP_006851756.1| hypothetical protein AMTR_s00040p00225910 [Amborella trichopoda]
 gb|ERN13223.1| hypothetical protein AMTR_s00040p00225910 [Amborella trichopoda]
Length=730

 Score =   451 bits (1159),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 302/736 (41%), Positives = 444/736 (60%), Gaps = 47/736 (6%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M + Q D   + E    SL  ELQ IW+E+G+P  +R+K L ++EQECLE YR+KVD  +
Sbjct  1     MTDLQRDGLEQPEPPWASLFHELQMIWDEVGKPRNDREKTLGEIEQECLEVYRKKVDHEN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQP---VNVRQSSRSLKTELQAIMPlleemkkrkl  597
                AQLRQ  A+++AELA ICAA+GE+P   +   Q    L  +L   +  L+EM+ RK 
Sbjct  61    CFRAQLRQTTADAQAELASICAAMGERPTLQIQPEQKLGGLLEDLNCTLSQLDEMRMRKS  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
              R  +F +++ QI  +  E+  S K    M+++DE DLSLR+L+D    L +L+KEKSDR
Sbjct  121   NRVQKFMDIMAQIQMLSDEINDSVKCDHPMVSVDEKDLSLRKLDDCIRKLETLRKEKSDR  180

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             +K VL +L +L S C VLGIDF +T+ E++P+L DS+    ++ +TIE+L      L++V
Sbjct  181   VKLVLGYLSTLKSTCSVLGIDFLHTVREVYPSLNDSAGSTCINHDTIEKLGTLTDRLQKV  240

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             K QR+  LQ+ ATT+++LWNL+D P+EEQQ F + T  IAASE E+ EPN+LS D +   
Sbjct  241   KRQRMKKLQDYATTMLQLWNLLDTPIEEQQPFQDTTSNIAASEHEMIEPNSLSKDSIHQV  300

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHL  1311
             E EV RL+E+K S+MKE+ LKK++ LEE+ +++H+  +  I  EF+  +IESG ++PS L
Sbjct  301   ESEVIRLEELKGSRMKELALKKQLDLEEIYQKSHMLAETDIESEFSVASIESGMVNPSAL  360

Query  1312  LEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKR  1491
             L+ +E +I+N KEEA SRKEI+E VEKW AA  EESWLE YN+++ RYN G+G HL LK 
Sbjct  361   LDIMEDRIANAKEEALSRKEIIELVEKWHAARVEESWLEAYNKDEKRYNTGKGMHLTLKH  420

Query  1492  AEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQR  1671
             AE+AR +V+K+PGM+++L ++   WE ERG  F+YDGV L++++E+Y ++KQEKE E++R
Sbjct  421   AERARIIVSKLPGMVDSLIAKTSVWERERGKEFMYDGVPLITVMEEYRIMKQEKEQEQRR  480

Query  1672  QRDQKKLQGQLMAEQEVLFGSKRS---PSQS----GKKNVVGGASNKRISVG--------  1806
             +++QK+ QGQ   EQEVLFGSK S   P  +     K        N R+S+G        
Sbjct  481   KKEQKRRQGQQTKEQEVLFGSKPSLVKPQSARDTPNKHRPNSTTPNGRLSLGVTSSNNPI  540

Query  1807  GAMLQTPYTERAPLSSHSL------KKINPVKQQALAN-ITQNYVALSSG------RRES  1947
                LQ+P       S+H +      +K+  +   + +N I Q   A  +G      RR  
Sbjct  541   PGGLQSPKATTV-ASTHGVTPRSEGRKLPKIDDISTSNQIYQCLAAQGNGSSTQLSRRPF  599

Query  1948  SMHAKQPSCNKSNLQKTEPTQRKPLSPISSLSFNTSSANIMDKISESEELREMPASLLTT  2127
             S   K+P     + ++T+ T  K     +S  F  S  +  +  S+ EELR       TT
Sbjct  600   SPRLKKPP---DDFKRTDHTSPK---DTASTKFPASKVSKQNNTSK-EELRSPNLKSNTT  652

Query  2128  PIKNVSGIGGNATPKtmpipmpstpasaassiamQMG----MTPAPVAATTPMVGHDGVE  2295
                + S +  +   +    P   +     S +  Q       +   + A++P V H  VE
Sbjct  653   STNSASVVCIHMQTQKTVAPFQISSQMTTSQMQTQTASANLFSGTNMVASSPKVPH--VE  710

Query  2296  YSYEEMRAGFLLPRLH  2343
             YS+EE+RAGF+LP LH
Sbjct  711   YSFEEIRAGFVLPDLH  726



>ref|XP_010252611.1| PREDICTED: 65-kDa microtubule-associated protein 1 [Nelumbo nucifera]
Length=585

 Score =   446 bits (1146),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 272/535 (51%), Positives = 378/535 (71%), Gaps = 18/535 (3%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             E TC SLL +LQ+IW+E+GE + ERDKML QLEQECL+ Y+RKVDQA++S AQL QA+A+
Sbjct  13    EITCGSLLHQLQQIWDEVGESDEERDKMLLQLEQECLDVYKRKVDQAAKSRAQLLQALAD  72

Query  463   SEAELARICAALGEQP-VNV-RQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQI  636
             +++EL+ + +ALGE+  V V  ++S ++K +L AI P+LE++ K+K ER  +FS+V  QI
Sbjct  73    AKSELSSLLSALGEKTFVGVPEKTSGTIKEQLAAIAPVLEQLCKQKEERIKEFSDVQLQI  132

Query  637   DSVLKELGKSRKELQHMIA---LDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLES  807
               +  E+  + K L   I    +DESDLSL++ ++  + L  LQKEK+DRL +VLD + +
Sbjct  133   QKICGEIAGNLK-LSEQIGTPVVDESDLSLKKFDEFHAQLQELQKEKADRLHKVLDFVST  191

Query  808   LNSLCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHML  981
             ++ LC VLGIDF +TI E+HP+L DS  +  KS+S +T+ RL+  +  L+E K QRL  L
Sbjct  192   VHDLCAVLGIDFFSTITEVHPSLDDSIGVQSKSISNDTLARLAKTVLALKEDKKQRLLKL  251

Query  982   QNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQ  1161
             Q LA  + +LWNLMD P EE+ LFD+VT  I+AS  E+  P AL+LDL++ AE+EV RL 
Sbjct  252   QELAAQLSDLWNLMDTPNEERSLFDHVTCNISASVDEVIVPGALALDLIEQAEVEVERLD  311

Query  1162  EMKSSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHLLEQLEIQI  1335
             ++K+S+MKE+  KK+  LEE+  +AH+ ID     E     I+SG I+PS LL  ++ QI
Sbjct  312   QLKASRMKEIAFKKQAELEEIFARAHIEIDSDAAREKIMALIDSGNIEPSELLADMDNQI  371

Query  1336  SNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALV  1515
                KEEA SRKEIL+KVEKW+++CEEESWLEDYNR+DNRYN  RG H+ LKRAEKAR LV
Sbjct  372   LKAKEEALSRKEILDKVEKWMSSCEEESWLEDYNRDDNRYNSSRGAHINLKRAEKARILV  431

Query  1516  NKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQ  1695
             NKIP +++ L ++ + WE +RG+ F YDGV LL+ML++Y +L+ ++E E++R RDQK+  
Sbjct  432   NKIPALVDTLVAKTQAWEEDRGMSFTYDGVPLLAMLDEYAMLRHDREEEKRRMRDQKRFH  491

Query  1696  GQLMAEQEVLFGSKRSPSQS-GKKNVVGGASNKRISVGGAMLQTPYTERAPLSSH  1857
              QL  EQE +FGS+ SPS+  G K VVG  SN      G    TP + R  L+SH
Sbjct  492   EQLNTEQEAIFGSRPSPSRPLGPKKVVGPRSN------GVTSNTP-SRRLSLNSH  539



>ref|NP_001265928.1| Hop-interacting protein THI016 [Solanum lycopersicum]
 ref|XP_010324188.1| PREDICTED: hop-interacting protein THI016 isoform X1 [Solanum 
lycopersicum]
 gb|AEW69788.1| Hop-interacting protein THI016 [Solanum lycopersicum]
Length=581

 Score =   445 bits (1144),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 269/572 (47%), Positives = 387/572 (68%), Gaps = 19/572 (3%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             ETTC +LL +LQ+IW+E+GE + ERDKML Q++QECL+ Y+RKVD A +S A L QA+A+
Sbjct  14    ETTCGTLLQKLQQIWDEVGETDDERDKMLLQIDQECLDVYKRKVDHAVKSRAHLLQALAD  73

Query  463   SEAELARICAALGEQP-VNV-RQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQI  636
             ++ EL+R+ +ALGE+  V +  ++S ++K +L AI P LE++ K+K +R   F +V  QI
Sbjct  74    AKVELSRLLSALGEKTYVGIPEKTSGTIKEQLAAIAPTLEKLWKQKDDRIKDFFDVQSQI  133

Query  637   DSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESLNS  816
               +  E+    ++++ +  +DESDLS+++L++    L  LQKEKSDRL +VLD + +++ 
Sbjct  134   QKISSEIAGYSEQVESL-TVDESDLSVKKLDEFHVQLQELQKEKSDRLHKVLDLVSTVHD  192

Query  817   LCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHMLQNL  990
             LC VLG+DF +T+ E+HP+L DS+ +  KS+S +T+  L+  +  L+E K QRL  LQ L
Sbjct  193   LCAVLGMDFFSTVTEVHPSLDDSTGVQSKSISNDTLSNLANTVLVLKEDKKQRLLKLQEL  252

Query  991   ATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQEMK  1170
             AT +++LWNLMD P EE+ LFD+VT  I+AS  E+  P AL+LDL++ AE+EV RL ++K
Sbjct  253   ATQLIDLWNLMDTPEEERSLFDHVTCNISASVDEVAIPGALALDLIEQAEVEVERLDQLK  312

Query  1171  SSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHLLEQLEIQISNV  1344
             +SKMKE+  K++  LE++  +AH+ ID     E     I+SG +DP+ LL  ++ QI   
Sbjct  313   ASKMKEISFKRQAELEDIYARAHVEIDTEAAREKIMGLIDSGNVDPAELLADMDNQIVIA  372

Query  1345  KEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVNKI  1524
             KEEA SRKEILEKVEKW+AACEEESWLEDYNR+DNRYN  RG HL LKRAEKAR LVNKI
Sbjct  373   KEEAHSRKEILEKVEKWMAACEEESWLEDYNRDDNRYNASRGAHLNLKRAEKARILVNKI  432

Query  1525  PGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQGQL  1704
             P ++++L ++ + WE ER   F YDGV LL+ML++Y +L+ ++E E++R RDQKK   Q+
Sbjct  433   PALVDSLVAKTRAWEQERDTTFTYDGVPLLAMLDEYMMLRHDREEEKRRLRDQKKFHEQM  492

Query  1705  MAEQEVLFGSKRSPSQS-GKKNVVGGASNKRISVGGAMLQTPYTERAPLSSH---SLKKI  1872
               + EV FGS  SP++  G K V G  +N     G A    P + R  L+SH   S    
Sbjct  493   SKDPEV-FGSTPSPARPLGSKKVTGPRAN-----GSA--NGPASRRLSLNSHQNGSRSTS  544

Query  1873  NPVKQQALANITQNYVALSSGRRESSMHAKQP  1968
                K+ A  +   NYVA++     S +   +P
Sbjct  545   KDGKKDARLSAPVNYVAMTKDDAASHISGTEP  576



>gb|ACN85253.1| microtubule-associated protein MAP65-1a [Oryza officinalis]
Length=581

 Score =   443 bits (1139),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 256/531 (48%), Positives = 372/531 (70%), Gaps = 21/531 (4%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             ETTC SLL +LQ IW+E+GE + +RDKML QLEQECL+ YRRKVDQAS S A+L Q +A 
Sbjct  13    ETTCGSLLQQLQLIWDEVGESDEDRDKMLLQLEQECLDVYRRKVDQASNSRARLLQQLAN  72

Query  463   SEAELARICAALGEQPVNV--RQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQI  636
             +++EL+R+  ALGE  ++    +++ ++K +L+AI P LE++ + K +R  +F++V  QI
Sbjct  73    AKSELSRLLCALGELSISGIPDKTTGTIKEQLEAISPFLEKLCREKDKRVREFADVQLQI  132

Query  637   DSVLKELGKSRKELQHM--IALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESL  810
              ++  E+  S +   HM    ++E DLS ++L +  S L +LQKEKS+RL ++LD + S+
Sbjct  133   QTIRGEIAGSLQVGDHMETPCVNEDDLSTKKLNEFLSELQALQKEKSNRLHKILDFVSSV  192

Query  811   NSLCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHMLQ  984
             + LC VLG+DF +T+ E+HP+L DS     KS+S  T+ +LS  + +L+E K +RL  +Q
Sbjct  193   HDLCSVLGMDFLSTVTEVHPSLNDSVGAESKSISDATLSKLSKMVIQLKEEKSKRLEKIQ  252

Query  985   NLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQE  1164
              LA+ + +LWNLMD   EEQ+LFD+VT  ++++  E+T P AL LDL++ AE+EV RL +
Sbjct  253   ALASQLTDLWNLMDTSAEEQRLFDHVTCNMSSTLDEVTAPGALDLDLIEQAELEVERLDQ  312

Query  1165  MKSSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHLLEQLEIQIS  1338
             +K+S+MK++  K++  LE++  QAH+AID S   +     I+S   +PS LL  +E QI 
Sbjct  313   LKASRMKDIAFKRQTELEDIYAQAHIAIDTSAARDRILTVIDSTIFEPSELLADMENQIL  372

Query  1339  NVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVN  1518
               KEEA SRK+ILEKVE+W++ACEEESWLEDY+++DNRY+  RG HL LKRAEKAR LV+
Sbjct  373   KAKEEALSRKDILEKVERWMSACEEESWLEDYSQDDNRYSATRGAHLNLKRAEKARLLVS  432

Query  1519  KIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQG  1698
             KIP +++ L ++ + WE + G+PF YDGV LL+ML++Y +L+Q+KE E++R RDQKK+  
Sbjct  433   KIPAIVDTLMAKTRAWEQDHGMPFTYDGVHLLAMLDEYKILRQQKEEEKRRMRDQKKIND  492

Query  1699  QLMAEQEVLFGSKRSPS--QSGKK--------NVVGGASNKRISV---GGA  1812
             QL AEQE LFGSK SP+  QS +K            G  N+R+SV   GG 
Sbjct  493   QLAAEQEKLFGSKPSPARPQSSRKAPGPRANGGAASGTPNRRLSVHQNGGG  543



>gb|ACN85226.1| microtubule-associated protein MAP65-1a [Oryza punctata]
Length=580

 Score =   441 bits (1135),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 258/531 (49%), Positives = 373/531 (70%), Gaps = 21/531 (4%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             ETTC SLL +LQ IW+E+GE + +RDKML QLEQECL+ YRRKVDQAS S A+L Q +A 
Sbjct  13    ETTCGSLLQQLQLIWDEVGESDEDRDKMLLQLEQECLDVYRRKVDQASNSRARLLQQLAN  72

Query  463   SEAELARICAALGEQPVNV--RQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQI  636
             +++EL+R+  ALGE  V+    +++ ++K +L+AI P LE++ + K +R  +F++V  QI
Sbjct  73    AKSELSRLLCALGELSVSGIPDKTTGTIKEQLEAISPFLEKLCREKDKRIREFADVQLQI  132

Query  637   DSVLKELGKSRKELQHMIA--LDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESL  810
              ++  E+  S +   HM    ++E DLS ++L +  S L +LQKEKS+RL ++LD + S+
Sbjct  133   QTICGEIAGSLQVGDHMETPRVNEDDLSTKKLNEFLSELQALQKEKSNRLHKILDFVSSV  192

Query  811   NSLCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHMLQ  984
             + LC VLG+DF +T+ E+HP+L DS     KS+S  T+ +LS  + +L+E K +RL  +Q
Sbjct  193   HDLCSVLGMDFLSTVTEVHPSLNDSVGAESKSISDATLSKLSKMVIQLKEEKSKRLEKIQ  252

Query  985   NLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQE  1164
              LA+ + +LWNLMD  VEE++LFD+VT  ++++  E+T P AL LDL++ A +EV RL +
Sbjct  253   ALASQLTDLWNLMDTSVEERRLFDHVTCNMSSTLDEVTAPGALDLDLIQQAGLEVERLDQ  312

Query  1165  MKSSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHLLEQLEIQIS  1338
             +K+S+MK++  K++  LE++  QAH+AID S   +     I+S   +PS LL  +E QI 
Sbjct  313   LKASRMKDIAFKRQAELEDIYAQAHIAIDTSAARDRILTVIDSSIFEPSELLADMENQIL  372

Query  1339  NVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVN  1518
               KEEA SRK+ILEKVE+W++ACEEESWLEDY+++DNRY+  RG HL LKRAEKAR LV+
Sbjct  373   KAKEEALSRKDILEKVERWMSACEEESWLEDYSQDDNRYSATRGAHLNLKRAEKARLLVS  432

Query  1519  KIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQG  1698
             KIP +++ L ++ + WE E G+PF YDGV LL+ML++Y +L+Q+KE E++R RDQKK+  
Sbjct  433   KIPVIVDTLMAKTRAWEQEHGMPFSYDGVHLLAMLDEYKVLRQQKEEEKRRMRDQKKIND  492

Query  1699  QLMAEQEVLFGSKRSPS--QSGKK--------NVVGGASNKRISV---GGA  1812
             QL AEQE LFGSK SP+  QS +K          V G  N+R+SV   GG 
Sbjct  493   QLAAEQEKLFGSKPSPARPQSSRKVPGPRANGGTVSGTPNRRLSVHQNGGG  543



>ref|XP_010270085.1| PREDICTED: 65-kDa microtubule-associated protein 1-like [Nelumbo 
nucifera]
 ref|XP_010270086.1| PREDICTED: 65-kDa microtubule-associated protein 1-like [Nelumbo 
nucifera]
 ref|XP_010270087.1| PREDICTED: 65-kDa microtubule-associated protein 1-like [Nelumbo 
nucifera]
 ref|XP_010270088.1| PREDICTED: 65-kDa microtubule-associated protein 1-like [Nelumbo 
nucifera]
 ref|XP_010270089.1| PREDICTED: 65-kDa microtubule-associated protein 1-like [Nelumbo 
nucifera]
Length=585

 Score =   441 bits (1135),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 267/577 (46%), Positives = 390/577 (68%), Gaps = 24/577 (4%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             E TC SLL +LQ+IW+E+GE E ERDKML QLEQECL+ Y+RKVDQA++S  QL QA+ +
Sbjct  13    EITCGSLLQKLQQIWDEVGESEEERDKMLLQLEQECLDVYKRKVDQAAKSREQLLQALDD  72

Query  463   SEAELARICAALGEQPVN--VRQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQI  636
             +++EL+ + +ALGE+       +++ +++ +L AI P+LE++ K+K ER  +FS+V  QI
Sbjct  73    AQSELSNLLSALGEKSFAGAPEKTTGTIREQLAAIAPVLEKLWKQKEERIKEFSDVQLQI  132

Query  637   DSVLKELGKSRKELQHMIA---LDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLES  807
               +  E+  + K L   +    +DE+DLSL++L++  + L  LQKEKSDRL +VLD + +
Sbjct  133   QKICGEVAGNLK-LSEQVGPPTVDEADLSLKKLDEFHAQLQELQKEKSDRLHKVLDFVST  191

Query  808   LNSLCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHML  981
             ++ LC  LG+DF +TI E+HP+L DS  +  KS+S +T+ +L+  +  L+E K QRL  +
Sbjct  192   VHDLCAALGMDFFSTITEVHPSLNDSVGVQAKSISNDTLSKLAKTVLALKEEKKQRLQKI  251

Query  982   QNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQ  1161
             Q LA  + +LWNLMD P EE+ LF++VT  I+AS  E+T P AL+LDL++ AE+EV RL 
Sbjct  252   QELAAQLFDLWNLMDTPEEERNLFEHVTCNISASVDEVTIPGALALDLIEQAEVEVERLD  311

Query  1162  EMKSSKMKEVLLKKRITLEELCRQAHLAIDD--SIEFTDETIESGAIDPSHLLEQLEIQI  1335
             ++K+S+MKE+ LK++  LEE+   AH+ ID   + E     I+SG  +PS LL  ++ QI
Sbjct  312   QLKASRMKEIALKRQAELEEIYAHAHIEIDSVAAQEKIMALIDSGNFEPSELLADMDNQI  371

Query  1336  SNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALV  1515
             +  KEEA SRKEIL+KVEKW++ACEEESWLEDYNR++NRYN  RG H+ LKRAEKAR LV
Sbjct  372   AKAKEEAISRKEILDKVEKWMSACEEESWLEDYNRDENRYNASRGAHINLKRAEKARILV  431

Query  1516  NKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQ  1695
             NKIP +++ L ++ + WE ERG+ F YDGV LL+ML++Y +L+ ++E E++R RDQK+  
Sbjct  432   NKIPAIVDTLVAKTRAWEEERGISFTYDGVPLLAMLDEYAMLRHDREEEKRRMRDQKRYN  491

Query  1696  GQLMAEQEVLFGSKRSPSQ--SGKKNVVGGASNKRISVGGAMLQTPYTERAPLSSHSLKK  1869
              QL  EQE +FGS+ SP++  + KK +V  A+       G+   TP + R  L++H    
Sbjct  492   EQLNTEQEAIFGSRPSPNRPIAPKKVMVPRAN-------GSANGTP-SRRLSLNAHQNGA  543

Query  1870  INPVKQQALAN----ITQNYVALSSGRRESSMHAKQP  1968
              +  K     N       NYVA+S     S +   +P
Sbjct  544   RSAAKDGKKDNSRPVAPVNYVAISKEDAASHVSGTEP  580



>ref|XP_010096093.1| hypothetical protein L484_012448 [Morus notabilis]
 gb|EXB63258.1| hypothetical protein L484_012448 [Morus notabilis]
Length=679

 Score =   445 bits (1144),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 265/528 (50%), Positives = 377/528 (71%), Gaps = 23/528 (4%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             ETTC SLL +LQ+IW+E+GE + ERDKML QLEQECL+ Y+RKV+QA++S AQL QA+++
Sbjct  110   ETTCGSLLQKLQEIWDEVGESDDERDKMLLQLEQECLDVYKRKVEQAAKSRAQLLQALSD  169

Query  463   SEAELARICAALGEQP-VNV-RQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQI  636
              + EL+ + +ALGE+  V +  ++S ++K +L AI P LE++ K+K ER  + ++V  QI
Sbjct  170   GKLELSTLLSALGEKSSVGIPEKTSGTIKEQLAAIAPALEQLWKQKEERVKEIADVQSQI  229

Query  637   DSVLKEL-GKSR-KELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESL  810
               +  E+ G S   E       DESDL+L++L++  + L  LQKEKSDRL +VL+ + ++
Sbjct  230   QKICGEIAGNSNLSEQAGTPVFDESDLTLKKLDEYHAQLQELQKEKSDRLHKVLEFVSTV  289

Query  811   NSLCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHMLQ  984
             + LC VLGIDF +T+ E+HP+L DS+ +  KS+S +T+ RL+  +  L+E K QRLH LQ
Sbjct  290   HDLCAVLGIDFFSTVTEVHPSLNDSTGMQSKSISNDTLSRLAKTVLALKEDKKQRLHKLQ  349

Query  985   NLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQE  1164
              LA+ +++LWNLMD P EE+ LFD+VT  I+AS  E+T P AL+LDL++ AE+EV RL +
Sbjct  350   ELASQLIDLWNLMDTPDEERSLFDHVTCNISASVDEVTVPGALALDLIEQAEVEVERLDQ  409

Query  1165  MKSSKMKEVLLKKRITLEELCRQAHLAID-----DSIEFTDETIESGAIDPSHLLEQLEI  1329
             +KSS+MKE+  K++  LEE+  +AH+ ID     D I      I+SG ++P+ LL  ++ 
Sbjct  410   LKSSRMKEIAFKRQAELEEIFARAHIEIDPEAARDKIM---AMIDSGNVEPAELLAGMDN  466

Query  1330  QISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARA  1509
             +I+  KEEA SRKEIL+KVEKW++ACEEESWLEDYNR+DNRYN  RG HL LKRAEKAR 
Sbjct  467   EIAKAKEEALSRKEILDKVEKWMSACEEESWLEDYNRDDNRYNASRGAHLNLKRAEKARI  526

Query  1510  LVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKK  1689
             LVNKIP +++ L ++ + WE +RG+ F YDGV LL+ML++Y +L+QE+E E++R +DQKK
Sbjct  527   LVNKIPALVDTLVAKTRAWEEDRGISFTYDGVPLLAMLDEYAMLRQEREEEKRRMKDQKK  586

Query  1690  LQGQLMAEQEVLFGSKRSPSQS-GKKNVVG--------GASNKRISVG  1806
                Q   EQE +FGSK SP++  G K VVG        G  N+R+S+ 
Sbjct  587   YTDQQHTEQEAIFGSKPSPARPVGTKKVVGPRVNGGANGTPNRRLSLN  634



>gb|ACN85211.1| microtubule-associated protein MAP65-1a [Oryza glaberrima]
Length=581

 Score =   441 bits (1133),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 255/531 (48%), Positives = 371/531 (70%), Gaps = 21/531 (4%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             ETTC SLL +LQ IW+E+GE + +RDKML QLEQECL+ YRRKVDQAS S A+L Q +A 
Sbjct  13    ETTCGSLLQQLQLIWDEVGESDEDRDKMLLQLEQECLDVYRRKVDQASNSRARLLQQLAN  72

Query  463   SEAELARICAALGEQPVNV--RQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQI  636
             +++EL+R+  ALGE  ++    +++ ++K +L+AI P LE++ + K +R  +F++V  QI
Sbjct  73    AKSELSRLLCALGELSISSIPDKTTGTIKEQLEAISPFLEKLCREKDKRVREFADVQLQI  132

Query  637   DSVLKELGKSRKELQHMIA--LDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESL  810
              ++  E+  S +   HM    ++E DLS ++L +  S L +LQKEKS+RL ++LD + S+
Sbjct  133   QTIRGEIAGSLQVGDHMETPRVNEDDLSTKKLNEFLSELQALQKEKSNRLHKILDFVSSV  192

Query  811   NSLCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHMLQ  984
             + LC VLG+DF +T+ E+HP+L DS     KS+S  T+ +LS  + +L+E K +RL  +Q
Sbjct  193   HDLCSVLGMDFLSTVTEVHPSLNDSVGAESKSISDATLSKLSKMVIQLKEEKSKRLERIQ  252

