BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c1784_g1_i1 len=1023 path=[1:0-1022]

Length=1023
                                                                      Score     E

ref|XP_009631208.1|  PREDICTED: myb-like protein J                      174   9e-48   
ref|XP_009780709.1|  PREDICTED: myb-like protein H isoform X1           167   3e-45   
ref|XP_009780711.1|  PREDICTED: transcription factor MYB1R1-like ...    165   3e-45   
ref|XP_010262182.1|  PREDICTED: transcription factor MYB1R1-like        167   6e-45   
ref|XP_010090029.1|  Transcription factor                               164   5e-44   
ref|XP_010267000.1|  PREDICTED: transcription factor MYB1R1-like ...    164   9e-44   
ref|XP_009760073.1|  PREDICTED: transcription factor MYB1R1-like        161   3e-43   
ref|XP_007012873.1|  Myb-like transcription factor family protein...    159   2e-42   
ref|XP_010915342.1|  PREDICTED: transcription factor MYB1R1-like ...    159   2e-42   
ref|XP_010915341.1|  PREDICTED: transcription factor MYB1R1-like ...    159   2e-42   
ref|XP_009352631.1|  PREDICTED: myb-like protein J                      159   5e-42   
ref|XP_007202213.1|  hypothetical protein PRUPE_ppa008425mg             159   5e-42   
ref|XP_008242415.1|  PREDICTED: uncharacterized protein LOC103340749    159   7e-42   
gb|KHG05222.1|  Transcription factor MYB1R1                             154   2e-41   
emb|CDP08249.1|  unnamed protein product                                157   3e-41   
ref|XP_010049555.1|  PREDICTED: transcription factor MYB1R1-like        157   3e-41   
ref|XP_008798617.1|  PREDICTED: transcription factor MYB1R1-like        156   3e-41   
ref|XP_008337686.1|  PREDICTED: myb-like protein J                      157   4e-41   
ref|XP_010266999.1|  PREDICTED: transcription factor MYB1R1-like ...    156   6e-41   
gb|KCW82238.1|  hypothetical protein EUGRSUZ_C03658                     157   7e-41   
gb|EYU27307.1|  hypothetical protein MIMGU_mgv1a011837mg                155   7e-41   
emb|CDP03183.1|  unnamed protein product                                156   8e-41   
ref|XP_007012263.1|  Myb transcription factor family protein, put...    154   1e-40   
ref|XP_006353528.1|  PREDICTED: transcription factor MYB1R1-like        154   2e-40   
gb|ABU68406.1|  putative MYB transcription factor                       153   3e-40   Avicennia marina
ref|XP_010097075.1|  Transcription factor                               153   7e-40   
ref|XP_009400577.1|  PREDICTED: transcription factor MYB1R1-like        152   8e-40   
ref|XP_009590196.1|  PREDICTED: myb-like protein J                      152   9e-40   
ref|XP_010918640.1|  PREDICTED: transcription factor MYB1R1-like        152   1e-39   
ref|XP_002277676.1|  PREDICTED: transcription factor MYB1R1             150   1e-39   Vitis vinifera
gb|KDO80052.1|  hypothetical protein CISIN_1g038601mg                   149   2e-39   
ref|NP_001235940.1|  MYB transcription factor MYB127                    150   3e-39   
ref|XP_011093715.1|  PREDICTED: transcription factor MYB1R1-like        150   3e-39   
ref|XP_009780710.1|  PREDICTED: myb-like protein J isoform X2           149   4e-39   
ref|XP_004287537.1|  PREDICTED: uncharacterized protein LOC101290800    152   6e-39   
ref|XP_011019483.1|  PREDICTED: transcription factor MYB1R1-like        149   6e-39   
ref|XP_008387730.1|  PREDICTED: myb-like protein J                      151   7e-39   
ref|XP_006361001.1|  PREDICTED: transcription factor MYB1R1-like        146   1e-38   
ref|XP_007160238.1|  hypothetical protein PHAVU_002G304400g             147   2e-38   
ref|XP_002514146.1|  conserved hypothetical protein                     149   2e-38   Ricinus communis
gb|ABK26274.1|  unknown                                                 150   2e-38   Picea sitchensis
ref|XP_006450815.1|  hypothetical protein CICLE_v10009011mg             149   2e-38   
gb|EAY96856.1|  hypothetical protein OsI_18777                          149   3e-38   Oryza sativa Indica Group [Indian rice]
ref|XP_006475946.1|  PREDICTED: transcription factor DIVARICATA-l...    149   3e-38   
ref|XP_004135816.1|  PREDICTED: uncharacterized protein LOC101217799    148   3e-38   
ref|XP_004158442.1|  PREDICTED: uncharacterized protein LOC101231239    148   4e-38   
ref|XP_004960912.1|  PREDICTED: transcription factor MYB1R1-like        149   4e-38   
emb|CAN66264.1|  hypothetical protein VITISV_041371                     148   4e-38   Vitis vinifera
ref|XP_002282498.1|  PREDICTED: uncharacterized protein LOC100247499    148   4e-38   Vitis vinifera
ref|XP_003525309.1|  PREDICTED: transcription factor MYB1R1             147   4e-38   
ref|XP_004245108.1|  PREDICTED: transcription factor MYB1R1-like        147   4e-38   
ref|NP_001054863.1|  Os05g0195700                                       148   4e-38   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006654137.1|  PREDICTED: transcription factor MYB1R1-like        148   5e-38   
ref|XP_007218820.1|  hypothetical protein PRUPE_ppa010092mg             147   5e-38   
ref|XP_008795522.1|  PREDICTED: transcription factor MYB1R1-like        148   6e-38   
gb|AFV78981.1|  myb-related protein                                     149   6e-38   
gb|AFV79075.1|  myb-related protein                                     149   6e-38   
gb|AFV78978.1|  myb-related protein                                     149   6e-38   
gb|AFV78976.1|  myb-related protein                                     149   6e-38   
gb|AFV78996.1|  myb-related protein                                     149   6e-38   
ref|XP_006475945.1|  PREDICTED: transcription factor DIVARICATA-l...    148   6e-38   
gb|AFV79045.1|  myb-related protein                                     149   6e-38   
gb|AFV79000.1|  myb-related protein                                     149   6e-38   
gb|AFV78994.1|  myb-related protein                                     149   6e-38   
gb|AFV79077.1|  myb-related protein                                     149   7e-38   
gb|AFV78990.1|  myb-related protein                                     149   7e-38   
gb|AFV78975.1|  myb-related protein                                     149   7e-38   
gb|AFV78977.1|  myb-related protein                                     149   7e-38   
gb|AFK46715.1|  unknown                                                 147   8e-38   
gb|AFV79024.1|  myb-related protein                                     148   1e-37   
gb|AFV78992.1|  myb-related protein                                     148   1e-37   
ref|XP_010924479.1|  PREDICTED: transcription factor MYB1R1-like        146   1e-37   
ref|XP_002516455.1|  conserved hypothetical protein                     146   2e-37   Ricinus communis
gb|AEV91163.1|  MYB-related protein                                     146   2e-37   
gb|AFV79042.1|  myb-related protein                                     147   2e-37   
ref|XP_002989801.1|  hypothetical protein SELMODRAFT_130556             142   2e-37   
gb|AFV79053.1|  myb-related protein                                     147   3e-37   
gb|AFV79026.1|  myb-related protein                                     147   3e-37   
ref|XP_002990122.1|  hypothetical protein SELMODRAFT_131017             142   3e-37   
gb|AFV79550.1|  myb-related protein                                     147   3e-37   
gb|AFK37271.1|  unknown                                                 144   4e-37   
gb|ABR18214.1|  unknown                                                 145   8e-37   Picea sitchensis
ref|XP_004143039.1|  PREDICTED: uncharacterized protein LOC101204468    145   9e-37   
ref|XP_001766974.1|  predicted protein                                  141   1e-36   
ref|XP_004513098.1|  PREDICTED: uncharacterized protein LOC101505306    144   1e-36   
ref|XP_008234449.1|  PREDICTED: transcription factor MYB1R1 isofo...    145   1e-36   
ref|XP_008234450.1|  PREDICTED: myb-like protein J isoform X2           145   2e-36   
gb|ABK24521.1|  unknown                                                 146   2e-36   Picea sitchensis
ref|XP_003620926.1|  hypothetical protein MTR_6g092540                  144   2e-36   
gb|AFK44275.1|  unknown                                                 143   3e-36   
gb|AFK47856.1|  unknown                                                 143   3e-36   
ref|XP_001766973.1|  predicted protein                                  139   4e-36   
ref|XP_004251664.1|  PREDICTED: transcription factor MYB1R1             140   5e-36   
ref|XP_010443340.1|  PREDICTED: transcription factor DIVARICATA-like    140   8e-36   
ref|XP_010451524.1|  PREDICTED: uncharacterized protein LOC104733656    140   9e-36   
ref|XP_006401279.1|  hypothetical protein EUTSA_v10014394mg             141   9e-36   
ref|XP_010483171.1|  PREDICTED: uncharacterized protein LOC104761750    140   1e-35   
ref|XP_011077962.1|  PREDICTED: transcription factor MYB1R1             141   1e-35   
ref|NP_001043505.1|  Os01g0603300                                       142   1e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003569313.1|  PREDICTED: uncharacterized protein LOC100839820    141   1e-35   
gb|KCW81661.1|  hypothetical protein EUGRSUZ_C03026                     140   2e-35   
gb|KDP33815.1|  hypothetical protein JCGZ_07386                         141   2e-35   
ref|XP_002864483.1|  DNA-binding family protein                         139   2e-35   
ref|XP_008375712.1|  PREDICTED: transcription factor MYB1R1-like        142   2e-35   
ref|XP_006451435.1|  hypothetical protein CICLE_v10009128mg             140   2e-35   
ref|XP_004309020.1|  PREDICTED: uncharacterized protein LOC101301055    142   3e-35   
ref|XP_009362715.1|  PREDICTED: myb-like protein J                      142   3e-35   
ref|XP_002511019.1|  conserved hypothetical protein                     141   4e-35   Ricinus communis
ref|XP_010545871.1|  PREDICTED: transcription factor MYB1R1             139   4e-35   
gb|KFK27243.1|  hypothetical protein AALP_AA8G356500                    138   4e-35   
gb|KDP22474.1|  hypothetical protein JCGZ_26305                         141   6e-35   
ref|XP_008799749.1|  PREDICTED: transcription factor MYB1R1-like        138   1e-34   
gb|EMS53342.1|  Transcription factor MYB1R1                             134   1e-34   
ref|XP_009120194.1|  PREDICTED: protein REVEILLE 5-like                 137   2e-34   
ref|XP_004969089.1|  PREDICTED: transcription factor MYB1R1-like        139   2e-34   
ref|XP_003630638.1|  hypothetical protein MTR_8g101650                  138   2e-34   
ref|XP_001764790.1|  predicted protein                                  139   2e-34   
gb|AFK39858.1|  unknown                                                 138   2e-34   
gb|EYU30648.1|  hypothetical protein MIMGU_mgv1a019786mg                136   2e-34   
ref|XP_004489944.1|  PREDICTED: transcription factor MYB1R1-like        137   3e-34   
gb|EAY74856.1|  hypothetical protein OsI_02748                          138   3e-34   Oryza sativa Indica Group [Indian rice]
ref|XP_007224164.1|  hypothetical protein PRUPE_ppa016461mg             136   3e-34   
ref|XP_006280948.1|  hypothetical protein CARUB_v10026949mg             137   3e-34   
ref|XP_002440757.1|  hypothetical protein SORBIDRAFT_09g006060          137   5e-34   Sorghum bicolor [broomcorn]
ref|XP_006345334.1|  PREDICTED: myb-like protein J-like                 136   5e-34   
emb|CDY65437.1|  BnaCnng47140D                                          135   5e-34   
ref|XP_002991458.1|  hypothetical protein SELMODRAFT_133546             134   5e-34   
ref|XP_010049179.1|  PREDICTED: transcription factor MYB1R1-like        135   5e-34   
ref|XP_006643865.1|  PREDICTED: transcription factor MYB1R1-like        137   6e-34   
ref|XP_009370418.1|  PREDICTED: myb-like protein J                      138   7e-34   
ref|NP_200495.1|  myb-like transcription factor family protein          135   7e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011010641.1|  PREDICTED: uncharacterized protein LOC105115454    137   7e-34   
gb|AFU81575.1|  MYB-related transcription factor                        136   9e-34   
ref|XP_010662238.1|  PREDICTED: transcription factor MYB1R1-like ...    137   1e-33   
ref|XP_002278155.2|  PREDICTED: transcription factor MYB1R1-like ...    137   1e-33   Vitis vinifera
gb|AFK48132.1|  unknown                                                 136   1e-33   
ref|XP_010441468.1|  PREDICTED: uncharacterized protein LOC104724629    138   1e-33   
ref|NP_001042277.1|  Os01g0192300                                       137   1e-33   Oryza sativa Japonica Group [Japonica rice]
gb|EAY72864.1|  hypothetical protein OsI_00735                          136   1e-33   Oryza sativa Indica Group [Indian rice]
ref|XP_008655699.1|  PREDICTED: transcription factor MYB1R1-like        137   1e-33   
ref|XP_010481334.1|  PREDICTED: pinin-like                              138   1e-33   
ref|XP_007152917.1|  hypothetical protein PHAVU_004G171200g             135   1e-33   
gb|ABR16522.1|  unknown                                                 137   1e-33   Picea sitchensis
emb|CDY11901.1|  BnaC03g13270D                                          134   2e-33   
ref|XP_010052392.1|  PREDICTED: protein REVEILLE 5-like                 136   2e-33   
ref|XP_002308294.2|  hypothetical protein POPTR_0006s15480g             137   2e-33   Populus trichocarpa [western balsam poplar]
ref|XP_004242968.1|  PREDICTED: myb-like protein J                      134   2e-33   
ref|NP_001235955.1|  MYB transcription factor MYB128                    132   2e-33   
gb|ACJ85142.1|  unknown                                                 132   2e-33   Medicago truncatula
ref|XP_009132174.1|  PREDICTED: uncharacterized protein LOC103856794    134   2e-33   
ref|XP_002455021.1|  hypothetical protein SORBIDRAFT_03g003100          136   2e-33   Sorghum bicolor [broomcorn]
ref|XP_004503538.1|  PREDICTED: uncharacterized protein LOC101500241    135   3e-33   
ref|XP_009416462.1|  PREDICTED: uncharacterized protein LOC103997055    134   3e-33   
ref|XP_002455906.1|  hypothetical protein SORBIDRAFT_03g027120          135   3e-33   Sorghum bicolor [broomcorn]
ref|XP_001764190.1|  predicted protein                                  140   3e-33   
ref|XP_008450842.1|  PREDICTED: transcription factor MYB1R1-like ...    134   4e-33   
ref|XP_009593865.1|  PREDICTED: myb-like protein J                      135   4e-33   
ref|XP_004297686.1|  PREDICTED: transcription factor MYB1R1-like        135   4e-33   
gb|KFK31380.1|  hypothetical protein AALP_AA6G104600                    136   4e-33   
gb|ACI12883.1|  R1MYB1 protein                                          135   4e-33   Saccharum hybrid cultivar Q117
gb|KDP39902.1|  hypothetical protein JCGZ_03433                         135   4e-33   
gb|AGT16142.1|  MCB2 protein                                            135   5e-33   
gb|ABR28340.1|  MYB transcription factor MYB52                          136   5e-33   
gb|AHB59602.1|  putative MYB-related protein 16                         135   5e-33   
ref|XP_011081287.1|  PREDICTED: uncharacterized protein LOC105164353    135   5e-33   
ref|XP_003597679.1|  hypothetical protein MTR_2g100930                  136   5e-33   
emb|CDX88591.1|  BnaA03g10580D                                          133   6e-33   
ref|XP_008791498.1|  PREDICTED: uncharacterized protein LOC103708379    135   8e-33   
ref|XP_004983650.1|  PREDICTED: transcription factor MYB1R1-like        134   1e-32   
gb|ACJ85445.1|  unknown                                                 131   1e-32   Medicago truncatula
ref|XP_008450841.1|  PREDICTED: putative uncharacterized protein ...    135   1e-32   
ref|XP_003613473.1|  DIV1B protein                                      134   1e-32   
ref|XP_003545373.1|  PREDICTED: transcription factor MYB1R1-like        133   1e-32   
ref|XP_006398430.1|  hypothetical protein EUTSA_v10000932mg             135   1e-32   
dbj|BAJ34014.1|  unnamed protein product                                135   1e-32   
ref|XP_002865122.1|  myb family transcription factor                    135   2e-32   
ref|NP_199550.1|  myb-like transcription factor family protein          134   2e-32   Arabidopsis thaliana [mouse-ear cress]
gb|KHG18328.1|  Transcription factor MYB1R1                             134   2e-32   
gb|AHB59608.1|  putative MYB-related protein 22                         134   2e-32   
ref|XP_006279493.1|  hypothetical protein CARUB_v10026634mg             134   2e-32   
ref|XP_002520190.1|  transcription factor, putative                     134   2e-32   Ricinus communis
ref|NP_001169313.1|  putative MYB DNA-binding domain superfamily ...    133   2e-32   Zea mays [maize]
gb|EYU19295.1|  hypothetical protein MIMGU_mgv1a005826mg                135   2e-32   
ref|XP_007038262.1|  Myb-like transcription factor family protein...    133   2e-32   
ref|XP_004508939.1|  PREDICTED: transcription factor MYB1R1-like        134   2e-32   
ref|XP_010109133.1|  Transcription factor                               134   3e-32   
emb|CAN76720.1|  hypothetical protein VITISV_005733                     130   3e-32   Vitis vinifera
ref|NP_001275007.1|  MYBST1 protein                                     134   3e-32   
dbj|BAJ99046.1|  predicted protein                                      132   3e-32   
gb|EMT19857.1|  Myb-like protein J                                      130   3e-32   
gb|KGN53172.1|  hypothetical protein Csa_4G025050                       134   4e-32   
ref|XP_006438523.1|  hypothetical protein CICLE_v10032167mg             132   4e-32   
ref|XP_008444473.1|  PREDICTED: transcription factor MYB1R1-like ...    129   5e-32   
ref|XP_006414230.1|  hypothetical protein EUTSA_v10025432mg             134   5e-32   
ref|XP_007038261.1|  Myb-like transcription factor family protein...    133   5e-32   
ref|XP_003517881.1|  PREDICTED: transcription factor MYB1R1             132   5e-32   
ref|XP_010053506.1|  PREDICTED: uncharacterized protein LOC104441938    132   6e-32   
gb|AGT21470.1|  myb-like transcription factor family protein            132   6e-32   
ref|XP_002464930.1|  hypothetical protein SORBIDRAFT_01g029020          132   6e-32   Sorghum bicolor [broomcorn]
gb|KDO82666.1|  hypothetical protein CISIN_1g021351mg                   132   6e-32   
emb|CAJ53899.1|  transcription factor MybS3                             132   7e-32   Hordeum vulgare [barley]
ref|XP_011031922.1|  PREDICTED: myb-like protein J isoform X1           132   7e-32   
ref|XP_011031924.1|  PREDICTED: myb-like protein J isoform X3           132   7e-32   
ref|XP_006438522.1|  hypothetical protein CICLE_v10032167mg             132   7e-32   
ref|XP_006483741.1|  PREDICTED: transcription factor MYB1R1-like ...    132   7e-32   
ref|XP_006483742.1|  PREDICTED: transcription factor MYB1R1-like ...    132   7e-32   
ref|XP_008794113.1|  PREDICTED: transcription factor MYB1R1-like        132   7e-32   
ref|XP_009783629.1|  PREDICTED: transcription factor MYB1R1 isofo...    132   7e-32   
gb|KDO82664.1|  hypothetical protein CISIN_1g021351mg                   132   7e-32   
ref|XP_006438524.1|  hypothetical protein CICLE_v10032167mg             132   8e-32   
ref|XP_003564752.1|  PREDICTED: transcription factor MYB1R1-like        131   8e-32   
emb|CAN71598.1|  hypothetical protein VITISV_010937                     132   8e-32   Vitis vinifera
ref|NP_001237761.1|  MYB transcription factor MYB138                    131   9e-32   
gb|EMT00513.1|  Myb-like protein J                                      131   9e-32   
emb|CDY23049.1|  BnaC07g31380D                                          132   9e-32   
ref|XP_008376361.1|  PREDICTED: myb-like protein J isoform X1           132   9e-32   
ref|XP_009626132.1|  PREDICTED: transcription factor MYB1R1 isofo...    132   9e-32   
ref|XP_010925548.1|  PREDICTED: transcription factor MYB1R1-like        132   9e-32   
gb|ABD65013.1|  myb family transcription factor                         132   9e-32   Brassica oleracea
ref|XP_009128962.1|  PREDICTED: uncharacterized protein LOC103853804    132   9e-32   
emb|CDY28938.1|  BnaA02g25380D                                          132   1e-31   
emb|CCA29105.1|  putative MYB transcription factor                      132   1e-31   
emb|CDM81667.1|  unnamed protein product                                131   1e-31   
ref|XP_008376363.1|  PREDICTED: myb-like protein J isoform X2           132   1e-31   
gb|KDO57294.1|  hypothetical protein CISIN_1g048263mg                   129   1e-31   
ref|XP_009783628.1|  PREDICTED: transcription factor MYB1R1 isofo...    132   1e-31   
gb|KDO82665.1|  hypothetical protein CISIN_1g021351mg                   131   1e-31   
ref|XP_010529976.1|  PREDICTED: protein REVEILLE 8-like                 132   1e-31   
ref|XP_010443985.1|  PREDICTED: uncharacterized protein LOC104726752    131   1e-31   
emb|CDY51681.1|  BnaC02g46900D                                          132   1e-31   
ref|XP_009626131.1|  PREDICTED: transcription factor MYB1R1 isofo...    131   1e-31   
gb|AHB59603.1|  putative MYB-related protein 17                         128   1e-31   
ref|NP_001266509.1|  ZmMybst1                                           131   2e-31   
gb|AIB05106.1|  MYB-related transcription factor                        131   2e-31   
gb|ACF85648.1|  unknown                                                 131   2e-31   Zea mays [maize]
emb|CDY30163.1|  BnaC05g36990D                                          132   2e-31   
ref|XP_001775256.1|  predicted protein                                  131   2e-31   
ref|XP_010941064.1|  PREDICTED: uncharacterized protein LOC105059...    130   2e-31   
ref|NP_001238622.1|  MYB transcription factor MYB180                    130   2e-31   
ref|XP_002274350.1|  PREDICTED: transcription factor MYB1R1             131   2e-31   Vitis vinifera
ref|XP_010518718.1|  PREDICTED: uncharacterized protein LOC104798365    131   2e-31   
ref|XP_006477144.1|  PREDICTED: transcription factor MYB1R1-like        131   2e-31   
ref|XP_010941063.1|  PREDICTED: uncharacterized protein LOC105059...    130   2e-31   
ref|XP_004245787.1|  PREDICTED: transcription factor MYB1R1             131   2e-31   
ref|XP_011002026.1|  PREDICTED: myb-like protein G                      131   2e-31   
emb|CDP09999.1|  unnamed protein product                                131   2e-31   
emb|CDM83166.1|  unnamed protein product                                129   2e-31   
ref|XP_010677080.1|  PREDICTED: transcription factor MYB1R1             131   2e-31   
dbj|BAK01725.1|  predicted protein                                      129   2e-31   
ref|XP_009609815.1|  PREDICTED: transcription factor MYB1R1-like ...    130   2e-31   
gb|KDO61361.1|  hypothetical protein CISIN_1g019948mg                   130   3e-31   
dbj|BAD52653.1|  putative MCB2 protein                                  129   3e-31   Oryza sativa Japonica Group [Japonica rice]
gb|AAK31280.1|AC079890_16  putative Myb-related protein                 130   3e-31   Oryza sativa [red rice]
ref|XP_006421517.1|  hypothetical protein CICLE_v10006771mg             129   3e-31   
ref|XP_006600251.1|  PREDICTED: MYB transcription factor MYB180 i...    130   3e-31   
ref|XP_006440261.1|  hypothetical protein CICLE_v10021067mg             130   3e-31   
gb|AHB59604.1|  putative MYB-related protein 18                         129   3e-31   
ref|XP_006490065.1|  PREDICTED: uncharacterized protein LOC102615658    130   3e-31   
ref|XP_007024302.1|  Myb-like transcription factor family protein       131   3e-31   
ref|XP_008448819.1|  PREDICTED: transcription factor MYB1R1             130   3e-31   
emb|CBI29498.3|  unnamed protein product                                130   3e-31   
emb|CAC24845.1|  MCB2 protein                                           129   4e-31   Hordeum vulgare [barley]
ref|XP_004170300.1|  PREDICTED: transcription factor MYB1R1-like        130   4e-31   
ref|XP_008444472.1|  PREDICTED: transcription factor MYB1R1-like ...    126   4e-31   
ref|XP_009609816.1|  PREDICTED: transcription factor MYB1R1-like ...    130   4e-31   
ref|XP_009130166.1|  PREDICTED: transcription factor MYB1R1-like        129   4e-31   
emb|CDY68479.1|  BnaCnng59200D                                          130   4e-31   
ref|XP_002304291.1|  syringolide-induced protein 1-3-1B                 130   4e-31   Populus trichocarpa [western balsam poplar]
gb|AGV54357.1|  MYB transcription factor                                130   5e-31   
emb|CDY70918.1|  BnaAnng35540D                                          130   5e-31   
gb|AGT16570.1|  transcription factor                                    128   5e-31   
dbj|BAG15871.1|  myb transcription factor                               130   5e-31   Bruguiera gymnorhiza [Burma mangrove]
ref|XP_006655650.1|  PREDICTED: uncharacterized protein LOC102703403    128   6e-31   
gb|AAN63154.1|  transcription factor MYBS3                              129   6e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002864744.1|  myb family transcription factor                    129   6e-31   
gb|KHG00790.1|  Transcription factor MYB1R1                             129   6e-31   
ref|XP_007155690.1|  hypothetical protein PHAVU_003G222900g             130   6e-31   
ref|XP_006394486.1|  hypothetical protein EUTSA_v10005259mg             129   6e-31   
ref|NP_001237520.1|  MYB transcription factor MYB93                     129   6e-31   
ref|XP_007044445.1|  Myb-like transcription factor family protein       129   7e-31   
ref|XP_008238436.1|  PREDICTED: transcription factor MYB1R1 isofo...    129   7e-31   
ref|XP_010934654.1|  PREDICTED: transcription factor MYB1R1-like        129   8e-31   
emb|CBI38571.3|  unnamed protein product                                125   8e-31   
ref|XP_010275370.1|  PREDICTED: transcription factor MYB1R1-like        129   8e-31   
ref|XP_008238435.1|  PREDICTED: transcription factor MYB1R1 isofo...    129   9e-31   
ref|XP_010258761.1|  PREDICTED: transcription factor MYB1R1-like ...    129   1e-30   
gb|KHN32913.1|  Transcription factor MYB1R1                             127   1e-30   
ref|XP_006572906.1|  PREDICTED: MYB transcription factor MYB128 i...    127   1e-30   
ref|XP_010495816.1|  PREDICTED: uncharacterized protein LOC104772962    128   1e-30   
ref|XP_010483843.1|  PREDICTED: uncharacterized protein LOC104762276    129   1e-30   
ref|XP_010258762.1|  PREDICTED: transcription factor MYB1R1-like ...    129   1e-30   
ref|XP_004299409.1|  PREDICTED: transcription factor MYB1R1-like        129   1e-30   
ref|XP_010047591.1|  PREDICTED: uncharacterized protein LOC104436...    128   1e-30   
ref|XP_008775190.1|  PREDICTED: transcription factor MYB1R1-like        128   2e-30   
gb|ABH02876.1|  MYB transcription factor MYB129                         127   2e-30   
emb|CDY58852.1|  BnaAnng15540D                                          129   2e-30   
ref|XP_003059136.1|  myb transcription factor                           129   2e-30   
emb|CDY18967.1|  BnaC01g21010D                                          129   2e-30   
ref|XP_010249506.1|  PREDICTED: uncharacterized protein LOC104592058    129   2e-30   
ref|XP_008363786.1|  PREDICTED: transcription factor MYB1R1-like        128   2e-30   
ref|XP_008444471.1|  PREDICTED: myb-like protein I isoform X1           127   2e-30   
ref|XP_006644342.1|  PREDICTED: putative uncharacterized protein ...    128   2e-30   
gb|AFK40445.1|  unknown                                                 126   2e-30   
gb|AAT38000.1|  putative MYB transcription factor                       128   2e-30   
ref|XP_008462421.1|  PREDICTED: uncharacterized protein LOC103500780    128   2e-30   
ref|XP_007209344.1|  hypothetical protein PRUPE_ppa008493mg             128   2e-30   
gb|AGT21472.1|  myb-like transcription factor family protein            128   2e-30   
ref|XP_009344186.1|  PREDICTED: transcription factor MYB1R1-like        128   2e-30   
ref|XP_009136499.1|  PREDICTED: transcription factor MYB1R1             128   2e-30   
emb|CDY42868.1|  BnaAnng06930D                                          127   2e-30   
gb|KFK40215.1|  hypothetical protein AALP_AA3G345600                    126   3e-30   
ref|XP_004141664.1|  PREDICTED: uncharacterized protein LOC101214316    128   3e-30   
gb|EEC79784.1|  hypothetical protein OsI_21199                          126   3e-30   
gb|ABD65094.1|  myb family transcription factor                         128   3e-30   
ref|XP_006426881.1|  hypothetical protein CICLE_v10025950mg             128   3e-30   
ref|XP_006282324.1|  hypothetical protein CARUB_v10028616mg             127   3e-30   
ref|XP_009144512.1|  PREDICTED: uncharacterized protein LOC103868158    128   3e-30   
gb|EEE64879.1|  hypothetical protein OsJ_19738                          126   3e-30   
ref|XP_011076440.1|  PREDICTED: myb-like protein J                      127   4e-30   
ref|NP_001056481.1|  Os05g0589400                                       126   4e-30   
ref|XP_010267150.1|  PREDICTED: uncharacterized protein LOC104604...    128   4e-30   
ref|XP_010267151.1|  PREDICTED: transcription factor MYB1R1 isofo...    127   4e-30   
ref|XP_010457560.1|  PREDICTED: uncharacterized protein LOC104739021    127   4e-30   
emb|CDO97977.1|  unnamed protein product                                128   4e-30   
ref|XP_004489945.1|  PREDICTED: transcription factor MYB1R1-like        127   4e-30   
ref|XP_004961036.1|  PREDICTED: uncharacterized protein LOC101771187    127   4e-30   
ref|XP_006465688.1|  PREDICTED: transcription factor MYB1R1-like        127   5e-30   
ref|XP_007222642.1|  hypothetical protein PRUPE_ppa008539mg             127   5e-30   
gb|ADL36775.1|  MYBR domain class transcription factor                  127   5e-30   
gb|KHG24899.1|  Transcription factor MYB1R1                             127   6e-30   
ref|XP_002500416.1|  myb family transcription factor                    127   6e-30   
ref|XP_010919736.1|  PREDICTED: protein REVEILLE 6-like                 127   6e-30   
ref|XP_010258818.1|  PREDICTED: transcription factor MYB1R1             127   6e-30   
ref|NP_001235649.1|  MYB transcription factor MYB52                     127   7e-30   
ref|XP_002982986.1|  hypothetical protein SELMODRAFT_445372             127   8e-30   
ref|XP_009413857.1|  PREDICTED: transcription factor MYB1R1-like ...    127   8e-30   
ref|XP_002965509.1|  hypothetical protein SELMODRAFT_439294             127   8e-30   
ref|XP_008453855.1|  PREDICTED: transcription factor MYB1R1 isofo...    127   8e-30   
ref|XP_006302702.1|  hypothetical protein CARUB_v10020813mg             125   9e-30   
ref|XP_008453854.1|  PREDICTED: transcription factor MYB1R1 isofo...    127   1e-29   
gb|ABD64943.1|  myb transcription factor, putative                      126   1e-29   
ref|XP_010652808.1|  PREDICTED: transcription factor MYB1R1             125   1e-29   
gb|ABK95405.1|  unknown                                                 125   1e-29   
gb|KFK22551.1|  hypothetical protein AALP_AAs68488U001300               125   1e-29   
ref|XP_008676506.1|  PREDICTED: putative MYB DNA-binding domain s...    125   1e-29   
ref|NP_001131609.1|  putative MYB DNA-binding domain superfamily ...    126   1e-29   
gb|ACG34036.1|  myb-like DNA-binding domain, SHAQKYF class family...    126   1e-29   
emb|CDY68924.1|  BnaCnng61080D                                          125   1e-29   
dbj|BAJ97852.1|  predicted protein                                      124   1e-29   
gb|KDP40862.1|  hypothetical protein JCGZ_24861                         127   1e-29   
gb|AEV91187.1|  MYB-related protein                                     126   1e-29   
gb|EMS49345.1|  Transcription factor MYB1R1                             126   2e-29   
dbj|BAK02871.1|  predicted protein                                      126   2e-29   
ref|XP_002312695.2|  hypothetical protein POPTR_0008s19610g             125   2e-29   
gb|AFW61246.1|  putative MYB DNA-binding domain superfamily protein     124   2e-29   
ref|XP_011043023.1|  PREDICTED: transcription factor MYB1R1-like        125   2e-29   
ref|XP_009778274.1|  PREDICTED: transcription factor MYB1R1-like        125   2e-29   
ref|XP_010512072.1|  PREDICTED: transcription factor MYB1R1-like        124   2e-29   
ref|XP_007157550.1|  hypothetical protein PHAVU_002G078600g             125   2e-29   
ref|XP_003608683.1|  MYB domain containing transcription factor         125   2e-29   
ref|NP_001168009.1|  uncharacterized protein LOC100381732               124   3e-29   
ref|XP_001764191.1|  predicted protein                                  128   3e-29   
gb|KFK22552.1|  hypothetical protein AALP_AAs68488U001300               124   4e-29   
ref|XP_009114281.1|  PREDICTED: uncharacterized protein LOC103839529    124   4e-29   
ref|XP_002315700.2|  DNA-binding family protein                         124   4e-29   
ref|XP_010234426.1|  PREDICTED: protein REVEILLE 5-like isoform X3      124   4e-29   
emb|CDX82407.1|  BnaA03g34140D                                          125   4e-29   
ref|XP_008339970.1|  PREDICTED: transcription factor MYB1R1             124   4e-29   
dbj|BAC64998.1|  putative transcription factor Myb1                     124   4e-29   
ref|XP_006601240.1|  PREDICTED: transcription factor MYB1R1-like        122   4e-29   
gb|ABI74688.1|  MYB                                                     125   5e-29   
ref|NP_200970.1|  myb-like transcription factor family protein          124   5e-29   
emb|CDY41049.1|  BnaA09g18280D                                          124   5e-29   
gb|EEE68049.1|  hypothetical protein OsJ_26047                          124   5e-29   
ref|XP_008221488.1|  PREDICTED: transcription factor MYB1R1             124   6e-29   
gb|AFW83192.1|  putative MYB DNA-binding domain superfamily protein     121   7e-29   
ref|XP_009404535.1|  PREDICTED: transcription factor MYB1R1-like        124   7e-29   
dbj|BAJ88649.1|  predicted protein                                      124   7e-29   
ref|XP_010043839.1|  PREDICTED: transcription factor MYB1R1             123   8e-29   
ref|XP_003573373.1|  PREDICTED: uncharacterized protein LOC100834934    125   8e-29   
ref|XP_008790110.1|  PREDICTED: uncharacterized protein LOC103707412    124   8e-29   
ref|XP_004972855.1|  PREDICTED: uncharacterized protein LOC101753...    124   8e-29   
gb|EEC82896.1|  hypothetical protein OsI_27803                          124   9e-29   
ref|XP_009400892.1|  PREDICTED: uncharacterized protein LOC103985010    123   9e-29   
ref|NP_001136746.1|  putative MYB DNA-binding domain superfamily ...    124   9e-29   
ref|XP_009400698.1|  PREDICTED: transcription factor MYB1R1-like        123   9e-29   
ref|NP_177158.1|  myb-like transcription factor                         122   9e-29   
ref|XP_004972854.1|  PREDICTED: uncharacterized protein LOC101753...    124   9e-29   
ref|XP_010234424.1|  PREDICTED: protein REVEILLE 5-like isoform X1      124   1e-28   
ref|XP_002445045.1|  hypothetical protein SORBIDRAFT_07g003330          123   1e-28   
ref|NP_001280790.1|  uncharacterized protein LOC103443746               123   1e-28   
ref|XP_010098248.1|  Transcription factor                               122   2e-28   
ref|XP_007150607.1|  hypothetical protein PHAVU_005G166300g             123   2e-28   
ref|XP_010415672.1|  PREDICTED: transcription factor MYB1R1-like        121   2e-28   
gb|AAB63650.1|  Myb-related transcription activator (MybSt1) isolog     123   2e-28   
ref|XP_006352488.1|  PREDICTED: transcription factor MYB1R1-like        119   2e-28   
emb|CDP05386.1|  unnamed protein product                                120   2e-28   
ref|XP_006369213.1|  hypothetical protein POPTR_0001s19070g             123   2e-28   
ref|XP_009127770.1|  PREDICTED: transcription factor MYB1R1-like        120   2e-28   
gb|ABK96220.1|  unknown                                                 123   2e-28   
emb|CBY88798.1|  myb transcription factor                               122   2e-28   
ref|XP_002298242.1|  myb family transcription factor family protein     123   2e-28   
gb|KHN32212.1|  Transcription factor MYB1R1                             120   2e-28   
ref|XP_010234425.1|  PREDICTED: protein REVEILLE 5-like isoform X2      123   2e-28   
emb|CDY52459.1|  BnaCnng22510D                                          120   2e-28   
emb|CEF98277.1|  Myb domain, plants                                     122   3e-28   
ref|XP_002455032.1|  hypothetical protein SORBIDRAFT_03g003270          123   3e-28   
ref|XP_010098140.1|  Transcription factor                               122   3e-28   
ref|XP_011010432.1|  PREDICTED: uncharacterized protein LOC105115...    123   3e-28   
ref|XP_010933630.1|  PREDICTED: transcription factor MYB1R1-like        122   3e-28   
ref|XP_011010433.1|  PREDICTED: uncharacterized protein LOC105115...    122   3e-28   
ref|XP_011010434.1|  PREDICTED: uncharacterized protein LOC105115...    122   3e-28   
ref|XP_006662602.1|  PREDICTED: transcription factor MYB1R1-like        120   3e-28   
ref|XP_009421290.1|  PREDICTED: transcription factor MYB1R1-like        122   4e-28   
gb|AFW79484.1|  putative MYB DNA-binding domain superfamily protein     123   5e-28   
ref|XP_009353549.1|  PREDICTED: uncharacterized protein LOC103944815    122   5e-28   
gb|KFK39581.1|  hypothetical protein AALP_AA3G262800                    120   5e-28   
ref|NP_001132840.1|  putative MYB DNA-binding domain superfamily ...    121   5e-28   
ref|XP_008654446.1|  PREDICTED: uncharacterized protein LOC100194...    121   5e-28   
ref|XP_008228426.1|  PREDICTED: transcription factor MYB1R1             122   5e-28   
ref|XP_009407831.1|  PREDICTED: transcription factor MYB1R1-like ...    120   5e-28   
gb|KHN37023.1|  Transcription factor MYB1R1                             120   6e-28   
gb|AFW79483.1|  putative MYB DNA-binding domain superfamily protein     123   7e-28   
ref|XP_010255646.1|  PREDICTED: transcription factor MYB1R1-like        120   7e-28   
ref|XP_010033837.1|  PREDICTED: uncharacterized protein LOC104423076    121   7e-28   
ref|XP_003079745.1|  putative Myb-related transcription activator...    120   8e-28   
emb|CDM81700.1|  unnamed protein product                                121   9e-28   
ref|XP_002515966.1|  DNA binding protein, putative                      121   9e-28   
gb|EAY74852.1|  hypothetical protein OsI_02744                          117   9e-28   
emb|CDY23531.1|  BnaC06g25000D                                          119   1e-27   
ref|XP_009401485.1|  PREDICTED: transcription factor MYB1R1-like        120   1e-27   
emb|CDY48382.1|  BnaA07g24010D                                          118   1e-27   
ref|XP_009104974.1|  PREDICTED: transcription factor MYB1R1             118   1e-27   
gb|KHF99337.1|  Transcription factor MYB1R1                             120   1e-27   
ref|XP_010911001.1|  PREDICTED: transcription factor MYB1R1-like        120   1e-27   
gb|KGN66224.1|  hypothetical protein Csa_1G586860                       119   1e-27   
ref|XP_009773328.1|  PREDICTED: protein REVEILLE 4-like                 119   1e-27   
ref|XP_009407830.1|  PREDICTED: uncharacterized protein LOC103990...    120   1e-27   
ref|XP_007039774.1|  Myb-like transcription factor family protein...    120   1e-27   
ref|XP_010272144.1|  PREDICTED: transcription factor MYB1R1-like        119   2e-27   
gb|AEZ00878.1|  putative MYB transcription factor-like protein          119   2e-27   
ref|NP_001149973.1|  myb-related transcription activator                120   2e-27   
ref|XP_010548834.1|  PREDICTED: transcription factor MYB1R1-like        119   2e-27   
gb|EMT29058.1|  Myb-like protein J                                      120   2e-27   
ref|XP_004147257.1|  PREDICTED: transcription factor MYB1R1-like        120   2e-27   
ref|XP_002888750.1|  hypothetical protein ARALYDRAFT_476127             118   2e-27   
ref|XP_004146936.1|  PREDICTED: uncharacterized protein LOC101213371    119   2e-27   
ref|XP_010545666.1|  PREDICTED: myb-like protein J                      119   3e-27   
ref|XP_006829488.1|  hypothetical protein AMTR_s00074p00097250          119   3e-27   
ref|XP_010104868.1|  Transcription factor                               119   3e-27   
ref|XP_009146146.1|  PREDICTED: transcription factor MYB1R1             120   3e-27   
ref|XP_008798808.1|  PREDICTED: uncharacterized protein LOC103713598    119   4e-27   
ref|XP_009368939.1|  PREDICTED: transcription factor MYB1R1             119   5e-27   
ref|XP_010527294.1|  PREDICTED: transcription factor MYB1R1-like        117   5e-27   
ref|XP_004252360.1|  PREDICTED: transcription factor MYB1R1             119   5e-27   
ref|XP_002297928.1|  syringolide-induced protein 1-3-1B                 119   6e-27   
ref|XP_006359477.1|  PREDICTED: transcription factor MYB1R1-like        119   6e-27   
gb|EMS51882.1|  Transcription factor MYB1R1                             117   6e-27   
ref|XP_010665911.1|  PREDICTED: transcription factor MYB1R1             119   6e-27   
ref|XP_009626737.1|  PREDICTED: transcription factor MYB1R1             119   7e-27   
ref|XP_010471001.1|  PREDICTED: transcription factor MYB1R1             117   8e-27   
ref|XP_009772765.1|  PREDICTED: transcription factor MYB1R1             119   8e-27   
ref|XP_010047590.1|  PREDICTED: protein REVEILLE 7 isoform X1           117   9e-27   
gb|KDP21270.1|  hypothetical protein JCGZ_21741                         117   1e-26   
ref|XP_006368993.1|  syringolide-induced protein 1-3-1B                 117   1e-26   
ref|NP_001151255.1|  LOC100284888                                       118   1e-26   
ref|XP_011026742.1|  PREDICTED: transcription factor MYB1R1-like        117   2e-26   
ref|XP_010465657.1|  PREDICTED: uncharacterized protein LOC104745965    117   2e-26   
ref|XP_007039775.1|  Myb-like transcription factor family protein...    115   2e-26   
dbj|BAJ40869.1|  transcriptional factor MYB-4                           114   2e-26   
ref|XP_006406842.1|  hypothetical protein EUTSA_v10020915mg             117   3e-26   
ref|XP_011086441.1|  PREDICTED: transcription factor MYB1R1             116   3e-26   
ref|XP_004302861.1|  PREDICTED: uncharacterized protein LOC101305277    117   3e-26   
ref|XP_007153882.1|  hypothetical protein PHAVU_003G072800g             114   3e-26   
ref|XP_006659108.1|  PREDICTED: transcription factor MYB1R1-like        116   4e-26   
ref|XP_002991762.1|  hypothetical protein SELMODRAFT_47760              113   4e-26   
emb|CDX90475.1|  BnaA03g43060D                                          116   4e-26   
ref|XP_006603403.1|  PREDICTED: uncharacterized protein LOC100780755    117   4e-26   
ref|XP_009136840.1|  PREDICTED: uncharacterized protein LOC103860911    116   4e-26   
gb|ADC94862.1|  MYB transcription factor 1                              115   4e-26   
ref|XP_011012039.1|  PREDICTED: uncharacterized protein LOC105116394    116   4e-26   
ref|XP_002989732.1|  hypothetical protein SELMODRAFT_47768              112   4e-26   
ref|XP_001418177.1|  predicted protein                                  109   4e-26   
ref|XP_010934643.1|  PREDICTED: uncharacterized protein LOC105054...    115   4e-26   
emb|CDY09630.1|  BnaC07g34310D                                          115   5e-26   
ref|NP_001281063.1|  transcription factor MYB1R1-like                   115   5e-26   
gb|ABD65139.1|  myb family transcription factor                         115   5e-26   
gb|EMT01615.1|  Myb-like protein J                                      115   6e-26   
ref|XP_009383025.1|  PREDICTED: uncharacterized protein LOC103970821    115   6e-26   
ref|XP_009147920.1|  PREDICTED: transcription factor DIVARICATA-like    115   7e-26   
gb|AAS09982.1|  MYB transcription factor                                116   7e-26   
ref|XP_010419320.1|  PREDICTED: transcription factor MYB1R1-like        115   7e-26   
ref|XP_010487491.1|  PREDICTED: uncharacterized protein LOC104765474    116   8e-26   
ref|XP_010062531.1|  PREDICTED: myb-like protein H                      115   9e-26   
emb|CDY48593.1|  BnaCnng16520D                                          114   1e-25   
ref|XP_011072427.1|  PREDICTED: protein REVEILLE 4-like                 114   1e-25   
ref|XP_010504183.1|  PREDICTED: uncharacterized protein LOC104781253    115   1e-25   
ref|XP_003523642.1|  PREDICTED: uncharacterized protein LOC100795143    112   1e-25   
dbj|BAJ40868.1|  transcriptional factor MYB-3                           113   1e-25   
ref|XP_002883001.1|  hypothetical protein ARALYDRAFT_479087             115   1e-25   



