BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c17877_g1_i1 len=1172 path=[1430:0-727 2156:728-1171]

Length=1172
                                                                      Score     E

ref|XP_004308006.1|  PREDICTED: uncharacterized protein LOC101294406    339   2e-110   
ref|XP_007038963.1|  General transcription factor IIF subunit 1         327   3e-106   
ref|XP_002268340.1|  PREDICTED: uncharacterized protein LOC100244979    326   5e-106   Vitis vinifera
emb|CBI22534.3|  unnamed protein product                                326   7e-106   
ref|XP_006376621.1|  hypothetical protein POPTR_0012s01440g             322   2e-104   
ref|XP_011015183.1|  PREDICTED: uncharacterized protein LOC105118833    320   1e-103   
ref|XP_011001964.1|  PREDICTED: uncharacterized protein LOC105109071    320   2e-102   
ref|XP_011005532.1|  PREDICTED: uncharacterized protein LOC105111780    314   1e-101   
ref|XP_010671510.1|  PREDICTED: uncharacterized protein LOC104888288    313   4e-101   
ref|XP_007218733.1|  hypothetical protein PRUPE_ppa009099mg             313   9e-101   
ref|XP_008376696.1|  PREDICTED: LOW QUALITY PROTEIN: polypyrimidi...    325   4e-100   
emb|CAN66869.1|  hypothetical protein VITISV_013673                     325   6e-100   Vitis vinifera
ref|XP_006422127.1|  hypothetical protein CICLE_v10005489mg             311   7e-100   
ref|XP_006374129.1|  hypothetical protein POPTR_0015s02280g             309   2e-99    
gb|KDP22167.1|  hypothetical protein JCGZ_25998                         308   9e-99    
gb|KDO56121.1|  hypothetical protein CISIN_1g047564mg                   306   5e-98    
gb|KHG01320.1|  tRNA dimethylallyltransferase                           305   6e-98    
gb|KEH35444.1|  polypyrimidine tract-binding-like protein, putative     305   2e-97    
ref|XP_009589657.1|  PREDICTED: uncharacterized protein LOC104086988    304   2e-97    
ref|XP_003523385.1|  PREDICTED: uncharacterized protein LOC100775278    302   2e-96    
ref|XP_010097854.1|  hypothetical protein L484_011453                   301   2e-96    
ref|XP_003527975.1|  PREDICTED: uncharacterized protein LOC100808653    301   2e-96    
ref|XP_009788724.1|  PREDICTED: uncharacterized protein LOC104236496    300   8e-96    
ref|XP_007137572.1|  hypothetical protein PHAVU_009G137800g             299   2e-95    
ref|XP_004234273.1|  PREDICTED: uncharacterized protein LOC101255466    298   6e-95    
ref|XP_002523309.1|  conserved hypothetical protein                     298   7e-95    Ricinus communis
ref|XP_010261521.1|  PREDICTED: uncharacterized protein LOC104600334    297   1e-94    
ref|XP_004502615.1|  PREDICTED: uncharacterized protein LOC101500123    295   1e-93    
ref|XP_006350579.1|  PREDICTED: uncharacterized protein LOC102585948    295   2e-93    
gb|EYU25200.1|  hypothetical protein MIMGU_mgv1a010494mg                292   1e-92    
emb|CDP05089.1|  unnamed protein product                                291   3e-92    
ref|XP_003602203.1|  Polypyrimidine tract-binding protein-like pr...    305   6e-92    
gb|KFK27697.1|  hypothetical protein AALP_AA8G416800                    290   1e-91    
ref|XP_010493553.1|  PREDICTED: uncharacterized protein LOC104770791    286   3e-90    
ref|XP_010550522.1|  PREDICTED: uncharacterized protein LOC104821367    286   3e-90    
ref|XP_010454704.1|  PREDICTED: uncharacterized protein LOC104736425    285   1e-89    
ref|XP_002872093.1|  hypothetical protein ARALYDRAFT_489270             283   5e-89    
gb|KGN49880.1|  hypothetical protein Csa_5G139580                       281   2e-88    
ref|NP_197801.1|  uncharacterized protein                               278   6e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010421224.1|  PREDICTED: uncharacterized protein LOC104706713    273   2e-85    
ref|XP_006289578.1|  hypothetical protein CARUB_v10003123mg             270   6e-84    
ref|XP_011076462.1|  PREDICTED: uncharacterized protein LOC105160678    268   2e-83    
ref|XP_009150943.1|  PREDICTED: uncharacterized protein LOC103874287    268   5e-83    
emb|CDX80417.1|  BnaC07g30270D                                          267   9e-83    
ref|XP_006394671.1|  hypothetical protein EUTSA_v10005277mg             267   1e-82    
ref|XP_004145983.1|  PREDICTED: polypyrimidine tract-binding prot...    276   2e-81    
ref|XP_010913877.1|  PREDICTED: uncharacterized protein LOC105039436    261   7e-81    
ref|XP_010925757.1|  PREDICTED: uncharacterized protein LOC105048216    259   2e-79    
ref|XP_008437579.1|  PREDICTED: LOW QUALITY PROTEIN: polypyrimidi...    268   2e-78    
ref|XP_008783833.1|  PREDICTED: uncharacterized protein LOC103702954    256   5e-78    
ref|XP_009419791.1|  PREDICTED: uncharacterized protein LOC103999697    248   1e-75    
ref|XP_009400133.1|  PREDICTED: uncharacterized protein LOC103984377    248   2e-75    
ref|XP_010915673.1|  PREDICTED: uncharacterized protein LOC105040713    247   1e-74    
emb|CDM82073.1|  unnamed protein product                                245   2e-74    
ref|XP_008382638.1|  PREDICTED: bidirectional sugar transporter S...    244   2e-72    
ref|XP_008810837.1|  PREDICTED: polypyrimidine tract-binding prot...    251   6e-72    
dbj|BAJ94001.1|  predicted protein                                      239   8e-72    
dbj|BAJ85962.1|  predicted protein                                      238   1e-71    
gb|EMT05914.1|  hypothetical protein F775_43838                         238   1e-71    
ref|XP_003571174.1|  PREDICTED: uncharacterized protein LOC100837489    235   3e-70    
gb|EPS69524.1|  hypothetical protein M569_05242                         231   1e-69    
ref|XP_009405759.1|  PREDICTED: uncharacterized protein LOC103988835    231   3e-69    
ref|XP_002322029.1|  hypothetical protein POPTR_0015s06180g             224   2e-67    Populus trichocarpa [western balsam poplar]
ref|XP_002453632.1|  hypothetical protein SORBIDRAFT_04g009370          221   4e-65    Sorghum bicolor [broomcorn]
ref|XP_004951283.1|  PREDICTED: uncharacterized protein LOC101767480    216   7e-63    
gb|AFW71050.1|  hypothetical protein ZEAMMB73_759750                    212   1e-61    
ref|XP_006648514.1|  PREDICTED: uncharacterized protein LOC102702258    212   2e-61    
gb|ACG25602.1|  hypothetical protein                                    211   2e-61    Zea mays [maize]
ref|NP_001046472.1|  Os02g0257200                                       208   5e-60    Oryza sativa Japonica Group [Japonica rice]
gb|EAY85254.1|  hypothetical protein OsI_06627                          207   6e-60    Oryza sativa Indica Group [Indian rice]
gb|KHN44230.1|  hypothetical protein glysoja_024450                     195   1e-56    
dbj|BAK07099.1|  predicted protein                                      194   2e-55    
gb|EAZ22464.1|  hypothetical protein OsJ_06133                          189   3e-53    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004173685.1|  PREDICTED: uncharacterized protein LOC101224750    179   3e-50    
gb|EAY99221.1|  hypothetical protein OsI_21179                          180   1e-49    Oryza sativa Indica Group [Indian rice]
ref|XP_011016841.1|  PREDICTED: uncharacterized protein LOC105120377    173   8e-49    
ref|NP_001056464.1|  Os05g0586700                                       174   4e-47    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002440352.1|  hypothetical protein SORBIDRAFT_09g030120          170   8e-46    Sorghum bicolor [broomcorn]
ref|NP_001130233.1|  hypothetical protein                               158   1e-41    Zea mays [maize]
ref|XP_004961054.1|  PREDICTED: uncharacterized protein LOC101778091    156   6e-41    
ref|XP_009376261.1|  PREDICTED: uncharacterized protein LOC103964972    154   8e-40    
ref|XP_011007946.1|  PREDICTED: uncharacterized protein LOC105113464    149   1e-38    
ref|XP_001782862.1|  predicted protein                                  143   7e-36    
gb|EEE64862.1|  hypothetical protein OsJ_19719                          141   4e-35    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006655643.1|  PREDICTED: uncharacterized protein LOC102701453    134   8e-33    
ref|XP_002978101.1|  hypothetical protein SELMODRAFT_271297             128   3e-30    
ref|XP_002966642.1|  hypothetical protein SELMODRAFT_270578             127   5e-30    
ref|XP_003567806.1|  PREDICTED: uncharacterized protein LOC100820898    120   2e-27    
ref|XP_006847359.1|  hypothetical protein AMTR_s00015p00258100          110   2e-25    
gb|EMS68377.1|  hypothetical protein TRIUR3_07236                     97.1    7e-20    
ref|XP_006376626.1|  hypothetical protein POPTR_0012s01490g           89.7    3e-18    
ref|NP_001142548.1|  uncharacterized protein LOC100274799             87.4    4e-17    Zea mays [maize]
gb|EMT01834.1|  hypothetical protein F775_20590                       82.0    4e-15    
ref|XP_006847361.1|  hypothetical protein AMTR_s00015p00258140        67.0    5e-10    
ref|WP_026300548.1|  hypothetical protein                             50.8    7e-04    



>ref|XP_004308006.1| PREDICTED: uncharacterized protein LOC101294406 [Fragaria vesca 
subsp. vesca]
Length=334

 Score =   339 bits (870),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 193/316 (61%), Positives = 238/316 (75%), Gaps = 10/316 (3%)
 Frame = -1

Query  1100  ETRTEKMVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAELSREPKSGlv  921
             E    KMVKLASARE R+YGP LS +R+EY+NAGLYVF+  VLL GFAAE+S+EP SGLV
Sbjct  26    ENADLKMVKLASAREARMYGPRLSRNRAEYINAGLYVFAMAVLLGGFAAEMSKEPTSGLV  85

Query  920   llliafaliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGIL  741
             LLLI FAL+ +VN HDLLAHLAGFD+RL +   D QLA VEFA P++  LG L  FLGIL
Sbjct  86    LLLIGFALVLLVNLHDLLAHLAGFDYRLRMMELDLQLAFVEFAVPVVQALGSLLWFLGIL  145

Query  740   FLFIQDEKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIP  561
             FLFIQ E+G YG+Y+LE   + +LIAGP LW+LGSI NSCQIYER+ GH+QILQQS+ IP
Sbjct  146   FLFIQAERG-YGFYKLEKHAMNMLIAGPVLWLLGSIHNSCQIYERSDGHVQILQQSVQIP  204

Query  560   FLIGSLLFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKV  381
             FLI S+LF +GA+LN+        ++YH    LLGGTW+ +GI GST+L VGGLANVVKV
Sbjct  205   FLIASVLFTIGAVLNIL---EQGGVVYHGL-ELLGGTWIWMGIAGSTLLLVGGLANVVKV  260

Query  380   FNIQQMS--GMMRLEKLRGGAHERLMHEREGGLPLIVDDAAEKQRWRIRPPHEEWQpapa  207
             F +QQM    ++RLEKLRGGA ERL+HEREG +PLI++D   ++R   +   ++ +P+  
Sbjct  261   FKMQQMDDGAILRLEKLRGGAQERLVHEREGQVPLILEDQRRRKR---QLSQQQQEPSIH  317

Query  206   apvsaptPYKDVLVGN  159
                  PTPYKDVLVG 
Sbjct  318   IAAPQPTPYKDVLVGQ  333



>ref|XP_007038963.1| General transcription factor IIF subunit 1 [Theobroma cacao]
 gb|EOY23464.1| General transcription factor IIF subunit 1 [Theobroma cacao]
Length=292

 Score =   327 bits (837),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 190/308 (62%), Positives = 227/308 (74%), Gaps = 16/308 (5%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAELSREPKSGlvllliaf  903
             MVKLASARE R YGP LS SR+E +NAGLY+F+T+VL+CGFAAE S EP+SGLVL+LIA 
Sbjct  1     MVKLASARESRTYGPRLSRSRAECVNAGLYLFATVVLICGFAAEFSWEPRSGLVLMLIAL  60

Query  902   aliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLFIQD  723
             ALI  VN HDLLAHLAG D+R  L G+DTQLALVEFA P++ +LG L  F+GILF FIQ 
Sbjct  61    ALIIFVNLHDLLAHLAGIDYRFPLMGFDTQLALVEFAVPVVQVLGSLLFFVGILFFFIQA  120

Query  722   EKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLIGSL  543
             EKG YGY++LE   L LLIAGP  WVLGSI NSCQIYERA GH+QILQQS+ IPFLIGS+
Sbjct  121   EKG-YGYFKLEKHALGLLIAGPVFWVLGSIHNSCQIYERADGHVQILQQSVLIPFLIGSV  179

Query  542   LFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVFNIQQM  363
             L +VG+ILN     H    I H    LLG TWVR+GICGS + F+GGL NVVKVF +QQ+
Sbjct  180   LLMVGSILN----SHEQAGISHHGLELLGRTWVRLGICGSLMFFIGGLTNVVKVFKMQQI  235

Query  362   SGMMRLEKLRGGAHERLMHEREGGLPLIVDDAAEKQRWRIRPPHEEWQpapaapvsaptP  183
             +G +RLEKLRGGA +RL+  RE  +PLI+++          P  +       A  +A TP
Sbjct  236   NG-LRLEKLRGGAQDRLIQGRERHVPLIIEE----------PRRKMLVEEVNATAAASTP  284

Query  182   YKDVLVGN  159
             YKDVL+G 
Sbjct  285   YKDVLLGR  292



>ref|XP_002268340.1| PREDICTED: uncharacterized protein LOC100244979 [Vitis vinifera]
Length=293

 Score =   326 bits (836),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 188/308 (61%), Positives = 232/308 (75%), Gaps = 16/308 (5%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAELSREPKSGlvllliaf  903
             MVKLASARE R+YG  L+ +R EY+NAGLYVF+TIVLL GF ++LSR+PKSGL L++I  
Sbjct  1     MVKLASARESRLYGTRLARNRFEYINAGLYVFATIVLLSGFVSQLSRDPKSGLALMMIGL  60

Query  902   aliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLFIQD  723
              L+ VVN HDL+AH+AG D+RL L  +D QL LVEF+ P +  +G L SFLGILFLF+Q+
Sbjct  61    GLLFVVNVHDLVAHMAGIDYRLGLMEFDLQLGLVEFSVPFVQAMGYLLSFLGILFLFLQE  120

Query  722   EKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLIGSL  543
             EKG YGY++LE   L +LIAGP LWVLGSI NSCQIYERA GH+QILQQS+HIPFL+GSL
Sbjct  121   EKG-YGYFKLERHALNMLIAGPVLWVLGSIHNSCQIYERADGHIQILQQSVHIPFLMGSL  179

Query  542   LFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVFNIQQM  363
             LF+VG+I+N    H  + L++H    LLG  WV +G+ GS + F+GGL NVVKVF +QQM
Sbjct  180   LFMVGSIINC---HEQARLVHHGI-DLLGMAWVWLGMFGSLLFFIGGLMNVVKVFKMQQM  235

Query  362   SGMMRLEKLRGGAHERLMHEREGGLPLIVDDAAEKQRWRIRPPHEEWQpapaapvsaptP  183
              G +RLEKLRGGA ERL+HEREG +PLI++D       R R  H E       PV  PTP
Sbjct  236   DG-LRLEKLRGGAQERLIHEREGQIPLILEDQ------RRRKIHVE----ETMPVVVPTP  284

Query  182   YKDVLVGN  159
             Y+DVLVG+
Sbjct  285   YRDVLVGH  292



>emb|CBI22534.3| unnamed protein product [Vitis vinifera]
Length=306

 Score =   326 bits (836),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 188/308 (61%), Positives = 232/308 (75%), Gaps = 16/308 (5%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAELSREPKSGlvllliaf  903
             MVKLASARE R+YG  L+ +R EY+NAGLYVF+TIVLL GF ++LSR+PKSGL L++I  
Sbjct  1     MVKLASARESRLYGTRLARNRFEYINAGLYVFATIVLLSGFVSQLSRDPKSGLALMMIGL  60

Query  902   aliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLFIQD  723
              L+ VVN HDL+AH+AG D+RL L  +D QL LVEF+ P +  +G L SFLGILFLF+Q+
Sbjct  61    GLLFVVNVHDLVAHMAGIDYRLGLMEFDLQLGLVEFSVPFVQAMGYLLSFLGILFLFLQE  120

Query  722   EKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLIGSL  543
             EKG YGY++LE   L +LIAGP LWVLGSI NSCQIYERA GH+QILQQS+HIPFL+GSL
Sbjct  121   EKG-YGYFKLERHALNMLIAGPVLWVLGSIHNSCQIYERADGHIQILQQSVHIPFLMGSL  179

Query  542   LFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVFNIQQM  363
             LF+VG+I+N    H  + L++H    LLG  WV +G+ GS + F+GGL NVVKVF +QQM
Sbjct  180   LFMVGSIINC---HEQARLVHHGI-DLLGMAWVWLGMFGSLLFFIGGLMNVVKVFKMQQM  235

Query  362   SGMMRLEKLRGGAHERLMHEREGGLPLIVDDAAEKQRWRIRPPHEEWQpapaapvsaptP  183
              G +RLEKLRGGA ERL+HEREG +PLI++D       R R  H E       PV  PTP
Sbjct  236   DG-LRLEKLRGGAQERLIHEREGQIPLILEDQ------RRRKIHVE----ETMPVVVPTP  284

Query  182   YKDVLVGN  159
             Y+DVLVG+
Sbjct  285   YRDVLVGH  292



>ref|XP_006376621.1| hypothetical protein POPTR_0012s01440g [Populus trichocarpa]
 gb|ERP54418.1| hypothetical protein POPTR_0012s01440g [Populus trichocarpa]
Length=296

 Score =   322 bits (825),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 199/311 (64%), Positives = 234/311 (75%), Gaps = 19/311 (6%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAELSREPKSGlvllliaf  903
             MVKLASARE R+YGP LS +R+EYMNAGLYVF+TIVL+ GF AELS+E K GLVLLLIA 
Sbjct  1     MVKLASARESRMYGPRLSKNRAEYMNAGLYVFATIVLIGGFVAELSKETKPGLVLLLIAL  60

Query  902   aliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLFIQD  723
              LI VVN HDL+AHLAG D+R  L GYDTQLALVEFA P++  LG L SFLGILFLFIQ+
Sbjct  61    LLITVVNLHDLVAHLAGIDYRWRLMGYDTQLALVEFAVPVIQALGTLLSFLGILFLFIQE  120

Query  722   EKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLIGSL  543
              KG YG+++LE   L LL AGP  WVLGS+ NSCQIYERA GH+QILQQS+HIPFL+GS 
Sbjct  121   YKG-YGHFKLERHALNLLAAGPAFWVLGSLHNSCQIYERADGHVQILQQSVHIPFLMGSS  179

Query  542   LFLVGAILNL---TGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVFNI  372
             LFLVG+ILN+    G  HH          LLG TWV +G  GS + F+GGLA+VVKVF +
Sbjct  180   LFLVGSILNIREQAGWGHHG-------LELLGKTWVWIGFFGSLMFFIGGLADVVKVFEM  232

Query  371   QQMSGMMRLEKLRGGAHERLMHEREGGLPLIVDDAAEKQRWRIRPPHEEWQpapaapvsa  192
             QQ+  ++RLEKLRGGA ERL+ EREG  PLI+ + AE++  RI       +   AAP+ A
Sbjct  233   QQID-VLRLEKLRGGAQERLVREREGQAPLILAE-AERRGKRIA------EGTRAAPIPA  284

Query  191   ptPYKDVLVGN  159
             PTPYKDVLVG 
Sbjct  285   PTPYKDVLVGQ  295



>ref|XP_011015183.1| PREDICTED: uncharacterized protein LOC105118833 [Populus euphratica]
Length=296

 Score =   320 bits (820),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 196/314 (62%), Positives = 228/314 (73%), Gaps = 25/314 (8%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAELSREPKSGlvllliaf  903
             MVKLASARE R+YGP LS SR+EYMNAGLYVF+TIVL+ GF AELS+E K GLVLLLIA 
Sbjct  1     MVKLASAREIRMYGPRLSKSRAEYMNAGLYVFATIVLIGGFVAELSKETKPGLVLLLIAL  60

Query  902   aliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLFIQD  723
              LI VVN HDL+AHLAG D+RL L GYDTQLALVEFA P++  LG L SFLGILFLFIQ+
Sbjct  61    LLITVVNLHDLVAHLAGIDYRLRLMGYDTQLALVEFAVPVIQALGALLSFLGILFLFIQE  120

Query  722   EKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLIGSL  543
              KG Y +++LE   L LL AGP  W+LGS+ NSCQIYERA GH+QILQQS+HIPFL+GS 
Sbjct  121   YKG-YDHFKLERHALNLLAAGPAFWMLGSLHNSCQIYERADGHVQILQQSVHIPFLMGSS  179

Query  542   LFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVFNIQQM  363
             LFLVG+ILN+     H+   +H    LLG TWV +GI GS + F+GGL NVVKVF +Q +
Sbjct  180   LFLVGSILNI---REHAGWGHHGL-ELLGKTWVWIGIFGSLMFFIGGLTNVVKVFEMQHV  235

Query  362   SGMMRLEKLRGGAHERLMHEREGGLPLIV------DDAAEKQRWRIRPPHEEWQpapaap  201
              G +RLEKLRGGA ERL  EREG  PLI+      +  AE+ R  +  P           
Sbjct  236   DG-LRLEKLRGGAQERLRREREGQAPLILGGERRGETIAEETRAALLIP-----------  283

Query  200   vsaptPYKDVLVGN  159
               APTPYKDVLVG 
Sbjct  284   --APTPYKDVLVGQ  295



>ref|XP_011001964.1| PREDICTED: uncharacterized protein LOC105109071 [Populus euphratica]
Length=389

 Score =   320 bits (821),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 196/315 (62%), Positives = 228/315 (72%), Gaps = 25/315 (8%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAELSREPKSGlvllliaf  903
             MVKLASARE R+YGP LS SR+EYMNAGLYVF+TIVL+ GF AELS+E K GLVLLLIA 
Sbjct  1     MVKLASAREIRMYGPRLSKSRAEYMNAGLYVFATIVLIGGFVAELSKETKPGLVLLLIAL  60

Query  902   aliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLFIQD  723
              LI VVN HDL+AHLAG D+RL L GYDTQLALVEFA P++  LG L SFLGILFLFIQ+
Sbjct  61    LLITVVNLHDLVAHLAGIDYRLRLMGYDTQLALVEFAVPVIQALGALLSFLGILFLFIQE  120

Query  722   EKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLIGSL  543
              KG Y +++LE   L LL AGP  W+LGS+ NSCQIYERA GH+QILQQS+HIPFL+GS 
Sbjct  121   YKG-YDHFKLERHALNLLAAGPAFWMLGSLHNSCQIYERADGHVQILQQSVHIPFLMGSS  179

Query  542   LFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVFNIQQM  363
             LFLVG+ILN+     H+   +H    LLG TWV +GI GS + F+GGL NVVKVF +Q +
Sbjct  180   LFLVGSILNI---REHAGWGHHGL-ELLGKTWVWIGIFGSLMFFIGGLTNVVKVFEMQHV  235