Query  985   NLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQE  1164
              LA+ + +LWNLMD   +E+QLFD+VT  I+++  E+T P AL +DL++ AE+EV RL +
Sbjct  253   ALASQLTDLWNLMDTSADERQLFDHVTCNISSTLDEVTAPGALDIDLIEQAELEVERLDQ  312

Query  1165  MKSSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHLLEQLEIQIS  1338
             +K+S+MK++  K++  LE++  QAH+ ID S   +     I+S   +PS LL  +E QI 
Sbjct  313   LKASRMKDIAFKRQTELEDIYAQAHITIDTSAARDRILTVIDSSIFEPSELLADMENQIL  372

Query  1339  NVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVN  1518
               KEEA SRK+ILEKVE+W++ACEEESWLEDY+++DNRY+  RG HL LKRAEKAR LV+
Sbjct  373   KAKEEALSRKDILEKVERWMSACEEESWLEDYSQDDNRYSATRGAHLNLKRAEKARLLVS  432

Query  1519  KIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQG  1698
             KIP +++ L ++ + WE E G+PF YDGV LL+ML++Y +L+Q+KE E++R RDQKK+  
Sbjct  433   KIPVIVDTLMAKTRAWEQEHGMPFSYDGVHLLAMLDEYKVLRQQKEEEKRRMRDQKKIND  492

Query  1699  QLMAEQEVLFGSKRSPS--QSGKK--------NVVGGASNKRISV---GGA  1812
             QL AEQE LFGSK SP+  QS +K          V G  N+R+S    GG 
Sbjct  493   QLAAEQEKLFGSKPSPARPQSSRKAPGPRANGGAVNGTPNRRLSAHQNGGG  543



>ref|XP_002531201.1| Protein regulator of cytokinesis, putative [Ricinus communis]
 gb|EEF31178.1| Protein regulator of cytokinesis, putative [Ricinus communis]
Length=583

 Score =   441 bits (1133),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 271/561 (48%), Positives = 396/561 (71%), Gaps = 20/561 (4%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             ETTC +LL +LQ+IW+E+GE + ERDKML Q+EQECL+ Y++KV+QA++S AQL +A+++
Sbjct  13    ETTCGTLLQKLQEIWDEVGESDEERDKMLLQIEQECLDVYKKKVEQAAKSRAQLLEALSD  72

Query  463   SEAELARICAALGEQP-VNV-RQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQI  636
             ++ ELA + +ALGE+  V +  ++S ++K +L AI P LE++ K+K ER  +FS+V  QI
Sbjct  73    AKIELANLLSALGEKSFVGMPEKTSGTIKEQLAAIAPALEQLWKQKEERVKEFSDVQSQI  132

Query  637   DSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESLNS  816
               +  E+  S   +     +DESDLSL++L++    L  LQKEKSDRL++VL+ + S++ 
Sbjct  133   QKICGEIAGSSN-VNGTPTVDESDLSLKKLDEYHVQLQELQKEKSDRLQKVLEFVSSVHD  191

Query  817   LCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHMLQNL  990
             LC VLG+DF +T+ E+HP+L D++ +  KS+S +T+ RL+  +  L+E K QRLH LQ L
Sbjct  192   LCAVLGMDFLSTVTEVHPSLNDATGVQSKSISNDTLARLAKTVLALKEDKKQRLHKLQEL  251

Query  991   ATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQEMK  1170
             A  +++LWNLMD   EE+QLFD+VT  I+AS  E+T P AL++DL++ AE+EV RL ++K
Sbjct  252   AVQLIDLWNLMDTSEEERQLFDHVTCNISASVDEVTVPGALAVDLIEQAEVEVERLDQLK  311

Query  1171  SSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHLLEQLEIQISNV  1344
             +S+MKE+ LK++  LEE+  +AH+ +D     E     I+SG+++P+ LL  ++ QIS  
Sbjct  312   ASRMKEIALKRQAELEEIYARAHIEVDPEAAREKIMALIDSGSVEPAELLADMDNQISKA  371

Query  1345  KEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVNKI  1524
             KEEA SRKEIL+KVEKW++ACEEESWLEDYNR++NRYN  RG HL LKRAEKAR LVNKI
Sbjct  372   KEEALSRKEILDKVEKWMSACEEESWLEDYNRDENRYNASRGAHLNLKRAEKARVLVNKI  431

Query  1525  PGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQGQL  1704
             P +++ L ++ + WE +RG+ F YDGV LL+ML++Y +L+QE+E E++R RDQKK     
Sbjct  432   PALVDTLVAKTRAWEDDRGLQFAYDGVPLLAMLDEYAMLRQEREEEKRRLRDQKKYTELQ  491

Query  1705  MAEQEVLFGSKRSPSQS-GKKNVVGGASNKRISVGGAMLQTPYTERAPLSSHSLKKINPV  1881
               EQE +FGS+ SP++S G K VVG  +N     GGA   TP + R  L++H     +  
Sbjct  492   STEQEAIFGSRPSPARSVGTKKVVGPRAN-----GGAN-GTP-SRRLSLNAHQNGSKSST  544

Query  1882  KQQALANITQ-----NYVALS  1929
             K+    +  +     NYVA+S
Sbjct  545   KEGRRDSTNRPAAPLNYVAIS  565



>ref|XP_010928887.1| PREDICTED: 65-kDa microtubule-associated protein 1-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010928888.1| PREDICTED: 65-kDa microtubule-associated protein 1-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010928889.1| PREDICTED: 65-kDa microtubule-associated protein 1-like isoform 
X1 [Elaeis guineensis]
Length=589

 Score =   440 bits (1132),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 277/565 (49%), Positives = 397/565 (70%), Gaps = 22/565 (4%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             ETTC SLL +LQ IWNE+GE + ERDK+L Q+EQECL+ Y+RKVDQAS+S A L QA+A+
Sbjct  13    ETTCGSLLQQLQLIWNEVGESDEERDKILLQVEQECLDVYKRKVDQASKSRALLLQALAD  72

Query  463   SEAELARICAALGEQP-VNV-RQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQI  636
             S  ELAR+ +ALGE+  V +  +SS ++K +L AI P LE++ ++K ER  + ++VL QI
Sbjct  73    SRLELARLLSALGEKSFVGIPDKSSGTIKEQLAAIGPALEQLCRQKKERIKESADVLSQI  132

Query  637   DSVLKELGKSRKELQHM--IALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESL  810
               +  E+  + K  + M   A++E DLSL +L++ +S L  LQKEKS+RL +VLD + ++
Sbjct  133   QKIRGEISGTLKISEKMGTSAVNEEDLSLNKLDEYRSQLQELQKEKSERLHKVLDFVSTV  192

Query  811   NSLCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHMLQ  984
             + LC VLG+DF ++I E+HP+L DS  +  KS+S +T+ +LS  + EL+E K  RL  LQ
Sbjct  193   HDLCAVLGMDFFSSITEVHPSLNDSVGVQSKSISNDTLLKLSKMVIELKEDKRMRLQKLQ  252

Query  985   NLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQE  1164
              LA  + +LWNLMD P+EE+ LF++VT  I+A+  E+T P AL+LDL++ AE+EV RL +
Sbjct  253   ELAAQLTDLWNLMDTPMEERSLFNHVTCYISATVDEVTVPGALALDLIEQAEVEVERLDQ  312

Query  1165  MKSSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHLLEQLEIQIS  1338
             +K+SKMKE+ LK++  LE++  +AH+  D +   E     I+SG ++PS LL  ++ +I 
Sbjct  313   LKASKMKEIALKRQTELEDVYARAHIETDSAAARERIISLIDSGNLEPSELLTDMDNRIL  372

Query  1339  NVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVN  1518
               KEEA SRKEILE+VEKW++ACEEESWLEDYNR++NRYN  RG HL LKRAEKAR LVN
Sbjct  373   KAKEEALSRKEILERVEKWMSACEEESWLEDYNRDENRYNASRGAHLNLKRAEKARILVN  432

Query  1519  KIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQG  1698
             KIP +++AL ++ + WE  RG+ F+YDGVSLL+ML++Y +L+QE+E E++R R QK+ Q 
Sbjct  433   KIPALVDALVAKTRAWEEGRGMSFMYDGVSLLAMLDEYTMLRQEREEEKRRLRGQKRFQE  492

Query  1699  QLMAEQEVLFGSKRSPSQS-GKKNVVGGASNKRISVGGAMLQTPYTERAPLSSH--SLKK  1869
             QL  EQE LFGS+ SP++  G K V+G  +N     GGA   TP + R  L++H  S   
Sbjct  493   QLNTEQEALFGSRPSPARPLGPKKVMGPRAN-----GGASNGTP-SRRLSLNTHHGSSNG  546

Query  1870  INPVKQQALANITQ-----NYVALS  1929
             +  V +     +++     NYVA++
Sbjct  547   VRSVSRDGKREVSRPAAPVNYVAIA  571



>ref|NP_001058056.1| Os06g0611000 [Oryza sativa Japonica Group]
 dbj|BAD35496.1| putative microtubule-associated protein MAP65-1a [Oryza sativa 
Japonica Group]
 dbj|BAF19970.1| Os06g0611000 [Oryza sativa Japonica Group]
 gb|EAZ01643.1| hypothetical protein OsI_23680 [Oryza sativa Indica Group]
 gb|EAZ37615.1| hypothetical protein OsJ_21950 [Oryza sativa Japonica Group]
 dbj|BAG90327.1| unnamed protein product [Oryza sativa Japonica Group]
Length=581

 Score =   440 bits (1131),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 255/531 (48%), Positives = 371/531 (70%), Gaps = 21/531 (4%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             ETTC SLL +LQ IW+E+GE + +RDKML QLEQECL+ YRRKVDQAS S A+L Q +A 
Sbjct  13    ETTCGSLLQQLQLIWDEVGESDEDRDKMLLQLEQECLDVYRRKVDQASNSRARLLQQLAN  72

Query  463   SEAELARICAALGEQPVNV--RQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQI  636
             +++EL+R+  ALGE  ++    +++ ++K +L+AI P LE++ + K +R  +F+ V  QI
Sbjct  73    AKSELSRLLCALGELSISGIPDKTTGTIKEQLEAISPFLEKLCREKDKRVREFAGVQLQI  132

Query  637   DSVLKELGKSRKELQHMIA--LDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESL  810
              ++  E+  S +   HM    ++E DLS ++L +  S L +LQKEKS+RL ++LD + S+
Sbjct  133   QTIRGEIAGSLQVGDHMETPRVNEDDLSTKKLNEFLSELQALQKEKSNRLHKILDFVSSV  192

Query  811   NSLCIVLGIDFKNTIGEIHPTLGDS--SALKSVSTETIERLSAAIHELREVKIQRLHMLQ  984
             + LC VLG+DF +T+ E+HP+L DS  +  KS+S  T+ +LS  + +L+E K +RL  +Q
Sbjct  193   HDLCSVLGMDFLSTVTEVHPSLNDSVGAEFKSISDATLSKLSKMVIQLKEEKSKRLERIQ  252

Query  985   NLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQE  1164
              LA+ + +LWNLMD   +E+QLFD+VT  I+++  E+T P AL +DL++ AE+EV RL +
Sbjct  253   ALASQLTDLWNLMDTSADERQLFDHVTCNISSTLDEVTAPGALDIDLIEQAELEVERLDQ  312

Query  1165  MKSSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHLLEQLEIQIS  1338
             +K+S+MK++  K++  LE++  QAH+ ID S   +     I+S   +PS LL  +E QI 
Sbjct  313   LKASRMKDIAFKRQTELEDIYAQAHITIDTSAARDRILTVIDSSIFEPSELLADMENQIL  372

Query  1339  NVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVN  1518
               KEEA SRK+ILEKVE+W++ACEEESWLEDY+++DNRY+  RG HL LKRAEKAR LV+
Sbjct  373   KAKEEALSRKDILEKVERWMSACEEESWLEDYSQDDNRYSATRGAHLNLKRAEKARLLVS  432

Query  1519  KIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQG  1698
             KIP +++ L ++ + WE E G+PF YDGV LL+ML++Y +L+Q+KE E++R RDQKK+  
Sbjct  433   KIPVIVDTLMAKTRAWEQEHGMPFSYDGVHLLAMLDEYKVLRQQKEEEKRRMRDQKKIND  492

Query  1699  QLMAEQEVLFGSKRSPS--QSGKK--------NVVGGASNKRISV---GGA  1812
             QL AEQE LFGSK SP+  QS +K          V G  N+R+S    GG 
Sbjct  493   QLAAEQEKLFGSKPSPARPQSSRKAPGPRANGGAVNGTPNRRLSAHQNGGG  543



>gb|ACN85279.1| microtubule-associated protein MAP65-1a [Oryza alta]
Length=581

 Score =   440 bits (1131),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 257/531 (48%), Positives = 373/531 (70%), Gaps = 21/531 (4%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             ETTC SLL +LQ IW+E+GE + +RDKML QLEQECL+ YRRKVDQAS S A+L Q +A 
Sbjct  13    ETTCGSLLQQLQLIWDEVGESDEDRDKMLLQLEQECLDVYRRKVDQASNSRARLLQQLAN  72

Query  463   SEAELARICAALGEQPVNV--RQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQI  636
             +++EL+R+  ALGE  ++    +++ ++K +L+ I P LE++ + K +R  +F++VL QI
Sbjct  73    AKSELSRLLCALGELSISGIPDKTTGTIKEQLEVISPFLEKLCREKDKRVREFADVLLQI  132

Query  637   DSVLKELGKSRKELQHM--IALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESL  810
              ++  E+  + +   HM    ++E DLS ++L    S L +LQKEKS+RL ++LD + S+
Sbjct  133   QTIRGEIAGTLQVGDHMETPCVNEDDLSTKKLNKFLSELQALQKEKSNRLHKILDFVSSV  192

Query  811   NSLCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHMLQ  984
             + LC VLG+DF +T+ ++HP+L DS     KS+S  T+ +LS  + +L+E K +RL  +Q
Sbjct  193   HDLCSVLGMDFLSTVTKVHPSLNDSVGAESKSISEATLSKLSKMVIQLKEEKSKRLEKIQ  252

Query  985   NLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQE  1164
              LA+ + +LWNLMD   EE++LFD+VT  ++++  E+T P AL LDL++ AE+EV RL +
Sbjct  253   ALASQLTDLWNLMDTSAEERRLFDHVTCNMSSTLDEVTAPGALDLDLIEQAELEVERLDQ  312

Query  1165  MKSSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHLLEQLEIQIS  1338
             +K+S+MK++  K++  LE++  QAH+AID S   +     I+S   +PS LL  +E QI 
Sbjct  313   LKASRMKDIAFKRQTELEDIYAQAHIAIDTSAARDRILTVIDSSIFEPSELLADMENQIL  372

Query  1339  NVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVN  1518
               KEEA SRK+ILEKVE+W++ACEEESWLEDY+++DNRY+  RG HL LKRAEKAR LV+
Sbjct  373   KAKEEALSRKDILEKVERWMSACEEESWLEDYSQDDNRYSATRGAHLNLKRAEKARLLVS  432

Query  1519  KIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQG  1698
             KIP +++ L ++ + WE E G+PF YDGV LL+ML++Y +L+Q KE E++R RDQKK+  
Sbjct  433   KIPAIVDTLMAKTRAWEQEHGMPFTYDGVHLLAMLDEYKVLRQRKEEEKRRMRDQKKIND  492

Query  1699  QLMAEQEVLFGSKRSPS--QSGKK----NVVGGAS----NKRISV---GGA  1812
             QL AEQE LFGSK SP+  QS +K       GGAS    N+R+SV   GG 
Sbjct  493   QLAAEQEKLFGSKPSPARPQSSRKAPGPRANGGASNGTPNRRLSVHQNGGG  543



>gb|EYU27387.1| hypothetical protein MIMGU_mgv1a003477mg [Erythranthe guttata]
Length=583

 Score =   440 bits (1131),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 262/573 (46%), Positives = 384/573 (67%), Gaps = 18/573 (3%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             + +C SLL +LQ+IW+E+GE + ERD ML QLEQECL+ YRRKVD A +S A L Q +A+
Sbjct  13    QISCGSLLQQLQQIWDEVGETDEERDNMLLQLEQECLDVYRRKVDLAVKSRAHLLQTLAD  72

Query  463   SEAELARICAALGEQP-VNV-RQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQI  636
             +  EL  + +ALGE+  V +  ++S ++K +L AI P LE++ K+K ER  +F +V  QI
Sbjct  73    ARVELTNLLSALGEKTYVGIPEKTSGTIKEQLLAIAPALEKLWKQKEERIKEFFDVQSQI  132

Query  637   DSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESLNS  816
               +  E+  +  +++   A+DE+DLS+++L++  + L  LQKEKSDRL +VL+ + +++ 
Sbjct  133   QKICAEIAGTSDQVESP-AVDETDLSMKKLDEFHAQLQDLQKEKSDRLHKVLEFVSTVHD  191

Query  817   LCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHMLQNL  990
             +C VLG+DF  T+ E+HP+L DS+ +  KS+S +T+ RL   +  L+E K QRL  LQ L
Sbjct  192   ICAVLGMDFFTTVTEVHPSLNDSTGVQSKSISNDTLSRLVKTVLALKEDKKQRLQKLQEL  251

Query  991   ATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQEMK  1170
             AT +++LWNLMD P EE+ LFD+ T  I+AS  E+T P AL+ DL++ AE+EV RL ++K
Sbjct  252   ATQLIDLWNLMDTPPEERSLFDHFTCNISASVDEVTIPGALASDLIEQAEVEVERLDQLK  311

Query  1171  SSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHLLEQLEIQISNV  1344
             +S+MKE+  KK+  LEE+   AH+ ID     E     I+SG ++P+ LL  ++ QI   
Sbjct  312   ASRMKEIAFKKQSELEEIFAHAHVEIDTEAAREKILSLIDSGNVEPTELLSDMDNQIVKA  371

Query  1345  KEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVNKI  1524
             KEEA SRK+IL+KVEKW++ACEEESWL+DYNR++NRYN  RG HL LKRAEKAR LVNKI
Sbjct  372   KEEALSRKDILDKVEKWMSACEEESWLDDYNRDENRYNASRGAHLNLKRAEKARVLVNKI  431

Query  1525  PGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQGQL  1704
             P ++++L ++ + WE ERG+ F YDGV LL+ML++Y +L+Q++E E++R RDQKK   Q+
Sbjct  432   PALVDSLVAKTRVWEQERGITFTYDGVPLLAMLDEYAMLRQDREEEKRRMRDQKKFHEQV  491

Query  1705  MAEQEVLFGSKRSPS-QSGKKNVVGGASNKRISVGGAMLQTPYTERAPLSSH--SLKKIN  1875
               EQE +FG+  SP+ Q   K VVG  +N   + G A      + R  L++H    + IN
Sbjct  492   NKEQESIFGATPSPARQPSTKKVVGPRTNGGGANGAA------SRRLSLNAHQNGSRSIN  545

Query  1876  --PVKQQALANITQNYVALSSGRRESSMHAKQP  1968
                 +  +      NYVA+S     S +   +P
Sbjct  546   RDGRRDSSRPAAPVNYVAISKEDAASHISGTEP  578



>gb|ACN85233.1| microtubule-associated protein MAP65-1a [Oryza minuta]
Length=582

 Score =   439 bits (1130),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 255/524 (49%), Positives = 371/524 (71%), Gaps = 12/524 (2%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             ETTC SLL +LQ IW+E+GE + +RDKML QLEQECL+ YRRKVDQAS S A+L Q +A 
Sbjct  13    ETTCGSLLQQLQLIWDEVGESDEDRDKMLLQLEQECLDVYRRKVDQASNSRARLLQQLAN  72

Query  463   SEAELARICAALGEQPVNV--RQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQI  636
             +++EL+R+  ALGE  V+    +++ ++K +L+AI P LE++ + K +R  +F++V  QI
Sbjct  73    AKSELSRLLCALGELSVSGIPDKTTGTIKEQLEAISPFLEKLCREKDKRIREFADVQLQI  132

Query  637   DSVLKELGKSRKELQHMIA--LDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESL  810
              ++  E+  S +   HM    ++E DLS ++L +  S L +LQKEKS+RL ++LD +  +
Sbjct  133   QTICGEIAGSLQVGDHMETPRVNEDDLSTKKLNEFLSELQALQKEKSNRLHKILDFVSLV  192

Query  811   NSLCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHMLQ  984
             + LC VLG+DF +T+ E+HP+L DS     KS+S  T+ +LS  + +L+E K +RL  +Q
Sbjct  193   HDLCSVLGMDFLSTVTEVHPSLNDSVGAESKSISDATLSKLSKMVIQLKEEKSKRLEKIQ  252

Query  985   NLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQE  1164
              LA+ + +LWNLMD  VEE++LFD+VT  ++++  E+T P AL LDL++ A +EV RL +
Sbjct  253   ALASQLTDLWNLMDTSVEERRLFDHVTCNMSSTLDEVTAPGALDLDLIQQAGLEVERLDQ  312

Query  1165  MKSSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHLLEQLEIQIS  1338
             +K+S+MK++  K++  LE++  QAH+AID S   +     I+S   +PS LL  +E QI 
Sbjct  313   LKASRMKDIAFKRQAELEDIYAQAHIAIDTSAARDRILTVIDSSIFEPSELLADMENQIL  372

Query  1339  NVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVN  1518
               KEEA SRK+ILEKVE+W++ACEEESWLEDY+++DNRY+  RG HL LKRAEKAR LV+
Sbjct  373   KAKEEALSRKDILEKVERWMSACEEESWLEDYSQDDNRYSATRGAHLNLKRAEKARLLVS  432

Query  1519  KIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQG  1698
             KIP +++ L ++ + WE E G+PF YDGV LL+ML++Y +L+Q+KE E++R RDQKK+  
Sbjct  433   KIPVIVDTLMAKTRAWEQEHGMPFSYDGVHLLAMLDEYKVLRQQKEEEKRRMRDQKKIND  492

Query  1699  QLMAEQEVLFGSKRSPSQ-SGKKNVVGGASNKRISVGGAMLQTP  1827
             QL AEQE LFGSK SP+Q    + V G  +N   + GGA+  TP
Sbjct  493   QLAAEQEKLFGSKPSPAQPQSSRKVPGPRAN---ANGGAVSGTP  533



>ref|XP_009394695.1| PREDICTED: 65-kDa microtubule-associated protein 1-like [Musa 
acuminata subsp. malaccensis]
Length=586

 Score =   439 bits (1130),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 260/519 (50%), Positives = 363/519 (70%), Gaps = 9/519 (2%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             E TC SLL +LQ IW+EIGE + ERDKML QLEQECL+ Y+RKVDQAS+S A L Q++A+
Sbjct  13    EITCGSLLQQLQIIWDEIGESDEERDKMLLQLEQECLDVYKRKVDQASKSRALLLQSLAD  72

Query  463   SEAELARICAALGEQP-VNVR-QSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQI  636
             S AELAR+  ALGE+  V+++ +SS ++K +L AI P++E++ K+K ER  +F   L QI
Sbjct  73    SRAELARLLFALGEKSLVDIQDRSSGTIKEQLVAIAPVVEQLCKQKEERIKEFDNTLLQI  132

Query  637   DSVLKELGKSRK--ELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESL  810
               +  E+  + K  E      +DE DLSL++L++ K  L  LQ+EKSDRL++VLD + ++
Sbjct  133   QKIRGEISGTLKLGEQIETPVVDEEDLSLKKLDEYKLQLQELQREKSDRLQKVLDFVSTV  192

Query  811   NSLCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHMLQ  984
             + LC V+G+DF +TI E+HP+L DS  +  KS+S  T+ +LS  +  L+E K  RL  LQ
Sbjct  193   HDLCAVMGLDFFSTITEVHPSLNDSVGVQSKSISDGTLSKLSGMVIGLKEDKKMRLQKLQ  252

Query  985   NLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQE  1164
              LA  + +LWNLMD P+EE+ LF +VT     +  E+T P AL+LDL++ AE+EV RL +
Sbjct  253   ELAAQLHDLWNLMDTPMEERNLFSHVTCNTNCTVDEVTVPGALTLDLIEQAEVEVERLDQ  312

Query  1165  MKSSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHLLEQLEIQIS  1338
             +K+SKMKE+  KK+I LE++  +AH+ ID +   E     I+SG  +P  LL  ++ QI 
Sbjct  313   LKASKMKEIAFKKQIELEDIYSRAHIEIDSAAAREKILALIDSGNFEPLELLADMDNQIL  372

Query  1339  NVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVN  1518
               KEEA SRK+ILE+VEKW++ACEEESWLEDYNR+ NRYN  RG HL LKRAEKAR LVN
Sbjct  373   KAKEEALSRKDILERVEKWMSACEEESWLEDYNRDQNRYNSSRGAHLNLKRAEKARILVN  432

Query  1519  KIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQG  1698
             KIP +++ L ++ K WE +  + F+YDGVSLL+ML++Y +L+Q++E E+++QRDQK+   
Sbjct  433   KIPALVDTLVAKTKAWEQDHDMSFMYDGVSLLAMLDEYNMLRQDREEEKRKQRDQKRFHE  492

Query  1699  QLMAEQEVLFGSKRSPSQS-GKKNVVGGASNKRISVGGA  1812
             QL  EQE +FGS+ SP +  G K V+   SN     G A
Sbjct  493   QLATEQEAMFGSRPSPVRPLGAKKVISPRSNGSAPNGTA  531



>gb|ACN85194.1| microtubule-associated protein MAP65-1a [Oryza rufipogon]
Length=581

 Score =   439 bits (1129),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 255/525 (49%), Positives = 371/525 (71%), Gaps = 16/525 (3%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             ETTC SLL +LQ IW+E+GE + +RDKML QLEQECL+ YRRKVDQAS S A+L Q +A 
Sbjct  13    ETTCGSLLQQLQLIWDEVGESDEDRDKMLLQLEQECLDVYRRKVDQASNSRARLLQQLAN  72

Query  463   SEAELARICAALGEQPVNV--RQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQI  636
             +++EL+R+  ALGE  ++    +++ ++K +L+AI P LE++ + K +R  +F++V  QI
Sbjct  73    AKSELSRLLCALGELSISSIPDKTTGTIKEQLEAISPFLEKLCREKDKRVREFADVQLQI  132

Query  637   DSVLKELGKSRKELQHMIA--LDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESL  810
              ++  E+  S +   HM    ++E DLS ++L +  S L +LQKEKS+RL ++LD + S+
Sbjct  133   QTIRGEIAGSLQVGDHMETPRVNEDDLSTKKLNEFLSELQALQKEKSNRLHKILDFVSSV  192