>ref|XP_009631208.1| PREDICTED: myb-like protein J [Nicotiana tomentosiformis]
Length=285

 Score =   174 bits (440),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 104/185 (56%), Positives = 119/185 (64%), Gaps = 10/185 (5%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTC-------NNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssy  780
            M RKCS CG TGHNSRTC       +  NE  TS+ G  MKLFGVKL     +  +S++ 
Sbjct  1    MGRKCSHCGITGHNSRTCKPQKTKIDGKNEDATSNIG--MKLFGVKLEIPKTSSFASTAS  58

Query  779  sfvmkksfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKR  600
                            S S A S   +     DEN D KV   GY+SD  + G   +KK+
Sbjct  59   MKKSFSVGCLQNSSKISSSTAGSFTSNCKMFSDENLDYKVSN-GYLSDHELVGRTSDKKK  117

Query  599  GVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRR  420
            GVPW+EEEHRIFLVGLEKLG+GDWRGISR FVTTRTPTQ+ASHAQKYFLR NSL+ TKRR
Sbjct  118  GVPWTEEEHRIFLVGLEKLGKGDWRGISRKFVTTRTPTQVASHAQKYFLRQNSLNRTKRR  177

Query  419  RSLFD  405
            RSLFD
Sbjct  178  RSLFD  182



>ref|XP_009780709.1| PREDICTED: myb-like protein H isoform X1 [Nicotiana sylvestris]
Length=297

 Score =   167 bits (424),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 111/188 (59%), Positives = 128/188 (68%), Gaps = 16/188 (9%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTC-------NNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssy  780
            M RKCS CG TGHNSRTC       +   E   +S+ G MKLFGVKL       SSS + 
Sbjct  1    MGRKCSHCGITGHNSRTCKSQKAKIDEKKEDAITSNIG-MKLFGVKL---EIPKSSSFAS  56

Query  779  sfvmkksfSDDCLPaasysfadssfgssg---FLFDENFDGKVPGCGYISDGLVCGNLPE  609
            S  MKKSFS  CL  +S   + +    +       DEN D KV   GY+SD LV G   +
Sbjct  57   SASMKKSFSVGCLLNSSKISSSTVGSFASNCEMFSDENLDYKVSN-GYLSDELV-GRTLD  114

Query  608  KKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHST  429
            KK+GVPW+EEEHRIFL+GLEKLG+GDWRGISR+FVTTRTPTQ+ASHAQKYFLR NSL+ T
Sbjct  115  KKKGVPWTEEEHRIFLIGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKYFLRQNSLNRT  174

Query  428  KRRRSLFD  405
            KRRRSLFD
Sbjct  175  KRRRSLFD  182



>ref|XP_009780711.1| PREDICTED: transcription factor MYB1R1-like isoform X3 [Nicotiana 
sylvestris]
Length=220

 Score =   165 bits (417),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 111/188 (59%), Positives = 128/188 (68%), Gaps = 16/188 (9%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTC-------NNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssy  780
            M RKCS CG TGHNSRTC       +   E   +S+ G MKLFGVKL       SSS + 
Sbjct  1    MGRKCSHCGITGHNSRTCKSQKAKIDEKKEDAITSNIG-MKLFGVKL---EIPKSSSFAS  56

Query  779  sfvmkksfSDDCLPaasysfadssfgssg---FLFDENFDGKVPGCGYISDGLVCGNLPE  609
            S  MKKSFS  CL  +S   + +    +       DEN D KV   GY+SD LV G   +
Sbjct  57   SASMKKSFSVGCLLNSSKISSSTVGSFASNCEMFSDENLDYKVSN-GYLSDELV-GRTLD  114

Query  608  KKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHST  429
            KK+GVPW+EEEHRIFL+GLEKLG+GDWRGISR+FVTTRTPTQ+ASHAQKYFLR NSL+ T
Sbjct  115  KKKGVPWTEEEHRIFLIGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKYFLRQNSLNRT  174

Query  428  KRRRSLFD  405
            KRRRSLFD
Sbjct  175  KRRRSLFD  182



>ref|XP_010262182.1| PREDICTED: transcription factor MYB1R1-like [Nelumbo nucifera]
Length=315

 Score =   167 bits (423),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 126/180 (70%), Gaps = 10/180 (6%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            M RKCS CG  GHNSRTC        ++ GG ++LFGV      Q    SSS S  MKKS
Sbjct  1    MGRKCSHCGNIGHNSRTCTTYRGSAAAAVGG-LRLFGV------QLDLLSSSPSLSMKKS  53

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKRGVPWSEE  579
            FS DCLP+AS S A SS  SS  + DEN D K P  GY+SDGLV     E+K+GVPW+EE
Sbjct  54   FSMDCLPSASSSSASSSSSSSQVVTDENSD-KAPN-GYLSDGLV-ARTQERKKGVPWTEE  110

Query  578  EHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFDLA  399
            EHR FL GLEKLG+GDWRGISR+FVTTRTPTQ+ASHAQKYFLR  SL+  KRR SLFD+ 
Sbjct  111  EHRTFLAGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKYFLRQTSLNKKKRRSSLFDMV  170



>ref|XP_010090029.1| Transcription factor [Morus notabilis]
 gb|EXB38826.1| Transcription factor [Morus notabilis]
Length=316

 Score =   164 bits (416),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 102/189 (54%), Positives = 127/189 (67%), Gaps = 8/189 (4%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            M RKCS CG  GHNSRTC N  +   +  GGS++LFGV+L         SSS S  +KKS
Sbjct  1    MGRKCSHCGNIGHNSRTCTNYYKASATFVGGSLRLFGVQL------DMYSSSSSISIKKS  54

Query  758  fSDDCLPaasysfadssfgssgFL-FDENFDGKVPGCGYISDGLVCGNLPEKKRGVPWSE  582
            FS DCL ++S   +  S   S  +  DE         GY+SDGL+C    E+K+GVPW+E
Sbjct  55   FSMDCLNSSSSPSSSPSSSMSSRIALDEASHLDKASIGYLSDGLIC-RAQERKKGVPWTE  113

Query  581  EEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFDL  402
            EEHRIFL+GLEKLG+GDWRGIS+++VTTRTPTQ+ASHAQKYFLR  SL+  KRR SLFD+
Sbjct  114  EEHRIFLIGLEKLGKGDWRGISKNYVTTRTPTQVASHAQKYFLRQASLNKKKRRSSLFDM  173

Query  401  AWKADECRV  375
               ++   V
Sbjct  174  VGTSNSMVV  182



>ref|XP_010267000.1| PREDICTED: transcription factor MYB1R1-like isoform X2 [Nelumbo 
nucifera]
Length=309

 Score =   164 bits (414),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 122/183 (67%), Gaps = 16/183 (9%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            M RKCS CG  GHNSRTC N    R S+ GG +KLFGV+L  S  +  +      +    
Sbjct  1    MGRKCSHCGNMGHNSRTCTN---YRASAVGGGLKLFGVQLDLSSSSSLALKKSFSM----  53

Query  758  fSDDCLPaasysfadssfgssg---FLFDENFDGKVPGCGYISDGLVCGNLPEKKRGVPW  588
               DCLP+ S + + SS   S     + DEN D K+   GY+SDGL+ G   E+K+GVPW
Sbjct  54   ---DCLPSTSSASSSSSSSLSSSSRVVADENSD-KISN-GYLSDGLI-GRTQERKKGVPW  107

Query  587  SEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLF  408
            +EEEHR FL GLEKLG+GDWRGISR+FVTTRTPTQ+ASHAQKYFLR  +L+  KRR SLF
Sbjct  108  TEEEHRTFLAGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKYFLRQANLNKKKRRSSLF  167

Query  407  DLA  399
            D+ 
Sbjct  168  DMV  170



>ref|XP_009760073.1| PREDICTED: transcription factor MYB1R1-like [Nicotiana sylvestris]
Length=269

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 102/182 (56%), Positives = 124/182 (68%), Gaps = 16/182 (9%)
 Frame = -2

Query  944  IRMTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmk  765
            ++M RKCS CG TGHNSRTC+      T S  G +KLFGV+L     N SSSSS S  +K
Sbjct  1    MKMGRKCSHCGNTGHNSRTCSTLKCANTGSFIGGLKLFGVQL-DIPNNASSSSSSSIHLK  59

Query  764  ksfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKRGVPWS  585
            KSFS DCL  +     + S   +               GY+SDGLV   + ++K+G PW+
Sbjct  60   KSFSLDCLSPSVNESCEKSTSINN--------------GYLSDGLVV-RVEKRKKGAPWT  104

Query  584  EEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFD  405
            EEEHR FL+GLEKLG+GDWRGISR+FVTTRTPTQ+ASHAQKYFLRH+SL+  KRR SLFD
Sbjct  105  EEEHRKFLIGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKYFLRHSSLNKKKRRSSLFD  164

Query  404  LA  399
            +A
Sbjct  165  MA  166



>ref|XP_007012873.1| Myb-like transcription factor family protein, putative [Theobroma 
cacao]
 gb|EOY30492.1| Myb-like transcription factor family protein, putative [Theobroma 
cacao]
Length=256

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 100/182 (55%), Positives = 121/182 (66%), Gaps = 17/182 (9%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            M RKCS CG  GHNSRTC      R ++ GG ++LFGV+L  S  + +   S+S      
Sbjct  1    MGRKCSHCGNIGHNSRTCTT---YRRAAVGG-LRLFGVQLDISSSSVAMKKSFSM-----  51

Query  758  fSDDCLPaasysfadssfgssg--FLFDENFDGKVPGCGYISDGLVCGNLPEKKRGVPWS  585
               DCL +AS S    S   S      DEN D      GY+SDGL+ G  PE+K+GVPW+
Sbjct  52   ---DCLSSASPSSPSPSSSLSSSRVSIDENSDKT--SIGYLSDGLM-GRSPERKKGVPWT  105

Query  584  EEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFD  405
            EEEHRIFL+GLEKLG+GDWRGISR+FVTTRTPTQ+ASHAQKYFLR  +L+  KRR SLFD
Sbjct  106  EEEHRIFLLGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKYFLRQATLNKKKRRSSLFD  165

Query  404  LA  399
            + 
Sbjct  166  MV  167



>ref|XP_010915342.1| PREDICTED: transcription factor MYB1R1-like isoform X2 [Elaeis 
guineensis]
Length=254

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 94/183 (51%), Positives = 113/183 (62%), Gaps = 14/183 (8%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            M RKCS CG  GHNSRTC++    R+    G ++LFGV+L          +S        
Sbjct  2    MARKCSYCGNNGHNSRTCSS---PRSLVGAGGLRLFGVQL--------QVASPIKKSFSM  50

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKRGVPWSEE  579
                     + S +  S  SS    +EN D      GY+SDGLV     E+K+GVPW+EE
Sbjct  51   ECLSSSSYPASSSSSPSSSSSLASIEENTDKT--SNGYLSDGLV-DRAQERKKGVPWTEE  107

Query  578  EHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFDLA  399
            EHR FL GLEKLG+GDWRGISRHFVTTRTPTQ+ASHAQKYFLR NSLH  KRR SLFD+ 
Sbjct  108  EHRTFLAGLEKLGKGDWRGISRHFVTTRTPTQVASHAQKYFLRQNSLHKKKRRSSLFDVV  167

Query  398  WKA  390
             ++
Sbjct  168  ARS  170



>ref|XP_010915341.1| PREDICTED: transcription factor MYB1R1-like isoform X1 [Elaeis 
guineensis]
Length=283

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 94/183 (51%), Positives = 113/183 (62%), Gaps = 14/183 (8%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            M RKCS CG  GHNSRTC++    R+    G ++LFGV+L          +S        
Sbjct  2    MARKCSYCGNNGHNSRTCSS---PRSLVGAGGLRLFGVQL--------QVASPIKKSFSM  50

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKRGVPWSEE  579
                     + S +  S  SS    +EN D      GY+SDGLV     E+K+GVPW+EE
Sbjct  51   ECLSSSSYPASSSSSPSSSSSLASIEENTDKT--SNGYLSDGLV-DRAQERKKGVPWTEE  107

Query  578  EHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFDLA  399
            EHR FL GLEKLG+GDWRGISRHFVTTRTPTQ+ASHAQKYFLR NSLH  KRR SLFD+ 
Sbjct  108  EHRTFLAGLEKLGKGDWRGISRHFVTTRTPTQVASHAQKYFLRQNSLHKKKRRSSLFDVV  167

Query  398  WKA  390
             ++
Sbjct  168  ARS  170



>ref|XP_009352631.1| PREDICTED: myb-like protein J [Pyrus x bretschneideri]
Length=319

 Score =   159 bits (403),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 101/194 (52%), Positives = 122/194 (63%), Gaps = 16/194 (8%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssss--------  783
            M RKCS CG  GHNSRTC N     +S+     +LFGV+L   H +   SSS        
Sbjct  1    MGRKCSHCGNVGHNSRTCTNFRGTLSSTSFVGFRLFGVQLQHDHHHVVMSSSNMNSNSAN  60

Query  782  --ysfvmkksfSDDCLPaasysfadssfgssgFLFDENFDGKV-----PGCGYISDGLVC  624
               +  MKKSFS DCLP  S + + S   SS      + D  +        GY+SDGL+C
Sbjct  61   HHVAMSMKKSFSTDCLPTTSSASSSSPSNSSLSPSRLSMDENICAADKASIGYLSDGLIC  120

Query  623  GNLPEKKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHN  444
                E+K+GVPW+EEEHR FL+GLEKLG+GDWRGISR++VTTRTPTQ+ASHAQKYFLR  
Sbjct  121  -RAQERKKGVPWTEEEHRTFLIGLEKLGKGDWRGISRNYVTTRTPTQVASHAQKYFLRQA  179

Query  443  SLHSTKRRRSLFDL  402
            SL   KRR SLFD+
Sbjct  180  SLTKKKRRSSLFDM  193



>ref|XP_007202213.1| hypothetical protein PRUPE_ppa008425mg [Prunus persica]
 gb|EMJ03412.1| hypothetical protein PRUPE_ppa008425mg [Prunus persica]
Length=332

 Score =   159 bits (403),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 97/203 (48%), Positives = 121/203 (60%), Gaps = 12/203 (6%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGG--SMKLFGVKLIGSHQNysssssysfvmk  765
            M RKCS CG  GHNSRTC N     TS   G   ++LFGV+L     ++    S S +  
Sbjct  1    MGRKCSHCGNIGHNSRTCTNFRGTGTSFSVGHVGVRLFGVQLHHHDHHHLMMPSSSNMNH  60

Query  764  ksfSD-------DCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEK  606
                        DCLP +S S +  S        DEN        GY+SDGL+C    E+
Sbjct  61   HVAMSMKKSFSMDCLPTSSASSSSPSSSRIS--VDENSIQDKASIGYLSDGLIC-RAQER  117

Query  605  KRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTK  426
            K+GVPW+EEEHR FL+GLEKLG+GDWRGISR++VTTRTPTQ+ASHAQKYFLR  +L   K
Sbjct  118  KKGVPWTEEEHRTFLIGLEKLGKGDWRGISRNYVTTRTPTQVASHAQKYFLRQATLTKKK  177

Query  425  RRRSLFDLAWKADECRVLCGKMA  357
            RR SLFD+  +++   +  G  A
Sbjct  178  RRSSLFDMFGRSNNINLSTGHPA  200



>ref|XP_008242415.1| PREDICTED: uncharacterized protein LOC103340749 [Prunus mume]
Length=332

 Score =   159 bits (403),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 97/203 (48%), Positives = 121/203 (60%), Gaps = 12/203 (6%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGG--SMKLFGVKLIGSHQNysssssysfvmk  765
            M RKCS CG  GHNSRTC N     TS   G   ++LFGV+L     ++    S S +  
Sbjct  1    MGRKCSHCGNIGHNSRTCTNFRGTGTSFSVGHVGVRLFGVQLHHHDHHHLMMPSSSNMNH  60

Query  764  ksfSD-------DCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEK  606
                        DCLP +S S +  S        DEN        GY+SDGL+C    E+
Sbjct  61   HVAMSMKKSFSMDCLPTSSASSSSPSSSRIS--VDENSIQDKASVGYLSDGLIC-RAQER  117

Query  605  KRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTK  426
            K+GVPW+EEEHR FL+GLEKLG+GDWRGISR++VTTRTPTQ+ASHAQKYFLR  +L   K
Sbjct  118  KKGVPWTEEEHRTFLIGLEKLGKGDWRGISRNYVTTRTPTQVASHAQKYFLRQATLTKKK  177

Query  425  RRRSLFDLAWKADECRVLCGKMA  357
            RR SLFD+  +++   +  G  A
Sbjct  178  RRSSLFDMFGRSNNINLSTGHPA  200



>gb|KHG05222.1| Transcription factor MYB1R1 [Gossypium arboreum]
Length=181

 Score =   154 bits (389),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 121/179 (68%), Gaps = 9/179 (5%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            M RKCS CG  GHNSRTC        +  G  ++LFGV+L       S S   + +MKKS
Sbjct  1    MGRKCSHCGNIGHNSRTCTTFRSA-AAGMGSGVRLFGVQL--QLDVSSPSVVSNHMMKKS  57

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKRGVPWSEE  579
            FS DCL ++    + SS   S    DEN D      GY+SDGL+ G  P++K+GVPW+EE
Sbjct  58   FSMDCLSSSPSPSSLSSSRVS---IDENSDK--TSMGYLSDGLM-GRSPDRKKGVPWTEE  111

Query  578  EHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFDL  402
            EHRIFL+GLEKLG+GDWRGISR+FVTTRTPTQ+ASHAQKYFLR  +L+   RR SLFD+
Sbjct  112  EHRIFLIGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKYFLRQATLNKKNRRSSLFDM  170



>emb|CDP08249.1| unnamed protein product [Coffea canephora]
Length=296

 Score =   157 bits (396),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 102/194 (53%), Positives = 119/194 (61%), Gaps = 35/194 (18%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            M RKCS CG TGHNSRTC     +    +   MKLFGV+L+   Q+   SSS +  MKKS
Sbjct  1    MGRKCSCCGTTGHNSRTCPTQRRR----NAARMKLFGVQLLD--QSPFPSSSNNLSMKKS  54

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGC-------------GYISDGLVCGN  618
            FS D L              S   F+     + P C             GY+SDGL+   
Sbjct  55   FSVDSL--------------SVSQFNAPSRSRTPSCSPSPQDHVLLESSGYLSDGLI-QT  99

Query  617  LPEKKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSL  438
              EKK+G+PW+EEEHRIFLVGLEKLGRGDWRGISR+FVTTRTPTQ+ASHAQKYFLR NSL
Sbjct  100  TQEKKKGMPWTEEEHRIFLVGLEKLGRGDWRGISRNFVTTRTPTQVASHAQKYFLRQNSL  159

Query  437  H-STKRRRSLFDLA  399
            +    RR SLFD+ 
Sbjct  160  NRKINRRPSLFDMV  173



>ref|XP_010049555.1| PREDICTED: transcription factor MYB1R1-like [Eucalyptus grandis]
Length=299

 Score =   157 bits (396),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 114/182 (63%), Gaps = 11/182 (6%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSS--HGGSMKLFGVKLIGSHQNysssssysfvmk  765
            M RKCS CG  GHNSRTC        +     G ++LFGV+L  S  + S +   SF M 
Sbjct  1    MGRKCSHCGNIGHNSRTCTVTYSSSATVGFDSGGLRLFGVQLDISPCSSSLAIKKSFSM-  59

Query  764  ksfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKRGVPWS  585
                 DCLP  S   + SS  SS     EN D      GY+SDGL+ G   EKK+GVPW+
Sbjct  60   -----DCLPFTSSPASSSSLSSSRISIGENSDKA--SLGYLSDGLL-GRSQEKKKGVPWT  111

Query  584  EEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFD  405
            EEEHR FLVGLEKLG+GDWRGISR +VTTRTP Q+ASHAQKYFLR  S +  KRR SLFD
Sbjct  112  EEEHRTFLVGLEKLGKGDWRGISRSYVTTRTPAQVASHAQKYFLRQVSFNKKKRRSSLFD  171

Query  404  LA  399
            + 
Sbjct  172  MV  173



>ref|XP_008798617.1| PREDICTED: transcription factor MYB1R1-like [Phoenix dactylifera]
Length=287

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 96/179 (54%), Positives = 116/179 (65%), Gaps = 13/179 (7%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            M RKCS CGK GHNSRTC++    R+      ++LFGV+L         +S         
Sbjct  2    MARKCSYCGKNGHNSRTCSS---PRSLGGAAGLRLFGVQL-------HVASPIKKSFSME  51

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKRGVPWSEE  579
                    AS S + SS  SS    +EN D K+   GY+S+GL+ G   E+K+GVPW+EE
Sbjct  52   CLSSSSYPASSSSSPSSSSSSLASMEENAD-KISN-GYLSEGLM-GRAQERKKGVPWTEE  108

Query  578  EHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFDL  402
            EHR FL GLEKLG+GDWRGISRHFVTTRTPTQ+ASHAQKYFLRHN+L   KRR SLFD+
Sbjct  109  EHRTFLAGLEKLGKGDWRGISRHFVTTRTPTQVASHAQKYFLRHNTLRKKKRRSSLFDV  167



>ref|XP_008337686.1| PREDICTED: myb-like protein J [Malus domestica]
Length=319

 Score =   157 bits (397),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 99/194 (51%), Positives = 122/194 (63%), Gaps = 16/194 (8%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssss--------  783
            M RKCS CG  GHNSRTC N     +S+     +LFGV+L   H +   SSS        
Sbjct  1    MGRKCSHCGNIGHNSRTCTNFRGTPSSTSFVGFRLFGVQLHHDHHHIVMSSSNMNSNSAN  60

Query  782  --ysfvmkksfSDDCLPaasysfadssfgssgFLFDENFDGKV-----PGCGYISDGLVC  624
               +  MKKS+S DCLP  S + + S   SS      + +  +        GY+SDGL+C
Sbjct  61   HHVAMSMKKSYSTDCLPTTSSASSSSPSNSSLSPSRLSMEENICAADKASIGYLSDGLIC  120

Query  623  GNLPEKKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHN  444
                E+K+GVPW+EEEHR FL+GLEKLG+GDWRGISR++VTTRTPTQ+ASHAQKYFLR  
Sbjct  121  -RAQERKKGVPWTEEEHRTFLIGLEKLGKGDWRGISRNYVTTRTPTQVASHAQKYFLRQA  179

Query  443  SLHSTKRRRSLFDL  402
            SL   KRR SLFD+
Sbjct  180  SLTKKKRRSSLFDM  193



>ref|XP_010266999.1| PREDICTED: transcription factor MYB1R1-like isoform X1 [Nelumbo 
nucifera]
Length=315

 Score =   156 bits (395),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 100/189 (53%), Positives = 122/189 (65%), Gaps = 22/189 (12%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            M RKCS CG  GHNSRTC N    R S+ GG +KLFGV+L  S  +  +      +    
Sbjct  1    MGRKCSHCGNMGHNSRTCTN---YRASAVGGGLKLFGVQLDLSSSSSLALKKSFSM----  53

Query  758  fSDDCLPaasysfadssfgssg---FLFDENFDGKVPGCGYISDGLVCGNLPEKKR----  600
               DCLP+ S + + SS   S     + DEN D K+   GY+SDGL+ G   E+K+    
Sbjct  54   ---DCLPSTSSASSSSSSSLSSSSRVVADENSD-KISN-GYLSDGLI-GRTQERKKAVCG  107

Query  599  --GVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTK  426
              GVPW+EEEHR FL GLEKLG+GDWRGISR+FVTTRTPTQ+ASHAQKYFLR  +L+  K
Sbjct  108  WLGVPWTEEEHRTFLAGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKYFLRQANLNKKK  167

Query  425  RRRSLFDLA  399
            RR SLFD+ 
Sbjct  168  RRSSLFDMV  176



>gb|KCW82238.1| hypothetical protein EUGRSUZ_C03658 [Eucalyptus grandis]
Length=363

 Score =   157 bits (398),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 115/183 (63%), Gaps = 11/183 (6%)
 Frame = -2

Query  941  RMTRKCSSCGKTGHNSRTCNNNNEQRTSS--HGGSMKLFGVKLIGSHQNysssssysfvm  768
            +M RKCS CG  GHNSRTC        +     G ++LFGV+L  S  + S +   SF M
Sbjct  64   KMGRKCSHCGNIGHNSRTCTVTYSSSATVGFDSGGLRLFGVQLDISPCSSSLAIKKSFSM  123

Query  767  kksfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKRGVPW  588
                  DCLP  S   + SS  SS     EN D      GY+SDGL+ G   EKK+GVPW
Sbjct  124  ------DCLPFTSSPASSSSLSSSRISIGENSDKA--SLGYLSDGLL-GRSQEKKKGVPW  174

Query  587  SEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLF  408
            +EEEHR FLVGLEKLG+GDWRGISR +VTTRTP Q+ASHAQKYFLR  S +  KRR SLF
Sbjct  175  TEEEHRTFLVGLEKLGKGDWRGISRSYVTTRTPAQVASHAQKYFLRQVSFNKKKRRSSLF  234

Query  407  DLA  399
            D+ 
Sbjct  235  DMV  237



>gb|EYU27307.1| hypothetical protein MIMGU_mgv1a011837mg [Erythranthe guttata]
Length=269

 Score =   155 bits (391),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 94/189 (50%), Positives = 125/189 (66%), Gaps = 9/189 (5%)
 Frame = -2

Query  944  IRMTRKCSSCGKTGHNSRTCNNNNE-QRTSSHGGSMKLFGVKL--IGSHQNysssssysf  774
            ++M RKCS CG  GHNSRTCNN ++    +   GS++LFGV+L  I S+   ++++ +  
Sbjct  1    MKMGRKCSQCGNIGHNSRTCNNISKGAAINGVCGSVRLFGVQLDNISSYSYTNNNNIHMK  60

Query  773  vmkksfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKRGV  594
                    DCL +   + + SS  SS      N D      GY+SDG +   +PE+K+GV
Sbjct  61   KSFSL---DCLSSTPSALSSSSSLSSSTRIPINDDK--ASIGYLSDGNL-ARIPERKKGV  114

Query  593  PWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRS  414
            PW+EEEHR FL+GLEKLG+GDWRGISR++VT+RTPTQ+ASHAQKYFLR  S+   KRR S
Sbjct  115  PWTEEEHRTFLIGLEKLGKGDWRGISRNYVTSRTPTQVASHAQKYFLRQASITKKKRRSS  174

Query  413  LFDLAWKAD  387
            LFD+A   D
Sbjct  175  LFDMAGGKD  183



>emb|CDP03183.1| unnamed protein product [Coffea canephora]
Length=316

 Score =   156 bits (394),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 100/181 (55%), Positives = 120/181 (66%), Gaps = 2/181 (1%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKL-IGSHQNysssssysfvmkk  762
            M RKCS CG  GHNSRTC   +    S     ++LFGV+L +  +   SSS+S S  MKK
Sbjct  1    MGRKCSHCGNIGHNSRTCTAYSSGNISVMAAGLRLFGVQLDVSCNSAPSSSNSNSIAMKK  60

Query  761  sfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKRGVPWSE  582
            SFS DCL ++  S    S   S        +      GY+SDGL+ G   E+K+GVPW+E
Sbjct  61   SFSLDCLSSSPTSSPSPSSSLSSSRISIGENSDKISIGYLSDGLL-GRPQERKKGVPWTE  119

Query  581  EEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFDL  402
            EEHR FLVGLEKLG+GDWRGISR+FVTTRTPTQ+ASHAQKYFLR  SL+  KRR SLFD+
Sbjct  120  EEHRSFLVGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKYFLRQASLNKKKRRSSLFDM  179

Query  401  A  399
             
Sbjct  180  V  180



>ref|XP_007012263.1| Myb transcription factor family protein, putative [Theobroma 
cacao]
 gb|EOY29882.1| Myb transcription factor family protein, putative [Theobroma 
cacao]
Length=276

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 102/180 (57%), Positives = 118/180 (66%), Gaps = 18/180 (10%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            M RKCS CG  GHNSRTC++N     S         GVKL G   + SSSS    ++KK 
Sbjct  1    MGRKCSHCGNKGHNSRTCSSNRGILPS---------GVKLFGVQLDLSSSSGSFPMIKKC  51

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISD-GLVCGNLPEKKRGVPWSE  582
             S DCL       + SS  SS    DEN D      GY+SD G +     EKK+GVPW+E
Sbjct  52   LSMDCL------SSPSSSTSSHVTMDENPDKL--STGYLSDDGGLVARTQEKKKGVPWTE  103

Query  581  EEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFDL  402
            EEHRIFLVGLEKLG+GDWRGISR+FVTTRTPTQ+ASHAQKYFLR NSL+  +RR SLFD+
Sbjct  104  EEHRIFLVGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKYFLRKNSLNKRRRRTSLFDV  163



>ref|XP_006353528.1| PREDICTED: transcription factor MYB1R1-like [Solanum tuberosum]
Length=277

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 96/188 (51%), Positives = 120/188 (64%), Gaps = 17/188 (9%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHG-GSMKLFGVKL------IGSHQNysssssy  780
            M RKCS CG  GHNSRTC+      + ++  G ++LFGV+L        SH N    S  
Sbjct  1    MGRKCSHCGYIGHNSRTCSTLKCAISDNNIIGGLRLFGVQLDISNSCFSSHNNNLKKSFS  60

Query  779  sfvmkksfSDDCLP-aasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKK  603
                      DCL    S+ F+ SS  S    ++++    +   GYISDG + G + EKK
Sbjct  61   L---------DCLSLTNSHLFSSSSSPSLNESWEKSSTTSIDNNGYISDGTLVGCVGEKK  111

Query  602  RGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKR  423
            +GVPW+EEEHR FL GLEKLG+GDWRGISR+FVTTRTPTQ+ASHAQKYFLR +SL+  KR
Sbjct  112  KGVPWTEEEHRRFLNGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKYFLRQSSLNKKKR  171

Query  422  RRSLFDLA  399
            R SLFD+A
Sbjct  172  RSSLFDMA  179



>gb|ABU68406.1| putative MYB transcription factor [Avicennia marina]
Length=260

 Score =   153 bits (387),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 117/181 (65%), Gaps = 12/181 (7%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGS--MKLFGVKLIGSHQNysssssysfvmk  765
            M RKCS CGK GHNSRTCN   +    S GG   ++LFGV+L  S  + SSS        
Sbjct  1    MGRKCSHCGKIGHNSRTCNTATK---GSIGGGVIIRLFGVQLDISSSSNSSSIPIKKSFS  57

Query  764  ksfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKRGVPWS  585
                 DCL +     + S   S     +++ D      GY+SDGL  G  P++K+GVPWS
Sbjct  58   L----DCLSSTPTLSSSSLSSSRAPTNNQHPDKT--SVGYLSDGLE-GRAPDRKKGVPWS  110

Query  584  EEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFD  405
            EEEHR FL+GLEKLGRGDWRGISR+FVTTRTPTQ+ASHAQKYFLR  SL+  KRR SLFD
Sbjct  111  EEEHRTFLIGLEKLGRGDWRGISRNFVTTRTPTQVASHAQKYFLRQASLNKRKRRPSLFD  170

Query  404  L  402
            L
Sbjct  171  L  171



>ref|XP_010097075.1| Transcription factor [Morus notabilis]
 gb|EXB66876.1| Transcription factor [Morus notabilis]
Length=307

 Score =   153 bits (387),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 103/197 (52%), Positives = 127/197 (64%), Gaps = 21/197 (11%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKL----------IGSHQNysss  789
            M RKCS CGK GHNSRTCN+   +R    G   +LFGV+L            S    SS 
Sbjct  1    MGRKCSHCGKMGHNSRTCNS---RRRLVSGCRFRLFGVQLDQYYPSSSSSSPSSSQISSF  57

Query  788  ssysfvmkksfSDDCLPaasysfadssfgssgFLF-------DENFDGKVPGCGYISDGL  630
            S+++   KKS S DCL ++S   + SS   S           +E  D K+   GY+SDG 
Sbjct  58   SNHAMNTKKSLSIDCLSSSSTPSSSSSSRISNSTTSHSTVHHEEISDHKLLSNGYLSDGF  117

Query  629  VCGNLPEKKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLR  450
            + G   E+K+GVPWS+EEHRIFL+GLEKLG+GDWRGISR+FVTTRTPTQ+ASHAQKYFLR
Sbjct  118  IAG-AQERKKGVPWSDEEHRIFLIGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKYFLR  176

Query  449  HNSLHSTKRRRSLFDLA  399
             N+L+  KRR SLFD+ 
Sbjct  177  QNTLNKRKRRSSLFDVV  193



>ref|XP_009400577.1| PREDICTED: transcription factor MYB1R1-like [Musa acuminata subsp. 
malaccensis]
Length=264

 Score =   152 bits (384),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 116/182 (64%), Gaps = 17/182 (9%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            M RKCS CG  GHNSRTC N         GG ++LFGV+L             +  +KKS
Sbjct  1    MVRKCSHCGHNGHNSRTCINTRSSMVG--GGGVRLFGVQL-----------HMASPLKKS  47

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGC--GYISDGLVCGNLPEKKRGVPWS  585
            FS +CL     + + SS  SS      + D        GY+SDGL  G   E+K+GVPW+
Sbjct  48   FSMECLSYTYPAASSSSPSSSSSSLG-SIDEATQKISHGYLSDGL-GGRTQERKKGVPWT  105