Query  362   SGMMRLEKLRGGAHERLMHEREGGLPLIV------DDAAEKQRWRIRPPHEEWQpapaap  201
              G +RLEKLRGGA ERL  EREG  PLI+      +  AE+ R  +  P           
Sbjct  236   DG-LRLEKLRGGAQERLRREREGQAPLILGGERRGETIAEETRAALLIP-----------  283

Query  200   vsaptPYKDVLVGNV  156
               APTPYKDVLV  V
Sbjct  284   --APTPYKDVLVVKV  296



>ref|XP_011005532.1| PREDICTED: uncharacterized protein LOC105111780 [Populus euphratica]
Length=257

 Score =   314 bits (804),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 177/258 (69%), Positives = 207/258 (80%), Gaps = 6/258 (2%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAELSREPKSGlvllliaf  903
             MVKLASARE R+YGPGL+ +R EYMNAGL VF+ IVL+ GF AELS+EPKSGLVLLLI  
Sbjct  1     MVKLASARESRMYGPGLARNRGEYMNAGLCVFAAIVLVGGFVAELSKEPKSGLVLLLIGL  60

Query  902   aliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLFIQD  723
              LI VVN HDL+AHLAG D+R  L G+DTQLALVEFA P++   G L SFLGILFLFIQ+
Sbjct  61    LLIMVVNLHDLVAHLAGIDYRFPLMGFDTQLALVEFAVPVVQASGALLSFLGILFLFIQE  120

Query  722   EKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLIGSL  543
              KG YG+++LE   L LLIAGP LWVLGSI NSCQIYERA GH+QILQQS+HIPFL+GSL
Sbjct  121   YKG-YGHFKLERHALNLLIAGPALWVLGSIHNSCQIYERADGHVQILQQSVHIPFLMGSL  179

Query  542   LFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVFNIQQM  363
             LFLVG+ILN+   H  +   YH  + LLG TWV  GICGS ++F+GGLAN VKVF +QQ+
Sbjct  180   LFLVGSILNI---HEQAGRGYHGLK-LLGKTWVWTGICGSLMIFIGGLANAVKVFKMQQI  235

Query  362   SGMMRLEKLRGGAHERLM  309
              G +RLEKLRGGA ER++
Sbjct  236   DG-LRLEKLRGGAQERIL  252



>ref|XP_010671510.1| PREDICTED: uncharacterized protein LOC104888288 [Beta vulgaris 
subsp. vulgaris]
Length=294

 Score =   313 bits (803),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 182/308 (59%), Positives = 222/308 (72%), Gaps = 15/308 (5%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAELSREPKSGlvllliaf  903
             MVKLASARE R+YGP L+ +RSEYMNAGLY+F+T+VLL GF A+ S EPKSGLVLLLI F
Sbjct  1     MVKLASAREIRMYGPRLTRNRSEYMNAGLYLFATVVLLMGFLAQFSWEPKSGLVLLLIGF  60

Query  902   aliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLFIQD  723
              LI +VN HDL+AHLAG D+R+SL  +D QLALVEFA P L  LG + SF  I  LFI +
Sbjct  61    FLIIIVNVHDLVAHLAGIDYRMSLMEFDIQLALVEFAVPFLQTLGSILSFFAIFLLFILE  120

Query  722   EKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLIGSL  543
             EKG    Y+LEN  + +L+AGP LW++GSI NSCQIYERA GH+QILQ+S+ +PFL+GSL
Sbjct  121   EKGI--GYKLENHAMNMLVAGPVLWLIGSIHNSCQIYERADGHVQILQESVTVPFLLGSL  178

Query  542   LFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVFNIQQM  363
             LF+VGAI+N       S   YH    LLG TWV  G+ GS +LF+GGL NVVKVF +QQM
Sbjct  179   LFVVGAIIN---SREQSRWFYHGLM-LLGKTWVWSGVFGSLLLFIGGLMNVVKVFKMQQM  234

Query  362   SGMMRLEKLRGGAHERLMHEREGGLPLIVDDAAEKQRWRIRPPHEEWQpapaapvsaptP  183
             +G +RLEKLRGGA ERL+  REG +PLI ++    +R +   P            +  TP
Sbjct  235   NG-LRLEKLRGGAQERLIRVREGQVPLIPEENQPTRRLQSADPKN--------LSTPATP  285

Query  182   YKDVLVGN  159
             YKDVLVGN
Sbjct  286   YKDVLVGN  293



>ref|XP_007218733.1| hypothetical protein PRUPE_ppa009099mg [Prunus persica]
 gb|EMJ19932.1| hypothetical protein PRUPE_ppa009099mg [Prunus persica]
Length=306

 Score =   313 bits (802),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 176/286 (62%), Positives = 215/286 (75%), Gaps = 8/286 (3%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAELSREPKSGlvllliaf  903
             MVKLASARE R+YGP +  +R+EY+NAGLYVF+T+VLL GF A+LS+ PKSGLVL+LIA 
Sbjct  1     MVKLASAREVRMYGPRMGRNRAEYINAGLYVFATVVLLGGFVAQLSKAPKSGLVLMLIAL  60

Query  902   aliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLFIQD  723
              +I VVN HDL+AHLA FD+ + L   D QLALVEFA P++  LG + SFLGILFL IQ 
Sbjct  61    VIILVVNLHDLVAHLAMFDYSMPLMELDLQLALVEFAVPVIQALGSVLSFLGILFLLIQA  120

Query  722   EKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLIGSL  543
             EKG YGY + E     +LIAGP LW+LGSI NSCQIYERA GH+QILQQS+HIPFLIGS+
Sbjct  121   EKG-YGYSKFERHAKNMLIAGPVLWLLGSIHNSCQIYERADGHVQILQQSVHIPFLIGSV  179

Query  542   LFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVFNIQQM  363
             LF VGAILN   +H    L  H  + LLG  WV +G  GS +  +GGLANV KVF +QQM
Sbjct  180   LFTVGAILNTREQHD---LFRHGLQ-LLGRNWVWLGTGGSLMFLIGGLANVAKVFKMQQM  235

Query  362   SGMMRLEKLRGGAHERLMHEREGGLPLIVDDAAEKQRWRIRPPHEE  225
             S  +RLEKLRGGA ERL++EREG +PLI++D   ++R   RP + +
Sbjct  236   SDGLRLEKLRGGAQERLVYEREGHVPLILED---QRRRSNRPSYHD  278



>ref|XP_008376696.1| PREDICTED: LOW QUALITY PROTEIN: polypyrimidine tract-binding 
protein homolog 2 [Malus domestica]
Length=747

 Score =   325 bits (833),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 183/271 (68%), Positives = 214/271 (79%), Gaps = 5/271 (2%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAELSREPKSGlvllliaf  903
             MVKLASARE R+YGP LS +R+EYMNAGLYVF+T+VLL GF A+LS+EPKSGLVL+LIA 
Sbjct  1     MVKLASAREFRMYGPRLSRNRAEYMNAGLYVFATVVLLGGFVAQLSKEPKSGLVLMLIAL  60

Query  902   aliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLFIQD  723
             ALI VVN HDL+AHLA FD+R+ L  +D QLALVEFA P++  LG + SFLGILFL IQ 
Sbjct  61    ALILVVNLHDLVAHLAMFDYRMPLMEFDLQLALVEFAVPVVQALGTVLSFLGILFLLIQA  120

Query  722   EKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLIGSL  543
             EKG YGY +LE     +LIAGP LW+LGSI NSCQIYERA GH+QILQQSIHIPFLIGS+
Sbjct  121   EKG-YGYSKLERHAKNMLIAGPVLWLLGSIHNSCQIYERADGHVQILQQSIHIPFLIGSV  179

Query  542   LFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVFNIQQM  363
             LF VGAILN   +H    L  H  + LLG  WV +G+ GS    +GGLANVVKVF +QQM
Sbjct  180   LFTVGAILNSREQHG---LFLHGLQ-LLGRNWVWLGMGGSLFFLIGGLANVVKVFKMQQM  235

Query  362   SGMMRLEKLRGGAHERLMHEREGGLPLIVDD  270
                +RLEKLRGGA ERL+HEREG +PLI++D
Sbjct  236   GDGLRLEKLRGGAQERLVHEREGQVPLILED  266



>emb|CAN66869.1| hypothetical protein VITISV_013673 [Vitis vinifera]
Length=755

 Score =   325 bits (833),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 173/276 (63%), Positives = 217/276 (79%), Gaps = 6/276 (2%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAELSREPKSGlvllliaf  903
             MVKLASARE R+YG  L+ +R EY+NAGLYVF+TIVLL GF ++LSR+PKSGL L++I  
Sbjct  1     MVKLASARESRLYGTRLARNRFEYINAGLYVFATIVLLSGFVSQLSRDPKSGLALMMIGL  60

Query  902   aliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLFIQD  723
              L+ VVN HDL+AH+AG D+RL L  +D QL LVEF+ P +  +G L SFLGILFLF+Q+
Sbjct  61    GLLFVVNVHDLVAHMAGIDYRLGLMEFDLQLGLVEFSVPFVQAMGYLLSFLGILFLFLQE  120

Query  722   EKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLIGSL  543
             EKG YGY++LE   L +LIAGP LWVLGSI NSCQIYERA GH+QILQQS+HIPFL+GSL
Sbjct  121   EKG-YGYFKLERHALNMLIAGPVLWVLGSIHNSCQIYERADGHIQILQQSVHIPFLMGSL  179

Query  542   LFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVFNIQQM  363
             LF+VG+I+N    H  + L++H    LLG  WV +G+ GS + F+GGL NVVKVF +QQM
Sbjct  180   LFMVGSIINC---HEQARLVHHGI-DLLGMAWVWLGMFGSLLFFIGGLMNVVKVFKMQQM  235

Query  362   SGMMRLEKLRGGAHERLMHEREGGLPLIVDDAAEKQ  255
              G +RLEKLRGGA ERL+HEREG +PLI++D   ++
Sbjct  236   DG-LRLEKLRGGAQERLIHEREGQIPLILEDQRRRK  270



>ref|XP_006422127.1| hypothetical protein CICLE_v10005489mg [Citrus clementina]
 gb|ESR35367.1| hypothetical protein CICLE_v10005489mg [Citrus clementina]
Length=309

 Score =   311 bits (796),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 190/285 (67%), Positives = 218/285 (76%), Gaps = 16/285 (6%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAELSREPKSGlvllliaf  903
             MVKLASARE R+YGP L+ +R+EYMNAGLYVF+TIVLL GFAAE SREPKSGLVLLLIA 
Sbjct  1     MVKLASARETRMYGPRLTRNRAEYMNAGLYVFATIVLLGGFAAEFSREPKSGLVLLLIAL  60

Query  902   aliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLFIQD  723
             ALI V+N HDLLAHLAG ++   L G+D QLALVEFA P++  LG L  FL ILFLFIQ+
Sbjct  61    ALIMVINVHDLLAHLAGINYWFPLLGFDIQLALVEFAVPVVQTLGSLLFFLAILFLFIQE  120

Query  722   EKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLIGSL  543
             EK NYG ++LE   L +LIAGP LW+LGSI NSCQIYERA GH+QILQQS+HIPFL+GSL
Sbjct  121   EK-NYGLFKLEKHALNMLIAGPVLWLLGSIHNSCQIYERADGHVQILQQSVHIPFLMGSL  179

Query  542   LFLVGAILN---LTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVFNI  372
             L +VGAILN     G  HH          LL   W  +GI GS +LF+GGL NVVKVF +
Sbjct  180   LLMVGAILNSREQAGWMHHG-------TELLSTDWAWLGIIGSLLLFIGGLTNVVKVFKM  232

Query  371   QQMSGMMRLEKLRGGAHERLMHEREGGLPLIVDDAAEKQRWRIRP  237
             QQM G +RLEKLRGGAHERLM EREG +PLI+    E+QR R RP
Sbjct  233   QQMDG-LRLEKLRGGAHERLMQEREGQVPLII----EEQRRRKRP  272



>ref|XP_006374129.1| hypothetical protein POPTR_0015s02280g [Populus trichocarpa]
 gb|ERP51926.1| hypothetical protein POPTR_0015s02280g [Populus trichocarpa]
Length=293

 Score =   309 bits (792),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 194/311 (62%), Positives = 228/311 (73%), Gaps = 22/311 (7%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAELSREPKSGlvllliaf  903
             MVKLASARE R+YGP L+ +R EYMNAGL VF+ IVL+ GF AELS+EPKSGLVLLLI  
Sbjct  1     MVKLASARESRMYGPRLARNRGEYMNAGLCVFAAIVLVGGFVAELSKEPKSGLVLLLIGL  60

Query  902   aliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLFIQD  723
              LI VVN HDL+AHLAG D+R  L G+DTQLALVEFA P++   G L SFLG   L  Q+
Sbjct  61    LLIMVVNLHDLVAHLAGIDYRFPLMGFDTQLALVEFAVPVVLASGALLSFLGNPQL--QE  118

Query  722   EKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLIGSL  543
              KG YG+++LE   L LLIAGP LWVLGSI NSCQIYERA GH+QILQQS+ IPFL+GSL
Sbjct  119   YKG-YGHFKLERHALNLLIAGPALWVLGSIHNSCQIYERADGHVQILQQSVQIPFLMGSL  177

Query  542   LFLVGAILNL---TGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVFNI  372
             LFLVG+ILN+    G+ HH          LLG TWV  GICGS ++F+GGLANVVKVF +
Sbjct  178   LFLVGSILNIHEQAGRGHHG-------LKLLGKTWVWTGICGSLIIFIGGLANVVKVFKM  230

Query  371   QQMSGMMRLEKLRGGAHERLMHEREGGLPLIVDDAAEKQRWRIRPPHEEWQpapaapvsa  192
             QQ+ G +RLEKLRGGA ERL+ EREG  PLI+++  E++R  I           A P+ A
Sbjct  231   QQIDG-LRLEKLRGGAQERLIREREGHSPLILEE--ERRRKMIAAETR------ATPLPA  281

Query  191   ptPYKDVLVGN  159
              TPYKDVLVG 
Sbjct  282   TTPYKDVLVGQ  292



>gb|KDP22167.1| hypothetical protein JCGZ_25998 [Jatropha curcas]
Length=295

 Score =   308 bits (788),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 200/309 (65%), Positives = 232/309 (75%), Gaps = 14/309 (5%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAELSREPKSGlvllliaf  903
             MVKLASARE R+YGP L  +R+EY+N+GLYVF+TIVL+ GFAAE S EP+SGLVLL IA 
Sbjct  1     MVKLASARESRMYGPRLGRNRAEYINSGLYVFATIVLISGFAAEFSMEPRSGLVLLFIAC  60

Query  902   aliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLFIQD  723
             ALI VVN HDL+AHLAG D+RL L  +D QLALVEFA PL+  LG +  FLG  FLF+Q+
Sbjct  61    ALIMVVNLHDLIAHLAGIDYRLHLMEFDMQLALVEFAVPLVQALGAVLLFLGFFFLFLQE  120

Query  722   EKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLIGSL  543
             EKG YGY++LE   L +LIAGP LWVLGSI NSCQIYE+A GH+QILQ S+ IPFL+GSL
Sbjct  121   EKG-YGYFKLEKHALNMLIAGPVLWVLGSIHNSCQIYEKADGHVQILQGSVQIPFLMGSL  179

Query  542   LFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVFNIQQM  363
             L LVG+ILNL      +  I+H  R LLG T V +GI GS +LFVGGL NVVKVF +QQ+
Sbjct  180   LLLVGSILNL---QEQAGSIHHGLR-LLGKTMVWMGIFGSLLLFVGGLTNVVKVFKMQQI  235

Query  362   SGMMRLEKLRGGAHERLMHEREGGLPLIVDDAAEKQRWRIRPPHEEWQpapaapvsaptP  183
              G +RLEKLRGGAHERL H REG LPLI    AE+QR R R   E      A PV APTP
Sbjct  236   DG-LRLEKLRGGAHERLRHHREGHLPLI----AEEQRSRKRVIEE----TKAVPVPAPTP  286

Query  182   YKDVLVGNV  156
             YKDVL+G  
Sbjct  287   YKDVLLGRT  295



>gb|KDO56121.1| hypothetical protein CISIN_1g047564mg [Citrus sinensis]
Length=309

 Score =   306 bits (784),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 189/285 (66%), Positives = 217/285 (76%), Gaps = 16/285 (6%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAELSREPKSGlvllliaf  903
             MVKLASARE R+YGP L+ +R+E MNAGLYVF+TIVLL GFAAE SREPKSGLVLLLIA 
Sbjct  1     MVKLASARETRMYGPRLTRNRAECMNAGLYVFATIVLLGGFAAEFSREPKSGLVLLLIAL  60

Query  902   aliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLFIQD  723
             ALI V+N HDLLAHLAG ++   L G+D QLALVEFA P++  LG L  FL ILFLFIQ+
Sbjct  61    ALIMVINVHDLLAHLAGINYWFPLLGFDIQLALVEFAVPVVQTLGSLLFFLAILFLFIQE  120

Query  722   EKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLIGSL  543
             EK NYG ++LE   L +LIAGP LW+LGSI NSCQIYERA GH+QILQQS+HIPFL+GSL
Sbjct  121   EK-NYGLFKLEKHALNMLIAGPVLWLLGSIHNSCQIYERADGHVQILQQSVHIPFLMGSL  179

Query  542   LFLVGAILN---LTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVFNI  372
             L +VGAILN     G  HH          LL   W  +GI GS +LF+GGL NVVKVF +
Sbjct  180   LLMVGAILNSREQAGWMHHG-------TELLSTDWAWLGIIGSLLLFIGGLTNVVKVFKM  232

Query  371   QQMSGMMRLEKLRGGAHERLMHEREGGLPLIVDDAAEKQRWRIRP  237
             QQM G +RLEKLRGGAHERLM EREG +PLI+    E+QR R RP
Sbjct  233   QQMDG-LRLEKLRGGAHERLMQEREGQVPLII----EEQRRRKRP  272



>gb|KHG01320.1| tRNA dimethylallyltransferase [Gossypium arboreum]
Length=295

 Score =   305 bits (782),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 193/307 (63%), Positives = 231/307 (75%), Gaps = 14/307 (5%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAELSREPKSGlvllliaf  903
             MVKLASARE R YGP L+ SR+EYMNAGLY+FSTIVL+CGFAAE SREP+SGLVL+LIA 
Sbjct  1     MVKLASARESRTYGPRLAQSRAEYMNAGLYLFSTIVLICGFAAEFSREPRSGLVLMLIAL  60

Query  902   aliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLFIQD  723
              LI +VN HDLLAHLAG D+R +L G+D QLALVEF+ PL+ ILG L  FLGILFLFIQ 
Sbjct  61    GLIILVNIHDLLAHLAGIDYRFTLMGFDPQLALVEFSVPLVQILGSLLLFLGILFLFIQA  120

Query  722   EKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLIGSL  543
             EKG YG+++LE   L +L+AGP LWV+GSI NSCQIYERA  H+QILQQS+HIPFLIGS+
Sbjct  121   EKG-YGFFKLERHALGMLVAGPVLWVVGSIHNSCQIYERADAHVQILQQSVHIPFLIGSV  179

Query  542   LFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVFNIQQM  363
             LF+VGAILN       + +I+H  + LLG  WV +GICGS +  +GGL NVVKVF +QQM
Sbjct  180   LFMVGAILN---GREQTGVIHHGLQ-LLGKRWVWLGICGSVMFMIGGLTNVVKVFKMQQM  235

Query  362   SGMMRLEKLRGGAHERLMHEREGGLPLIVDDAAEKQRWRIRPPHEEWQpapaapvsaptP  183
             +G +RLEKLRGGA   L+  REG +PLI DD   ++         E     AA  + PTP
Sbjct  236   NG-IRLEKLRGGAQNGLIEGREGQVPLISDDDLRRKM--------EVDEVKAATAATPTP  286

Query  182   YKDVLVG  162
             YKDVL+ 
Sbjct  287   YKDVLLA  293



>gb|KEH35444.1| polypyrimidine tract-binding-like protein, putative [Medicago 
truncatula]
Length=298

 Score =   305 bits (780),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 178/308 (58%), Positives = 221/308 (72%), Gaps = 13/308 (4%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAELSREPKSGlvllliaf  903
             MVKLASARE R YGPGL+ +R EY+NAGLY+F+T++L  GF A+LS E +SGLV+LLIA 
Sbjct  1     MVKLASAREFRTYGPGLTRNRYEYINAGLYLFATVILCSGFVAQLSPEARSGLVVLLIAL  60

Query  902   aliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLFIQD  723
              +I  VN HD+LAH A  DFR SL  +D QL  VEFAAP++ ILG L  FLGILF FI++
Sbjct  61    TIIIFVNLHDILAHFAAIDFRSSLLPFDLQLLFVEFAAPVVQILGSLLIFLGILFTFIEE  120

Query  722   EKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLIGSL  543
             EKG   Y +LE   + +L+AGP LW++GSI NSCQIYERA GH+QILQQ ++IPFL+GSL
Sbjct  121   EKGY--YLKLEKHVVNMLVAGPVLWMVGSIHNSCQIYERADGHVQILQQFVYIPFLMGSL  178

Query  542   LFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVFNIQQM  363
              F++GAILN    HH    I H   +LLGGTWV +GI GS + F+GGL N++KVF +QQM
Sbjct  179   SFMLGAILN----HHQQSGIIHHGMNLLGGTWVWLGIFGSLMFFIGGLTNLIKVFKMQQM  234

Query  362   SGMMRLEKLRGGAHERLMHEREGGLPLIVDDAAEKQRWRIRPPHEEWQpapaapvsaptP  183
             +G MRLEKLRGGA ERL+  REG +PLI+      Q    R   EE +      +  PTP
Sbjct  235   NGTMRLEKLRGGAQERLVSAREGRVPLIL---GHHQPMINRQISEETK----VDIPLPTP  287

Query  182   YKDVLVGN  159
             YKDVL+G 
Sbjct  288   YKDVLLGQ  295



>ref|XP_009589657.1| PREDICTED: uncharacterized protein LOC104086988 [Nicotiana tomentosiformis]
Length=296

 Score =   304 bits (779),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 193/309 (62%), Positives = 233/309 (75%), Gaps = 13/309 (4%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAELSREPKSGlvllliaf  903
             MVKLASARE R+YGP L+ +R EY+NAGLY+FSTI+L+ GFAA+ S+EP SGLVLLLIA 
Sbjct  1     MVKLASAREIRMYGPRLTRNRFEYINAGLYMFSTILLVGGFAAQFSKEPLSGLVLLLIAL  60

Query  902   aliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLFIQD  723
             A+I VVN HDL+AHLA  D+R  L G+D QLALVEFA P++  LG L  FLGILFLF + 
Sbjct  61    AVIIVVNVHDLMAHLAAIDYRFLLLGFDPQLALVEFAVPVVQSLGTLLYFLGILFLFTKA  120

Query  722   EKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLIGSL  543
             EKG Y  +++E Q + LLIAGP LW+LGSI NSCQIYERA GH+QILQQS++IPFL+GSL
Sbjct  121   EKG-YDNFKVEKQAVNLLIAGPALWLLGSIHNSCQIYERADGHVQILQQSVNIPFLLGSL  179

Query  542   LFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVFNIQQM  363
             LFLVGA+LN   +  H   ++H  + LL   WV +GI GS +L +GGL NVVKVF +QQM
Sbjct  180   LFLVGALLNWKEQSGH---VHHGLK-LLSEDWVWLGIFGSLLLLIGGLMNVVKVFKMQQM  235