Query  811   NSLCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHMLQ  984
             + LC VLG+DF +T+ E+HP+L DS     KS+S  T+ +LS  + +L+E K +RL  +Q
Sbjct  193   HDLCSVLGMDFLSTVTEVHPSLNDSVGAESKSISDATLSKLSKMVIQLKEEKSKRLERIQ  252

Query  985   NLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQE  1164
              LA+ + +LWNLMD   +E+QLFD+VT  I+++  E+T P AL +DL++ AE+EV RL +
Sbjct  253   ALASQLTDLWNLMDTSADERQLFDHVTCNISSTLDEVTAPGALDIDLIEQAELEVERLDQ  312

Query  1165  MKSSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHLLEQLEIQIS  1338
             +K+S+MK++  K++  LE++  QAH+ ID S   +     I+S   +PS LL  +E QI 
Sbjct  313   LKASRMKDIAFKRQTELEDIYAQAHITIDTSAARDRILTVIDSSIFEPSELLADMENQIL  372

Query  1339  NVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVN  1518
               KEEA SRK+ILEKVE+W++ACEEESWLEDY+++DNRY+  RG HL LKRAEKAR LV+
Sbjct  373   KAKEEALSRKDILEKVERWMSACEEESWLEDYSQDDNRYSATRGAHLNLKRAEKARLLVS  432

Query  1519  KIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQG  1698
             KIP +++ L ++ + WE E G+PF YDGV LL+ML++Y +L+Q+KE E++R RDQKK+  
Sbjct  433   KIPVIVDTLMAKTRAWEQEHGMPFSYDGVHLLAMLDEYKVLRQQKEEEKRRMRDQKKIND  492

Query  1699  QLMAEQEVLFGSKRSPS--QSGKKNVVGGASNKRISVGGAMLQTP  1827
             QL AEQE LFGSK SP+  QS +K   G  +N     GGA+  TP
Sbjct  493   QLAAEQEKLFGSKPSPARPQSSRK-APGPRAN-----GGAVNGTP  531



>gb|KDO62132.1| hypothetical protein CISIN_1g007822mg [Citrus sinensis]
Length=588

 Score =   438 bits (1127),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 269/574 (47%), Positives = 401/574 (70%), Gaps = 25/574 (4%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             ETTC SLL +LQ+IW+E+GE + ERDKML Q+E+ECL+ Y+RKV+QA++S AQL QA+++
Sbjct  13    ETTCSSLLHKLQEIWDEVGENDEERDKMLLQIEKECLDVYKRKVEQAAKSRAQLLQALSD  72

Query  463   SEAELARICAALGEQPVNV----RQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLD  630
             ++ ELA + +ALGE+ +       ++S ++K +L AI P LE++ K+K ER  +FS+V  
Sbjct  73    AKIELASLLSALGEKSIAGLGIPEKTSGTIKEQLAAIAPALEQLWKQKEERVKEFSDVQS  132

Query  631   QIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESL  810
             QI  +  E+  +        ++DESDL+L++L++ ++ L  LQKEKSDRL +VL+ + ++
Sbjct  133   QIQKICGEIAGNLSLGDQAPSVDESDLTLKKLDEYQAQLQELQKEKSDRLHKVLEFVSTV  192

Query  811   NSLCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHMLQ  984
             + LC VLG+DF +T+ E+HP+L DS+ +  KS+S +T+ RL+  +  L+E K QRLH LQ
Sbjct  193   HDLCGVLGMDFFSTVTEVHPSLNDSTGVQSKSISNDTLARLAKTVLALKEDKKQRLHKLQ  252

Query  985   NLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQE  1164
              LAT +++LWNLMD P EE++LFD+VT  I+A    +T P AL+LDL++ AE+EV RL +
Sbjct  253   ELATQLIDLWNLMDTPSEERRLFDHVTCNISAYVDGVTVPGALALDLIEQAEVEVERLDQ  312

Query  1165  MKSSKMKEVLLKKRITLEELCRQAHLAID--DSIEFTDETIESGAIDPSHLLEQLEIQIS  1338
             +K+S+MKE+  K++  LEE+  +AH+ ID   + E     I+SG ++P+ LL  ++ QI+
Sbjct  313   LKASRMKEIAFKRQGELEEIFARAHIEIDPVAAREKIMTLIDSGNVEPAELLADMDNQIA  372

Query  1339  NVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVN  1518
               KEEA SRKEIL+KVEKW++ACEEESWLEDYNR++NRYN  RG HL LKRAEKAR LVN
Sbjct  373   KAKEEAHSRKEILDKVEKWMSACEEESWLEDYNRDENRYNASRGAHLNLKRAEKARILVN  432

Query  1519  KIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQG  1698
             KIP ++E L ++ + WE + G+ F YDGV LL+ML++Y +L+QE+E E++R R+ KK   
Sbjct  433   KIPALVETLVAKTRAWEEDHGISFTYDGVPLLAMLDEYAMLRQEREEEKRRMRESKKFHE  492

Query  1699  QLMAEQEVLFGSKRSPSQ-SGKKNVVGGASNKRISVGGAMLQTPYTERAPLSSH---SLK  1866
             Q  +EQE +FGS+ SP++ +G K VVG  +N      G +  TP + R  L++H   S  
Sbjct  493   QQSSEQESIFGSRPSPARPAGPKKVVGPRTN------GGVNGTP-SRRLSLNAHQNGSRS  545

Query  1867  KINPVKQQALANITQ----NYVALSSGRRESSMH  1956
                  K+++  +I      NYVA+S  + +S+ H
Sbjct  546   TTKEGKRESTGSIRPAAPVNYVAIS--KEDSASH  577



>gb|ACN85178.1| microtubule-associated protein MAP65-1a [Oryza nivara]
Length=581

 Score =   438 bits (1127),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 254/525 (48%), Positives = 371/525 (71%), Gaps = 16/525 (3%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             ETTC SLL +LQ IW+E+GE + +RDKML QLEQECL+ YRRKVDQAS S A+L Q +A 
Sbjct  13    ETTCGSLLQQLQLIWDEVGESDEDRDKMLLQLEQECLDVYRRKVDQASNSRARLLQQLAN  72

Query  463   SEAELARICAALGEQPVNV--RQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQI  636
             +++EL+R+  ALGE  ++    +++ ++K +L+AI P LE++ + K +R  +F++V  QI
Sbjct  73    AKSELSRLLCALGELSISSIPDKTTGTIKEQLEAISPFLEKLCREKDKRVREFADVQLQI  132

Query  637   DSVLKELGKSRKELQHMIA--LDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESL  810
              ++  E+  S +   HM    ++E DLS ++L +  S L +LQKEKS+RL ++LD + S+
Sbjct  133   QTIRGEIAGSLQVGDHMETPRVNEDDLSTKKLNEFLSELQALQKEKSNRLHKILDFVSSV  192

Query  811   NSLCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHMLQ  984
             + LC VLG+DF +T+ E+HP+L DS     KS+S  T+ +LS  + +L+E K +RL  +Q
Sbjct  193   HDLCSVLGMDFLSTVTEVHPSLNDSVGAESKSISDATLSKLSKMVIQLKEEKSKRLERIQ  252

Query  985   NLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQE  1164
              LA+ + +LWNLMD   +E+QLFD++T  I+++  E+T P AL +DL++ AE+EV RL +
Sbjct  253   ALASQLTDLWNLMDTSADERQLFDHITCNISSTLDEVTAPGALDIDLIEQAELEVERLDQ  312

Query  1165  MKSSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHLLEQLEIQIS  1338
             +K+S+MK++  K++  LE++  QAH+ ID S   +     I+S   +PS LL  +E QI 
Sbjct  313   LKASRMKDIAFKRQTELEDIYAQAHITIDTSAARDRILTVIDSSIFEPSELLADMENQIL  372

Query  1339  NVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVN  1518
               KEEA SRK+ILEKVE+W++ACEEESWLEDY+++DNRY+  RG HL LKRAEKAR LV+
Sbjct  373   KAKEEALSRKDILEKVERWMSACEEESWLEDYSQDDNRYSATRGAHLNLKRAEKARLLVS  432

Query  1519  KIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQG  1698
             KIP +++ L ++ + WE E G+PF YDGV LL+ML++Y +L+Q+KE E++R RDQKK+  
Sbjct  433   KIPVIVDTLMAKTRAWEQEHGMPFSYDGVHLLAMLDEYKVLRQQKEEEKRRMRDQKKIND  492

Query  1699  QLMAEQEVLFGSKRSPS--QSGKKNVVGGASNKRISVGGAMLQTP  1827
             QL AEQE LFGSK SP+  QS +K   G  +N     GGA+  TP
Sbjct  493   QLAAEQEKLFGSKPSPARPQSSRK-APGPRAN-----GGAVNGTP  531



>emb|CDY36737.1| BnaA03g11490D [Brassica napus]
Length=630

 Score =   440 bits (1131),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 254/560 (45%), Positives = 376/560 (67%), Gaps = 33/560 (6%)
 Frame = +1

Query  154   RSPFSFVACSLSSHTSRFLSPPGLLGRIASDMYNRQNDQSLRMETTCCSLLSELQKIWNE  333
             R PF FV   ++   S  L                        E TC +LL +LQ+IW+E
Sbjct  35    RKPFDFVTMVVTDTESTHLG-----------------------EITCGTLLQKLQEIWDE  71

Query  334   IGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAESEAELARICAALGEQP-  510
             +GE + ERDK+L Q+EQECL  Y+RKV+QA++S A+L Q ++++ AEL+ +  +LG++  
Sbjct  72    VGESDEERDKLLLQIEQECLHVYKRKVEQAAKSRAELLQTLSDANAELSSLTTSLGDKTF  131

Query  511   VNV--RQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQIDSVLKELGKSRKELQH  684
             VN    +SS ++K +L AI P LE++ ++K ER  +FS+V  QI  +  E+         
Sbjct  132   VNDIPDKSSGTIKEQLAAIAPALEQLWQQKDERVREFSDVQSQIQKICGEIAGGLS--SE  189

Query  685   MIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESLNSLCIVLGIDFKNTIGEI  864
             +  +DESDLSL++L+D  S L  LQKEKSDRL++VL+ + S++ LC VLG+DF +T+ E+
Sbjct  190   VPIVDESDLSLKKLDDFNSQLQELQKEKSDRLQKVLEFVSSVHDLCAVLGLDFLSTVKEV  249

Query  865   HPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHMLQNLATTIVELWNLMDMPVE  1038
             HP+L + +++  KS+S ET+ RL+  +  L++ K QRL  LQ LAT +++LWNLMD P E
Sbjct  250   HPSLDEETSVQAKSISNETLSRLAKTVLTLKDDKKQRLQKLQELATQLIDLWNLMDTPDE  309

Query  1039  EQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQEMKSSKMKEVLLKKRITLE  1218
             E++LFD+VT  I+AS  E+T P AL+ DL+K AE+EV RL ++K+S+MKE+  KK+  LE
Sbjct  310   ERELFDHVTCNISASVDEVTTPGALAHDLIKQAEVEVDRLDQLKASRMKEIAFKKQTELE  369

Query  1219  ELCRQAHLAID--DSIEFTDETIESGAIDPSHLLEQLEIQISNVKEEAFSRKEILEKVEK  1392
             E+  +AH+  +   + E     I+SG ++P+ LL  ++ QI+  KEEAFSRK+IL++VEK
Sbjct  370   EIYVRAHVETNPESARERIMSLIDSGNVEPTELLADMDSQIAKAKEEAFSRKDILDRVEK  429

Query  1393  WLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVNKIPGMLEALTSRAKGWEI  1572
             W++ACEEESWLEDYNR+ NRY+  RG HL LKRAEKAR LV+KIP M++ L ++ + WE 
Sbjct  430   WMSACEEESWLEDYNRDQNRYSASRGAHLNLKRAEKARVLVSKIPAMVDTLVAKTRAWEE  489

Query  1573  ERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQGQLMAEQEVLFGSKRSPSQ  1752
             E  + F YDGV LL+ML++YG+L+QE+E E++R R+QKK+Q Q   EQ+  F ++ SP++
Sbjct  490   EHNMSFAYDGVPLLAMLDEYGMLRQEREDEKRRLREQKKVQEQPHVEQDTAFSTRPSPAR  549

Query  1753  S-GKKNVVGGASNKRISVGG  1809
                 K  VG  +N  +   G
Sbjct  550   PVSAKKPVGARANNGVGANG  569



>ref|XP_006452462.1| hypothetical protein CICLE_v10007823mg [Citrus clementina]
 ref|XP_006474993.1| PREDICTED: 65-kDa microtubule-associated protein 1-like [Citrus 
sinensis]
 gb|ESR65702.1| hypothetical protein CICLE_v10007823mg [Citrus clementina]
Length=588

 Score =   438 bits (1127),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 269/574 (47%), Positives = 401/574 (70%), Gaps = 25/574 (4%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             ETTC SLL +LQ+IW+E+GE + ERDKML Q+E+ECL+ Y+RKV+QA++S AQL QA+++
Sbjct  13    ETTCSSLLHKLQEIWDEVGENDEERDKMLLQIEKECLDVYKRKVEQAAKSRAQLLQALSD  72

Query  463   SEAELARICAALGEQPVNV----RQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLD  630
             ++ ELA + +ALGE+ +       ++S ++K +L AI P LE++ K+K ER  +FS+V  
Sbjct  73    AKIELASLLSALGEKSIAGLGIPEKTSGTIKEQLAAIAPALEQLWKQKEERVKEFSDVQS  132

Query  631   QIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESL  810
             QI  +  E+  +        ++DESDL+L++L++ ++ L  LQKEKSDRL +VL+ + ++
Sbjct  133   QIQKICGEIAGNLSLGDQAPSVDESDLTLKKLDEYQAQLQELQKEKSDRLHKVLEFVSTV  192

Query  811   NSLCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHMLQ  984
             + LC VLG+DF +T+ E+HP+L DS+ +  KS+S +T+ RL+  +  L+E K QRLH LQ
Sbjct  193   HDLCGVLGMDFFSTVTEVHPSLNDSTGVQSKSISNDTLARLAKTVLALKEDKKQRLHKLQ  252

Query  985   NLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQE  1164
              LAT +++LWNLMD P EE++LFD+VT  I+A    +T P AL+LDL++ AE+EV RL +
Sbjct  253   ELATQLIDLWNLMDTPSEERRLFDHVTCNISAYVDGVTVPGALALDLIEQAEVEVERLDQ  312

Query  1165  MKSSKMKEVLLKKRITLEELCRQAHLAID--DSIEFTDETIESGAIDPSHLLEQLEIQIS  1338
             +K+S+MKE+  K++  LEE+  +AH+ ID   + E     I+SG ++P+ LL  ++ QI+
Sbjct  313   LKASRMKEIAFKRQGELEEIFARAHIEIDPVAAREKIMTLIDSGNVEPAELLADMDNQIA  372

Query  1339  NVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVN  1518
               KEEA SRKEIL+KVEKW++ACEEESWLEDYNR++NRYN  RG HL LKRAEKAR LVN
Sbjct  373   KAKEEAHSRKEILDKVEKWMSACEEESWLEDYNRDENRYNASRGAHLNLKRAEKARILVN  432

Query  1519  KIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQG  1698
             KIP ++E L ++ + WE + G+ F YDGV LL+ML++Y +L+QE+E E++R R+ KK   
Sbjct  433   KIPALVETLVAKTRAWEEDHGISFTYDGVPLLAMLDEYAMLRQEREEEKRRMRESKKFHE  492

Query  1699  QLMAEQEVLFGSKRSPSQ-SGKKNVVGGASNKRISVGGAMLQTPYTERAPLSSH---SLK  1866
             Q  +EQE +FGS+ SP++ +G K VVG  +N      G +  TP + R  L++H   S  
Sbjct  493   QQSSEQESIFGSRPSPARPAGPKKVVGPRTN------GGVNGTP-SRRLSLNAHQNGSRS  545

Query  1867  KINPVKQQALANITQ----NYVALSSGRRESSMH  1956
                  K+++  +I      NYVA+S  + +S+ H
Sbjct  546   TTKEGKRESTGSIRPAAPVNYVAIS--KEDSASH  577



>ref|XP_009132397.1| PREDICTED: 65-kDa microtubule-associated protein 1 [Brassica 
rapa]
Length=588

 Score =   438 bits (1127),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 264/592 (45%), Positives = 390/592 (66%), Gaps = 36/592 (6%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             E TC +LL +LQ+IW+E+GE + ERDK+L Q+EQECL  Y+RKV+QA++S A+L Q +++
Sbjct  12    EITCGTLLQKLQEIWDEVGESDEERDKLLLQIEQECLHVYKRKVEQAAKSRAELLQTLSD  71

Query  463   SEAELARICAALGEQP-VN--VRQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQ  633
             + AEL+ +  +LG++  VN    +SS ++K +L AI P LE++ ++K ER  +FS+V  Q
Sbjct  72    ANAELSSLTTSLGDKTFVNDIPDKSSGTIKEQLAAIAPALEQLWQQKDERVREFSDVQSQ  131

Query  634   IDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESLN  813
             I  +  E+         +  +DESDLSL++L+D +S L  LQKEKSDRL++VL+ + S++
Sbjct  132   IQKICGEIAGGLS--SEVPIVDESDLSLKKLDDFQSQLQELQKEKSDRLQKVLEFVSSVH  189

Query  814   SLCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHMLQN  987
              LC VLG+DF NT+ E+HP+L + + +  KS+S ET+ RL+  +  L++ K QRL  LQ 
Sbjct  190   DLCAVLGLDFLNTVTEVHPSLDEETGVEAKSISNETLSRLAKTVLALKDDKKQRLQKLQE  249

Query  988   LATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQEM  1167
             LAT +++LWNLMD P EE++LFD+VT  I+AS  E+T+P AL+ DL+K AE+EV RL ++
Sbjct  250   LATQLIDLWNLMDTPDEERELFDHVTCNISASVDEVTKPGALAHDLIKQAEVEVDRLDQL  309

Query  1168  KSSKMKEVLLKKRITLEELCRQAHLAID--DSIEFTDETIESGAIDPSHLLEQLEIQISN  1341
             K+S+MKE+  KK+  LEE+  +AH+  +   + E     I+SG ++P+ LL  ++ QI+ 
Sbjct  310   KASRMKEIAFKKQTELEEIYVRAHVETNPESARERIMSLIDSGNVEPTELLADMDSQIAK  369

Query  1342  VKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVNK  1521
              KEEAFSRK+IL++VEKW++ACEEESWLEDYNR+ NRY+  RG HL LKRAEKAR LV+K
Sbjct  370   AKEEAFSRKDILDRVEKWMSACEEESWLEDYNRDQNRYSASRGAHLNLKRAEKARVLVSK  429

Query  1522  IPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQGQ  1701
             IP M++ L ++ + WE E  + F YDGV LL+M ++ G+L+QE+E E++R R+QKK+Q Q
Sbjct  430   IPAMVDTLVAKTRAWEEEHNMSFAYDGVPLLAMFDECGMLRQEREDEKRRLREQKKVQEQ  489

Query  1702  LMAEQEVLFGSKRSPSQS-GKKNVVGGASNKRISVGGAMLQTPYTERAPLSSHSLKKINP  1878
                EQ+  F ++ SP++    K  VG  +N  +   G                      P
Sbjct  490   PHVEQDTAFSTRPSPARPVSAKKPVGARANNGVGANG---------------------TP  528

Query  1879  VKQQALANITQN---YVALSSGRRESSMHAKQPSCNKSNLQKTEPTQRKPLS  2025
              ++ +L N  QN    VA   GRRES      P+ N   + K E     P+S
Sbjct  529   NRRLSL-NANQNGSRSVAKEGGRRESLNRPAAPT-NYVAISKEEAASSPPVS  578



>gb|EPS69123.1| hypothetical protein M569_05644, partial [Genlisea aurea]
Length=498

 Score =   435 bits (1118),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 249/497 (50%), Positives = 362/497 (73%), Gaps = 9/497 (2%)
 Frame = +1

Query  301   LLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAESEAELA  480
             L   LQ +WNEIGE E  + KML ++E++CL+ Y+ ++D+A    AQL+  +AE+E+ELA
Sbjct  1     LFYFLQALWNEIGEDEAAKGKMLEEIERQCLDIYKTRIDEAKTYEAQLKHEMAETESELA  60

Query  481   RICAALGEQPVNVRQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQIDSVLKEL-  657
              I +A+GEQPV++RQ   +LK +L+AI P +EEM++RK++R++QF EVL++I  V  ++ 
Sbjct  61    AIFSAMGEQPVHIRQQHENLKAKLEAIGPHIEEMRRRKVDRENQFLEVLEEIKDVKHDIY  120

Query  658   GKSRKELQHMIALDES-DLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESLNSLCIVLG  834
             G    +  H I  +E+ DLS R+LE++ S L  L++EK  R+KQVLDHL +L+SLC VLG
Sbjct  121   GSDDVDSLHHIEFNEAADLSTRKLEELHSELQELRREKIVRMKQVLDHLSNLDSLCSVLG  180

Query  835   IDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQRLHMLQNLATTIVELW  1014
             ++ K     IHP+L +++  K+V+ +TI++L  A+  L+++K QR+  LQ+LA ++++LW
Sbjct  181   MESKTITNGIHPSLVETNHSKNVTDKTIQQLRLAVESLKDLKSQRMQKLQDLAASLLQLW  240

Query  1015  NLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQEMKSSKMKEVL  1194
             N MD  +EEQ+ F  VTR IAASE E+TEPN LS+D L   E EVSRL+E+K+S M E++
Sbjct  241   NSMDTRMEEQEPFHKVTRNIAASEDEITEPNFLSVDYLNLVEGEVSRLEELKASIMMELI  300

Query  1195  LKKRITLEELCRQAHLAIDD---SIEFTDETIESGAIDPSHLLEQLEIQISNVKEEAFSR  1365
             LKK+  LE++C++ HLA+ D   SIE +   +ESGAI+ SH+LEQ+E+ I+  KE+   R
Sbjct  301   LKKKEDLEDICQKTHLAVSDEYGSIETSIRDVESGAIEGSHVLEQIEVSIAKAKEDTLIR  360

Query  1366  KEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVNKIPGMLEAL  1545
             K++LE+VEKW  ACEEE WL++YN+++NRYN G+GTHL+LKRAEKARALVNK+P M+EAL
Sbjct  361   KDVLERVEKWQMACEEEIWLDEYNKDENRYNTGKGTHLVLKRAEKARALVNKLPAMVEAL  420

Query  1546  TSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQGQLMAEQEVL  1725
               +   WE      F YDGV LLSML QY ++++EKE E++ QRD+KKL G ++AEQEV+
Sbjct  421   IGKVAAWEESNRTEFTYDGVHLLSMLNQYMIMRREKEAEQKFQRDRKKLHGHIVAEQEVV  480

Query  1726  FGSKRSPS----QSGKK  1764
                ++ PS    QS KK
Sbjct  481   VTKQQQPSLVKNQSFKK  497



>ref|XP_007139995.1| hypothetical protein PHAVU_008G076000g [Phaseolus vulgaris]
 gb|ESW11989.1| hypothetical protein PHAVU_008G076000g [Phaseolus vulgaris]
Length=702

 Score =   442 bits (1136),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 335/720 (47%), Positives = 444/720 (62%), Gaps = 63/720 (9%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             ETTC  LL ELQ IW+E+GE + +RD ML +++Q+CL+ YR KVD+A    AQ++Q + +
Sbjct  11    ETTCHLLLKELQIIWDEVGESDSQRDAMLLEIKQKCLDLYRNKVDEAKLYRAQIQQEITD  70

Query  463   SEAELARICAALGEQPVNVR-QSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQID  639
              E E+A ICAALGEQ ++   +S  SLK   + ++  LEEM+K K E+K QF+EVL  + 
Sbjct  71    YEGEIAGICAALGEQSLHFDPKSCGSLKKAREKVVSQLEEMRKLKTEKKKQFAEVLYHLK  130

Query  640   SVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESLNSL  819
             ++  EL  S+    +   LDE++LSL+RLE+++  LL LQ EK+ RLKQV D L +LNSL
Sbjct  131   NISIELHGSKVLDAY---LDENNLSLKRLEELQKQLLQLQNEKASRLKQVSDQLNTLNSL  187

Query  820   CIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQRLHMLQNLATT  999
             C VLG+D K+ I EI PT+ +SS  K VS  TI+ L++ I  LRE+KI R+  LQ+LA  
Sbjct  188   CSVLGLDVKDKICEICPTMVNSSLTKDVSDNTIKNLTSEIQSLREIKIHRMQKLQSLAVA  247

Query  1000  IVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQEMKSSK  1179
             ++E+W+LMD P+EEQQ F +VT  IAA ESE  E   LS+D +   E EV RLQE+KS K
Sbjct  248   LLEMWDLMDTPLEEQQKFLHVTSKIAALESEFAESKILSIDSVIYVEKEVERLQELKSIK  307

Query  1180  MKEVLLKKRITLEELCRQAHLAI------DDSIEFTDETIESGAIDPSHLLEQLEIQISN  1341
             MKE+LLKK++ LEE+CR+ HL          S+EF D              +Q+E  I+ 
Sbjct  308   MKELLLKKKLKLEEICRKTHLTTQTVLPGQHSLEFLD-------------YDQIEHLITK  354

Query  1342  VKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVNK  1521
               EEA  RKEILEKVEKW AAC+EESWLE+YNR+DNRYN GRG HL LKRAEKARAL++K
Sbjct  355   TNEEALGRKEILEKVEKWFAACQEESWLEEYNRDDNRYNSGRGVHLALKRAEKARALLSK  414

Query  1522  IPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQGQ  1701
             IPG++EA+ S+ K WE ERG  FLYDG  LLS+LE Y +L+QEKE ER R RDQKKLQGQ
Sbjct  415   IPGLVEAIISKVKAWEKERGQDFLYDGSRLLSILEDYSILRQEKENERLRHRDQKKLQGQ  474

Query  1702  LMAEQEVLFGSKRSPSQS----GKKNVVGGASNKRISVGGAMLQTPYTERAPLSSHSLKK  1869
             LMAE E LFGSK SPS        +   G  S ++ S+GGAMLQ      A L   S KK
Sbjct  475   LMAEHETLFGSKPSPSSKSGYKASRCSTGIPSIRKFSIGGAMLQDQ--RHASLVHQSNKK  532

Query  1870  INPVKQQA--LANITQNYVALSSGRRES---SMHAKQPSCNKSNLQKTEPTQRKPLSPIS  2034
              N    +   L N    +   SSG   S       K  S  + N++      RKPLSP+S
Sbjct  533   GNITNHKGSILRNKNIYHSTQSSGNDNSKAVGHSVKTASSAEKNIEILSSLTRKPLSPLS  592