Query  584  EEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFD  405
            EEEHR FL+GLEKLG+GDWRGISR+FVTTRTPTQ+ASHAQKYFLR NSL+  KRR SLFD
Sbjct  106  EEEHRSFLIGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKYFLRQNSLNKKKRRSSLFD  165

Query  404  LA  399
            + 
Sbjct  166  VV  167



>ref|XP_009590196.1| PREDICTED: myb-like protein J [Nicotiana tomentosiformis]
Length=272

 Score =   152 bits (384),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 117/188 (62%), Gaps = 15/188 (8%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            M RKCS CG  GHNSRTC+        S  G +KLFGV+L  S+   SSSSS   + K  
Sbjct  1    MGRKCSHCGNIGHNSRTCSTLKCASNGSFIGGLKLFGVQLDISNNASSSSSSIDHLKKSF  60

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKRGVPWSEE  579
              D   P +     + S   +               GY+SDGLV   + E+K+GVPW+EE
Sbjct  61   SLDCLTPPSVNESCEKSTSINN--------------GYLSDGLVV-RVEERKKGVPWTEE  105

Query  578  EHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFDLA  399
            EHR FL+GLEK G+GDWRGISR+FVTTRTPTQ+ASHAQKYFLR +SL+  KRR SLFD+A
Sbjct  106  EHRKFLIGLEKQGKGDWRGISRNFVTTRTPTQVASHAQKYFLRQSSLNKKKRRSSLFDMA  165

Query  398  WKADECRV  375
               ++  V
Sbjct  166  RSNNKMHV  173



>ref|XP_010918640.1| PREDICTED: transcription factor MYB1R1-like [Elaeis guineensis]
Length=263

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 96/184 (52%), Positives = 114/184 (62%), Gaps = 12/184 (7%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            M RKCS CG  GHNSRTC++    R     G ++LFGV+L   H  +    S+S     S
Sbjct  1    MGRKCSHCGNNGHNSRTCSS---PRGVVSNGGLRLFGVQL---HVAFPMKKSFSMECLAS  54

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKRGVPWSEE  579
             S     +   S + SS   S     E F       GY+SDGL+ G  PE+K+GVPW+EE
Sbjct  55   SSYLASSSPCSSTSSSSSLVSIDETTEKFSN-----GYLSDGLL-GRTPERKKGVPWTEE  108

Query  578  EHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFDLA  399
            EHR FL+GLEKLG+GDWRGISR FVTTRTPTQ+ASHAQKYFLR  SL   KRR SLFD+ 
Sbjct  109  EHRSFLIGLEKLGKGDWRGISRKFVTTRTPTQVASHAQKYFLRQTSLSKKKRRSSLFDVV  168

Query  398  WKAD  387
               D
Sbjct  169  ASCD  172



>ref|XP_002277676.1| PREDICTED: transcription factor MYB1R1 [Vitis vinifera]
 emb|CBI20631.3| unnamed protein product [Vitis vinifera]
Length=211

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 124/183 (68%), Gaps = 15/183 (8%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNN---NNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvm  768
            M RKCS CG  GHNSRTC     ++   +SS  G +KLFGV+L          S+    M
Sbjct  1    MGRKCSHCGNIGHNSRTCTTLRGSSGVSSSSLTGGVKLFGVQL-------EMPSTTPLPM  53

Query  767  kksfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKRGVPW  588
            KKSFS DCLP++S + + S+        DEN D      GY+SDGL+     E+K+GVPW
Sbjct  54   KKSFSLDCLPSSSSTPSSSTSSRVSA--DENSDKF--SRGYLSDGLI-ARTQERKKGVPW  108

Query  587  SEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLF  408
            +EEEHR FL+GLEKLGRGDWRGISR+FVTTRTPTQ+ASHAQKYFLR +SL+  KRR SLF
Sbjct  109  TEEEHRTFLLGLEKLGRGDWRGISRNFVTTRTPTQVASHAQKYFLRQSSLNKKKRRPSLF  168

Query  407  DLA  399
            DL 
Sbjct  169  DLV  171



>gb|KDO80052.1| hypothetical protein CISIN_1g038601mg [Citrus sinensis]
Length=199

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 102/198 (52%), Positives = 130/198 (66%), Gaps = 8/198 (4%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCN--NNNEQ----RTSSHGGSMKLFGVKL-IGSHQNysssssy  780
            M RKCS CG TGHNSRTC+  +NN +     TS+  G ++LFGV+L I S+ + SSSS  
Sbjct  1    MGRKCSHCGNTGHNSRTCSSYDNNLKGGSCSTSTLAGGLRLFGVQLAISSNSSSSSSSQL  60

Query  779  sfvmkksfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKR  600
              + K   +D      S S + SS  S+G   + +        GYISD L+     ++K+
Sbjct  61   LPLKKSLSTDSFPAIPSPSSSASSSSSTGVTINIDQHSNKLSNGYISDSLIAPT-QDRKK  119

Query  599  GVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRR  420
            GVPW+EEEHR+FL+GLEKLGRGDWRGIS++FVTTRTPTQ+ASHAQKYFLR  +L+  KRR
Sbjct  120  GVPWTEEEHRVFLMGLEKLGRGDWRGISKNFVTTRTPTQVASHAQKYFLRQKNLYKRKRR  179

Query  419  RSLFDLAWKADECRVLCG  366
             SLFD+   A    VL G
Sbjct  180  PSLFDVMPWAWFLLVLLG  197



>ref|NP_001235940.1| MYB transcription factor MYB127 [Glycine max]
 gb|ABH02855.1| MYB transcription factor MYB127 [Glycine max]
 gb|KHN16681.1| Transcription factor MYB1R1 [Glycine soja]
Length=267

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 95/180 (53%), Positives = 113/180 (63%), Gaps = 18/180 (10%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            M RKCS CG  GHNSRTC +     TS  G  ++LFGV+L  ++               S
Sbjct  1    MGRKCSHCGTIGHNSRTCTSLRGATTSFVG--LRLFGVQLDSTN-------------CVS  45

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKRGVPWSEE  579
                    +  S + SSF SS    DEN D      GY+SDGL+     E+K+GVPW+EE
Sbjct  46   IKKSFSMDSLPSSSSSSFSSSRLTIDENSDR--TSFGYLSDGLL-ARAQERKKGVPWTEE  102

Query  578  EHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFDLA  399
            EHRIFLVGLEKLG+GDWRGISR+FVTTRTPTQ+ASHAQKYFLR  ++   KRR SLFDL 
Sbjct  103  EHRIFLVGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKYFLRLATIDKKKRRSSLFDLV  162



>ref|XP_011093715.1| PREDICTED: transcription factor MYB1R1-like [Sesamum indicum]
Length=267

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 91/187 (49%), Positives = 112/187 (60%), Gaps = 12/187 (6%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            M RKCS CG  GHNSRTCN  +    ++ G  M+LFGV+L  S            +    
Sbjct  1    MGRKCSHCGNIGHNSRTCNFLSRGPNAAGGAVMRLFGVQLDISSSPSIPMKKSFSL----  56

Query  758  fSDDCLPaasysfadssfgssgFL---FDENFDGKVPGCGYISDGLVCGNLPEKKRGVPW  588
               DCL +A    + S   S         E+ D      GY+SDG +     E+K+GVPW
Sbjct  57   ---DCLSSAPPLLSSSPSSSLSSSCVPIHEHPDKA--SIGYLSDGPLGPRPSERKKGVPW  111

Query  587  SEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLF  408
            +EEEHR FL+GLEKLG+GDWRGISR+FVTTRTPTQ+ASHAQKYFLR   +H  KRR SLF
Sbjct  112  TEEEHRTFLIGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKYFLRQACVHKKKRRSSLF  171

Query  407  DLAWKAD  387
            D+   +D
Sbjct  172  DMVGGSD  178



>ref|XP_009780710.1| PREDICTED: myb-like protein J isoform X2 [Nicotiana sylvestris]
Length=243

 Score =   149 bits (377),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 81/94 (86%), Gaps = 2/94 (2%)
 Frame = -2

Query  686  FDENFDGKVPGCGYISDGLVCGNLPEKKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHF  507
             DEN D KV   GY+SD LV G   +KK+GVPW+EEEHRIFL+GLEKLG+GDWRGISR+F
Sbjct  37   IDENLDYKVSN-GYLSDELV-GRTLDKKKGVPWTEEEHRIFLIGLEKLGKGDWRGISRNF  94

Query  506  VTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFD  405
            VTTRTPTQ+ASHAQKYFLR NSL+ TKRRRSLFD
Sbjct  95   VTTRTPTQVASHAQKYFLRQNSLNRTKRRRSLFD  128



>ref|XP_004287537.1| PREDICTED: uncharacterized protein LOC101290800 [Fragaria vesca 
subsp. vesca]
Length=349

 Score =   152 bits (383),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 93/187 (50%), Positives = 119/187 (64%), Gaps = 10/187 (5%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGS-----MKLFGVKLIGSHQNysssssysf  774
            M RKCS CG  GHNSRTC N      +   G+      +LFGV++    Q  SS SS++ 
Sbjct  1    MGRKCSHCGNIGHNSRTCTNFRGSSAAGFVGTTPPHGFRLFGVQVHHHDQVSSSVSSFNA  60

Query  773  vmkksfSD---DCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKK  603
            +          DCLP +S S +  S      + +E+ D      GY+SDGL+C    ++K
Sbjct  61   MNMMMKKSFSMDCLPTSSASSSSPSSSRIS-IDNEHSDHHKAPIGYLSDGLIC-RAQDRK  118

Query  602  RGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKR  423
            +GVPW+EEEHR FL+GLEKLG+GDWRGISR++VTTRTPTQ+ASHAQKYFLR  +L   KR
Sbjct  119  KGVPWTEEEHRTFLMGLEKLGKGDWRGISRNYVTTRTPTQVASHAQKYFLRQATLTKKKR  178

Query  422  RRSLFDL  402
            R SLFD+
Sbjct  179  RSSLFDM  185



>ref|XP_011019483.1| PREDICTED: transcription factor MYB1R1-like [Populus euphratica]
Length=240

 Score =   149 bits (376),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 124/179 (69%), Gaps = 14/179 (8%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            M RKCS CG  GHNSRTC       T++   S++LFGV+L         +SS S  MKKS
Sbjct  1    MGRKCSHCGNVGHNSRTC-------TATQKESLRLFGVQL------DIPASSSSPAMKKS  47

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKRGVPWSEE  579
            FS   LP++S + + S+  +S  + +   +  +   GY+SDG V G  PE+K+ VPW+EE
Sbjct  48   FSVGSLPSSSTTPSSSTSYNSPQVVNTGDEFYLLSNGYLSDGQV-GRTPERKKSVPWTEE  106

Query  578  EHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFDL  402
            EHRIFL+GLEKLG+GDWRGISR+FVTTRTPTQ+ASHAQKYFLR NSL   KRR SLFD+
Sbjct  107  EHRIFLLGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKYFLRQNSLTKRKRRPSLFDV  165



>ref|XP_008387730.1| PREDICTED: myb-like protein J [Malus domestica]
Length=321

 Score =   151 bits (381),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 92/196 (47%), Positives = 113/196 (58%), Gaps = 18/196 (9%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            M RKCS CG  GHNSRTC N     +S+     +LFGV+L   H ++   SS +     +
Sbjct  1    MGRKCSHCGNIGHNSRTCANFRGTTSSTSFVGFRLFGVQLHHDHDHHIMMSSSNMNNNSA  60

Query  758  fSDDCLPaasysfa----------------dssfgssgFLFDENF-DGKVPGCGYISDGL  630
                 +P                       +SS   S    DEN         GY+SDGL
Sbjct  61   NYHVSMPMKKSFSMDCLPTTTSSASSSSPSNSSLSPSRLSMDENICASDKASIGYLSDGL  120

Query  629  VCGNLPEKKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLR  450
            +C    E+K+GVPW+EEEHR FL+GLEKLG+GDWRGISR++VTTRTPTQ+ASHAQKYFLR
Sbjct  121  IC-RAQERKKGVPWTEEEHRTFLIGLEKLGKGDWRGISRNYVTTRTPTQVASHAQKYFLR  179

Query  449  HNSLHSTKRRRSLFDL  402
              SL   KRR SLFD+
Sbjct  180  QASLTKKKRRSSLFDM  195



>ref|XP_006361001.1| PREDICTED: transcription factor MYB1R1-like [Solanum tuberosum]
Length=174

 Score =   146 bits (369),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 114/188 (61%), Gaps = 27/188 (14%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHG----------GSMKLFGVKLIGSHQNysss  789
            M RKCS CG  GHNSRTC  + + +               G MKLFGVKL         S
Sbjct  1    MGRKCSHCGIAGHNSRTCKTHEKTKNEDEKIINDEDPKIIGMMKLFGVKL------EVPS  54

Query  788  ssysfvmkksfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPE  609
            SS S  +KKSFS DCL  +S   +         +   NF       GY+SD    G    
Sbjct  55   SSSSSWIKKSFSVDCLSNSSKISSS--------MAASNFSYCDISNGYLSD---VGRASY  103

Query  608  KKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHST  429
            KK+GV W+EEEHRIFLVGLEKLG+GDWRGISR+FVTTRTPTQ+ASHAQKYFLR N L+  
Sbjct  104  KKKGVAWTEEEHRIFLVGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKYFLRQNCLNIK  163

Query  428  KRRRSLFD  405
            KRRRSLFD
Sbjct  164  KRRRSLFD  171



>ref|XP_007160238.1| hypothetical protein PHAVU_002G304400g [Phaseolus vulgaris]
 gb|ESW32232.1| hypothetical protein PHAVU_002G304400g [Phaseolus vulgaris]
Length=220

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 114/187 (61%), Gaps = 36/187 (19%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            M RKCS CG  GHNSRTC +    R SS  G ++LFGV+L                    
Sbjct  1    MGRKCSHCGVIGHNSRTCTS---LRGSSFVG-LRLFGVQL--------------------  36

Query  758  fSDDCLPaasy-------sfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKR  600
              D C+            S + SSF SS    DEN D      GY+SDGL+   L E+K+
Sbjct  37   --DTCVTIKKSFSMDSLPSSSSSSFSSSRLTIDENSDRT--SFGYLSDGLI-PPLQERKK  91

Query  599  GVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRR  420
            GVPW+EEEHRIFLVGLEKLG+GDWRGISR+FVTTRTPTQ+ASHAQKYFLR  ++   KRR
Sbjct  92   GVPWTEEEHRIFLVGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKYFLRLATIDKKKRR  151

Query  419  RSLFDLA  399
             SLFD+ 
Sbjct  152  SSLFDVV  158



>ref|XP_002514146.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48100.1| conserved hypothetical protein [Ricinus communis]
Length=285

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 95/180 (53%), Positives = 117/180 (65%), Gaps = 5/180 (3%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            M RKCS CG  GHNSRTC N          G ++LFGV+   S  + SSS S        
Sbjct  1    MGRKCSHCGNIGHNSRTCTNYRGTAVVGGAGGLRLFGVQFDLSTSSSSSSLSMKKSFSM-  59

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKRGVPWSEE  579
               DCL ++S S   SS  SS     ++ +      GY+SDGL+ G + E+K+GVPW+EE
Sbjct  60   ---DCLSSSSSSSPSSSLCSSRLSNVDDNNPDRTSTGYLSDGLL-GRVQERKKGVPWTEE  115

Query  578  EHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFDLA  399
            EHR FL+GLEKLG+GDWRGIS++FVTTRTPTQ+ASHAQKYFLR  SL+  KRR SLFD+ 
Sbjct  116  EHRTFLIGLEKLGKGDWRGISKNFVTTRTPTQVASHAQKYFLRLASLNKKKRRSSLFDMV  175



>gb|ABK26274.1| unknown [Picea sitchensis]
Length=331

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 112/187 (60%), Gaps = 36/187 (19%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            + + CS CG +GH+SR C +          GS+KLFGV+LI +                 
Sbjct  5    LLKMCSHCGHSGHSSRACPDR---------GSVKLFGVRLIAT-----------------  38

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCG------YISDGLV--CGNLPEKK  603
              +D +     S +  + G    L++ N       CG      Y+SDGLV    N  E+K
Sbjct  39   --NDGMACMRKSLSMGNLGHYRSLYNINHCSGTSECGSADQDGYLSDGLVHSSSNARERK  96

Query  602  RGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKR  423
            +GVPWSEEEHR+FL GLEKLG+GDWRGISR+FVTTRTPTQ+ASHAQKYFLR +SL+  KR
Sbjct  97   KGVPWSEEEHRMFLYGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKYFLRQSSLNKRKR  156

Query  422  RRSLFDL  402
            R SLFD+
Sbjct  157  RSSLFDM  163



>ref|XP_006450815.1| hypothetical protein CICLE_v10009011mg [Citrus clementina]
 gb|ESR64055.1| hypothetical protein CICLE_v10009011mg [Citrus clementina]
Length=305

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 125/185 (68%), Gaps = 8/185 (4%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCN--NNNEQ----RTSSHGGSMKLFGVKL-IGSHQNysssssy  780
            M RKCS CG TGHNSRTC+  +NN +     TS+  G ++LFGV+L I S+ + SSSS  
Sbjct  1    MGRKCSHCGNTGHNSRTCSSYDNNLKGGSCSTSTLAGGLRLFGVQLAISSNSSSSSSSQL  60

Query  779  sfvmkksfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKR  600
              + K   +D      S S + SS  S+G   + +        GYISD L+     ++K+
Sbjct  61   LPLKKSLSTDSFPAIPSPSSSASSSSSTGVTINIDQHSNKLSNGYISDSLIAPT-QDRKK  119

Query  599  GVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRR  420
            GVPW+EEEHR+FL+GLEKLGRGDWRGIS++FVTTRTPTQ+ASHAQKYFLR  +L+  KRR
Sbjct  120  GVPWTEEEHRVFLMGLEKLGRGDWRGISKNFVTTRTPTQVASHAQKYFLRQKNLYKRKRR  179

Query  419  RSLFD  405
             SLFD
Sbjct  180  PSLFD  184



>gb|EAY96856.1| hypothetical protein OsI_18777 [Oryza sativa Indica Group]
Length=287

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 96/203 (47%), Positives = 122/203 (60%), Gaps = 38/203 (19%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHG-----------------GSMKLFGVKL-IG  813
            M RKCSSCG  GHNSRTC+    QR   H                  G ++LFGV+L +G
Sbjct  1    MARKCSSCGNNGHNSRTCSG---QRVLDHSISSGNSGSTTAAAATACGGLRLFGVQLQVG  57

Query  812  SHQNysssssysfvmkksfSDDCLPaas-----ysfadssfgssgFLFDENFDGKVPGCG  648
               +                 +CL + +      S + SS  SS    +EN + +V   G
Sbjct  58   GGSSPLKKCLSM---------ECLASPAYYGASASPSVSSSSSSLVSIEENTE-RVSN-G  106

Query  647  YISDGLVCGNLPEKKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHA  468
            Y+SDGL+ G + E+K+GVPW+EEEH++FL GL+KLG+GDWRGISRHFVTTRTPTQ+ASHA
Sbjct  107  YLSDGLM-GRVQERKKGVPWTEEEHQMFLAGLDKLGKGDWRGISRHFVTTRTPTQVASHA  165

Query  467  QKYFLRHNSLHSTKRRRSLFDLA  399
            QKYFLR NS+   KRR SLFD+ 
Sbjct  166  QKYFLRQNSMTQKKRRSSLFDVV  188



>ref|XP_006475946.1| PREDICTED: transcription factor DIVARICATA-like isoform X2 [Citrus 
sinensis]
Length=304

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 126/186 (68%), Gaps = 8/186 (4%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCN--NNNEQ----RTSSHGGSMKLFGVKL-IGSHQNysssssy  780
            M RKCS CG TGHNSRTC+  +NN +     TS+  G ++LFGV+L I S+ + SSSS  
Sbjct  1    MGRKCSHCGNTGHNSRTCSSYDNNLKGGSCSTSTLAGGLRLFGVQLAISSNSSSSSSSQL  60

Query  779  sfvmkksfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKR  600
              + K   +D      S S + SS  S+G   + +        GYISD L+     ++K+
Sbjct  61   LPLKKSLSTDSFPAIPSPSSSASSSSSTGVTINIDQHSNKLSNGYISDSLIAPT-QDRKK  119

Query  599  GVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRR  420
            GVPW+EEEHR+FL+GLEKLGRGDWRGIS++FVTTRTPTQ+ASHAQKYFLR  +L+  KRR
Sbjct  120  GVPWTEEEHRVFLMGLEKLGRGDWRGISKNFVTTRTPTQVASHAQKYFLRPKNLYKRKRR  179

Query  419  RSLFDL  402
             SLFD+
Sbjct  180  PSLFDM  185



>ref|XP_004135816.1| PREDICTED: uncharacterized protein LOC101217799, partial [Cucumis 
sativus]
Length=263

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 101/210 (48%), Positives = 134/210 (64%), Gaps = 22/210 (10%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNN------NNEQRTSSHGGSMKLFGVKL--------------  819
            M RKCS CG  GHNSRTC+N            ++  G ++LFGV L              
Sbjct  1    MGRKCSHCGNIGHNSRTCSNIRGSIITPNLNVANTCGLVRLFGVHLDSYSSSSTSSSTTS  60

Query  818  IGSHQNysssssysfvmkksfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYIS  639
              S+ +YSSS++ +F +KKSFS DCL ++S S +     +      E++  K P  GY+S
Sbjct  61   SSSNASYSSSTASAFSIKKSFSTDCLSSSSTSSSRIHIDNHHHHHLEHY-SKSPSNGYLS  119

Query  638  DGLVCGNLPEKKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKY  459
            DGL+ G+  E+K+GVPW+EEEHR FL+GLEKLGRGDWRGIS+++VTTRTPTQ+ASHAQKY
Sbjct  120  DGLLNGD-QERKKGVPWTEEEHRKFLIGLEKLGRGDWRGISKNYVTTRTPTQVASHAQKY  178

Query  458  FLRHNSLHSTKRRRSLFDLAWKADECRVLC  369
            FLR ++L+   RR SLFD+   A E   + 
Sbjct  179  FLRQSTLNKKNRRSSLFDMVGTAYETTTIA  208



>ref|XP_004158442.1| PREDICTED: uncharacterized protein LOC101231239, partial [Cucumis 
sativus]
Length=274

 Score =   148 bits (373),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 101/210 (48%), Positives = 134/210 (64%), Gaps = 22/210 (10%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNN------NNEQRTSSHGGSMKLFGVKL--------------  819
            M RKCS CG  GHNSRTC+N            ++  G ++LFGV L              
Sbjct  1    MGRKCSHCGNIGHNSRTCSNIRGSIITPNLNVANTCGLVRLFGVHLDSYSSSSTSSSTTS  60

Query  818  IGSHQNysssssysfvmkksfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYIS  639
              S+ +YSSS++ +F +KKSFS DCL ++S S +     +      E++  K P  GY+S
Sbjct  61   SSSNASYSSSTASAFSIKKSFSTDCLSSSSTSSSRIHIDNHHHHHLEHY-SKSPSNGYLS  119

Query  638  DGLVCGNLPEKKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKY  459
            DGL+ G+  E+K+GVPW+EEEHR FL+GLEKLGRGDWRGIS+++VTTRTPTQ+ASHAQKY
Sbjct  120  DGLLNGD-QERKKGVPWTEEEHRKFLIGLEKLGRGDWRGISKNYVTTRTPTQVASHAQKY  178

Query  458  FLRHNSLHSTKRRRSLFDLAWKADECRVLC  369
            FLR ++L+   RR SLFD+   A E   + 
Sbjct  179  FLRQSTLNKKNRRSSLFDMVGTAYETTTIA  208



>ref|XP_004960912.1| PREDICTED: transcription factor MYB1R1-like [Setaria italica]
Length=300

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 99/200 (50%), Positives = 122/200 (61%), Gaps = 18/200 (9%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHG----------GSMKLFGVKL-IGSHQNyss  792
            M RKCSSCG  GHNSRTC+       S             G ++LFGV+L +GSH     
Sbjct  1    MARKCSSCGNNGHNSRTCSGYRGHENSISTSSNSSGNTSCGGLRLFGVQLQVGSHPLKKC  60

Query  791  sssy----sfvmkksfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVC  624
             S      +     + +     A+S S + SS  SS    +EN +    G  Y+SDGL+ 
Sbjct  61   LSMECLSPAAYYGAAAAAAAAAASSLSPSVSSSSSSLVSIEENSERVSSG--YMSDGLM-  117

Query  623  GNLPEKKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHN  444
            G + E+K+GVPW+EEEHR+FL GL+KLG+GDWRGISRHFVTTRTPTQ+ASHAQKYFLR N
Sbjct  118  GRVQERKKGVPWTEEEHRMFLAGLDKLGKGDWRGISRHFVTTRTPTQVASHAQKYFLRQN  177

Query  443  SLHSTKRRRSLFDLAWKADE  384
            SL   KRR SLFD    A +
Sbjct  178  SLTQKKRRSSLFDAVEGAKK  197



>emb|CAN66264.1| hypothetical protein VITISV_041371 [Vitis vinifera]
Length=297

 Score =   148 bits (374),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 94/180 (52%), Positives = 113/180 (63%), Gaps = 13/180 (7%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            M RKCS CG  GHNSRTC +          G ++LFGV+L  S  + +   S+S     S
Sbjct  1    MGRKCSHCGNIGHNSRTCISYKGTVV----GGLRLFGVQLDLSSSSIAMKKSFSMESLPS  56

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKRGVPWSEE  579
                    AS     SS  SS    DEN D  +   GY+SDGL+  +  E+K+GVPW+EE
Sbjct  57   SL------ASSPSPSSSLCSSRVSMDENSDKAM--NGYLSDGLIARSQ-ERKKGVPWTEE  107

Query  578  EHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFDLA  399
            EHR FL GLEKLG+GDWRGISR+FVTTRTPTQ+ASHAQKYFLR  +L   KRR SLFD+ 
Sbjct  108  EHRTFLAGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKYFLRQATLSKKKRRSSLFDMV  167



>ref|XP_002282498.1| PREDICTED: uncharacterized protein LOC100247499 [Vitis vinifera]
 emb|CBI27930.3| unnamed protein product [Vitis vinifera]
Length=297

 Score =   148 bits (374),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 94/180 (52%), Positives = 113/180 (63%), Gaps = 13/180 (7%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            M RKCS CG  GHNSRTC +          G ++LFGV+L  S  + +   S+S     S
Sbjct  1    MGRKCSHCGNIGHNSRTCISYKGTVV----GGLRLFGVQLDLSSSSIAMKKSFSMESLPS  56

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKRGVPWSEE  579
                    AS     SS  SS    DEN D  +   GY+SDGL+  +  E+K+GVPW+EE
Sbjct  57   SL------ASSPSPSSSLCSSRVSMDENSDKAM--NGYLSDGLIARSQ-ERKKGVPWTEE  107

Query  578  EHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFDLA  399
            EHR FL GLEKLG+GDWRGISR+FVTTRTPTQ+ASHAQKYFLR  +L   KRR SLFD+ 
Sbjct  108  EHRTFLAGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKYFLRQATLSKKKRRSSLFDMV  167



>ref|XP_003525309.1| PREDICTED: transcription factor MYB1R1 [Glycine max]
 gb|KHM99844.1| Transcription factor MYB1R1 [Glycine soja]
Length=266

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 94/180 (52%), Positives = 112/180 (62%), Gaps = 21/180 (12%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            M RKCS CG  GHNSRTC +    R +S  G ++LFGV+L                   +
Sbjct  1    MGRKCSHCGTIGHNSRTCTS---LRGTSFVG-LRLFGVQL--------------DTTCVT  42

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKRGVPWSEE  579
                    +  S + SSF SS    DEN D      GY+SDGL+     E+K+GVPW+EE
Sbjct  43   IKKSFSMDSLPSSSSSSFSSSRITIDENSDRT--SFGYLSDGLL-ARAQERKKGVPWTEE  99

Query  578  EHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFDLA  399
            EHRIFLVGLEKLG+GDWRGISR+FVTTRTPTQ+ASHAQKYFLR  ++   KRR SLFDL 
Sbjct  100  EHRIFLVGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKYFLRLATMDKKKRRSSLFDLV  159



>ref|XP_004245108.1| PREDICTED: transcription factor MYB1R1-like [Solanum lycopersicum]
Length=269

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 100/199 (50%), Positives = 116/199 (58%), Gaps = 25/199 (13%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRT-----SSHGGSMKLFGVKLIGSHQNysssssysf  774
            M RKCS CG TGHNSRTC  + +++          G MKLFGVKL               
Sbjct  1    MGRKCSHCGITGHNSRTCKTHKDEKIIYDEDPKTIGMMKLFGVKL----------EVPCS  50

Query  773  vmkksfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKRGV  594
             MKKSFS DCL  +S + +  +     +    N        GY+SD  V      KK+GV
Sbjct  51   WMKKSFSVDCLSNSSKTSSSMAASKFSYCDISN--------GYLSD--VGRASSYKKKGV  100

Query  593  PWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRS  414
             W+EEEHRIFLVGLEKLG+GDWRGIS +FVTTRTPTQ+ASHAQKYFLR NSL   KRRRS
Sbjct  101  AWTEEEHRIFLVGLEKLGKGDWRGISSNFVTTRTPTQVASHAQKYFLRQNSLSKKKRRRS  160

Query  413  LFDLAWKADECRVLCGKMA  357
            LFD         +L  KM 
Sbjct  161  LFDKVGMDKSTMLLFDKMV  179



>ref|NP_001054863.1| Os05g0195700 [Oryza sativa Japonica Group]
 gb|AAT38072.1| putative Myb-related transcription factor [Oryza sativa Japonica 
Group]
 dbj|BAF16777.1| Os05g0195700 [Oryza sativa Japonica Group]
 dbj|BAG89578.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87919.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62638.1| hypothetical protein OsJ_17441 [Oryza sativa Japonica Group]
Length=287

 Score =   148 bits (373),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 96/203 (47%), Positives = 122/203 (60%), Gaps = 38/203 (19%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHG-----------------GSMKLFGVKL-IG  813
            M RKCSSCG  GHNSRTC+    QR   H                  G ++LFGV+L +G
Sbjct  1    MARKCSSCGNNGHNSRTCSG---QRVLDHSISSSNSGSTTAAAATACGGLRLFGVQLQVG  57

Query  812  SHQNysssssysfvmkksfSDDCLPaas-----ysfadssfgssgFLFDENFDGKVPGCG  648
               +                 +CL + +      S + SS  SS    +EN + +V   G
Sbjct  58   GGSSPLKKCLSM---------ECLASPAYYGASASPSVSSSSSSLVSIEENTE-RVSN-G  106

Query  647  YISDGLVCGNLPEKKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHA  468
            Y+SDGL+ G + E+K+GVPW+EEEH++FL GL+KLG+GDWRGISRHFVTTRTPTQ+ASHA
Sbjct  107  YLSDGLM-GRVQERKKGVPWTEEEHQMFLAGLDKLGKGDWRGISRHFVTTRTPTQVASHA  165

Query  467  QKYFLRHNSLHSTKRRRSLFDLA  399
            QKYFLR NS+   KRR SLFD+ 
Sbjct  166  QKYFLRQNSMTQKKRRSSLFDVV  188



>ref|XP_006654137.1| PREDICTED: transcription factor MYB1R1-like [Oryza brachyantha]
Length=286

 Score =   148 bits (373),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 120/201 (60%), Gaps = 34/201 (17%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHG---------------GSMKLFGVKL-IGSH  807
            M RKCSSCG  GHNSRTC+       SS                 G ++LFGV+L +G  
Sbjct  1    MARKCSSCGNNGHNSRTCSGQRILENSSSSSSYTATAAAAAAVTCGGLRLFGVQLQVGGS  60

Query  806  QNysssssysfvmkksfSDDCLPa-----asysfadssfgssgFLFDENFDGKVPGCGYI  642
                   S           +CLP+     A+ S + SS  SS    +EN +      GY+
Sbjct  61   SPLKKCISM----------ECLPSPAYYGAAASPSVSSSSSSLVSIEENTERI--SSGYL  108

Query  641  SDGLVCGNLPEKKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQK  462
            SDGL+ G   E+K+GVPW+E+EHR+FL GL+KLG+GDWRGIS+HFVTTRTPTQ+ASHAQK
Sbjct  109  SDGLM-GRGQERKKGVPWTEDEHRMFLAGLDKLGKGDWRGISQHFVTTRTPTQVASHAQK  167

Query  461  YFLRHNSLHSTKRRRSLFDLA  399
            YFLR NSL   KRR SLFD+ 
Sbjct  168  YFLRQNSLTQKKRRSSLFDVV  188



>ref|XP_007218820.1| hypothetical protein PRUPE_ppa010092mg [Prunus persica]
 gb|EMJ20019.1| hypothetical protein PRUPE_ppa010092mg [Prunus persica]
Length=264

 Score =   147 bits (371),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 82/184 (45%), Positives = 106/184 (58%), Gaps = 24/184 (13%)
 Frame = -2

Query  932  RKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkksfS  753
            RKCS CG  GHNSRTCNNN      + G  +KLFGV ++    +    S     ++ + +
Sbjct  2    RKCSHCGHNGHNSRTCNNNGHGHGQNKGVCLKLFGVNIMEKEDDSMKKSYSMGNLQAAGN  61

Query  752  DDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGN----LPEKKRGVPWS  585
             D                     + N        GY+SDGL+         E+K+G PW+
Sbjct  62   AD--------------------HNNNVVTIDHDAGYLSDGLIHNKKHKAAHERKKGRPWT  101

Query  584  EEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFD  405
            EEEHR+FL GL+KLG+GDWRGI+R+FVTTRTPTQ+ASHAQKYFLR  +    KRR SLFD
Sbjct  102  EEEHRVFLAGLKKLGKGDWRGIARNFVTTRTPTQVASHAQKYFLRQATYDKRKRRSSLFD  161

Query  404  LAWK  393
            + +K
Sbjct  162  MQFK  165



>ref|XP_008795522.1| PREDICTED: transcription factor MYB1R1-like [Phoenix dactylifera]
Length=313

 Score =   148 bits (374),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 92/184 (50%), Positives = 113/184 (61%), Gaps = 12/184 (7%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            M RKCS CG  GHNSRTC+     R     G ++LFGV+L+ ++    S S+        
Sbjct  1    MGRKCSHCGNNGHNSRTCST---PRGVVGSGGLRLFGVQLLLTYPMKKSLSTECLASSSY  57

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKRGVPWSEE  579
             +         +   SS  SS    DE    K    GY+SDGL+ G  PE+K+G+PW+EE
Sbjct  58   LASS------SASPSSSCSSSLVSIDETT--KKISNGYLSDGLL-GATPERKKGLPWTEE  108

Query  578  EHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFDLA  399
            EHR FL GLE LG+GDWRGISR FVTTRTPTQ+ASHAQKYFLR NSL+  KRR S+FD+ 
Sbjct  109  EHRSFLTGLEILGKGDWRGISRSFVTTRTPTQVASHAQKYFLRQNSLNEKKRRSSVFDVV  168

Query  398  WKAD  387
               D
Sbjct  169  AGCD  172



>gb|AFV78981.1| myb-related protein [Pinus sylvestris]
 gb|AFV78986.1| myb-related protein [Pinus sylvestris]
 gb|AFV78987.1| myb-related protein [Pinus sylvestris]
 gb|AFV78989.1| myb-related protein [Pinus sylvestris]
 gb|AFV78997.1| myb-related protein [Pinus sylvestris]
 gb|AFV79018.1| myb-related protein [Pinus sylvestris]
 gb|AFV79028.1| myb-related protein [Pinus sylvestris]
 gb|AFV79033.1| myb-related protein [Pinus sylvestris]
 gb|AFV79038.1| myb-related protein [Pinus sylvestris]
 gb|AFV79041.1| myb-related protein [Pinus sylvestris]
 gb|AFV79043.1| myb-related protein [Pinus sylvestris]
 gb|AFV79056.1| myb-related protein [Pinus sylvestris]
 gb|AFV79073.1| myb-related protein [Pinus sylvestris]
Length=331

 Score =   149 bits (375),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 110/183 (60%), Gaps = 36/183 (20%)
 Frame = -2

Query  926  CSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkksfSDD  747
            CS+CG +GH+SR C +          GS+KLFGV+LI +                   DD
Sbjct  9    CSNCGHSGHSSRACPDR---------GSVKLFGVRLIAT-------------------DD  40

Query  746  CLPaasysfadssfgssgFLFDENFDGKVPGC------GYISDGLV--CGNLPEKKRGVP  591
             +     S +  + G    L++ N       C      GY+SDG V    N  E+K+GVP
Sbjct  41   GMACMRKSLSMGNLGHYRSLYNVNHCSGTSECGSADQDGYLSDGFVHSSSNARERKKGVP  100

Query  590  WSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSL  411
            WSEEEHR+FL GLEKLG+GDWRGISR+FVTTRTPTQ+ASHAQKYFLR ++L+  KRR SL
Sbjct  101  WSEEEHRMFLYGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKYFLRQSNLNKRKRRSSL  160

Query  410  FDL  402
            FD+
Sbjct  161  FDM  163



>gb|AFV79075.1| myb-related protein [Pinus sylvestris]
Length=331

 Score =   149 bits (375),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 110/183 (60%), Gaps = 36/183 (20%)
 Frame = -2

Query  926  CSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkksfSDD  747
            CS+CG +GH+SR C +          GS+KLFGV+LI +                   DD
Sbjct  9    CSNCGHSGHSSRACPDR---------GSVKLFGVRLIAT-------------------DD  40

Query  746  CLPaasysfadssfgssgFLFDENFDGKVPGC------GYISDGLV--CGNLPEKKRGVP  591
             +     S +  + G    L++ N       C      GY+SDG V    N  E+K+GVP
Sbjct  41   GMACMRKSLSMGNLGHYRSLYNVNHCSGTSECGSADQDGYLSDGFVHSSSNARERKKGVP  100

Query  590  WSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSL  411
            WSEEEHR+FL GLEKLG+GDWRGISR+FVTTRTPTQ+ASHAQKYFLR ++L+  KRR SL
Sbjct  101  WSEEEHRMFLYGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKYFLRQSNLNKRKRRSSL  160

Query  410  FDL  402
            FD+
Sbjct  161  FDM  163



>gb|AFV78978.1| myb-related protein [Pinus sylvestris]
 gb|AFV78985.1| myb-related protein [Pinus sylvestris]
 gb|AFV78988.1| myb-related protein [Pinus sylvestris]
 gb|AFV79063.1| myb-related protein [Pinus sylvestris]
Length=331

 Score =   149 bits (375),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 110/183 (60%), Gaps = 36/183 (20%)
 Frame = -2

Query  926  CSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkksfSDD  747
            CS+CG +GH+SR C +          GS+KLFGV+LI +                   DD
Sbjct  9    CSNCGHSGHSSRACPDR---------GSVKLFGVRLIAT-------------------DD  40

Query  746  CLPaasysfadssfgssgFLFDENFDGKVPGC------GYISDGLV--CGNLPEKKRGVP  591
             +     S +  + G    L++ N       C      GY+SDG V    N  E+K+GVP
Sbjct  41   GMACMRKSLSMGNLGHYRSLYNVNHCSGTSECGSADQDGYLSDGFVHSSSNARERKKGVP  100

Query  590  WSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSL  411
            WSEEEHR+FL GLEKLG+GDWRGISR+FVTTRTPTQ+ASHAQKYFLR ++L+  KRR SL
Sbjct  101  WSEEEHRMFLYGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKYFLRQSNLNKRKRRSSL  160

Query  410  FDL  402
            FD+
Sbjct  161  FDM  163



>gb|AFV78976.1| myb-related protein [Pinus sylvestris]
 gb|AFV78983.1| myb-related protein [Pinus sylvestris]
 gb|AFV79003.1| myb-related protein [Pinus sylvestris]
 gb|AFV79007.1| myb-related protein [Pinus sylvestris]
 gb|AFV79008.1| myb-related protein [Pinus sylvestris]
 gb|AFV79010.1| myb-related protein [Pinus sylvestris]
 gb|AFV79011.1| myb-related protein [Pinus sylvestris]
 gb|AFV79015.1| myb-related protein [Pinus sylvestris]
 gb|AFV79016.1| myb-related protein [Pinus sylvestris]
 gb|AFV79039.1| myb-related protein [Pinus sylvestris]
 gb|AFV79070.1| myb-related protein [Pinus sylvestris]
 gb|AFV79085.1| myb-related protein [Pinus sylvestris]
Length=331

 Score =   149 bits (375),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 110/183 (60%), Gaps = 36/183 (20%)
 Frame = -2

Query  926  CSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkksfSDD  747
            CS+CG +GH+SR C +          GS+KLFGV+LI +                   DD
Sbjct  9    CSNCGHSGHSSRACPDR---------GSVKLFGVRLIAT-------------------DD  40

Query  746  CLPaasysfadssfgssgFLFDENFDGKVPGC------GYISDGLV--CGNLPEKKRGVP  591
             +     S +  + G    L++ N       C      GY+SDG V    N  E+K+GVP
Sbjct  41   GMACMRKSLSMGNLGHYRSLYNVNHCSGTSECGSADQDGYLSDGFVHSSSNARERKKGVP  100

Query  590  WSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSL  411
            WSEEEHR+FL GLEKLG+GDWRGISR+FVTTRTPTQ+ASHAQKYFLR ++L+  KRR SL
Sbjct  101  WSEEEHRMFLYGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKYFLRQSNLNKRKRRSSL  160

Query  410  FDL  402
            FD+
Sbjct  161  FDM  163



>gb|AFV78996.1| myb-related protein [Pinus sylvestris]
Length=331

 Score =   149 bits (375),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 110/183 (60%), Gaps = 36/183 (20%)
 Frame = -2

Query  926  CSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkksfSDD  747
            CS+CG +GH+SR C +          GS+KLFGV+LI +                   DD
Sbjct  9    CSNCGHSGHSSRACPDR---------GSVKLFGVRLIAT-------------------DD  40

Query  746  CLPaasysfadssfgssgFLFDENFDGKVPGC------GYISDGLV--CGNLPEKKRGVP  591
             +     S +  + G    L++ N       C      GY+SDG V    N  E+K+GVP
Sbjct  41   GMACMRKSLSMGNLGHYRSLYNVNHCSGTSECGSADQDGYLSDGFVHSSSNARERKKGVP  100

Query  590  WSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSL  411
            WSEEEHR+FL GLEKLG+GDWRGISR+FVTTRTPTQ+ASHAQKYFLR ++L+  KRR SL
Sbjct  101  WSEEEHRMFLYGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKYFLRQSNLNKRKRRSSL  160

Query  410  FDL  402
            FD+
Sbjct  161  FDM  163



>ref|XP_006475945.1| PREDICTED: transcription factor DIVARICATA-like isoform X1 [Citrus 
sinensis]
Length=305

 Score =   148 bits (374),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 125/185 (68%), Gaps = 8/185 (4%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCN--NNNEQ----RTSSHGGSMKLFGVKL-IGSHQNysssssy  780
            M RKCS CG TGHNSRTC+  +NN +     TS+  G ++LFGV+L I S+ + SSSS  
Sbjct  1    MGRKCSHCGNTGHNSRTCSSYDNNLKGGSCSTSTLAGGLRLFGVQLAISSNSSSSSSSQL  60

Query  779  sfvmkksfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKR  600
              + K   +D      S S + SS  S+G   + +        GYISD L+     ++K+
Sbjct  61   LPLKKSLSTDSFPAIPSPSSSASSSSSTGVTINIDQHSNKLSNGYISDSLIAPT-QDRKK  119

Query  599  GVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRR  420
            GVPW+EEEHR+FL+GLEKLGRGDWRGIS++FVTTRTPTQ+ASHAQKYFLR  +L+  KRR
Sbjct  120  GVPWTEEEHRVFLMGLEKLGRGDWRGISKNFVTTRTPTQVASHAQKYFLRPKNLYKRKRR  179

Query  419  RSLFD  405
             SLFD
Sbjct  180  PSLFD  184



>gb|AFV79045.1| myb-related protein [Pinus sylvestris]
 gb|AFV79047.1| myb-related protein [Pinus sylvestris]
Length=331

 Score =   149 bits (375),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 110/183 (60%), Gaps = 36/183 (20%)
 Frame = -2

Query  926  CSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkksfSDD  747
            CS+CG +GH+SR C +          GS+KLFGV+LI +                   DD
Sbjct  9    CSNCGHSGHSSRACPDR---------GSVKLFGVRLIAT-------------------DD  40

Query  746  CLPaasysfadssfgssgFLFDENFDGKVPGC------GYISDGLV--CGNLPEKKRGVP  591
             +     S +  + G    L++ N       C      GY+SDG V    N  E+K+GVP
Sbjct  41   GMACMRKSLSMGNLGHYRSLYNVNHCSGTSECGSADQDGYLSDGFVHSSSNARERKKGVP  100

Query  590  WSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSL  411
            WSEEEHR+FL GLEKLG+GDWRGISR+FVTTRTPTQ+ASHAQKYFLR ++L+  KRR SL
Sbjct  101  WSEEEHRMFLYGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKYFLRQSNLNKRKRRSSL  160

Query  410  FDL  402
            FD+
Sbjct  161  FDM  163



>gb|AFV79000.1| myb-related protein [Pinus sylvestris]
Length=331

 Score =   149 bits (375),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 110/183 (60%), Gaps = 36/183 (20%)
 Frame = -2

Query  926  CSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkksfSDD  747
            CS+CG +GH+SR C +          GS+KLFGV+LI +                   DD
Sbjct  9    CSNCGHSGHSSRACPDR---------GSVKLFGVRLIAT-------------------DD  40

Query  746  CLPaasysfadssfgssgFLFDENFDGKVPGC------GYISDGLV--CGNLPEKKRGVP  591
             +     S +  + G    L++ N       C      GY+SDG V    N  E+K+GVP
Sbjct  41   GMACMRKSLSMGNLGHYRSLYNVNHCSGTSECGSADQDGYLSDGFVHSSSNARERKKGVP  100

Query  590  WSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSL  411
            WSEEEHR+FL GLEKLG+GDWRGISR+FVTTRTPTQ+ASHAQKYFLR ++L+  KRR SL
Sbjct  101  WSEEEHRMFLYGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKYFLRQSNLNKRKRRSSL  160

Query  410  FDL  402
            FD+
Sbjct  161  FDM  163



>gb|AFV78994.1| myb-related protein [Pinus sylvestris]
Length=331

 Score =   149 bits (375),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 110/183 (60%), Gaps = 36/183 (20%)
 Frame = -2

Query  926  CSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkksfSDD  747
            CS+CG +GH+SR C +          GS+KLFGV+LI +                   DD
Sbjct  9    CSNCGHSGHSSRACPDR---------GSVKLFGVRLIAT-------------------DD  40

Query  746  CLPaasysfadssfgssgFLFDENFDGKVPGC------GYISDGLV--CGNLPEKKRGVP  591
             +     S +  + G    L++ N       C      GY+SDG V    N  E+K+GVP
Sbjct  41   GMACMRKSLSMGNLGHYRSLYNVNHCSGTSECGSADQDGYLSDGFVHSSSNARERKKGVP  100

Query  590  WSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSL  411
            WSEEEHR+FL GLEKLG+GDWRGISR+FVTTRTPTQ+ASHAQKYFLR ++L+  KRR SL
Sbjct  101  WSEEEHRMFLYGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKYFLRQSNLNKRKRRSSL  160

Query  410  FDL  402
            FD+
Sbjct  161  FDM  163



>gb|AFV79077.1| myb-related protein [Pinus sylvestris]
 gb|AFV79080.1| myb-related protein [Pinus sylvestris]
 gb|AFV79082.1| myb-related protein [Pinus sylvestris]
Length=331

 Score =   149 bits (375),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 110/183 (60%), Gaps = 36/183 (20%)
 Frame = -2

Query  926  CSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkksfSDD  747
            CS+CG +GH+SR C +          GS+KLFGV+LI +                   DD
Sbjct  9    CSNCGHSGHSSRACPDR---------GSVKLFGVRLIAT-------------------DD  40

Query  746  CLPaasysfadssfgssgFLFDENFDGKVPGC------GYISDGLV--CGNLPEKKRGVP  591
             +     S +  + G    L++ N       C      GY+SDG V    N  E+K+GVP
Sbjct  41   GMACMRKSLSMGNLGHYRSLYNVNHCSGTSECGSADQDGYLSDGFVHSSSNARERKKGVP  100

Query  590  WSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSL  411
            WSEEEHR+FL GLEKLG+GDWRGISR+FVTTRTPTQ+ASHAQKYFLR ++L+  KRR SL
Sbjct  101  WSEEEHRMFLYGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKYFLRQSNLNKRKRRSSL  160

Query  410  FDL  402
            FD+
Sbjct  161  FDM  163



>gb|AFV78990.1| myb-related protein [Pinus sylvestris]
 gb|AFV78993.1| myb-related protein [Pinus sylvestris]
 gb|AFV79037.1| myb-related protein [Pinus sylvestris]
Length=331

 Score =   149 bits (375),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 110/183 (60%), Gaps = 36/183 (20%)
 Frame = -2

Query  926  CSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkksfSDD  747
            CS+CG +GH+SR C +          GS+KLFGV+LI +                   DD
Sbjct  9    CSNCGHSGHSSRACPDR---------GSVKLFGVRLIAT-------------------DD  40

Query  746  CLPaasysfadssfgssgFLFDENFDGKVPGC------GYISDGLV--CGNLPEKKRGVP  591
             +     S +  + G    L++ N       C      GY+SDG V    N  E+K+GVP
Sbjct  41   GMACMRKSLSMGNLGHYRSLYNVNHCSGTSECGSADQDGYLSDGFVHSSSNARERKKGVP  100

Query  590  WSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSL  411
            WSEEEHR+FL GLEKLG+GDWRGISR+FVTTRTPTQ+ASHAQKYFLR ++L+  KRR SL
Sbjct  101  WSEEEHRMFLYGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKYFLRQSNLNKRKRRSSL  160

Query  410  FDL  402
            FD+
Sbjct  161  FDM  163



>gb|AFV78975.1| myb-related protein [Pinus sylvestris]
 gb|AFV78999.1| myb-related protein [Pinus sylvestris]
 gb|AFV79002.1| myb-related protein [Pinus sylvestris]
 gb|AFV79012.1| myb-related protein [Pinus sylvestris]
 gb|AFV79013.1| myb-related protein [Pinus sylvestris]
 gb|AFV79017.1| myb-related protein [Pinus sylvestris]
 gb|AFV79022.1| myb-related protein [Pinus sylvestris]
 gb|AFV79025.1| myb-related protein [Pinus sylvestris]
 gb|AFV79027.1| myb-related protein [Pinus sylvestris]
 gb|AFV79029.1| myb-related protein [Pinus sylvestris]
 gb|AFV79034.1| myb-related protein [Pinus sylvestris]
 gb|AFV79036.1| myb-related protein [Pinus sylvestris]
 gb|AFV79040.1| myb-related protein [Pinus sylvestris]
 gb|AFV79044.1| myb-related protein [Pinus sylvestris]
 gb|AFV79046.1| myb-related protein [Pinus sylvestris]
 gb|AFV79050.1| myb-related protein [Pinus sylvestris]
 gb|AFV79051.1| myb-related protein [Pinus sylvestris]
 gb|AFV79054.1| myb-related protein [Pinus sylvestris]
 gb|AFV79055.1| myb-related protein [Pinus sylvestris]
 gb|AFV79057.1| myb-related protein [Pinus sylvestris]
 gb|AFV79060.1| myb-related protein [Pinus sylvestris]
 gb|AFV79067.1| myb-related protein [Pinus sylvestris]
 gb|AFV79069.1| myb-related protein [Pinus sylvestris]
 gb|AFV79071.1| myb-related protein [Pinus sylvestris]
Length=331

 Score =   149 bits (375),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 110/183 (60%), Gaps = 36/183 (20%)
 Frame = -2

Query  926  CSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkksfSDD  747
            CS+CG +GH+SR C +          GS+KLFGV+LI +                   DD
Sbjct  9    CSNCGHSGHSSRACPDR---------GSVKLFGVRLIAT-------------------DD  40

Query  746  CLPaasysfadssfgssgFLFDENFDGKVPGC------GYISDGLV--CGNLPEKKRGVP  591
             +     S +  + G    L++ N       C      GY+SDG V    N  E+K+GVP
Sbjct  41   GMACMRKSLSMGNLGHYRSLYNVNHCSGTSECGSADQDGYLSDGFVHSSSNARERKKGVP  100

Query  590  WSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSL  411
            WSEEEHR+FL GLEKLG+GDWRGISR+FVTTRTPTQ+ASHAQKYFLR ++L+  KRR SL
Sbjct  101  WSEEEHRMFLYGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKYFLRQSNLNKRKRRSSL  160

Query  410  FDL  402
            FD+
Sbjct  161  FDM  163



>gb|AFV78977.1| myb-related protein [Pinus sylvestris]
 gb|AFV78979.1| myb-related protein [Pinus sylvestris]
 gb|AFV78980.1| myb-related protein [Pinus sylvestris]
 gb|AFV78982.1| myb-related protein [Pinus sylvestris]
 gb|AFV78984.1| myb-related protein [Pinus sylvestris]
 gb|AFV78991.1| myb-related protein [Pinus sylvestris]
 gb|AFV78995.1| myb-related protein [Pinus sylvestris]
 gb|AFV78998.1| myb-related protein [Pinus sylvestris]
 gb|AFV79001.1| myb-related protein [Pinus sylvestris]
 gb|AFV79004.1| myb-related protein [Pinus sylvestris]
 gb|AFV79005.1| myb-related protein [Pinus sylvestris]
 gb|AFV79006.1| myb-related protein [Pinus sylvestris]
 gb|AFV79009.1| myb-related protein [Pinus sylvestris]
 gb|AFV79014.1| myb-related protein [Pinus sylvestris]
 gb|AFV79019.1| myb-related protein [Pinus sylvestris]
 gb|AFV79020.1| myb-related protein [Pinus sylvestris]
 gb|AFV79021.1| myb-related protein [Pinus sylvestris]
 gb|AFV79023.1| myb-related protein [Pinus sylvestris]
 gb|AFV79030.1| myb-related protein [Pinus sylvestris]
 gb|AFV79031.1| myb-related protein [Pinus sylvestris]
 gb|AFV79032.1| myb-related protein [Pinus sylvestris]
 gb|AFV79035.1| myb-related protein [Pinus sylvestris]
 gb|AFV79048.1| myb-related protein [Pinus sylvestris]
 gb|AFV79049.1| myb-related protein [Pinus sylvestris]
 gb|AFV79052.1| myb-related protein [Pinus sylvestris]
 gb|AFV79059.1| myb-related protein [Pinus sylvestris]
 gb|AFV79061.1| myb-related protein [Pinus sylvestris]
 gb|AFV79062.1| myb-related protein [Pinus sylvestris]
 gb|AFV79064.1| myb-related protein [Pinus sylvestris]
 gb|AFV79065.1| myb-related protein [Pinus sylvestris]
 gb|AFV79066.1| myb-related protein [Pinus sylvestris]
 gb|AFV79068.1| myb-related protein [Pinus sylvestris]
 gb|AFV79072.1| myb-related protein [Pinus sylvestris]
 gb|AFV79074.1| myb-related protein [Pinus sylvestris]
 gb|AFV79076.1| myb-related protein [Pinus sylvestris]
 gb|AFV79078.1| myb-related protein [Pinus sylvestris]
 gb|AFV79079.1| myb-related protein [Pinus sylvestris]
 gb|AFV79081.1| myb-related protein [Pinus sylvestris]
 gb|AFV79083.1| myb-related protein [Pinus sylvestris]
 gb|AFV79084.1| myb-related protein [Pinus sylvestris]
Length=331

 Score =   149 bits (375),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 110/183 (60%), Gaps = 36/183 (20%)
 Frame = -2

Query  926  CSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkksfSDD  747
            CS+CG +GH+SR C +          GS+KLFGV+LI +                   DD
Sbjct  9    CSNCGHSGHSSRACPDR---------GSVKLFGVRLIAT-------------------DD  40

Query  746  CLPaasysfadssfgssgFLFDENFDGKVPGC------GYISDGLV--CGNLPEKKRGVP  591
             +     S +  + G    L++ N       C      GY+SDG V    N  E+K+GVP
Sbjct  41   GMACMRKSLSMGNLGHYRSLYNVNHCSGTSECGSADQDGYLSDGFVHSSSNARERKKGVP  100

Query  590  WSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSL  411
            WSEEEHR+FL GLEKLG+GDWRGISR+FVTTRTPTQ+ASHAQKYFLR ++L+  KRR SL
Sbjct  101  WSEEEHRMFLYGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKYFLRQSNLNKRKRRSSL  160

Query  410  FDL  402
            FD+
Sbjct  161  FDM  163



>gb|AFK46715.1| unknown [Lotus japonicus]
Length=279

 Score =   147 bits (371),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 89/180 (49%), Positives = 112/180 (62%), Gaps = 18/180 (10%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            M RKCS C   GHNSRTC       T S G  ++LFGV+L  S  + S   +    +   
Sbjct  1    MGRKCSHCENIGHNSRTC-------TFSRGVGLRLFGVQLDISSSSPSHHFTIKKSVSMD  53

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKRGVPWSEE  579
                    +  S + S   S   +FD+         GY+SDGL+ G   ++K+GVPW+EE
Sbjct  54   SF-----PSPSSPSSSFSSSRIAIFDDR-----TSIGYLSDGLI-GRPQDRKKGVPWTEE  102

Query  578  EHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFDLA  399
            EHRIFLVGLEKLG+GDWRGIS++FVTTRTPTQ+ASHAQKYFLR  ++ + KRR SLFDL 
Sbjct  103  EHRIFLVGLEKLGKGDWRGISKNFVTTRTPTQVASHAQKYFLRLATIANKKRRSSLFDLV  162



>gb|AFV79024.1| myb-related protein [Pinus sylvestris]
Length=331

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 109/183 (60%), Gaps = 36/183 (20%)
 Frame = -2

Query  926  CSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkksfSDD  747
            CS+CG +GH+SR C +          GS+KLFGV LI +                   DD
Sbjct  9    CSNCGHSGHSSRACPDR---------GSVKLFGVSLIAT-------------------DD  40

Query  746  CLPaasysfadssfgssgFLFDENFDGKVPGC------GYISDGLV--CGNLPEKKRGVP  591
             +     S +  + G    L++ N       C      GY+SDG V    N  E+K+GVP
Sbjct  41   GMACMRKSLSMGNLGHYRSLYNVNHCSGTSECGSADQDGYLSDGFVHSSSNARERKKGVP  100

Query  590  WSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSL  411
            WSEEEHR+FL GLEKLG+GDWRGISR+FVTTRTPTQ+ASHAQKYFLR ++L+  KRR SL
Sbjct  101  WSEEEHRMFLYGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKYFLRQSNLNKRKRRSSL  160

Query  410  FDL  402
            FD+
Sbjct  161  FDM  163



>gb|AFV78992.1| myb-related protein [Pinus sylvestris]
 gb|AFV79058.1| myb-related protein [Pinus sylvestris]
Length=331

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 109/183 (60%), Gaps = 36/183 (20%)
 Frame = -2

Query  926  CSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkksfSDD  747
            CS+CG +GH+SR C +          GS+KLFGV LI +                   DD
Sbjct  9    CSNCGHSGHSSRACPDR---------GSVKLFGVSLIAT-------------------DD  40

Query  746  CLPaasysfadssfgssgFLFDENFDGKVPGC------GYISDGLV--CGNLPEKKRGVP  591
             +     S +  + G    L++ N       C      GY+SDG V    N  E+K+GVP
Sbjct  41   GMACMRKSLSMGNLGHYRSLYNVNHCSGTSECGSADQDGYLSDGFVHSSSNARERKKGVP  100

Query  590  WSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSL  411
            WSEEEHR+FL GLEKLG+GDWRGISR+FVTTRTPTQ+ASHAQKYFLR ++L+  KRR SL
Sbjct  101  WSEEEHRMFLYGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKYFLRQSNLNKRKRRSSL  160

Query  410  FDL  402
            FD+
Sbjct  161  FDM  163



>ref|XP_010924479.1| PREDICTED: transcription factor MYB1R1-like [Elaeis guineensis]
Length=281

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 116/184 (63%), Gaps = 20/184 (11%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKL-IGSHQNysssssysfvmkk  762
            M RKCS CG  GHNSRTC++    R  +    ++LFGV L I S    S S         
Sbjct  1    MGRKCSHCGNNGHNSRTCSS---PRGVACSSGLRLFGVHLHITSPMKKSFSM--------  49

Query  761  sfSDDCLPaasysfadssfgssgFLFDE---NFDGKVPGCGYISDGLVCGNLPEKKRGVP  591
                +CL ++SY  + S+  SS         +   K    GY+SDGL+ G +PE+K+GVP
Sbjct  50   ----ECLTSSSYLASSSASSSSTSSSSLVSIDQTTKKISSGYLSDGLL-GRVPERKKGVP  104

Query  590  WSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSL  411
            W+EEEHR FL GLE LG+GDWRGISR+FVTTRTPTQ+ASHAQKYFLR NSL+   RR SL
Sbjct  105  WTEEEHRSFLAGLENLGKGDWRGISRNFVTTRTPTQVASHAQKYFLRQNSLNKKNRRSSL  164

Query  410  FDLA  399
            FD+ 
Sbjct  165  FDVV  168



>ref|XP_002516455.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45796.1| conserved hypothetical protein [Ricinus communis]
Length=277

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 96/189 (51%), Positives = 120/189 (63%), Gaps = 24/189 (13%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            M RKCS CG  GHNSRTC+   E        S++LFGVKL     + +SSSS    +KKS
Sbjct  1    MGRKCSHCGNVGHNSRTCHFEKE--------SLRLFGVKL-----HSNSSSSSHLFLKKS  47

Query  758  fSDDCLPaasysfadssfgssgFL----------FDENFDGKVPGCGYISDGLVCGNLPE  609
            FS DCL ++S +                      F +N D K+   GY+S+GL       
Sbjct  48   FSVDCLSSSSTTTTPPPPPPPSSSSSSSTTTTSTFGDNVDIKL-STGYLSEGLAAPTQEI  106

Query  608  KKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHST  429
            +K+GVPW+ EEH+IFL+GL+KLG+GDWRGISR+FVTTRTPTQ+ASHAQKYFLR NS +  
Sbjct  107  RKKGVPWTAEEHQIFLLGLQKLGKGDWRGISRNFVTTRTPTQVASHAQKYFLRQNSFNKR  166

Query  428  KRRRSLFDL  402
            KRR SLFD+
Sbjct  167  KRRPSLFDM  175



>gb|AEV91163.1| MYB-related protein [Aegilops speltoides]
Length=278

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 98/194 (51%), Positives = 122/194 (63%), Gaps = 19/194 (10%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQR---------TSSHGGSMKLFGVKLIGSHQNyssss  786
            M RKCS CG  GHNSRTC++  +QR          SS G  ++LFGV++   H     S+
Sbjct  1    MARKCSHCGNYGHNSRTCSSAGKQREVMLCEGGGGSSSGSGLRLFGVQV---HVGAGRST  57

Query  785  sysfvmkksfSDDCLPaasy-----sfadssfgssgFLFDENFDGKVPGCGYISDGLVCG  621
                 M+KS+S DCL  A       S + SS  S     DE  +      GY+SDG    
Sbjct  58   GAGASMRKSYSMDCLQLAVAPSSIVSPSSSSSSSVLLSIDEGLERA--SNGYLSDGPHGR  115

Query  620  NLPEKKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNS  441
             + E+K+GVPWSEEEHR+FLVGLEKLG+GDWRGISR +VTTRTPTQ+ASHAQK+FLR +S
Sbjct  116  LVQERKKGVPWSEEEHRLFLVGLEKLGKGDWRGISRSYVTTRTPTQVASHAQKFFLRQSS  175

Query  440  LHSTKRRRSLFDLA  399
            +   KRR SLFD+ 
Sbjct  176  MGKKKRRSSLFDMV  189



>gb|AFV79042.1| myb-related protein [Pinus sylvestris]
Length=331

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 109/183 (60%), Gaps = 36/183 (20%)
 Frame = -2

Query  926  CSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkksfSDD  747
            CS+CG  GH+SR C +          GS+KLFGV+LI +                   DD
Sbjct  9    CSNCGHGGHSSRACPDR---------GSVKLFGVRLIAT-------------------DD  40

Query  746  CLPaasysfadssfgssgFLFDENFDGKVPGC------GYISDGLV--CGNLPEKKRGVP  591
             +     S +  + G    L++ N       C      GY+SDG V    N  E+K+GVP
Sbjct  41   GMACMRKSLSMGNLGHYRSLYNVNHCSGTSECGSADQDGYLSDGFVHSSSNARERKKGVP  100

Query  590  WSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSL  411
            WSEEEHR+FL GLEKLG+GDWRGISR+FVTTRTPTQ+ASHAQKYFLR ++L+  KRR SL
Sbjct  101  WSEEEHRMFLYGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKYFLRQSNLNKRKRRSSL  160

Query  410  FDL  402
            FD+
Sbjct  161  FDM  163



>ref|XP_002989801.1| hypothetical protein SELMODRAFT_130556, partial [Selaginella 
moellendorffii]
 gb|EFJ09068.1| hypothetical protein SELMODRAFT_130556, partial [Selaginella 
moellendorffii]
Length=153

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/182 (45%), Positives = 106/182 (58%), Gaps = 35/182 (19%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            MTRKCS CG  GHNSRTC +            ++LFGV+L    +  +S  +       +
Sbjct  1    MTRKCSHCGHNGHNSRTCPDRG----------VRLFGVRLTEGMRKSASMGNLLHYNPSA  50

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLV--CGNLPEKKRGVPWS  585
                                   +  E  D      GY+SDGLV    N  E+K+GVPW+
Sbjct  51   -----------------------VTPEPSDSGAIADGYVSDGLVQTSSNARERKKGVPWT  87

Query  584  EEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFD  405
            EEEHR FL+GL+KLG+GDWRGI+++FVTTRTPTQ+ASHAQKYF+R ++L   KRR SLFD
Sbjct  88   EEEHRCFLLGLQKLGKGDWRGIAKNFVTTRTPTQVASHAQKYFIRQSNLSKRKRRSSLFD  147

Query  404  LA  399
            ++
Sbjct  148  IS  149



>gb|AFV79053.1| myb-related protein [Pinus sylvestris]
Length=331

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 86/183 (47%), Positives = 110/183 (60%), Gaps = 36/183 (20%)
 Frame = -2

Query  926  CSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkksfSDD  747
            CS+CG +GH+SR C +          GS+KLFGV+LI +                   D+
Sbjct  9    CSNCGHSGHSSRACPDR---------GSVKLFGVRLIAT-------------------DN  40

Query  746  CLPaasysfadssfgssgFLFDENFDGKVPGCG------YISDGLV--CGNLPEKKRGVP  591
             +     S +  + G    L++ N       CG      Y+SDG V    N  E+K+GVP
Sbjct  41   GMACMRKSLSMGNLGHYRSLYNVNHCSGTSECGSADQDGYLSDGFVHSSSNARERKKGVP  100

Query  590  WSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSL  411
            WSEEEHR+FL GLEKLG+GDWRGISR+FVTTRTPTQ+ASHAQKYFLR ++L+  KRR SL
Sbjct  101  WSEEEHRMFLYGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKYFLRQSNLNKRKRRSSL  160

Query  410  FDL  402
            FD+
Sbjct  161  FDM  163



>gb|AFV79026.1| myb-related protein [Pinus sylvestris]
Length=331

 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 109/183 (60%), Gaps = 36/183 (20%)
 Frame = -2

Query  926  CSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkksfSDD  747
            CS+CG +GH+SR C +          GS+KLFGV+LI +                   DD
Sbjct  9    CSNCGHSGHSSRACPDR---------GSVKLFGVRLIAT-------------------DD  40

Query  746  CLPaasysfadssfgssgFLFDENFDGKVPGCG------YISDGLV--CGNLPEKKRGVP  591
                   S +  + G    L++ N       CG      Y+SDG V    N  E+K+GVP
Sbjct  41   GKACMRKSLSMGNLGHYRSLYNVNHCSGTSECGSADQDGYLSDGFVHSSSNARERKKGVP  100

Query  590  WSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSL  411
            WSEEEHR+FL GLEKLG+GDWRGISR+FVTTRTPTQ+ASHAQKYFLR ++L+  KRR SL
Sbjct  101  WSEEEHRMFLYGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKYFLRQSNLNKRKRRSSL  160

Query  410  FDL  402
            FD+
Sbjct  161  FDM  163



>ref|XP_002990122.1| hypothetical protein SELMODRAFT_131017, partial [Selaginella 
moellendorffii]
 gb|EFJ08839.1| hypothetical protein SELMODRAFT_131017, partial [Selaginella 
moellendorffii]
Length=153

 Score =   142 bits (357),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 81/182 (45%), Positives = 106/182 (58%), Gaps = 35/182 (19%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            MTRKCS CG  GHNSRTC +            ++LFGV+L    +  +S  +       +
Sbjct  1    MTRKCSHCGHNGHNSRTCPDRG----------VRLFGVRLTEGMRKSASMGNLLHYNPSA  50

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLV--CGNLPEKKRGVPWS  585
             +                        E  D      GY+SDGLV    N  E+K+GVPW+
Sbjct  51   ATP-----------------------EPSDSGAIADGYVSDGLVQTSSNARERKKGVPWT  87

Query  584  EEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFD  405
            EEEHR FL+GL+KLG+GDWRGI+++FVTTRTPTQ+ASHAQKYF+R ++L   KRR SLFD
Sbjct  88   EEEHRCFLLGLQKLGKGDWRGIAKNFVTTRTPTQVASHAQKYFIRQSNLSKRKRRSSLFD  147

Query  404  LA  399
            ++
Sbjct  148  IS  149



>gb|AFV79550.1| myb-related protein [Pinus pinaster]
Length=331

 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 109/183 (60%), Gaps = 36/183 (20%)
 Frame = -2

Query  926  CSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkksfSDD  747
            CS+CG +GH+SR C +          GS+KLFGV+LI +                   DD
Sbjct  9    CSNCGHSGHSSRACPDR---------GSVKLFGVRLIAT-------------------DD  40

Query  746  CLPaasysfadssfgssgFLFDENFDGKVPGCG------YISDGLV--CGNLPEKKRGVP  591
             +     S +  + G    L + N       CG      Y+SDG V    N  E+K+GVP
Sbjct  41   GMACMRKSLSMGNLGHYRSLHNVNHCSGTSECGSADQDGYLSDGFVHSSSNARERKKGVP  100

Query  590  WSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSL  411
            WSEEEHR+FL GLEKLG+GDWRGISR+FVTTRTPTQ+ASHAQKYFLR ++L+  KRR SL
Sbjct  101  WSEEEHRMFLYGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKYFLRQSNLNKRKRRSSL  160

Query  410  FDL  402
            FD+
Sbjct  161  FDM  163



>gb|AFK37271.1| unknown [Medicago truncatula]
Length=242

 Score =   144 bits (363),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 91/180 (51%), Positives = 108/180 (60%), Gaps = 18/180 (10%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            M RKCS CG  GHNSRTCN        S  GS    GV+L G   + SSS          
Sbjct  1    MGRKCSHCGNIGHNSRTCN--------SLRGSGSFVGVRLFGVQLDLSSSCVSMKKSFSM  52

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKRGVPWSEE  579
               D  P +S S   S   S   + D          GY+SDGL+     E+K+GVPW+EE
Sbjct  53   ---DSFPTSSSSPTSSFSSSRLTIDDR------ASIGYLSDGLIV-RTQERKKGVPWTEE  102

Query  578  EHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFDLA  399
            EHR FLVGLEKLG+GDWRGISR++VTTRTPTQ+ASHAQKYF+R  +L+  KRR SLFD+ 
Sbjct  103  EHRKFLVGLEKLGKGDWRGISRNYVTTRTPTQVASHAQKYFIRLATLNKKKRRSSLFDMV  162



>gb|ABR18214.1| unknown [Picea sitchensis]
Length=322

 Score =   145 bits (367),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 88/199 (44%), Positives = 112/199 (56%), Gaps = 43/199 (22%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGS------------HQNys  795
            MTRKCS CG  GHNSRTC N            +KLFGV+L               H + +
Sbjct  1    MTRKCSHCGHNGHNSRTCPNRG----------VKLFGVRLTDGPIRKSVSMGNLLHYSNN  50

Query  794  ssssysfvmkksfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNL  615
            +SSS +     S  + C                    +   +      GY+SDGLV  N 
Sbjct  51   ASSSNNSPGSASAMESC--------------------ESVANAAASAEGYVSDGLVHNNS  90

Query  614  -PEKKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSL  438
              E+K+GVPW+EEEHR+FL+GL+KLG+GDWRGISR+FV TRTPTQ+ASHAQKYF+R ++L
Sbjct  91   RGERKKGVPWTEEEHRMFLIGLQKLGKGDWRGISRNFVPTRTPTQVASHAQKYFIRQSNL  150

Query  437  HSTKRRRSLFDLAWKADEC  381
               KRR SLFD+  +   C
Sbjct  151  TRRKRRSSLFDITAEPISC  169



>ref|XP_004143039.1| PREDICTED: uncharacterized protein LOC101204468 [Cucumis sativus]
 gb|KGN62393.1| hypothetical protein Csa_2G351740 [Cucumis sativus]
Length=294

 Score =   145 bits (365),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 99/189 (52%), Positives = 121/189 (64%), Gaps = 15/189 (8%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            M RKCS CG  GHNSRTC     + T       KLFGV+LI +         ++ ++KKS
Sbjct  1    MVRKCSHCGNVGHNSRTCTIQKHKETK-----FKLFGVQLIDNGTTTHHHHHHTTLLKKS  55

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKRGVPWSEE  579
             S D LP++S S + S   SS      N        GY+SDGLV     E+K+GVPWSEE
Sbjct  56   ISLDSLPSSSSSASSSLSSSSSSEKLSN--------GYLSDGLVAKT-HERKKGVPWSEE  106

Query  578  EHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRR-SLFDL  402
            EH++FL+GLEKLG+GDWRGISR FVTTRTPTQ+ASHAQKYFLR  +L+  K+RR SLFD 
Sbjct  107  EHKVFLIGLEKLGKGDWRGISRKFVTTRTPTQVASHAQKYFLRLTTLNKRKQRRPSLFDG  166

Query  401  AWKADECRV  375
            A   D+  V
Sbjct  167  AAARDKLTV  175



>ref|XP_001766974.1| predicted protein [Physcomitrella patens]
 gb|EDQ68140.1| predicted protein [Physcomitrella patens]
Length=187

 Score =   141 bits (356),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 111/182 (61%), Gaps = 27/182 (15%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            M+R+CS CG  GHNSRTC              ++LFGV+L  S  + +   S S      
Sbjct  1    MSRRCSHCGLNGHNSRTCPER----------GVRLFGVRLTDSVSSTNMRKSVSMNNLSH  50

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLV--CGNLPEKKRGVPWS  585
            +S+   PA+                 E ++      GY+SDGLV    N  E+K+GVPW+
Sbjct  51   YSNVHNPASP---------------PEQWESGAAPDGYVSDGLVQTSNNARERKKGVPWT  95

Query  584  EEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFD  405
            E+EHR+FL+GL+KLG+GDWRGISR++V TRTPTQ+ASHAQKYF+R ++L+  KRR SLFD
Sbjct  96   EDEHRLFLLGLQKLGKGDWRGISRNYVHTRTPTQVASHAQKYFIRQSNLNKRKRRSSLFD  155

Query  404  LA  399
            + 
Sbjct  156  IV  157



>ref|XP_004513098.1| PREDICTED: uncharacterized protein LOC101505306 [Cicer arietinum]
Length=299

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 93/187 (50%), Positives = 115/187 (61%), Gaps = 15/187 (8%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            M RKCS CG  GHNSRTCN      +   GG+    GV+L G   + SSS          
Sbjct  1    MGRKCSHCGNIGHNSRTCN------SLRGGGNSSFVGVRLFGVQLDLSSSCVSMKKSFSM  54

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKRGVPWSEE  579
               D L   S S   SSF SS    D+         GY+SDGL+     E+K+GVPW+EE
Sbjct  55   ---DSLFPTSSSSPSSSFSSSRLSIDDR-----TSIGYLSDGLIV-RAQERKKGVPWTEE  105

Query  578  EHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFDLA  399
            EHR FLVGLEKLG+GDWRGISR++VTTRTPTQ+ASHAQKYF+R ++++  KRR SLFD+ 
Sbjct  106  EHRKFLVGLEKLGKGDWRGISRNYVTTRTPTQVASHAQKYFIRLSTINKKKRRSSLFDMV  165

Query  398  WKADECR  378
              ++  R
Sbjct  166  GSSNRNR  172



>ref|XP_008234449.1| PREDICTED: transcription factor MYB1R1 isoform X1 [Prunus mume]
Length=353

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 81/184 (44%), Positives = 106/184 (58%), Gaps = 24/184 (13%)
 Frame = -2

Query  932  RKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkksfS  753
            RKCS CG  GHNSRTCN+N      + G  +KLFGV ++    +    S     ++ + +
Sbjct  7    RKCSHCGHNGHNSRTCNSNGHGHGQNKGVCLKLFGVNIMEKEDDAMKKSYSMGNLQAAGN  66

Query  752  DDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGN----LPEKKRGVPWS  585
             D                     + N        GY+SDGL+         E+K+G PW+
Sbjct  67   AD--------------------HNNNVVTIDHDAGYLSDGLIHNKRHKAAHERKKGRPWT  106

Query  584  EEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFD  405
            EEEHR+FL GL+KLG+GDWRGI+R+FVTTRTPTQ+ASHAQKYFLR  +    KRR SLFD
Sbjct  107  EEEHRVFLAGLKKLGKGDWRGIARNFVTTRTPTQVASHAQKYFLRQATYDKRKRRSSLFD  166

Query  404  LAWK  393
            + +K
Sbjct  167  MQFK  170



>ref|XP_008234450.1| PREDICTED: myb-like protein J isoform X2 [Prunus mume]
Length=349

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/184 (44%), Positives = 106/184 (58%), Gaps = 24/184 (13%)
 Frame = -2

Query  932  RKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkksfS  753
            RKCS CG  GHNSRTCN+N      + G  +KLFGV ++    +    S     ++ + +
Sbjct  7    RKCSHCGHNGHNSRTCNSNGHGHGQNKGVCLKLFGVNIMEKEDDAMKKSYSMGNLQAAGN  66

Query  752  DDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGN----LPEKKRGVPWS  585
             D                     + N        GY+SDGL+         E+K+G PW+
Sbjct  67   AD--------------------HNNNVVTIDHDAGYLSDGLIHNKRHKAAHERKKGRPWT  106

Query  584  EEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFD  405
            EEEHR+FL GL+KLG+GDWRGI+R+FVTTRTPTQ+ASHAQKYFLR  +    KRR SLFD
Sbjct  107  EEEHRVFLAGLKKLGKGDWRGIARNFVTTRTPTQVASHAQKYFLRQATYDKRKRRSSLFD  166

Query  404  LAWK  393
            + +K
Sbjct  167  MQFK  170



>gb|ABK24521.1| unknown [Picea sitchensis]
Length=390

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 87/192 (45%), Positives = 111/192 (58%), Gaps = 27/192 (14%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            MTRKCS CG  GHNSRTC N          G +KLFGV+L     +     S S      
Sbjct  1    MTRKCSHCGNNGHNSRTCPNR---------GGVKLFGVRLT----DGPIRKSASMGNLMM  47

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLV----CGNLPEKKRGVP  591
             +    PA     A ++  ++    D          GY+SDGLV      N  E+K+GVP
Sbjct  48   MASPSSPADPSEPASAAAAAAAAAAD----------GYLSDGLVEASTSSNSRERKKGVP  97