Query  362   SGMMRLEKLRGGAHERLMHEREGGLPLIVDDAAEKQRWRIRPPHEEWQpapaapvsaptP  183
             SG +RLEKLRGGA +RLM EREG +PLI+    E+QR R   P E      +  V APTP
Sbjct  236   SG-LRLEKLRGGAQDRLMQEREGQMPLII----EEQRRRRNSPEE---GTTSTTVIAPTP  287

Query  182   YKDVLVGNV  156
             YKDVLVG V
Sbjct  288   YKDVLVGQV  296



>ref|XP_003523385.1| PREDICTED: uncharacterized protein LOC100775278 [Glycine max]
Length=296

 Score =   302 bits (773),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 172/313 (55%), Positives = 221/313 (71%), Gaps = 23/313 (7%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAELSREPKSGlvllliaf  903
             MVKLASAR  R YGPGL+ +R EY+NA LY+ +++VLL G AA+LS E +SGLVL++ A 
Sbjct  1     MVKLASARVFRTYGPGLAKNRYEYINAALYLIASLVLLSGLAAQLSSEARSGLVLIIAAL  60

Query  902   aliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLFIQD  723
             A+I +VN HDL AHL G DFRL L  +D QLA VEFA P++ + G L +FLG+ FLFIQ+
Sbjct  61    AIILLVNLHDLFAHLVGIDFRLPLIAFDLQLAFVEFAVPVIQMFGTLLAFLGVFFLFIQE  120

Query  722   EKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLIGSL  543
             EKG YGY++LE   L +L+AGP LWV+GSI NSCQIYERA GH+QILQQ ++IPFL+GSL
Sbjct  121   EKG-YGYFKLEKHALNMLVAGPVLWVIGSIHNSCQIYERADGHVQILQQCVYIPFLMGSL  179

Query  542   LFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVFNIQQM  363
              F++ AILN    H  S  I+H    LLGGTW+ +GI GS + F+GGL N++KVF +QQM
Sbjct  180   SFMLSAILNY---HEKSRDIHHGLH-LLGGTWIWLGIFGSLMFFIGGLTNLIKVFKMQQM  235

Query  362   SGMMRLEKLRGGAHERLMHEREGGLPLIVDDAA----EKQRWRIRPPHEEWQpapaapvs  195
             +G +RLEKLRG AHERL+  RE  +PLI++       + Q  ++  P             
Sbjct  236   NG-IRLEKLRGEAHERLLSAREAQIPLIMEHQTNISHQPQETKVTLP-------------  281

Query  194   aptPYKDVLVGNV  156
              PTPYKDVL+G  
Sbjct  282   LPTPYKDVLIGQT  294



>ref|XP_010097854.1| hypothetical protein L484_011453 [Morus notabilis]
 gb|EXB72451.1| hypothetical protein L484_011453 [Morus notabilis]
Length=297

 Score =   301 bits (772),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 177/308 (57%), Positives = 217/308 (70%), Gaps = 14/308 (5%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAELSREPKSGlvllliaf  903
             MVKLASAR+ RVYGP  S +R EY+NAGLY+F+T+VLL GF A  SRE KS LV+L++A 
Sbjct  1     MVKLASARDARVYGPRGSRNRGEYINAGLYLFATVVLLGGFVALFSREAKSSLVVLMMAL  60

Query  902   aliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLFIQD  723
              LI   N HDL+AHLA +D+RL L  YD QL LVEFA PLL  LG L SFLGILFLFIQ+
Sbjct  61    LLILAANVHDLVAHLAAYDYRLGLMEYDLQLVLVEFAVPLLQALGSLLSFLGILFLFIQE  120

Query  722   EKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLIGSL  543
             EKG YGY +LE   L +LIAGP LW++GSI NSCQIYERA  H+QILQQS+HIPFL+ S+
Sbjct  121   EKG-YGYSKLEKHTLNMLIAGPVLWLIGSIYNSCQIYERADSHLQILQQSVHIPFLMASV  179

Query  542   LFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVFNIQQM  363
             LF+  AILN   +   + + +H    L+G TW+ +GI GS  L  GG  NVVKVF +QQ+
Sbjct  180   LFMTAAILN---RREQAGVDHHGL-ELVGMTWIWLGIFGSLCLVFGGFMNVVKVFKMQQV  235

Query  362   SGMMRLEKLRGGAHERLMHEREGGLPLIVDDAAEKQRWRIRPPHEEWQpapaapvsaptP  183
              G +RLEKLRGGA ERL+  REG +P ++    E  R R +   EE +       ++ TP
Sbjct  236   DG-LRLEKLRGGAPERLIQAREGQIPFLL----ENHRRRRQSAEEEVK----VLPASTTP  286

Query  182   YKDVLVGN  159
             YKDVLVG 
Sbjct  287   YKDVLVGQ  294



>ref|XP_003527975.1| PREDICTED: uncharacterized protein LOC100808653 [Glycine max]
 gb|KHN23394.1| hypothetical protein glysoja_015696 [Glycine soja]
Length=296

 Score =   301 bits (772),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 168/312 (54%), Positives = 220/312 (71%), Gaps = 23/312 (7%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAELSREPKSGlvllliaf  903
             MVKLASAR+ R YGPGL+ +R EY+NAGLY+ +++VL+ G  A+LS   +SGLVL++ A 
Sbjct  1     MVKLASARDFRTYGPGLAKNRCEYINAGLYLIASVVLVSGLVAQLSSLARSGLVLIIAAL  60

Query  902   aliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLFIQD  723
              +I +VN HD  AHL G DFRL L  +D QLA VEFA P++ +LG L +FLG+ FLFIQ+
Sbjct  61    GIILLVNLHDFFAHLVGIDFRLPLMAFDLQLAFVEFAVPVIQMLGTLLTFLGVFFLFIQE  120

Query  722   EKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLIGSL  543
             EKG YGY++LE   L +L+AGP LWV+GSI NSCQIYERA GH+QILQQ +++PFL+GSL
Sbjct  121   EKG-YGYFKLEKHALNMLVAGPVLWVIGSIHNSCQIYERADGHVQILQQCVNVPFLMGSL  179

Query  542   LFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVFNIQQM  363
              F++ AILN    H  S  I+H    LL GTW+ +GI GS + F+GGL N++KVF +QQM
Sbjct  180   SFMLSAILN---YHEKSKDIHHGLH-LLSGTWIWLGIFGSLMFFIGGLTNLIKVFKMQQM  235

Query  362   SGMMRLEKLRGGAHERLMHEREGGLPLIVDDAA----EKQRWRIRPPHEEWQpapaapvs  195
             +G +RLEKLRGGAHERL+  RE  +PLI++       + Q  ++  P             
Sbjct  236   NG-IRLEKLRGGAHERLLSARERQIPLIMEHQTNISHQPQETKVTSP-------------  281

Query  194   aptPYKDVLVGN  159
              PTPYKDVL+G 
Sbjct  282   LPTPYKDVLIGQ  293



>ref|XP_009788724.1| PREDICTED: uncharacterized protein LOC104236496 [Nicotiana sylvestris]
Length=295

 Score =   300 bits (768),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 190/308 (62%), Positives = 229/308 (74%), Gaps = 14/308 (5%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAELSREPKSGlvllliaf  903
             MVKLASARE R+YGP L+ +R EY+NAGLY+FSTI+L+ GFAA+ S+EP SGLVLLL+A 
Sbjct  1     MVKLASAREIRMYGPRLTRNRFEYINAGLYMFSTILLVGGFAAQFSKEPLSGLVLLLLAL  60

Query  902   aliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLFIQD  723
               I VVN HDL+AHLA  D+R  L G+D QLALVEFA P++  LG L  FLGILFLF + 
Sbjct  61    GEIIVVNVHDLMAHLAAIDYRFLLLGFDPQLALVEFAVPVVQSLGTLLYFLGILFLFTKA  120

Query  722   EKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLIGSL  543
             EKG Y  Y++E Q + LLIAGP LW+LGSI NSCQIYERA GH+QILQQS++IPFL+GSL
Sbjct  121   EKG-YDNYKVEKQAVNLLIAGPALWLLGSIHNSCQIYERADGHVQILQQSVNIPFLLGSL  179

Query  542   LFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVFNIQQM  363
             LFLVGA+LN   +  H   ++H  + LL   WV +G+ GS +L +GGL NVVKVF +QQM
Sbjct  180   LFLVGALLNWREQSGH---VHHGLK-LLSEEWVWLGMFGSLLLLIGGLMNVVKVFKMQQM  235

Query  362   SGMMRLEKLRGGAHERLMHEREGGLPLIVDDAAEKQRWRIRPPHEEWQpapaapvsaptP  183
             SG +RLEKLRGGA ERLM EREG +PLI+    E+QR R   P E       +   APTP
Sbjct  236   SG-LRLEKLRGGAQERLMQEREGQMPLII----EEQRRRRNSPEE----GTTSTTVAPTP  286

Query  182   YKDVLVGN  159
             YKDVLVG 
Sbjct  287   YKDVLVGQ  294



>ref|XP_007137572.1| hypothetical protein PHAVU_009G137800g [Phaseolus vulgaris]
 gb|ESW09566.1| hypothetical protein PHAVU_009G137800g [Phaseolus vulgaris]
Length=297

 Score =   299 bits (765),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 172/308 (56%), Positives = 220/308 (71%), Gaps = 14/308 (5%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAELSREPKSGlvllliaf  903
             MVKLASAR+ R YGPGL+ +R EY+NAGLY+ ++I+LL G  A+LS +P+ GL+L++ A 
Sbjct  1     MVKLASARDFRTYGPGLTKNRLEYINAGLYLIASILLLSGLTAQLSSQPRLGLLLIIAAL  60

Query  902   aliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLFIQD  723
             A I +VN HDL AHLAG DF+L L  +D QLA VEFA PLL +LG L +FLG+LFLFIQ+
Sbjct  61    AFILLVNLHDLFAHLAGIDFQLHLMTFDLQLAFVEFAVPLLQMLGTLLAFLGVLFLFIQE  120

Query  722   EKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLIGSL  543
             EKG YGY++LE   L +LIAG   WV+GSI NSCQIYE+A GH+QILQQ + IPF +GSL
Sbjct  121   EKG-YGYFKLEKNALNMLIAGSVFWVIGSIHNSCQIYEKADGHVQILQQCVCIPFFMGSL  179

Query  542   LFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVFNIQQM  363
              F++ AILN   K   S  I+H    LLG TW+ +GI GS +   GG  N++KVF +QQM
Sbjct  180   SFMLSAILNYQEK---SKTIHHDIH-LLGSTWIWLGIFGSLMFLTGGFTNLIKVFKMQQM  235

Query  362   SGMMRLEKLRGGAHERLMHEREGGLPLIVDDAAEKQRWRIRPPHEEWQpapaapvsaptP  183
             +G +RLEKLRGGAHERL+  REG +PLI++        R    HE  +     PV  PTP
Sbjct  236   NG-IRLEKLRGGAHERLVSSREGRVPLIIE--------RQTISHEPQETKITLPVPTPTP  286

Query  182   YKDVLVGN  159
             YKD+L+G+
Sbjct  287   YKDILIGS  294



>ref|XP_004234273.1| PREDICTED: uncharacterized protein LOC101255466 [Solanum lycopersicum]
Length=315

 Score =   298 bits (764),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 182/324 (56%), Positives = 233/324 (72%), Gaps = 26/324 (8%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAELSREPKSGlvllliaf  903
             MVKLASARE R+YGP L+G+R EY+NAGLY+F+TI+L  GF A++S+E  SGLVLL IA 
Sbjct  1     MVKLASAREMRLYGPRLTGNRFEYINAGLYLFATILLAGGFVAQISKEQLSGLVLLQIAL  60

Query  902   aliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLFIQD  723
             A+I VVN HDLLAHLAG D+R  L G+D QLALVEFA P++H +G + +F+ ILFLF Q 
Sbjct  61    AVIVVVNVHDLLAHLAGIDYRFLLLGFDPQLALVEFAVPVVHSVGTILNFIAILFLFTQA  120

Query  722   EKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLIGSL  543
             EKG YG +++E Q + LLIAGP LW+LGSI NSCQIYERA GH+QILQ+S++IPFL+GSL
Sbjct  121   EKG-YGSHKMEKQAVSLLIAGPALWLLGSIHNSCQIYERADGHVQILQESVNIPFLLGSL  179

Query  542   LFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVFNIQQM  363
             LFLVG++LN   +  ++    H    LL   W+  G+ GS +LF+GGL NVVKVF +QQM
Sbjct  180   LFLVGSLLNWREQSRYA----HHGLKLLSEDWMLFGLFGSLLLFIGGLMNVVKVFKMQQM  235

Query  362   SGMMRLEKLRGGAHERLMHEREGGLPLIVDDA----------------AEKQRWRIRPPH  231
             SG +RLEKLRGGA +RL+ EREG +PL++++                  E+Q  R + P 
Sbjct  236   SG-LRLEKLRGGAQDRLIQEREGQMPLLIEEQRRRRQSSGEEGQMPLLVEEQSRRKKAPV  294

Query  230   EEWQpapaapvsaptPYKDVLVGN  159
             +E      +   APTPYKDVLVG 
Sbjct  295   KE----TTSTTIAPTPYKDVLVGQ  314



>ref|XP_002523309.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39025.1| conserved hypothetical protein [Ricinus communis]
Length=297

 Score =   298 bits (762),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 193/308 (63%), Positives = 227/308 (74%), Gaps = 12/308 (4%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAELSREPKSGlvllliaf  903
             MVKLASARE R+YGP L  +R+EY+NAGLYVF+TIVLL GFAA  S EPKSGLVL+ IA 
Sbjct  1     MVKLASARESRMYGPRLGRNRAEYINAGLYVFATIVLLGGFAALFSMEPKSGLVLMFIAL  60

Query  902   aliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLFIQD  723
              LI  VN HDL AHLAG D+RL L G+D QLALVEFA P++  LG L  FLGI FLF+Q+
Sbjct  61    GLIMAVNLHDLFAHLAGIDYRLPLMGFDVQLALVEFAVPIVQALGALLLFLGIFFLFLQE  120

Query  722   EKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLIGSL  543
             EK  YGYY+LE   L +LIAGP LW+LGSI NSCQIYERA GH+QILQ+S+HIPFL+GSL
Sbjct  121   EK-RYGYYKLEKHSLNMLIAGPILWILGSIHNSCQIYERADGHVQILQESVHIPFLMGSL  179

Query  542   LFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVFNIQQM  363
             LFLVGAILN+        L +H  + LLG + V +GI G+ +LF+GGL NVVKVF +QQ+
Sbjct  180   LFLVGAILNI---QEQDGLDHHGLQ-LLGRSLVWMGIFGTLLLFIGGLTNVVKVFKMQQI  235

Query  362   SGMMRLEKLRGGAHERLMHEREGGLPLIVDDAAEKQRWRIRPPHEEWQpapaapvsaptP  183
              G +RLEKLRGGA ERL+ +REG LPLI    AE+ R R     E    A   P   PTP
Sbjct  236   DG-LRLEKLRGGAQERLIQQREGQLPLI----AEEHRRRKMIIEET--KAVPVPDPVPTP  288

Query  182   YKDVLVGN  159
             YKDVL+G 
Sbjct  289   YKDVLIGQ  296



>ref|XP_010261521.1| PREDICTED: uncharacterized protein LOC104600334 [Nelumbo nucifera]
Length=292

 Score =   297 bits (760),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 164/282 (58%), Positives = 215/282 (76%), Gaps = 5/282 (2%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAELSREPKSGlvllliaf  903
             MVKLASARE R+YGP L  +R E++NAGLYVF++++L+ GF ++ SR+ KSGLV+LLIA 
Sbjct  1     MVKLASARENRLYGPRLGRNRLEFINAGLYVFASLLLVGGFLSQFSRDAKSGLVILLIAL  60

Query  902   aliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLFIQD  723
             ALI++VN HDLLAHLAG D++L L G+D QLALVEFA P++ +LG + +FL ILF  IQ 
Sbjct  61    ALISLVNVHDLLAHLAGIDYQLGLMGFDRQLALVEFAVPIVQVLGSVLNFLPILFFLIQA  120

Query  722   EKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLIGSL  543
             EKG Y Y+ LE   L +LI G  LW++GSI NSCQIYERA GH+QILQQS+++PFL+GSL
Sbjct  121   EKGRYYYFRLEKYALNMLIVGSVLWLIGSINNSCQIYERADGHVQILQQSVYLPFLMGSL  180

Query  542   LFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVFNIQQM  363
             LFLVGAILN    H  S +I+H    LLG +WV +GI GS +  +GGL N+ KVF +QQ+
Sbjct  181   LFLVGAILNC---HEQSGMIHHGL-MLLGKSWVWLGIFGSLLFLIGGLVNLAKVFKMQQV  236

Query  362   SGMMRLEKLRGGAHERLMHEREGGLPLIVDDAAEKQRWRIRP  237
              G +RLEKLRGGA E+L  EREG +PLI+++   +++   +P
Sbjct  237   GG-VRLEKLRGGAQEQLNREREGEVPLILEEQTRRKQNEAKP  277



>ref|XP_004502615.1| PREDICTED: uncharacterized protein LOC101500123 [Cicer arietinum]
Length=301

 Score =   295 bits (754),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 182/309 (59%), Positives = 229/309 (74%), Gaps = 11/309 (4%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAELSREPKSGlvllliaf  903
             MVKLASAR+ R YGPGLS +R EY+NAGLY+F+T++L  GFAA+ S EP+SGLVLLLIA 
Sbjct  1     MVKLASARDFRTYGPGLSRNRYEYINAGLYLFATVILCSGFAAQFSHEPRSGLVLLLIAL  60

Query  902   aliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLFIQD  723
             ALI VVN HD+LAH AG DFRL+L  +D QL  VEFA P++ I+G L  FLG+LF+ IQ+
Sbjct  61    ALIVVVNLHDILAHFAGIDFRLALMSFDLQLFFVEFAVPVVQIIGTLLLFLGLLFILIQE  120

Query  722   EKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLIGSL  543
             EKG YGY +LE   + +L+AGP LWV+GSI NSCQIYERA GH+QILQQ ++IPFL+GSL
Sbjct  121   EKG-YGYVKLEKHAVNMLVAGPVLWVVGSIHNSCQIYERADGHVQILQQFVYIPFLMGSL  179

Query  542   LFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVFNIQQM  363
              F++GA+LN   +   S +I+H    LLGGTW+ +GI GS + F+GGL N++KVF +QQM
Sbjct  180   SFMLGAVLNYRQR---SRVIHHGI-YLLGGTWIWLGIFGSLMFFIGGLTNLIKVFKMQQM  235

Query  362   SGMMRLEKLRGGAHERLMHEREGGLPLIVDDAAEKQRWRIRPPHEEWQpapaapvsaptP  183
             +G MRLEKLRGGA ERL+  REG +PLI+D     Q    RP   +        +S PTP
Sbjct  236   NGTMRLEKLRGGAQERLISAREGRVPLILDHHHHHQPIINRPEDTK------VDISLPTP  289

Query  182   YKDVLVGNV  156
             YKDVL+G  
Sbjct  290   YKDVLIGQT  298



>ref|XP_006350579.1| PREDICTED: uncharacterized protein LOC102585948 [Solanum tuberosum]
Length=335

 Score =   295 bits (756),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 176/288 (61%), Positives = 219/288 (76%), Gaps = 10/288 (3%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAELSREPKSGlvllliaf  903
             MVKLASARE R+YGP L+ +R EY+NAGLY+F+TI+L+ GFAA+ S E  SGLVLLLIA 
Sbjct  1     MVKLASAREMRLYGPRLTRNRFEYINAGLYLFATILLVGGFAAQFSNEQLSGLVLLLIAL  60

Query  902   aliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLFIQD  723
             A+I VVN HDLLAHLAG D+R    G+D QLALVEFA P++  +G + +FL ILFLF Q 
Sbjct  61    AVIVVVNVHDLLAHLAGIDYRFLFLGFDPQLALVEFAVPVVQSVGTILNFLAILFLFTQA  120

Query  722   EKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLIGSL  543
             EKG YG Y++E Q + LLIAGP LW+LGSI NSCQIYERA GH+QILQQS++IPFL+GSL
Sbjct  121   EKG-YGNYKMEKQAVSLLIAGPALWLLGSIHNSCQIYERADGHVQILQQSVNIPFLLGSL  179

Query  542   LFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVFNIQQM  363
             LFLVG++LN       S  ++H  + LL   W+  G+ GS +LF+GGL NVVKVF +QQM
Sbjct  180   LFLVGSLLNW---REQSGYVHHGLK-LLSEDWMLFGLFGSLLLFIGGLMNVVKVFKMQQM  235

Query  362   SGMMRLEKLRGGAHERLMHEREGGLPLIVDDAAEKQRWRIRPPHEEWQ  219
             SG +RLEKLRGGA +RL+ EREG +PL++    E+QR R +   EE Q
Sbjct  236   SG-LRLEKLRGGAQDRLIQEREGQMPLLI----EEQRRRRQSSVEEGQ  278



>gb|EYU25200.1| hypothetical protein MIMGU_mgv1a010494mg [Erythranthe guttata]
Length=310

 Score =   292 bits (748),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 187/319 (59%), Positives = 225/319 (71%), Gaps = 19/319 (6%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAELSREPKSGlvllliaf  903
             MVKLASARE R+YGP L+ +R+EY+NAGLYVF+TI+LL GFAA+LS E KSGLV+LLI F
Sbjct  1     MVKLASARESRMYGPRLARNRAEYINAGLYVFATILLLGGFAAQLSYEAKSGLVILLIGF  60

Query  902   aliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLFIQD  723
              ++ VVN HDL+AHLAG D+RL L   D Q ALVEFA PL++ +G L  FL  LFLFIQ 
Sbjct  61    FVLIVVNLHDLIAHLAGIDYRLPLMELDMQFALVEFAVPLVYTIGTLLFFLATLFLFIQA  120

Query  722   EKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLIGSL  543
             EKG  GY +LE   L +LIAGP LW+LGS+ NSCQIYERA GH QILQ ++ IPFL  SL
Sbjct  121   EKGE-GYLKLERLALSMLIAGPVLWLLGSVHNSCQIYERADGHFQILQATVLIPFLTASL  179

Query  542   LFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVFNIQQM  363
             LFLVG+I+N   +  HS    H    LLG TW+ +GI GS VL +GG ANVVKVF +QQ+
Sbjct  180   LFLVGSIINTRDQVGHS----HHGLGLLGDTWIWMGIMGSLVLLMGGFANVVKVFKMQQL  235

Query  362   SGMMRLEKLRGGAHERLMHEREG-GLPLIVDDA---------AEKQRWRIRPPHEEWQpa  213
             SG+MRLE+LRGGA ERL+  R+G   PLIV D           E++R R+    EE Q  
Sbjct  236   SGVMRLERLRGGAQERLLLIRDGQAAPLIVHDEQQRRLRAADVEEERRRMAADLEEGQ--  293

Query  212   paapvsaptPYKDVLVGNV  156
               +    PTPYKDVLVG  
Sbjct  294   --SADDRPTPYKDVLVGQT  310



>emb|CDP05089.1| unnamed protein product [Coffea canephora]
Length=295

 Score =   291 bits (744),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 183/309 (59%), Positives = 225/309 (73%), Gaps = 14/309 (5%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAELSREPKSGlvllliaf  903
             MVKLASARE R+YGP  S +R EY+NAGLY F+T+VLL GFAA+LS EP+SGLVLLL+A 
Sbjct  1     MVKLASARESRMYGPRSSRNRLEYINAGLYAFATVVLLSGFAAQLSGEPRSGLVLLLVAL  60