Query  2035  SLSFNTSSANIMDKISESE----ELREMPASLLTTPIKN--VSGIGGNATPKtmpipmps  2196
                 +T++ + + +   S+      ++    L  TP     ++G   N TPK M +P+P+
Sbjct  593   PAVLSTTNISNLQEDHNSKLQNVATQQKSQMLTATPPSRPYIAGAEENMTPKNMTLPVPT  652

Query  2197  tpasaassiamQMGMTPAP-VAATTPMVGHDGV----------EYSYEEMRAGFLLPRLH  2343
             TP            +T  P + ATTP   + G           EYS+EE+RAGF+LP+ +
Sbjct  653   TP------------LTSIPMLTATTPDTVYSGTTASSKTSQSFEYSFEEVRAGFMLPKTY  700



>ref|XP_008227009.1| PREDICTED: 65-kDa microtubule-associated protein 1 isoform X1 
[Prunus mume]
Length=608

 Score =   438 bits (1126),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 263/559 (47%), Positives = 380/559 (68%), Gaps = 42/559 (8%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             E TC SLL +LQ+IWNE+GE + ERDKML QLEQECL+ Y+RKV+ A+ S AQL QA+++
Sbjct  13    EITCGSLLQKLQEIWNEVGESDEERDKMLLQLEQECLDVYKRKVELAAMSRAQLLQALSD  72

Query  463   SEAELARICAALGEQP-VNV-RQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQI  636
             ++ EL+ + +ALGE+  V V  ++S ++K +L AI P+LE++ K+K +R  +FS+V  QI
Sbjct  73    AKLELSSLVSALGEKSFVGVPEKTSGTIKEQLAAIAPVLEQLWKQKEDRVKEFSDVQSQI  132

Query  637   DSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESLNS  816
               +  E+  +   L    A+DESDLSL++L++ +S L  LQKEKS+RL +VL+ + +++ 
Sbjct  133   QKICGEIAGNLN-LSESPAVDESDLSLKKLDEYQSQLHDLQKEKSERLHKVLEFVSTVHD  191

Query  817   LCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHMLQNL  990
             LC VLG+DF +T+ E+HP+L DS+ +  KS+S +T+ RL+  +  L+E K QRLH LQ  
Sbjct  192   LCAVLGLDFLSTVTEVHPSLNDSTGVQSKSISNDTLSRLAKTVLALKEDKKQRLHKLQES  251

Query  991   ATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLK-------------  1131
             AT +++LWNLMD P EE+  +D+VT  I+AS  E+T P AL+ DL++             
Sbjct  252   ATQLLDLWNLMDTPDEERGFYDHVTCNISASVDEVTVPGALAWDLIEQVFMHMMFSGLLK  311

Query  1132  --------------SAEIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAIDDSI--E  1263
                             E+EV RL ++KSS+MKE+  KK+  LEE+  +AH+ ID     E
Sbjct  312   QFMMAVYSFLDFVLKTEVEVERLDQLKSSRMKEIAFKKQSELEEIFTRAHIEIDPEAARE  371

Query  1264  FTDETIESGAIDPSHLLEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrn  1443
                E I+SG ++P+ LL  ++ QI+  ++EA SRK+IL+KVEKW++ACEEESWLEDYNR+
Sbjct  372   KIMELIDSGNVEPTELLADMDDQIAKARDEALSRKDILDKVEKWMSACEEESWLEDYNRD  431

Query  1444  dnrynggrgTHLMLKRAEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSML  1623
             +NRYN  RG HL LKRAEKAR LVNKIP +++ L ++ +GWE +RG+ F YDGV LL+ML
Sbjct  432   ENRYNASRGAHLNLKRAEKARILVNKIPALVDTLVAKTRGWEEDRGISFTYDGVPLLAML  491

Query  1624  EQYGLLKQEKELERQRQRDQKKLQGQLMAEQEVLFGSKRSPSQS-GKKNVVGGASNKRIS  1800
             ++Y +L+Q++E E++R RDQKK Q     EQE +FGSK SP++  G K VVG  +N    
Sbjct  492   DEYAMLRQDREEEKRRMRDQKKYQELQHTEQETIFGSKPSPARPVGTKKVVGPRAN----  547

Query  1801  VGGAMLQTPYTERAPLSSH  1857
               G    TP + R  L++H
Sbjct  548   --GGPNGTP-SRRLSLNAH  563



>ref|XP_002864778.1| microtubule associated protein family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH41037.1| microtubule associated protein family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=547

 Score =   436 bits (1120),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 268/553 (48%), Positives = 392/553 (71%), Gaps = 24/553 (4%)
 Frame = +1

Query  277   RMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAV  456
             ++E+TC SLL +L+ IWNE+GE E ER+K+L ++E+EC E Y RK+++      +++Q +
Sbjct  5     QIESTCASLLQQLEIIWNEVGETETEREKVLIEIEEECREVYNRKIEKFKEERIRIKQEI  64

Query  457   AESEAELARICAALGEQPVNVRQ------SSRSLKTELQAIMPlleemkkrklerkHQFS  618
             A+SEA +  IC+ + E P+  RQ      + RSLK EL  I+  LEEM+KRK ERK QF 
Sbjct  65    ADSEARVIDICSVMDEPPILGRQHQSDQQNGRSLKDELVKILQKLEEMEKRKSERKKQFI  124

Query  619   EVLDQIDSVLKEL-GKSRKE-LQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVL  792
             +V++ I  V  E+ G+S +       ++DESDLSLR+LE++   L +LQ++K +R+KQ+ 
Sbjct  125   QVIEDIRCVRDEINGESYQSTCSSDFSVDESDLSLRKLEELHRELYTLQEQKRNRVKQIQ  184

Query  793   DHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQRL  972
             DHL++L SLC VLG++F+ T+  IHP+L +S   +S+S ET+++L+ +I    E+KIQR+
Sbjct  185   DHLKTLESLCSVLGLNFRETVTTIHPSLVESEGSRSISNETLDKLALSIKNWHEIKIQRM  244

Query  973   HMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVS  1152
               LQ+L TT++E WNLMD P EEQQ F +V+  IAA+ SE+T+PN+LS+DLL+  + E+ 
Sbjct  245   QELQDLVTTMLEFWNLMDTPAEEQQKFMDVSCNIAATVSEITKPNSLSIDLLEEVKAELC  304

Query  1153  RLQEMKSSKMKEVLLKKRITLEELCRQAHLAI----DDSIEFTDETIESGAIDPSHLLEQ  1320
             RL+E+K SKMKE++LKKR  LEE+CR+ H+ +    D ++E   + IESG ++P ++LEQ
Sbjct  305   RLEELKWSKMKELVLKKRSELEEICRRTHIVLEEEEDIAVENVIKAIESGDVNPENILEQ  364

Query  1321  LEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEK  1500
             +E +   VKEEA SRKEILEK EKWL ACEEE+WLE+YN+++NRYN G+G+HL+LKRAEK
Sbjct  365   IEYRAGKVKEEALSRKEILEKAEKWLNACEEENWLEEYNQDENRYNAGKGSHLILKRAEK  424

Query  1501  ARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRD  1680
             ARALVNK+P M+EAL S+   WE E+   FL+DG  LLSMLE+Y  L++EKE ER+R+RD
Sbjct  425   ARALVNKLPAMVEALASKITIWESEKESEFLFDGNRLLSMLEEYSELREEKEQERRRKRD  484

Query  1681  QKKLQGQLMAEQEVLFGSKRSPSQSGKKNVVGGASNKRISVGGAMLQTPYTERA--PLSS  1854
              KKLQGQ+++EQ+   G+   P QS KK +       ++S     + +P+T RA  P S+
Sbjct  485   LKKLQGQVISEQDK--GNVTKP-QSAKKGL-------KVSTNKRFVSSPHTPRADSPQSA  534

Query  1855  HSLKKINPVKQQA  1893
              S +   P+ + +
Sbjct  535   KSNQYFTPLSRHS  547



>ref|XP_006656241.1| PREDICTED: 65-kDa microtubule-associated protein 1-like [Oryza 
brachyantha]
 gb|ACN85324.1| microtubule-associated protein MAP65-1a [Oryza brachyantha]
Length=580

 Score =   437 bits (1123),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 258/531 (49%), Positives = 365/531 (69%), Gaps = 21/531 (4%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             ETTC SLL +LQ IW+E+GE + +RD ML QLEQECL+ YRRKVDQAS S A L Q +A 
Sbjct  13    ETTCGSLLQQLQLIWDEVGETDDDRDNMLLQLEQECLDVYRRKVDQASNSRALLLQQLAN  72

Query  463   SEAELARICAALGEQPVNV--RQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQI  636
             +++EL+R+  ALGE  V+    +++ ++K +L AI P LE++ + K +R  +F++V  QI
Sbjct  73    AKSELSRVLCALGELSVSGIPDKTNGTIKEQLAAISPFLEKLCREKDKRVREFADVQLQI  132

Query  637   DSVLKELGKSRKELQHMIA--LDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESL  810
              ++  E+  S +  +HM    ++E DLS ++L +    L  LQKEKS+RL ++LD + S+
Sbjct  133   QTIRGEIAGSLQVGEHMETPRVNEGDLSTKKLNEFLYELQVLQKEKSNRLHKILDLVSSV  192

Query  811   NSLCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHMLQ  984
             + LC VLG+DF +T+ E+HP+L DS     KS+S  T+ +LS  + EL+E K++RL  +Q
Sbjct  193   HDLCSVLGMDFLSTVTEVHPSLNDSVGAESKSISDATLSKLSKMVIELKEEKLKRLEKIQ  252

Query  985   NLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQE  1164
              LA+ + +LWNLMD  VEE+ LF +VT  +++   E+T P AL LDL+K AE+EV RL +
Sbjct  253   ALASQLTDLWNLMDTSVEERHLFHHVTCNMSSILDEVTVPGALDLDLIKQAELEVERLDQ  312

Query  1165  MKSSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHLLEQLEIQIS  1338
             +K+S+MK++  K++  LE++  QAH+AID S   +     I+S   +PS LL  +E QI 
Sbjct  313   LKASRMKDIAFKRQTELEDIYAQAHIAIDTSAARDRILTVIDSSMFEPSELLADMENQIL  372

Query  1339  NVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVN  1518
               KEEA SRK+ILEKV++W++ACEEESWLEDY+R+DNRY+  RG HL LKRAEKAR LV+
Sbjct  373   KAKEEALSRKDILEKVDRWMSACEEESWLEDYSRDDNRYSATRGAHLNLKRAEKARVLVS  432

Query  1519  KIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQG  1698
             KIP +++ L ++ + WE E G PF YDGV LL+ML++Y +L+QEKE E++R RDQKK+  
Sbjct  433   KIPAIVDTLMTKTRAWEQEHGTPFNYDGVHLLAMLDEYKILRQEKEEEKRRMRDQKKIND  492

Query  1699  QLMAEQEVLFGSKRSP--SQSGKK--------NVVGGASNKRISV---GGA  1812
             QL AEQE LFGSK SP   QS +K            G  N+R+SV   GG 
Sbjct  493   QLAAEQEKLFGSKPSPVRPQSSRKMPGPRANGGAANGTPNRRLSVHQNGGG  543



>ref|XP_009760793.1| PREDICTED: 65-kDa microtubule-associated protein 1-like [Nicotiana 
sylvestris]
Length=580

 Score =   437 bits (1123),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 266/561 (47%), Positives = 392/561 (70%), Gaps = 23/561 (4%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             ETTC SLL +LQ+IW+E+GE + ERD ML Q++QECL+ Y+RKVDQA +S A L QA+A+
Sbjct  13    ETTCGSLLQKLQQIWDEVGETDDERDNMLLQIDQECLDVYKRKVDQAVKSRAHLLQALAD  72

Query  463   SEAELARICAALGEQP-VNV-RQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQI  636
             ++ EL+R+ ++LGE+  V +  ++S ++K +L AI P LE++ ++K +R  +F +V  QI
Sbjct  73    AKLELSRLLSSLGEKTYVGIPEKTSGTIKEQLAAIAPALEKLWEQKDDRIKEFFDVQSQI  132

Query  637   DSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESLNS  816
               +  E+  + ++++ +  +DESDLSL++L++ ++ L  LQKEKS+RL +VL+ + +++ 
Sbjct  133   QKISSEIAGTCEQVESL-TVDESDLSLKKLDEFQAQLQELQKEKSERLHKVLELVSTVHD  191

Query  817   LCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHMLQNL  990
             LC VLG+DF +T+ E+HP+L DS+ +  KS+S +T+  L+  +  L+E K QRLH LQ L
Sbjct  192   LCAVLGMDFFSTVTEVHPSLNDSTGVQSKSISNDTLSSLAKTVLVLKEDKKQRLHKLQEL  251

Query  991   ATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQEMK  1170
             AT +++LWNLMD P EE+ LFD+VT  I+AS  E+  P AL+LDL++ AE+EV RL ++K
Sbjct  252   ATQLIDLWNLMDTPEEERSLFDHVTCNISASVDEVAIPGALALDLIEQAEVEVERLDQLK  311

Query  1171  SSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHLLEQLEIQISNV  1344
             +SKMKE+  K++  LE++  +AH+ ID     E     I+SG +DP+ LL  ++ QI N 
Sbjct  312   ASKMKEIAFKRQAELEDIYARAHVEIDTEAAREKIMALIDSGNVDPAELLADMDNQIVNA  371

Query  1345  KEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVNKI  1524
             KEEA SRKEIL+KVEKW+AACEEESWLEDYNR+DNRYN  RG HL LKRAEKAR LVNKI
Sbjct  372   KEEAHSRKEILDKVEKWMAACEEESWLEDYNRDDNRYNASRGAHLNLKRAEKARILVNKI  431

Query  1525  PGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQGQL  1704
             P ++++L ++ + WE ER   F YDGV LL+ML++Y +L+ ++E E++R RDQKK   Q+
Sbjct  432   PALVDSLVAKTRAWEQERDTTFTYDGVPLLAMLDEYMMLRHDREEEKRRLRDQKKFHEQI  491

Query  1705  MAEQEVLFGSKRSPSQS-GKKNVVGGASNKRISVGGAMLQTPYTERAPLSSH-----SLK  1866
              +++E +FGS  SP++  G K V G  SN     G A    P + R  L+SH     S  
Sbjct  492   -SKEETVFGSTPSPARPLGPKKVTGPRSN-----GSA--NGPTSRRLSLNSHQNGSRSTN  543

Query  1867  KINPVKQQALANITQNYVALS  1929
             K      + +A +  NYVA++
Sbjct  544   KDGKRDTRPIAPL--NYVAMT  562



>ref|XP_004294398.1| PREDICTED: 65-kDa microtubule-associated protein 1-like [Fragaria 
vesca subsp. vesca]
Length=582

 Score =   436 bits (1121),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 271/559 (48%), Positives = 387/559 (69%), Gaps = 19/559 (3%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             ETTC SLL +LQ+IW+E+GE + +RD+ML QLEQECL+ Y+RKV+ A++S AQL QA+++
Sbjct  11    ETTCGSLLQKLQEIWDEVGESDEQRDRMLLQLEQECLDVYKRKVELAAKSRAQLLQALSD  70

Query  463   SEAELARICAALGEQP-VNV-RQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQI  636
                EL+ + +ALGE+  V    ++S ++K +L AI P LE++ K+K ER  QF++V  QI
Sbjct  71    GRVELSTLQSALGEKSSVGFPEKTSGTIKEQLAAIAPALEQLWKQKEERVTQFADVQSQI  130

Query  637   DSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESLNS  816
               +  E+  +   L    A+DESDLSL++L++ +S L  LQKEKSDRL+QVL+++ +++ 
Sbjct  131   QKICGEIAGNLS-LGETPAVDESDLSLKKLDEYQSQLQDLQKEKSDRLQQVLEYVSTVHD  189

Query  817   LCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHMLQNL  990
             LC VLGIDF +T+ E+HP+L DS+ +  KS+S +T+ RL   +  L E K QRLH LQ  
Sbjct  190   LCAVLGIDFYSTVTEVHPSLNDSTGVQSKSISNDTLSRLDQTVLALEEDKKQRLHKLQES  249

Query  991   ATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQEMK  1170
             A  +++LWNLMD P EE++LFD+VT  I+AS  E+T P AL+ DL++  E+EV RL ++K
Sbjct  250   AAQLIDLWNLMDTPEEERKLFDHVTCNISASVDEVTVPGALAADLIEQTEVEVERLDQLK  309

Query  1171  SSKMKEVLLKKRITLEELCRQAHLAIDDSIEFTD--ETIESGAIDPSHLLEQLEIQISNV  1344
             +S+MKE+  KK+  LEE+  +AH+ ID         E I+SG+++P+ LL  ++ QI+  
Sbjct  310   ASRMKEIAFKKQGELEEIFARAHIEIDTEAARGKIMELIDSGSVEPTELLADMDDQIAKA  369

Query  1345  KEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVNKI  1524
             K+EA SRK+IL+KVEKW++ACEEESWLEDYNR++NRYN  RG HL LKRAEKAR LVNKI
Sbjct  370   KDEALSRKDILDKVEKWMSACEEESWLEDYNRDENRYNASRGAHLNLKRAEKARILVNKI  429

Query  1525  PGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQGQL  1704
             P ++++L ++ + WE ERG+ F YDGV LL+ML++Y +L+QE+E E++R RDQKK+Q   
Sbjct  430   PALVDSLVAKTRVWEEERGISFTYDGVPLLAMLDEYAMLRQEREEEKRRLRDQKKIQELQ  489

Query  1705  MAEQEVLFGSKRSPSQS--GKKNVVGGASNKRISVGGAMLQTPYTERAPLSSHSLKK--I  1872
               +QE +FGSK SPS    G K VVG  +N      G    TP   R  L++H   +  +
Sbjct  490   HTDQESVFGSKPSPSPRPVGTKKVVGPRAN------GGPNGTP--RRLSLNAHQNGRSAV  541

Query  1873  NPVKQQALANITQNYVALS  1929
                K+        NYV LS
Sbjct  542   KDAKRDPRPVAPLNYVELS  560



>gb|KDP39198.1| hypothetical protein JCGZ_00955 [Jatropha curcas]
Length=583

 Score =   436 bits (1121),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 269/574 (47%), Positives = 399/574 (70%), Gaps = 20/574 (3%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             ETTC +LL +LQ+IW+E+GE + +RDKML Q+EQECL+ Y++KV+QA++S AQL +A+++
Sbjct  13    ETTCGTLLQKLQEIWDEVGESDEDRDKMLLQIEQECLDVYKKKVEQAAKSRAQLLEALSD  72

Query  463   SEAELARICAALGEQP-VNV-RQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQI  636
             ++ ELA + +ALGE+  V +  ++S ++K +L AI P LE++ K+K ER  +FS+V  QI
Sbjct  73    AKIELASLLSALGEKSFVGMPEKTSGTIKEQLAAIAPALEQLWKQKEERVKEFSDVQSQI  132

Query  637   DSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESLNS  816
               +  E+  +   +    A+DE+DLSL++L++  + L  LQKEKSDRL++VL+ + S++ 
Sbjct  133   QKICGEIAGNLN-VNETPAVDETDLSLKKLDEYHARLQELQKEKSDRLQKVLEFVSSVHD  191

Query  817   LCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHMLQNL  990
             LC VLG+DF +T+ E+HP+L DS+ +  KS+S +T+  L+  +  L E K QRLH LQ L
Sbjct  192   LCAVLGLDFFSTVTEVHPSLNDSTGMQSKSISNDTLASLANTVLTLNEDKKQRLHKLQEL  251

Query  991   ATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQEMK  1170
             A  +++LWNLMD   EE++LF++VT  I+AS  E+T P AL++DL++ AE+EV RL ++K
Sbjct  252   ANQLIDLWNLMDTSEEERELFNHVTCNISASVDEVTVPGALAMDLIEQAEVEVERLDQLK  311

Query  1171  SSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHLLEQLEIQISNV  1344
             +S+MKE+  KK+  LE++  +AH+ +D     E     I+SG ++P+ LL  ++ QIS  
Sbjct  312   ASRMKEIAFKKQAELEDIYTRAHIEVDPEAAREKIMALIDSGNVEPAELLADMDNQISKA  371

Query  1345  KEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVNKI  1524
             KEEA SRKEIL+KVEKW++ACEEESWLEDYNR++NRYN  RG HL LKRAEKAR LVNKI
Sbjct  372   KEEALSRKEILDKVEKWMSACEEESWLEDYNRDENRYNASRGAHLNLKRAEKARILVNKI  431

Query  1525  PGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQGQL  1704
             P ++E+L ++ + WE +RG+ F YDGV LL+ML++Y +L+QE+E E++R RDQKK   Q 
Sbjct  432   PALVESLVAKTQTWEEDRGIQFAYDGVPLLAMLDEYAMLRQEREEEKRRLRDQKKFHEQQ  491

Query  1705  MAEQEVLFGSKRSPSQS-GKKNVVGGASNKRISVGGAMLQTPYTERAPLSSHSLKKINPV  1881
               EQE +FGS+ SP++  G K VVG  +N     GGA   TP + R  L++H     +  
Sbjct  492   STEQEAIFGSRPSPARPVGTKKVVGPRTN-----GGAN-GTP-SRRLSLNAHQNGSRSST  544

Query  1882  KQQALANITQ-----NYVALSSGRRESSMHAKQP  1968
             K+    + ++     NYVA+S     S +    P
Sbjct  545   KEGRRDSTSRPAAPVNYVAISKEDAASHISGTDP  578



>gb|EPS64691.1| hypothetical protein M569_10086 [Genlisea aurea]
Length=583

 Score =   436 bits (1120),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 251/511 (49%), Positives = 363/511 (71%), Gaps = 14/511 (3%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             + TC +LL +LQ+IW+E+GE + ERDKML QLEQECL+ Y+RKV+ A +S A L Q++A+
Sbjct  13    QVTCSTLLQQLQQIWDEVGESDEERDKMLLQLEQECLDVYKRKVELAVKSRAHLLQSLAD  72

Query  463   SEAELARICAALGEQPVN--VRQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQI  636
             +  ELA + +ALGE+       ++S ++K +L +I P LE++  +K ER ++  +V  QI
Sbjct  73    ARVELANLQSALGEKTYAGFSERNSGTIKEQLASIAPALEKLWAQKDERMNELFDVQSQI  132

Query  637   DSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESLNS  816
               +  E+  +   + + + +DESDLSL++L++  + L  LQKEKSDRL +VLD + +++ 
Sbjct  133   QKINSEISGTNDAVVNPV-VDESDLSLKKLDEFHAQLQELQKEKSDRLHKVLDFVSTVHD  191

Query  817   LCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHMLQNL  990
             LC VLG+DF  T+ E+HP+L DS+A+  KS+S ET+ RL+  +  L+E K +RL  LQ+L
Sbjct  192   LCAVLGVDFFATVTEVHPSLNDSTAVQSKSISNETLSRLAKTVLSLKEDKKKRLGKLQDL  251

Query  991   ATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQEMK  1170
             AT +++LWNLMD P EE+ LFD+VT  I+AS  E+T P AL+ DL++ A +EV RL ++K
Sbjct  252   ATQLIDLWNLMDTPPEERILFDHVTCNISASVDEVTIPGALARDLIEEAVVEVDRLDQLK  311

Query  1171  SSKMKEVLLKKRITLEELCRQAHLAIDDSIEFTDETI----ESGAIDPSHLLEQLEIQIS  1338
             +S+MKE+  K++  LE++   AH+ ID   E T E I    +SG+++P  LL  ++ QI 
Sbjct  312   ASRMKEIAFKRQAELEDIYACAHVEID--TEATREKILSLIDSGSVEPQELLADMDDQIQ  369

Query  1339  NVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVN  1518
               KEEA SRK+IL+KVEKW++ACEEESWLEDYNR++NRYN  RG HL LKRAEKAR LVN
Sbjct  370   KAKEEALSRKDILDKVEKWMSACEEESWLEDYNRDENRYNASRGAHLNLKRAEKARLLVN  429

Query  1519  KIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQG  1698
             KIP ++++L S+ + WE +RG+ F YDGV LL+ML++Y +L+Q++E E++R RDQKK   
Sbjct  430   KIPALVDSLVSKTRAWEHDRGLTFAYDGVPLLAMLDEYTMLRQDREEEKKRMRDQKKFHE  489

Query  1699  QLMAEQEVLFGSKRSPSQ-SGKKNVVGGASN  1788
             Q+  EQE +FGS  SP Q S  K VVG   N
Sbjct  490   QMNKEQEAIFGS--SPRQLSSTKKVVGPRMN  518



>gb|KHG26044.1| 65-kDa microtubule-associated 1 -like protein [Gossypium arboreum]
Length=581

 Score =   434 bits (1116),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 257/517 (50%), Positives = 371/517 (72%), Gaps = 12/517 (2%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             E TC SL+ +LQ+IW+E+GE + ERDKML Q+EQECL+ Y+RKV+QA+ S AQL Q +++
Sbjct  11    EITCGSLMQKLQEIWDEVGESDEERDKMLLQIEQECLDVYKRKVEQAANSRAQLLQVLSD  70

Query  463   SEAELARICAALGEQP-VNV-RQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQI  636
             ++ EL+ + +ALG++  V +  ++S ++K +L AI P LE + K+K ER  +FS+V  QI
Sbjct  71    AKLELSTLVSALGDKSSVGIPEKASETIKEQLAAIAPALERLWKQKEERVKEFSDVRSQI  130

Query  637   DSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESLNS  816
               +  E+  +  E    + +DESDLSL++L++ +  L  LQKEKSDRL +VL+ + +++ 
Sbjct  131   QKICGEIAGNASEQTGALVVDESDLSLKKLDEYQVKLKELQKEKSDRLNKVLEFVSTVHD  190

Query  817   LCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHMLQNL  990
             LC VLG+DF +TI E+H +LGDS+ +  KS+S +T+ RL+  +  L E K QRLH LQ L
Sbjct  191   LCAVLGMDFFSTITEVHSSLGDSTGVQSKSISNDTLSRLAETVSALNEDKKQRLHKLQEL  250

Query  991   ATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQEMK  1170
             AT +++LWNLMD P EE++LFD+VT   +A   ++T P AL+LDL++ AE+EV RL ++K
Sbjct  251   ATQLIDLWNLMDTPEEERRLFDHVTCNSSALVDKVTVPGALALDLIEQAEVEVDRLDKLK  310

Query  1171  SSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHLLEQLEIQISNV  1344
             SS+MKE+ LK+++ LE++    H+ ID     E     I+SG ++P+ LL  ++ QI   
Sbjct  311   SSRMKEIALKRQLELEKIFASVHIEIDPEAAREKIMALIDSGNVEPTELLADMDNQIMKA  370