Query  590  WSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSL  411
            W+EEEHR+FL+GL+KLG+GDWRGI+R+FV TRTPTQ+ASHAQKYF+R +++   KRR SL
Sbjct  98   WTEEEHRMFLLGLQKLGKGDWRGIARNFVITRTPTQVASHAQKYFIRQSNMTRRKRRSSL  157

Query  410  FDLAWKADECRV  375
            FD+        V
Sbjct  158  FDMTPDPSATAV  169



>ref|XP_003620926.1| hypothetical protein MTR_6g092540 [Medicago truncatula]
 gb|AES77144.1| MYB-like transcription factor family protein [Medicago truncatula]
Length=289

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 91/180 (51%), Positives = 108/180 (60%), Gaps = 18/180 (10%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            M RKCS CG  GHNSRTCN        S  GS    GV+L G   + SSS          
Sbjct  1    MGRKCSHCGNIGHNSRTCN--------SLRGSGSFVGVRLFGVQLDLSSSCVSMKKSFSM  52

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKRGVPWSEE  579
               D  P +S S   S   S   + D          GY+SDGL+     E+K+GVPW+EE
Sbjct  53   ---DSFPTSSSSPTSSFSSSRLTIDDR------ASIGYLSDGLIV-RTQERKKGVPWTEE  102

Query  578  EHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFDLA  399
            EHR FLVGLEKLG+GDWRGISR++VTTRTPTQ+ASHAQKYF+R  +L+  KRR SLFD+ 
Sbjct  103  EHRKFLVGLEKLGKGDWRGISRNYVTTRTPTQVASHAQKYFIRLATLNKKKRRSSLFDMV  162



>gb|AFK44275.1| unknown [Lotus japonicus]
Length=277

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 117/182 (64%), Gaps = 21/182 (12%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGS---MKLFGVKLIGSHQNysssssysfvm  768
            M RKCS CG  GHNSRTC       TS   GS   ++LFGV+L          SS   + 
Sbjct  1    MGRKCSHCGIIGHNSRTC-------TSLIRGSFVGVRLFGVQL--------DISSCLTMK  45

Query  767  kksfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKRGVPW  588
            K    D     +S S   SSF SS    +EN+ G+    GY+SDGL+ G   E+K+GVPW
Sbjct  46   KSFSMDSLPLPSSSSSPSSSFCSSRITVEENY-GRT-SFGYLSDGLIAG-AQERKKGVPW  102

Query  587  SEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLF  408
            +EEEHR FL+GLEKLG+GDWRGISR++VTTRTPTQ+ASHAQKYF+R   ++  KRR SLF
Sbjct  103  TEEEHRTFLIGLEKLGKGDWRGISRNYVTTRTPTQVASHAQKYFIRLAMMNKKKRRSSLF  162

Query  407  DL  402
            D+
Sbjct  163  DM  164



>gb|AFK47856.1| unknown [Medicago truncatula]
Length=289

 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 91/180 (51%), Positives = 108/180 (60%), Gaps = 18/180 (10%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            M RKCS CG  GHNSRTCN        S  GS    GV+L G   + SSS          
Sbjct  1    MGRKCSHCGNIGHNSRTCN--------SLRGSGSFVGVRLFGVQLDLSSSCVSMKKSFSM  52

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKRGVPWSEE  579
               D  P +S S   S   S   + D          GY+SDGL+     E+K+GVPW+EE
Sbjct  53   ---DSFPTSSSSPTSSFSSSRLTIDDR------ASIGYLSDGLIV-RTQERKKGVPWTEE  102

Query  578  EHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFDLA  399
            EHR FLVGLEKLG+GDWRGISR++VTTRTPTQ+ASHAQKYF+R  +L+  KRR SLFD+ 
Sbjct  103  EHRKFLVGLEKLGKGDWRGISRNYVTTRTPTQVASHAQKYFIRLATLNKKKRRSSLFDMV  162



>ref|XP_001766973.1| predicted protein [Physcomitrella patens]
 gb|EDQ68139.1| predicted protein [Physcomitrella patens]
Length=156

 Score =   139 bits (350),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 110/181 (61%), Gaps = 27/181 (15%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            M+R+CS CG  GHNSRTC              ++LFGV+L     + +   S S      
Sbjct  1    MSRRCSHCGLNGHNSRTCPER----------GVRLFGVRLTDGVSSTNMRKSVSMNNLSH  50

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLV--CGNLPEKKRGVPWS  585
            +S+   PA+                 E ++      GY+SDGLV    N  E+K+GVPW+
Sbjct  51   YSNVHNPASP---------------PEQWESGAAPDGYVSDGLVQTSNNARERKKGVPWT  95

Query  584  EEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFD  405
            E+EHR+FL+GL+KLG+GDWRGIS++FV TRTPTQ+ASHAQKYF+R ++++  KRR SLFD
Sbjct  96   EDEHRLFLLGLQKLGKGDWRGISKNFVQTRTPTQVASHAQKYFIRQSNMNKRKRRSSLFD  155

Query  404  L  402
            +
Sbjct  156  M  156



>ref|XP_004251664.1| PREDICTED: transcription factor MYB1R1 [Solanum lycopersicum]
Length=188

 Score =   140 bits (352),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 90/173 (52%), Positives = 117/173 (68%), Gaps = 2/173 (1%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSH-GGSMKLFGVKL-IGSHQNysssssysfvmk  765
            M RKCS CG  GHNSRTC+      + S+  G ++LFGV+L I +    S +++ +  +K
Sbjct  1    MGRKCSHCGYIGHNSRTCSTLKSAISGSNFNGGLRLFGVQLDISNSCFSSHNNNNNNNLK  60

Query  764  ksfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKRGVPWS  585
            KSFS DCL   +      S  SS  L + +    +   GY+SDG + G + E+K+GVPW+
Sbjct  61   KSFSLDCLSLTNSHLLLLSSSSSPSLNENSSTNSIDNNGYLSDGTLVGCVGERKKGVPWT  120

Query  584  EEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTK  426
            EEEHR FL GLEKLG+GDWRGISR+FVTTRTPTQ+ASHAQKYFLR +SL+  K
Sbjct  121  EEEHRRFLNGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKYFLRQSSLNKKK  173



>ref|XP_010443340.1| PREDICTED: transcription factor DIVARICATA-like [Camelina sativa]
Length=232

 Score =   140 bits (354),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 90/195 (46%), Positives = 114/195 (58%), Gaps = 33/195 (17%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            M R+CS CG  GHNSRTC       +S H   ++LFGV L  ++ +    S  S +    
Sbjct  1    MGRRCSHCGNVGHNSRTC-------SSYHTRVIRLFGVHLDTTNSSPPPPSPPSILAAAM  53

Query  758  fSD---DCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKRGVPW  588
                  DCLPA S S +                      GY+SDGL     P++K+GVPW
Sbjct  54   KKSFSMDCLPACSSSSSSF-------------------AGYLSDGLT-HKTPDRKKGVPW  93

Query  587  SEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRH-NSLHSTKRRRSL  411
            +EEEHR FL+GLEKLG+GDWRGISR+FV T++PTQ+ASHAQKYFLR   +LH  +RR SL
Sbjct  94   TEEEHRTFLIGLEKLGKGDWRGISRNFVVTKSPTQVASHAQKYFLRQTTTLHHKRRRTSL  153

Query  410  FDL--AWKADECRVL  372
            FD+  A K +E   L
Sbjct  154  FDMVSAGKVEENSTL  168



>ref|XP_010451524.1| PREDICTED: uncharacterized protein LOC104733656 [Camelina sativa]
Length=232

 Score =   140 bits (353),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 90/195 (46%), Positives = 114/195 (58%), Gaps = 33/195 (17%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            M R+CS CG  GHNSRTC       +S H   ++LFGV L  ++ +    S  S +    
Sbjct  1    MGRRCSHCGNVGHNSRTC-------SSYHTRVIRLFGVHLDTTNSSPPPPSPPSILAAAM  53

Query  758  fSD---DCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKRGVPW  588
                  DCLPA S S +                      GY+SDGL     P++K+GVPW
Sbjct  54   KKSFSMDCLPACSSSSSSF-------------------AGYLSDGLA-HKTPDRKKGVPW  93

Query  587  SEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRH-NSLHSTKRRRSL  411
            +EEEHR FL+GLEKLG+GDWRGISR+FV T++PTQ+ASHAQKYFLR   +LH  +RR SL
Sbjct  94   TEEEHRTFLIGLEKLGKGDWRGISRNFVVTKSPTQVASHAQKYFLRQTTTLHHKRRRTSL  153

Query  410  FDL--AWKADECRVL  372
            FD+  A K +E   L
Sbjct  154  FDMVSAGKVEENSTL  168



>ref|XP_006401279.1| hypothetical protein EUTSA_v10014394mg [Eutrema salsugineum]
 gb|ESQ42732.1| hypothetical protein EUTSA_v10014394mg [Eutrema salsugineum]
Length=268

 Score =   141 bits (356),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 84/187 (45%), Positives = 110/187 (59%), Gaps = 32/187 (17%)
 Frame = -2

Query  944  IRMTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmk  765
            I M R+CS CG  GHNSRTC++   +       +++LFGV L  +  +         ++ 
Sbjct  37   ITMGRRCSHCGNIGHNSRTCSSYKTR-------AIRLFGVHLDTTCSSPPPPPPPLSILA  89

Query  764  ksfSD----DCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKRG  597
             +       DCLPA S S +                     CGY+SDGL     P++K+G
Sbjct  90   TAMKKSFSMDCLPACSSSSSSF-------------------CGYLSDGLA-HKTPDRKKG  129

Query  596  VPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRH-NSLHSTKRR  420
            VPW+EEEHR FL+GLEKLG+GDWRGISR FV T++PTQ+ASHAQKYFLR   +LH  +RR
Sbjct  130  VPWTEEEHRTFLIGLEKLGKGDWRGISRKFVVTKSPTQVASHAQKYFLRQATTLHHKRRR  189

Query  419  RSLFDLA  399
             SLFD+ 
Sbjct  190  TSLFDMV  196



>ref|XP_010483171.1| PREDICTED: uncharacterized protein LOC104761750 [Camelina sativa]
Length=232

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 90/195 (46%), Positives = 114/195 (58%), Gaps = 33/195 (17%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            M R+CS CG  GHNSRTC       +S H   ++LFGV L  ++ +    S  S +    
Sbjct  1    MGRRCSHCGNVGHNSRTC-------SSYHTRVIRLFGVHLDTTNSSPPPPSPPSILAAAM  53

Query  758  fSD---DCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKRGVPW  588
                  DCLPA S S +                      GY+SDGL     P++K+GVPW
Sbjct  54   KKSFSMDCLPACSSSSSSF-------------------AGYLSDGLT-HKTPDRKKGVPW  93

Query  587  SEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRH-NSLHSTKRRRSL  411
            +EEEHR FL+GLEKLG+GDWRGISR+FV T++PTQ+ASHAQKYFLR   +LH  +RR SL
Sbjct  94   TEEEHRTFLIGLEKLGKGDWRGISRNFVVTKSPTQVASHAQKYFLRQTTTLHHKRRRTSL  153

Query  410  FDL--AWKADECRVL  372
            FD+  A K +E   L
Sbjct  154  FDMVSAGKVEENSTL  168



>ref|XP_011077962.1| PREDICTED: transcription factor MYB1R1 [Sesamum indicum]
Length=273

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 117/181 (65%), Gaps = 11/181 (6%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKL-IGSHQNysssssysfvmkk  762
            M RKCS CG  GHNSRTCN +  +  S+ G  ++LFGV+L I S  +  +          
Sbjct  1    MGRKCSHCGNIGHNSRTCNASC-RAPSNTGSGVRLFGVQLDIVSSSSSLNIIPIKKSFSL  59

Query  761  sfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKRGVPWSE  582
                D L  ++   + S+  SS    ++N +      GY+SDG +   L ++K+GVPW+E
Sbjct  60   ----DSLSISTPPSSSSTSSSSRLSINDNSNS----IGYLSDGPLPPAL-DRKKGVPWTE  110

Query  581  EEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFDL  402
            EEHR+FL+GLEKLG+GDWRGISR+FVT+RTPTQ+ASHA KYFLR  +L+  +RR SLFD+
Sbjct  111  EEHRVFLIGLEKLGKGDWRGISRNFVTSRTPTQVASHALKYFLRQATLNKKRRRSSLFDM  170

Query  401  A  399
             
Sbjct  171  V  171



>ref|NP_001043505.1| Os01g0603300 [Oryza sativa Japonica Group]
 dbj|BAB78640.1| putative MCB2 protein [Oryza sativa Japonica Group]
 dbj|BAB89985.1| putative MCB2 protein [Oryza sativa Japonica Group]
 dbj|BAF05419.1| Os01g0603300 [Oryza sativa Japonica Group]
 gb|EAZ12604.1| hypothetical protein OsJ_02512 [Oryza sativa Japonica Group]
 dbj|BAG96078.1| unnamed protein product [Oryza sativa Japonica Group]
Length=301

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 93/198 (47%), Positives = 117/198 (59%), Gaps = 20/198 (10%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQ-----------RTSSHGGSMKLFGVKLIGSHQNyss  792
            M RKCS CG  GHNSRTC+++                   G  ++LFGV++  +      
Sbjct  1    MARKCSYCGNYGHNSRTCSSSASAGHRDTTMLCDGGDGGGGSGLRLFGVQVHVAAGGGGG  60

Query  791  sssysfvmkksfSDDCL--------PaasysfadssfgssgFLFDENFDGKVPGCGYISD  636
                   MKKS+S DCL        P +  S + SS  S     DE    +    GY+SD
Sbjct  61   GGGGGLPMKKSYSMDCLQLAAAGAAPGSLVSPSSSSSSSMLLSIDEGGLERASN-GYLSD  119

Query  635  GLVCGNLPEKKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYF  456
            G     + E+K+GVPWSEEEHR+FLVGLEKLG+GDWRGISR +VTTRTPTQ+ASHAQK+F
Sbjct  120  GPHGRIVQERKKGVPWSEEEHRLFLVGLEKLGKGDWRGISRSYVTTRTPTQVASHAQKFF  179

Query  455  LRHNSLHSTKRRRSLFDL  402
            LR +S+   KRR SLFD+
Sbjct  180  LRQSSIGKKKRRSSLFDM  197



>ref|XP_003569313.1| PREDICTED: uncharacterized protein LOC100839820 [Brachypodium 
distachyon]
Length=288

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 93/194 (48%), Positives = 119/194 (61%), Gaps = 23/194 (12%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLF---------GVKLIGSHQNyssss  786
            M RKCS CG  GHNSRTC       TSS GG  ++          G++L G   + ++ +
Sbjct  1    MARKCSHCGNYGHNSRTC-------TSSAGGQREIMLCEGGGGGSGLRLFGVQVHVAAGA  53

Query  785  sysfvmkksfSDDCLPaasysfadssfgssgFL-----FDENFDGKVPGCGYISDGLVCG  621
                 M+KS+S DCL  A+   +  S  SS         DE  +      GY+SDG    
Sbjct  54   GAGASMRKSYSMDCLQLAAAPSSLVSPSSSSSSSVLLSIDEGLERA--SNGYLSDGPHGR  111

Query  620  NLPEKKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNS  441
             + E+K+GVPWSEEEHR+FLVGLEKLG+GDWRGISR +VT+RTPTQ+ASHAQK+FLR +S
Sbjct  112  LVQERKKGVPWSEEEHRLFLVGLEKLGKGDWRGISRSYVTSRTPTQVASHAQKFFLRQSS  171

Query  440  LHSTKRRRSLFDLA  399
            +   KRR SLFD+ 
Sbjct  172  MGKKKRRSSLFDMV  185



>gb|KCW81661.1| hypothetical protein EUGRSUZ_C03026 [Eucalyptus grandis]
Length=240

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 92/204 (45%), Positives = 114/204 (56%), Gaps = 26/204 (13%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTS-SHGGSMKLFGVKLIGSHQNysssssysfvmkk  762
            M RKCS CG  GHNSRTC +   +  S   GG +KLFGV+L  ++    +S         
Sbjct  1    MGRKCSHCGFMGHNSRTCASIRRRDASFGGGGRVKLFGVQLEAAYPCGVASRLPLKKSLS  60

Query  761  sfSDDCL-----------PaasysfadssfgssgFLFDENFDGKVPGC--------GYIS  639
                DCL           P +S + +  S  ++  + D     + P          GY S
Sbjct  61   M---DCLMPSVRVLTSSSPLSSATNSSLSLRAACDVGDRLLRDESPNKAANSPSNDGYAS  117

Query  638  DGLVCGNLPEKKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKY  459
            DG + G   E+K+G+PW+EEEHR FLVGLE LG+GDWRGIS+ FV TRTPTQ+ASHAQKY
Sbjct  118  DGFL-GRAQERKKGLPWTEEEHRTFLVGLETLGKGDWRGISKKFVGTRTPTQVASHAQKY  176

Query  458  FLRHNSL--HSTKRRRSLFDLAWK  393
            FLR  SL     KRR SLFD  WK
Sbjct  177  FLRQKSLLPRRNKRRPSLFDWGWK  200



>gb|KDP33815.1| hypothetical protein JCGZ_07386 [Jatropha curcas]
Length=289

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 90/186 (48%), Positives = 118/186 (63%), Gaps = 11/186 (6%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            M RKCS CG  GHNSRTC        +++   ++LFGV+L  S  + SSSSS + +    
Sbjct  1    MGRKCSHCGNIGHNSRTC--------TTYRAGLRLFGVQLDLSSSSSSSSSSSTSLSLAM  52

Query  758  fSDDCL--PaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKRGVPWS  585
                 +   ++S S + S   S   + D          GY+SDGL+ G   EKK+GVPW+
Sbjct  53   KKSFSMDCLSSSPSPSSSLCSSRVSIEDNPPVSDRTSSGYLSDGLI-GRAQEKKKGVPWT  111

Query  584  EEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFD  405
            EEEHR FL+GLE+LG+GDWRGISR++V TRTPTQ+ASHAQKYFLR  SL+  KRR SLFD
Sbjct  112  EEEHRTFLIGLERLGKGDWRGISRNYVITRTPTQVASHAQKYFLRLASLNKKKRRSSLFD  171

Query  404  LAWKAD  387
            +   ++
Sbjct  172  MVGSSN  177



>ref|XP_002864483.1| DNA-binding family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40742.1| DNA-binding family protein [Arabidopsis lyrata subsp. lyrata]
Length=234

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 85/184 (46%), Positives = 107/184 (58%), Gaps = 31/184 (17%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            M R+CS CG  GHNSRTC       +S H   ++LFGV L  +  +       S +    
Sbjct  1    MGRRCSHCGNVGHNSRTC-------SSYHTRVIRLFGVHLDTTSSSPPPPPPPSILAAAM  53

Query  758  fSD---DCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKRGVPW  588
                  DCLPA S S +                      GY+SDGL     P++K+GVPW
Sbjct  54   KKSFSMDCLPACSSSSSSF-------------------AGYLSDGLA-HKTPDRKKGVPW  93

Query  587  SEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRH-NSLHSTKRRRSL  411
            +EEEHR FLVGLEKLG+GDWRGISR++V T++PTQ+ASHAQKYFLR   +LH  +RR SL
Sbjct  94   TEEEHRTFLVGLEKLGKGDWRGISRNYVVTKSPTQVASHAQKYFLRQTTTLHHKRRRTSL  153

Query  410  FDLA  399
            FD+ 
Sbjct  154  FDMV  157



>ref|XP_008375712.1| PREDICTED: transcription factor MYB1R1-like [Malus domestica]
Length=349

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 80/185 (43%), Positives = 108/185 (58%), Gaps = 28/185 (15%)
 Frame = -2

Query  935  TRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkksf  756
             RKCS CG  GHNSRTCN+++  +    G  +KLFGV ++ + ++    S     +    
Sbjct  6    ARKCSHCGHNGHNSRTCNHSHVNK----GVCLKLFGVNILENQEDSMKKSYSMGNLHTDG  61

Query  755  SDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGN----LPEKKRGVPW  588
            + D                     + N  G     GY+SDGL+         E+++G PW
Sbjct  62   NGD--------------------HNNNAVGADNDAGYLSDGLIHNKRHKAAHERRKGRPW  101

Query  587  SEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLF  408
            +EEEHR+FL GL+KLG+GDWRGI+R+FVTTRTPTQ+ASHAQKYFLR  +    KRR SLF
Sbjct  102  TEEEHRVFLAGLKKLGKGDWRGIARNFVTTRTPTQVASHAQKYFLRQATNDKRKRRSSLF  161

Query  407  DLAWK  393
            D+ +K
Sbjct  162  DMHFK  166



>ref|XP_006451435.1| hypothetical protein CICLE_v10009128mg [Citrus clementina]
 ref|XP_006475419.1| PREDICTED: transcription factor MYB1R1-like [Citrus sinensis]
 gb|ESR64675.1| hypothetical protein CICLE_v10009128mg [Citrus clementina]
 gb|KDO59244.1| hypothetical protein CISIN_1g047042mg [Citrus sinensis]
Length=283

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 97/192 (51%), Positives = 120/192 (63%), Gaps = 19/192 (10%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNE-QRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkk  762
            M RKCS CG  GHNSRTC ++         G S++LFGV+LI    +  SSSS S +   
Sbjct  1    MGRKCSHCGNIGHNSRTCTSHKAVGGGGGGGSSLRLFGVQLIDVSSSSPSSSSSSSIAMS  60

Query  761  sfSD---DCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLP-------  612
                   DCL +A+   + SS  SS    DE+        GY+SDGL+   +P       
Sbjct  61   LKKSFSMDCLSSAAVPSSSSSNSSSLVSIDED----KTAVGYLSDGLIM--IPPTSNHQH  114

Query  611  -EKKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNS-L  438
             E+K+GV W+EEEHR FL+GLEKLG+GDWRGISR FV+TRTPTQ+ASHAQKYFLR  S L
Sbjct  115  QERKKGVAWTEEEHRKFLMGLEKLGKGDWRGISRKFVSTRTPTQVASHAQKYFLRLASDL  174

Query  437  HSTKRRRSLFDL  402
            +  KRR SLFD+
Sbjct  175  NKKKRRSSLFDM  186



>ref|XP_004309020.1| PREDICTED: uncharacterized protein LOC101301055 [Fragaria vesca 
subsp. vesca]
Length=359

 Score =   142 bits (358),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 83/190 (44%), Positives = 109/190 (57%), Gaps = 35/190 (18%)
 Frame = -2

Query  932  RKCSSCGKTGHNSRTCN------NNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfv  771
            RKCS CG  GHNSRTCN      NNN +     G  +KLFGV ++   ++    S     
Sbjct  7    RKCSHCGHNGHNSRTCNLLGHGVNNNNK-----GICLKLFGVNIMERQEDSIKKSYSMGN  61

Query  770  mkksfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGN----LPEKK  603
            ++ + + D                     + N +      GY+SDGL+         E+K
Sbjct  62   LQAAGNGDQ--------------------NNNINVGADDAGYLSDGLIHNKKRKAAHERK  101

Query  602  RGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKR  423
            +G PW+EEEHR+FL GL+KLG+GDWRGI+R+FVTTRTPTQ+ASHAQKYFLR  +    KR
Sbjct  102  KGRPWTEEEHRVFLAGLKKLGKGDWRGIARNFVTTRTPTQVASHAQKYFLRQATNDKRKR  161

Query  422  RRSLFDLAWK  393
            R SLFD+ +K
Sbjct  162  RTSLFDMHFK  171



>ref|XP_009362715.1| PREDICTED: myb-like protein J [Pyrus x bretschneideri]
Length=349

 Score =   142 bits (358),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 81/185 (44%), Positives = 108/185 (58%), Gaps = 28/185 (15%)
 Frame = -2

Query  935  TRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkksf  756
             RKCS CG  GHNSRTCN+++  +    G  +KLFGV ++ + ++    S     +    
Sbjct  6    ARKCSHCGHNGHNSRTCNHSHVNK----GVCLKLFGVNILENQEDSIKKSYSMGNLHTDG  61

Query  755  SDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGN----LPEKKRGVPW  588
            + D                     + N  G     GY+SDGL+         E+K+G PW
Sbjct  62   NGD--------------------HNNNAVGADHDPGYLSDGLIHNKRHKAAHERKKGRPW  101

Query  587  SEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLF  408
            +EEEHR+FL GL+KLG+GDWRGI+R+FVTTRTPTQ+ASHAQKYFLR  +    KRR SLF
Sbjct  102  TEEEHRVFLAGLKKLGKGDWRGIARNFVTTRTPTQVASHAQKYFLRQATNDKRKRRSSLF  161

Query  407  DLAWK  393
            D+ +K
Sbjct  162  DMHFK  166



>ref|XP_002511019.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51621.1| conserved hypothetical protein [Ricinus communis]
Length=333

 Score =   141 bits (356),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 82/185 (44%), Positives = 103/185 (56%), Gaps = 33/185 (18%)
 Frame = -2

Query  935  TRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkksf  756
             RKCS CG  GHNSRTC+          GG +KLFGVK+I   +     S     +    
Sbjct  7    ARKCSHCGHNGHNSRTCSGKG-------GGCLKLFGVKIIEKQEKPIQRSVSLGNL----  55

Query  755  SDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLV----CGNLPEKKRGVPW  588
              D LP    +                        GY+SDG +    C    ++K+G PW
Sbjct  56   --DSLPDTGDADHHDHADD----------------GYMSDGYIDSKRCKAAHKRKKGKPW  97

Query  587  SEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLF  408
            +EEEHRIFL GL+KLG+GDWRGIS++FVTTRTPTQ+ASHAQKYFLR ++    KRR SLF
Sbjct  98   TEEEHRIFLEGLDKLGKGDWRGISKNFVTTRTPTQVASHAQKYFLRQSAADKKKRRSSLF  157

Query  407  DLAWK  393
            D+  +
Sbjct  158  DMTLR  162



>ref|XP_010545871.1| PREDICTED: transcription factor MYB1R1 [Tarenaya hassleriana]
Length=226

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 92/185 (50%), Positives = 117/185 (63%), Gaps = 24/185 (13%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKL-IGSHQNysssssysfvmkk  762
            M RKCS CG  GHNSRTC++ N          ++LFGV+L + +  +       S  MKK
Sbjct  1    MGRKCSHCGNIGHNSRTCSSYNRT-------GVRLFGVQLDLPTASSPPPPPDSSAAMKK  53

Query  761  sfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKRGVPWSE  582
            SFS + LPAA  S + SS   S               GY+SDG+   + P++K+GVPW+E
Sbjct  54   SFSMNSLPAAFSSSSSSSASFS---------------GYLSDGIAPTS-PDRKKGVPWTE  97

Query  581  EEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFDL  402
            EEH  FL+GL+KLG+GDWRGISR+FV T+TPTQ+ASHAQKYFLR  +LH  KRR SLFD+
Sbjct  98   EEHMKFLLGLQKLGKGDWRGISRNFVVTKTPTQVASHAQKYFLRRATLHKKKRRASLFDM  157

Query  401  AWKAD  387
                D
Sbjct  158  VSADD  162



>gb|KFK27243.1| hypothetical protein AALP_AA8G356500 [Arabis alpina]
Length=230

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 91/183 (50%), Positives = 113/183 (62%), Gaps = 30/183 (16%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKL--IGSHQNysssssysfvmk  765
            M R+CS CG  GHNSRTC       +S   G+++LFGV L    S       S  +  MK
Sbjct  1    MGRRCSHCGTVGHNSRTC-------SSYRTGAIRLFGVHLDTASSSPLPPPPSILAVAMK  53

Query  764  ksfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKRGVPWS  585
            KSFS DCLPA S S +                      GY+SDGL     P++K+GVPW+
Sbjct  54   KSFSMDCLPACSSSSSSF-------------------AGYLSDGLA-HKTPDRKKGVPWT  93

Query  584  EEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRH-NSLHSTKRRRSLF  408
            EEEHR FL+GLEKLG+GDWRGISR+FV T++PTQ+ASHAQKYFLR   +L+  +RR SLF
Sbjct  94   EEEHRTFLIGLEKLGKGDWRGISRNFVVTKSPTQVASHAQKYFLRQATTLNHKRRRTSLF  153

Query  407  DLA  399
            D+ 
Sbjct  154  DMV  156



>gb|KDP22474.1| hypothetical protein JCGZ_26305 [Jatropha curcas]
Length=354

 Score =   141 bits (355),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 86/197 (44%), Positives = 108/197 (55%), Gaps = 41/197 (21%)
 Frame = -2

Query  935  TRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkksf  756
            TRKCS CG+ GHNSRTCN+         G  +KLFGV +    +     S+    ++   
Sbjct  6    TRKCSHCGQNGHNSRTCNHGK------GGAGVKLFGVNIFEKQEQPMKKSASLGNLES--  57

Query  755  SDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLV------CGNLPEKKRGV  594
                                  L D N    V   GY+SDG +        N  E+K+G 
Sbjct  58   ----------------------LIDNNAHHHV-DEGYLSDGYINFKRGKAAN--ERKKGK  92

Query  593  PWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRS  414
            PW+EEEHR FL GL+KLG+GDWRGIS++FVTTRTPTQ+ASHAQKY+LR  S    KRR S
Sbjct  93   PWTEEEHRTFLAGLKKLGKGDWRGISKNFVTTRTPTQVASHAQKYYLRQASADIKKRRSS  152

Query  413  LFDLAWKADECRVLCGK  363
            LFD+  K  E +VL  +
Sbjct  153  LFDMTLK--EPKVLTSQ  167



>ref|XP_008799749.1| PREDICTED: transcription factor MYB1R1-like [Phoenix dactylifera]
Length=269

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 91/185 (49%), Positives = 116/185 (63%), Gaps = 12/185 (6%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            M RKC  CG  GHNSRTC+     R     G ++LFG +L     + +SS        + 
Sbjct  1    MGRKCLHCGNNGHNSRTCS---RPRGVVGSGGLRLFGAQL-----HVASSPMKKSFSMEC  52

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKRGVPWSEE  579
             +     A+S   + +S  SS    DE  + K+   GY+SDG + G  PE+K+GVPW+EE
Sbjct  53   LASSSYLASSSPCSSTSSSSSLVSIDETTE-KISN-GYLSDGPL-GRTPERKKGVPWTEE  109

Query  578  EHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKR-RRSLFDL  402
            EHR FL GLEKLG+GDWRGISR+FV+TRTPTQ+ASHAQKYFLR +SL+  KR R SLFD+
Sbjct  110  EHRSFLAGLEKLGKGDWRGISRNFVSTRTPTQVASHAQKYFLRQDSLNKKKRHRSSLFDV  169

Query  401  AWKAD  387
                D
Sbjct  170  VASCD  174



>gb|EMS53342.1| Transcription factor MYB1R1 [Triticum urartu]
Length=126

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 72/86 (84%), Gaps = 1/86 (1%)
 Frame = -2

Query  656  GCGYISDGLVCGNLPEKKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIA  477
            G GY+SDGL+ G   E+K+GVPW+E+EHR FL GLEKLG+GDWRGISRHFVTTRTPTQ+A
Sbjct  2    GHGYLSDGLM-GRAQERKKGVPWTEDEHRRFLAGLEKLGKGDWRGISRHFVTTRTPTQVA  60

Query  476  SHAQKYFLRHNSLHSTKRRRSLFDLA  399
            SHAQKYFLR   L   KRR SLFD+A
Sbjct  61   SHAQKYFLRQAGLAQKKRRSSLFDVA  86



>ref|XP_009120194.1| PREDICTED: protein REVEILLE 5-like [Brassica rapa]
Length=231

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 89/190 (47%), Positives = 114/190 (60%), Gaps = 33/190 (17%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIG-----SHQNysssssysf  774
            M R+CS CG  GHNSRTC++   +        ++LFGV +              SS  + 
Sbjct  1    MGRRCSHCGNVGHNSRTCSSYKTR-------VIRLFGVHVDARGSSPPPPPPPPSSLLAA  53

Query  773  vmkksfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKRGV  594
             MKKSFS DCLPA S S +                      GY+SDGL     P++K+GV
Sbjct  54   AMKKSFSMDCLPACSTSSSSF-------------------AGYLSDGLT-HRTPDRKKGV  93

Query  593  PWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRH-NSLHSTKRRR  417
            PW+EEEHR FL+GLEKLG+GDWRGISR+FV T++PTQ+ASHAQKYFLR   +LH  +RR 
Sbjct  94   PWTEEEHRTFLIGLEKLGKGDWRGISRNFVVTKSPTQVASHAQKYFLRQATTLHHKRRRT  153

Query  416  SLFDLAWKAD  387
            SLFD+ +  +
Sbjct  154  SLFDMVFAGN  163



>ref|XP_004969089.1| PREDICTED: transcription factor MYB1R1-like [Setaria italica]
Length=311

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 94/204 (46%), Positives = 118/204 (58%), Gaps = 28/204 (14%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRT-------------------SSHGGSMKLFGVKLI  816
            M RKCS CG  GHNSRTC   N + T                         ++LFGV++ 
Sbjct  1    MARKCSHCGNYGHNSRTCGLGNSRETMLCQGGGDNGGGVGGGSRSGGGTSGLRLFGVQV-  59

Query  815  GSHQNysssssysfvmkksfSDDCLPaas-----ysfadssfgssgFLFDENFDGKVPGC  651
              H     + S +  MKKS+S DCL  A+      S + SS  S     +E  +      
Sbjct  60   --HAGGGGAGSAAASMKKSYSMDCLQLAAPGCSIVSPSSSSSSSLLLSIEEGLERAAATN  117

Query  650  GYISDGLVCGNLPEKKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASH  471
            GY+SDG     + E+K+GVPWSEEEHR FL GLEKLG+GDWRGISR++VTTRTPTQ+ASH
Sbjct  118  GYLSDGNA-RVVAERKKGVPWSEEEHRQFLAGLEKLGKGDWRGISRNYVTTRTPTQVASH  176

Query  470  AQKYFLRHNSLHSTKRRRSLFDLA  399
            AQK+FLR +S+   KRR SLFD+ 
Sbjct  177  AQKFFLRQSSMGKKKRRSSLFDMV  200



>ref|XP_003630638.1| hypothetical protein MTR_8g101650 [Medicago truncatula]
 gb|AET05114.1| MYB-like transcription factor family protein [Medicago truncatula]
Length=280

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 90/179 (50%), Positives = 113/179 (63%), Gaps = 14/179 (8%)
 Frame = -2

Query  932  RKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkksfS  753
            RKCS CGK GHN RTC       TS   G ++LFGV+L  S  + SSS+           
Sbjct  4    RKCSHCGKIGHNCRTC-------TSFTLGGLRLFGVQLSSSSSSSSSSNMIKKSFSM---  53

Query  752  DDCLPaasysfadssfgssgFLFDEN-FDGKVPGCGYISDGLVCGNLPEKKRGVPWSEEE  576
             D  P+ S   +  S  +S    DEN +        Y+SD  + G   E+K+GVPW+EEE
Sbjct  54   -DTFPSPSSPSSSFSSSTSLTNIDENHYHKSTSNIAYLSDCFI-GPPQERKKGVPWTEEE  111

Query  575  HRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFDLA  399
            HR+FLVGLEKLG+GDWRGIS++FVT+RTPTQ+ASHAQKYFLR  +++  KRR SLFDL 
Sbjct  112  HRMFLVGLEKLGKGDWRGISKNFVTSRTPTQVASHAQKYFLRLATINK-KRRSSLFDLV  169



>ref|XP_001764790.1| predicted protein [Physcomitrella patens]
 gb|EDQ70489.1| predicted protein [Physcomitrella patens]
Length=317

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 82/191 (43%), Positives = 106/191 (55%), Gaps = 31/191 (16%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            M R CS CG  GHNSRTC +            ++LFGV+L       S S          
Sbjct  1    MARGCSHCGHNGHNSRTCPDRG----------VRLFGVRLTDGVMRKSVSMGNLSHYASP  50

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLV--CGNLPEKKRGVPWS  585
             +                        E+  G   G GY+SDGLV    N  E+K+GVPW+
Sbjct  51   NNPSS----------------PPSHSESGAG---GDGYVSDGLVQTSNNTRERKKGVPWT  91

Query  584  EEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFD  405
            EEEHR+FL+GL+KLG+GDWRGISR+FV TRTPTQ+ASHAQKYF+R ++++  KRR SLFD
Sbjct  92   EEEHRLFLLGLQKLGKGDWRGISRNFVQTRTPTQVASHAQKYFIRQSNINKRKRRSSLFD  151

Query  404  LAWKADECRVL  372
            +  +     +L
Sbjct  152  IVSETGPTPIL  162



>gb|AFK39858.1| unknown [Medicago truncatula]
Length=280

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 90/179 (50%), Positives = 113/179 (63%), Gaps = 14/179 (8%)
 Frame = -2

Query  932  RKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkksfS  753
            RKCS CGK GHN RTC       TS   G ++LFGV+L  S  + SSS+           
Sbjct  4    RKCSHCGKIGHNCRTC-------TSFTLGGLRLFGVQLSSSSSSSSSSNMIKKSFSM---  53

Query  752  DDCLPaasysfadssfgssgFLFDEN-FDGKVPGCGYISDGLVCGNLPEKKRGVPWSEEE  576
             D  P+ S   +  S  +S    DEN +        Y+SD  + G   E+K+GVPW+EEE
Sbjct  54   -DTFPSPSSPSSSFSSSTSLTNIDENHYHKSTSNIAYLSDCFI-GPPQERKKGVPWTEEE  111

Query  575  HRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFDLA  399
            HR+FLVGLEKLG+GDWRGIS++FVT+RTPTQ+ASHAQKYFLR  +++  KRR SLFDL 
Sbjct  112  HRMFLVGLEKLGKGDWRGISKNFVTSRTPTQVASHAQKYFLRLATINK-KRRSSLFDLV  169



>gb|EYU30648.1| hypothetical protein MIMGU_mgv1a019786mg [Erythranthe guttata]
Length=206

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 90/198 (45%), Positives = 116/198 (59%), Gaps = 19/198 (10%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTC------------NNNNEQRTSSHGGSMKLFGVKL---IGSHQ  804
            M RKCS CGK GHNSRTC            + +++   +  GG ++LFGV++   +    
Sbjct  1    MGRKCSECGKVGHNSRTCTTSASRSGLVADDRDDDVIINGGGGGIRLFGVRIDDDVIISS  60

Query  803  NysssssysfvmkksfSDDCLPaasysfadssfgssgFLFDENFDGK---VPGCGYISDG  633
            +  SSS     MKKS   D LP    +   +   SS     +N D         GY+SD 
Sbjct  61   SALSSSLIITPMKKSLRFDSLPIMILTPPAAPSSSSSSSIYDNSDNNNNTFTAGGYLSDD  120

Query  632  LVCGNLPEKKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFL  453
             +    PE+++GVPW+E+EHR FL GLEKLG+GDWRGISR +V+TRTPTQIASHAQKYFL
Sbjct  121  PLIHQPPERRKGVPWTEDEHRTFLDGLEKLGKGDWRGISREYVSTRTPTQIASHAQKYFL  180

Query  452  RHNSLHSTKRRRSLFDLA  399
            R  +   TK R SLFD+ 
Sbjct  181  RQTT-KKTKHRSSLFDMV  197



>ref|XP_004489944.1| PREDICTED: transcription factor MYB1R1-like [Cicer arietinum]
Length=255

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 79/184 (43%), Positives = 107/184 (58%), Gaps = 31/184 (17%)
 Frame = -2

Query  944  IRMTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmk  765
            +  +R CS CG  GHNSRTCNN  +         +K+FGV +I ++ + +S    + +  
Sbjct  1    MSQSRTCSQCGNNGHNSRTCNNKEK--------IIKIFGVPVIRANNDNNSFRRSASLNN  52

Query  764  ksfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLV--CGNLPEKKRGVP  591
             +  +   P                         V   GYISD +V   G  PE+KR V 
Sbjct  53   LTQYEQLPPQ---------------------QSNVVDVGYISDNVVHASGRAPERKRAVA  91