Query  902   aliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLFIQD  723
              +IA+VN HDL+AHL+G D RL++  +DTQ A VEFAAP+L   G +  FLGILFLF+QD
Sbjct  61    PVIALVNVHDLIAHLSGIDCRLNILKFDTQFAAVEFAAPVLQTFGTVLFFLGILFLFLQD  120

Query  722   EKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLIGSL  543
             E+G YGY ++E   L +LIAG  LW+LGSI NSCQIYERAGGH+QILQ+SI IPF +GSL
Sbjct  121   ERG-YGYRKVERHALNMLIAGSALWLLGSIQNSCQIYERAGGHVQILQESIQIPFSMGSL  179

Query  542   LFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVFNIQQM  363
             LFLVGAILN   +  H   I+H  + LLG TW+ +GI GS + F GGLAN+VKVF +QQ 
Sbjct  180   LFLVGAILNSREQTGH---IHHGMK-LLGLTWIWIGIFGSLLFFAGGLANLVKVFKMQQG  235

Query  362   SGMMRLEKLRGGAHERLMHEREGGLPLIVDDAAEKQRWRIRPPHEEWQpapaapvsaptP  183
              G ++LEKLRGGA ERL+  REG +P I++   E  R R RP  E         +   TP
Sbjct  236   DG-LQLEKLRGGAQERLLDLREGQVPFILE---ESSRRRERPAEE-----GKTAIVPATP  286

Query  182   YKDVLVGNV  156
             YKDVL+   
Sbjct  287   YKDVLLSQT  295



>ref|XP_003602203.1| Polypyrimidine tract-binding protein-like protein [Medicago truncatula]
Length=828

 Score =   305 bits (782),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 165/269 (61%), Positives = 205/269 (76%), Gaps = 6/269 (2%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAELSREPKSGlvllliaf  903
             MVKLASARE R YGPGL+ +R EY+NAGLY+F+T++L  GF A+LS E +SGLV+LLIA 
Sbjct  1     MVKLASAREFRTYGPGLTRNRYEYINAGLYLFATVILCSGFVAQLSPEARSGLVVLLIAL  60

Query  902   aliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLFIQD  723
              +I  VN HD+LAH A  DFR SL  +D QL  VEFAAP++ ILG L  FLGILF FI++
Sbjct  61    TIIIFVNLHDILAHFAAIDFRSSLLPFDLQLLFVEFAAPVVQILGSLLIFLGILFTFIEE  120

Query  722   EKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLIGSL  543
             EKG   Y +LE   + +L+AGP LW++GSI NSCQIYERA GH+QILQQ ++IPFL+GSL
Sbjct  121   EKGY--YLKLEKHVVNMLVAGPVLWMVGSIHNSCQIYERADGHVQILQQFVYIPFLMGSL  178

Query  542   LFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVFNIQQM  363
              F++GAILN    HH    I H   +LLGGTWV +GI GS + F+GGL N++KVF +QQM
Sbjct  179   SFMLGAILN----HHQQSGIIHHGMNLLGGTWVWLGIFGSLMFFIGGLTNLIKVFKMQQM  234

Query  362   SGMMRLEKLRGGAHERLMHEREGGLPLIV  276
             +G MRLEKLRGGA ERL+  REG +PLI+
Sbjct  235   NGTMRLEKLRGGAQERLVSAREGRVPLIL  263



>gb|KFK27697.1| hypothetical protein AALP_AA8G416800 [Arabis alpina]
Length=313

 Score =   290 bits (742),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 178/318 (56%), Positives = 219/318 (69%), Gaps = 16/318 (5%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAE-LSREPKSGlvlllia  906
             MVKLASARE R YGP L  SR+EY+NAGLY+F+T+VL+ GF A   S EP+SGLVL+L+A
Sbjct  1     MVKLASAREIRTYGPRLGRSRAEYINAGLYLFATVVLIGGFTATGFSWEPRSGLVLILLA  60

Query  905   faliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLFIQ  726
               LI  VN HDL+AHLAG D+RL L  YD QL LVEFA P++ I G +  FLGILF+F Q
Sbjct  61    LVLITAVNVHDLVAHLAGIDYRLRLMEYDLQLGLVEFAVPVVQIAGSVVFFLGILFVFNQ  120

Query  725   DEKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLIGS  546
              E     Y   E   L +L+AGP LWV+GSI NSCQIYERA  H+QILQQ +HIPFL+GS
Sbjct  121   AET-KLQYTGREKHALNMLLAGPLLWVIGSIHNSCQIYERADSHVQILQQCVHIPFLVGS  179

Query  545   LLFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVFNIQQ  366
             LLFLV A+LN   +   S    H+   LLG  WV +GI G+  LFVGGL NVVKVFN  Q
Sbjct  180   LLFLVSAVLNSLDQSGSS----HSGLKLLGSRWVWLGISGAICLFVGGLMNVVKVFNFVQ  235

Query  365   MSGMMRLEKLRGGAHERLMHEREGGLPLIVDD------AAEKQRWRIRPP---HEEWQpa  213
             ++G +RLEKLRGGA +RL+ EREG LPL+V++       A++   R +P      + + A
Sbjct  236   ITG-IRLEKLRGGAQDRLLEEREGYLPLVVEEERIRKMEADQASNRAKPRTHITSKARAA  294

Query  212   paapvsaptPYKDVLVGN  159
                  S+PTPYKDVL+G 
Sbjct  295   EPVMGSSPTPYKDVLIGQ  312



>ref|XP_010493553.1| PREDICTED: uncharacterized protein LOC104770791 [Camelina sativa]
Length=316

 Score =   286 bits (733),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 169/283 (60%), Positives = 205/283 (72%), Gaps = 17/283 (6%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAE-LSREPKSGlvlllia  906
             MVKLA+ARE R YGP L  SR+EY+NAGLY+F+T+VL+ GF A   S EP+SGLVL+L+A
Sbjct  1     MVKLATAREIRTYGPRLGRSRAEYINAGLYLFATVVLIGGFTATGFSWEPRSGLVLILLA  60

Query  905   faliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLFIQ  726
               LIA VN HDL+AHLAG D+RL L  YD QL LVEFA PL++I G +  F+GILF+F Q
Sbjct  61    LVLIAAVNVHDLVAHLAGIDYRLRLMEYDLQLGLVEFAVPLVNIAGSVVFFVGILFVFHQ  120

Query  725   DEKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLIGS  546
              EK   GY   E   L +LIAGP LWV+GS+ NSCQIYERA  H+QILQQS+HIPFL+GS
Sbjct  121   AEK-KLGYSGKEKHTLNMLIAGPLLWVIGSLHNSCQIYERADSHVQILQQSVHIPFLVGS  179

Query  545   LLFLVGAILN---LTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVFN  375
             LLFLV A+LN   L+G  H           LLG  W+ +GI G+   FVGGL NVVKVFN
Sbjct  180   LLFLVSAVLNSLDLSGSSHSG-------LKLLGERWIWLGISGAICFFVGGLMNVVKVFN  232

Query  374   IQQMSGMMRLEKLRGGAHERLMHEREGGLPLIVDDAAEKQRWR  246
               Q++G +RLEKLRGGA +RL+ EREG LPL+    AE++R R
Sbjct  233   FVQITG-LRLEKLRGGAQDRLLEEREGYLPLV----AEEERIR  270



>ref|XP_010550522.1| PREDICTED: uncharacterized protein LOC104821367 [Tarenaya hassleriana]
Length=305

 Score =   286 bits (732),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 181/320 (57%), Positives = 215/320 (67%), Gaps = 28/320 (9%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGF-AAELSREPKSGlvlllia  906
             MVKLA+ARE R YGP L   R+EY+NAGLYVFST+VL+ GF AA  S EP+SGLVL+L A
Sbjct  1     MVKLATAREIRTYGPRLGRQRAEYINAGLYVFSTVVLIGGFIAAGFSLEPRSGLVLILFA  60

Query  905   faliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLFIQ  726
              A+I+VVN HDL AHLAG D+RL L  YD QLALVEFA PL HI G +  FLGI F+F Q
Sbjct  61    LAIISVVNAHDLFAHLAGIDYRLRLMEYDLQLALVEFAVPLFHIAGSIVFFLGIFFVFYQ  120

Query  725   DE-KGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLIG  549
              E K   G    E   L +LIAGP LW++GS+ NSCQIYERA GH+QILQQ +HIPFL+G
Sbjct  121   AETKRGDGQ---EKHALNMLIAGPVLWMIGSVHNSCQIYERADGHVQILQQCVHIPFLVG  177

Query  548   SLLFLVGAILNL--TGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVFN  375
             S+LFLV AILN       HH  L       LLG TWV +G+ G    F+GGL NV+KVFN
Sbjct  178   SVLFLVAAILNTREQSASHHRGL------KLLGKTWVWLGMSGGICFFLGGLMNVIKVFN  231

Query  374   IQQMSGMMRLEKLRGGAHERLMHEREGGLPLIVDDAAEKQRWRIRPPHEEWQpapaapvs  195
               Q+ G +RLEKLRGGA +RL+ EREG  PL+V++       RIR   EE + AP A  +
Sbjct  232   FVQIIG-LRLEKLRGGAQDRLLEEREGYHPLVVEEE------RIRKMEEETKAAPLAAST  284

Query  194   a--------ptPYKDVLVGN  159
             +           YKDVLVG 
Sbjct  285   SAAAAPRTGTNSYKDVLVGQ  304



>ref|XP_010454704.1| PREDICTED: uncharacterized protein LOC104736425 [Camelina sativa]
Length=316

 Score =   285 bits (729),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 169/283 (60%), Positives = 203/283 (72%), Gaps = 17/283 (6%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAE-LSREPKSGlvlllia  906
             MVKLA+ARE R YGP L  SR+EY+NAGLY+F+T+VL+ GF A   S EP+SGLVL+L+A
Sbjct  1     MVKLATAREIRTYGPRLGRSRAEYINAGLYLFATVVLIGGFTATGFSWEPRSGLVLILLA  60

Query  905   faliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLFIQ  726
               LIA VN HDL+AHLAG D+RL+L  YD QL LVEFA PL+ I G +  FLGI F+F Q
Sbjct  61    LVLIAAVNVHDLVAHLAGIDYRLNLMEYDLQLGLVEFAVPLVQITGSIVFFLGIFFVFHQ  120

Query  725   DEKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLIGS  546
              EK   GY   E   L LLIAGP LWV+GS+ NSCQIYERA  H+QILQQ +HIPFL+GS
Sbjct  121   AEK-KLGYSGKEKHTLNLLIAGPLLWVIGSLHNSCQIYERADSHVQILQQCVHIPFLVGS  179

Query  545   LLFLVGAILN---LTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVFN  375
             LLFLV A+LN   L+G  H           LLG  W+ +GI G+   FVGGL NVVKVFN
Sbjct  180   LLFLVSAVLNSLDLSGSSHSG-------LKLLGERWIWLGISGAICFFVGGLMNVVKVFN  232

Query  374   IQQMSGMMRLEKLRGGAHERLMHEREGGLPLIVDDAAEKQRWR  246
               Q++G +RLEKLRGGA +RL+ EREG LPL+    AE++R R
Sbjct  233   FVQITG-LRLEKLRGGAQDRLLEEREGYLPLV----AEEERIR  270



>ref|XP_002872093.1| hypothetical protein ARALYDRAFT_489270 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48352.1| hypothetical protein ARALYDRAFT_489270 [Arabidopsis lyrata subsp. 
lyrata]
Length=315

 Score =   283 bits (724),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 177/320 (55%), Positives = 215/320 (67%), Gaps = 18/320 (6%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAE-LSREPKSGlvlllia  906
             MVKLA+ARE R YGP L  SR+EY+NAGLY+F+T+ L+ GF A   S EP+SGLVL+L+A
Sbjct  1     MVKLATAREIRTYGPRLGRSRAEYINAGLYLFATVALIGGFTATGFSWEPRSGLVLILLA  60

Query  905   faliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLFIQ  726
               LI  VN HDL+AHLAG D+RL L  YD QL LVEFA PL+ I G +  FLGI F+F Q
Sbjct  61    LVLITAVNVHDLVAHLAGIDYRLRLMEYDLQLGLVEFAVPLVQIAGSVVFFLGIFFVFHQ  120

Query  725   DEKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLIGS  546
              E    GY   E+  L LLIAGP LWV+GSI NSCQIY+RA  H+QILQQ +HIPFL+GS
Sbjct  121   AET-KRGYSGREHHALNLLIAGPLLWVIGSIHNSCQIYQRADSHVQILQQCVHIPFLVGS  179

Query  545   LLFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVFNIQQ  366
             LLFLV A+LN   +   S    H+   LLG  WV +GI G+  LFVGGL NVVKVFN  Q
Sbjct  180   LLFLVSAVLNSLDQSGSS----HSGLKLLGERWVWLGIAGAICLFVGGLMNVVKVFNFVQ  235

Query  365   MSGMMRLEKLRGGAHERLMHEREGGLPLIVDD------AAEKQRWRIRP-----PHEEWQ  219
             ++G +RLEKLRGGA +RL+  REG LPL+ ++       A++   R +P           
Sbjct  236   ITG-LRLEKLRGGAQDRLLEGREGYLPLVAEEERIRKMEADEASSRTKPRAHLTSKAGAG  294

Query  218   papaapvsaptPYKDVLVGN  159
                   VS+PTPYKDVLVG 
Sbjct  295   ATETVVVSSPTPYKDVLVGQ  314



>gb|KGN49880.1| hypothetical protein Csa_5G139580 [Cucumis sativus]
Length=297

 Score =   281 bits (719),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 174/309 (56%), Positives = 217/309 (70%), Gaps = 15/309 (5%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAELSREPKSGlvllliaf  903
             MVKL SAR+ RVYGP    +R+EY+NAGLY+F+TI+LL GF A+LSREPKSGL L+L+A 
Sbjct  1     MVKLVSARDFRVYGPRSVRNRAEYINAGLYLFATILLLGGFVAQLSREPKSGLALILLAT  60

Query  902   aliavVNFHDLLAHLAGFDFRLSLF-GYDTQLALVEFAAPLLHILGCLCSFLGILFLFIQ  726
             +L A+VN HDL AHLAG D+RL L   YD QL  VEFA P L  +G L      LFL IQ
Sbjct  61    SLFAIVNLHDLFAHLAGIDYRLPLLVQYDAQLFFVEFAVPFLQAIGSLLLSFAALFLLIQ  120

Query  725   DEKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLIGS  546
             ++KG + Y++LE     +LIAGP LW+LGSI NSCQIYERA  H+QILQQS+HIPFLIGS
Sbjct  121   EKKG-HDYHKLEKHASNMLIAGPALWMLGSIHNSCQIYERADAHVQILQQSVHIPFLIGS  179

Query  545   LLFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVFNIQQ  366
             LLF V A+LN    +    L +H  + LLG  W+ +GI GS    +GGLANV+KVF +QQ
Sbjct  180   LLFFVAAVLN---SYEQVGLAHHGLK-LLGKNWIWLGIFGSLSFLLGGLANVLKVFKMQQ  235

Query  365   MSGMMRLEKLRGGAHERLMHEREGGLPLIVDDAAEKQRWRIRPPHEEWQpapaapvsapt  186
               G +RLEKLRGGA+ERL+ EREG +PLI++D   ++R      H + +       + PT
Sbjct  236   FEG-LRLEKLRGGANERLLGEREGRIPLILEDQGRRKR------HSDEE--RGRVEARPT  286

Query  185   PYKDVLVGN  159
             PYKDVLVG 
Sbjct  287   PYKDVLVGQ  295



>ref|NP_197801.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB11573.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAC43033.1| unknown protein [Arabidopsis thaliana]
 gb|AAO63371.1| At5g24130 [Arabidopsis thaliana]
 gb|AED93260.1| uncharacterized protein AT5G24130 [Arabidopsis thaliana]
Length=316

 Score =   278 bits (711),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 176/325 (54%), Positives = 215/325 (66%), Gaps = 25/325 (8%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAE-LSREPKSGlvlllia  906
             MVKLA+ARE R YGP L  SR+EY+NAGLY+F+T+VL+ GF A   S EP+SGLVL+L+A
Sbjct  1     MVKLATAREIRTYGPRLGRSRAEYINAGLYLFATVVLIGGFTATGFSWEPRSGLVLILLA  60

Query  905   faliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLFIQ  726
               LI  VN HDL+AHLAG D+RL L  YD QL LVEFA PL+ I G +  FLGI F+F Q
Sbjct  61    LVLITAVNVHDLVAHLAGIDYRLRLMEYDLQLGLVEFAVPLVQIAGSVVFFLGIFFVFHQ  120

Query  725   DEKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLIGS  546
              E    GY   E+  L LLIAGP LW++GSI NSCQIYERA  H+QILQQ ++IPFL+GS
Sbjct  121   AET-KRGYSGREHHALNLLIAGPLLWLIGSIHNSCQIYERADSHVQILQQCVYIPFLVGS  179

Query  545   LLFLVGAILNLTGKHHHSPLIYHTFRS---LLGGTWVRVGICGSTVLFVGGLANVVKVFN  375
             LLFLV A+LN       S  I  + RS   LLG  W+ +GI G+  LFVGGL NVVKVFN
Sbjct  180   LLFLVSAVLN-------SLDISGSSRSGLKLLGERWIWLGISGAICLFVGGLLNVVKVFN  232

Query  374   IQQMSGMMRLEKLRGGAHERLMHEREGGLPLIVD-------DAAEKQRWRIRP-PHEEWQ  219
               Q+SG +RLEKLRGGA +RL+  REG LPL+ +       +A  +   R +P  H   +
Sbjct  233   FVQISG-LRLEKLRGGAQDRLLEGREGYLPLVAEEERIRKMEADHEASSRAKPRAHTTSK  291

Query  218   papaapvsaptP----YKDVLVGNV  156
                 A  +        YKDVLVG +
Sbjct  292   AGEGATETVVVSSPTPYKDVLVGQI  316



>ref|XP_010421224.1| PREDICTED: uncharacterized protein LOC104706713 [Camelina sativa]
Length=297

 Score =   273 bits (698),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 157/283 (55%), Positives = 190/283 (67%), Gaps = 36/283 (13%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAE-LSREPKSGlvlllia  906
             MVKLA+ARE R YGP L  SR+EY+NAGLY+F+T+VLL GF A   S EP+SG       
Sbjct  1     MVKLATAREIRTYGPRLGRSRAEYINAGLYLFATVVLLGGFTATGFSWEPRSG-------  53

Query  905   faliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLFIQ  726
                         LAHLAG D+RL L  YD QL LVEFA PL+++ G +  F+GILF+F Q
Sbjct  54    ------------LAHLAGIDYRLRLMEYDLQLGLVEFAVPLVNVAGSVVFFVGILFVFHQ  101

Query  725   DEKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLIGS  546
              EK   GY   E   L +LIAGP LWV+GS+ NSCQIYERA  H+QILQQS+HIPFL+GS
Sbjct  102   AEK-KLGYSGKEKHTLNMLIAGPLLWVIGSLHNSCQIYERADSHVQILQQSVHIPFLVGS  160

Query  545   LLFLVGAILN---LTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVFN  375
             LLFLV A+LN   L+G  H           LLG  W+ +GI G+   FVGGL NVVKVFN
Sbjct  161   LLFLVSAVLNSLDLSGSSHSG-------LKLLGERWIWLGISGAICFFVGGLMNVVKVFN  213

Query  374   IQQMSGMMRLEKLRGGAHERLMHEREGGLPLIVDDAAEKQRWR  246
               Q++G +RLEKLRGGA +RL+ EREG LPL+    AE++R R
Sbjct  214   FVQITG-LRLEKLRGGAQDRLLEEREGYLPLV----AEEERIR  251



>ref|XP_006289578.1| hypothetical protein CARUB_v10003123mg [Capsella rubella]
 gb|EOA22476.1| hypothetical protein CARUB_v10003123mg [Capsella rubella]
Length=314

 Score =   270 bits (690),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 181/319 (57%), Positives = 218/319 (68%), Gaps = 17/319 (5%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAE-LSREPKSGlvlllia  906
             MVKLA+ARE R YGP L  SR+EY+NAGLY+F+T+VL+ GF A   S EP+SGLVL+L+A
Sbjct  1     MVKLATAREIRTYGPRLGRSRAEYINAGLYLFATVVLIGGFTATGFSWEPRSGLVLILLA  60

Query  905   faliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLFIQ  726
               LIA VN HDL+AHLAG D+RL L  YD QL LVEFA PL+ I G +  FLG+ F+F Q
Sbjct  61    LVLIAAVNVHDLVAHLAGIDYRLRLMEYDLQLGLVEFAVPLVQIAGSVVFFLGVFFVFHQ  120

Query  725   DEKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLIGS  546
              EK   G+   E   L +LIAGP LWV+GSI NSCQIYERA  H+QILQQ +HIPFL+GS
Sbjct  121   AEK-KLGHSGKEKHILNMLIAGPLLWVIGSIHNSCQIYERADSHVQILQQCVHIPFLVGS  179

Query  545   LLFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVFNIQQ  366
             LLFLV A+LN       S    H+   LLG  W+ +GI G+  LFVGGL NVVKVFN  Q
Sbjct  180   LLFLVSAVLNSIDLSESS----HSGLKLLGERWIWLGISGAICLFVGGLMNVVKVFNFVQ  235

Query  365   MSGMMRLEKLRGGAHERLMHEREGGLPLIVD-------DAAEKQRWRIR---PPHEEWQp  216
             ++G +RLEKLRGGA +RL+ EREG LPL+V+       +A E  R + R       E   
Sbjct  236   ITG-IRLEKLRGGAQDRLLEEREGYLPLVVEEERIRKMEADEACRAKPRNHITSKAEVGG  294

Query  215   apaapvsaptPYKDVLVGN  159
             A     S+PTPYKDVLVG 
Sbjct  295   ADTVVRSSPTPYKDVLVGQ  313



>ref|XP_011076462.1| PREDICTED: uncharacterized protein LOC105160678 [Sesamum indicum]
Length=310

 Score =   268 bits (686),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 185/322 (57%), Positives = 224/322 (70%), Gaps = 27/322 (8%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAELSREPKSGlvllliaf  903
             MVKLASARE R+YGP LS +RSEYMNAGLYVF+TI+LL GF A+LS EPKSGLVLLLI F
Sbjct  1     MVKLASARESRMYGPRLSRNRSEYMNAGLYVFATILLLGGFTAQLSHEPKSGLVLLLIGF  60

Query  902   aliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLFIQD  723
              +I +VN HDL+AHLAG D+RL L  +D QL LVEFA PL++ +G L  FL  LFLF+Q 
Sbjct  61    LIIILVNLHDLIAHLAGIDYRLPLMEFDLQLGLVEFAVPLVYTIGTLLFFLATLFLFLQA  120

Query  722   EKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLIGSL  543
             EKG Y  ++LE   L +L+AGP LW+LGSI NSCQIYER+ GH+QILQ+S+ IPFL+ S+
Sbjct  121   EKG-YVNFKLERVALSMLVAGPALWLLGSIHNSCQIYERSDGHVQILQESVLIPFLMASM  179

Query  542   LFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVFNIQQM  363
             LFLVGAI+N   +  HS   +H    LLG TW+ +GI GS +LF+G LANVVKVF + Q+
Sbjct  180   LFLVGAIVNGREQVGHS---HHHGLKLLGDTWIWLGIFGSLILFIGALANVVKVFKMLQL  236

Query  362   SGMMRLEKLRGGAHERLMHEREGGLPLIVDDAAEKQRWRIR------PPHEEWQpapa--  207
             SG +RLEKLR     RL+  REG +PLI     E++R   R      PP  E Q      
Sbjct  237   SG-LRLEKLR-----RLVRLREGQMPLI---GGEQRRPPNRISEGPMPPIVEEQRRERPA  287