Query  1345  KEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVNKI  1524
             KEEA SRKEIL++VEKW++ACEEESWLEDYNR++NRYN  RG HL LKRAEKAR LVNKI
Sbjct  371   KEEALSRKEILDRVEKWMSACEEESWLEDYNRDENRYNASRGAHLNLKRAEKARILVNKI  430

Query  1525  PGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQGQL  1704
             PGM++ L ++ + WE +RG+ F+YDGV LL+ML++Y +L+QE+E E++R R QKK+  Q 
Sbjct  431   PGMVDTLVAKTRAWEEDRGISFMYDGVPLLAMLDEYAMLRQEREEEKRRLRGQKKVSEQQ  490

Query  1705  MAEQEVLFGSKRSPSQ-SGKKNVVGGASNKRISVGGA  1812
               EQE  FGS+ SP + +G K VVG  +N     GGA
Sbjct  491   NMEQETAFGSRLSPVRPAGPKKVVGPRAN-----GGA  522



>ref|XP_010433442.1| PREDICTED: 65-kDa microtubule-associated protein 2-like [Camelina 
sativa]
Length=578

 Score =   433 bits (1114),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 248/522 (48%), Positives = 370/522 (71%), Gaps = 14/522 (3%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             E TC +LL +LQ+IW+E+GE + ERDK+L Q+E+ECL  Y++KV+QA++S A+L Q +++
Sbjct  13    EFTCGTLLQKLQEIWDEVGESDEERDKLLLQIEEECLNVYKKKVEQAAKSRAELLQTLSD  72

Query  463   SEAELARICAALGEQP-VNV-RQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQI  636
             +  EL+ + +ALGE+  +++  +SS ++K +L AI P LE++ ++K ER   FS+V  QI
Sbjct  73    ATVELSNLTSALGEKSYIDIPDKSSGTIKEQLSAIAPALEQLWQQKEERVRAFSDVQSQI  132

Query  637   DSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESLNS  816
               + +E+        H++  DESDLSL+RL+D +  L  LQKEKSDRL++VL+ + +++ 
Sbjct  133   QKICEEIAGGLNNGPHVV--DESDLSLKRLDDFQRKLQELQKEKSDRLQKVLEFVSTVHD  190

Query  817   LCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHMLQNL  990
             LC VLG+DF +T+ E+HP+L +++ +  KS+S ET+ RL+  +  L+E KIQRL  LQ L
Sbjct  191   LCAVLGLDFLSTVTEVHPSLDEANGVQTKSISNETLARLAKTVLTLKEDKIQRLKKLQEL  250

Query  991   ATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQEMK  1170
             AT + +LWNLMD P EE++LFD+VT  I+AS  E+T   AL+LDL++ AE+EV RL ++K
Sbjct  251   ATQLTDLWNLMDTPDEERELFDHVTCNISASVHEVTVSGALALDLIEQAEVEVDRLDQLK  310

Query  1171  SSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHLLEQLEIQISNV  1344
             SS+MKE+  KK+  LEE+  +AH+ +   +  E     I++G  +PS LL  ++ QI+  
Sbjct  311   SSRMKEIAFKKQTELEEIYARAHIEVKPEVVRERIMSLIDAGNTEPSELLADMDSQIAKA  370

Query  1345  KEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVNKI  1524
             KEEAFSRKEIL++VEKW++ACEEESWLEDYNR+ NRY+  RG HL LKRAEKAR LV+KI
Sbjct  371   KEEAFSRKEILDRVEKWMSACEEESWLEDYNRDQNRYSASRGAHLNLKRAEKARILVSKI  430

Query  1525  PGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQGQL  1704
               M++ L ++ + WE +  + F YDGV LL+ML++Y +L+QE+E E++R ++QKK Q Q 
Sbjct  431   TAMVDTLVAKTRAWEEDNSMSFEYDGVPLLAMLDEYTMLRQEREDEKRRLKEQKKQQEQP  490

Query  1705  MAEQEVLFGSKRSPSQS-GKKNVVGGASNKRISVGGAMLQTP  1827
               +Q+  FGSK SP++    K  VG  +N     GG + +TP
Sbjct  491   HTDQDSAFGSKPSPARPISAKKPVGTRAN-----GGGLNETP  527



>ref|XP_010438700.1| PREDICTED: 65-kDa microtubule-associated protein 2-like [Camelina 
sativa]
Length=578

 Score =   433 bits (1114),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 247/522 (47%), Positives = 370/522 (71%), Gaps = 14/522 (3%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             E TC +LL +LQ+IW+E+GE + ERDK+L Q+E+ECL  Y++KV+QA++S A+L Q +++
Sbjct  13    EITCGTLLQKLQEIWDEVGESDEERDKLLLQIEEECLNVYKKKVEQAAKSRAELLQTLSD  72

Query  463   SEAELARICAALGEQP-VNV-RQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQI  636
             +  EL+ + +ALGE+  +++  +SS ++K +L AI P LE++ ++K ER   FS+V  QI
Sbjct  73    ATVELSNLTSALGEKSYIDIPDKSSGTIKEQLSAIAPALEQLWQQKEERVRAFSDVQSQI  132

Query  637   DSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESLNS  816
               + +E+        H++  DESDLSL+RL+D +  L  LQKEKSDRL++VL+ + +++ 
Sbjct  133   QKICEEIAGGLNNGPHVV--DESDLSLKRLDDFQRKLQELQKEKSDRLQKVLEFVSTVHD  190

Query  817   LCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHMLQNL  990
             LC VLG+DF +T+ E+HP+L +++ +  KS+S ET+ RL+  +  L+E K+QRL  LQ L
Sbjct  191   LCAVLGLDFLSTVTEVHPSLDEANGVQTKSISNETLARLAKTVLTLKEDKMQRLRKLQEL  250

Query  991   ATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQEMK  1170
             AT + +LWNLMD P EE++LFD+VT  I+AS  E+T   AL+LDL++ AE+EV RL ++K
Sbjct  251   ATQLTDLWNLMDTPDEERELFDHVTCNISASVHEVTVSGALALDLIEQAEVEVDRLDQLK  310

Query  1171  SSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHLLEQLEIQISNV  1344
             SS+MKE+  KK+  LEE+  +AH+ +   +  E     I++G  +PS LL  ++ QI+  
Sbjct  311   SSRMKEIAFKKQTELEEIYARAHIEVKPEVVRERIMSLIDAGNTEPSELLADMDSQIAKA  370

Query  1345  KEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVNKI  1524
             KEEAFSRKEIL++VEKW++ACEEESWLEDYNR+ NRY+  RG HL LKRAEKAR LV+KI
Sbjct  371   KEEAFSRKEILDRVEKWMSACEEESWLEDYNRDQNRYSASRGAHLNLKRAEKARILVSKI  430

Query  1525  PGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQGQL  1704
               M++ L ++ + WE +  + F YDGV LL+ML++Y +L+QE+E E++R ++QKK Q Q 
Sbjct  431   TAMVDTLVTKTRAWEEDNSISFEYDGVPLLAMLDEYTMLRQEREDEKRRLKEQKKQQEQP  490

Query  1705  MAEQEVLFGSKRSPSQS-GKKNVVGGASNKRISVGGAMLQTP  1827
               +Q+  FGSK SP++    K  VG  +N     GG + +TP
Sbjct  491   HTDQDSAFGSKPSPARPISAKKPVGTRAN-----GGGLNETP  527



>emb|CAD58680.1| 65kD microtubule associated protein [Daucus carota]
Length=576

 Score =   433 bits (1114),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 256/531 (48%), Positives = 371/531 (70%), Gaps = 22/531 (4%)
 Frame = +1

Query  271   SLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQ  450
             +L  ETTC SLL +LQ+IW+E+GE + ERDKML QLEQECL+ Y+RKVD A +S A L Q
Sbjct  9     TLLGETTCGSLLQQLQQIWDEVGESDAERDKMLLQLEQECLDVYKRKVDHAVKSRAHLLQ  68

Query  451   AVAESEAELARICAALGEQ-----PVNVRQSSRSLKTELQAIMPlleemkkrklerkHQF  615
             ++A+ + EL  + +ALGE+     P N   +S ++K +L AI P LE++ K+K ER  +F
Sbjct  69    SLADGQVELHSLMSALGEKTYVGIPDN---TSGTIKEQLSAIAPTLEQLWKQKDERIKEF  125

Query  616   SEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLD  795
             S+V  QI + + ++  + +++   + +DESDLSL++L++ ++ L  LQKEKSDRL +VL+
Sbjct  126   SDVQSQIQNDMCQITGTIEKVGSPV-VDESDLSLKKLDEFQAKLQELQKEKSDRLHKVLE  184

Query  796   HLESLNSLCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQR  969
              + +++ LC VL +DF +T+ E+HP+L DS  +  KS+S +T+ +L+  +  L E K QR
Sbjct  185   FVSTVHDLCAVLRMDFFSTVTEVHPSLDDSIGVQSKSISNDTLSQLAKTVLALEEDKEQR  244

Query  970   LHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEV  1149
             LH LQ LA  +++LWNLMD   EE+ LFD+VT  ++AS  E+T P AL+LDL++ AE+EV
Sbjct  245   LHKLQELAKQLIDLWNLMDTSEEERSLFDHVTCNVSASVDEVTIPGALALDLIEQAEVEV  304

Query  1150  SRLQEMKSSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHLLEQL  1323
              RL ++K+S+MKE+  K++  LEE+   AH+ ID     E     I+SG ++P+ LL+ +
Sbjct  305   ERLDQLKASRMKEIAFKRQAELEEIYVHAHVEIDSEAARERIMALIDSGDVEPAELLDDM  364

Query  1324  EIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKA  1503
             + QI   KEEA SRK+IL+KVEKW++ACEEESWLEDYNR+DNRYN  RG HL LKRAEKA
Sbjct  365   DNQIVKAKEEALSRKDILDKVEKWMSACEEESWLEDYNRDDNRYNASRGAHLNLKRAEKA  424

Query  1504  RALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQ  1683
             R LVNKIP ++E+L ++ + WE ERGV F YDGV LL+ML++Y +L+ ++E E++R +DQ
Sbjct  425   RILVNKIPALVESLVAKTRAWEEERGVSFTYDGVPLLAMLDEYAMLRNDREEEKRRMKDQ  484

Query  1684  KKLQGQL-MAEQEVLFGSKRSPSQS-GKKNVVG-------GASNKRISVGG  1809
             KK   Q   AEQE  F ++ SP++  G K  VG       G  N+R+S+  
Sbjct  485   KKFHEQTNAAEQETAFTARPSPARPVGTKKAVGSRANGANGTPNRRLSLNA  535



>ref|XP_010928150.1| PREDICTED: 65-kDa microtubule-associated protein 1-like [Elaeis 
guineensis]
 ref|XP_010928151.1| PREDICTED: 65-kDa microtubule-associated protein 1-like [Elaeis 
guineensis]
 ref|XP_010928152.1| PREDICTED: 65-kDa microtubule-associated protein 1-like [Elaeis 
guineensis]
 ref|XP_010928153.1| PREDICTED: 65-kDa microtubule-associated protein 1-like [Elaeis 
guineensis]
Length=589

 Score =   434 bits (1115),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 262/508 (52%), Positives = 363/508 (71%), Gaps = 11/508 (2%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             ETTC SLL +LQ IW+E+GE E ERDKML QLEQECL+ Y+RKVDQAS S   L Q++A+
Sbjct  13    ETTCGSLLQQLQLIWDEVGENEEERDKMLLQLEQECLDVYKRKVDQASSSRDVLLQSLAD  72

Query  463   SEAELARICAALGEQPVNVR---QSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQ  633
             ++ ELA + +AL E+  NV    +SS ++K +L AI P LE++ K+K ER  +F+++  Q
Sbjct  73    AKNELAGLLSAL-EEKTNVNTPEESSGTIKEQLAAIAPALEQLGKQKEERIKEFADIQSQ  131

Query  634   IDSVLKELGKSRK--ELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLES  807
             I  +  E+  + K  EL     +DE DLSL++LE+ ++ L  LQKEKSDRL +VLD + +
Sbjct  132   IQKICGEIAGNLKIGELVGTPTVDEDDLSLKKLEEYQTQLQELQKEKSDRLHKVLDLVST  191

Query  808   LNSLCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHML  981
             ++ LC VLG+DF +TI E+HP+L DS  +  KS+S +T+  L+  +  L E K  RL  L
Sbjct  192   VHDLCAVLGMDFYSTITEVHPSLDDSVGVQSKSISNDTLSMLARTVVALEEDKKMRLQKL  251

Query  982   QNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQ  1161
             Q LA  + +LWNLMD P+EEQ LFD+VT  ++A+  E+T P AL+LDL++ AE+EV RL 
Sbjct  252   QQLAAQLSDLWNLMDTPMEEQSLFDHVTCNMSATVYEVTVPGALALDLIEQAEVEVERLD  311

Query  1162  EMKSSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHLLEQLEIQI  1335
             ++K SKMKE+ LKK+  LEE+   AH+AID  +  E     I+SG ++PS L+  ++  I
Sbjct  312   QLKFSKMKEIALKKQSELEEIYAHAHIAIDSVVAQEKIMALIDSGNVEPSELIADMDSHI  371

Query  1336  SNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALV  1515
                KEEA SRKEILEKVE+W++ACEEESWLEDYNR++NRY+  RG HL LKRAEKAR LV
Sbjct  372   LKAKEEALSRKEILEKVERWMSACEEESWLEDYNRDENRYSSSRGAHLNLKRAEKARILV  431

Query  1516  NKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQ  1695
             NKIP +++ L ++ + WE +RG+ F+YDGV LL+ML++Y +L+ E+E E++R RDQK+  
Sbjct  432   NKIPALVDTLVAKTRTWEEDRGLSFMYDGVPLLAMLDEYVVLRHEREEEKRRLRDQKRFH  491

Query  1696  GQLMAEQEVLFGSKRSPSQ-SGKKNVVG  1776
              QL  EQE LFGS+ SP++ +G K VVG
Sbjct  492   EQLNTEQEALFGSRPSPNRPTGPKKVVG  519



>ref|XP_008811151.1| PREDICTED: 65-kDa microtubule-associated protein 1-like [Phoenix 
dactylifera]
Length=586

 Score =   434 bits (1115),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 262/507 (52%), Positives = 365/507 (72%), Gaps = 9/507 (2%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             E+TC SLL +LQ IW+E+GE E ERDKML QL+QECL+ Y+RKVD ASRS   L Q++ +
Sbjct  13    ESTCGSLLQQLQLIWDEVGESEEERDKMLLQLDQECLDVYKRKVDHASRSRDVLLQSLDD  72

Query  463   SEAELARICAALGEQP-VNV-RQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQI  636
             ++AELAR+ +ALGE+  VN   +SS ++K +L AI P LE++ K+K ER  +F++V  QI
Sbjct  73    AKAELARLLSALGEKTNVNTPEKSSGTIKEQLAAIAPALEQLGKQKEERMKEFADVRSQI  132

Query  637   DSVLKELGKSRK--ELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESL  810
               +  E+  + K  EL     +DE DLSL++L + ++ L  LQKEKSDRL +VLD + ++
Sbjct  133   QKICGEIAGNLKIGELVGTPTVDEDDLSLKKLNEYQTQLQELQKEKSDRLHKVLDFVSTV  192

Query  811   NSLCIVLGIDFKNTIGEIHPTLGDS--SALKSVSTETIERLSAAIHELREVKIQRLHMLQ  984
             + LC VLG+D  +TI E+HP+L DS  +  KS+S +T+ +L+  +  L E K  RL  LQ
Sbjct  193   HDLCAVLGMDLYSTITEVHPSLDDSLGAQSKSISNDTLSKLARTVVALEEDKKMRLQKLQ  252

Query  985   NLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQE  1164
              LAT + +LWNLMD P+EE+ LFD+VT  I+A   E+T P AL+LDL++ AE+EV RL +
Sbjct  253   QLATQLSDLWNLMDTPMEERSLFDHVTCNISAEVDEVTVPGALALDLIEQAEVEVERLDQ  312

Query  1165  MKSSKMKEVLLKKRITLEELCRQAHLAIDD--SIEFTDETIESGAIDPSHLLEQLEIQIS  1338
             +K SKMKE+ LKK+  LE++  +AH AID   + E     I+SG ++PS L+  ++  I 
Sbjct  313   LKFSKMKEIALKKQSELEDIYARAHRAIDSVAARERIIALIDSGNVEPSELIADMDNHIL  372

Query  1339  NVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVN  1518
               KEEA SRKEIL+KVE+W++ACEEESWLEDYNR++NRY+ GRG HL LKRAEKAR LVN
Sbjct  373   EAKEEALSRKEILDKVERWMSACEEESWLEDYNRDENRYSSGRGAHLNLKRAEKARILVN  432

Query  1519  KIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQG  1698
             KIP +++ L ++ + WE +RG+ F+YDGV LL+ML++Y +L+ E+E E++R RDQK+   
Sbjct  433   KIPALVDTLVAKTRTWEEDRGLSFMYDGVPLLAMLDEYVVLRHEREEEKRRMRDQKRFHE  492

Query  1699  QLMAEQEVLFGSKRSPSQ-SGKKNVVG  1776
             QL AEQE LFGS+ SP++  G K VVG
Sbjct  493   QLNAEQESLFGSRPSPNRPPGPKKVVG  519



>ref|XP_011097829.1| PREDICTED: 65-kDa microtubule-associated protein 1 [Sesamum indicum]
 ref|XP_011097830.1| PREDICTED: 65-kDa microtubule-associated protein 1 [Sesamum indicum]
 ref|XP_011097831.1| PREDICTED: 65-kDa microtubule-associated protein 1 [Sesamum indicum]
Length=581

 Score =   433 bits (1114),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 263/575 (46%), Positives = 384/575 (67%), Gaps = 18/575 (3%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             + TC SLL +LQ+IW+E+GE + ERDKML QLEQECL+ Y+RKVD A +S A L Q +A+
Sbjct  13    QITCGSLLQQLQQIWDEVGETDEERDKMLLQLEQECLDVYKRKVDHAVKSRAHLLQTLAD  72

Query  463   SEAELARICAALGEQP-VNV-RQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQI  636
             +  EL  + +ALGE+  V +  ++S ++K +L AI P LE++ K+K +R  +FS++  QI
Sbjct  73    ARVELTNLLSALGEKTYVGIPEKTSGTIKEQLAAIAPALEKLWKQKDDRVKEFSDIQSQI  132

Query  637   DSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESLNS  816
               +  E+  + + ++  + +DESDLS ++L++  + L  LQKEKS+RL +VL+ + +++ 
Sbjct  133   QKICAEIAGTSEPVESPV-VDESDLSTKKLDEFHAQLQDLQKEKSERLHKVLEFVSTVHD  191

Query  817   LCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHMLQNL  990
             LC VLG+DF  T+ E+HP+L DS  +  KS+S +T+ RL+  +  L+E K +RL  LQ L
Sbjct  192   LCAVLGMDFLMTVTEVHPSLNDSRGVQSKSISNDTLARLANTVLALKEDKKKRLQKLQEL  251

Query  991   ATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQEMK  1170
             AT +++LWNLMD P EE+ L  +VT  I+AS  E+T P AL+LD+++ AE+EV RL ++K
Sbjct  252   ATQLIDLWNLMDTPTEERSLSGHVTCNISASVDEVTVPGALALDVIEQAEVEVERLDQLK  311

Query  1171  SSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHLLEQLEIQISNV  1344
             +S+MKE+  KK+  LEE+   AH+ ID     E     I+SG  +P  LL  ++ QI   
Sbjct  312   ASRMKEIAFKKQAELEEIFAHAHIEIDTEAAREKILSIIDSGNFEPVELLADMDNQIVKA  371

Query  1345  KEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVNKI  1524
             KEEA SRK+IL+KVEKW++ACEEESWLEDYNR++NRYN  RG HL LKRAEKAR LVNKI
Sbjct  372   KEEAVSRKDILDKVEKWMSACEEESWLEDYNRDENRYNASRGAHLNLKRAEKARILVNKI  431

Query  1525  PGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQGQL  1704
             P ++++L ++ + WE +RGV F YDGV LL+ML++Y +L+ ++E E++R RDQKKL  QL
Sbjct  432   PALVDSLVAKTRAWEQDRGVTFTYDGVPLLAMLDEYVMLRHDREEEKKRLRDQKKLHEQL  491

Query  1705  MAEQEVLFGSKRSPS-QSGKKNVVGGASNKRISVGGAMLQTPYTERAPLSSH--SLKKIN  1875
               E +  FGS  SP+ Q   K VVG  +N     GGA   T  + R  L++H    + +N
Sbjct  492   NKEPDSPFGSTPSPARQPSTKKVVGPRAN-----GGANGST--SRRLSLNAHQNGSRSVN  544

Query  1876  -PVKQQALANITQNYVALSSGRRESSMHAKQPSCN  1977
                ++ +      NYVA+S     S +   +P  N
Sbjct  545   KDGRRDSRPGAPVNYVAMSKEDAASHVSGTEPLPN  579



>emb|CDY17313.1| BnaA10g09470D [Brassica napus]
Length=585

 Score =   433 bits (1113),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 246/525 (47%), Positives = 368/525 (70%), Gaps = 17/525 (3%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             E TC +LL +LQ+IW+E+GE + ERDK+L Q+EQECL  Y++KV+QA++S A+L Q +++
Sbjct  13    EITCGTLLQKLQEIWDEVGESDEERDKLLLQIEQECLGVYKKKVEQAAKSRAELLQTLSD  72

Query  463   SEAELARICAALGEQPVNVR----QSSRSLKTELQAIMPlleemkkrklerkHQFSEVLD  630
             + AEL+ +  +LG++         +SS ++K +L AI P LE++ ++K ER  +FS+V  
Sbjct  73    ANAELSSLTTSLGDKTFLNNGIPDKSSGTIKEQLAAIAPALEQLWQQKEERVREFSDVQS  132

Query  631   QIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESL  810
             QI  +  E+         +  +DESDLSL++L+D  S L  LQKEKSDRL++VL+ + ++
Sbjct  133   QIQKICGEIAGGLS--SEVPIVDESDLSLKKLDDFHSQLQELQKEKSDRLQRVLEFVSTV  190

Query  811   NSLCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHMLQ  984
             + LC VLG+DF  T+ E+HP+L + + +  KS+S ET+  L+  +  L++ K QRL  LQ
Sbjct  191   HDLCAVLGLDFLTTVREVHPSLDEETGVQSKSISNETLSTLAKTVLTLKDDKKQRLQKLQ  250

Query  985   NLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQE  1164
              LAT +++LWNLMD P EE+ LF++VTR I+AS  E+T P AL+ DL+K AE+EV RL +
Sbjct  251   ELATQLIDLWNLMDTPDEERDLFNHVTRNISASVDEVTTPGALARDLIKQAEVEVDRLDQ  310

Query  1165  MKSSKMKEVLLKKRITLEELCRQAHLAID--DSIEFTDETIESGAIDPSHLLEQLEIQIS  1338
             +K+S+MKE+  KK+  LEE+  +AH+  +   + E     I+SG ++P+ LL  ++ QI+
Sbjct  311   LKASRMKEIAFKKQSELEEIYARAHVETNPESARERIMSLIDSGNVEPTELLADMDSQIA  370

Query  1339  NVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVN  1518
               KEEAFSRK+IL++VEKW++ACEEESWLEDYNR+ NRY+  RG HL LKRAEKAR LV+
Sbjct  371   KAKEEAFSRKDILDRVEKWMSACEEESWLEDYNRDQNRYSASRGAHLNLKRAEKARILVS  430

Query  1519  KIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQG  1698
             KIP M++ L ++ + WE E  + F YDGV LL+ML++YG+L+QE+E E++R R+QKK+Q 
Sbjct  431   KIPAMVDTLVAKTRAWEEEHSMSFAYDGVPLLAMLDEYGMLRQEREDEKRRLREQKKVQE  490

Query  1699  QLMAEQEVLFGSKRSPSQ--SGKKNVVG-----GASNKRISVGGA  1812
             Q   EQ+  F ++ SP++  S KK V       GA N+R+S+  +
Sbjct  491   QPHVEQDTAFSTRPSPARPVSAKKPVGARANNNGAPNRRLSLNAS  535



>ref|XP_003617643.1| Microtubule-associated protein MAP65-1a [Medicago truncatula]
 gb|AET00602.1| microtubule associated protein, MAP65/ASE1 family protein [Medicago 
truncatula]
Length=582

 Score =   432 bits (1112),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 274/578 (47%), Positives = 390/578 (67%), Gaps = 29/578 (5%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             E TC SLL +LQ+IW+E+GE + ERDKML QLEQECL+ Y+RKV+ A++S AQL QA+++
Sbjct  13    ENTCGSLLKKLQEIWDEVGESDEERDKMLLQLEQECLDVYKRKVEHAAKSRAQLLQALSD  72

Query  463   SEAELARICAALGEQ-----PVNVRQSSRSLKTELQAIMPlleemkkrklerkHQFSEVL  627
             ++ EL+ + +ALGE+     P N   +S ++K +L AI P LE++ ++K ER   FS+V 
Sbjct  73    AKLELSTLLSALGEKGFAGIPDN---TSGTIKEQLAAIAPALEQLWQQKEERIKDFSDVQ  129

Query  628   DQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLES  807
              QI  +  E+  S   L  + A+DESDL+L++ E+ +S L  LQKEKSDRL++V + + +
Sbjct  130   SQIQKICGEITGSLN-LNDVPAVDESDLTLKKFEEYQSELQELQKEKSDRLQKVFEFVST  188

Query  808   LNSLCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHML  981
             ++ LC VLG+DF +T+ E+HP+L DS+ +  KS+S ET+ RL+  +  L+E K QRLH L
Sbjct  189   VHDLCAVLGMDFFSTVTEVHPSLNDSTGVQSKSISNETLARLANTVLTLKEDKKQRLHKL  248

Query  982   QNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQ  1161
             Q LA+ +++LWNLMD P EE++LFD+VT  I+AS  E+T P AL+LDL++ AE+EV RL 
Sbjct  249   QELASQLIDLWNLMDTPPEERKLFDHVTCNISASVDEVTIPGALALDLIEQAEVEVERLD  308

Query  1162  EMKSSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHLLEQLEIQI  1335
             ++K+S+MKE+  KK+  LE +   AH+ ID     E     I+SG I+P+ LL  ++ QI
Sbjct  309   QLKASRMKEIAFKKQSELEVIFANAHIEIDSDAAREKIMALIDSGDIEPTELLADMDNQI  368

Query  1336  SNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALV  1515
             +  +EEA SRK+IL+KVEKW++ACEEESWLEDYNR+DNRYN  RG HL LKRAEKAR LV
Sbjct  369   AKAQEEALSRKDILDKVEKWMSACEEESWLEDYNRDDNRYNASRGAHLNLKRAEKARILV  428