Query  590  WSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSL  411
            W+EEEH++FL+GL+KLG+GDWRGISR+FV TRTPTQIASHAQKYFLR ++ +  +RR SL
Sbjct  92   WTEEEHKLFLLGLQKLGKGDWRGISRNFVKTRTPTQIASHAQKYFLRRHNQNRRRRRSSL  151

Query  410  FDLA  399
            FD+ 
Sbjct  152  FDIT  155



>gb|EAY74856.1| hypothetical protein OsI_02748 [Oryza sativa Indica Group]
Length=303

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 93/201 (46%), Positives = 116/201 (58%), Gaps = 22/201 (11%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQ-----------RTSSHGGSMKLFGVKL--IGSHQNy  798
            M RKCS CG  GHNSRTC+++                   G  ++LFGV++         
Sbjct  1    MARKCSHCGNYGHNSRTCSSSASAGHRDTTMLCDGGDGGGGSGLRLFGVQVHVAAGGGGG  60

Query  797  sssssysfvmkksfSDDCL--------PaasysfadssfgssgFLFDENFDGKVPGCGYI  642
                     MKKS+S DCL        P +  S + SS  S     DE    +    GY+
Sbjct  61   GGGGGGGLPMKKSYSMDCLQLAAAGAAPGSLVSPSSSSSSSMLLSIDEGGLERASN-GYL  119

Query  641  SDGLVCGNLPEKKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQK  462
            SDG     + E+K+GVPWSEEEHR+FLVGLEKLG+GDWRGISR +VTTRTPTQ+ASHAQK
Sbjct  120  SDGPHGRIVQERKKGVPWSEEEHRLFLVGLEKLGKGDWRGISRSYVTTRTPTQVASHAQK  179

Query  461  YFLRHNSLHSTKRRRSLFDLA  399
            +FLR +S+   KRR SLFD+ 
Sbjct  180  FFLRQSSIGKKKRRSSLFDMV  200



>ref|XP_007224164.1| hypothetical protein PRUPE_ppa016461mg [Prunus persica]
 gb|EMJ25363.1| hypothetical protein PRUPE_ppa016461mg [Prunus persica]
Length=242

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 92/195 (47%), Positives = 116/195 (59%), Gaps = 17/195 (9%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCN-NNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkk  762
            M RKCS CG  GHNSRTC      QR    GG ++LFGV+++    + SSS+S     KK
Sbjct  1    MGRKCSQCGNMGHNSRTCGVRQPRQRGGGGGGGLRLFGVQVLDLSSSSSSSNSLISRKKK  60

Query  761  sfSDD--------CLPaasysfadssfg------ssgFLFDENFDGKVPGCGYISDGLVC  624
            +            CLP+ + S   +          S  L D N +      GY SDGL  
Sbjct  61   NIIIKRCPPSMVHCLPSVAASSPTAPSSSTSSRLQSRALIDLNSEKM--SNGYPSDGLTA  118

Query  623  GNLPEKKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHN  444
                   +GV WSEEEHR+F++GLEKLG+GDW+GISRHFVTTRTPTQ+ASHAQKYFLR N
Sbjct  119  LPQENNNKGVAWSEEEHRVFVMGLEKLGKGDWKGISRHFVTTRTPTQVASHAQKYFLRIN  178

Query  443  SLHSTKRRRSLFDLA  399
            +L+  +RR +LF L+
Sbjct  179  TLNKKRRRPNLFYLS  193



>ref|XP_006280948.1| hypothetical protein CARUB_v10026949mg [Capsella rubella]
 gb|EOA13846.1| hypothetical protein CARUB_v10026949mg [Capsella rubella]
Length=272

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 85/186 (46%), Positives = 110/186 (59%), Gaps = 31/186 (17%)
 Frame = -2

Query  944  IRMTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmk  765
            I M R+CS CG  GHNSRTC       +S H  +++LFGV L  +  +    S  S +  
Sbjct  40   IAMGRRCSHCGNVGHNSRTC-------SSYHTRAIRLFGVHLDTTSSSPPPPSPPSILTA  92

Query  764  ksfSD---DCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKRGV  594
                    DCLPA S S +                      GY+SDGL     P++++GV
Sbjct  93   AMKKSFSMDCLPACSSSSSSF-------------------AGYLSDGL-SQKTPDRRKGV  132

Query  593  PWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRR-  417
            PW+EEEHR FL+GLEKLG+GDWRGISR+FV T++PTQ+ASHAQK+FLR  +  + KRRR 
Sbjct  133  PWTEEEHRTFLIGLEKLGKGDWRGISRNFVVTKSPTQVASHAQKHFLRQTTTLNHKRRRT  192

Query  416  SLFDLA  399
            SLFD+ 
Sbjct  193  SLFDMV  198



>ref|XP_002440757.1| hypothetical protein SORBIDRAFT_09g006060 [Sorghum bicolor]
 gb|EES19187.1| hypothetical protein SORBIDRAFT_09g006060 [Sorghum bicolor]
Length=302

 Score =   137 bits (346),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 75/89 (84%), Gaps = 5/89 (6%)
 Frame = -2

Query  650  GYISDGLVCGNLPEKKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASH  471
            GY+SDGLV   + ++K+GVPW+EEEHR+FL GL+KLGRGDWRGISRHFVTTRTPTQ+ASH
Sbjct  104  GYVSDGLVV-RVQDRKKGVPWTEEEHRMFLAGLDKLGRGDWRGISRHFVTTRTPTQVASH  162

Query  470  AQKYFLRHNSLHSTKRRRSLFDLAWKADE  384
            AQKYFLR NSL   KRR SLFD    ADE
Sbjct  163  AQKYFLRQNSLTQKKRRSSLFD----ADE  187



>ref|XP_006345334.1| PREDICTED: myb-like protein J-like [Solanum tuberosum]
Length=258

 Score =   136 bits (343),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 97/188 (52%), Positives = 119/188 (63%), Gaps = 19/188 (10%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLI----GSHQNysssssysfv  771
            M RKCS CG  GHNSRTC+      ++S  G ++LFGV+LI     S  + SSSSSY   
Sbjct  1    MGRKCSHCGNIGHNSRTCSTFKLGASASFVGGLRLFGVQLIDISSSSSASSSSSSSYDIH  60

Query  770  mkksfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCG---YISDGLVCGNLPEKKR  600
            +KKS S DC+ +   S + S             + K   C    Y+SD L+ G   E+++
Sbjct  61   LKKSLSLDCMSSPQVSSSSSLV---------TLNEKSTTCTNGDYLSDCLL-GQPQERRK  110

Query  599  GVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLH--STK  426
            GV W+EEEHR FL+GLEKLG+GDWRGISR FVTTRTPTQ+ASHAQKYFLR  S H    K
Sbjct  111  GVGWTEEEHRRFLMGLEKLGKGDWRGISRKFVTTRTPTQVASHAQKYFLRQYSTHLNKKK  170

Query  425  RRRSLFDL  402
            RR SLFD+
Sbjct  171  RRSSLFDM  178



>emb|CDY65437.1| BnaCnng47140D [Brassica napus]
Length=234

 Score =   135 bits (341),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 90/193 (47%), Positives = 114/193 (59%), Gaps = 34/193 (18%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssy-------  780
            M RKCS CG  GHNSRTC +N  +        +KLFGV +  +  +     S        
Sbjct  1    MGRKCSHCGSVGHNSRTCFSNKTR-------VIKLFGVHVDTTGSSPPPGPSSPPPSSIL  53

Query  779  sfvmkksfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKR  600
            +  MKKSFS DCLPA S S +                      GY+SDGL       KK 
Sbjct  54   AAAMKKSFSMDCLPACSSSSSSF-------------------AGYLSDGLTHKTPDRKKV  94

Query  599  GVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRH-NSLHSTKR  423
            GVPW+E+EH++FL+GLEKLG+GDWRGISR+FV T++PTQ+ASHAQKYF+R   +LH  +R
Sbjct  95   GVPWTEKEHQMFLIGLEKLGKGDWRGISRNFVVTKSPTQVASHAQKYFIRQATTLHHKRR  154

Query  422  RRSLFDLAWKADE  384
            R SLFD+A   +E
Sbjct  155  RTSLFDMASNVEE  167



>ref|XP_002991458.1| hypothetical protein SELMODRAFT_133546 [Selaginella moellendorffii]
 ref|XP_002993844.1| hypothetical protein SELMODRAFT_137652 [Selaginella moellendorffii]
 gb|EFJ05081.1| hypothetical protein SELMODRAFT_137652 [Selaginella moellendorffii]
 gb|EFJ07570.1| hypothetical protein SELMODRAFT_133546 [Selaginella moellendorffii]
Length=175

 Score =   134 bits (337),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 78/182 (43%), Positives = 109/182 (60%), Gaps = 21/182 (12%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            M R+CS CG  GHNSRTC +            ++LFGV+L       +  +S   + + +
Sbjct  1    MARRCSHCGHNGHNSRTCPDRG----------IRLFGVRLT---MKATDGASGVAMRRSA  47

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGN--LPEKKRGVPWS  585
             + + +   + +   SS   +    +   DG      Y SDGLV  +     +K+GVPW 
Sbjct  48   SAGNLVTMQAIATPTSSSAVASEQSESGGDG------YASDGLVQASSYARARKKGVPWR  101

Query  584  EEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFD  405
            EEEHR+FLVGL  LG+GDWRGISR++VT+RTPTQ+ASHAQKYF+R ++L   KRR SLFD
Sbjct  102  EEEHRLFLVGLHALGKGDWRGISRNYVTSRTPTQVASHAQKYFIRQSNLTKRKRRSSLFD  161

Query  404  LA  399
            ++
Sbjct  162  IS  163



>ref|XP_010049179.1| PREDICTED: transcription factor MYB1R1-like [Eucalyptus grandis]
Length=221

 Score =   135 bits (340),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 90/201 (45%), Positives = 113/201 (56%), Gaps = 26/201 (13%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTS-SHGGSMKLFGVKLIGSHQNysssssysfvmkk  762
            M RKCS CG  GHNSRTC +   +  S   GG +KLFGV+L  ++    +S         
Sbjct  1    MGRKCSHCGFMGHNSRTCASIRRRDASFGGGGRVKLFGVQLEAAYPCGVASRLPLKKSLS  60

Query  761  sfSDDCL-----------PaasysfadssfgssgFLFDENFDGKVPGC--------GYIS  639
                DCL           P +S + +  S  ++  + D     + P          GY S
Sbjct  61   M---DCLMPSVRVLTSSSPLSSATNSSLSLRAACDVGDRLLRDESPNKAANSPSNDGYAS  117

Query  638  DGLVCGNLPEKKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKY  459
            DG + G   E+K+G+PW+EEEHR FLVGLE LG+GDWRGIS+ FV TRTPTQ+ASHAQKY
Sbjct  118  DGFL-GRAQERKKGLPWTEEEHRTFLVGLETLGKGDWRGISKKFVGTRTPTQVASHAQKY  176

Query  458  FLRHNSL--HSTKRRRSLFDL  402
            FLR  SL     KRR SLFD+
Sbjct  177  FLRQKSLLPRRNKRRPSLFDV  197



>ref|XP_006643865.1| PREDICTED: transcription factor MYB1R1-like [Oryza brachyantha]
Length=287

 Score =   137 bits (344),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 75/90 (83%), Gaps = 1/90 (1%)
 Frame = -2

Query  650  GYISDGLVCGNLPEKKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASH  471
            GY+SDGL+     E+K+GVPW+EEEHR FLVGLEKLG+GDWRGISRHFVTTRTPTQ+ASH
Sbjct  109  GYLSDGLM-ARAQERKKGVPWTEEEHRKFLVGLEKLGKGDWRGISRHFVTTRTPTQVASH  167

Query  470  AQKYFLRHNSLHSTKRRRSLFDLAWKADEC  381
            AQKYFLR +SL   KRR SLFD+   A++ 
Sbjct  168  AQKYFLRQSSLTQKKRRSSLFDVVENAEKA  197



>ref|XP_009370418.1| PREDICTED: myb-like protein J [Pyrus x bretschneideri]
Length=349

 Score =   138 bits (348),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 81/187 (43%), Positives = 106/187 (57%), Gaps = 32/187 (17%)
 Frame = -2

Query  935  TRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkksf  756
             RKCS CG  GHNSRTCN+ +  +    G  +KLFGV ++   ++    S     +    
Sbjct  6    ARKCSHCGHNGHNSRTCNHGHGNK----GVCLKLFGVNIMEIEEDSIKKSYSMGNLLADG  61

Query  755  SDDCLPaasysfadssfgssgFLFDENFDGKVPG--CGYISDGLVCGN----LPEKKRGV  594
            + D                       N +  V G   GY+SDGL+         E+ +G 
Sbjct  62   TGD----------------------HNNNAVVAGHDAGYLSDGLIHNKRHKAAHERNKGR  99

Query  593  PWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRS  414
            PW+EEEHR+FL GL+KLG+GDWRGI+R+FVTTRTPTQ+ASHAQKYFLR  +    KRR S
Sbjct  100  PWTEEEHRVFLAGLKKLGKGDWRGIARNFVTTRTPTQVASHAQKYFLRQATNDKRKRRSS  159

Query  413  LFDLAWK  393
            LFD+ +K
Sbjct  160  LFDMHFK  166



>ref|NP_200495.1| myb-like transcription factor family protein [Arabidopsis thaliana]
 dbj|BAB09902.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAS09987.1| MYB transcription factor [Arabidopsis thaliana]
 gb|AAS99672.1| At5g56840 [Arabidopsis thaliana]
 gb|AAT47807.1| At5g56840 [Arabidopsis thaliana]
 gb|AED96812.1| myb-like transcription factor family protein [Arabidopsis thaliana]
Length=233

 Score =   135 bits (340),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 82/184 (45%), Positives = 106/184 (58%), Gaps = 31/184 (17%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            M R+CS CG  GHNSRTC++   +        ++LFGV L  +  +       S +    
Sbjct  1    MGRRCSHCGNVGHNSRTCSSYQTR-------VVRLFGVHLDTTSSSPPPPPPPSILAAAI  53

Query  758  fSD---DCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKRGVPW  588
                  DCLPA S S +                      GY+SDGL     P++K+GVPW
Sbjct  54   KKSFSMDCLPACSSSSSSF-------------------AGYLSDGLA-HKTPDRKKGVPW  93

Query  587  SEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRH-NSLHSTKRRRSL  411
            + EEHR FL+GLEKLG+GDWRGISR+FV T++PTQ+ASHAQKYFLR   +LH  +RR SL
Sbjct  94   TAEEHRTFLIGLEKLGKGDWRGISRNFVVTKSPTQVASHAQKYFLRQTTTLHHKRRRTSL  153

Query  410  FDLA  399
            FD+ 
Sbjct  154  FDMV  157



>ref|XP_011010641.1| PREDICTED: uncharacterized protein LOC105115454 [Populus euphratica]
Length=303

 Score =   137 bits (345),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 89/180 (49%), Positives = 111/180 (62%), Gaps = 17/180 (9%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            M RKCS C   GHNSRTC  +     +   G ++LFGV+L  S  + +   S+S     S
Sbjct  1    MGRKCSHCWNIGHNSRTCTTHR----AVVAGGVRLFGVQLDISSSSAAMKKSFSVDCLPS  56

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKRGVPWSEE  579
             S             SS  SS    D+N D       Y+SD L+ G +  +K+GVPW+EE
Sbjct  57   SS----------SPSSSLCSSRVSIDDNSDKT--SVDYLSDVLL-GPVQARKKGVPWTEE  103

Query  578  EHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFDLA  399
            EHR FL+GLE+LG+GDWRGISR+FVTTRTPTQ+ASHAQKYFLR   L+  KRR SLFD+A
Sbjct  104  EHRTFLIGLERLGKGDWRGISRNFVTTRTPTQVASHAQKYFLRQAILNKKKRRSSLFDMA  163



>gb|AFU81575.1| MYB-related transcription factor, partial [Zea mays subsp. mays]
 tpg|DAA58868.1| TPA: putative MYB DNA-binding domain superfamily protein [Zea 
mays]
Length=291

 Score =   136 bits (343),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 114/190 (60%), Gaps = 16/190 (8%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNN---EQRTSSHGGSMKLFGVKLIGSHQNysssssysfvm  768
            M RKCS CG  GHNSRTC       E   +   G ++LFGV++           + S  M
Sbjct  1    MARKCSHCGNCGHNSRTCGRETMLCEAGDNGGHGGLRLFGVQV-----RIGGGGAGSASM  55

Query  767  kksfSDDCLPaasy-------sfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPE  609
            KKS+S DCL  A+        S + SS        +E  +   P  GY+SDG     + E
Sbjct  56   KKSYSMDCLQLAAPGCSLVSPSTSSSSSSLLLMSIEEGSERGAPN-GYLSDGPHGRAVQE  114

Query  608  KKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHST  429
            +K+GVPWSEEEHR FL GLEKLG+GDWRGISR +V TRTPTQ+ASHAQK+FLR +SL   
Sbjct  115  RKKGVPWSEEEHRQFLSGLEKLGKGDWRGISRSYVPTRTPTQVASHAQKFFLRQSSLGKK  174

Query  428  KRRRSLFDLA  399
            KRR SLFD+ 
Sbjct  175  KRRSSLFDMV  184



>ref|XP_010662238.1| PREDICTED: transcription factor MYB1R1-like isoform X2 [Vitis 
vinifera]
Length=301

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 102/182 (56%), Gaps = 37/182 (20%)
 Frame = -2

Query  935  TRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkksf  756
             RKCS CG  GHNSRTC+   +       G +KLFGV+++   +                
Sbjct  8    VRKCSHCGNNGHNSRTCSAGGK-------GCLKLFGVQILTEKE----------------  44

Query  755  SDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGN----LPEKKRGVPW  588
             D+ +             S G L   N +      GY+SDGL+         E+K+GVPW
Sbjct  45   -DEAM---------RKSLSMGNLQSCNIEHHHGDAGYLSDGLLQSRRGKRAHERKKGVPW  94

Query  587  SEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLF  408
            SEEEHR FL GLEKLG+GDWRGI++ FVTTRTPTQ+ASHAQKYFLR  +    KRR SLF
Sbjct  95   SEEEHRTFLAGLEKLGKGDWRGIAKKFVTTRTPTQVASHAQKYFLRRAACDKRKRRPSLF  154

Query  407  DL  402
            D+
Sbjct  155  DM  156



>ref|XP_002278155.2| PREDICTED: transcription factor MYB1R1-like isoform X1 [Vitis 
vinifera]
Length=318

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 102/182 (56%), Gaps = 37/182 (20%)
 Frame = -2

Query  935  TRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkksf  756
             RKCS CG  GHNSRTC+   +       G +KLFGV+++   +                
Sbjct  8    VRKCSHCGNNGHNSRTCSAGGK-------GCLKLFGVQILTEKE----------------  44

Query  755  SDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGN----LPEKKRGVPW  588
             D+ +             S G L   N +      GY+SDGL+         E+K+GVPW
Sbjct  45   -DEAM---------RKSLSMGNLQSCNIEHHHGDAGYLSDGLLQSRRGKRAHERKKGVPW  94

Query  587  SEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLF  408
            SEEEHR FL GLEKLG+GDWRGI++ FVTTRTPTQ+ASHAQKYFLR  +    KRR SLF
Sbjct  95   SEEEHRTFLAGLEKLGKGDWRGIAKKFVTTRTPTQVASHAQKYFLRRAACDKRKRRPSLF  154

Query  407  DL  402
            D+
Sbjct  155  DM  156



>gb|AFK48132.1| unknown [Medicago truncatula]
Length=280

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 112/178 (63%), Gaps = 14/178 (8%)
 Frame = -2

Query  929  KCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkksfSD  750
            KCS CGK GHN RTC       TS   G ++LFGV+L  S  + SSS+            
Sbjct  5    KCSHCGKIGHNCRTC-------TSFTLGGLRLFGVQLSSSSSSSSSSNMIKKSFSM----  53

Query  749  DCLPaasysfadssfgssgFLFDEN-FDGKVPGCGYISDGLVCGNLPEKKRGVPWSEEEH  573
            D  P+ S   +  S  +S    DEN +        Y+SD  + G   E+K+GVPW+EEEH
Sbjct  54   DTFPSPSSPSSSFSSSTSLTNIDENHYHKSTSNIAYLSDCFI-GPPQERKKGVPWTEEEH  112

Query  572  RIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFDLA  399
            R+FLVGLEKLG+GDWRGIS++FVT+RTPTQ+ASHAQKYFLR  +++  KRR SLFDL 
Sbjct  113  RMFLVGLEKLGKGDWRGISKNFVTSRTPTQVASHAQKYFLRLATINK-KRRSSLFDLV  169



>ref|XP_010441468.1| PREDICTED: uncharacterized protein LOC104724629 [Camelina sativa]
Length=375

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 107/183 (58%), Gaps = 24/183 (13%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLI-GSHQNysssssysfvmkk  762
            MTR+CS C   GHNSRTC N            +KLFGV+L  GS +  +S  + S     
Sbjct  1    MTRRCSHCNHNGHNSRTCPNRG----------VKLFGVRLTEGSIRKSASMGNLSHYTGS  50

Query  761  sfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLP--EKKRGVPW  588
                     +    +             +    VPG GY S+  V G+    E+K+G PW
Sbjct  51   GSGGHGGTGSITPGSPG-----------DVPDHVPGDGYASEDFVAGSSSSRERKKGTPW  99

Query  587  SEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLF  408
            +EEEHR+FL+GL+KLG+GDWRGISR++VTTRTPTQ+ASHAQKYF+R +++   KRR SLF
Sbjct  100  TEEEHRMFLLGLQKLGKGDWRGISRNYVTTRTPTQVASHAQKYFIRQSNVSRRKRRSSLF  159

Query  407  DLA  399
            D+ 
Sbjct  160  DMV  162



>ref|NP_001042277.1| Os01g0192300 [Oryza sativa Japonica Group]
 dbj|BAD72233.1| putative MCB2 protein [Oryza sativa Japonica Group]
 dbj|BAF04191.1| Os01g0192300 [Oryza sativa Japonica Group]
 gb|EAZ10870.1| hypothetical protein OsJ_00711 [Oryza sativa Japonica Group]
 dbj|BAG88219.1| unnamed protein product [Oryza sativa Japonica Group]
Length=310

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 75/90 (83%), Gaps = 1/90 (1%)
 Frame = -2

Query  650  GYISDGLVCGNLPEKKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASH  471
            GY+SDGL+     E+K+GVPW+EEEHR FLVGLEKLG+GDWRGISRHFVTTRTPTQ+ASH
Sbjct  107  GYLSDGLM-ARAQERKKGVPWTEEEHRKFLVGLEKLGKGDWRGISRHFVTTRTPTQVASH  165

Query  470  AQKYFLRHNSLHSTKRRRSLFDLAWKADEC  381
            AQKYFLR +SL   KRR SLFD+   A++ 
Sbjct  166  AQKYFLRQSSLTQKKRRSSLFDVIEDAEKA  195



>gb|EAY72864.1| hypothetical protein OsI_00735 [Oryza sativa Indica Group]
Length=306

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 75/90 (83%), Gaps = 1/90 (1%)
 Frame = -2

Query  650  GYISDGLVCGNLPEKKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASH  471
            GY+SDGL+     E+K+GVPW+EEEHR FLVGLEKLG+GDWRGISRHFVTTRTPTQ+ASH
Sbjct  103  GYLSDGLM-ARAQERKKGVPWTEEEHRKFLVGLEKLGKGDWRGISRHFVTTRTPTQVASH  161

Query  470  AQKYFLRHNSLHSTKRRRSLFDLAWKADEC  381
            AQKYFLR +SL   KRR SLFD+   A++ 
Sbjct  162  AQKYFLRQSSLTQKKRRSSLFDVIEDAEKA  191



>ref|XP_008655699.1| PREDICTED: transcription factor MYB1R1-like [Zea mays]
 gb|AFW80249.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
Length=347

 Score =   137 bits (346),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = -2

Query  656  GCGYISDGLVCGNLPEKKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIA  477
              GY+SDGLV     E+K+GVPW+E+EHR FL GLEKLG+GDWRGISRHFVTTRTPTQ+A
Sbjct  116  ASGYLSDGLVGRAQAERKKGVPWTEDEHRRFLAGLEKLGKGDWRGISRHFVTTRTPTQVA  175

Query  476  SHAQKYFLRHNSLHSTKRRRSLFDLAWKADE  384
            SHAQKYFLR +SL   KRR SLFD+   A E
Sbjct  176  SHAQKYFLRQSSLAHKKRRSSLFDVVENAAE  206



>ref|XP_010481334.1| PREDICTED: pinin-like [Camelina sativa]
Length=381

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 107/183 (58%), Gaps = 24/183 (13%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLI-GSHQNysssssysfvmkk  762
            MTR+CS C   GHNSRTC N            +KLFGV+L  GS +  +S  + S     
Sbjct  1    MTRRCSHCNHNGHNSRTCPNRG----------VKLFGVRLTEGSIRKSASMGNLSHYTGS  50

Query  761  sfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLP--EKKRGVPW  588
                     +    +             +    VPG GY S+  V G+    E+K+G PW
Sbjct  51   GSGGHGGTGSITPGSPG-----------DVPDHVPGDGYASEDFVAGSSSSRERKKGTPW  99

Query  587  SEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLF  408
            +EEEHR+FL+GL+KLG+GDWRGISR++VTTRTPTQ+ASHAQKYF+R +++   KRR SLF
Sbjct  100  TEEEHRMFLLGLQKLGKGDWRGISRNYVTTRTPTQVASHAQKYFIRQSNVSRRKRRSSLF  159

Query  407  DLA  399
            D+ 
Sbjct  160  DMV  162



>ref|XP_007152917.1| hypothetical protein PHAVU_004G171200g [Phaseolus vulgaris]
 gb|ESW24911.1| hypothetical protein PHAVU_004G171200g [Phaseolus vulgaris]
Length=263

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 82/189 (43%), Positives = 107/189 (57%), Gaps = 31/189 (16%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            M RKCS CG  GHNSRTC++    R +  G  ++LFGV+L  S+ +  +      +    
Sbjct  1    MGRKCSHCGNRGHNSRTCSS---LRATFVG--VRLFGVQLHISNSSSLTMKKSFSMDSLP  55

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISD--GLVCGNLPEKKRGVPWS  585
                                                GY+SD  GL+     ++K+GVPW+
Sbjct  56   LLS-----------------------SPSSSFSSSVGYLSDSDGLIVPP-QDRKKGVPWT  91

Query  584  EEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFD  405
            EEEHR FLVGLEKLG+GDWRGISR++VTTRTPTQ+ASHAQKYF+R  +L+  KRR SLFD
Sbjct  92   EEEHRTFLVGLEKLGKGDWRGISRNYVTTRTPTQVASHAQKYFIRLATLNKKKRRSSLFD  151

Query  404  LAWKADECR  378
            L   +  C+
Sbjct  152  LVGGSSNCK  160



>gb|ABR16522.1| unknown [Picea sitchensis]
Length=361

 Score =   137 bits (346),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 83/182 (46%), Positives = 106/182 (58%), Gaps = 34/182 (19%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            M+R CS CG  GHNSRTC           G ++ LFGV+L       S S +    + + 
Sbjct  1    MSRSCSQCGHNGHNSRTCV----------GNAVMLFGVRLTDGPMRKSVSMNNLSNLSQY  50

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLV--CGNLPEKKRGVPWS  585
               D     +                E FDG      Y+SD LV    N  E+KRGVPW+
Sbjct  51   EHSDPAEDGA----------------EGFDG------YVSDDLVHSSSNARERKRGVPWT  88

Query  584  EEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFD  405
            EEEHR+FLVGL+K+G+GDWRGISR+FV TRTPTQ+ASHAQKYFLR ++++  +RR SLFD
Sbjct  89   EEEHRMFLVGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKYFLRQSNMNRRRRRSSLFD  148

Query  404  LA  399
            + 
Sbjct  149  IT  150



>emb|CDY11901.1| BnaC03g13270D [Brassica napus]
Length=234

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 90/193 (47%), Positives = 114/193 (59%), Gaps = 34/193 (18%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssy-------  780
            M RKCS CG  GHNSRTC +N  +        +KLFGV +  +  +     S        
Sbjct  1    MGRKCSHCGSVGHNSRTCFSNKTR-------VIKLFGVHVDTTGSSPPPGPSSPPPSSIL  53

Query  779  sfvmkksfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKR  600
            +  MKKSFS DCLPA S S +                      GY+SDGL       KK 
Sbjct  54   AAAMKKSFSMDCLPACSSSSSSF-------------------AGYLSDGLNHKTPDRKKV  94

Query  599  GVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRH-NSLHSTKR  423
            GVPW+E+EH++FL+GLEKLG+GDWRGISR+FV T++PTQ+ASHAQKYF+R   +LH  +R
Sbjct  95   GVPWTEKEHQMFLIGLEKLGKGDWRGISRNFVVTKSPTQVASHAQKYFIRQATTLHHKRR  154

Query  422  RRSLFDLAWKADE  384
            R SLFD+A   +E
Sbjct  155  RTSLFDMASNVEE  167



>ref|XP_010052392.1| PREDICTED: protein REVEILLE 5-like [Eucalyptus grandis]
 gb|KCW76353.1| hypothetical protein EUGRSUZ_D00726 [Eucalyptus grandis]
Length=296

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 92/210 (44%), Positives = 116/210 (55%), Gaps = 28/210 (13%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTS-SHGGSMKLFGVKLIGSHQNysssssysfvmkk  762
            M RKCS CG  GHNSRTC +   +  S   GG +KLFGV+L  ++    +S         
Sbjct  1    MGRKCSHCGFMGHNSRTCASIRRRDASFGGGGRVKLFGVQLEAAYPCGVASRLPLKKSLS  60

Query  761  sfSDDCL-----------PaasysfadssfgssgFLFDENFDGKVPGC--------GYIS  639
                DCL           P +S + +  S  ++  + D     + P          GY S
Sbjct  61   M---DCLMPSVRVLTSSSPLSSATNSSLSLRAACDVGDRLLRDESPNKAANSPSNDGYAS  117

Query  638  DGLVCGNLPEKKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKY  459
            DG + G   E+K+G+PW+EEEHR FLVGLE LG+GDWRGIS+ FV TRTPTQ+ASHAQKY
Sbjct  118  DGFL-GRAQERKKGLPWTEEEHRTFLVGLETLGKGDWRGISKKFVGTRTPTQVASHAQKY  176

Query  458  FLRHNSL--HSTKRRRSLFDLAWKADECRV  375
            FLR  SL     KRR SLFD+    + CR 
Sbjct  177  FLRQKSLLPRRNKRRPSLFDVGM--ERCRA  204



>ref|XP_002308294.2| hypothetical protein POPTR_0006s15480g [Populus trichocarpa]
 gb|EEE91817.2| hypothetical protein POPTR_0006s15480g [Populus trichocarpa]
Length=383

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 114/182 (63%), Gaps = 17/182 (9%)
 Frame = -2

Query  944  IRMTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmk  765
            ++M RKCS C   GHNSRTC      R +  GG ++LFGV+L  S  + +   S+S    
Sbjct  79   VKMGRKCSHCWNIGHNSRTCTT---YRAAVAGG-VRLFGVQLDISSSSAAMKKSFSVDCL  134

Query  764  ksfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKRGVPWS  585
             S S             SS  SS    D+N D       Y+SD L+ G +  +K+GVPW+
Sbjct  135  PSSS----------SPSSSLCSSRVSIDDNSDKA--SVDYLSDVLL-GPVQARKKGVPWT  181

Query  584  EEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFD  405
            EEEHR FL+GLEKLG+GDWRGISR+FVTTRTPTQ+ASHAQKYFLR   ++  KRR SLFD
Sbjct  182  EEEHRTFLMGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKYFLRQAIVNKKKRRPSLFD  241

Query  404  LA  399
            +A
Sbjct  242  MA  243



>ref|XP_004242968.1| PREDICTED: myb-like protein J [Solanum lycopersicum]
Length=247

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 96/188 (51%), Positives = 124/188 (66%), Gaps = 12/188 (6%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLI--------GSHQNysssss  783
            M RKCS C   GHNSRTC+      +++  G ++LFGV+LI         S  + SSSSS
Sbjct  1    MGRKCSRCRNIGHNSRTCSTFKLGASANFVGGLRLFGVQLIDISSSSSTSSSSSSSSSSS  60

Query  782  ysfvmkksfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKK  603
            Y   +KKS S DC+ +   S + SS  S   L +++         Y+SD L+ G   E++
Sbjct  61   YDIHLKKSLSLDCMSSPQVSISPSSSSSLVTLNEKS--TTCTNGDYLSDCLL-GQPKERR  117

Query  602  RGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNS-LHSTK  426
            +GV W+EEEHR FL+GLEKLG+GDWRGISR FVTTRTPTQ+ASHAQKYFLRH++ L+  K
Sbjct  118  KGVGWTEEEHRRFLMGLEKLGKGDWRGISRKFVTTRTPTQVASHAQKYFLRHSTHLNKKK  177

Query  425  RRRSLFDL  402
            RR SLFD+
Sbjct  178  RRSSLFDM  185



>ref|NP_001235955.1| MYB transcription factor MYB128 [Glycine max]
 gb|ABH02856.1| MYB transcription factor MYB128 [Glycine max]
 gb|ACU22952.1| unknown [Glycine max]
Length=168

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 108/183 (59%), Gaps = 23/183 (13%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            M RKCS CG  GHNSRTC +           +    GV+L G      SS+S + +  K 
Sbjct  1    MGRKCSHCGNIGHNSRTCASFR---------ATNFVGVRLFGVQLADISSTSSNSLSMKK  51

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISD--GLVCGNLPEKKRGVPWS  585
                    +S S + S   S   +            GY+SD  GL+ G    +K+GVPW+
Sbjct  52   SFSMDSFPSSSSPSSSFSSSRTSI------------GYLSDSDGLIVGAQEIRKKGVPWT  99

Query  584  EEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFD  405
            EEEHR FLVGLEKLG+GDWRGISR++VT+RTPTQ+ASHAQKYF+R  +++  KRR SLFD
Sbjct  100  EEEHRTFLVGLEKLGKGDWRGISRNYVTSRTPTQVASHAQKYFIRLATMNKKKRRSSLFD  159

Query  404  LAW  396
            + +
Sbjct  160  MVY  162



>gb|ACJ85142.1| unknown [Medicago truncatula]
Length=182

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 114/185 (62%), Gaps = 19/185 (10%)
 Frame = -2

Query  944  IRMTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmk  765
            + ++R CS CG  GHNSRTCN+  E++      S+ +FGV+L G + + +++++ + +  
Sbjct  1    MSLSRTCSQCGNNGHNSRTCNDGGEEK------SIMIFGVRLTGGNNHLNTTTTNTTINN  54

Query  764  ksfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLV--CGNLPEKKRGVP  591
                   +   S                   D      GY+SD +V   G   E+KRGVP
Sbjct  55   SFRKSASMTNLSQYEQPPPQ-----------DSNPADAGYVSDDIVHASGRSRERKRGVP  103

Query  590  WSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSL  411
            W+EEEH++FL+GL+++G+GDWRGISR+FV TRTPTQ+ASHAQKYFLR ++ +  +RR SL
Sbjct  104  WTEEEHKLFLLGLQQVGKGDWRGISRNFVKTRTPTQVASHAQKYFLRRHNQNRRRRRSSL  163

Query  410  FDLAW  396
            FD+ +
Sbjct  164  FDITF  168



>ref|XP_009132174.1| PREDICTED: uncharacterized protein LOC103856794 [Brassica rapa]
Length=235

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 88/188 (47%), Positives = 114/188 (61%), Gaps = 35/188 (19%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssy-------  780
            M RKCS CG  GHNSRTC +N  +        +KLFGV +  +  +     S        
Sbjct  1    MGRKCSHCGSVGHNSRTCFSNKTR-------VIKLFGVHVDTTGSSPPPGPSSPPPSSIL  53

Query  779  sfvmkksfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKR  600
            +  MKKSFS DCLPA S S +                      GY+SDGL     P++K+
Sbjct  54   AAAMKKSFSMDCLPACSSSSSSF-------------------AGYLSDGLT-HKTPDRKK  93

Query  599  GVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRH-NSLHSTKR  423
            GVPW+E+EH++FL+GLEKLG+GDWRGISR+FV T++PTQ+ASHAQKYF+R   +LH  +R
Sbjct  94   GVPWTEKEHQMFLIGLEKLGKGDWRGISRNFVVTKSPTQVASHAQKYFIRQATTLHHKRR  153

Query  422  RRSLFDLA  399
            R SLFD+ 
Sbjct  154  RTSLFDMV  161



>ref|XP_002455021.1| hypothetical protein SORBIDRAFT_03g003100 [Sorghum bicolor]
 gb|EES00141.1| hypothetical protein SORBIDRAFT_03g003100 [Sorghum bicolor]
Length=342

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 74/88 (84%), Gaps = 1/88 (1%)
 Frame = -2

Query  650  GYISDGLVCGNLPEKKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASH  471
            GY+SDGL+ G   E+K+GVPW+E+EHR FL GLEKLG+GDWRGISRHFVTTRTPTQ+ASH
Sbjct  112  GYLSDGLM-GRAQERKKGVPWTEDEHRRFLAGLEKLGKGDWRGISRHFVTTRTPTQVASH  170

Query  470  AQKYFLRHNSLHSTKRRRSLFDLAWKAD  387
            AQKYFLR +SL   KRR SLFD+   AD
Sbjct  171  AQKYFLRQSSLTHKKRRSSLFDVVENAD  198



>ref|XP_004503538.1| PREDICTED: uncharacterized protein LOC101500241 [Cicer arietinum]
Length=290

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 111/180 (62%), Gaps = 11/180 (6%)
 Frame = -2

Query  932  RKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSH--QNysssssysfvmkks  759
            RKCS CGK GHNSRTC       T      ++LFGV+L  ++   + +S  S + + K  
Sbjct  4    RKCSQCGKIGHNSRTC-------TPFTNIGLRLFGVQLPYNNIPPSSNSVVSNNNIKKSF  56

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKRGVPWSEE  579
              D      S   +  S      + + N         Y SD  + G   +KK+GVPW+EE
Sbjct  57   SMDTFPSPISSPSSSLSSSIITNIDEINHHKSTSNISYPSDCFI-GPPQDKKKGVPWTEE  115

Query  578  EHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRR-SLFDL  402
            EHRIFLVGLEK+G+GDWRGISR+FVTTRTPTQ+ASHAQKYFLR  ++++ K+RR SLFDL
Sbjct  116  EHRIFLVGLEKVGKGDWRGISRNFVTTRTPTQVASHAQKYFLRLATINNKKKRRSSLFDL  175



>ref|XP_009416462.1| PREDICTED: uncharacterized protein LOC103997055 [Musa acuminata 
subsp. malaccensis]
Length=274

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 114/180 (63%), Gaps = 15/180 (8%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            M RKC    ++ HNSR  N+ + +R    GG ++LFG++L             +  MKK 
Sbjct  1    MERKCCEGVESEHNSR--NSISPRRMV--GGGLRLFGMQL----------EMAASPMKKC  46

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKRGVPWSEE  579
            FS DCL   + + +  S  SS  L   +   +    GY+SDGLV     E+K+GV W+EE
Sbjct  47   FSTDCLTCPAAASSSPSPSSSSSLVSIDETAEKTSNGYLSDGLVV-RTQERKKGVAWTEE  105

Query  578  EHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFDLA  399
            EH++FL GLE+LGRGDWRGISR+FVTTRTPTQ+ASHAQKYFLR + L+  KRR SLFD+ 
Sbjct  106  EHKLFLAGLERLGRGDWRGISRNFVTTRTPTQVASHAQKYFLRQSGLNKKKRRSSLFDVV  165