Query  206   ------apvsaptPYKDVLVGN  159
                   A    PTPYKDVLVG 
Sbjct  288   VDIEEGASKEVPTPYKDVLVGQ  309



>ref|XP_009150943.1| PREDICTED: uncharacterized protein LOC103874287 [Brassica rapa]
 emb|CDX88079.1| BnaA06g26700D [Brassica napus]
Length=315

 Score =   268 bits (684),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 175/320 (55%), Positives = 215/320 (67%), Gaps = 18/320 (6%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAE-LSREPKSGlvlllia  906
             MVKLA+ARE R YGP L  SR+EY+NAGLY+F+T+VL+ GF A   S EP+SGLVL+L+A
Sbjct  1     MVKLATAREIRTYGPRLGRSRAEYINAGLYLFATVVLIGGFTATGFSWEPRSGLVLILLA  60

Query  905   faliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLFIQ  726
              ALI  VN HDL+AHLAG D+RL L  YD QL LVEFA PL+ I G +  FLGILF+F Q
Sbjct  61    LALITAVNVHDLVAHLAGIDYRLKLMEYDLQLGLVEFAVPLVQIAGSVVFFLGILFVFNQ  120

Query  725   DEKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLIGS  546
              E   +G    E   L +LIAGP LWV+GSI NSCQIYERA  H+QILQQ +HIPFL+GS
Sbjct  121   AET-KHGNSGREKHALNMLIAGPLLWVIGSIHNSCQIYERADSHVQILQQCVHIPFLVGS  179

Query  545   LLFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVFNIQQ  366
             LLFLV ++LN   +   S    HT   LLG  W+ +G+ GS  LFVGGL NVVKVFN  Q
Sbjct  180   LLFLVSSLLNSFDQSGSS----HTALKLLGRRWIWLGLSGSICLFVGGLMNVVKVFNFVQ  235

Query  365   MSGMMRLEKLRGGAHERLMHEREGGLPLI----------VDDAAEKQRWRIRPPHEEWQp  216
             ++G +RLEKLRGGA +RL+ EREG LPL+           D A+ + + R     +E   
Sbjct  236   ITG-LRLEKLRGGAQDRLLEEREGYLPLVAEEERIRKMEADQASNRAKTRSHLDSKEGAG  294

Query  215   apaapvsaptP-YKDVLVGN  159
             A  + +      YKDVL+G 
Sbjct  295   ATESVMGTSQTPYKDVLLGQ  314



>emb|CDX80417.1| BnaC07g30270D [Brassica napus]
Length=315

 Score =   267 bits (683),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 175/320 (55%), Positives = 215/320 (67%), Gaps = 18/320 (6%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAE-LSREPKSGlvlllia  906
             MVKLA+ARE R YGP L  SR+EY+NAGLY+F+T+VL+ GF A   S EP+SGLVL+L+A
Sbjct  1     MVKLATAREIRTYGPRLGRSRAEYINAGLYLFATVVLIGGFTATGFSWEPRSGLVLILLA  60

Query  905   faliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLFIQ  726
              ALI  VN HDL+AHLAG D+RL L  YD QL LVEFA PL+ I G +  FLGILF+F Q
Sbjct  61    LALITAVNVHDLVAHLAGIDYRLKLMEYDLQLGLVEFAVPLVQIAGSVVFFLGILFVFNQ  120

Query  725   DEKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLIGS  546
              E   +G    E   L +LIAGP LWV+GSI NSCQIYERA  H+QILQQ +HIPFL+GS
Sbjct  121   AET-KHGNSGREKHALNMLIAGPLLWVIGSIHNSCQIYERADSHVQILQQCVHIPFLVGS  179

Query  545   LLFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVFNIQQ  366
             LLFLV ++LN   +   S    HT   LLG  W+ +G+ GS  LFVGGL NVVKVFN  Q
Sbjct  180   LLFLVSSLLNSFDQTGSS----HTALKLLGRRWIWLGLSGSICLFVGGLMNVVKVFNFVQ  235

Query  365   MSGMMRLEKLRGGAHERLMHEREGGLPLI----------VDDAAEKQRWRIRPPHEEWQp  216
             ++G +RLEKLRGGA +RL+ EREG LPL+           D A+ + + R     +E   
Sbjct  236   ITG-LRLEKLRGGAQDRLLEEREGYLPLVAEEERIRKMEADQASNRAKTRSHLDSKEGAG  294

Query  215   apaapvsaptP-YKDVLVGN  159
             A  + +      YKDVL+G 
Sbjct  295   AVESVMGTSQTPYKDVLLGQ  314



>ref|XP_006394671.1| hypothetical protein EUTSA_v10005277mg [Eutrema salsugineum]
 gb|ESQ31957.1| hypothetical protein EUTSA_v10005277mg [Eutrema salsugineum]
Length=315

 Score =   267 bits (683),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 179/324 (55%), Positives = 216/324 (67%), Gaps = 26/324 (8%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAE-LSREPKSGlvlllia  906
             MVKLA+ARE R YGP L  SR+EY+NAGLY+F+T+VL+ GF A   S EP+SGLVL+L+A
Sbjct  1     MVKLATAREIRTYGPRLGRSRAEYINAGLYLFATVVLIGGFTATGFSWEPRSGLVLILLA  60

Query  905   faliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLFIQ  726
              ALI  VN HDL+AHLAG D+RL L  YD QL LVE A PL+ I G +  F+GI F+F Q
Sbjct  61    LALIIAVNIHDLVAHLAGIDYRLRLMEYDLQLGLVELAVPLVQIAGSVVFFVGIFFVFNQ  120

Query  725   DEKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLIGS  546
              EK   GY   E   L +LIAGP LW +GS+ NSCQIYERA  H+QILQQ +HIPFL+GS
Sbjct  121   AEK-KLGYSGREKHALNMLIAGPLLWAIGSVHNSCQIYERADSHVQILQQCVHIPFLVGS  179

Query  545   LLFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVFNIQQ  366
             LLFLV AILN   +   S    H+   LLG  W+ +GI G+  LFVGGL NVVKVFN  Q
Sbjct  180   LLFLVSAILNSFDQSGSS----HSGLKLLGKRWIWLGISGAICLFVGGLMNVVKVFNFVQ  235

Query  365   MSGMMRLEKLRGGAHERLMHEREGGLPLIVDDAAEKQRWRIRPPHEEWQ-----------  219
             +SG +RLEKLRGGA +RL+  REG LPL+    AE++R R     E ++           
Sbjct  236   ISG-LRLEKLRGGAQDRLLEGREGYLPLV----AEEERIRKMEADEAFKRAIPRAQLANK  290

Query  218   ----papaapvsaptPYKDVLVGN  159
                  A     S+PTPYKDVLVG 
Sbjct  291   SGPGAAETVERSSPTPYKDVLVGQ  314



>ref|XP_004145983.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
[Cucumis sativus]
Length=776

 Score =   276 bits (707),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 162/272 (60%), Positives = 200/272 (74%), Gaps = 7/272 (3%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAELSREPKSGlvllliaf  903
             MVKL SAR+ RVYGP    +R+EY+NAGLY+F+TI+LL GF A+LSREPKSGL L+L+A 
Sbjct  1     MVKLVSARDFRVYGPRSVRNRAEYINAGLYLFATILLLGGFVAQLSREPKSGLALILLAT  60

Query  902   aliavVNFHDLLAHLAGFDFRLSLF-GYDTQLALVEFAAPLLHILGCLCSFLGILFLFIQ  726
             +L A+VN HDL AHLAG D+RL L   YD QL  VEFA P L  +G L      LFL IQ
Sbjct  61    SLFAIVNLHDLFAHLAGIDYRLPLLVQYDAQLFFVEFAVPFLQAIGSLLLSFAALFLLIQ  120

Query  725   DEKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLIGS  546
             ++KG + Y++LE     +LIAGP LW+LGSI NSCQIYERA  H+QILQQS+HIPFLIGS
Sbjct  121   EKKG-HDYHKLEKHASNMLIAGPALWMLGSIHNSCQIYERADAHVQILQQSVHIPFLIGS  179

Query  545   LLFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVFNIQQ  366
             LLF V A+LN    +    L +H  + LLG  W+ +GI GS    +GGLANV+KVF +QQ
Sbjct  180   LLFFVAAVLN---SYEQVGLAHHGLK-LLGKNWIWLGIFGSLSFLLGGLANVLKVFKMQQ  235

Query  365   MSGMMRLEKLRGGAHERLMHEREGGLPLIVDD  270
               G +RLEKLRGGA+ERL+ EREG +PLI++D
Sbjct  236   FEG-LRLEKLRGGANERLLGEREGRIPLILED  266



>ref|XP_010913877.1| PREDICTED: uncharacterized protein LOC105039436 [Elaeis guineensis]
Length=286

 Score =   261 bits (667),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 145/277 (52%), Positives = 190/277 (69%), Gaps = 16/277 (6%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAELSRE---PKSGlvlll  912
             MVKLA+ARE R+YGP    +R EY+NAGLYVF+ I+L+ GF A+L R     + GLV++L
Sbjct  1     MVKLATARESRMYGPHPVRNRWEYINAGLYVFAAILLVFGFVAQLPRSGEVDEFGLVVIL  60

Query  911   iafaliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLF  732
             I   L+  VN HDL+AHLAG D+R  L G+D QL LVEFA PL+  +G +  F+ ILFL 
Sbjct  61    IGLVLVVAVNVHDLVAHLAGIDYRFELMGFDVQLGLVEFAVPLVQTIGSILVFIAILFLL  120

Query  731   IQDEKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLI  552
             IQ+ +G    Y LE   L +L+AGP LWVLGSI N+CQ+YER+  H QILQ  +H+PFL+
Sbjct  121   IQEVRGYN--YRLEKHALNMLMAGPLLWVLGSIHNACQVYERSDSHTQILQSGVHVPFLM  178

Query  551   GSLLFLVGAILN---LTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKV  381
             GS LFL+G I N   + G  HHS         L+  +W+ + I GS +  +GG+ NVVKV
Sbjct  179   GSFLFLLGGIFNRHDIFGSMHHSI-------KLMAKSWIWLSIFGSLLFLIGGILNVVKV  231

Query  380   FNIQQMSGMMRLEKLRGGAHERLMHEREGGLPLIVDD  270
             F +QQ  G +RLEKLRGGA ERL+ +REG +PLI++D
Sbjct  232   FKMQQADG-LRLEKLRGGAQERLVRDREGRVPLILED  267



>ref|XP_010925757.1| PREDICTED: uncharacterized protein LOC105048216 [Elaeis guineensis]
Length=343

 Score =   259 bits (663),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 149/285 (52%), Positives = 196/285 (69%), Gaps = 10/285 (4%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAELSREP---KSGlvlll  912
             MVKLA+ARE R YGP  + +R EY+NAGLY+F+ I+L+ GF A+L+  P   KSGLV++L
Sbjct  1     MVKLATARESRTYGPRRARNRWEYINAGLYLFAAILLIGGFVAQLAPTPLRAKSGLVVVL  60

Query  911   iafaliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLF  732
             I  AL  +VN HDL+AH+AG D+  +L  +D QLALVEFA PL++ILG + +F+G+LF  
Sbjct  61    IGLALFTLVNCHDLVAHMAGIDYWFALMEFDVQLALVEFAVPLVNILGSILTFIGVLFFL  120

Query  731   IQDEKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLI  552
             IQ E+G YGY  LE   L  LIAGP  W LGSI N CQIYER+ G +QILQ+S+ +PF +
Sbjct  121   IQAERG-YGY-RLEKHALNTLIAGPVFWALGSIHNLCQIYERSDGRVQILQKSVQVPFFM  178

Query  551   GSLLFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVFNI  372
             GSLLFLVG ++N    +       HT   +LG +WV + + GS +   GGL N+VKVF +
Sbjct  179   GSLLFLVGGVVNRNDIYGS----IHTSLKILGRSWVWLCLSGSLLFATGGLLNLVKVFKM  234

Query  371   QQMSGMMRLEKLRGGAHERLMHEREGGLPLIVDDAAEKQRWRIRP  237
             QQM   M LEKLRGGA ER   EREG +PLI++++  K    +R 
Sbjct  235   QQMD-RMGLEKLRGGAQERFGREREGQVPLILENSRRKTGEEVRA  278



>ref|XP_008437579.1| PREDICTED: LOW QUALITY PROTEIN: polypyrimidine tract-binding 
protein homolog 2 [Cucumis melo]
Length=750

 Score =   268 bits (684),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 178/308 (58%), Positives = 219/308 (71%), Gaps = 16/308 (5%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAELSREPKSGlvllliaf  903
             MVKL SAR+ RVYGP    +R+EY+NAGLY+F+TI+LL GF A+LSREPKSGL L+L+A 
Sbjct  1     MVKLVSARDFRVYGPRPLRNRAEYINAGLYLFATILLLGGFVAQLSREPKSGLALILLAT  60

Query  902   aliavVNFHDLLAHLAGFDFRLSLF-GYDTQLALVEFAAPLLHILGCLCSFLGILFLFIQ  726
             +LIA+VN HDL AHLAG D RL L   YD QL  VEFA P L  +G L   L  LFL IQ
Sbjct  61    SLIAIVNLHDLFAHLAGIDHRLPLLVQYDAQLFFVEFAVPFLQAIGSLLLSLAALFLLIQ  120

Query  725   DEKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLIGS  546
             ++KG + Y +LE     +LIAGP LW+LGSI NSCQIYERA GH+QILQQS+HIPFLIGS
Sbjct  121   EKKG-HDYDKLEKHASNMLIAGPALWMLGSIHNSCQIYERADGHVQILQQSVHIPFLIGS  179

Query  545   LLFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVFNIQQ  366
             LLF V A+LN    +    L +H  + LLG  W+ +GI GS  L +GGLANV+KVF +QQ
Sbjct  180   LLFFVAAVLN---SYEQVGLAHHGLK-LLGKNWIWLGIFGSLSLLLGGLANVLKVFKMQQ  235

Query  365   MSGMMRLEKLRGGAHERLMHEREGGLPLIVDDAAEKQRWRIRPPHEEWQpapaapvsapt  186
               G +RLEKLRGGA+ERL+ EREG +PLI++D   ++R      H + +       + PT
Sbjct  236   FEG-LRLEKLRGGANERLLGEREGRIPLILEDQGRRKR------HSDEE---RGREARPT  285

Query  185   PYKDVLVG  162
             PYKDVLVG
Sbjct  286   PYKDVLVG  293



>ref|XP_008783833.1| PREDICTED: uncharacterized protein LOC103702954 [Phoenix dactylifera]
Length=339

 Score =   256 bits (653),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 144/279 (52%), Positives = 197/279 (71%), Gaps = 10/279 (4%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAELSR---EPKSGlvlll  912
             MVKLA+ARE R YGP  + +R EY+NAGLY+F+ I+L+ GF A+LS      KSGL ++L
Sbjct  1     MVKLATARESRTYGPRPARNRWEYINAGLYIFAAILLVGGFMAQLSPTRLSAKSGLAVVL  60

Query  911   iafaliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLF  732
             I   L+ +VN HDL+AH+AG D+  +L  +D QLALVEFA PL++I+G + +F+G+LF  
Sbjct  61    IGLVLVTLVNAHDLVAHMAGIDYCFALMEFDIQLALVEFAVPLVNIVGSILTFIGVLFFL  120

Query  731   IQDEKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLI  552
             IQ E+G+   Y LE   L  LIAGP  W LGSI N CQIYER+GGH+QILQ+++ +PFL+
Sbjct  121   IQAERGHS--YRLEKHALNTLIAGPACWALGSIHNVCQIYERSGGHVQILQKTVQVPFLV  178

Query  551   GSLLFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVFNI  372
             GSLLFLVG ++N    +       HT   +LG +WV + + GS +  VGGL N++KVF +
Sbjct  179   GSLLFLVGGVVNRNDIYGS----IHTNFKILGRSWVWLSLSGSLLFLVGGLLNLLKVFKM  234

Query  371   QQMSGMMRLEKLRGGAHERLMHEREGGLPLIVDDAAEKQ  255
             QQM   M LEKLRGGA +RL  EREG +PLI++++  ++
Sbjct  235   QQMD-RMGLEKLRGGAQQRLGREREGQVPLILENSRRRK  272



>ref|XP_009419791.1| PREDICTED: uncharacterized protein LOC103999697 [Musa acuminata 
subsp. malaccensis]
Length=284

 Score =   248 bits (632),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 148/288 (51%), Positives = 192/288 (67%), Gaps = 10/288 (3%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAELSREP---KSGlvlll  912
             MVKL +ARE R YG   +  R EY+NAGLYV + ++L+ GF A+LS  P   KSGL L L
Sbjct  1     MVKLTTARESRTYGHLAARDRLEYINAGLYVLAPVLLVGGFTAQLSAAPAFAKSGLALAL  60

Query  911   iafaliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLF  732
             I  AL+ VVN HDL+AHLAG DF LSL  +D QLALVEF+ PL HI+G + +F+GILF  
Sbjct  61    IGLALVLVVNAHDLVAHLAGVDFCLSLVEFDVQLALVEFSVPLAHIVGTILNFIGILFFL  120

Query  731   IQDEKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLI  552
             IQ EK  Y    LE+  +  LI+GP  WV+GSI N CQ+YE A GH+QILQ+ + +P L+
Sbjct  121   IQMEK-RYSP-RLESHAVNTLISGPIFWVIGSIHNICQVYETANGHVQILQKCVQVPLLM  178

Query  551   GSLLFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVFNI  372
             GSLLFLV  ILN    +H +    HT   ++G +WV + + GS + FVGGL NVVKV  +
Sbjct  179   GSLLFLVAGILN----NHDTFGSIHTTSKIMGKSWVWLCLSGSCLFFVGGLLNVVKVSKM  234

Query  371   QQMSGMMRLEKLRGGAHERLMHEREGGLPLIVDDAAEKQRWRIRPPHE  228
             Q+  G +RLEKLRG AHE     REG LPLI++ +  K+   + P ++
Sbjct  235   QRRDG-VRLEKLRGSAHESSARRREGQLPLILESSRRKKAEEVTPHYK  281



>ref|XP_009400133.1| PREDICTED: uncharacterized protein LOC103984377 [Musa acuminata 
subsp. malaccensis]
Length=301

 Score =   248 bits (632),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 161/317 (51%), Positives = 209/317 (66%), Gaps = 29/317 (9%)
 Frame = -1

Query  1082  MVKLASARECRVYGPG--LSGSRSEYMNAGLYVFSTIVLLCGFAAELSRE----PKSGlv  921
             MVKLASARE R YGPG  L+ +R EY+NAGLY+F+T +L+ GFA ++S       KSGLV
Sbjct  1     MVKLASARESRTYGPGSRLARTRWEYINAGLYLFATAILVGGFATQISSVSSAGAKSGLV  60

Query  920   llliafaliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGIL  741
              +L+A AL+  VN HDL+AHLA  D+ LSL  +D QLALVEFA PL++ +G + +F+G L
Sbjct  61    AVLVALALLLAVNAHDLVAHLAAVDYCLSLVEFDVQLALVEFAVPLMNTVGVILTFVGNL  120

Query  740   FLFIQDEKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIP  561
             F  I  EKG    Y LE   L  LIAGP  WV+GSI N CQIYERA GH+Q+LQ+S+ +P
Sbjct  121   FFLIPMEKGYR--YRLEKHALNTLIAGPIFWVIGSIHNVCQIYERADGHVQLLQKSVQVP  178

Query  560   FLIGSLLFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKV  381
              ++GSLLFLV  I+N   KH        T   LLG +W+ + + GS++  VGGL N V+V
Sbjct  179   LIMGSLLFLVAGIVN---KHD------DTLHMLLGRSWIWLCLSGSSLFLVGGLMNTVRV  229

Query  380   FNIQQMSGMMRLEKLRGGAHERLMHEREGGLPLIVDD--AAEKQRWRIRPPHEEWQpapa  207
             F +Q+  G +RLEKLRG AHERL   RE  LPLI++    + KQ+   RP         +
Sbjct  230   FKMQRTEG-LRLEKLRGSAHERLAKVRE-ELPLILESNKKSRKQQEEGRP--------VS  279

Query  206   apvsaptPYKDVLVGNV  156
             AP   PTPYKD L+G++
Sbjct  280   APTPVPTPYKDALLGSL  296



>ref|XP_010915673.1| PREDICTED: uncharacterized protein LOC105040713 [Elaeis guineensis]
Length=348

 Score =   247 bits (630),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 143/279 (51%), Positives = 190/279 (68%), Gaps = 10/279 (4%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAELSR---EPKSGlvlll  912
             MVKLA+ARE R YGP  + +R EY+NAGLY+F+ I+L+ GF A+LS      KSGL ++L
Sbjct  1     MVKLATARESRTYGPRPARNRWEYINAGLYLFAAILLVGGFLAQLSPTRLSAKSGLAVVL  60

Query  911   iafaliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLF  732
             I   L+ +VN HDL+AH+AG D+  +L  +D QL LVEFA PLL+ILG + +F+G+LF  
Sbjct  61    IGLVLVTLVNAHDLVAHMAGIDYCFALMEFDIQLPLVEFAVPLLNILGSILAFVGVLFFL  120

Query  731   IQDEKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLI  552
             IQ E+G    Y LE   L  L+AGP  W LGSI N CQIYER+G  +QILQ+ + +PFL+
Sbjct  121   IQAERGYS--YRLEKHALNALVAGPACWALGSIHNECQIYERSGVLVQILQKIVQVPFLM  178

Query  551   GSLLFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVFNI  372
             GSL FLVG ++N    +       HT   +LG  W+ + + GS +  +GGL N+VKVF +
Sbjct  179   GSLFFLVGGVVNRNDIYGS----IHTNFKILGRRWIWLSLSGSLLFLIGGLLNLVKVFKM  234

Query  371   QQMSGMMRLEKLRGGAHERLMHEREGGLPLIVDDAAEKQ  255
             QQM GM  LEKLRGGA ERL  EREG +PLI++D   ++
Sbjct  235   QQMDGMG-LEKLRGGAQERLGREREGQVPLILEDGRRRK  272



>emb|CDM82073.1| unnamed protein product [Triticum aestivum]
Length=300

 Score =   245 bits (626),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 143/295 (48%), Positives = 189/295 (64%), Gaps = 17/295 (6%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGS------RSEYMNAGLYVFSTIVLLCGFAAEL---SREPKS  930
             MVKLA+AR+CR Y  G +G       R EY+NAG+YVF+ ++LL GF A+L   +   K+
Sbjct  1     MVKLATARDCRAYSLGATGGETSRNRRWEYINAGVYVFAAVLLLAGFLAQLWPWAVSTKA  60

Query  929   GlvllliafaliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFL  750
             GL + ++    +  VN HDLLAH+AG D+ L L G DTQ  LVE AAP + + G   + +
Sbjct  61    GLAVAVVGLLGVLAVNAHDLLAHVAGVDYNLGLAGLDTQFVLVELAAPAVQLAGAALTLV  120

Query  749   GILFLFIQDEKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSI  570
              ++   IQ E+G+     LE  GL LLIAGP LW LGSI N CQ+YERA GH+QILQ+S+
Sbjct  121   ALILFEIQMERGHR--RGLEKHGLNLLIAGPALWCLGSIHNMCQVYERANGHVQILQKSV  178

Query  569   HIPFLIGSLLFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANV  390
             HIPFL+GS LF +G ++N    H HS    H+F +LLG +W    + GS +   GGL N+
Sbjct  179   HIPFLLGSTLFFIGGVVNRNDVHGHSS---HSF-TLLGRSWAWYCLFGSLLFLAGGLLNL  234