Query  1516  NKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQ  1695
             NKIP +++ L ++ + WE    + F YDGV LL+ML++Y +L+ E+E E++R RDQKK Q
Sbjct  429   NKIPALVDTLVAKTRAWEETHDMSFTYDGVPLLAMLDEYAMLRHEREEEKRRMRDQKKFQ  488

Query  1696  GQLMAEQEVLFGSKRSPSQ--SGKKNVVGGASNKRISVGGAMLQTPYTERAPLSSH----  1857
                  E E  FGSK SP++  S  K V G  +N     GGA   TP   R  L++H    
Sbjct  489   ELQSTEPEAPFGSKPSPARPVSAAKKVGGPRAN-----GGAN-GTP-NRRLSLNAHQNGS  541

Query  1858  -SLKKINPVKQQALANITQNYVALSSGRRESSMHAKQP  1968
              S+ K      + +A +  NYVA+S     S +   +P
Sbjct  542   RSISKDGKRDNRPVAPV--NYVAMSKEDAASHVSGTEP  577



>ref|XP_003519598.1| PREDICTED: 65-kDa microtubule-associated protein 1 isoform X1 
[Glycine max]
Length=582

 Score =   432 bits (1111),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 259/527 (49%), Positives = 374/527 (71%), Gaps = 21/527 (4%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             E TC SLL +LQ+IW+E+GE + +RDKML QLEQECL+ Y+RKV+QA++S AQL QA+++
Sbjct  13    ENTCGSLLKKLQEIWDEVGESDEQRDKMLLQLEQECLDVYKRKVEQAAKSRAQLLQALSD  72

Query  463   SEAELARICAALGEQ-----PVNVRQSSRSLKTELQAIMPlleemkkrklerkHQFSEVL  627
             ++ EL+ + +ALGE+     P N   +S ++K +L AI P+LE++ ++K ER  +FS+V 
Sbjct  73    AKLELSTLLSALGEKSFAGIPEN---TSGTIKEQLAAIAPVLEQLWQQKEERIKEFSDVQ  129

Query  628   DQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLES  807
              QI  +  E+  +        A+DESDLSL++L++ +S L  LQKEKS+RL +VL+ + +
Sbjct  130   SQIQQICGEIAGNLNLNDVSPAVDESDLSLKKLDEYQSELQELQKEKSERLHKVLEFVST  189

Query  808   LNSLCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHML  981
             ++ LC VLGIDF  T+ E+HP+L DS+ +  KS+S +T+ RL+  +  L+E K QRLH L
Sbjct  190   VHDLCAVLGIDFFTTVTEVHPSLNDSTGVQSKSISNDTLARLAKTVLTLKEDKKQRLHKL  249

Query  982   QNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQ  1161
             Q LA+ +++LWNLMD   EE++LFD+VT  ++AS  E+T P AL+LDL++ AE+EV RL 
Sbjct  250   QELASQLIDLWNLMDTHPEERRLFDHVTCNMSASVDEVTVPGALALDLIEQAEVEVERLD  309

Query  1162  EMKSSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHLLEQLEIQI  1335
             ++K+S+MKE+  KK+  LEE+   AH+ +D     E     I+SG I+P+ LL  ++ QI
Sbjct  310   QLKASRMKEIAFKKQAELEEIFVCAHIEVDPDAAREKIMALIDSGNIEPTELLADMDNQI  369

Query  1336  SNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALV  1515
             +  KEEA SRK+IL+KVEKW++ACEEESWLEDYNR+DNRYN  RG HL LKRAEKAR LV
Sbjct  370   ATAKEEALSRKDILDKVEKWMSACEEESWLEDYNRDDNRYNASRGAHLNLKRAEKARILV  429

Query  1516  NKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQ  1695
             NKIP +++ L ++ + WE + G+ F YDGV LL+ML++Y +L+ E+E E++R RDQKK  
Sbjct  430   NKIPALVDTLVAKTRAWEEDHGMSFTYDGVPLLAMLDEYAMLRHEREEEKRRMRDQKKHH  489

Query  1696  GQLMAEQEVLFGSKRSP------SQSGKKNVVGGAS---NKRISVGG  1809
              Q   EQE +FGS+ SP      S+SG     GGA+   N+R+S+  
Sbjct  490   EQRNTEQETIFGSRPSPARPVSSSKSGGPRANGGANGTPNRRLSLNA  536



>ref|XP_010485060.1| PREDICTED: 65-kDa microtubule-associated protein 3-like, partial 
[Camelina sativa]
Length=441

 Score =   427 bits (1097),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 256/441 (58%), Positives = 337/441 (76%), Gaps = 5/441 (1%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M   Q D  L++ETTC SLL ELQ IW+E+GE E +RDKML +LE+ECLE YRRKVDQA+
Sbjct  1     MATIQKDPILQVETTCGSLLYELQIIWDEVGETETDRDKMLLELERECLEVYRRKVDQAN  60

Query  427   RSCAQLRQAVAESEAELARICAALGEQPVNVRQSSRS---LKTELQAIMPlleemkkrkl  597
             R  AQLRQA+A++EAELA IC+A+GE+PV++RQS +S   LK EL  I+P LEEM+KRK+
Sbjct  61    RCRAQLRQAIADAEAELATICSAMGERPVHIRQSDQSVGSLKQELGTILPELEEMQKRKI  120

Query  598   erkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDR  777
             ER++QF  VL++IDS+  ++    + +     +DE+DLS+R+LE++   L +LQKEKSDR
Sbjct  121   ERRNQFVVVLEEIDSIANDIKGQGELVLSKPLIDETDLSMRKLEELHCQLQALQKEKSDR  180

Query  778   LKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREV  957
             ++ +  HL +L S C VLG+DF   +G+++PTL D    +S+S  TIE+L AA+ +LREV
Sbjct  181   VEMIRKHLCTLYSHCSVLGMDFNEVVGQVNPTLSDPEGPRSLSDHTIEKLGAAVQKLREV  240

Query  958   KIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSA  1137
             KIQR+  LQ+LATT++ELWNLMD P EEQQ + ++T  IAASE E+TE N+LS D +K  
Sbjct  241   KIQRMQRLQDLATTMLELWNLMDTPTEEQQEYQHITCNIAASEHEITEANSLSEDFIKYV  300

Query  1138  EIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHL--AIDDSIEFTDETIESGAIDPSHL  1311
             E EV RL  +K+SKMKE++LKKR  LE++CR+ HL    D +I+ T   IESG +D + +
Sbjct  301   EAEVVRLDAVKTSKMKELVLKKRSELEDICRKTHLLPVSDSAIDQTIAAIESGIVDATMV  360

Query  1312  LEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKR  1491
             LE LE  IS +KEEA SRKEILE+VEKWL+AC+EESWLE+YNR+DNRYN GRG HL LKR
Sbjct  361   LEHLEQHISKIKEEALSRKEILERVEKWLSACDEESWLEEYNRDDNRYNAGRGAHLTLKR  420

Query  1492  AEKARALVNKIPGMLEALTSR  1554
             AEKAR LVNK+PGM+EAL S+
Sbjct  421   AEKARNLVNKLPGMVEALASK  441



>ref|XP_004965899.1| PREDICTED: 65-kDa microtubule-associated protein 1-like [Setaria 
italica]
Length=586

 Score =   432 bits (1111),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 259/560 (46%), Positives = 383/560 (68%), Gaps = 15/560 (3%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             ETTC SLL +LQ IW+E+GE + +RDKML QLEQECL+ YRRKVD AS S A+L Q +A 
Sbjct  13    ETTCGSLLQQLQAIWDEVGESDEDRDKMLLQLEQECLDVYRRKVDHASSSRARLLQQLAN  72

Query  463   SEAELARICAALGEQPVNV--RQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQI  636
             S++EL R+ +ALGE  V+    +++ ++K +L AI P LE + +++  R  +F++V  QI
Sbjct  73    SKSELTRLLSALGELSVSGIPDKTTGTIKEQLAAISPSLELLCRKRDSRVKEFADVQLQI  132

Query  637   DSVLKELGKSRK--ELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESL  810
              ++  E+  + +  EL     ++E DLS+++L +    L +LQKEKS+RL ++L+ + S+
Sbjct  133   QTLRGEITGNLQSGELLETPHVNEDDLSVKKLNEFLFELQALQKEKSNRLHKILESVSSV  192

Query  811   NSLCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHMLQ  984
             + LC VLG++F  T+ E+HP+L DS  +  KS+S ET+ +LS  +  L+E K +R   +Q
Sbjct  193   HDLCSVLGMNFVGTVTEVHPSLDDSVGVQSKSISDETLSKLSKMVIGLQEEKSKRFAKIQ  252

Query  985   NLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQE  1164
              LA+ + +LWNLMD  VEE+Q F ++T  ++++  E+T P AL+LD+++ AE+EV RL +
Sbjct  253   ALASQLSDLWNLMDARVEERQPFHHITCNMSSTLDEVTVPGALALDVIEQAELEVERLDQ  312

Query  1165  MKSSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHLLEQLEIQIS  1338
             +K+S+MK++  KK+  LE++  +AH+AID S   +     IES + +PS LL  +E QI 
Sbjct  313   LKASRMKDIAFKKQTELEDIYARAHIAIDTSAARDRIMSIIESSSFEPSELLANMENQIL  372

Query  1339  NVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVN  1518
                EEA SRK+ILE+V++W++ACEEESWLEDY+R+DNRY+  RG HL LKRAEKAR LVN
Sbjct  373   QANEEALSRKDILERVDRWMSACEEESWLEDYSRDDNRYSATRGAHLNLKRAEKARVLVN  432

Query  1519  KIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQG  1698
             KIP +++ L ++ + WE E G+PF YDGV LL+ML++Y +L+Q+KE E++R RDQKK+  
Sbjct  433   KIPAIVDTLVAKTQAWEQEHGMPFTYDGVPLLAMLDEYKILRQDKEDEKRRMRDQKKIND  492

Query  1699  QLMAEQEVLFGSKRSPS--QSGKKNVVGGASNKRISVGGAMLQTPYTERAPLSSHSLKKI  1872
             QL AEQE LFGSK SP+  QS +K V G  +N   S GGA+  TP    + L S      
Sbjct  493   QLAAEQEKLFGSKPSPARPQSSRK-VAGARAN---SGGGAVNGTPVRRLSALQSGGRTAS  548

Query  1873  NPVKQQALANITQ-NYVALS  1929
                ++ A   +   NYVA++
Sbjct  549   RDGRRDASRPVAPVNYVAIA  568



>emb|CDY19902.1| BnaC09g31680D [Brassica napus]
Length=585

 Score =   432 bits (1110),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 248/525 (47%), Positives = 369/525 (70%), Gaps = 17/525 (3%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             E TC +LL +LQ+IW+E+GE + ERDK+L Q+EQECL  Y++KV+QA++S A+L Q +++
Sbjct  13    EITCGTLLQKLQEIWDEVGESDEERDKLLLQIEQECLGVYKKKVEQAAKSRAELLQTLSD  72

Query  463   SEAELARICAALGEQP-VN---VRQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLD  630
             + AEL+ +  +LG++  VN     +SS ++K +L AI P LE++ ++K ER  +FS+V  
Sbjct  73    ANAELSSLTTSLGDKTFVNNGIPDKSSGTIKEQLAAIAPALEQLWQQKEERVREFSDVQS  132

Query  631   QIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESL  810
             QI  +  E+         +  +DESDLSL++L+D  S L  LQKEKSDRL++VL+ + ++
Sbjct  133   QIQKICGEIAGGLS--SEVPIVDESDLSLKKLDDFHSQLQELQKEKSDRLQKVLEFVSTV  190

Query  811   NSLCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHMLQ  984
             + LC VLG+DF  T+ E+HP+L + +    KS+S ET+  L+  +  L++ K QRL MLQ
Sbjct  191   HDLCAVLGLDFLTTVREVHPSLDEETGAQSKSISNETLSTLAKTVLTLKDDKKQRLQMLQ  250

Query  985   NLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQE  1164
              LAT +++LWNLMD P EE+ LF++VT  I+AS  E+T P AL+ DL+K AE+EV RL +
Sbjct  251   ELATQLIDLWNLMDTPDEERDLFNHVTCNISASVDEVTTPGALARDLIKQAEVEVDRLDQ  310

Query  1165  MKSSKMKEVLLKKRITLEELCRQAHLAID--DSIEFTDETIESGAIDPSHLLEQLEIQIS  1338
             +K+S+MKE+  KK+  LEE+  +AH+  +   + E     I+SG ++P+ LL  ++ QI+
Sbjct  311   LKASRMKEIAFKKQSELEEIYARAHVETNPESARERIMSLIDSGNVEPTELLADMDSQIA  370

Query  1339  NVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVN  1518
               KEEAFSRK+IL++VEKW++ACEEESWLEDYNR+ NRY+  RG HL LKRAEKAR LV+
Sbjct  371   KAKEEAFSRKDILDRVEKWMSACEEESWLEDYNRDQNRYSASRGAHLNLKRAEKARILVS  430

Query  1519  KIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQG  1698
             KIP M++ L ++ + WE E  + F YDGV LL+ML++YG+L+QE+E E++R R+QKK+Q 
Sbjct  431   KIPAMVDTLVAKTRAWEEEHSMSFAYDGVPLLAMLDEYGMLRQEREDEKRRLREQKKVQE  490

Query  1699  QLMAEQEVLFGSKRSPSQ--SGKKNVVG-----GASNKRISVGGA  1812
             Q   EQ+  F ++ SP++  S KK V       GA N+R+S+  +
Sbjct  491   QPHVEQDTAFSTRPSPARPVSAKKPVGARANNNGAPNRRLSLNAS  535



>ref|XP_009787869.1| PREDICTED: 65-kDa microtubule-associated protein 1-like [Nicotiana 
sylvestris]
 emb|CAC17796.1| microtubule-associated protein MAP65-1c [Nicotiana tabacum]
Length=582

 Score =   431 bits (1109),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 257/554 (46%), Positives = 375/554 (68%), Gaps = 17/554 (3%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             ETTC SLL +LQ+IW+E+G+ + E  ++L Q+++ECL+ Y+RKV QA +S A L +A+A+
Sbjct  13    ETTCGSLLQQLQQIWDEVGQTDDEWHEILLQMDRECLDVYKRKVGQAVKSRAHLLEALAD  72

Query  463   SEAELARICAALGEQPVNV--RQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQI  636
             ++ EL R+ AALGE+       ++S S+K +L AI P LE + K+K +R  +F +V  QI
Sbjct  73    AKIELCRLLAALGEKTYAGIPEKASGSIKEQLAAIAPALENLWKQKEDRVKEFFDVQAQI  132

Query  637   DSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESLNS  816
             + +  E+    + +++   +DESDLSL++L++ ++ L  LQKEKS+RL +VL+ + +++ 
Sbjct  133   EKISSEIAGISEHVENP-KVDESDLSLKKLDEFQAQLQELQKEKSERLHKVLEFVSTIHD  191

Query  817   LCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHMLQNL  990
             LC VLG+DF  TI E+HP+L DS+ +  KS+S +T+  LS  +  L E K QRL  LQ L
Sbjct  192   LCAVLGLDFFGTITEVHPSLNDSTGVQSKSISDDTLSNLSRTVLALTEDKKQRLQKLQEL  251

Query  991   ATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQEMK  1170
              T +++LWNLMD P EE+ LFD+V   I+AS  E++ P AL+LDL++ AE+EV RL ++K
Sbjct  252   TTQLIDLWNLMDTPEEERSLFDHVCCNISASVDEVSIPGALALDLIEQAEVEVERLDQLK  311

Query  1171  SSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHLLEQLEIQISNV  1344
             +S+MKE+  KK+  LEE+   AH+ ID     +     IESG I+P+ LL  ++ QI   
Sbjct  312   ASRMKEIAFKKQAVLEEIFAHAHVEIDSEAARQKIMTLIESGNIEPAELLTDMDNQIVKA  371

Query  1345  KEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVNKI  1524
              EEA SRKEILEKVEKW+AACEEESWLEDYNR+ NRYN  RG HL LKRAEKAR LVNKI
Sbjct  372   NEEAHSRKEILEKVEKWMAACEEESWLEDYNRDQNRYNASRGAHLNLKRAEKARILVNKI  431

Query  1525  PGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQGQL  1704
             P ++++L ++ + WE +RG  F YDGV LL+ML++Y +L+ ++E E++R RDQKK   Q+
Sbjct  432   PALVDSLIAKTRAWEQDRGTTFTYDGVPLLAMLDEYMMLRHDREEEKRRLRDQKKFHEQI  491

Query  1705  MAEQEVLFGSKRSPSQS-GKKNVVG--------GASNKRISVGGAMLQTPYTERAPLSSH  1857
               E E  FGS  SP++  G K VVG        G++N+R+S+      +  T +     H
Sbjct  492   SKEPETPFGSTPSPARPLGTKKVVGPRANGNANGSANRRLSLNSHQNGSRSTTKDGKRDH  551

Query  1858  SLKKINPVKQQALA  1899
             S +K+ PV   A++
Sbjct  552   S-RKVAPVNNFAIS  564



>ref|XP_002437274.1| hypothetical protein SORBIDRAFT_10g023980 [Sorghum bicolor]
 gb|EER88641.1| hypothetical protein SORBIDRAFT_10g023980 [Sorghum bicolor]
Length=580

 Score =   431 bits (1109),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 259/561 (46%), Positives = 379/561 (68%), Gaps = 16/561 (3%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             ETTC SLL +LQ IW+E+GE + +RDKML QLEQECL+ YRRKVDQAS   ++L Q +  
Sbjct  13    ETTCGSLLQQLQLIWDEVGESDDDRDKMLLQLEQECLDVYRRKVDQASSFRSRLLQQLDN  72

Query  463   SEAELARICAALGEQPVNV--RQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQI  636
             S+ EL R+ +ALGE  ++    ++S ++K +L A+ P LE + +++  R  +F++V  QI
Sbjct  73    SKLELTRLLSALGESSISGIPDKTSGTIKEQLAAMSPSLEILCRKRESRVKEFADVQLQI  132

Query  637   DSVLKELGKSRKELQHMIA--LDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESL  810
               +  E+  +    +H+    ++E DLS+R+L +  S L +LQKEKS RL ++L+ + S+
Sbjct  133   QILRDEIAGNLHVSEHLETPHVNEDDLSVRKLNEYLSELQALQKEKSTRLHKILESVSSV  192

Query  811   NSLCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHMLQ  984
             + LC VLG+DF  T+ ++HP+L DS ++  KS+S ETI +LS  +  L+E K +R   +Q
Sbjct  193   HDLCSVLGMDFVGTVTKVHPSLDDSVSVQSKSISDETISKLSKMVIVLQEEKSKRFAKIQ  252

Query  985   NLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQE  1164
              +A+ + +LWNLMD PVEE+Q F +VT  ++++  ++T P AL+LD+++ AE+EV RL E
Sbjct  253   AIASQLSDLWNLMDAPVEERQPFHHVTCNMSSTLDDVTVPGALALDVIQQAELEVERLDE  312

Query  1165  MKSSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHLLEQLEIQIS  1338
             +K+S+MK++  KK+  LE++  +AH+AID S   +     IES + +PS LL  +E QI 
Sbjct  313   LKASRMKDIAFKKQTELEDIYARAHVAIDSSAARDRIMSIIESSSFEPSELLADMENQIL  372

Query  1339  NVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVN  1518
                EE+ SRK+ILE+V++W++ACEEESWLEDY+R+DNRY+  RG HL LKRAEKAR LVN
Sbjct  373   KANEESLSRKDILERVDRWMSACEEESWLEDYSRDDNRYSATRGAHLNLKRAEKARVLVN  432

Query  1519  KIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQG  1698
             KIP +++ L ++ + WE E G  F YDGV LL+ML++Y +L+QEKE E++R RDQKK+  
Sbjct  433   KIPAIVDTLVAKTRAWEQEHGAAFTYDGVPLLAMLDEYKILRQEKEDEKRRMRDQKKMND  492

Query  1699  QLMAEQEVLFGSKRSPS--QSGKKNVVGGASNKRIS-VGGAMLQTPYTERAPLSSHSLKK  1869
             QL AEQE LFGSK SP+  QS  + V G     RIS VGGA   TP    + L S     
Sbjct  493   QLAAEQEKLFGSKPSPARPQSSSRKVAGA----RISGVGGAANGTPVRRLSALQSGGRTV  548

Query  1870  INPVKQQALANITQ-NYVALS  1929
                 ++ A   +   NYVA++
Sbjct  549   SRDGRRDASRPVAPVNYVAIA  569



>gb|ACN85285.1| microtubule-associated protein MAP65-1a [Oryza australiensis]
Length=581

 Score =   431 bits (1109),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 255/531 (48%), Positives = 371/531 (70%), Gaps = 21/531 (4%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             ETTC SLL +LQ IW+E+GE + +RDKML QLEQECL+ YRRKVDQAS S A+L Q +A 
Sbjct  13    ETTCGSLLQQLQLIWDEVGESDEDRDKMLLQLEQECLDVYRRKVDQASNSRARLLQQLAN  72

Query  463   SEAELARICAALGEQPVNV--RQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQI  636
             +++EL+R+  ALGE  ++    ++  ++K +L+AI P LE++ + K +R  +F++V  QI
Sbjct  73    AKSELSRLLCALGELIISGIPDKTIGTIKEQLEAISPFLEKLCREKDKRVREFADVQLQI  132

Query  637   DSVLKELGKSRKELQHMIA--LDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESL  810
              ++  E+  S +   H+    ++E DLS ++L +  S L +L+KEKS+RL ++LD + S+
Sbjct  133   QTIRGEIAGSLQVGDHIETPRVNEDDLSTKKLNEFLSELQALRKEKSNRLHKILDFVSSV  192

Query  811   NSLCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHMLQ  984
             + LC VLG+DF +T+ ++HP+L DS     KS+S  T+ +LS  + +L+E K +RL  +Q
Sbjct  193   HDLCSVLGMDFLSTVTKVHPSLNDSVGAESKSISDATLSKLSKMVIQLKEEKSKRLEKIQ  252

Query  985   NLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQE  1164
              LA+ + +LWNLMD   EE++LFD+VT  + ++  E+T P AL LDL++ AE+EV RL +
Sbjct  253   ALASQLTDLWNLMDTSAEERRLFDHVTCNMCSTLDEVTAPGALDLDLIEQAELEVERLDQ  312

Query  1165  MKSSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHLLEQLEIQIS  1338
             +K+S+MK++  K++  LE++  QAH+AID S   +     I+S   +PS LL  +E QI 
Sbjct  313   LKASRMKDIAFKRQTELEDIYAQAHIAIDSSAARDRILTVIDSSIFEPSELLADMENQIL  372

Query  1339  NVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVN  1518
               KEEA SRK+ILEKVE+W++ACEEESWLEDY+++DNRY+  RG HL LKRAEKAR LV 
Sbjct  373   KAKEEALSRKDILEKVERWMSACEEESWLEDYSQDDNRYSATRGAHLNLKRAEKARLLVG  432

Query  1519  KIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQG  1698
             KIP +++ L ++ + WE E G+ F YDGV LL+ML++Y +L+Q+KE E++R RDQKK+  
Sbjct  433   KIPAIVDTLMAKTRAWEQEHGMLFTYDGVHLLAMLDEYKVLRQQKEEEKRRMRDQKKIND  492

Query  1699  QLMAEQEVLFGSKRSPS--QSGKK----NVVGGAS----NKRISV---GGA  1812
             QL AEQE LFGSK SP+  QS +K       GGAS    N+R+SV   GG 
Sbjct  493   QLAAEQEKLFGSKPSPARPQSSRKAPGPRANGGASNGTPNRRLSVHQNGGG  543



>ref|XP_010545152.1| PREDICTED: 65-kDa microtubule-associated protein 4 [Tarenaya 
hassleriana]
Length=697

 Score =   435 bits (1118),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 293/664 (44%), Positives = 416/664 (63%), Gaps = 57/664 (9%)
 Frame = +1

Query  247   MYNRQNDQSLRMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQAS  426
             M  +  +Q  R+ETTC  LL +LQ+IWNE+GE E ERD  L ++E+ECL  YRRKV+ AS
Sbjct  1     MLRQSAEQFARIETTCGLLLRQLQEIWNEMGESEDERDAALVEIEKECLAVYRRKVEDAS  60

Query  427   RSCAQLRQAVAESEAELARICAALG--EQPVNVRQSSRSLKTELQAIMPlleemkkrkle  600
                A+L +++A   AE+A I +++G  +   N R    + K EL+ +   L EM+K+K+E
Sbjct  61    TCKAELLKSIAIGRAEIAAIGSSMGGPDGHSNNR-VGENFKEELENVNLQLGEMRKKKME  119

Query  601   rkHQFSEVLDQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRL  780
             RK+ F EVLDQ+  +  +LG     L+ + A +E+DLSL++LE+++  L+ LQ E S RL
Sbjct  120   RKNLFDEVLDQLLKISFQLGNPTDYLRKLAA-EETDLSLQKLEELRRELVELQNENSKRL  178

Query  781   KQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVK  960
             K+V DHL+ L SLC VLG DF + I  +H +L DS   K VS  T+++L+     L EVK
Sbjct  179   KEVEDHLDMLKSLCSVLGEDFSDLISGVHLSLVDSRT-KDVSRSTLDKLAMMTDNLLEVK  237

Query  961   IQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAE  1140
             +QR+  LQ+LA +++ELWNL+D PVEEQ +F++ TR IA+SESE+TE   LS+  +K  E
Sbjct  238   LQRMQKLQDLAVSLLELWNLLDTPVEEQMMFNHFTRTIASSESEITESGVLSVTSIKRVE  297

Query  1141  IEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLA--IDDSIEF-TDETIESGAIDPSHL  1311
              EV+RL ++K++ +KE++L+K++ LE++ R+ H+   +  S E+ T E+I+SG  DP  L
Sbjct  298   DEVTRLGKVKTTMIKELILRKQLELEDISRKMHMTSEVLKSNEYSTIESIQSGDKDPEKL  357

Query  1312  LEQ-LEIQI------------SNVKEEAFSRKEIL-------------------------  1377
             LE+ L++ +            +    E   R+ +L                         
Sbjct  358   LEKALQVSVGVKLNFPPKQNTTQFYSECHGRRGVLPTGGNTRKPGSFSHFTEHFYNCSSS  417

Query  1378  EKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVNKIPGMLEALTSRA  1557
             ++VEKW+AACEEESWLE+YNR++NRYN GRG HL LKRAEKAR LVNK+PGM+EAL  + 
Sbjct  418   QRVEKWMAACEEESWLEEYNRDENRYNAGRGAHLTLKRAEKARLLVNKLPGMVEALMVKV  477