>ref|XP_002455906.1| hypothetical protein SORBIDRAFT_03g027120 [Sorghum bicolor]
 gb|EES01026.1| hypothetical protein SORBIDRAFT_03g027120 [Sorghum bicolor]
Length=307

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 90/196 (46%), Positives = 116/196 (59%), Gaps = 21/196 (11%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRT----------SSHGGSMKLFGVKLIGSHQNysss  789
            M RKCS CG  GHNSRTC   + +               G  ++LFGV++    +     
Sbjct  1    MARKCSHCGNYGHNSRTCGLGHSREVMLCEAGDNGGGHGGSGLRLFGVQV----RIGGGG  56

Query  788  ssysfvmkksfSDDCLPaasysf-------adssfgssgFLFDENFDGKVPGCGYISDGL  630
            +  S  MKKS+S DCL  A+          + SS  S     +E  +      GY+SDG 
Sbjct  57   AGSSASMKKSYSMDCLQLAAAQAGCSLVSPSSSSSSSLLLSIEEGLERGAAANGYLSDGP  116

Query  629  VCGNLPEKKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLR  450
                + E+K+GVPWSEEEHR FL GLE+LG+GDWRGISR++VTTRTPTQ+ASHAQK+FLR
Sbjct  117  HGRVVQERKKGVPWSEEEHRQFLAGLEQLGKGDWRGISRNYVTTRTPTQVASHAQKFFLR  176

Query  449  HNSLHSTKRRRSLFDL  402
             +S+   KRR SLFD+
Sbjct  177  QSSMGKKKRRSSLFDM  192



>ref|XP_001764190.1| predicted protein [Physcomitrella patens]
 gb|EDQ71031.1| predicted protein [Physcomitrella patens]
Length=694

 Score =   140 bits (352),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 82/184 (45%), Positives = 112/184 (61%), Gaps = 27/184 (15%)
 Frame = -2

Query  944  IRMTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmk  765
            I M+R+CS CG  GHNSRTC +            ++LFGV+L     + +   S S    
Sbjct  151  IEMSRRCSHCGLNGHNSRTCPDRG----------VRLFGVRLTDGISSMNMRKSVSMNNL  200

Query  764  ksfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLV--CGNLPEKKRGVP  591
              ++                 +S    + +  G  P  GY+SDGLV    N  E+K+GVP
Sbjct  201  SHYTS--------------THNSPSPSEHSESGAAPD-GYVSDGLVQTSNNARERKKGVP  245

Query  590  WSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSL  411
            W+E+EHR+FL+GL+KLG+GDWRGISR+FVTTRTPTQ+ASHAQKYF+R ++++  KRR SL
Sbjct  246  WTEDEHRLFLLGLQKLGKGDWRGISRNFVTTRTPTQVASHAQKYFIRQSNMNKRKRRSSL  305

Query  410  FDLA  399
            FD+ 
Sbjct  306  FDIV  309



>ref|XP_008450842.1| PREDICTED: transcription factor MYB1R1-like isoform X2 [Cucumis 
melo]
Length=258

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 76/89 (85%), Gaps = 1/89 (1%)
 Frame = -2

Query  665  KVPGCGYISDGLVCGNLPEKKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPT  486
            K P  GY+SDGL+ G+  E+K+GVPW+EEEHR FL+GLEKLGRGDWRGISR++VTTRTPT
Sbjct  113  KSPSNGYLSDGLLNGD-QERKKGVPWTEEEHRKFLIGLEKLGRGDWRGISRNYVTTRTPT  171

Query  485  QIASHAQKYFLRHNSLHSTKRRRSLFDLA  399
            Q+ASHAQKYFLR ++L+   RR SLFD+ 
Sbjct  172  QVASHAQKYFLRQSTLNKKNRRSSLFDMV  200



>ref|XP_009593865.1| PREDICTED: myb-like protein J [Nicotiana tomentosiformis]
Length=286

 Score =   135 bits (339),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 87/186 (47%), Positives = 113/186 (61%), Gaps = 24/186 (13%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            M RKCS CGK GHNSRTC++    +  +    ++LFGV+++    + SS+         S
Sbjct  1    MGRKCSHCGKIGHNSRTCSSF---KVGAISCGLRLFGVQVVDISASSSSAYDVQLKKSLS  57

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGC---GYISDGLVCGNLPEKKRGVPW  588
               DCL +   + + SS              K   C   G +SD L+     ++++GV W
Sbjct  58   L--DCLSSPPPTVSSSSE-------------KTTSCTNIGSLSDCLLGQVHQDRRKGVAW  102

Query  587  SEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLR---HNSLHSTKRRR  417
            +EEEHR FLVGLEKLG+GDWRGISR+FVTTRTPTQ+ASHAQKYFLR   H  L++ KRR 
Sbjct  103  TEEEHRTFLVGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKYFLRLSTHYHLNNNKRRS  162

Query  416  SLFDLA  399
            SLFDL 
Sbjct  163  SLFDLV  168



>ref|XP_004297686.1| PREDICTED: transcription factor MYB1R1-like [Fragaria vesca subsp. 
vesca]
Length=331

 Score =   135 bits (341),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 107/182 (59%), Gaps = 27/182 (15%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHG-GSMKLFGVKLIGSHQNysssssysfvmkk  762
            M+R CS CG  GHNSRTC        +S     + LFGV+L+    N    S+    + +
Sbjct  1    MSRTCSQCGNNGHNSRTCTEAAGGGAASPAENGIMLFGVRLVTEQGNAFRKSASMNNLSQ  60

Query  761  sfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLV--CGNLPEKKRGVPW  588
                D LP                L D N     P  GY SD +V   GN  E+KRGV W
Sbjct  61   Y---DQLP----------------LQDSN-----PDAGYASDDVVHASGNRRERKRGVAW  96

Query  587  SEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLF  408
            +EEEHR+FL+GL+K+G+GDWRGISR+FV TRTPTQ+ASHAQKYFLR ++ +  +RR SLF
Sbjct  97   TEEEHRLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKYFLRRSNHNRRRRRSSLF  156

Query  407  DL  402
            D+
Sbjct  157  DI  158



>gb|KFK31380.1| hypothetical protein AALP_AA6G104600 [Arabis alpina]
Length=367

 Score =   136 bits (343),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 107/181 (59%), Gaps = 21/181 (12%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            MTR+CS C   GHNSRTC N            +KLFGV+L       S+S         S
Sbjct  1    MTRRCSHCNHNGHNSRTCPNRG----------VKLFGVRLTEGSIRKSASMGNLSHYTGS  50

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLP--EKKRGVPWS  585
             S   L A S +       +         D  V G GY S+  V G+    E+K+G PW+
Sbjct  51   GSGGHLGAGSNTPGSPGDVT---------DHHVAGDGYASEDFVAGSSSSRERKKGTPWT  101

Query  584  EEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFD  405
            EEEHR+FL+GL+KLG+GDWRGISR++VTTRTPTQ+ASHAQKYF+R +++   KRR SLFD
Sbjct  102  EEEHRMFLLGLQKLGKGDWRGISRNYVTTRTPTQVASHAQKYFIRQSNVSRRKRRSSLFD  161

Query  404  L  402
            +
Sbjct  162  M  162



>gb|ACI12883.1| R1MYB1 protein [Saccharum hybrid cultivar Q117]
Length=313

 Score =   135 bits (340),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 76/92 (83%), Gaps = 1/92 (1%)
 Frame = -2

Query  650  GYISDGLVCGNLPEKKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASH  471
            GY+SDGLV   + ++K+GVPW+E+EHR+FL GL+KLG+GDWRGISRHFVTTRTPTQ+ASH
Sbjct  103  GYVSDGLVV-RVQDRKKGVPWTEDEHRMFLAGLDKLGKGDWRGISRHFVTTRTPTQVASH  161

Query  470  AQKYFLRHNSLHSTKRRRSLFDLAWKADECRV  375
            AQKYFLR NSL   KRR SLFD    A++  +
Sbjct  162  AQKYFLRQNSLTQKKRRSSLFDAVEGANKAAI  193



>gb|KDP39902.1| hypothetical protein JCGZ_03433 [Jatropha curcas]
Length=335

 Score =   135 bits (341),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 110/188 (59%), Gaps = 24/188 (13%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLI-GSHQNysssssysfvmkk  762
            MTR+CS C   GHNSRTC N            +KLFGV+L  GS +  +S  + S     
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRG----------VKLFGVRLTDGSIRKSASMGNLSHYTGS  50

Query  761  sfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLP--EKKRGVPW  588
                  L + S +              E  D      GY S+  V G+    E+K+GVPW
Sbjct  51   PNPGGALASGSNNPGSPG---------ETPDHGAAADGYASEDFVAGSSSSRERKKGVPW  101

Query  587  SEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLF  408
            +EEEHR+FL+GL+KLG+GDWRGI+R++V +RTPTQ+ASHAQKYF+R +++   KRR SLF
Sbjct  102  TEEEHRMFLLGLQKLGKGDWRGIARNYVISRTPTQVASHAQKYFIRQSNVSRRKRRSSLF  161

Query  407  DLAWKADE  384
            D+   ADE
Sbjct  162  DIV--ADE  167



>gb|AGT16142.1| MCB2 protein [Saccharum hybrid cultivar R570]
Length=346

 Score =   135 bits (341),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 74/90 (82%), Gaps = 1/90 (1%)
 Frame = -2

Query  650  GYISDGLVCGNLPEKKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASH  471
            GY+SDGL+ G   E+K+GVPW+E+EHR FL GLEKLG+GDWRGISRHFVTTRTPTQ+ASH
Sbjct  116  GYLSDGLM-GRAQERKKGVPWTEDEHRRFLAGLEKLGKGDWRGISRHFVTTRTPTQVASH  174

Query  470  AQKYFLRHNSLHSTKRRRSLFDLAWKADEC  381
            AQKYFLR +SL   KRR SLFD+   AD  
Sbjct  175  AQKYFLRQSSLTHKKRRSSLFDVVENADRA  204



>gb|ABR28340.1| MYB transcription factor MYB52 [Medicago truncatula]
Length=353

 Score =   136 bits (342),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 85/186 (46%), Positives = 110/186 (59%), Gaps = 18/186 (10%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            MTR+CS C   GHNSRTC      RT++ GG +KLFGV+L           S S      
Sbjct  1    MTRRCSHCSNNGHNSRTC----PSRTAAAGG-VKLFGVRLT---DGSIIKKSASMGNLNL  52

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLP------EKKRG  597
             +     ++S     SS       F+   D      GY+SD  V  +        E+K+G
Sbjct  53   AALHHSSSSSSLNPGSSLNPGSPCFEPPHDPD----GYLSDDPVHASSANATRRSERKKG  108

Query  596  VPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRR  417
            VPW+EEEHR+FLVGL+KLG+GDWRGI+R+FV +RTPTQ+ASHAQKYF+R ++    KRR 
Sbjct  109  VPWTEEEHRLFLVGLQKLGKGDWRGIARNFVVSRTPTQVASHAQKYFIRQSNATRRKRRS  168

Query  416  SLFDLA  399
            SLFD+A
Sbjct  169  SLFDMA  174



>gb|AHB59602.1| putative MYB-related protein 16 [Arachis hypogaea]
Length=306

 Score =   135 bits (339),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 83/189 (44%), Positives = 107/189 (57%), Gaps = 30/189 (16%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGS-------MKLFGVKLIGSHQNysssssy  780
            M+R CS CG  GHNSRTC + +    S  GG        + LFGV+L  +    SS    
Sbjct  1    MSRTCSQCGNNGHNSRTCTDASLAAGSVSGGGTPQRENGIMLFGVRLTTTEGTSSSFRKS  60

Query  779  sfvmkksfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLV--CGNLPEK  606
            + +   S  D   P                      D  V   GY+SD +V   G   E+
Sbjct  61   ASMGNLSQFDQQPPQ---------------------DPIVADAGYVSDDVVHASGRSRER  99

Query  605  KRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTK  426
            KRGVPW+EEEH++FL+GL K+G+GDWRGISR+FV TRTPTQ+ASHAQKYFLR ++ +  +
Sbjct  100  KRGVPWTEEEHKLFLLGLHKVGKGDWRGISRNFVKTRTPTQVASHAQKYFLRRHNQNRRR  159

Query  425  RRRSLFDLA  399
            RR SLFD+ 
Sbjct  160  RRSSLFDIT  168



>ref|XP_011081287.1| PREDICTED: uncharacterized protein LOC105164353 [Sesamum indicum]
Length=342

 Score =   135 bits (341),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 78/181 (43%), Positives = 103/181 (57%), Gaps = 12/181 (7%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            MTR+CS C   GHNSRTC N            +KLFGV+L       S+S          
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRG----------VKLFGVRLTDGSIRKSASMGNLTHYMGG  50

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLP--EKKRGVPWS  585
                    ++      +  S     D    G     GY S+  V G+    E+K+GVPW+
Sbjct  51   GGGGSGSGSATPQNGVTHDSPADTPDHPSAGSGGADGYASEDFVAGSSSSRERKKGVPWT  110

Query  584  EEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFD  405
            EEEHR+FL+GL+KLG+GDWRGI+R+FV +RTPTQ+ASHAQKYF+R +++   KRR SLFD
Sbjct  111  EEEHRMFLLGLQKLGKGDWRGIARNFVISRTPTQVASHAQKYFIRQSNVSRRKRRSSLFD  170

Query  404  L  402
            +
Sbjct  171  I  171



>ref|XP_003597679.1| hypothetical protein MTR_2g100930 [Medicago truncatula]
 gb|AES67930.1| MYB-like transcription factor family protein [Medicago truncatula]
Length=353

 Score =   136 bits (342),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 85/186 (46%), Positives = 110/186 (59%), Gaps = 18/186 (10%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            MTR+CS C   GHNSRTC      RT++ GG +KLFGV+L           S S      
Sbjct  1    MTRRCSHCSNNGHNSRTC----PSRTAAAGG-VKLFGVRLT---DGSIIKKSASMGNLNL  52

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLP------EKKRG  597
             +     ++S     SS       F+   D      GY+SD  V  +        E+K+G
Sbjct  53   AALHHSSSSSSLNPGSSLNPGSPCFEPPHDPD----GYLSDDPVHASSAFATRRSERKKG  108

Query  596  VPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRR  417
            VPW+EEEHR+FLVGL+KLG+GDWRGI+R+FV +RTPTQ+ASHAQKYF+R ++    KRR 
Sbjct  109  VPWTEEEHRLFLVGLQKLGKGDWRGIARNFVVSRTPTQVASHAQKYFIRQSNATRRKRRS  168

Query  416  SLFDLA  399
            SLFD+A
Sbjct  169  SLFDMA  174



>emb|CDX88591.1| BnaA03g10580D [Brassica napus]
Length=246

 Score =   133 bits (335),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 89/188 (47%), Positives = 112/188 (60%), Gaps = 34/188 (18%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssy-------  780
            M RKCS CG  GHNSRTC +N  +        +KLFGV +  +  +     S        
Sbjct  1    MGRKCSHCGSVGHNSRTCFSNKTR-------VIKLFGVHVDTTGSSPPPGPSSPPPSSIL  53

Query  779  sfvmkksfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKR  600
            +  MKKSFS DCLPA S S +                      GY+SDGL       KK 
Sbjct  54   AAAMKKSFSMDCLPACSSSSSSF-------------------AGYLSDGLNHKTPDRKKV  94

Query  599  GVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRH-NSLHSTKR  423
            GVPW+E+EH++FL+GLEKLG+GDWRGISR+FV T++PTQ+ASHAQKYF+R   +LH  +R
Sbjct  95   GVPWTEKEHQMFLIGLEKLGKGDWRGISRNFVVTKSPTQVASHAQKYFIRQATTLHHKRR  154

Query  422  RRSLFDLA  399
            R SLFD+A
Sbjct  155  RTSLFDMA  162



>ref|XP_008791498.1| PREDICTED: uncharacterized protein LOC103708379 [Phoenix dactylifera]
Length=351

 Score =   135 bits (340),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 80/192 (42%), Positives = 106/192 (55%), Gaps = 32/192 (17%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKL---IGSHQNysss-----ss  783
            MTR+CS C   GHNSRTC         +  G ++LFGV+L   +GS +  +S      + 
Sbjct  1    MTRRCSHCSNNGHNSRTC--------PTRAGGVRLFGVRLTDGVGSMKKSASMGSLYSAG  52

Query  782  ysfvmkksfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLP---  612
             S +        C P                  D   D +V   GY SD     +     
Sbjct  53   SSSIAGAGGGGGCSPNPGSPSN-----------DPLRDHQVAAAGYASDDAAHASCSSNC  101

Query  611  --EKKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSL  438
              E+K+GVPW+EEEHR+FL+GL+KLG+GDWRGI+R+FV +RTPTQ+ASHAQKYF+R  + 
Sbjct  102  RSERKKGVPWTEEEHRMFLLGLQKLGKGDWRGIARNFVVSRTPTQVASHAQKYFIRQTNA  161

Query  437  HSTKRRRSLFDL  402
               KRR SLFD+
Sbjct  162  SRRKRRSSLFDM  173



>ref|XP_004983650.1| PREDICTED: transcription factor MYB1R1-like [Setaria italica]
Length=315

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 81/182 (45%), Positives = 105/182 (58%), Gaps = 29/182 (16%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            MTR+CS C   GHNSRTC N            +K+FGV+L             +     S
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRG----------VKIFGVRLT---------DGSAIRKSAS  41

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLP---EKKRGVPW  588
              +  L +A  +   +S      L D        G GY SD  V G+     E+K+GVPW
Sbjct  42   MGNLSLLSAGSTSGGASPADGPDLADG-------GGGYASDDFVQGSSSASRERKKGVPW  94

Query  587  SEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLF  408
            +EEEHR FL+GL+KLG+GDWRGISR+FV +RTPTQ+ASHAQKYF+R +++   KRR SLF
Sbjct  95   TEEEHRRFLLGLQKLGKGDWRGISRNFVVSRTPTQVASHAQKYFIRQSNMSRRKRRSSLF  154

Query  407  DL  402
            D+
Sbjct  155  DM  156



>gb|ACJ85445.1| unknown [Medicago truncatula]
Length=211

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 88/179 (49%), Positives = 112/179 (63%), Gaps = 14/179 (8%)
 Frame = -2

Query  932  RKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkksfS  753
            RKCS CGK GHN RT        TS   G ++LFGV+L  S  + SSS+           
Sbjct  4    RKCSHCGKIGHNCRT-------YTSFTLGGLRLFGVQLSSSSSSSSSSNMIKKSFSM---  53

Query  752  DDCLPaasysfadssfgssgFLFDEN-FDGKVPGCGYISDGLVCGNLPEKKRGVPWSEEE  576
             D  P+ S   +  S  +S    DEN +        Y+SD  + G   E+K+GVPW+EEE
Sbjct  54   -DTFPSPSSPSSSFSSSTSLTNIDENHYHKSTSNIAYLSDCFI-GPPQERKKGVPWTEEE  111

Query  575  HRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFDLA  399
            +R+FLVGLEKLG+GDWRGIS++FVT+RTPTQ+ASHAQKYFLR  +++  KRR SLFDL 
Sbjct  112  YRMFLVGLEKLGKGDWRGISKNFVTSRTPTQVASHAQKYFLRLATINK-KRRSSLFDLV  169



>ref|XP_008450841.1| PREDICTED: putative uncharacterized protein DDB_G0277255 isoform 
X1 [Cucumis melo]
Length=362

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 76/90 (84%), Gaps = 1/90 (1%)
 Frame = -2

Query  668  GKVPGCGYISDGLVCGNLPEKKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTP  489
             K P  GY+SDGL+ G+  E+K+GVPW+EEEHR FL+GLEKLGRGDWRGISR++VTTRTP
Sbjct  112  SKSPSNGYLSDGLLNGD-QERKKGVPWTEEEHRKFLIGLEKLGRGDWRGISRNYVTTRTP  170

Query  488  TQIASHAQKYFLRHNSLHSTKRRRSLFDLA  399
            TQ+ASHAQKYFLR ++L+   RR SLFD+ 
Sbjct  171  TQVASHAQKYFLRQSTLNKKNRRSSLFDMV  200



>ref|XP_003613473.1| DIV1B protein [Medicago truncatula]
 gb|AES96431.1| MYB-like transcription factor family protein [Medicago truncatula]
Length=314

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 76/184 (41%), Positives = 113/184 (61%), Gaps = 19/184 (10%)
 Frame = -2

Query  944  IRMTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmk  765
            + ++R CS CG  GHNSRTCN+  E++      S+ +FGV+L G + + +++++ + +  
Sbjct  1    MSLSRTCSQCGNNGHNSRTCNDGGEEK------SIMIFGVRLTGGNNHLNTTTTNTTINN  54

Query  764  ksfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLV--CGNLPEKKRGVP  591
                   +   S                   D      GY+SD +V   G   E+KRGVP
Sbjct  55   SFRKSASMTNLSQYEQPPPQ-----------DSNPADAGYVSDDIVHASGRSRERKRGVP  103

Query  590  WSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSL  411
            W+EEEH++FL+GL+++G+GDWRGISR+FV TRTPTQ+ASHAQKYFLR ++ +  +RR SL
Sbjct  104  WTEEEHKLFLLGLQQVGKGDWRGISRNFVKTRTPTQVASHAQKYFLRRHNQNRRRRRSSL  163

Query  410  FDLA  399
            FD+ 
Sbjct  164  FDIT  167



>ref|XP_003545373.1| PREDICTED: transcription factor MYB1R1-like [Glycine max]
 gb|KHN17220.1| Transcription factor MYB1R1 [Glycine soja]
Length=267

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 92/207 (44%), Positives = 112/207 (54%), Gaps = 26/207 (13%)
 Frame = -2

Query  944  IRMTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKL---IGSHQNysssssysf  774
            +RM RKCS CG  GHNSRTCN        +H   +KLFGV+L     S  +    +S   
Sbjct  1    MRMGRKCSYCGNFGHNSRTCN--------THKRGLKLFGVQLDLCSSSSSSSLPLTSPCT  52

Query  773  vmkksfSDDCLPaasysfadssfgssgFLF--------DENFDGKVPGCGYISD----GL  630
                S   D +  +       S       +        DEN   K    GYI+     GL
Sbjct  53   SSSSSTPFDIMKRSLSMDYLVSSRIISPSYNFLLGGGADENSSDKTITDGYIASVGGGGL  112

Query  629  VCGNL-PEKKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFL  453
                   E+K+GVPWSEEEHR FL GLEKLG+GDWRGIS+ FV TRTP+Q+ASHAQK+FL
Sbjct  113  TSTTHHQERKKGVPWSEEEHRKFLEGLEKLGKGDWRGISKKFVITRTPSQVASHAQKFFL  172

Query  452  RHNSLHSTKRRRSLFDLAWKADECRVL  372
            R  S +  KRRRSLFD+  + DE   L
Sbjct  173  RQTSFNQRKRRRSLFDM--ERDETTTL  197



>ref|XP_006398430.1| hypothetical protein EUTSA_v10000932mg [Eutrema salsugineum]
 gb|ESQ39883.1| hypothetical protein EUTSA_v10000932mg [Eutrema salsugineum]
Length=367

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 82/183 (45%), Positives = 109/183 (60%), Gaps = 24/183 (13%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLI-GSHQNysssssysfvmkk  762
            MTR+CS C   GHNSRTC N            +KLFGV+L  GS +  +S  + S     
Sbjct  1    MTRRCSHCNHNGHNSRTCPNRG----------VKLFGVRLTEGSIRKSASMGNLSHYTGS  50

Query  761  sfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLP--EKKRGVPW  588
                     ++   +            +N D  V G GY S+  V G+    E+K+G PW
Sbjct  51   GSGGHGGNGSNTPGSPG----------DNPD-HVAGDGYASEDFVAGSSSSRERKKGTPW  99

Query  587  SEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLF  408
            +EEEHR+FL+GL+KLG+GDWRGISR++VTTRTPTQ+ASHAQKYF+R +++   KRR SLF
Sbjct  100  TEEEHRMFLLGLQKLGKGDWRGISRNYVTTRTPTQVASHAQKYFIRQSNVSRRKRRSSLF  159

Query  407  DLA  399
            D+ 
Sbjct  160  DMV  162



>dbj|BAJ34014.1| unnamed protein product [Thellungiella halophila]
Length=367

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 82/183 (45%), Positives = 109/183 (60%), Gaps = 24/183 (13%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLI-GSHQNysssssysfvmkk  762
            MTR+CS C   GHNSRTC N            +KLFGV+L  GS +  +S  + S     
Sbjct  1    MTRRCSHCNHNGHNSRTCPNRG----------VKLFGVRLTEGSIRKSASMGNLSHYTGS  50

Query  761  sfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLP--EKKRGVPW  588
                     ++   +            +N D  V G GY S+  V G+    E+K+G PW
Sbjct  51   GSGGHGGNGSNTPGSPG----------DNPD-HVAGDGYASEDFVAGSSSSRERKKGTPW  99

Query  587  SEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLF  408
            +EEEHR+FL+GL+KLG+GDWRGISR++VTTRTPTQ+ASHAQKYF+R +++   KRR SLF
Sbjct  100  TEEEHRMFLLGLQKLGKGDWRGISRNYVTTRTPTQVASHAQKYFIRQSNVSRRKRRSSLF  159

Query  407  DLA  399
            D+ 
Sbjct  160  DMV  162



>ref|XP_002865122.1| myb family transcription factor [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41381.1| myb family transcription factor [Arabidopsis lyrata subsp. lyrata]
Length=366

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 106/183 (58%), Gaps = 25/183 (14%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLI-GSHQNysssssysfvmkk  762
            MTR+CS C   GHNSRTC N            +KLFGV+L  GS +  +S  + S     
Sbjct  1    MTRRCSHCNHNGHNSRTCPNRG----------VKLFGVRLTEGSIRKSASMGNLSHYTGS  50

Query  761  sfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLP--EKKRGVPW  588
                    + +                 +    V G GY S+  V G+    E+K+G PW
Sbjct  51   GSGGHGTGSNTPGSPG------------DVPDHVAGDGYASEDFVAGSSSSRERKKGTPW  98

Query  587  SEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLF  408
            +EEEHR+FL+GL+KLG+GDWRGISR++VTTRTPTQ+ASHAQKYF+R +++   KRR SLF
Sbjct  99   TEEEHRMFLLGLQKLGKGDWRGISRNYVTTRTPTQVASHAQKYFIRQSNVSRRKRRSSLF  158

Query  407  DLA  399
            D+ 
Sbjct  159  DMV  161



>ref|NP_199550.1| myb-like transcription factor family protein [Arabidopsis thaliana]
 dbj|BAA97173.1| Myb-related transcription activator-like [Arabidopsis thaliana]
 gb|AAL59900.1| putative Myb-related transcription activator protein [Arabidopsis 
thaliana]
 gb|AAM20295.1| putative Myb-related transcription activator [Arabidopsis thaliana]
 gb|AAM60886.1| Myb-related transcription activator-like [Arabidopsis thaliana]
 gb|AAS09986.1| MYB transcription factor [Arabidopsis thaliana]
 dbj|BAE99002.1| Myb-related transcription activator-like [Arabidopsis thaliana]
 gb|AED95505.1| myb-like transcription factor family protein [Arabidopsis thaliana]
Length=365

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 106/183 (58%), Gaps = 25/183 (14%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLI-GSHQNysssssysfvmkk  762
            MTR+CS C   GHNSRTC N            +KLFGV+L  GS +  +S  + S     
Sbjct  1    MTRRCSHCNHNGHNSRTCPNRG----------VKLFGVRLTEGSIRKSASMGNLSHYTGS  50

Query  761  sfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLP--EKKRGVPW  588
                    + +                 +    V G GY S+  V G+    E+K+G PW
Sbjct  51   GSGGHGTGSNTPGSPG------------DVPDHVAGDGYASEDFVAGSSSSRERKKGTPW  98

Query  587  SEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLF  408
            +EEEHR+FL+GL+KLG+GDWRGISR++VTTRTPTQ+ASHAQKYF+R +++   KRR SLF
Sbjct  99   TEEEHRMFLLGLQKLGKGDWRGISRNYVTTRTPTQVASHAQKYFIRQSNVSRRKRRSSLF  158

Query  407  DLA  399
            D+ 
Sbjct  159  DMV  161



>gb|KHG18328.1| Transcription factor MYB1R1 [Gossypium arboreum]
Length=331

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 83/189 (44%), Positives = 106/189 (56%), Gaps = 30/189 (16%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            MTR+CS C   GHNSRTC N            +KLFGV+L                    
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRG----------VKLFGVRLT---------------EGLI  35

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLP---EKKRGVPW  588
                 +   S     +S   +G    E  DG     GY S+  V G+     E+KRGVPW
Sbjct  36   RKSASMGNLSQYSGLNSGMHNGNGSGEAGDGPDHADGYASEDFVPGSSSSNRERKRGVPW  95

Query  587  SEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLF  408
            +EEEHR+FL+GL+KLG+GDWRGISR++V +RTPTQ+ASHAQKYF+R +++   KRR SLF
Sbjct  96   TEEEHRMFLLGLQKLGKGDWRGISRNYVISRTPTQVASHAQKYFIRQSNVSRRKRRSSLF  155

Query  407  DLAWKADEC  381
            D+   ADE 
Sbjct  156  DIV--ADES  162



>gb|AHB59608.1| putative MYB-related protein 22 [Arachis hypogaea]
Length=332

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 81/192 (42%), Positives = 107/192 (56%), Gaps = 30/192 (16%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLI-------GSHQNysssssy  780
            MTR+CS C   GHNSRTC N            +KLFGV+L         S  N +  ++ 
Sbjct  1    MTRRCSHCSNNGHNSRTCPNRG----------VKLFGVRLTDGSIRKSASMGNLTHYAAS  50

Query  779  sfvmkksfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKR  600
                         P +          ++     E+F   VPG    S         E+KR
Sbjct  51   GSSSGSHHHASNNPGSPGGGDTPDHAAAEGYASEDF---VPGSSSTSR--------ERKR  99

Query  599  GVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRR  420
            GVPW+EEEHR+FL+GL+KLG+GDWRGI+R++VT+RTPTQ+ASHAQKYF+R +++   KRR
Sbjct  100  GVPWTEEEHRMFLLGLQKLGKGDWRGIARNYVTSRTPTQVASHAQKYFIRQSNVSRRKRR  159

Query  419  RSLFDLAWKADE  384
             SLFD+   ADE
Sbjct  160  SSLFDIV--ADE  169



>ref|XP_006279493.1| hypothetical protein CARUB_v10026634mg [Capsella rubella]
 gb|EOA12391.1| hypothetical protein CARUB_v10026634mg [Capsella rubella]
Length=366

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 83/182 (46%), Positives = 106/182 (58%), Gaps = 22/182 (12%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            MTR+CS C   GHNSRTC N                GVKL G      S    + +   S
Sbjct  1    MTRRCSHCNHNGHNSRTCPNR---------------GVKLFGVRLTEGSIRKSASMGNLS  45

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLP--EKKRGVPWS  585
                   A       ++ GS G + D      VPG GY S+  V G+    E+K+G PW+
Sbjct  46   HYTGSGSAGHGGTGSNTPGSPGDVPDH-----VPGDGYASEDFVAGSSSSRERKKGTPWT  100

Query  584  EEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFD  405
            EEEHR+FL+GL+KLG+GDWRGISR++VTTRTPTQ+ASHAQKYF+R +++   KRR SLFD
Sbjct  101  EEEHRMFLLGLQKLGKGDWRGISRNYVTTRTPTQVASHAQKYFIRQSNVSRRKRRSSLFD  160

Query  404  LA  399
            + 
Sbjct  161  MV  162



>ref|XP_002520190.1| transcription factor, putative [Ricinus communis]
 gb|EEF42245.1| transcription factor, putative [Ricinus communis]
Length=331

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 81/181 (45%), Positives = 107/181 (59%), Gaps = 27/181 (15%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            M+R CS CG  GHNSRTC  N+    +   G M LFGV+++    ++  S S + + +  
Sbjct  1    MSRSCSQCGNNGHNSRTCGENSGGSAAGESGIM-LFGVRVMMEGASFRKSVSMNNLSQYD  59

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLV--CGNLPEKKRGVPWS  585
               D                         +  V   GY SD +V   G   E+KRGVPW+
Sbjct  60   QPQDP------------------------NADVAAAGYESDDVVHASGRSRERKRGVPWT  95

Query  584  EEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFD  405
            EEEHR+FL+GL+K+G+GDWRGISR+FV TRTPTQ+ASHAQKYFLR N+ +  +RR SLFD
Sbjct  96   EEEHRLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKYFLRRNNQNRRRRRSSLFD  155

Query  404  L  402
            +
Sbjct  156  I  156



>ref|NP_001169313.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
 gb|ACN33369.1| unknown [Zea mays]
 tpg|DAA46237.1| TPA: putative MYB DNA-binding domain superfamily protein [Zea 
mays]
 gb|AIB05025.1| MYB-related transcription factor, partial [Zea mays]
Length=317

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 105/183 (57%), Gaps = 29/183 (16%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            MTR+CS C   GHNSRTC N            +K+FGV+L             +     S
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRG----------VKIFGVRLTDG---------SAIRKSAS  41

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLP---EKKRGVPW  588
              +  L +A  +   +S      L D        G GY SD  V G+     E+K+GVPW
Sbjct  42   MGNLSLLSAGSTSGGASPADGPDLADG-------GGGYASDDFVQGSSSASRERKKGVPW  94

Query  587  SEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLF  408
            +EEEHR FL+GL+KLG+GDWRGISR+FV +RTPTQ+ASHAQKYF+R +++   KRR SLF
Sbjct  95   TEEEHRRFLLGLQKLGKGDWRGISRNFVVSRTPTQVASHAQKYFIRQSNMSRRKRRSSLF  154

Query  407  DLA  399
            D+ 
Sbjct  155  DMV  157



>gb|EYU19295.1| hypothetical protein MIMGU_mgv1a005826mg [Erythranthe guttata]
Length=469

 Score =   135 bits (341),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 110/191 (58%), Gaps = 22/191 (12%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLI-GSHQNysss--ssysfvm  768
            MTR+CS C   GHNSRTC N            +KLFGV+L  GS +  +S    ++    
Sbjct  126  MTRRCSHCSNNGHNSRTCPNRG----------VKLFGVRLTDGSIRKSASMGNLTHYMGG  175

Query  767  kksfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLP--EKKRGV  594
                S +  P    +             D    G     GY S+  V G+    E+K+GV
Sbjct  176  GGGGSGNATPQNGLAHDSPGGTP-----DHPSAGSAAADGYASEDFVAGSSSSRERKKGV  230

Query  593  PWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRS  414
            PW+EEEHR+FLVGL+KLG+GDWRGI+R++V +RTPTQ+ASHAQKYF+R +++   KRR S
Sbjct  231  PWTEEEHRLFLVGLQKLGKGDWRGIARNYVMSRTPTQVASHAQKYFIRQSNVSRRKRRSS  290

Query  413  LFDLAWKADEC  381
            LFD+   ADE 
Sbjct  291  LFDIV--ADES  299



>ref|XP_007038262.1| Myb-like transcription factor family protein, putative isoform 
2 [Theobroma cacao]
 gb|EOY22763.1| Myb-like transcription factor family protein, putative isoform 
2 [Theobroma cacao]
Length=324

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 98/190 (52%), Gaps = 40/190 (21%)
 Frame = -2

Query  932  RKCSSCGKTGHNSRTCNNNNEQRTSSHG-GSMKLFGVKLIGSHQNysssssysfvmkksf  756
            RKCS CG  GHNSRTC          HG G +KLFGV +    +  S       +     
Sbjct  7    RKCSHCGHNGHNSRTC----------HGKGCVKLFGVNISAVEKQESFMKKSFSMESLRS  56

Query  755  SDDCLPaasysfadssfgssgFLFDENFDGKVPGC--GYISDGLV----CGNLPEKKRGV  594
                                       ++   P    GY+SDG +         E+KRG 
Sbjct  57   -----------------------HHAEYNNNAPSVDDGYLSDGQIHSRKSNAARERKRGK  93

Query  593  PWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRS  414
            PW+EEEHRIFL GL KLG+GDWRGIS+ FVTTRTPTQ+ASHAQKYFLR       KRR S
Sbjct  94   PWTEEEHRIFLAGLRKLGKGDWRGISKKFVTTRTPTQVASHAQKYFLRQAGNDKKKRRPS  153

Query  413  LFDLAWKADE  384
            LFD+A++  E
Sbjct  154  LFDMAFQELE  163



>ref|XP_004508939.1| PREDICTED: transcription factor MYB1R1-like [Cicer arietinum]
Length=337

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 81/189 (43%), Positives = 107/189 (57%), Gaps = 25/189 (13%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            MTR+CS C   GHNSRTC N            +KLFGV+L          S+    +   
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRG----------VKLFGVRLT---DGSIRKSASMGNLSHY  47

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLP---EKKRGVPW  588
                  P  +      S G       EN D      GY S+  V G+     E+K+G+PW
Sbjct  48   TGSGSGPLHTGLNNPGSPG-------ENPDHAAAADGYASEDFVAGSSSTSRERKKGIPW  100

Query  587  SEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLF  408
            +EEEHR+FL+GL+KLG+GDWRGI+R++V +RTPTQ+ASHAQKYF+R +++   KRR SLF
Sbjct  101  TEEEHRMFLLGLQKLGKGDWRGIARNYVISRTPTQVASHAQKYFIRQSNISRRKRRSSLF  160

Query  407  DLAWKADEC  381
            D+   ADE 
Sbjct  161  DIV--ADES  167



>ref|XP_010109133.1| Transcription factor [Morus notabilis]
 gb|EXC21062.1| Transcription factor [Morus notabilis]
Length=354

 Score =   134 bits (336),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 82/194 (42%), Positives = 109/194 (56%), Gaps = 32/194 (16%)
 Frame = -2

Query  932  RKCSSCGKTGHNSRTCNNNNE------QRTSSHGGSMKLFGVKLI----GSHQNysssss  783
            RKCS CG+ GHNSRTCNN N       +  + +G S KLFGV ++     S +   S  +
Sbjct  7    RKCSHCGQQGHNSRTCNNRNNVVSPRNRNGNGNGHSFKLFGVNIVEGAEDSMKKSRSMGN  66

Query  782  ysfvmkksfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCG----NL  615
             + +      +D +                    ++ D   P  GY+SDG++        
Sbjct  67   LAALSGGQGKNDVV-----------------SGGDDHDDHDPEAGYLSDGVLHNVKRKAA  109

Query  614  PEKKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLH  435
             E+KRG PW+EEEHR FL G+ KLG+GDWRGIS  FVTTRTPTQ+ASHAQKYF+R  +  
Sbjct  110  RERKRGKPWTEEEHRTFLAGMNKLGKGDWRGISSKFVTTRTPTQVASHAQKYFIRKQAPK  169

Query  434  STKRRR-SLFDLAW  396
              K+RR SLFD+ +
Sbjct  170  DRKKRRSSLFDMPF  183



>emb|CAN76720.1| hypothetical protein VITISV_005733 [Vitis vinifera]
Length=202

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 101/180 (56%), Gaps = 40/180 (22%)
 Frame = -2

Query  935  TRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkksf  756
             RKCS CG  GHNSRTC+   +       G +KLFGV+++   ++ +   S S       
Sbjct  6    VRKCSHCGNNGHNSRTCSAGGK-------GCLKLFGVQILTEKEDEAMRKSLSMGNL---  55

Query  755  SDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKRG--VPWSE  582
               C                     E+  G     GY+SDGL+     + +RG  VPWSE
Sbjct  56   -QSCX-------------------IEHHHGDA---GYLSDGLL-----QSRRGKRVPWSE  87

Query  581  EEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFDL  402
            EEHR FL GLEKLG+GDWRGI++ FVTTRTPTQ+ASHAQKYFLR  +    KRR SLFD+
Sbjct  88   EEHRTFLAGLEKLGKGDWRGIAKKFVTTRTPTQVASHAQKYFLRRAACDKRKRRPSLFDM  147



>ref|NP_001275007.1| MYBST1 protein [Solanum tuberosum]
 gb|AAB32591.2| MybSt1 [Solanum tuberosum]
Length=342