Query  389   VKVFNIQQMSGMMRLEKLRGGAHERLMHEREGGLPLIVDDAAE-KQRWRIRPPHE  228
             +KVF +QQM G   LEKLRGGA ERL  EREG +PLI+++    K    + PP E
Sbjct  235   LKVFKMQQMGG-RGLEKLRGGAQERLSREREGKVPLILEEGRRGKHGGNVPPPPE  288



>ref|XP_008382638.1| PREDICTED: bidirectional sugar transporter SWEET2a-like [Malus 
domestica]
Length=442

 Score =   244 bits (624),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 134/194 (69%), Positives = 156/194 (80%), Gaps = 1/194 (1%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAELSREPKSGlvllliaf  903
             MVKLASARE R+YGP LS +R+EYMNAGLYVF+T VLL GF A+LS EPKSG +L+LIAF
Sbjct  1     MVKLASAREFRMYGPXLSRNRAEYMNAGLYVFATAVLLLGFVAQLSNEPKSGXLLMLIAF  60

Query  902   aliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLFIQD  723
             +LI VVN HDL+AHLA FD+R+ L  +D QLAL EFA P++H +G + SFLGILFL IQ 
Sbjct  61    SLILVVNLHDLVAHLAMFDYRMPLMEFDLQLALXEFAVPVVHAVGTVLSFLGILFLLIQL  120

Query  722   EKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLIGSL  543
             EKG YGY +LE     +LIAGP LW+LGSI NSCQIYERA GH QILQQS+HIPFLIGS+
Sbjct  121   EKG-YGYSKLERHAKNMLIAGPVLWLLGSIHNSCQIYERADGHXQILQQSVHIPFLIGSV  179

Query  542   LFLVGAILNLTGKH  501
             LF V AILN   +H
Sbjct  180   LFTVAAILNSREQH  193



>ref|XP_008810837.1| PREDICTED: polypyrimidine tract-binding protein homolog 2 [Phoenix 
dactylifera]
Length=796

 Score =   251 bits (641),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 142/265 (54%), Positives = 188/265 (71%), Gaps = 9/265 (3%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAEL--SREPKSGlvllli  909
             MVKLA+ARE R+YGP    +R EY+NAGLYVF+ I+L+ GFA +L  S E + GLV+ L+
Sbjct  1     MVKLATARESRMYGPHPVRNRWEYINAGLYVFAAILLVGGFAVQLPGSGEAEFGLVVTLV  60

Query  908   afaliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLFI  729
                L+A VN HDLLAHLAG D+R  L G+D QL LVEFA PL+ ++G +  F GILFLF+
Sbjct  61    GLVLVAAVNVHDLLAHLAGIDYRFELMGFDVQLGLVEFAVPLVQMIGSILVFTGILFLFM  120

Query  728   QDEKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLIG  549
             ++ +G    Y LE   L LL+AGP LW+LGSI N+CQ+YER+  H QILQ S+ +PFL+G
Sbjct  121   EEVRGYN--YRLEKHALNLLMAGPLLWLLGSIHNACQVYERSDSHTQILQSSVQMPFLLG  178

Query  548   SLLFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVFNIQ  369
             S LFLVG I N   +H     I+H+ + L+  +W+ + + GS +  +GG+ NVVKVF +Q
Sbjct  179   SFLFLVGGIFN---RHDIFGSIHHSIK-LMAKSWIWLSVFGSLLFLIGGILNVVKVFKMQ  234

Query  368   QMSGMMRLEKLRGGAHERLMHEREG  294
             Q  G +RLEKLRGGA ERL+ +REG
Sbjct  235   QADG-LRLEKLRGGAQERLIRDREG  258



>dbj|BAJ94001.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=312

 Score =   239 bits (609),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 148/316 (47%), Positives = 193/316 (61%), Gaps = 18/316 (6%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGS------RSEYMNAGLYVFSTIVLLCGFAAEL---SREPKS  930
             MVKLA+AR+CR Y  G +G       R EY+NAG+YVF+ ++L+ GF A+L   +   K+
Sbjct  1     MVKLATARDCRAYSLGAAGGETSRNRRWEYINAGVYVFAAVLLVVGFLAQLWPWAVSTKT  60

Query  929   GlvllliafaliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFL  750
             GL + ++    +  VN HDLLAH+AG D+ L L G DTQ  LVE AAP + + G   + +
Sbjct  61    GLAVAVVGLLGVLAVNAHDLLAHVAGVDYNLGLAGLDTQFVLVELAAPAVQLAGAALTLV  120

Query  749   GILFLFIQDEKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSI  570
              ++   IQ E+G      LE  GL LLIAGP LW LGSI N CQ+YERA GH+QILQ+S+
Sbjct  121   ALILFEIQMERGRR--RGLEKHGLNLLIAGPALWCLGSIHNMCQVYERANGHVQILQKSV  178

Query  569   HIPFLIGSLLFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANV  390
             HIPFL+GS LF +G ++N    H HS    H+  +LLG +W    + GS +   GGL N+
Sbjct  179   HIPFLLGSTLFFIGGVVNRNDVHGHSS---HS-SALLGRSWAWYCLFGSLLFLAGGLLNL  234

Query  389   VKVFNIQQMSGMMRLEKLRGGAHERLMHEREGGLPLIVDDAAE-KQRWRIRPPHEEWQpa  213
             +KVF  QQM G   LEKLRGGA ERL  EREG +PLI+++    K    +  P  E   A
Sbjct  235   LKVFKKQQMGG-RGLEKLRGGAQERLNREREGKVPLILEEGRRGKHGGNVGAPRHE-PRA  292

Query  212   paapvsaptPYKDVLV  165
             P  P      YKD LV
Sbjct  293   PPVPPPPEGSYKDALV  308



>dbj|BAJ85962.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=312

 Score =   238 bits (608),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 148/316 (47%), Positives = 193/316 (61%), Gaps = 18/316 (6%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGS------RSEYMNAGLYVFSTIVLLCGFAAEL---SREPKS  930
             MVKLA+AR+CR Y  G +G       R EY+NAG+YVF+ ++L+ GF A+L   +   K+
Sbjct  1     MVKLATARDCRAYSLGAAGGETSRNRRWEYINAGVYVFAAVLLVVGFLAQLWPWAVSTKA  60

Query  929   GlvllliafaliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFL  750
             GL + ++    +  VN HDLLAH+AG D+ L L G DTQ  LVE AAP + + G   + +
Sbjct  61    GLAVAVVGLLGVLAVNAHDLLAHVAGVDYNLGLAGLDTQFVLVELAAPAVQLAGAALTLV  120

Query  749   GILFLFIQDEKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSI  570
              ++   IQ E+G      LE  GL LLIAGP LW LGSI N CQ+YERA GH+QILQ+S+
Sbjct  121   ALILFEIQMERGRR--RGLEKHGLNLLIAGPALWCLGSIHNMCQVYERANGHVQILQKSV  178

Query  569   HIPFLIGSLLFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANV  390
             HIPFL+GS LF +G ++N    H HS    H+  +LLG +W    + GS +   GGL N+
Sbjct  179   HIPFLLGSTLFFIGGVVNRNDVHGHSS---HS-SALLGRSWAWYCLFGSLLFLAGGLLNL  234

Query  389   VKVFNIQQMSGMMRLEKLRGGAHERLMHEREGGLPLIVDDAAE-KQRWRIRPPHEEWQpa  213
             +KVF  QQM G   LEKLRGGA ERL  EREG +PLI+++    K    +  P  E   A
Sbjct  235   LKVFKKQQMGG-RGLEKLRGGAQERLNREREGKVPLILEEGRRGKHGGNVGAPRHE-PRA  292

Query  212   paapvsaptPYKDVLV  165
             P  P      YKD LV
Sbjct  293   PPVPPPPEGSYKDALV  308



>gb|EMT05914.1| hypothetical protein F775_43838 [Aegilops tauschii]
Length=316

 Score =   238 bits (608),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 135/280 (48%), Positives = 182/280 (65%), Gaps = 16/280 (6%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGS------RSEYMNAGLYVFSTIVLLCGFAAEL---SREPKS  930
             MVKLA+AR+CR Y  G +G       R EY+NAG+YVF+ ++L+ GF A+L   +   K+
Sbjct  1     MVKLATARDCRAYSLGATGGETSRNRRWEYINAGVYVFAAVLLVVGFLAQLWPWAVSTKA  60

Query  929   GlvllliafaliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFL  750
             GL + ++    +   N HDLLAH+AG D+ L L G DTQ  LVE AAP + + G   + +
Sbjct  61    GLAVAVVGLLGVLGANAHDLLAHVAGVDYNLGLAGLDTQFVLVELAAPAVQLAGAALTLV  120

Query  749   GILFLFIQDEKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSI  570
              ++   IQ E+G+     LE  GL LLIAGP LW LGSI N CQ+YERA GH+QILQ+S+
Sbjct  121   ALILFEIQMERGHR--RGLEKHGLNLLIAGPALWCLGSIHNMCQVYERANGHVQILQKSV  178

Query  569   HIPFLIGSLLFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANV  390
              IPFL+GS LF +G ++N    H HS    H+F +LLG +W    + GS +   GG+ N+
Sbjct  179   QIPFLLGSTLFFIGGVVNRNDVHGHSS---HSF-TLLGRSWAWYCLFGSLLFLAGGVLNL  234

Query  389   VKVFNIQQMSGMMRLEKLRGGAHERLMHEREGGLPLIVDD  270
             +KVF +QQM G   LEKLRGGA ERL  EREG +PLI+++
Sbjct  235   LKVFKMQQMGG-RGLEKLRGGAQERLSREREGKVPLILEE  273



>ref|XP_003571174.1| PREDICTED: uncharacterized protein LOC100837489 [Brachypodium 
distachyon]
Length=324

 Score =   235 bits (600),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 141/286 (49%), Positives = 180/286 (63%), Gaps = 16/286 (6%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGS-------RSEYMNAGLYVFSTIVLLCGFAAEL---SREPK  933
             MVKLA+ARECR Y  G  G        R E++NAG+YVF+  +L+CGF A+L   +   K
Sbjct  1     MVKLATARECRAYSLGAGGGQTQQANRRWEHINAGVYVFAAFLLVCGFLAQLWPWALSRK  60

Query  932   SGlvllliafaliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSF  753
             SGL L ++    +  VN HDLLAH+AG D+ L L G DTQ ALVE AAP + + G   + 
Sbjct  61    SGLALAVVGLLGVLGVNAHDLLAHVAGVDYNLGLAGLDTQFALVELAAPAVQLAGAALTL  120

Query  752   LGILFLFIQDEKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQS  573
             + ++F  IQ E+G  G   LE  GL LLIAGP LW LGSI N CQIYERA GH+QILQ+S
Sbjct  121   VALVFFEIQMERGYQG--SLEKHGLNLLIAGPALWCLGSIHNMCQIYERANGHVQILQKS  178

Query  572   IHIPFLIGSLLFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLAN  393
             + IP L+GS LFLVG ++N    H  S         LLG +W    + GS +   GGL N
Sbjct  179   VQIPLLLGSTLFLVGGVVNRHDVHSRSS---PGSTDLLGRSWPWFCLSGSLLFLAGGLLN  235

Query  392   VVKVFNIQQMSGMMRLEKLRGGAHERLMHEREGGLPLIVDDAAEKQ  255
             ++KV  +QQM G   LEKLRGGA ERL  EREG +PLI+++   ++
Sbjct  236   LLKVIKVQQMDG-RGLEKLRGGAQERLSREREGKVPLILEEGRRRK  280



>gb|EPS69524.1| hypothetical protein M569_05242, partial [Genlisea aurea]
Length=264

 Score =   231 bits (590),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 150/265 (57%), Positives = 183/265 (69%), Gaps = 11/265 (4%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAELSREPKSGlvllliaf  903
             MVKLASAR+ R YGP LS +R EY+NAG+YVFST++LL GFAA+ S E  SGL LLLI F
Sbjct  1     MVKLASARDFRQYGPILSRNRLEYINAGVYVFSTVLLLGGFAAQFSSETLSGLFLLLIGF  60

Query  902   aliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLFIQD  723
              LI +VN HDLLAHLAG D+RL L  +D Q A VEFA P  +  G L   L  LFLF++ 
Sbjct  61    FLILIVNLHDLLAHLAGIDYRLPLIRFDLQFAFVEFAVPFAYAAGALLMLLAALFLFLEV  120

Query  722   EKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLIGSL  543
             E G   Y + E   L + +AGPTLW LGSILNSCQIYER+G ++Q+LQ S+ +PF + SL
Sbjct  121   ENGGDPYLKWERASLSMFVAGPTLWTLGSILNSCQIYERSGAYVQLLQASVAVPFSMASL  180

Query  542   LFLVGAILNLT---GKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVFNI  372
             LFLV +ILN T   G H H          LLG     + + GS +LFVGGLANVV+VF +
Sbjct  181   LFLVASILNETEHIGSHRHG-------LELLGENSKWICVFGSLILFVGGLANVVRVFKM  233

Query  371   QQMSGMMRLEKLRGGAHERLMHERE  297
             QQ+ G +RLEKLRG AHE+L+  RE
Sbjct  234   QQLEG-LRLEKLRGQAHEQLLLGRE  257



>ref|XP_009405759.1| PREDICTED: uncharacterized protein LOC103988835 [Musa acuminata 
subsp. malaccensis]
Length=282

 Score =   231 bits (589),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 147/290 (51%), Positives = 186/290 (64%), Gaps = 22/290 (8%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAEL--SREPKSGlvllli  909
             MVKLASARE R+YGP    +R EY+NAGL+VF+  +L  GF+AEL      +  L ++L+
Sbjct  1     MVKLASARESRLYGPHSVENRWEYINAGLHVFAAALLTAGFSAELPGRSNDEVDLAVILV  60

Query  908   afaliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLFI  729
             A AL+AVVN HDL+AH+AG D++  LFGYD QL LVE A PLL +LG + +F GILFLFI
Sbjct  61    ALALLAVVNAHDLVAHMAGIDYQFGLFGYDLQLGLVELAVPLLQMLGSIVTFTGILFLFI  120

Query  728   QDEKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLIG  549
             Q+EKG    Y++E   + +LIAGP LWV+GSI N+CQIYERA G  QILQ  +++PFL+G
Sbjct  121   QEEKGFD--YKMEKDAVNMLIAGPLLWVIGSIHNACQIYERADGDTQILQSGVYVPFLMG  178

Query  548   SLLFLVGAILN---LTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVF  378
             SLLF V  I N   L G  H    I          +W  +   G  +  VGGL NV KVF
Sbjct  179   SLLFFVAGIFNRQDLRGSTHQEARITAI-------SWAWLSTFGGLLFLVGGLTNVAKVF  231

Query  377   NIQQMSGMMRLEKLRGGAHERLMHEREGGLPLIVDDAAEKQRWRIRPPHE  228
              +QQ  G +RLEKLRG A ERL  +REG  P++ +        R RP  E
Sbjct  232   KMQQRDG-LRLEKLRGSAQERLFRDREGRFPILENS-------RRRPGEE  273



>ref|XP_002322029.1| hypothetical protein POPTR_0015s06180g [Populus trichocarpa]
 gb|EEF06156.1| hypothetical protein POPTR_0015s06180g [Populus trichocarpa]
Length=207

 Score =   224 bits (570),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 133/199 (67%), Positives = 154/199 (77%), Gaps = 6/199 (3%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAELSREPKSGlvllliaf  903
             MVKLASARE R+YGP L+ +R EYMNAGL VF+ IVL+ GF AELS+EPKSGLVLLLI  
Sbjct  1     MVKLASARENRMYGPRLARNRGEYMNAGLCVFAAIVLVGGFVAELSKEPKSGLVLLLIGL  60

Query  902   aliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLFIQD  723
              LI VVN HDL+AHLAG D+R  L G+DTQLALV FA P++   G L SF G   L  Q+
Sbjct  61    LLIMVVNLHDLVAHLAGIDYRFPLMGFDTQLALVVFAVPVVQASGALLSFFGNPQL--QE  118

Query  722   EKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLIGSL  543
              KG YG+++LE   L LLIAGP LWVLGSI NSCQIYERA GH+QILQQS+HIPFL+GS 
Sbjct  119   YKG-YGHFKLERHALNLLIAGPALWVLGSIHNSCQIYERADGHVQILQQSVHIPFLMGSS  177

Query  542   LFLVGAILNL---TGKHHH  495
             LFLVG+ILN+    G+ HH
Sbjct  178   LFLVGSILNIHEQAGRGHH  196



>ref|XP_002453632.1| hypothetical protein SORBIDRAFT_04g009370 [Sorghum bicolor]
 gb|EES06608.1| hypothetical protein SORBIDRAFT_04g009370 [Sorghum bicolor]
Length=312

 Score =   221 bits (564),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 135/283 (48%), Positives = 178/283 (63%), Gaps = 21/283 (7%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGL-------SGSRSEYMNAGLYVFSTIVLLCGFAAEL-----SRE  939
             MVKLA+ARECR Y  G        S +R EY+NAG+Y+ + ++L+ GF A+L        
Sbjct  1     MVKLATARECRTYSLGAGAGSGTASRNRWEYINAGVYILAAVLLVAGFLAQLPPWGRGWS  60

Query  938   PKSGlvllliafaliavVNFHDLLAHLAGFDFRL-SLFGYDTQLALVEFAAPLLHILGCL  762
              + GLV+  I  A +  VN HDLLAH+AG D+RL ++ G D QLALVE A P + I+G L
Sbjct  61    GRPGLVVTAIGLAGVLAVNAHDLLAHVAGVDYRLGTVAGLDAQLALVELAVPAVQIVGTL  120

Query  761   CSFLGILFLFIQDEKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQIL  582
                + ++F  IQ E+G    + L   GL LLIAGP LW LGS+ N CQ+YERA GH+Q+L
Sbjct  121   LMLVAVIFFEIQMERGYR--HSLAVHGLNLLIAGPALWCLGSVHNICQVYERASGHVQLL  178

Query  581   QQSIHIPFLIGSLLFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGG  402
             Q+S+ IP L+GS LFLV  ++N      H     H+   LLG +WV   + GS +   GG
Sbjct  179   QKSVQIPLLLGSTLFLVAGVVN-----RHDRRSRHSAFVLLGRSWVWFCVFGSLLFLAGG  233

Query  401   LANVVKVFNIQQMSGMMRLEKLRGGAHERLMHEREGGLPLIVD  273
             + N++KVF  QQM G   LEKLRGGA ERL  EREG +PLI++
Sbjct  234   VLNLLKVFKTQQMGG-RGLEKLRGGAQERLALEREGKVPLILE  275



>ref|XP_004951283.1| PREDICTED: uncharacterized protein LOC101767480 [Setaria italica]
Length=310

 Score =   216 bits (549),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 129/288 (45%), Positives = 172/288 (60%), Gaps = 21/288 (7%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSG-------SRSEYMNAGLYVFSTIVLLCGFAAEL-----SRE  939
             MVKLA+ARECR Y  G  G       +R EY+NAG+YVFS ++L+ GF  +L        
Sbjct  1     MVKLATARECRAYSLGAGGGSGTALRNRWEYINAGVYVFSAVLLVGGFLGQLLATTWGGS  60

Query  938   PKSGlvllliafaliavVNFHDLLAHLAGFDFRLSLF-GYDTQLALVEFAAPLLHILGCL  762
              +  LV+  +  A +   N HDLLAH+AG D+RL +  G D QLALVE A P + I G  
Sbjct  61    SRPALVVAAVGLAGVLAANVHDLLAHVAGVDYRLGMVAGLDAQLALVEIAVPAVQIAGTT  120

Query  761   CSFLGILFLFIQDEKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQIL  582
                + ++   IQ E+G    + L   GL LLIAGP LW LGS+ N CQ+YERA GH+Q+L
Sbjct  121   LMLIAVVVFEIQMERGYR--HGLARHGLNLLIAGPALWCLGSVHNICQVYERASGHVQLL  178

Query  581   QQSIHIPFLIGSLLFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGG  402
             Q+S+ IP L+GS LFL+  I+N   +   +        SLLG +W    + GS +   GG
Sbjct  179   QKSVQIPLLLGSTLFLIAGIVNRHDRRSRTAAF-----SLLGRSWAWFCLFGSLLFLAGG  233

Query  401   LANVVKVFNIQQMSGMMRLEKLRGGAHERLMHEREGGLPLIVDDAAEK  258
             + N++KVF  QQM G   +EKLRGGA ERL  EREG +PLI++    +
Sbjct  234   VLNLLKVFKTQQMGG-RGMEKLRGGAQERLAMEREGKVPLILEHGGRR  280



>gb|AFW71050.1| hypothetical protein ZEAMMB73_759750 [Zea mays]
Length=301

 Score =   212 bits (540),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 131/288 (45%), Positives = 172/288 (60%), Gaps = 19/288 (7%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSG-------SRSEYMNAGLYVFSTIVLLCGFAAEL---SREPK  933
             MVKLA+ARECR Y  G          +R EY+NAG+Y+F+ ++L+ GF A+L        
Sbjct  1     MVKLATARECRAYSLGAGAGSGTALRNRWEYINAGVYIFAAVLLVGGFLAQLLPWGGPSS  60

Query  932   SGlvllliafaliavVNFHDLLAHLAGFDFRLSLF-GYDTQLALVEFAAPLLHILGCLCS  756
              GLV+  I  A +  VN HDLLAH AG D+RL +  G D Q+ LVE   P + I+G +  
Sbjct  61    PGLVVAAIGLAGLLAVNTHDLLAHAAGVDYRLGMVVGLDAQMGLVELGVPAVQIVGTVLM  120

Query  755   FLGILFLFIQDEKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQ  576
              + ++F  IQ E+G    + L   GL LLIAGP LW LGS+ N CQ YERA GH+Q+LQ+
Sbjct  121   LVAVVFFVIQMERGYR--HSLAMHGLNLLIAGPALWCLGSVQNICQFYERASGHVQLLQK  178

Query  575   SIHIPFLIGSLLFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLA  396
             S+ IP L+GS LFL+  I+N      H     H+   LLG +W    + GS +   GGL 
Sbjct  179   SVQIPLLLGSTLFLIAGIVN-----RHDRRSRHSGFVLLGRSWAWFCLFGSLLFLAGGLL  233

Query  395   NVVKVFNIQQMSGMMRLEKLRGGAHERLMHEREGGLPLIVDDAAEKQR  252
             N++KVF  QQM G   LEKLRGG  ERL  EREG +PLI++     +R
Sbjct  234   NLLKVFKTQQMGG-RGLEKLRGGTQERLALEREGKVPLILEHGHGGRR  280



>ref|XP_006648514.1| PREDICTED: uncharacterized protein LOC102702258 [Oryza brachyantha]
Length=313

 Score =   212 bits (540),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 133/282 (47%), Positives = 175/282 (62%), Gaps = 18/282 (6%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRS-------EYMNAGLYVFSTIVLLCGFAAELSR---EPK  933
             MVKLA+ARECR Y  G  G R        E +NAG YVF+ ++L+ GF  +LS      +
Sbjct  1     MVKLATARECRAYSLGGGGGRERAARGRWECINAGAYVFAAVLLVGGFVGQLSTWTATSR  60

Query  932   SGlvllliafaliavVNFHDLLAHLAGFDFRLSLF-GYDTQLALVEFAAPLLHILGCLCS  756
             SGL    +   ++ +VN HDLLAH A  D+ L L  G D+Q ALVE A P +HI G + +
Sbjct  61    SGLAAAALGLLVLLLVNAHDLLAHAARVDYSLGLAAGADSQFALVELAVPAVHIAGTVLT  120