Query  1558  KGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQGQLMAEQEVLFGSK  1737
               WE ERG+ F YDGV LLSMLEQY  L+QEKELE+QRQRD KKL+GQ +AE+E L G  
Sbjct  478   SDWEKERGIEFSYDGVRLLSMLEQYNNLRQEKELEKQRQRDLKKLKGQHIAEKEALHGPM  537

Query  1738  RSPSQSGKK--NVVGGASNKRISVGGAMLQTPYTERAPLSSHSLKKINPVKQQALA-NIT  1908
              SP++SGKK     G A N+++S+GGA+LQ    E+      + +K N   Q A   ++ 
Sbjct  538   LSPTKSGKKLPRTPGTALNRKLSLGGAILQISKPEKTTPRPLAFRKSNFSDQNATPRHMP  597

Query  1909  QNYVALSSGRRESS----MHAKQPSCNKSNLQ-KTEPTQRKPLSPISSLSFNTSSANIMD  2073
              + +   SGRR S     +  KQ S     ++ K  P  RKPLSP+ S   N  S+ I D
Sbjct  598   ASAIPTPSGRRNSETIRRLGKKQVSVGGKGVETKKSPLVRKPLSPVPS---NILSSPIED  654

Query  2074  KISE  2085
              + E
Sbjct  655   DLKE  658



>ref|XP_010060274.1| PREDICTED: 65-kDa microtubule-associated protein 1-like [Eucalyptus 
grandis]
 gb|KCW66902.1| hypothetical protein EUGRSUZ_F00650 [Eucalyptus grandis]
 gb|KCW66903.1| hypothetical protein EUGRSUZ_F00650 [Eucalyptus grandis]
Length=581

 Score =   431 bits (1107),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 268/571 (47%), Positives = 390/571 (68%), Gaps = 16/571 (3%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             E TC SLL +LQ IW+E+GE + ERDK+L Q+EQECL+ Y+R VDQA +S AQL QA+++
Sbjct  13    EITCGSLLQKLQGIWDEVGESDEERDKLLLQIEQECLDVYKRNVDQADKSRAQLLQALSD  72

Query  463   SEAELARICAALGEQPVNV--RQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQI  636
             ++ EL  + +ALGE+ V     ++S ++K +L +I P LE++ K+K ER  +FS V  QI
Sbjct  73    AKLELTSLLSALGEKSVVGIPDKASGTIKEQLASIAPALEQLWKQKEERLKEFSNVQSQI  132

Query  637   DSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESLNS  816
               +  E+  +    +    +DE+DLSL++L + ++ L  LQKEKSDRL +VL+ + +++ 
Sbjct  133   QRICGEIAGNLSVTEQPPEVDEADLSLKKLNEYQAQLQELQKEKSDRLHKVLEFVSTVHD  192

Query  817   LCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHMLQNL  990
             LC VLG+DF ++I E+HP+L +S++   KS+S ET+ RL+  +  L+E K QRLH LQ L
Sbjct  193   LCSVLGMDFFSSITEVHPSLNESASAQSKSISNETLSRLAKTVLALKEDKKQRLHKLQEL  252

Query  991   ATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQEMK  1170
             AT +++LWNLMD   EE++LFD+VT  I+AS  E+T P AL++DL++ AE+EV RL ++K
Sbjct  253   ATQLIDLWNLMDTSEEERRLFDHVTCNISASVDEVTAPGALAMDLIEQAEVEVERLDQLK  312

Query  1171  SSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHLLEQLEIQISNV  1344
             +S+M+E+  KK+  LEE+  +AH+ ID     E     IESG ++P+ L+  L+ QI   
Sbjct  313   ASRMQEIAFKKQAELEEIFARAHVEIDPEAAREKIMALIESGNVEPAELITDLDNQIVKA  372

Query  1345  KEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVNKI  1524
             +EEA SRKEIL+KVEKW++ACEEESWLEDY+R+DNRYN  RG HL LKRAEKAR LVNKI
Sbjct  373   REEALSRKEILDKVEKWMSACEEESWLEDYSRDDNRYNASRGAHLNLKRAEKARILVNKI  432

Query  1525  PGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQGQL  1704
             P ++++L ++ + WE + G+ F YDGV LL+ML++Y +L+ E+E E++R RDQKK   Q 
Sbjct  433   PALVDSLVAKTRAWEEDHGMSFTYDGVPLLAMLDEYTMLRHEREEEKRRLRDQKKYHEQQ  492

Query  1705  MAEQEVLFGSKRSPSQS-GKKNVVGGASNKRISVGGAMLQTPYTERAPLSSHSLKKIN--  1875
               EQE +FGSK SP++  G K VVG  +N     GGA   TP + R  L+  +  + N  
Sbjct  493   STEQEAIFGSKPSPARPVGTKKVVGPRAN-----GGAN-GTP-SRRLSLNPQNGSRSNSK  545

Query  1876  PVKQQALANITQNYVALSSGRRESSMHAKQP  1968
               K+ A  +   NYVA++     S +   +P
Sbjct  546   DAKRDARLSAPANYVAMTKEDSASHVSGTEP  576



>gb|KHN38240.1| 65-kDa microtubule-associated protein 1 [Glycine soja]
Length=582

 Score =   431 bits (1107),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 258/527 (49%), Positives = 373/527 (71%), Gaps = 21/527 (4%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             E TC SLL +LQ+IW+E+GE + +RDKML QLEQECL+ Y+RKV+QA++S  QL QA+++
Sbjct  13    ENTCGSLLKKLQEIWDEVGESDEQRDKMLLQLEQECLDVYKRKVEQAAKSRVQLLQALSD  72

Query  463   SEAELARICAALGEQ-----PVNVRQSSRSLKTELQAIMPlleemkkrklerkHQFSEVL  627
             ++ EL+ + +ALGE+     P N   +S ++K +L AI P+LE++ ++K ER  +FS+V 
Sbjct  73    AKLELSTLLSALGEKSFAGIPEN---TSGTIKEQLAAIAPVLEQLWQQKEERIKEFSDVQ  129

Query  628   DQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLES  807
              QI  +  E+  +        A+DESDLSL++L++ +S L  LQKEKS+RL +VL+ + +
Sbjct  130   SQIQQICGEIAGNLNLNDVSPAVDESDLSLKKLDEYQSELQELQKEKSERLHKVLEFVST  189

Query  808   LNSLCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHML  981
             ++ LC VLGIDF  T+ E+HP+L DS+ +  KS+S +T+ RL+  +  L+E K QRLH L
Sbjct  190   VHDLCAVLGIDFFTTVTEVHPSLNDSTGVQSKSISNDTLARLAKTVLTLKEDKKQRLHKL  249

Query  982   QNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQ  1161
             Q LA+ +++LWNLMD   EE++LFD+VT  ++AS  E+T P AL+LDL++ AE+EV RL 
Sbjct  250   QELASQLIDLWNLMDTHPEERRLFDHVTCNMSASVDEVTVPGALALDLIEQAEVEVERLD  309

Query  1162  EMKSSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHLLEQLEIQI  1335
             ++K+S+MKE+  KK+  LEE+   AH+ +D     E     I+SG I+P+ LL  ++ QI
Sbjct  310   QLKASRMKEIAFKKQAELEEIFVCAHIEVDPDAAREKIMALIDSGNIEPTELLADMDNQI  369

Query  1336  SNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALV  1515
             +  KEEA SRK+IL+KVEKW++ACEEESWLEDYNR+DNRYN  RG HL LKRAEKAR LV
Sbjct  370   ATAKEEALSRKDILDKVEKWMSACEEESWLEDYNRDDNRYNASRGAHLNLKRAEKARILV  429

Query  1516  NKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQ  1695
             NKIP +++ L ++ + WE + G+ F YDGV LL+ML++Y +L+ E+E E++R RDQKK  
Sbjct  430   NKIPALVDTLVAKTRAWEEDHGMSFTYDGVPLLAMLDEYAMLRHEREEEKRRMRDQKKHH  489

Query  1696  GQLMAEQEVLFGSKRSP------SQSGKKNVVGGAS---NKRISVGG  1809
              Q   EQE +FGS+ SP      S+SG     GGA+   N+R+S+  
Sbjct  490   EQRNTEQETIFGSRPSPARPVSSSKSGGPRANGGANATPNRRLSLNA  536



>ref|XP_009120044.1| PREDICTED: 65-kDa microtubule-associated protein 1 [Brassica 
rapa]
 ref|XP_009120045.1| PREDICTED: 65-kDa microtubule-associated protein 1 [Brassica 
rapa]
Length=585

 Score =   431 bits (1107),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 245/525 (47%), Positives = 367/525 (70%), Gaps = 17/525 (3%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             E TC +LL +LQ+IW+E+GE + ERDK+L Q+EQECL  Y++KV+QA++S A+L Q +++
Sbjct  13    EITCGTLLQKLQEIWDEVGESDEERDKLLLQIEQECLGVYKKKVEQAAKSRAELLQTLSD  72

Query  463   SEAELARICAALGEQPVNVR----QSSRSLKTELQAIMPlleemkkrklerkHQFSEVLD  630
             + AEL+ +  +LG++         +SS ++K +L AI P LE++ ++K ER  +FS+V  
Sbjct  73    ANAELSSLTTSLGDKNFLNNGIPDKSSGTIKEQLAAIAPALEQLWQQKEERVREFSDVQS  132

Query  631   QIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESL  810
             QI  +  E+         +  +DESDLSL++L+D  S L  LQKEKSDRL++VL+ + ++
Sbjct  133   QIQKICGEIAGGLS--SEVPIVDESDLSLKKLDDFHSQLQELQKEKSDRLQKVLEFVSTV  190

Query  811   NSLCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHMLQ  984
             + LC VLG+DF  T+ E+HP+L + + +  KS+S ET+  L+  +  L++ K QRL  LQ
Sbjct  191   HDLCAVLGLDFLTTVREVHPSLDEETGVQSKSISNETLSTLAKTVLTLKDDKKQRLQKLQ  250

Query  985   NLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQE  1164
              LAT +++LWNLMD P EE+ LF++VTR I+AS  E+T P AL+ DL+K AE+EV RL +
Sbjct  251   ELATQLIDLWNLMDTPDEERDLFNHVTRNISASVDEVTTPGALARDLIKQAEVEVDRLDQ  310

Query  1165  MKSSKMKEVLLKKRITLEELCRQAHLAID--DSIEFTDETIESGAIDPSHLLEQLEIQIS  1338
             +K+S+MKE+  KK+  LEE+  +AH+  +   + E     I+SG ++P+ LL  ++ QI+
Sbjct  311   LKASRMKEIAFKKQSELEEIYARAHVETNPESARERIMSLIDSGNVEPTELLADMDSQIA  370

Query  1339  NVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVN  1518
               KEEAFSRK+IL++VEKW++ACEEESWLEDYNR+ NRY+  RG HL LKRAEKAR LV+
Sbjct  371   KAKEEAFSRKDILDRVEKWMSACEEESWLEDYNRDQNRYSASRGAHLNLKRAEKARILVS  430

Query  1519  KIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQG  1698
             KIP M++ L ++ + WE E  + F YDGV LL+ML++YG+L+QE+E E++R R+QKK+Q 
Sbjct  431   KIPAMVDTLVAKTRAWEEEHSMSFAYDGVPLLAMLDEYGMLRQEREDEKRRLREQKKVQE  490

Query  1699  QLMAEQEVLFGSKRSPSQ--SGKKNVVG-----GASNKRISVGGA  1812
             Q   EQ+  F ++ SP++  S KK V       GA N+R+ +  +
Sbjct  491   QPHVEQDTAFSTRPSPARPVSAKKPVGARANNNGAPNRRLPLNAS  535



>gb|KHN23889.1| 65-kDa microtubule-associated protein 1 [Glycine soja]
Length=582

 Score =   430 bits (1105),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 257/527 (49%), Positives = 374/527 (71%), Gaps = 21/527 (4%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             E TC SLL +LQ+IW+E+GE + +RDKML QLEQECL+ Y+RKV+QA++S  QL QA+++
Sbjct  13    ENTCGSLLKKLQEIWDEVGESDEQRDKMLLQLEQECLDVYKRKVEQAAKSRVQLLQALSD  72

Query  463   SEAELARICAALGEQ-----PVNVRQSSRSLKTELQAIMPlleemkkrklerkHQFSEVL  627
             ++ EL+ + +ALGE+     P N   +S ++K +L AI P+LE++ ++K ER  +FS+V 
Sbjct  73    AKLELSTLLSALGEKSFAGIPEN---TSGTIKEQLAAIAPVLEQLWQQKEERIKEFSDVQ  129

Query  628   DQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLES  807
              QI  +  E+  +        A+DESDLSL++L++ +S L  LQKEKS+RL +VL+ + +
Sbjct  130   SQIQQICGEIAGNLNLNDVSPAVDESDLSLKKLDEYQSELQELQKEKSERLHKVLEFVST  189

Query  808   LNSLCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHML  981
             ++ LC VLG+DF +T  E+HP+L DS+ +  KS+S +T+ RL+  +  L+E K QRLH L
Sbjct  190   VHDLCAVLGMDFFSTATEVHPSLNDSTGVQSKSISNDTLARLAKTVLTLKEDKKQRLHKL  249

Query  982   QNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQ  1161
             Q LA+ +++LWNLMD   EE++LFD+VT  ++AS  E+T P AL+LDL++ AE+EV RL 
Sbjct  250   QELASQLIDLWNLMDTHPEERRLFDHVTCNMSASVDEVTVPGALALDLIEQAEVEVERLD  309

Query  1162  EMKSSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHLLEQLEIQI  1335
             ++K+S+MKE+  KK+  LEE+  +AH+ +D     E     I+SG I+P+ LL  ++ QI
Sbjct  310   QLKASRMKEIAFKKQAELEEIFARAHIEVDPDAAREKIMALIDSGNIEPTELLADMDNQI  369

Query  1336  SNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALV  1515
             +  KEEA SRK+IL+KVEKW++ACEEESWLEDYNR+DNRYN  RG HL LKRAEKAR LV
Sbjct  370   AKAKEEALSRKDILDKVEKWMSACEEESWLEDYNRDDNRYNASRGAHLNLKRAEKARILV  429

Query  1516  NKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQ  1695
             NKIP +++ L ++ + WE + G+ F YDGV LL+ML++Y +L+ E+E E++R RDQKK  
Sbjct  430   NKIPALVDTLVAKTRAWEEDHGMSFTYDGVPLLAMLDEYAMLRHEREEEKRRMRDQKKHH  489

Query  1696  GQLMAEQEVLFGSKRSP------SQSGKKNVVGGAS---NKRISVGG  1809
              Q   EQE +FGS+ SP      S+SG     GGA+   N+R+S+  
Sbjct  490   EQRNTEQETIFGSRPSPARPVSSSKSGGPRANGGANATPNRRLSLNA  536



>emb|CDY12006.1| BnaC03g14320D [Brassica napus]
Length=644

 Score =   432 bits (1110),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 249/519 (48%), Positives = 367/519 (71%), Gaps = 16/519 (3%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             E TC +LL +LQ+IW+E+GE + ERDK+L Q+EQECL  Y+RKV+QA++S A+L Q +++
Sbjct  70    EITCGTLLQKLQEIWDEVGESDEERDKLLLQIEQECLHVYKRKVEQAAKSRAELLQTLSD  129

Query  463   SEAELARICAALGEQP-VN--VRQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQ  633
             + AE + +  +LG++  VN    +SS ++K +L AI P LE++ ++K ER  +FS+V  Q
Sbjct  130   ANAEQSSLTTSLGDKSFVNDIPDKSSGTIKEQLAAIAPALEQLWQQKDERVREFSDVQSQ  189

Query  634   IDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESLN  813
             I  +  E+         +  +DESDLSL++L+D  S L  LQKEKSDRL++VL+ + S++
Sbjct  190   IQKICGEIAGGLS--SEVPIVDESDLSLKKLDDFHSQLQELQKEKSDRLQKVLEFVSSVH  247

Query  814   SLCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHMLQN  987
              LC VLG+DF NT+ E+HP+L + +++  KS+S ET+ RL+  +  L++ K QRL  LQ 
Sbjct  248   DLCAVLGLDFLNTVKEVHPSLDEETSVQAKSISNETLSRLAKTVLTLKDDKKQRLQKLQE  307

Query  988   LATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQEM  1167
             LAT +++LWNLMD P E++ LFD VT  I+AS  E+T   AL+ DL+K AE+EV+RL ++
Sbjct  308   LATQLIDLWNLMDTPDEKRDLFDYVTCNISASVDEVTTRGALAHDLIKQAEVEVNRLDQL  367

Query  1168  KSSKMKEVLLKKRITLEELCRQAHLAID--DSIEFTDETIESGAIDPSHLLEQLEIQISN  1341
             K+S+MKE+  KK+  LEE+  +AH+  +   + E     I+SG ++P+ LL  ++ QI+ 
Sbjct  368   KASRMKEIAFKKQTELEEIYARAHVETNPESARERIMSLIDSGNVEPTELLADMDSQIAK  427

Query  1342  VKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVNK  1521
              KEEAFSRK+IL++VEKW++ACEEESWLEDYNR+ NRY+  RG HL LKRAEKAR LV+K
Sbjct  428   AKEEAFSRKDILDRVEKWMSACEEESWLEDYNRDQNRYSASRGAHLNLKRAEKARVLVSK  487

Query  1522  IPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQGQ  1701
             IP M++ L ++ + WE E  + F YDGV LL+ML++YG+L+QE+E E++R R+QKK+Q Q
Sbjct  488   IPAMVDTLVAKTRAWEEEHNMSFAYDGVPLLAMLDEYGMLRQEREDEKRRLREQKKVQEQ  547

Query  1702  LMAEQEVLFGSKRSPSQ--SGKKNVVGGASNKRISVGGA  1812
                EQ+  F ++ SP++  S KK V   A+N     GGA
Sbjct  548   PHVEQDTAFSTRPSPARPVSAKKPVGARANN-----GGA  581



>ref|XP_006851821.1| hypothetical protein AMTR_s00041p00052270 [Amborella trichopoda]
 gb|ERN13288.1| hypothetical protein AMTR_s00041p00052270 [Amborella trichopoda]
Length=532

 Score =   428 bits (1100),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 262/533 (49%), Positives = 355/533 (67%), Gaps = 37/533 (7%)
 Frame = +1

Query  835   IDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHELREVKIQRLHMLQNLATTIVELW  1014
             +DF +T+ E+HP+L DS A K +S ETI+RL+ AI +LREVKIQR+  LQ+LATT++ELW
Sbjct  1     MDFLSTVREVHPSLEDSEASKCISNETIDRLANAIQKLREVKIQRMQKLQDLATTMLELW  60

Query  1015  NLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQEMKSSKMKEVL  1194
             NLMD PVEEQQ+F +VT  IAA E E+ EPN LS+D +   E EV+RL+E+K SKMKE++
Sbjct  61    NLMDTPVEEQQVFQSVTCNIAAKEHEINEPNNLSVDFINYVEAEVARLEELKESKMKELV  120

Query  1195  LKKRITLEELCRQAHLAIDD--SIEFTDETIESGAIDPSHLLEQLEIQISNVKEEAFSRK  1368
             LKKR  LEE+CR+ H+  D+  ++E+    IESG +DPS +LEQ+E QI+ VKE+AFSRK
Sbjct  121   LKKRTELEEICRKTHVDADEETTMEYAVAAIESGTVDPSCILEQIEAQIAKVKEDAFSRK  180

Query  1369  EILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVNKIPGMLEALT  1548
             EIL+KV+KWL AC+EE+WLEDYN+++NRYN GRG HL LKRAEKARA V+KIP  +EAL 
Sbjct  181   EILDKVDKWLVACDEENWLEDYNKDENRYNAGRGAHLTLKRAEKARAAVSKIPATVEALV  240

Query  1549  SRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQGQLMAEQEVLF  1728
              +   WE ERG  F+Y+GV LLSMLE Y +L+QEKE ER+RQRDQKKLQGQL+AEQE LF
Sbjct  241   VKTTVWERERGKEFMYNGVRLLSMLEDYNILRQEKEQERKRQRDQKKLQGQLIAEQEALF  300

Query  1729  GSKRSPSQ--SGKK--NVVGGASNKRISVGGAMLQTPYTERAPLSSHSLKKINPVKQQAL  1896
             GSK SPS+  S +K      G++N+R+S+GG M+ T   +  P +  S       K+   
Sbjct  301   GSKPSPSKTPSARKLSRTSTGSTNRRLSLGGPMMHTQTLDFLPPTKASAHGARQTKKAER  360

Query  1897  ANITQN------YVALSSGRRE---SSMHAKQPSCNKSNL--QKTEPTQRKPLSPISSLS  2043
              + + N      + ALS+GRR    + + A++ S   +N    +T  TQRKP SP+S+  
Sbjct  361   PHSSHNHHQDDSFAALSAGRRGLDIAGLPARKQSLYSTNNPEPETPSTQRKPFSPVSTKP  420

Query  2044  FNTSSANIMD---KISESEELREMP---ASLLTTPIKNVSGIGG----NATPKtmpipmp  2193
              NT+S +++D   K+      +  P    +L +TP  N   I      N TP+   I +P
Sbjct  421   -NTASNSLLDDHVKLQNINFAKNAPIKTTNLPSTPSTNKHQISATDEENRTPQ--SIAVP  477

Query  2194  stpasaassiamQMGMTPAPVAATTP--MVGH-----DGVEYSYEEMRAGFLL  2331
                  ++ S+ MQ  MTP  + + TP  + GH       +EYS+EE RAGF+ 
Sbjct  478   FLNTPSSVSMPMQTAMTPMHMVSATPAALFGHVQRSPAEIEYSFEERRAGFVY  530



>ref|XP_006394416.1| hypothetical protein EUTSA_v10003940mg [Eutrema salsugineum]
 gb|ESQ31702.1| hypothetical protein EUTSA_v10003940mg [Eutrema salsugineum]
Length=553

 Score =   428 bits (1101),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 268/554 (48%), Positives = 391/554 (71%), Gaps = 30/554 (5%)
 Frame = +1

Query  277   RMETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAV  456
             ++E+ C SLL EL+ IW+E+GE + ER+K+L ++E EC EAY RK++       +L+Q +
Sbjct  5     QIESICASLLQELEIIWDEVGETKTEREKILIEIEDECKEAYSRKIENVKEERTRLKQEI  64

Query  457   AESEAELARICAALGEQPVNVRQ-----SSRSLKTELQAIMPlleemkkrklerkHQFSE  621
             A+SEA +  I +A+ E P+  RQ     S RSLK EL  I+  L++M+KRK ERK+QF +
Sbjct  65    ADSEARVIAISSAMEEPPILGRQHQSDHSRRSLKEELVKILQKLKDMEKRKSERKNQFIQ  124

Query  622   VLDQIDSVLKEL-GKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSD--------  774
             V++ +  V  E+ G+S +      ++DESDLSLR+LE++   L +LQ++K D        
Sbjct  125   VIENMRCVKDEINGESDESCSSDFSIDESDLSLRKLEELHRDLYTLQEQKEDNIFVVLLA  184

Query  775   ---RLKQVLDHLESLNSLCIVLGIDFKNTIGEIHPTLGDSSALKSVSTETIERLSAAIHE  945
                R+KQ+ +HL+ L SLC VLG++F+ T  +IHP+L +S   +S+S ET+ +L++++++
Sbjct  185   QRNRIKQIQEHLKYLESLCSVLGLNFRETATKIHPSLVESEGSRSISNETLNKLASSVNQ  244

Query  946   LREVKIQRLHMLQNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDL  1125
               E KIQR+  LQ+LATT++E W+LMD P EEQQ F NV+  IAA+ SE+T+P++LSLDL
Sbjct  245   WHETKIQRMQELQDLATTMLEFWSLMDTPAEEQQKFMNVSCNIAATVSEITKPDSLSLDL  304

Query  1126  LKSAEIEVSRLQEMKSSKMKEVLLKKRITLEELCRQAHLAIDD---SIEFTDETIESGAI  1296
             L+  + E+ RL+E+K SKMKE++LKKR  LEE+C++ H+ +++   ++E   + IESG +
Sbjct  305   LEEVKAEICRLEELKWSKMKELVLKKRSELEEICKRTHIVLEEQDLAVENVIKAIESGDV  364

Query  1297  DPSHLLEQLEIQISNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTH  1476
             +P  +LEQ+E +   VKEEA SRK+ILEK EKWL ACEEE+WLE+YN+++NRYN G+G+H
Sbjct  365   NPETILEQIEYRAGKVKEEALSRKDILEKAEKWLNACEEENWLEEYNQDENRYNAGKGSH  424

Query  1477  LMLKRAEKARALVNKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKE  1656
             L+LKRAEKARALVNK+P M+EAL S+ K WE E+   FL+DG  LLSMLE+Y  L++E+E
Sbjct  425   LILKRAEKARALVNKLPAMVEALVSKIKIWESEKEAEFLFDGNRLLSMLEEYTELREERE  484

Query  1657  LERQRQRDQKKLQGQLMAEQEVLFGSKRSPSQSGKKNVVGGASNKRISVGGAMLQTPYTE  1836
              ER+R+RD KKLQGQ+ +EQE   G+   P QS KK+ +  ++NKR +      QTP T+
Sbjct  485   QERRRKRDLKKLQGQVTSEQEK--GTPTRP-QSAKKS-LKVSTNKRFASSSP--QTPRTD  538

Query  1837  RAPLSSHSLKKINP  1878
                 S HS K I P
Sbjct  539   ----SPHSAKSITP  548



>gb|AAX12477.1| microtubule associated protein [Zinnia violacea]
Length=576

 Score =   429 bits (1102),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 249/518 (48%), Positives = 363/518 (70%), Gaps = 11/518 (2%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             E TC SLL +LQKIW+E+GE + ERDK L Q+EQECL  Y+RKVDQA +S   L Q + +
Sbjct  3     EPTCGSLLLQLQKIWDEVGESDEERDKTLLQIEQECLNVYKRKVDQAEKSKEHLLQTLED  62

Query  463   SEAELARICAALGEQP-VNV-RQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQI  636
             ++ EL+ +  +LGE+  +++  ++S ++  +L +I P LE++ K+K ER  +FS+V  QI
Sbjct  63    AKLELSTLVGSLGEKSSIDIPEKTSGTINEQLASIAPALEQLWKKKEERIKEFSDVQSQI  122

Query  637   DSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESLNS  816
               +  E+  S  EL   + +D SDL+L++LE+  +HL  LQKEKS RL +VL+++ +L+ 
Sbjct  123   KRICGEIAGSN-ELAANVTVDVSDLTLKKLEEFHNHLQELQKEKSQRLNKVLEYVSNLHD  181