Query  755   FLGILFLFIQDEKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQ  576
              + + F  IQ  +G    + LE  GL LL+AGP LW+LGS+ N CQ+YERA GH+QILQ+
Sbjct  121   LVALTFFEIQMTRGYR--HNLEKHGLNLLVAGPALWLLGSVHNICQVYERANGHVQILQK  178

Query  575   SIHIPFLIGSLLFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLA  396
              +  P L+GS LFL+G I+N  G H  S   Y +   LLG +W    + GS +   GGL 
Sbjct  179   CVQTPLLLGSTLFLIGGIVNWNGIHSQSS--YSS--ELLGKSWGWFCLAGSLLFLAGGLL  234

Query  395   NVVKVFNIQQMSGMMRLEKLRGGAHERLMHEREGGLPLIVDD  270
             N++KVF +QQM G   LEKLRGGA ERL  EREG +PLI+++
Sbjct  235   NLLKVFKMQQMDG-RGLEKLRGGAQERLSREREGKVPLILEE  275



>gb|ACG25602.1| hypothetical protein [Zea mays]
Length=301

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 133/289 (46%), Positives = 173/289 (60%), Gaps = 21/289 (7%)
 Frame = -1

Query  1082  MVKLASARECRVY--------GPGLSGSRSEYMNAGLYVFSTIVLLCGFAAEL---SREP  936
             MVKLA+ARECR Y        G GL  +R EY+NAG+Y+F+ ++L+ GF A+L       
Sbjct  1     MVKLATARECRAYSLGAGAGSGTGLR-NRWEYINAGVYIFAAVLLVGGFLAQLLPWGGPS  59

Query  935   KSGlvllliafaliavVNFHDLLAHLAGFDFRLSLF-GYDTQLALVEFAAPLLHILGCLC  759
               GLV+  I  A +  VN HDLLAH AG D+RL +  G D Q+ LVE   P + I+G   
Sbjct  60    SPGLVVAAIGLAGLLAVNTHDLLAHAAGVDYRLGMVVGLDAQMGLVELGVPAVQIVGTAL  119

Query  758   SFLGILFLFIQDEKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQ  579
               + ++F  IQ E+G    + L   GL LLIAGP LW LGS+ N CQ YERA GH+Q+LQ
Sbjct  120   MLVAVVFFVIQMERGYR--HSLAMHGLNLLIAGPALWCLGSVQNICQFYERASGHVQLLQ  177

Query  578   QSIHIPFLIGSLLFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGL  399
             +S+ IP L+GS LFL+  I+N      H     H+   LLG  W    + GS +   GGL
Sbjct  178   KSVQIPLLLGSTLFLIAGIVN-----RHDRRSRHSGFVLLGRNWAWFCLFGSLLFLAGGL  232

Query  398   ANVVKVFNIQQMSGMMRLEKLRGGAHERLMHEREGGLPLIVDDAAEKQR  252
              N++KVF  QQM G   LEKLRGG+ ERL  EREG +PLI++     +R
Sbjct  233   LNLLKVFKTQQMGG-RGLEKLRGGSQERLALEREGKVPLILEHGHGGRR  280



>ref|NP_001046472.1| Os02g0257200 [Oryza sativa Japonica Group]
 dbj|BAD27962.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF08386.1| Os02g0257200 [Oryza sativa Japonica Group]
 dbj|BAG96113.1| unnamed protein product [Oryza sativa Japonica Group]
Length=304

 Score =   208 bits (529),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 136/284 (48%), Positives = 176/284 (62%), Gaps = 17/284 (6%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRS----EYMNAGLYVFSTIVLLCGFAAELSR---EPKSGl  924
             MVKLA+ARECR YG G  G  +    EY+NAG YVF+ ++L  GF   LS      +SGL
Sbjct  1     MVKLATARECRAYGLGGGGRAARGRWEYINAGAYVFAAVLLAGGFGWHLSAWSATTRSGL  60

Query  923   vllliafaliavVNFHDLLAHLAGFDFRLSLF-GYDTQLALVEFAAPLLHILGCLCSFLG  747
                 +   L+  VN HDLLAH AG D+ L+L  G D+Q ALVE A P +H  G + + + 
Sbjct  61    AAAALGLLLLLAVNAHDLLAHAAGVDYSLALAAGLDSQFALVEVAVPAVHFAGTVLTLIA  120

Query  746   ILFLFIQDEKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIH  567
             ++F  IQ  +G    + LE  GL +LIAGP LW+LGSI N CQ+YERA GH+QILQ+ + 
Sbjct  121   LIFFEIQMARGYR--HSLEKHGLNMLIAGPALWLLGSIQNICQVYERANGHVQILQKCVQ  178

Query  566   IPFLIGSLLFLVGAILNLTGKHHHSPLIYHTFRS-LLGGTWVRVGICGSTVLFVGGLANV  390
              P L+GS LFL+G I+N    H  S     T RS LLG +W    + GS +    GL N+
Sbjct  179   TPLLLGSTLFLIGGIINRHDIHSQS-----TSRSELLGRSWGWFCVSGSLLFVAAGLLNL  233

Query  389   VKVFNIQQMSGMMRLEKLRGGAHERLMHEREGGLPLIVDDAAEK  258
             +KVF +QQM G   LEKLRGGA ERL  EREG +PLI+++   +
Sbjct  234   LKVFKMQQMDG-RGLEKLRGGAQERLNREREGKVPLILEEGQRR  276



>gb|EAY85254.1| hypothetical protein OsI_06627 [Oryza sativa Indica Group]
Length=304

 Score =   207 bits (528),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 136/284 (48%), Positives = 176/284 (62%), Gaps = 17/284 (6%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRS----EYMNAGLYVFSTIVLLCGFAAELSR---EPKSGl  924
             MVKLA+ARECR YG G  G  +    EY+NAG YVF+ ++L  GF   LS      +SGL
Sbjct  1     MVKLATARECRAYGLGGGGRAARGRWEYINAGAYVFAAVLLAGGFGWHLSAWSATTRSGL  60

Query  923   vllliafaliavVNFHDLLAHLAGFDFRLSLF-GYDTQLALVEFAAPLLHILGCLCSFLG  747
                 +   L+  VN HDLLAH AG D+ L+L  G D+Q ALVE A P +H  G + + + 
Sbjct  61    AAAALGLLLLLAVNAHDLLAHAAGVDYSLALAAGLDSQFALVEVAVPAVHFAGTVLTLIA  120

Query  746   ILFLFIQDEKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIH  567
             ++F  IQ  +G    + LE  GL +LIAGP LW+LGSI N CQ+YERA GH+QILQ+ + 
Sbjct  121   LIFFEIQMARGYR--HSLEKHGLNMLIAGPALWLLGSIQNICQVYERANGHVQILQKCVQ  178

Query  566   IPFLIGSLLFLVGAILNLTGKHHHSPLIYHTFRS-LLGGTWVRVGICGSTVLFVGGLANV  390
              P L+GS LFL+G I+N    H  S     T RS LLG +W    + GS +    GL N+
Sbjct  179   TPLLLGSTLFLIGGIINRHDIHSRS-----TSRSELLGRSWGWFCVSGSLLFVAAGLMNL  233

Query  389   VKVFNIQQMSGMMRLEKLRGGAHERLMHEREGGLPLIVDDAAEK  258
             +KVF +QQM G   LEKLRGGA ERL  EREG +PLI+++   +
Sbjct  234   LKVFKMQQMDG-RGLEKLRGGAQERLNREREGKVPLILEEGRRR  276



>gb|KHN44230.1| hypothetical protein glysoja_024450 [Glycine soja]
Length=194

 Score =   195 bits (496),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 111/211 (53%), Positives = 144/211 (68%), Gaps = 23/211 (11%)
 Frame = -1

Query  776  ILGCLCSFLGILFLFIQDEKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGG  597
            + G L +FLG+ FLFIQ+EKG YGY++LE   L +L+AGP LWV+GSI NSCQIYERA G
Sbjct  1    MFGTLLAFLGVFFLFIQEEKG-YGYFKLEKHALNMLVAGPVLWVIGSIHNSCQIYERADG  59

Query  596  HMQILQQSIHIPFLIGSLLFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTV  417
            H+QILQQ ++IPFL+GSL F++ AILN    H  S  I+H    LLGGTW+ +GI GS +
Sbjct  60   HVQILQQCVYIPFLMGSLSFMLSAILNY---HEKSRDIHHGLH-LLGGTWIWLGIFGSLM  115

Query  416  LFVGGLANVVKVFNIQQMSGMMRLEKLRGGAHERLMHEREGGLPLIVDDAA----EKQRW  249
             F+GGL N++KVF +QQM+G +RLEKLRG AHERL+  RE  +PLI++       + Q  
Sbjct  116  FFIGGLTNLIKVFKMQQMNG-IRLEKLRGEAHERLLSAREAQIPLIMEHQTNISHQPQET  174

Query  248  RIRPPHEEWQpapaapvsaptPYKDVLVGNV  156
            ++  P              PTPYKDVL+G  
Sbjct  175  KVTLP-------------LPTPYKDVLIGQT  192



>dbj|BAK07099.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=266

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 131/291 (45%), Positives = 172/291 (59%), Gaps = 33/291 (11%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAELSREPKSGlvllliaf  903
             MVKLA+ARE R+YGP L+  R EY+NAG Y+F T++L  G AA  + E   G     +A 
Sbjct  1     MVKLATAREARLYGPALAVRRWEYINAGAYMFGTLLLAAGLAALCASEGGVGARDAGLAV  60

Query  902   aliavV-----NFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGI-L  741
             A +A+      N HDL AHLAG D R+ L  +D QL LVE  AP LH  GC+ + +G+ L
Sbjct  61    AGVALAVVAAVNAHDLGAHLAGVDCRVGLARFDPQLGLVELLAPALHAAGCVLAIVGLAL  120

Query  740   FLFIQDEKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIP  561
              LF Q ++       LE +    L+AG  LW+LGS+L+SCQ YERA G  Q+LQ S+ +P
Sbjct  121   QLFSQGDR-------LERRAADALLAGAVLWILGSVLSSCQTYERADGRAQLLQSSVQVP  173

Query  560   FLIGSLLFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKV  381
              L+GSLLFLV A+L+  G+            +L G +   + +CGS +   G L NV+KV
Sbjct  174   VLLGSLLFLVAAVLHRRGEP-----------TLPGESERWISLCGSVLWVAGALFNVLKV  222

Query  380   FNIQQMSGMMRLEKLRGGAHERLMHEREGGLPLIVDDAAEKQRWRIRPPHE  228
             F + Q S   RLEKLRGGA ERL  +REG +PL+   AA        PP E
Sbjct  223   FVMHQ-SDAPRLEKLRGGAQERLARDREGRVPLVWRSAA--------PPTE  264



>gb|EAZ22464.1| hypothetical protein OsJ_06133 [Oryza sativa Japonica Group]
Length=280

 Score =   189 bits (481),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 124/281 (44%), Positives = 162/281 (58%), Gaps = 35/281 (12%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRS----EYMNAGLYVFSTIVLLCGFAAELSREPKSGlvll  915
             MVKLA+ARECR YG G  G  +    EY+NAG YVF+ ++L  GF   LS    +     
Sbjct  1     MVKLATARECRAYGLGGGGRAARGRWEYINAGAYVFAAVLLAGGFGWHLSAWSAT-----  55

Query  914   liafaliavVNFHDLLAHLAGFDFRLSL-FGYDTQLALVEFAAPLLHILGCLCSFLGILF  738
                                AG D+ L+L  G D+Q ALVE A P +H  G + + + ++F
Sbjct  56    ----------------TSAAGVDYSLALAAGLDSQFALVEVAVPAVHFAGTVLTLIALIF  99

Query  737   LFIQDEKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPF  558
               IQ  +G    + LE  GL +LIAGP LW+LGSI N CQ+YERA GH+QILQ+ +  P 
Sbjct  100   FEIQMARGY--RHSLEKHGLNMLIAGPALWLLGSIQNICQVYERANGHVQILQKCVQTPL  157

Query  557   LIGSLLFLVGAILNLTGKHHHSPLIYHTFRS-LLGGTWVRVGICGSTVLFVGGLANVVKV  381
             L+GS LFL+G I+N    H  S     T RS LLG +W    + GS +    GL N++KV
Sbjct  158   LLGSTLFLIGGIINRHDIHSQS-----TSRSELLGRSWGWFCVSGSLLFVAAGLLNLLKV  212

Query  380   FNIQQMSGMMRLEKLRGGAHERLMHEREGGLPLIVDDAAEK  258
             F +QQM G   LEKLRGGA ERL  EREG +PLI+++   +
Sbjct  213   FKMQQMDG-RGLEKLRGGAQERLNREREGKVPLILEEGQRR  252



>ref|XP_004173685.1| PREDICTED: uncharacterized protein LOC101224750 [Cucumis sativus]
Length=198

 Score =   179 bits (453),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 135/206 (66%), Gaps = 13/206 (6%)
 Frame = -1

Query  776  ILGCLCSFLGILFLFIQDEKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGG  597
            +L   C+   + F  +  EK  + Y++LE     +LIAGP LW+LGSI NSCQIYERA  
Sbjct  4    VLSSFCTLQELPFNLLLQEKKGHDYHKLEKHASNMLIAGPALWMLGSIHNSCQIYERADA  63

Query  596  HMQILQQSIHIPFLIGSLLFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTV  417
            H+QILQQS+HIPFLIGSLLF V A+LN    +    L +H  + LLG  W+ +GI GS  
Sbjct  64   HVQILQQSVHIPFLIGSLLFFVAAVLN---SYEQVGLAHHGLK-LLGKNWIWLGIFGSLS  119

Query  416  LFVGGLANVVKVFNIQQMSGMMRLEKLRGGAHERLMHEREGGLPLIVDDAAEKQRWRIRP  237
              +GGLANV+KVF +QQ  G +RLEKLRGGA+ERL+ EREG +PLI++D   ++R     
Sbjct  120  FLLGGLANVLKVFKMQQFEG-LRLEKLRGGANERLLGEREGRIPLILEDQGRRKR-----  173

Query  236  PHEEWQpapaapvsaptPYKDVLVGN  159
             H + +       + PTPYKDVLVG 
Sbjct  174  -HSDEE--RGRVEARPTPYKDVLVGQ  196



>gb|EAY99221.1| hypothetical protein OsI_21179 [Oryza sativa Indica Group]
Length=275

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 122/284 (43%), Positives = 162/284 (57%), Gaps = 24/284 (8%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAELSREPKSGlvllliaf  903
             MVKLA+ARE R+YGP L+  R EY+NAG YVF+ ++L    AA  +     G        
Sbjct  1     MVKLATAREARMYGPALAVRRWEYINAGAYVFAALLLAVALAALSAGGGGGGGASRAALA  60

Query  902   aliavV------NFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGIL  741
                  +      N HDL AHLAG D R+ L  YD QL LVE   P LH+ GC+ + + + 
Sbjct  61    VAAVALALVAAVNAHDLAAHLAGVDCRVGLVRYDAQLGLVELLVPALHVAGCVLAVVAMA  120

Query  740   FLFIQDEKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIP  561
              L  Q E+        E      L+A   +W+LGSILNSCQ+YERA G  Q+LQ S+ +P
Sbjct  121   LLLSQGER--------ETHAANTLLAAALVWLLGSILNSCQVYERADGRAQLLQSSVQVP  172

Query  560   FLIGSLLFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWV-RVGICGSTVLFVGGLANVVK  384
              L+GSLLFLVGA++N   +    PL+      L+G +W   + + GS +  V  + N+ K
Sbjct  173   MLLGSLLFLVGAVVN--RRRRPEPLV------LVGRSWAWTMCVLGSVLWLVAAVFNMGK  224

Query  383   VFNIQQMSGMMRLEKLRGGAHERLMHEREGGLPLIVDDAAEKQR  252
             VF + Q S   RLEKLRGGA ERL  +REG LPL  ++AA  +R
Sbjct  225   VFVMHQ-SDAPRLEKLRGGAQERLSRDREGRLPLNWEEAARSRR  267



>ref|XP_011016841.1| PREDICTED: uncharacterized protein LOC105120377, partial [Populus 
euphratica]
Length=134

 Score =   173 bits (438),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 111/140 (79%), Gaps = 6/140 (4%)
 Frame = -1

Query  731  IQDEKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLI  552
            +Q+ KG YG+++LE   L LLIAGP LWVLGSI NSCQIYERA GH+QILQQS+HIPFL+
Sbjct  1    MQEYKG-YGHFKLERHALNLLIAGPALWVLGSIHNSCQIYERADGHVQILQQSVHIPFLM  59

Query  551  GSLLFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVFNI  372
            GSLLFLVG+ILN+   H  +   YH  + LLG TWV  GICGS ++F+GGLAN VKVF +
Sbjct  60   GSLLFLVGSILNI---HEQAGRGYHGLK-LLGKTWVWTGICGSLMIFIGGLANAVKVFKM  115

Query  371  QQMSGMMRLEKLRGGAHERL  312
            QQ+ G +RLEKLRGGA ERL
Sbjct  116  QQIDG-LRLEKLRGGAQERL  134



>ref|NP_001056464.1| Os05g0586700 [Oryza sativa Japonica Group]
 dbj|BAF18378.1| Os05g0586700 [Oryza sativa Japonica Group]
Length=306

 Score =   174 bits (441),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 123/308 (40%), Positives = 165/308 (54%), Gaps = 41/308 (13%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAELSREPKSGlvllliaf  903
             MVKLA+ARE R+YGP L+  R EY+NAG YVF+ ++L    AA  +     G        
Sbjct  1     MVKLATAREARMYGPALAVRRWEYINAGAYVFAALLLAVALAALSAGGGGGGGASRAALA  60

Query  902   aliavV------NFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGIL  741
                  +      N HDL AHLAG D R+ L  YD QL LVE   P LH+ GC+ + + + 
Sbjct  61    VAAVALALVAAVNAHDLAAHLAGVDCRVGLVRYDAQLGLVELLVPALHVAGCVLAVVAMA  120

Query  740   FLFIQDEKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIP  561
             FL  Q E+        E      L+A   +W+LGSILNSCQ+YERA G  Q+LQ S+ +P
Sbjct  121   FLLSQGER--------ETHAANTLLAAALVWLLGSILNSCQVYERADGRAQLLQSSVQVP  172

Query  560   FLIGSLLFLVGAILNLTGKHHHSPLIYHTFRSLL------------------------GG  453
              L+GSLLFLVGA++N   +    P++  + RS+                         G 
Sbjct  173   MLLGSLLFLVGAVVNRR-RRPEPPVLVVSARSIRSSNLAAGVGMHDAMTKPCGLTVTQGR  231

Query  452   TWV-RVGICGSTVLFVGGLANVVKVFNIQQMSGMMRLEKLRGGAHERLMHEREGGLPLIV  276
             +W   + + GS +  V  + N+ KVF + Q S   RLEKLRGGA ERL  +REG LPL  
Sbjct  232   SWAWTMCVLGSVLWLVAAVFNMGKVFVMHQ-SDAPRLEKLRGGAQERLSRDREGRLPLNW  290

Query  275   DDAAEKQR  252
             ++AA  +R
Sbjct  291   EEAARSRR  298



>ref|XP_002440352.1| hypothetical protein SORBIDRAFT_09g030120 [Sorghum bicolor]
 gb|EES18782.1| hypothetical protein SORBIDRAFT_09g030120 [Sorghum bicolor]
Length=282

 Score =   170 bits (430),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 122/272 (45%), Positives = 159/272 (58%), Gaps = 13/272 (5%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAELSREPKSGlvllliaf  903
             MVKLA+ARE R+YGP L+  R EY+NAG+YVF+ ++L+   +A  S      L +  +A 
Sbjct  1     MVKLATAREARLYGPALAARRWEYINAGVYVFAALLLVLALSASSSGARAG-LAVAAVAL  59

Query  902   aliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLFIQD  723
             A +A VN HDL AHLAG D R+ L  YD QL LVEF  P +H  GC  + +G+  L  Q 
Sbjct  60    AAVAAVNAHDLAAHLAGVDCRVGLARYDAQLGLVEFLVPAVHAAGCALAVVGLALLVSQS  119

Query  722   E----KGNYGYY-ELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPF  558
             +    KG  G+    E     +L+    LWVLGS+LNSCQ+YERA G  Q+LQ S+ +P 
Sbjct  120   QHEQGKGGPGHVGRREAHAATMLLVAALLWVLGSVLNSCQVYERADGRAQLLQSSVQVPQ  179

Query  557   LIGSLLFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVF  378
             L+GSLLFLV A LN         L+     S     W+ + + GS +     + NV+KVF
Sbjct  180   LLGSLLFLVAAALN------RRRLVVSGTGSAEEPAWLCLALAGSVLWLAAAMLNVLKVF  233

Query  377   NIQQMSGMMRLEKLRGGAHERLMHEREGGLPL  282
                Q S   RLEKLRGGA E L  +REG +PL
Sbjct  234   TRHQ-SDAPRLEKLRGGAQEWLSRDREGRVPL  264



>ref|NP_001130233.1| hypothetical protein [Zea mays]
 gb|ACF78395.1| unknown [Zea mays]
 gb|ACG23962.1| hypothetical protein [Zea mays]
 gb|AFW81285.1| hypothetical protein ZEAMMB73_440600 [Zea mays]
Length=264

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 120/277 (43%), Positives = 158/277 (57%), Gaps = 21/277 (8%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAELS-REPKSGlvlllia  906
             MVKLA+ARE R+YGP L+  R EY+NAG YVF+ ++L+   A  +S    + GL +  +A
Sbjct  1     MVKLATAREARLYGPALAARRWEYINAGTYVFAALLLVLAAALSMSVSAARLGLAVGAVA  60

Query  905   faliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLFIQ  726
              A +A VN HDL AHLAG D R+ L  YD QL LVEF  P +H  GC  +  G+  L   
Sbjct  61    LAAVAAVNAHDLAAHLAGVDCRVGLARYDAQLGLVEFLVPAVHAAGCALAAAGLALLASP  120

Query  725   DEKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLIGS  546
                        +     +L+    LWVLGS+LNSCQ+YERA G  Q+LQ  + +P L+GS
Sbjct  121   HSHSQ----SQQRHAATMLLVAALLWVLGSVLNSCQVYERADGRAQLLQSGVQVPQLLGS  176

Query  545   LLFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVFNIQQ  366
             LLFLV A LN               R   GG    + + GS +     L NV+KVF + Q
Sbjct  177   LLFLVAAALN---------------RPRSGGEPAWLCLVGSVLWLAAALLNVLKVFAMHQ  221

Query  365   MSGMMRLEKLRGGAHERLMHEREGGLPLIVDDAAEKQ  255
              S  +RLEKLRGGA E L  +REG +PL  ++AA ++
Sbjct  222   -SDALRLEKLRGGAQEWLSRDREGRVPLNWEEAARRR  257



>ref|XP_004961054.1| PREDICTED: uncharacterized protein LOC101778091 [Setaria italica]
Length=263

 Score =   156 bits (395),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 121/277 (44%), Positives = 160/277 (58%), Gaps = 22/277 (8%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAELSREPKSGlvllliaf  903
             MVKLA+ARE R+YGP L+  R EY+NAG+Y F+ ++L  G AA  +       + +  A 
Sbjct  1     MVKLATAREARLYGPALAVRRWEYINAGVYAFAALLLSAGLAALSAGGAARAGLAVAAAA  60

Query  902   aliav-VNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLFIQ  726
                   VN HDL AHLAG D+R+ L  YD QL LVEF  P LH  GC  +   +  L + 
Sbjct  61    LAAVAAVNAHDLAAHLAGVDWRVGLARYDAQLGLVEFLVPALHAAGCALA---VAGLALL  117

Query  725   DEKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLIGS  546
              E   Y Y   E     +L+A   LW+LGS+LNSCQ+YERA G  Q+LQ S+ +P L+GS
Sbjct  118   GEGAGYSYGR-EKHAANMLLAAALLWLLGSVLNSCQVYERADGRAQLLQSSVQMPMLLGS  176

Query  545   LLFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVFNIQQ  366
             LLFLV A+LN                   G +W  + + GS +     L NV+KVF + Q
Sbjct  177   LLFLVAAVLNRR----------------RGRSWAWLCLLGSLLWLAAALLNVLKVFMMHQ  220

Query  365   MSGMMRLEKLRGGAHERLMHEREGGLPLIVDDAAEKQ  255
              S  +RLEKLRGGA ERL  +REG +PL  ++AA ++
Sbjct  221   -SDALRLEKLRGGAQERLSRDREGRVPLNWEEAARRR  256



>ref|XP_009376261.1| PREDICTED: uncharacterized protein LOC103964972 [Pyrus x bretschneideri]
Length=289

 Score =   154 bits (389),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 106/200 (53%), Positives = 128/200 (64%), Gaps = 15/200 (8%)
 Frame = -1

Query  728  QDEKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLIG  549
            ++ K    Y +LE     +LIAGP LW+LGSI NSCQIYERA GH+QILQQ ++IPFLIG
Sbjct  95   RETKRRTQYSKLERHAKNMLIAGPVLWLLGSIHNSCQIYERADGHVQILQQCVYIPFLIG  154

Query  548  SLLFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVFNIQ  369
            S+LF V AILN   +H    L  H  + +LG TWV +G  GS +L +GGLANVVKVF +Q
Sbjct  155  SVLFTVAAILNSREQHR---LSLHGLQ-ILGRTWVWLGTGGSLLLLIGGLANVVKVFKMQ  210

Query  368  QMSGMMRLEKLRGGAHERLMHEREGGLPLIVDDAAEKQRWRIRPP---------HEEWQp  216
            QM   +RLEKLRGGA ERL+  REG +PLIV+D   ++R   RP          H     
Sbjct  211  QMGDGLRLEKLRGGAQERLVRGREGQVPLIVED--HRRRSSQRPSARYDNNHHAHHVEPN  268

Query  215  apaapvsaptPYKDVLVGNV  156
               A   APTPYKDVLVG  
Sbjct  269  PNVAAEPAPTPYKDVLVGQT  288



>ref|XP_011007946.1| PREDICTED: uncharacterized protein LOC105113464 [Populus euphratica]
Length=216

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 108/157 (69%), Gaps = 17/157 (11%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAELSREPKSGlvllliaf  903
             MVKLASARE R+YGPGL+ +R EYMNAGL VF+ IVL+ GF AELS+EPKSGLVLLLI  
Sbjct  1     MVKLASARESRMYGPGLARNRGEYMNAGLCVFAAIVLVGGFVAELSKEPKSGLVLLLIGL  60

Query  902   aliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLFIQD  723
              LI VVN HDL+AHLAG D+R  L G+DTQLALVEFA P++   G L SFLGILFLFIQ 
Sbjct  61    LLIMVVNLHDLVAHLAGIDYRFPLMGFDTQLALVEFAVPVVQASGALLSFLGILFLFIQV  120

Query  722   EKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIY  612
                             L IAG T WV   I  S  I+
Sbjct  121   ----------------LEIAGKT-WVWTGICGSLMIF  140


 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 68/102 (67%), Gaps = 9/102 (9%)
 Frame = -1

Query  464  LLGGTWVRVGICGSTVLFVGGLANVVKVFNIQQMSGMMRLEKLRGGAHERLMHEREGGLP  285
            + G TWV  GICGS ++F+GGLAN VKVF +QQ+ G +RLEKLRGGA ERL+ ER+G  P
Sbjct  123  IAGKTWVWTGICGSLMIFIGGLANAVKVFKMQQIDG-LRLEKLRGGAQERLIRERDGHSP  181

Query  284  LIVDDAAEKQRWRIRPPHEEWQpapaapvsaptPYKDVLVGN  159
            LI+++  E++R  I              + A TPY+DVLVG 
Sbjct  182  LILEE--ERRRKMIAAETRAAH------IPATTPYRDVLVGQ  215



>ref|XP_001782862.1| predicted protein [Physcomitrella patens]
 gb|EDQ52317.1| predicted protein [Physcomitrella patens]
Length=290

 Score =   143 bits (361),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 100/266 (38%), Positives = 146/266 (55%), Gaps = 13/266 (5%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAEL-SREPKSGlvlllia  906
             M KLAS R  R YGP       E  NA  Y+  T ++L G    L       G+  LLIA
Sbjct  1     MTKLASVRATRFYGPASMKYECELANAVGYLLGTALVLIGVVFFLPGWNVPVGIWCLLIA  60

Query  905   faliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLFIQ  726
               LI  VN HDL A LAGFDFR+ L   D QLAL+E AAPL+  +G L   +G +F F+Q
Sbjct  61    LVLIICVNVHDLYAQLAGFDFRIPLVTLDPQLALIEIAAPLVQAIGGLLFLVGFIF-FLQ  119

Query  725   DEKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLIGS  546
              +  +  Y  + N    L+IA    W+LGSI N+ Q+YE     +Q +Q+++ +P LI +
Sbjct  120   LDSIDVAY--VTNHAYSLVIAASAFWLLGSIHNAFQVYENTDTRVQFMQKTVSVPLLIAN  177

Query  545   LLFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVFNIQQ  366
              LFLV +IL+    +    L     ++ +G T + + I  + +L   G+ N+++V  +++
Sbjct  178   TLFLVASILS----YETWTLPPIAKKAAVGVTAIWLAIVAAGLLLFSGIMNIIRVLEMRE  233

Query  365   MS---GMMRLEKLRGGAHERLMHERE  297
             +    G+  LE LRGGA E L H+R+
Sbjct  234   VDHTGGL--LEPLRGGAQEELEHKRD  257



>gb|EEE64862.1| hypothetical protein OsJ_19719 [Oryza sativa Japonica Group]
Length=275

 Score =   141 bits (355),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 107/288 (37%), Positives = 150/288 (52%), Gaps = 32/288 (11%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAELS----------REPK  933
             MVKLA+ARE R+YGP L+  R EY+NAG YVF+ ++L    AA  +          R   
Sbjct  1     MVKLATAREARMYGPALAVRRWEYINAGAYVFAALLLAVALAALSAGGGDGGGPAGRRSP  60

Query  932   SGlvllliafaliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSF  753
                     +       +     A  A + +     G     A    + P LH+ GC+ + 
Sbjct  61    WPPWRWRSSPPSTRTTSRRTSPAWTAAWGWS----GTTPSSASWSSSCPALHVAGCVLAV  116

Query  752   LGILFLFIQDEKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQS  573
             + + FL  Q E+        E      L+A   +W+LGSILNSCQ+YERA G  Q+LQ S
Sbjct  117   VAMAFLLSQGER--------ETHAANTLLAAALVWLLGSILNSCQVYERADGRAQLLQSS  168

Query  572   IHIPFLIGSLLFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWV-RVGICGSTVLFVGGLA  396
             + +P L+GSLLFLVGA++N   +    P +      L+G +W   + + GS +  V  + 
Sbjct  169   VQVPMLLGSLLFLVGAVVNR--RRRPEPPV------LVGRSWAWTMCVLGSVLWLVAAVF  220

Query  395   NVVKVFNIQQMSGMMRLEKLRGGAHERLMHEREGGLPLIVDDAAEKQR  252
             N+ KVF + Q S   RLEKLRGGA ERL  +REG LPL  ++AA  +R
Sbjct  221   NMGKVFVMHQ-SDAPRLEKLRGGAQERLSRDREGRLPLNWEEAARSRR  267



>ref|XP_006655643.1| PREDICTED: uncharacterized protein LOC102701453 [Oryza brachyantha]
Length=237

 Score =   134 bits (336),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 102/277 (37%), Positives = 141/277 (51%), Gaps = 49/277 (18%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAELSREPKSGlvllliaf  903
             MVKLA+ARE R+YGP L+  R EY NAG YVF+ ++L                       
Sbjct  1     MVKLATAREARMYGPALAVRRWEYANAGAYVFAALLLAV---------------------  39

Query  902   aliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLFIQD  723
                                       YD QL LVE   P LH++GC+ + + +  L  Q 
Sbjct  40    ---------------------ALAALYDVQLGLVELLVPALHVVGCVLAVVAMALLLSQG  78

Query  722   EKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPFLIGSL  543
             E G +     E      L+A   +W+LGS+LNSCQ+YERA G  Q+LQ S+ +P L+GSL
Sbjct  79    E-GAWYRQGRETHAANTLLAAALVWLLGSVLNSCQVYERADGRAQLLQSSVQVPLLLGSL  137

Query  542   LFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVFNIQQM  363
             LFLV  + N         L +     L+G +W  + + GS +  V  + N++KV  + Q 
Sbjct  138   LFLVAGVAN-----RRRVLDWRREPVLVGRSWAWLCLFGSLLWLVAAVLNMLKVLVMHQ-  191

Query  362   SGMMRLEKLRGGAHERLMHEREGGLPLIVDDAAEKQR  252
             S  +RLEKLRGGA ERL  +REG +PL  ++AA  +R
Sbjct  192   SDAVRLEKLRGGAQERLSRDREGRVPLNWEEAARSRR  228



>ref|XP_002978101.1| hypothetical protein SELMODRAFT_271297 [Selaginella moellendorffii]
 gb|EFJ20758.1| hypothetical protein SELMODRAFT_271297 [Selaginella moellendorffii]
Length=300

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 106/291 (36%), Positives = 146/291 (50%), Gaps = 29/291 (10%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAELSREPKS--Glvllli  909
             MVKL S+R  R+Y PG      E +N  +YV   +++L G   +L     S  GL+L L 
Sbjct  1     MVKLVSSRTARLYAPGGYRELLEGINGFIYVLGAVLILAGLIFQLPSHENSKLGLILALT  60

Query  908   afaliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLFI  729
                LI +VN HDL AHLAG DF+L L   D Q  LVE A P++  LG    FL  L   +
Sbjct  61    GSILILLVNLHDLYAHLAGVDFKLELLKVDPQYILVEIAVPVVTALGSFLVFL-GLLFLL  119

Query  728   QDEKGNYGYY---ELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPF  558
                KG Y ++    L   GLR+LIAGP LW+L SI N  Q+YERA   +Q  ++ + + F
Sbjct  120   LTAKGRYSHHTRNSLAVHGLRMLIAGPALWLLASIHNIFQLYERASLGVQAYERGVTVCF  179

Query  557   LIGSLLFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVF  378
             +I S L L G ++ L       P    T    L        I G+ +L +GG+ N++++ 
Sbjct  180   VIASTLLLCGGVIGL-------PYWPKTVERRLQSNATWFAILGAALLVLGGIVNLMRIS  232

Query  377   NIQQMSGMMRLEK---------LRGGAHERLMHER-EGGLPLIVDDAAEKQ  255
              +Q      RLE+         LRGGA E L   R E G P +   A  ++
Sbjct  233   TLQ------RLEREGPGHGGEFLRGGAQESLNRMRGESGEPFLEGSAKHRE  277



>ref|XP_002966642.1| hypothetical protein SELMODRAFT_270578 [Selaginella moellendorffii]
 gb|EFJ32669.1| hypothetical protein SELMODRAFT_270578 [Selaginella moellendorffii]
Length=300

 Score =   127 bits (320),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 106/291 (36%), Positives = 146/291 (50%), Gaps = 29/291 (10%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAELSREPKS--Glvllli  909
             MVKL S+R  R+Y PG      E +N  +YV   +++L G   +L     S  GL+L L 
Sbjct  1     MVKLVSSRTARLYAPGGYRELLEGINGFIYVLGAVLILAGLIFQLPSHENSKLGLILALT  60

Query  908   afaliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLFI  729
                LI +VN HDL AHLAG DF+L L   D Q  LVE A P++  LG    FL  L   +
Sbjct  61    GSILIFLVNLHDLYAHLAGVDFKLELLKVDPQYILVEIAVPVVTALGSFLVFL-GLLFLL  119

Query  728   QDEKGNYGYY---ELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSIHIPF  558
                KG Y ++    L   GLR+LIAGP LW+L SI N  Q+YERA   +Q  ++ + + F
Sbjct  120   LTAKGRYSHHTRNTLAVHGLRMLIAGPALWLLASIHNIFQLYERASLGVQAYERGVTVCF  179

Query  557   LIGSLLFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVF  378
             +I S L L G ++ L       P    T    L        I G+ +L +GG+ N++++ 
Sbjct  180   VIASTLLLCGGVIGL-------PYWPKTVERRLQSNATWFAILGAALLVLGGIVNLMRIS  232

Query  377   NIQQMSGMMRLEK---------LRGGAHERLMHER-EGGLPLIVDDAAEKQ  255
              +Q      RLE+         LRGGA E L   R E G P +   A  ++
Sbjct  233   TLQ------RLEREGPGHGGEFLRGGAQESLNRMRGESGEPFLEGSAKHRE  277



>ref|XP_003567806.1| PREDICTED: uncharacterized protein LOC100820898 [Brachypodium 
distachyon]
Length=277

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 118/297 (40%), Positives = 155/297 (52%), Gaps = 34/297 (11%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAELSREP-----KSGlvl  918
             MVKLA+ARE R YGP L+  R EY+NA  Y F+T++L    +A  +        ++G+  
Sbjct  1     MVKLATAREARRYGPPLAVRRWEYINAAAYAFATLLLFAALSAAAASSSSLTGFRAGMAA  60

Query  917   lliafaliavVNFHDLLAHLAGFDFRLSLFGY---DTQLALVEFAAPLLHILGC-LCSFL  750
               +A A++A VN HDL AH+AG      +F     D QLALVE  AP LH  GC L    
Sbjct  61    AGVALAVVAAVNLHDLGAHVAGLGGVRRVFALARLDPQLALVELLAPALHSAGCALAIAA  120

Query  749   GILFLFIQDEKGNYGYYELENQGLRLLIAGPTLWVLGSILNSCQIYERAGGHMQILQQSI  570
             G+L L   D  G+     L   G    +        GS+LN+CQ+YERA G  Q+LQ ++
Sbjct  121   GVLAL--NDNNGDAAAAGLLVGGGGAWV-------AGSVLNACQVYERADGRAQLLQSAV  171

Query  569   HIPFLIGSLLFLVGAILNLTGKHHHSPLIYHTFRSLLGGTWVRV---GICGSTVLFVGGL  399
              +P L+GSLLFLV A+       +  PL+          T   V   G+CGS +  V  +
Sbjct  172   QVPLLLGSLLFLVSAV-----AANAMPLLLLPGPEGEKKTMTVVMTCGLCGSALWVVAAV  226

Query  398   ANVVKVFNIQQMSGMMRLEKLRGGAHERLMHEREGGLPLIVDDAAEKQRWRIRPPHE  228
              N VKV    Q S   RLE+LRGGA ERL  ER+GG P ++        WR  PP E
Sbjct  227   FNAVKVVAAHQ-SDAPRLERLRGGAEERLAWERDGGPPPLLG-------WRSPPPAE  275



>ref|XP_006847359.1| hypothetical protein AMTR_s00015p00258100 [Amborella trichopoda]
 gb|ERN08940.1| hypothetical protein AMTR_s00015p00258100 [Amborella trichopoda]
Length=130

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 89/120 (74%), Gaps = 1/120 (1%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAE-LSREPKSGlvlllia  906
             MVKLASARE R+YGP  S +R EY+NAGLY+F +I+LL G   E  S   +S LV+LLI+
Sbjct  1     MVKLASARENRLYGPPPSHNRWEYINAGLYIFCSILLLIGCLLELFSGVSRSALVILLIS  60

Query  905   faliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLFIQ  726
               L+A +N HDL AHLAG DFRLSL G D Q+ALVE  APL+ +LG + +FLG+LFL IQ
Sbjct  61    AVLMAAINMHDLFAHLAGIDFRLSLIGGDKQIALVEIGAPLIQMLGSILTFLGLLFLVIQ  120



>gb|EMS68377.1| hypothetical protein TRIUR3_07236 [Triticum urartu]
Length=245

 Score = 97.1 bits (240),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 78/129 (60%), Gaps = 9/129 (7%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGS------RSEYMNAGLYVFSTIVLLCGFAAEL---SREPKS  930
             MVKLA+AR+CR Y  G +G       R EY+NAG+YVF+ ++L+ GF A+L   +   K+
Sbjct  1     MVKLATARDCRAYSLGATGGETSRNRRWEYINAGVYVFAAVLLVAGFLAQLWPWAVSTKA  60

Query  929   GlvllliafaliavVNFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFL  750
             GL + ++    +   N HDLLAH+AG D+ L L G DTQ  LVE AAP + + G   + +
Sbjct  61    GLAVAVVGLLGVLGANAHDLLAHVAGVDYNLGLAGLDTQFVLVELAAPAVQLAGAALTLV  120

Query  749   GILFLFIQD  723
              ++   IQ 
Sbjct  121   ALILFEIQS  129



>ref|XP_006376626.1| hypothetical protein POPTR_0012s01490g [Populus trichocarpa]
 gb|ERP54423.1| hypothetical protein POPTR_0012s01490g [Populus trichocarpa]
Length=125

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 83/137 (61%), Gaps = 18/137 (13%)
 Frame = -1

Query  560  FLIGSLLFLVGAILNL---TGKHHHSPLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANV  390
            F+  S LFLVG+ILN+    G  HH          LLG TWV +G  GS + F+GGL NV
Sbjct  3    FIQASSLFLVGSILNIREQAGWGHHG-------LELLGKTWVWIGFFGSLMFFIGGLTNV  55

Query  389  VKVFNIQQMSGMMRLEKLRGGAHERLMHEREGGLPLIVDDAAEKQRWRIRPPHEEWQpap  210
            VKVF +QQ+ G +RLEKL+GGA ERL+ ERE   PL++  A E++  RI       +   
Sbjct  56   VKVFEMQQIDG-LRLEKLQGGAQERLVRERECQAPLVL--AEERRGERIAE-----ETRA  107

Query  209  aapvsaptPYKDVLVGN  159
            A  +  PTPYKDVLVG 
Sbjct  108  ALLIPVPTPYKDVLVGQ  124



>ref|NP_001142548.1| uncharacterized protein LOC100274799 [Zea mays]
 gb|ACG24974.1| hypothetical protein [Zea mays]
 gb|ACG26942.1| hypothetical protein [Zea mays]
Length=144

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 77/131 (59%), Gaps = 13/131 (10%)
 Frame = -1

Query  1082  MVKLASARECRVY--------GPGLSGSRSEYMNAGLYVFSTIVLLCGFAAEL---SREP  936
             MVKLA+ARECR Y        G GL  +R EY+NAG+Y+F+ ++L+ GF A+L       
Sbjct  1     MVKLATARECRAYSLGAGAGSGTGLR-NRWEYINAGVYIFAAVLLVGGFLAQLLPWGGPS  59

Query  935   KSGlvllliafaliavVNFHDLLAHLAGFDFRLSL-FGYDTQLALVEFAAPLLHILGCLC  759
               GLV+  I  A +  VN HDLLAH AG D+RL +  G D Q+ LVE   P + I+G   
Sbjct  60    SPGLVVAAIGLAGLLAVNTHDLLAHAAGVDYRLGMVVGLDAQMGLVELGVPAVQIVGTAL  119

Query  758   SFLGILFLFIQ  726
               + ++F  IQ
Sbjct  120   MLVAVVFFVIQ  130



>gb|EMT01834.1| hypothetical protein F775_20590 [Aegilops tauschii]
Length=145

 Score = 82.0 bits (201),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 77/125 (62%), Gaps = 6/125 (5%)
 Frame = -1

Query  1082  MVKLASARECRVYGPGLSGSRSEYMNAGLYVFSTIVLLCGFAAELSREPKSGlvllliaf  903
             MVKLA+ARE R+YG  L+  R EY+NAG Y+F T++L  G AA  + E   G     +A 
Sbjct  1     MVKLATAREARLYGQALAVRRWEYINAGAYMFGTLLLAAGLAALCASEGGVGATDAGLAV  60

Query  902   aliavV-----NFHDLLAHLAGFDFRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGI-L  741
             A +A+      N HDL AHLAG D R+ L  +D QL +VEF AP LH  GC+ + +G+ L
Sbjct  61    AGVALAVVAAVNAHDLGAHLAGVDCRVGLARFDPQLGIVEFLAPALHAAGCVLAIVGLAL  120

Query  740   FLFIQ  726
              LF Q
Sbjct  121   QLFSQ  125



>ref|XP_006847361.1| hypothetical protein AMTR_s00015p00258140 [Amborella trichopoda]
 gb|ERN08942.1| hypothetical protein AMTR_s00015p00258140 [Amborella trichopoda]
Length=120

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 59/99 (60%), Gaps = 7/99 (7%)
 Frame = -1

Query  449  WVRVGICGSTVLFVGGLANVVKVFNIQQ-MSGMMRLEKLRGGAHERLMHEREGGLPLIVD  273
            W   G  GS +   GG+ANV+KVF +Q  M  + RLEKLRGGA ERL  EREG LPL++D
Sbjct  21   WGLFGAVGSFLFLFGGMANVLKVFKMQGVMMDVGRLEKLRGGAQERLYREREGRLPLLLD  80

Query  272  DAAEKQRWRIRPPH--EEWQpapaapvsaptPYKDVLVG  162
            +    QR R    H  +   PA  +     TPYKDVLVG
Sbjct  81   E----QRRRTIQHHLPDSSLPATTSSAPTSTPYKDVLVG  115



>ref|WP_026300548.1| hypothetical protein [Halomonas lutea]
Length=237

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 61/234 (26%), Positives = 94/234 (40%), Gaps = 25/234 (11%)
 Frame = -1

Query  1016  EYMNAGLYVFSTIVLLCG---FAAELSREPKSGlvllliafaliavVNFHDLLAHLAGFD  846
             E +NA  YV      + G   F   L +   +G  L +    +   V  HDL   +  + 
Sbjct  24    EGLNASAYVVGAATFVVGSVFFLPALEKYSTAGAGLFIAGSLIYLAVTAHDLTETINHYR  83

Query  845   FRLSLFGYDTQLALVEFAAPLLHILGCLCSFLGILFLFIQDEKGNYGYYELENQGLRLLI  666
                S  G  T L   EF     +++ CL   +G +F   +           E  G    I
Sbjct  84    HHAS-HGKKTAL---EFITSTGYVIACLLFLVGSIFFLPRLGA--------ERWGAWCFI  131

Query  665   AGPTLWVLGSILNSCQIYERAGGHMQILQ--QSIHIPFLIGSLLFLVGAILNLTGKHHHS  492
              G  L+  G+ILN  QI +   G +  LQ   ++ + F+IGS+LFLV +I  L   H   
Sbjct  132   VGSALFTGGAILNVTQITQ--AGSLITLQLLNAVAVSFVIGSILFLVASIPYLWATHQAQ  189

Query  491   PLIYHTFRSLLGGTWVRVGICGSTVLFVGGLANVVKVFNIQQMSGMMRLEKLRG  330
               + H   + L   +    I  S +  +GGLAN  + +   Q       ++ RG
Sbjct  190   --LAHALYTYLASQF----IFASVLFLLGGLANFYRAYRTHQDHKQKSPDRSRG  237



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2869075245226