Query  817   LCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHMLQNL  990
             +C +LGIDF +T+ ++HP+L D++    KS+S +T+ RL+  +  L E K QRLH LQ+L
Sbjct  182   ICGLLGIDFYSTVSDVHPSLVDATCAQSKSISNDTLARLAKTVTALEEAKKQRLHKLQDL  241

Query  991   ATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQEMK  1170
             AT + ELWNLMD   EE    D+VTR I+AS  E+T+P AL+L L++ AE+EV RL +++
Sbjct  242   ATQLSELWNLMDTSEEEMTSCDHVTRNISASVDEVTDPGALALTLIEQAEVEVERLDQLE  301

Query  1171  SSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHLLEQLEIQISNV  1344
             +++MKE+ LKK+  LEE+   AH+  D     E     I+SG I+P+ LL  ++ Q+   
Sbjct  302   ATRMKEIALKKQDELEEIFAHAHIQNDSKAAREKVLALIDSGNIEPAELLADMDAQVIKA  361

Query  1345  KEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVNKI  1524
             KEEA SRK+IL+KVEKW++ACEEESWLEDYNR+ NRYNG RG HL LKRAEKAR LV+KI
Sbjct  362   KEEALSRKDILDKVEKWMSACEEESWLEDYNRDTNRYNGSRGAHLNLKRAEKARVLVSKI  421

Query  1525  PGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQGQL  1704
             PG+++ L ++ + WE E G+ F YDGV LL+ML++Y +L+ ++E E+++ RDQKK   QL
Sbjct  422   PGIVDTLVAKTQTWEEEHGMTFAYDGVPLLAMLDEYSVLRNDREEEKRKIRDQKKFHEQL  481

Query  1705  MAEQEVLFGSKRSPSQ--SGKKNVVG--GASNKRISVG  1806
               EQE +FG K SP++  S  K ++G  G  NKR+S+ 
Sbjct  482   NTEQEAMFGPKPSPARPLSSSKKMMGQNGVPNKRLSLN  519



>ref|XP_009361055.1| PREDICTED: 65-kDa microtubule-associated protein 1-like [Pyrus 
x bretschneideri]
Length=581

 Score =   429 bits (1102),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 268/532 (50%), Positives = 382/532 (72%), Gaps = 15/532 (3%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             ETTC SLL +LQ+IWNE+GE + ERDKML QL+QECL+ Y+RKV+ A++S AQL QA+++
Sbjct  13    ETTCGSLLQKLQEIWNEVGESDEERDKMLLQLDQECLDVYKRKVELAAKSRAQLLQALSD  72

Query  463   SEAELARICAALGEQPVNV--RQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQI  636
             S  EL+ + +ALGE+       ++S ++K +L AI PLLE++ K+K ER  +F++V  QI
Sbjct  73    SRLELSSLLSALGEKTFTGVPEETSGTIKEQLAAIAPLLEQLWKQKEERVKEFTDVQLQI  132

Query  637   DSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESLNS  816
               +  E+      L    A+DESDLSL++L++ +S L  LQKEKS+RL +VL+ + +++ 
Sbjct  133   QKICGEIA-GNSNLSESPAVDESDLSLKKLDEFQSQLHDLQKEKSERLHKVLEFVSTVHD  191

Query  817   LCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHMLQNL  990
             LC VLG+DF +T+ E+HP+L DS+ +  KS+S +T+ RL+  +  L+E K QRLH LQ  
Sbjct  192   LCAVLGLDFLSTVTEVHPSLKDSTGVQSKSISNDTLSRLANTVLALKEDKKQRLHKLQES  251

Query  991   ATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQEMK  1170
             AT +++LWNLMD P EE++LF++VT  I+AS  E+T P +L+LDL++  E+EV RL ++K
Sbjct  252   ATQLIDLWNLMDTPDEERKLFEHVTCNISASVDEVTVPGSLALDLIEQTEVEVERLDQLK  311

Query  1171  SSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHLLEQLEIQISNV  1344
             SS+MKE+  KK+  LEE+  +AH+ ID     E   E I+SG ++P+ LL  ++ QI+  
Sbjct  312   SSRMKEIAFKKQAELEEIFARAHIEIDTEAAREKIMELIDSGNVEPTELLADMDDQIAKA  371

Query  1345  KEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVNKI  1524
             K+EA SRK+IL+KVEKW++ACEEESWLEDYNR++NRYN  RG HL LKRAEKAR LVNKI
Sbjct  372   KDEALSRKDILDKVEKWMSACEEESWLEDYNRDENRYNASRGAHLNLKRAEKARILVNKI  431

Query  1525  PGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQGQL  1704
             P +++ L ++ +GWE +RG+ F YDGV LL+ML++Y +L+QE+E E++R RDQKK Q   
Sbjct  432   PALVDTLVAKTRGWEEDRGISFTYDGVPLLAMLDEYAMLRQEREEEKRRMRDQKKYQDLQ  491

Query  1705  MAEQEVLFGSKRSPSQS-GKKNVVGGASNKRISVGGAMLQTPYTERAPLSSH  1857
               EQE  FGSK SP++  G K VVG  +N     GGA   TP + R  L++H
Sbjct  492   HTEQEAPFGSKPSPARPVGTKKVVGPRAN-----GGAN-GTP-SRRLSLNAH  536



>ref|XP_006656018.1| PREDICTED: 65-kDa microtubule-associated protein 1-like [Oryza 
brachyantha]
Length=582

 Score =   429 bits (1102),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 254/536 (47%), Positives = 369/536 (69%), Gaps = 18/536 (3%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             E TC SLL +LQ IW+E+GE + +RDK+L QL+QECL+ Y+RKVDQA+ S   L QA+ +
Sbjct  4     EITCGSLLQKLQFIWDEVGESDEDRDKVLYQLDQECLDVYKRKVDQATNSRDLLIQALDD  63

Query  463   SEAELARICAALGEQPV--NVRQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQI  636
             S+ ELAR+ +ALGE+ +     ++S ++K +L AI P LE++ K+K ER  +F  V  QI
Sbjct  64    SKIELARLLSALGEKAIARTPEKTSGTIKQQLAAIAPTLEKLNKQKNERVREFVNVQSQI  123

Query  637   DSVLKELGKSRKELQHMIA---LDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLES  807
             D +  E+  +  E+   +A   ++E DL+L +LE+ +S L  L+KEKS+RL++VLD++  
Sbjct  124   DQICGEIAGT-TEVGEKVATPQVNEDDLTLEKLEEFRSQLQELEKEKSNRLEKVLDYVNM  182

Query  808   LNSLCIVLGIDFKNTIGEIHPTLGDS--SALKSVSTETIERLSAAIHELREVKIQRLHML  981
             ++ LC VLG+DF +T+ E+HP+L DS     KS+S +T+ +L   +  L E K  RL  L
Sbjct  183   IHDLCTVLGMDFLSTVTEVHPSLDDSIGDNCKSISNDTLSKLDKTVATLNEDKKSRLSKL  242

Query  982   QNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQ  1161
             Q LA  + +LW+LMD P++E+ +FD+VT   +AS  E+T P AL+LDL++ AE+EV RL 
Sbjct  243   QELAGQLYDLWDLMDAPMQERSMFDHVTCNRSASVDEVTAPGALALDLIEQAEVEVQRLD  302

Query  1162  EMKSSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHLLEQLEIQI  1335
             ++K SKMKE+  KK+  LE++   AH+ ID +   E     IE+G I+PS L+  ++ QI
Sbjct  303   QLKYSKMKEIAFKKQTELEDIYAGAHIVIDTAAAHEKILALIEAGNIEPSELIADMDSQI  362

Query  1336  SNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALV  1515
             S  KEEA SRKEIL+KVE+W++ACEEESWLEDYNR+DNRYN  RG HL LKRAEKAR LV
Sbjct  363   SKAKEEALSRKEILDKVERWMSACEEESWLEDYNRDDNRYNSSRGAHLNLKRAEKARILV  422

Query  1516  NKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKK-L  1692
             NKIP ++E L ++ + WE  RG+ F+YDGV LL+ML++Y +L+QE+E +++R R+QK+ +
Sbjct  423   NKIPALVETLVAKTRAWEESRGLSFMYDGVPLLAMLDEYVMLRQEREEDKKRMREQKRYV  482

Query  1693  QGQLMAEQEVLFGSKRSPSQ-SGKKNVVGGASNKRISVGGAMLQTPYTERAPLSSH  1857
             + QL  + E  FGS+ SP++ +  K V G  SN      G+   TP + R  +S H
Sbjct  483   EQQLNTDHEGPFGSRVSPNRPASAKKVPGAKSN------GSANGTPPSRRLSVSGH  532



>ref|XP_010448214.1| PREDICTED: 65-kDa microtubule-associated protein 2 [Camelina 
sativa]
Length=578

 Score =   428 bits (1101),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 246/522 (47%), Positives = 369/522 (71%), Gaps = 14/522 (3%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             E TC +LL +LQ+IW+E+GE + ERDK+L Q+E+ECL  Y++KV+ A++S A+L Q +++
Sbjct  13    EITCGTLLQKLQEIWDEVGESDEERDKLLLQIEEECLNVYKKKVELAAKSRAELLQTLSD  72

Query  463   SEAELARICAALGEQP-VNV-RQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQI  636
             +  EL+ + +ALGE+  +++  +SS ++K +L AI P LE++ ++K ER   FS+V  QI
Sbjct  73    ATVELSNLTSALGEKSYIDIPDKSSGTIKEQLSAIAPALEQLWQQKEERVRAFSDVQSQI  132

Query  637   DSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESLNS  816
               + +E+        H++  DESDLSL+RL+D +  L  LQKEKSDRL++VL+ + +++ 
Sbjct  133   QKICEEIAGGLNNGPHVV--DESDLSLKRLDDFQRKLQELQKEKSDRLQKVLEFVSTVHD  190

Query  817   LCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHMLQNL  990
             LC VLG+DF +T+ E+HP+L +++ +  KS+S ET+ RL+  +  L+E K+QRL  LQ L
Sbjct  191   LCAVLGLDFLSTVTEVHPSLDEANGVQTKSISNETLARLAKTVLTLKEDKMQRLKKLQEL  250

Query  991   ATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQEMK  1170
             AT + +LWNLMD P EE++LFD+VT  I+AS  E+T   AL+LDL++ AE+EV RL ++K
Sbjct  251   ATQLTDLWNLMDTPDEERELFDHVTCHISASVHEVTVSGALALDLIEQAEVEVDRLDQLK  310

Query  1171  SSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHLLEQLEIQISNV  1344
             SS+MKE+  KK+  LEE+  +AH+ +   +  E     I++G  +PS LL  ++ QI+  
Sbjct  311   SSRMKEIAFKKQTELEEIYARAHIEVKPEVVRERIMSLIDAGNTEPSELLADMDSQIAKA  370

Query  1345  KEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVNKI  1524
             KEEAFSRKEIL++VEKW++ACEEESWLEDYNR+ NRY+  RG HL LKRAEKAR LV+KI
Sbjct  371   KEEAFSRKEILDRVEKWMSACEEESWLEDYNRDQNRYSASRGAHLNLKRAEKARILVSKI  430

Query  1525  PGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQGQL  1704
               M++ L ++ + WE +  + F YDGV LL+ML++Y +L+QE+E E++R ++QKK Q Q 
Sbjct  431   TAMVDTLVTKTRAWEEDNSMSFEYDGVPLLAMLDEYTMLRQEREDEKRRLKEQKKQQEQP  490

Query  1705  MAEQEVLFGSKRSPSQS-GKKNVVGGASNKRISVGGAMLQTP  1827
               +Q+  FGSK SP++    K  VG  +N     GG + +TP
Sbjct  491   HTDQDSAFGSKPSPARPISSKKPVGTRAN-----GGGLNETP  527



>ref|XP_006283406.1| hypothetical protein CARUB_v10004454mg [Capsella rubella]
 gb|EOA16304.1| hypothetical protein CARUB_v10004454mg [Capsella rubella]
Length=578

 Score =   428 bits (1100),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 255/558 (46%), Positives = 383/558 (69%), Gaps = 19/558 (3%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             E TC +LL +LQ+IW+E+GE + ERDK+L Q+E+ECL  Y++KV+QA++S A+L Q +++
Sbjct  13    EITCGTLLQKLQEIWDEVGESDEERDKLLLQIEEECLNVYKKKVEQAAKSRAELLQTLSD  72

Query  463   SEAELARICAALGEQP-VNV-RQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQI  636
             +  EL+ +  +LGE+  +++  +S+ ++K +L AI P LE++ ++K ER   FS+V  QI
Sbjct  73    ATVELSNLTTSLGEKSYIDIPDKSAGTIKEQLSAIAPALEQLWQQKEERVRAFSDVQSQI  132

Query  637   DSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESLNS  816
               + +E+        H++  DESDLSL+RL+D K  L  LQKEKSDRL++VL+ + +++ 
Sbjct  133   QKICEEIAGGLNNGPHVV--DESDLSLKRLDDFKRKLQELQKEKSDRLQKVLEFVSTVHD  190

Query  817   LCIVLGIDFKNTIGEIHPTL--GDSSALKSVSTETIERLSAAIHELREVKIQRLHMLQNL  990
             LC VLG+DF +T+ E+HP+L   +++  KS+S ET+ RL+  +  L+E K+QRL  LQ L
Sbjct  191   LCAVLGLDFLSTVTEVHPSLDEANNAQTKSISNETLARLAKTVLTLKEDKMQRLKKLQEL  250

Query  991   ATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQEMK  1170
             AT + +LWNLMD P EE++LFD+VT  I+AS  E+T   AL+LDL++ AE+EV RL ++K
Sbjct  251   ATQLTDLWNLMDTPDEERELFDHVTCNISASVHEVTVSGALALDLIEQAEVEVDRLDQLK  310

Query  1171  SSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHLLEQLEIQISNV  1344
             SS+MKE+  KK+  LEE+  +AH+ I   +  E     I++G  +PS LL  ++ QI+  
Sbjct  311   SSRMKEIAFKKQTELEEIYARAHIEIKPEVVRERIMSLIDAGNTEPSELLADMDSQIAKA  370

Query  1345  KEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVNKI  1524
             KEEAFSRKEIL++VEKW++ACEEESWLEDYNR+ NRY+  RG HL LKRAEKAR LV+KI
Sbjct  371   KEEAFSRKEILDRVEKWMSACEEESWLEDYNRDQNRYSASRGAHLNLKRAEKARILVSKI  430

Query  1525  PGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQGQL  1704
               M++ L ++ + WE +  + F YDGV LL+ML++Y +L+QE+E E++R ++ KK Q Q 
Sbjct  431   TAMVDTLVAKTRAWEEDNSMSFEYDGVPLLAMLDEYTMLRQEREDEKRRLKEHKKQQEQP  490

Query  1705  MAEQEVLFGSKRSPSQS-GKKNVVGGASNKRISVGGAMLQTPYTERAPLSSHSLKKINPV  1881
               +Q+  FGSK SP++    K  VG  +N     GG + +TP      LS +S +  +  
Sbjct  491   HTDQDSAFGSKPSPARPISAKKPVGTRAN-----GGGLNETPIRR---LSMNSSQNGSKS  542

Query  1882  KQQALANIT--QNYVALS  1929
             K+ +L  I    N VA++
Sbjct  543   KRDSLNKIASPSNLVAIT  560



>ref|NP_001057475.1| Os06g0308300 [Oryza sativa Japonica Group]
 dbj|BAD62191.1| putative microtubule-associated protein [Oryza sativa Japonica 
Group]
 dbj|BAD62311.1| putative microtubule-associated protein [Oryza sativa Japonica 
Group]
 dbj|BAF19389.1| Os06g0308300 [Oryza sativa Japonica Group]
 dbj|BAG95118.1| unnamed protein product [Oryza sativa Japonica Group]
Length=576

 Score =   427 bits (1099),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 254/536 (47%), Positives = 368/536 (69%), Gaps = 18/536 (3%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             + TC SLL +LQ IW+E+GE + +RDK+L QL+QECL+ Y+RKVDQA+ S   L QA+ +
Sbjct  4     DITCGSLLQKLQLIWDEVGESDEDRDKVLYQLDQECLDVYKRKVDQATDSRDLLIQALDD  63

Query  463   SEAELARICAALGEQPV--NVRQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQI  636
             S+ ELAR+ +ALGE+ +     ++S ++K +L AI P LE++ K+K ER  +F  V  QI
Sbjct  64    SKIELARLLSALGEKAIARTPEKTSGTIKQQLAAIAPTLEKLNKQKNERVREFVNVQSQI  123

Query  637   DSVLKELGKSRKELQHMIA---LDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLES  807
             D +  E+  +  E+   +A   ++E DL+L RLE+ +S L  L+KEKS+RL++VLD++  
Sbjct  124   DQICGEIAGT-TEVGEKVATPQVNEDDLTLERLEEFRSQLQELEKEKSNRLEKVLDYVSM  182

Query  808   LNSLCIVLGIDFKNTIGEIHPTLGDS--SALKSVSTETIERLSAAIHELREVKIQRLHML  981
             +++LC VLG+DF +T+ E+HP+L DS     KS+S +T+ +L   +  L E K  RL  L
Sbjct  183   IHNLCTVLGMDFLSTVTEVHPSLDDSIGDNCKSISNDTLSKLDKTVATLNEDKKSRLSKL  242

Query  982   QNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQ  1161
             Q LA  + +LW+LMD P++E+ +FD+VT   +AS  ++T P AL+LDL++ AE+EV RL 
Sbjct  243   QELAGQLYDLWDLMDAPMQERSMFDHVTCNRSASVDKVTAPGALALDLIEQAEVEVQRLD  302

Query  1162  EMKSSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHLLEQLEIQI  1335
             ++K SKMKE+  KK+  LE++   AH+ ID +   E     IE+G I+PS L+  +E QI
Sbjct  303   QLKYSKMKEIAFKKQTELEDIYAGAHMVIDTAAAHEKILALIEAGNIEPSELIADMESQI  362

Query  1336  SNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALV  1515
             S  KEEA SRKEIL+KVE+W++ACEEESWLEDYNR+DNRYN  RG HL LKRAEKAR LV
Sbjct  363   SKAKEEALSRKEILDKVERWMSACEEESWLEDYNRDDNRYNSSRGAHLNLKRAEKARILV  422

Query  1516  NKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKK-L  1692
             NKIP ++E L ++ + WE  RG+ F+YDGV LL+ML++Y +L+QE+E +++R R+QK+ +
Sbjct  423   NKIPALVETLVAKTRAWEESRGLSFMYDGVPLLAMLDEYVMLRQEREEDKKRMREQKRYI  482

Query  1693  QGQLMAEQEVLFGSKRSPSQS-GKKNVVGGASNKRISVGGAMLQTPYTERAPLSSH  1857
             + QL  + E  FGS+ SP++    K V G  SN      G+   TP   R  +S H
Sbjct  483   EQQLNTDHEGPFGSRVSPNRPVSAKKVPGAKSN------GSANGTPPNRRLSVSGH  532



>ref|NP_001151771.1| microtubule-associated protein MAP65-1a [Zea mays]
 gb|ACG44267.1| microtubule-associated protein MAP65-1a [Zea mays]
 gb|ACN27862.1| unknown [Zea mays]
 gb|AFW77039.1| microtubule-associated protein MAP65-1a [Zea mays]
Length=584

 Score =   428 bits (1100),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 254/535 (47%), Positives = 366/535 (68%), Gaps = 15/535 (3%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             + TC SLL +LQ IW+E+GE E +RDK+L QL+QECL+ Y+RKVDQA+ S   L QA+ +
Sbjct  4     DITCGSLLQKLQFIWDEVGESEEDRDKVLYQLDQECLDVYKRKVDQATNSRDLLIQALDD  63

Query  463   SEAELARICAALGEQPV--NVRQSSRSLKTELQAIMPlleemkkrklerkHQFSEVLDQI  636
             S+ ELAR+ +ALGE+ +     +++ ++K +L AI P LE++ K+K ERK +F  V  QI
Sbjct  64    SKIELARLLSALGEKAIARTPEKTTGTIKQQLAAIAPTLEQLTKQKNERKREFVNVQSQI  123

Query  637   DSVLKELGKSRKELQHMIA--LDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLESL  810
             D +  E+  + +  + M    ++E DL+L RLED +S L  L+KEKS+RL++VLD++  +
Sbjct  124   DQICGEIAGTIEVGEQMTTPQVNEDDLTLERLEDFRSQLKDLEKEKSNRLEKVLDYVGIV  183

Query  811   NSLCIVLGIDFKNTIGEIHPTLGDS--SALKSVSTETIERLSAAIHELREVKIQRLHMLQ  984
             + LC VLG+DF +T+ E+HP+L DS     KS+S +T+ +L   +  L E K  RL  LQ
Sbjct  184   HDLCTVLGMDFLSTVIEVHPSLDDSIGDNCKSISNDTLSKLDNTVATLNEDKKLRLSKLQ  243

Query  985   NLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQE  1164
              LA  + +LW+LMD P EE+++FD+VT   +AS  E+T P +L+LDL++ AE+EV RL +
Sbjct  244   ELAGQLYDLWDLMDAPKEERRMFDHVTCNRSASVDEVTAPGSLALDLIEQAEVEVQRLDQ  303

Query  1165  MKSSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHLLEQLEIQIS  1338
             +K SKMKE+  KK+  LE++   AH+ ID +   E     IE+G I+PS L+  ++ QI+
Sbjct  304   LKYSKMKEIAFKKQTELEDIYAGAHIVIDTAAAHEKILALIEAGNIEPSELIADMDTQIA  363

Query  1339  NVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALVN  1518
               KEEA SRK+IL+KVE+W++ACEEESWLEDYNR+DNRYN  RG HL LKRAEKAR LVN
Sbjct  364   KAKEEALSRKDILDKVERWMSACEEESWLEDYNRDDNRYNSSRGAHLNLKRAEKARILVN  423

Query  1519  KIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKK-LQ  1695
             KIP ++E L S+   WE  RG+ F+YDGV LL+ML++Y +L+QE+E E++R R+QK+ ++
Sbjct  424   KIPALVETLVSKTTAWEENRGLSFMYDGVPLLAMLDEYAMLRQEREEEKKRMREQKRYIE  483

Query  1696  GQLMAEQEVLFGSKRSPSQ-SGKKNVVGGASNKRISVGGAMLQTPYTERAPLSSH  1857
              QL  + E  FGS+ SP++ +  K  VG   N  +S G     TP   R  +S  
Sbjct  484   QQLNTDHEGPFGSRVSPNRPASSKKAVGVKVNGSVSNG-----TPPNRRLSISGQ  533



>ref|XP_003544755.1| PREDICTED: 65-kDa microtubule-associated protein 1-like isoform 
1 [Glycine max]
Length=582

 Score =   427 bits (1099),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 254/527 (48%), Positives = 375/527 (71%), Gaps = 21/527 (4%)
 Frame = +1

Query  283   ETTCCSLLSELQKIWNEIGEPEIERDKMLCQLEQECLEAYRRKVDQASRSCAQLRQAVAE  462
             E TC SLL +LQ+IW+E+GE + +RDKML QLEQECL+ Y+RKV+QA++S AQL QA+++
Sbjct  13    ENTCGSLLKKLQEIWDEVGESDEQRDKMLLQLEQECLDVYKRKVEQAAKSRAQLLQALSD  72

Query  463   SEAELARICAALGEQ-----PVNVRQSSRSLKTELQAIMPlleemkkrklerkHQFSEVL  627
             ++ EL+ + +ALGE+     P N   +S ++K +L AI P+LE++ ++K ER  +FS+V 
Sbjct  73    AKLELSTLLSALGEKSFAGIPEN---TSGTIKEQLAAIAPVLEQLWQQKEERIKEFSDVQ  129

Query  628   DQIDSVLKELGKSRKELQHMIALDESDLSLRRLEDMKSHLLSLQKEKSDRLKQVLDHLES  807
              QI  +  E+  +        A+DESDLSL++L++ +S L  LQKEKS+RL +VL+ + +
Sbjct  130   SQIQQICGEIAGNLNLNDVSPAVDESDLSLKKLDEYQSELQELQKEKSERLHKVLEFVST  189

Query  808   LNSLCIVLGIDFKNTIGEIHPTLGDSSAL--KSVSTETIERLSAAIHELREVKIQRLHML  981
             ++ LC VLG+DF +T  E+HP+L DS+ +  KS+S +T+ RL+  +  L+E K QRLH L
Sbjct  190   VHDLCAVLGMDFFSTATEVHPSLNDSTGVQSKSISNDTLARLAKTVLTLKEDKKQRLHKL  249

Query  982   QNLATTIVELWNLMDMPVEEQQLFDNVTRAIAASESELTEPNALSLDLLKSAEIEVSRLQ  1161
             Q LA+ +++LWNLMD   EE++LFD+VT  ++AS  E+T P AL+LDL++ AE+EV RL 
Sbjct  250   QELASQLIDLWNLMDTHPEERRLFDHVTCNMSASVDEVTVPGALALDLIEQAEVEVERLD  309

Query  1162  EMKSSKMKEVLLKKRITLEELCRQAHLAIDDSI--EFTDETIESGAIDPSHLLEQLEIQI  1335
             ++K+S+MKE+  KK+  LEE+  +AH+ +D     E     I+SG I+P+ LL  ++ QI
Sbjct  310   QLKASRMKEIAFKKQAELEEIFARAHIEVDPDAAREKIMALIDSGNIEPTELLADMDNQI  369

Query  1336  SNVKEEAFSRKEILEKVEKWLAACEEESWLEdynrndnrynggrgTHLMLKRAEKARALV  1515
             +  KEEA S+K+IL+KVEKW++AC+EESWLEDYNR++NRYN  RG H+ LKRAEKAR LV
Sbjct  370   AKAKEEAVSQKDILDKVEKWMSACDEESWLEDYNRDENRYNASRGAHINLKRAEKARILV  429

Query  1516  NKIPGMLEALTSRAKGWEIERGVPFLYDGVSLLSMLEQYGLLKQEKELERQRQRDQKKLQ  1695
             NKIP +++ L ++ + WE + G+ F YDGV LL+ML++Y +L+ E+E E++R RDQKK  
Sbjct  430   NKIPALVDTLVAKTRAWEEDHGMSFTYDGVPLLAMLDEYAMLRHEREEEKRRMRDQKKHH  489

Query  1696  GQLMAEQEVLFGSKRSP------SQSGKKNVVGGAS---NKRISVGG  1809
              Q   EQE +FGS+ SP      S+SG     GGA+   N+R+S+  
Sbjct  490   EQRNTEQETIFGSRPSPARPVSSSKSGGPRANGGANATPNRRLSLNA  536



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 8212475441472