 Score =   134 bits (336),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 80/187 (43%), Positives = 103/187 (55%), Gaps = 19/187 (10%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            MTR+CS C   GHNSRTC N            +KLFGV+L       S+S          
Sbjct  1    MTRRCSHCSTNGHNSRTCPNRG----------VKLFGVRLTDGLIRKSASMGNLTHFASG  50

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLP--EKKRGVPWS  585
                  P                  D    G     GY S+  V G+    E+K+GVPW+
Sbjct  51   SGGGSTPLNGVVHDSPGDTP-----DHPAVGGGSADGYASEDFVAGSSSSRERKKGVPWT  105

Query  584  EEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFD  405
            EEEHR+FL+GL+KLG+GDWRGI+R++V +RTPTQ+ASHAQKYF+R +++   KRR SLFD
Sbjct  106  EEEHRMFLLGLQKLGKGDWRGIARNYVISRTPTQVASHAQKYFIRQSNMSRRKRRSSLFD  165

Query  404  LAWKADE  384
            +   ADE
Sbjct  166  IV--ADE  170



>dbj|BAJ99046.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=303

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 72/88 (82%), Gaps = 1/88 (1%)
 Frame = -2

Query  656  GCGYISDGLVCGNLPEKKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIA  477
            G GY+SDGL+ G   E+K+GVPW+E+EHR FL GLEKLG+GDWRGISRHFVTTRTPTQ+A
Sbjct  95   GHGYLSDGLM-GRAQERKKGVPWTEDEHRRFLAGLEKLGKGDWRGISRHFVTTRTPTQVA  153

Query  476  SHAQKYFLRHNSLHSTKRRRSLFDLAWK  393
            SHAQKYFLR   L   KRR SLFD+  K
Sbjct  154  SHAQKYFLRQAGLAQKKRRSSLFDVVEK  181



>gb|EMT19857.1| Myb-like protein J [Aegilops tauschii]
Length=212

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 72/89 (81%), Gaps = 1/89 (1%)
 Frame = -2

Query  656  GCGYISDGLVCGNLPEKKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIA  477
            G GY+SDGL+ G   E+K+GVPW+E+EHR FL GLEKLG+GDWRGISRHFVTTRTPTQ+A
Sbjct  96   GHGYLSDGLM-GRAQERKKGVPWTEDEHRRFLAGLEKLGKGDWRGISRHFVTTRTPTQVA  154

Query  476  SHAQKYFLRHNSLHSTKRRRSLFDLAWKA  390
            SHAQKYFLR   L   KRR SLFD+  + 
Sbjct  155  SHAQKYFLRQAGLAQKKRRSSLFDVVARV  183



>gb|KGN53172.1| hypothetical protein Csa_4G025050 [Cucumis sativus]
Length=354

 Score =   134 bits (336),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 81/182 (45%), Positives = 110/182 (60%), Gaps = 10/182 (5%)
 Frame = -2

Query  932  RKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkksfS  753
            RKCS CG  GHNSRTC N ++  ++++   +KLFGV L+ +       S     +     
Sbjct  7    RKCSHCGFNGHNSRTCGNFSKGNSNNYYYCVKLFGVNLMENRDESMRKSLSMGNLNLHSC  66

Query  752  DDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGN----LPEKKRGVPWS  585
            ++ L   + +  ++  G      +          GY+SDGL+         E+K+G PWS
Sbjct  67   NNVLDLNNTTTVNNVTGD-----NTAAAASTDDAGYLSDGLIHNKRRKAAHERKKGKPWS  121

Query  584  EEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRH-NSLHSTKRRRSLF  408
            EEEHR FL+GL+KLG+GDWRGIS++FVTTRTPTQ+ASHAQKYFLR  N+    KRR SLF
Sbjct  122  EEEHRTFLIGLKKLGKGDWRGISKNFVTTRTPTQVASHAQKYFLRKMNANDKKKRRASLF  181

Query  407  DL  402
            D+
Sbjct  182  DI  183



>ref|XP_006438523.1| hypothetical protein CICLE_v10032167mg [Citrus clementina]
 gb|ESR51763.1| hypothetical protein CICLE_v10032167mg [Citrus clementina]
Length=300

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 84/193 (44%), Positives = 107/193 (55%), Gaps = 33/193 (17%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGS---MKLFGVKLIGSHQNysssssysfvm  768
            M+R CS CG  GHNSRTC       +S  G     + LFGV++     ++  S S     
Sbjct  1    MSRSCSQCGNNGHNSRTCAEAGGGGSSGAGSEENGIMLFGVRVTEGSSSFRKSISM----  56

Query  767  kksfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLV--CGNLPEKKRGV  594
                  D L                  FD+  D      GY SD +V   G   E+KRGV
Sbjct  57   ------DNL----------------SQFDQPQDSNA-DAGYASDDIVHASGRSRERKRGV  93

Query  593  PWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRS  414
            PW+E+EHR+FL+GL+K+G+GDWRGISR+FV TRTPTQ+ASHAQKYFLR  + +  +RR S
Sbjct  94   PWTEDEHRLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKYFLRRFNQNKRRRRSS  153

Query  413  LFDL-AWKADECR  378
            LFD+ A   D  R
Sbjct  154  LFDITASSTDTAR  166



>ref|XP_008444473.1| PREDICTED: transcription factor MYB1R1-like isoform X3 [Cucumis 
melo]
Length=185

 Score =   129 bits (324),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 74/86 (86%), Gaps = 2/86 (2%)
 Frame = -2

Query  650  GYISDGLVCGNLPEKKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASH  471
            GY+SDGLV     E+K+GVPWSEEEH++FLVGLEKLG+GDWRGISR FVTTRTPTQ+ASH
Sbjct  92   GYLSDGLV-AKTHERKKGVPWSEEEHKVFLVGLEKLGKGDWRGISRKFVTTRTPTQVASH  150

Query  470  AQKYFLRHNSLHSTKRRR-SLFDLAW  396
            AQKYFLR  +L+  K+RR SLFDL +
Sbjct  151  AQKYFLRLTTLNKRKQRRPSLFDLQY  176



>ref|XP_006414230.1| hypothetical protein EUTSA_v10025432mg [Eutrema salsugineum]
 gb|ESQ55683.1| hypothetical protein EUTSA_v10025432mg [Eutrema salsugineum]
Length=386

 Score =   134 bits (336),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 82/183 (45%), Positives = 103/183 (56%), Gaps = 29/183 (16%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            MTR+CS C + GHNSRTC N            +KLFGV+L           S        
Sbjct  41   MTRRCSHCNQNGHNSRTCPNRG----------VKLFGVRLT--------EGSIRKSASMG  82

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCG--YISDGLVCGNLP--EKKRGVP  591
                C             G  G   D   DG   G G  Y S+  V G+    E+K+G P
Sbjct  83   NLSHC-------SGSGLSGLGGIGSDSPGDGPDHGVGDGYASEDFVPGSSSSRERKKGNP  135

Query  590  WSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSL  411
            W+EEEHR+FL+GL+KLG+GDWRGISR++VTTRTPTQ+ASHAQKYF+R +++   KRR SL
Sbjct  136  WTEEEHRMFLLGLQKLGKGDWRGISRNYVTTRTPTQVASHAQKYFIRQSNVSRRKRRSSL  195

Query  410  FDL  402
            FD+
Sbjct  196  FDM  198



>ref|XP_007038261.1| Myb-like transcription factor family protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY22762.1| Myb-like transcription factor family protein, putative isoform 
1 [Theobroma cacao]
Length=345

 Score =   133 bits (334),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 98/190 (52%), Gaps = 40/190 (21%)
 Frame = -2

Query  932  RKCSSCGKTGHNSRTCNNNNEQRTSSHG-GSMKLFGVKLIGSHQNysssssysfvmkksf  756
            RKCS CG  GHNSRTC          HG G +KLFGV +    +  S       +     
Sbjct  29   RKCSHCGHNGHNSRTC----------HGKGCVKLFGVNISAVEKQESFMKKSFSMESLRS  78

Query  755  SDDCLPaasysfadssfgssgFLFDENFDGKVPGC--GYISDGLV----CGNLPEKKRGV  594
                                       ++   P    GY+SDG +         E+KRG 
Sbjct  79   -----------------------HHAEYNNNAPSVDDGYLSDGQIHSRKSNAARERKRGK  115

Query  593  PWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRS  414
            PW+EEEHRIFL GL KLG+GDWRGIS+ FVTTRTPTQ+ASHAQKYFLR       KRR S
Sbjct  116  PWTEEEHRIFLAGLRKLGKGDWRGISKKFVTTRTPTQVASHAQKYFLRQAGNDKKKRRPS  175

Query  413  LFDLAWKADE  384
            LFD+A++  E
Sbjct  176  LFDMAFQELE  185



>ref|XP_003517881.1| PREDICTED: transcription factor MYB1R1 [Glycine max]
Length=300

 Score =   132 bits (332),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 78/181 (43%), Positives = 104/181 (57%), Gaps = 30/181 (17%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            M+R CS CG  GHNSRTC +     +    G M LFGV+++    +    S+    + + 
Sbjct  1    MSRTCSQCGNNGHNSRTCTDGGAAGSPRENGIM-LFGVRVMTEANSSFRKSASMNNLSQ-  58

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLV--CGNLPEKKRGVPWS  585
                                    +D  F+      GY SD +V   G   E+KRGVPW+
Sbjct  59   ------------------------YDAEFNAA--DAGYASDDVVHASGRTRERKRGVPWT  92

Query  584  EEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFD  405
            EEEHR+FL+GL K+G+GDWRGISR+FV TRTPTQ+ASHAQKYFLR ++ +  +RR SLFD
Sbjct  93   EEEHRLFLLGLHKVGKGDWRGISRNFVKTRTPTQVASHAQKYFLRRHNQNRRRRRSSLFD  152

Query  404  L  402
            +
Sbjct  153  I  153



>ref|XP_010053506.1| PREDICTED: uncharacterized protein LOC104441938 [Eucalyptus grandis]
 gb|KCW77815.1| hypothetical protein EUGRSUZ_D02103 [Eucalyptus grandis]
Length=340

 Score =   132 bits (333),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 81/182 (45%), Positives = 109/182 (60%), Gaps = 16/182 (9%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            MTR+CS C   GHNSRTC N            +KLFGV+L     + S   S S      
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRG----------VKLFGVRLT----DGSIRKSASMGNLSH  46

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLP--EKKRGVPWS  585
            ++     + + S + S     G       +G   G GY S+  V G+    E+K+GVPW+
Sbjct  47   YAGAGAGSGTGSGSGSGLAGGGNNPGSPGEGPDHGDGYASEDFVPGSSSSRERKKGVPWT  106

Query  584  EEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFD  405
            EEEHR+FL+GL+KLG+GDWRGISR++V +RTPTQ+ASHAQKYF+R +++   KRR SLFD
Sbjct  107  EEEHRMFLLGLQKLGKGDWRGISRNYVISRTPTQVASHAQKYFIRQSNVSKRKRRSSLFD  166

Query  404  LA  399
            + 
Sbjct  167  IV  168



>gb|AGT21470.1| myb-like transcription factor family protein [Carica papaya]
Length=325

 Score =   132 bits (332),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 79/187 (42%), Positives = 105/187 (56%), Gaps = 32/187 (17%)
 Frame = -2

Query  932  RKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkksfS  753
            RKC  CG  GHNSRTCN N   ++S      +LFGV ++ + +        + V K    
Sbjct  7    RKCGHCGLNGHNSRTCNGNGGDKSS-----FRLFGVDILENKE-------PAIVKKSRSL  54

Query  752  DDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDG-LVCGNLPEKKRGVPWSEEE  576
             D  P                L D++   +    GY SD  ++     E+K+G PWSEEE
Sbjct  55   GDLQP----------------LADKH---EAADSGYSSDTQIISQKSTERKKGNPWSEEE  95

Query  575  HRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFDLAW  396
            HR+FL GLEK+G+GDW GIS+ FV TRTPTQIASHAQKYFLR  S+   KRR S+FD+  
Sbjct  96   HRLFLAGLEKMGKGDWIGISKKFVNTRTPTQIASHAQKYFLRLASIDKRKRRTSVFDITL  155

Query  395  KADECRV  375
            +  + ++
Sbjct  156  EQSKSKI  162



>ref|XP_002464930.1| hypothetical protein SORBIDRAFT_01g029020 [Sorghum bicolor]
 gb|EER91928.1| hypothetical protein SORBIDRAFT_01g029020 [Sorghum bicolor]
Length=316

 Score =   132 bits (332),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 80/182 (44%), Positives = 104/182 (57%), Gaps = 28/182 (15%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            MTR+CS C   GHNSRTC N            +K+FGV+L             +     S
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRG----------VKIFGVRLT---------DGSAIRKSAS  41

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLP---EKKRGVPW  588
              +  L +A  +   +S      L D          GY SD  V G+     E+K+GVPW
Sbjct  42   MGNLSLLSAGSTSGGASPADGPDLADGG------AGGYASDDFVQGSSSASRERKKGVPW  95

Query  587  SEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLF  408
            +EEEHR FL+GL+KLG+GDWRGISR+FV +RTPTQ+ASHAQKYF+R +++   KRR SLF
Sbjct  96   TEEEHRRFLLGLQKLGKGDWRGISRNFVVSRTPTQVASHAQKYFIRQSNMSRRKRRSSLF  155

Query  407  DL  402
            D+
Sbjct  156  DM  157



>gb|KDO82666.1| hypothetical protein CISIN_1g021351mg [Citrus sinensis]
Length=300

 Score =   132 bits (331),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 84/193 (44%), Positives = 107/193 (55%), Gaps = 33/193 (17%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGS---MKLFGVKLIGSHQNysssssysfvm  768
            M+R CS CG  GHNSRTC       +S  G     + LFGV++     ++  S S     
Sbjct  1    MSRSCSQCGNNGHNSRTCAEAGGGGSSGAGSEENGIMLFGVRVTEGSSSFRKSISM----  56

Query  767  kksfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLV--CGNLPEKKRGV  594
                  D L                  FD+  D      GY SD +V   G   E+KRGV
Sbjct  57   ------DNL----------------SQFDQPQDSNA-DAGYASDDIVHASGRSRERKRGV  93

Query  593  PWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRS  414
            PW+E+EHR+FL+GL+K+G+GDWRGISR+FV TRTPTQ+ASHAQKYFLR  + +  +RR S
Sbjct  94   PWTEDEHRLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKYFLRRFNQNKRRRRSS  153

Query  413  LFDL-AWKADECR  378
            LFD+ A   D  R
Sbjct  154  LFDITASSTDTAR  166



>emb|CAJ53899.1| transcription factor MybS3 [Hordeum vulgare subsp. vulgare]
 emb|CAI84067.1| Mybst1 protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97718.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=314

 Score =   132 bits (332),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 84/195 (43%), Positives = 106/195 (54%), Gaps = 32/195 (16%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLI-GSHQNysssssysfvmkk  762
            MTR+CS C   GHNSRTC N            +K+FGV+L  GS +  +           
Sbjct  1    MTRRCSHCSYNGHNSRTCPNRG----------VKIFGVRLTDGSIRKSA-----------  39

Query  761  sfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLP---EKKRGVP  591
                  +   S     +S G      D   D      GY SD  V G+     E+K+GVP
Sbjct  40   -----SMGNLSLLGGSTSGGGGASPADVGHDAA--AEGYASDDFVQGSSSANRERKKGVP  92

Query  590  WSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSL  411
            W+EEEHR FL+GL+KLG+GDWRGISR+FV +RTPTQ+ASHAQKYF+R  ++   KRR SL
Sbjct  93   WTEEEHRRFLLGLQKLGKGDWRGISRNFVVSRTPTQVASHAQKYFIRQANMSRRKRRSSL  152

Query  410  FDLAWKADECRVLCG  366
            FDL     +   L G
Sbjct  153  FDLVPDESDLPPLPG  167



>ref|XP_011031922.1| PREDICTED: myb-like protein J isoform X1 [Populus euphratica]
 ref|XP_011031923.1| PREDICTED: myb-like protein J isoform X2 [Populus euphratica]
Length=338

 Score =   132 bits (333),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 109/188 (58%), Gaps = 22/188 (12%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLI-GSHQNysssssysfvmkk  762
            MTR+CS C   GHNSRTC N            +KLFGV+L  GS +  +S  + S     
Sbjct  1    MTRRCSHCSHNGHNSRTCPNR----------VVKLFGVRLTDGSIRKSASMGNLSHYTGS  50

Query  761  sfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLP--EKKRGVPW  588
            S     L +   +           +            GY S+  V G+    E+K+GVPW
Sbjct  51   SNVGGPLASGPNNPGSPGDTPDHGI-------AAASAGYASEDFVSGSSSSRERKKGVPW  103

Query  587  SEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLF  408
            +EEEHR+FL+GL+KLG+GDWRGI+R++V +RTPTQ+ASHAQKYF+R +++   KRR SLF
Sbjct  104  TEEEHRMFLLGLQKLGKGDWRGIARNYVISRTPTQVASHAQKYFIRQSNVSRRKRRSSLF  163

Query  407  DLAWKADE  384
            D+   ADE
Sbjct  164  DIV--ADE  169



>ref|XP_011031924.1| PREDICTED: myb-like protein J isoform X3 [Populus euphratica]
Length=337

 Score =   132 bits (333),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 109/188 (58%), Gaps = 22/188 (12%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLI-GSHQNysssssysfvmkk  762
            MTR+CS C   GHNSRTC N            +KLFGV+L  GS +  +S  + S     
Sbjct  1    MTRRCSHCSHNGHNSRTCPNR----------VVKLFGVRLTDGSIRKSASMGNLSHYTGS  50

Query  761  sfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLP--EKKRGVPW  588
            S     L +   +           +            GY S+  V G+    E+K+GVPW
Sbjct  51   SNVGGPLASGPNNPGSPGDTPDHGI-------AAASAGYASEDFVSGSSSSRERKKGVPW  103

Query  587  SEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLF  408
            +EEEHR+FL+GL+KLG+GDWRGI+R++V +RTPTQ+ASHAQKYF+R +++   KRR SLF
Sbjct  104  TEEEHRMFLLGLQKLGKGDWRGIARNYVISRTPTQVASHAQKYFIRQSNVSRRKRRSSLF  163

Query  407  DLAWKADE  384
            D+   ADE
Sbjct  164  DIV--ADE  169



>ref|XP_006438522.1| hypothetical protein CICLE_v10032167mg [Citrus clementina]
 gb|ESR51762.1| hypothetical protein CICLE_v10032167mg [Citrus clementina]
Length=313

 Score =   132 bits (331),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 81/193 (42%), Positives = 107/193 (55%), Gaps = 32/193 (17%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGS---MKLFGVKLIGSHQNysssssysfvm  768
            M+R CS CG  GHNSRTC       +S  G     + LFGV++     ++  S S     
Sbjct  1    MSRSCSQCGNNGHNSRTCAEAGGGGSSGAGSEENGIMLFGVRVTEGSSSFRKSISM----  56

Query  767  kksfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLV--CGNLPEKKRGV  594
                  D L                  FD+  D      GY SD +V   G   E+KRGV
Sbjct  57   ------DNL----------------SQFDQPQDSNA-DAGYASDDIVHASGRSRERKRGV  93

Query  593  PWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRS  414
            PW+E+EHR+FL+GL+K+G+GDWRGISR+FV TRTPTQ+ASHAQKYFLR  + +  +RR S
Sbjct  94   PWTEDEHRLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKYFLRRFNQNKRRRRSS  153

Query  413  LFDLAWKADECRV  375
            LFD+   + +  +
Sbjct  154  LFDITASSTDTNL  166



>ref|XP_006483741.1| PREDICTED: transcription factor MYB1R1-like isoform X1 [Citrus 
sinensis]
Length=313

 Score =   132 bits (331),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 81/193 (42%), Positives = 107/193 (55%), Gaps = 32/193 (17%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGS---MKLFGVKLIGSHQNysssssysfvm  768
            M+R CS CG  GHNSRTC       +S  G     + LFGV++     ++  S S     
Sbjct  1    MSRSCSQCGNNGHNSRTCAEAGGGGSSGAGSEENGIMLFGVRVTEGSSSFRKSISM----  56

Query  767  kksfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLV--CGNLPEKKRGV  594
                  D L                  FD+  D      GY SD +V   G   E+KRGV
Sbjct  57   ------DNL----------------SQFDQPQDSNA-DAGYASDDIVHASGRSRERKRGV  93

Query  593  PWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRS  414
            PW+E+EHR+FL+GL+K+G+GDWRGISR+FV TRTPTQ+ASHAQKYFLR  + +  +RR S
Sbjct  94   PWTEDEHRLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKYFLRRFNQNKRRRRSS  153

Query  413  LFDLAWKADECRV  375
            LFD+   + +  +
Sbjct  154  LFDITASSTDTNL  166



>ref|XP_006483742.1| PREDICTED: transcription factor MYB1R1-like isoform X2 [Citrus 
sinensis]
Length=310

 Score =   132 bits (331),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 81/191 (42%), Positives = 106/191 (55%), Gaps = 32/191 (17%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGS---MKLFGVKLIGSHQNysssssysfvm  768
            M+R CS CG  GHNSRTC       +S  G     + LFGV++     ++  S S     
Sbjct  1    MSRSCSQCGNNGHNSRTCAEAGGGGSSGAGSEENGIMLFGVRVTEGSSSFRKSISM----  56

Query  767  kksfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLV--CGNLPEKKRGV  594
                  D L                  FD+  D      GY SD +V   G   E+KRGV
Sbjct  57   ------DNL----------------SQFDQPQDSNA-DAGYASDDIVHASGRSRERKRGV  93

Query  593  PWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRS  414
            PW+E+EHR+FL+GL+K+G+GDWRGISR+FV TRTPTQ+ASHAQKYFLR  + +  +RR S
Sbjct  94   PWTEDEHRLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKYFLRRFNQNKRRRRSS  153

Query  413  LFDLAWKADEC  381
            LFD+   + + 
Sbjct  154  LFDITASSTDT  164



>ref|XP_008794113.1| PREDICTED: transcription factor MYB1R1-like [Phoenix dactylifera]
Length=349

 Score =   132 bits (333),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 84/195 (43%), Positives = 109/195 (56%), Gaps = 20/195 (10%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            MTR+CS C   GHNSRTC         +  G ++LFGV+L     +   S+S S +    
Sbjct  1    MTRRCSHCSNNGHNSRTC--------PTRAGGVRLFGVRLTEGAGSMKKSASMSSLYSAG  52

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLV---CGNL-PEKKRGVP  591
             S  C  A      +    S+  L            GY SD      C N   E+K+GVP
Sbjct  53   SSATCGRAGGGGSPNPGSPSNDPL------PPAAAAGYASDNAAHASCSNCRSERKKGVP  106

Query  590  WSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSL  411
            W+EEEHR+FL+GL+KLG+GDWRGI+R+FV +RTPTQ+ASHAQKYF+R  +    KRR SL
Sbjct  107  WTEEEHRMFLLGLQKLGKGDWRGIARNFVVSRTPTQVASHAQKYFIRQTNTSRRKRRSSL  166

Query  410  FDLA--WKADECRVL  372
            FD+      D+  VL
Sbjct  167  FDMVPDTPTDQIPVL  181



>ref|XP_009783629.1| PREDICTED: transcription factor MYB1R1 isoform X2 [Nicotiana 
sylvestris]
Length=334

 Score =   132 bits (332),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 80/188 (43%), Positives = 105/188 (56%), Gaps = 24/188 (13%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            MTR+CS C   GHNSRTC N            +KLFGV+L     +     S S      
Sbjct  1    MTRRCSHCSTNGHNSRTCPNRG----------VKLFGVRLT----DGLIRKSASMGNLTH  46

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLP--EKKRGVPWS  585
            F+    P                    + DG      Y S+  V G+    E+K+GVPW+
Sbjct  47   FASSSGPLNGAVHDSPGNTPDHPAVGGSADG------YASEDFVAGSSSSRERKKGVPWT  100

Query  584  EEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFD  405
            EEEHR+FL+GL+KLG+GDWRGI+R++V +RTPTQ+ASHAQKYF+R +++   KRR SLFD
Sbjct  101  EEEHRMFLLGLQKLGKGDWRGIARNYVISRTPTQVASHAQKYFIRQSNMSRRKRRSSLFD  160

Query  404  LAWKADEC  381
            +   ADE 
Sbjct  161  IV--ADES  166



>gb|KDO82664.1| hypothetical protein CISIN_1g021351mg [Citrus sinensis]
Length=313

 Score =   132 bits (331),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 81/193 (42%), Positives = 107/193 (55%), Gaps = 32/193 (17%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHG---GSMKLFGVKLIGSHQNysssssysfvm  768
            M+R CS CG  GHNSRTC       +S  G     + LFGV++     ++  S S     
Sbjct  1    MSRSCSQCGNNGHNSRTCAEAGGGGSSGAGSEENGIMLFGVRVTEGSSSFRKSISM----  56

Query  767  kksfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLV--CGNLPEKKRGV  594
                  D L                  FD+  D      GY SD +V   G   E+KRGV
Sbjct  57   ------DNL----------------SQFDQPQDSNA-DAGYASDDIVHASGRSRERKRGV  93

Query  593  PWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRS  414
            PW+E+EHR+FL+GL+K+G+GDWRGISR+FV TRTPTQ+ASHAQKYFLR  + +  +RR S
Sbjct  94   PWTEDEHRLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKYFLRRFNQNKRRRRSS  153

Query  413  LFDLAWKADECRV  375
            LFD+   + +  +
Sbjct  154  LFDITASSTDTNL  166



>ref|XP_006438524.1| hypothetical protein CICLE_v10032167mg [Citrus clementina]
 gb|ESR51764.1| hypothetical protein CICLE_v10032167mg [Citrus clementina]
Length=310

 Score =   132 bits (331),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 81/191 (42%), Positives = 106/191 (55%), Gaps = 32/191 (17%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGS---MKLFGVKLIGSHQNysssssysfvm  768
            M+R CS CG  GHNSRTC       +S  G     + LFGV++     ++  S S     
Sbjct  1    MSRSCSQCGNNGHNSRTCAEAGGGGSSGAGSEENGIMLFGVRVTEGSSSFRKSISM----  56

Query  767  kksfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLV--CGNLPEKKRGV  594
                  D L                  FD+  D      GY SD +V   G   E+KRGV
Sbjct  57   ------DNL----------------SQFDQPQDSNA-DAGYASDDIVHASGRSRERKRGV  93

Query  593  PWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRS  414
            PW+E+EHR+FL+GL+K+G+GDWRGISR+FV TRTPTQ+ASHAQKYFLR  + +  +RR S
Sbjct  94   PWTEDEHRLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKYFLRRFNQNKRRRRSS  153

Query  413  LFDLAWKADEC  381
            LFD+   + + 
Sbjct  154  LFDITASSTDT  164



>ref|XP_003564752.1| PREDICTED: transcription factor MYB1R1-like [Brachypodium distachyon]
Length=279

 Score =   131 bits (329),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 70/83 (84%), Gaps = 1/83 (1%)
 Frame = -2

Query  650  GYISDGLVCGNLPEKKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASH  471
            GY+SDGL+ G   E+K+GVPW+EEEHR FL GLEKLG+GDWRGISRHFVTTRTPTQ+ASH
Sbjct  105  GYLSDGLM-GRAQERKKGVPWTEEEHRRFLAGLEKLGKGDWRGISRHFVTTRTPTQVASH  163

Query  470  AQKYFLRHNSLHSTKRRRSLFDL  402
            AQKYFLR   L   KRR SLFD+
Sbjct  164  AQKYFLRQGGLAHKKRRSSLFDV  186



>emb|CAN71598.1| hypothetical protein VITISV_010937 [Vitis vinifera]
Length=315

 Score =   132 bits (331),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 79/188 (42%), Positives = 102/188 (54%), Gaps = 44/188 (23%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGV-KLIGSHQNysssssysfvmkk  762
            MTR+CS C   GHNSRTC N            +K+FG     G HQN  S ++       
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRG----------VKIFGAGSTSGHHQNGVSGNNSVSP---  47

Query  761  sfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLP--EKKRGVPW  588
                                       E  +      GY S+G V G+    E+K+G PW
Sbjct  48   --------------------------GETPEHGAAADGYASEGFVPGSSSSRERKKGTPW  81

Query  587  SEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLF  408
            +EEEHR+FL+GL+KLG+GDWRGISR++V +RTPTQ+ASHAQKYF+R  ++   KRR SLF
Sbjct  82   TEEEHRMFLLGLQKLGKGDWRGISRNYVISRTPTQVASHAQKYFIRQTNVSRRKRRSSLF  141

Query  407  DLAWKADE  384
            D+   ADE
Sbjct  142  DIV--ADE  147



>ref|NP_001237761.1| MYB transcription factor MYB138 [Glycine max]
 gb|ABH02859.1| MYB transcription factor MYB138 [Glycine max]
Length=296

 Score =   131 bits (330),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 100/181 (55%), Gaps = 30/181 (17%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            M+R CS CG  GHNSRTC +     +    G M LFGV+++    +    S+    + + 
Sbjct  1    MSRTCSQCGNNGHNSRTCTDGGAAGSPRENGIM-LFGVRVMTEANSSFRKSASMNNLSQ-  58

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLV--CGNLPEKKRGVPWS  585
                                    +D  F+      GY SD +V   G   E+KRGVPW+
Sbjct  59   ------------------------YDAEFNAA--DAGYASDDVVHASGRTRERKRGVPWT  92

Query  584  EEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFD  405
            EEEHR+FL+GL K+G+GDWRGISR+FV TRTPTQ+ASHAQKYFLR ++ +       LFD
Sbjct  93   EEEHRLFLLGLHKVGKGDWRGISRNFVKTRTPTQVASHAQKYFLRRHNQNLLPAEIYLFD  152

Query  404  L  402
            +
Sbjct  153  I  153



>gb|EMT00513.1| Myb-like protein J [Aegilops tauschii]
Length=305

 Score =   131 bits (330),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 120/213 (56%), Gaps = 38/213 (18%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQ---------RTSSHGGSMKLFGVKLIGSHQNyssss  786
            M RKCS CG  GHNSRTC++  +Q           SS G  ++LFGV++   H     S+
Sbjct  1    MARKCSHCGNYGHNSRTCSSTGKQGEIMLCEGGGGSSSGSGLRLFGVQV---HVAAGRST  57

Query  785  sysfvmkksfSDDCLPaasysfadssfgssgFLF-----DENFDGKVPGCGYISDGLVCG  621
                 M+KS+S DCL  A    +  S  SS         DE  +      GY+SDG    
Sbjct  58   GLGASMRKSYSMDCLQLAVAPSSIVSPSSSSSSSVLLSIDEGLERA--SNGYLSDGPHGR  115

Query  620  NLPEKKR-------------------GVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTT  498
             + E+K+                   GVPWSEEEHR+FLVGLEKLG+GDWRGISR +VTT
Sbjct  116  LVQERKKVVDELWPPELNGPSVNMSTGVPWSEEEHRLFLVGLEKLGKGDWRGISRSYVTT  175

Query  497  RTPTQIASHAQKYFLRHNSLHSTKRRRSLFDLA  399
            RTPTQ+ASHAQK+FLR +S+   KRR SLFD+ 
Sbjct  176  RTPTQVASHAQKFFLRQSSMGKKKRRSSLFDMV  208



>emb|CDY23049.1| BnaC07g31380D [Brassica napus]
Length=316

 Score =   132 bits (331),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 83/198 (42%), Positives = 110/198 (56%), Gaps = 34/198 (17%)
 Frame = -2

Query  932  RKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkksfS  753
            + CS CG  GHN+ TC N   +      GS+KLFGV  I S    S   +         +
Sbjct  6    KTCSHCGHNGHNAPTCLNGVNK------GSVKLFGVN-ISSDPIRSPEVTELRKSVSLGN  58

Query  752  DDCLPaasysfadssfgssgFLFDENFDGK------VPGCGYISDGLVCG----NLPEKK  603
             D L                 L ++N +G       V   GY SDG +      +  EKK
Sbjct  59   LDAL-----------------LANDNSNGNGDPIAAVEDNGYHSDGQIHSKTGRSAHEKK  101

Query  602  RGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKR  423
            +G PW+EEEHRIFLVGL++LG+GDWRGI+++FVTTRTPTQ+ASHAQKYFLR N+    +R
Sbjct  102  KGKPWTEEEHRIFLVGLKELGKGDWRGIAKNFVTTRTPTQVASHAQKYFLRLNANDKKRR  161

Query  422  RRSLFDLAWKADECRVLC  369
            R SLFD++ +    +V+ 
Sbjct  162  RASLFDISLEDQNSQVMT  179



>ref|XP_008376361.1| PREDICTED: myb-like protein J isoform X1 [Malus domestica]
Length=349

 Score =   132 bits (332),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 80/184 (43%), Positives = 106/184 (58%), Gaps = 28/184 (15%)
 Frame = -2

Query  932  RKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkksfS  753
            RKCS  G  GHNSRTCN+ +  +    G  +KLFGVK++   ++    S     ++   +
Sbjct  7    RKCSHGGHNGHNSRTCNHGHGNK----GVCLKLFGVKIMEKEEDSIKKSYSMGNLQADST  62

Query  752  DDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGN----LPEKKRGVPWS  585
             D                     + N        GY+SDGL+         E+K+G PW+
Sbjct  63   GDH--------------------NNNAAAADHDAGYLSDGLIHNKRHKATHERKKGRPWT  102

Query  584  EEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFD  405
            EEEHR+FL GL+KLG+GDWRGI+R+FVTTRTPTQ+ASHAQKYFLR  +    KRR SLFD
Sbjct  103  EEEHRVFLAGLKKLGKGDWRGIARNFVTTRTPTQVASHAQKYFLRQATNDKRKRRSSLFD  162

Query  404  LAWK  393
            + +K
Sbjct  163  MHFK  166



>ref|XP_009626132.1| PREDICTED: transcription factor MYB1R1 isoform X2 [Nicotiana 
tomentosiformis]
Length=334

 Score =   132 bits (332),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 80/188 (43%), Positives = 105/188 (56%), Gaps = 24/188 (13%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            MTR+CS C   GHNSRTC N            +KLFGV+L     +     S S      
Sbjct  1    MTRRCSHCSTNGHNSRTCPNRG----------VKLFGVRLT----DGLIRKSASMGNLTH  46

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLP--EKKRGVPWS  585
            F+    P                    + DG      Y S+  V G+    E+K+GVPW+
Sbjct  47   FASSSGPLNGAVHDSPGDTPDHPAVGGSADG------YASEDFVAGSSSSRERKKGVPWT  100

Query  584  EEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFD  405
            EEEHR+FL+GL+KLG+GDWRGI+R++V +RTPTQ+ASHAQKYF+R +++   KRR SLFD
Sbjct  101  EEEHRMFLLGLQKLGKGDWRGIARNYVISRTPTQVASHAQKYFIRQSNMSRRKRRSSLFD  160

Query  404  LAWKADEC  381
            +   ADE 
Sbjct  161  IV--ADES  166



>ref|XP_010925548.1| PREDICTED: transcription factor MYB1R1-like [Elaeis guineensis]
Length=349

 Score =   132 bits (332),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 86/197 (44%), Positives = 110/197 (56%), Gaps = 23/197 (12%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            MTR+CS C   GHNSRTC         +  G ++LFGV+L     +   S+S S +   S
Sbjct  1    MTRRCSHCSNNGHNSRTC--------PTRAGGVRLFGVRLTEGAGSMKKSASMSSLYSAS  52

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLV------CGNLPEKKRG  597
             S     A      +    SS  L D          GY SD         C N  E+K+G
Sbjct  53   SSATGGGAGGGGSTNPGSPSSDPLRDNPA-----AAGYASDNAAQASCSNCRN--ERKKG  105

Query  596  VPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRR  417
            VPW+EEEHR+FL+GL+KLG+GDWRGI+R+FV +RTPTQ+ASHAQKYF+R  +    KRR 
Sbjct  106  VPWTEEEHRMFLLGLQKLGKGDWRGIARNFVVSRTPTQVASHAQKYFIRQTNASRRKRRS  165

Query  416  SLFDLA--WKADECRVL  372
            SLFD+      D+  VL
Sbjct  166  SLFDMVPDMPTDQIPVL  182



>gb|ABD65013.1| myb family transcription factor [Brassica oleracea]
Length=351

 Score =   132 bits (332),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 81/189 (43%), Positives = 103/189 (54%), Gaps = 42/189 (22%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLI-------GSHQNysssssy  780
            MTR+CS C   GHNSRTC N            +KLFGV+L         S  N S  +  
Sbjct  1    MTRRCSHCNHNGHNSRTCPNRG----------VKLFGVRLTEGSIRKSASMGNLSHYTGS  50

Query  779  sfvmkksfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLP---E  609
                  S S   +P                      D    G GY S+  V G+     E
Sbjct  51   GSGGHGSGSPGDVP----------------------DHVAGGDGYASEDFVAGSSSSSRE  88

Query  608  KKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHST  429
            +K+G PW+EEEHR+FL+GL+KLG+GDWRGISR++V TRTPTQ+ASHAQKYF+R +++   
Sbjct  89   RKKGTPWTEEEHRMFLLGLQKLGKGDWRGISRNYVNTRTPTQVASHAQKYFIRQSNVSRR  148

Query  428  KRRRSLFDL  402
            KRR SLFD+
Sbjct  149  KRRSSLFDM  157



>ref|XP_009128962.1| PREDICTED: uncharacterized protein LOC103853804 [Brassica rapa]
Length=351

 Score =   132 bits (332),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 81/189 (43%), Positives = 103/189 (54%), Gaps = 42/189 (22%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLI-------GSHQNysssssy  780
            MTR+CS C   GHNSRTC N            +KLFGV+L         S  N S  +  
Sbjct  1    MTRRCSHCNHNGHNSRTCPNRG----------VKLFGVRLTEGSIRKSASMGNLSHYTGS  50

Query  779  sfvmkksfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLP---E  609
                  S S   +P                      D    G GY S+  V G+     E
Sbjct  51   GSGGHGSGSPGDVP----------------------DHVAGGDGYASEDFVAGSSSSSRE  88

Query  608  KKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHST  429
            +K+G PW+EEEHR+FL+GL+KLG+GDWRGISR++V TRTPTQ+ASHAQKYF+R +++   
Sbjct  89   RKKGTPWTEEEHRMFLLGLQKLGKGDWRGISRNYVNTRTPTQVASHAQKYFIRQSNVSRR  148

Query  428  KRRRSLFDL  402
            KRR SLFD+
Sbjct  149  KRRSSLFDM  157



>emb|CDY28938.1| BnaA02g25380D [Brassica napus]
Length=351

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 81/189 (43%), Positives = 103/189 (54%), Gaps = 42/189 (22%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLI-------GSHQNysssssy  780
            MTR+CS C   GHNSRTC N            +KLFGV+L         S  N S  +  
Sbjct  1    MTRRCSHCNHNGHNSRTCPNRG----------VKLFGVRLTEGSIRKSASMGNLSHYTGS  50

Query  779  sfvmkksfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLP---E  609
                  S S   +P                      D    G GY S+  V G+     E
Sbjct  51   GSGGHGSGSPGDVP----------------------DHVAGGDGYASEDFVAGSSSSSRE  88

Query  608  KKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHST  429
            +K+G PW+EEEHR+FL+GL+KLG+GDWRGISR++V TRTPTQ+ASHAQKYF+R +++   
Sbjct  89   RKKGTPWTEEEHRMFLLGLQKLGKGDWRGISRNYVNTRTPTQVASHAQKYFIRQSNVSRR  148

Query  428  KRRRSLFDL  402
            KRR SLFD+
Sbjct  149  KRRSSLFDM  157



>emb|CCA29105.1| putative MYB transcription factor [Rosa rugosa]
Length=334

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 105/183 (57%), Gaps = 28/183 (15%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHG--GSMKLFGVKLIGSHQNysssssysfvmk  765
            M+R CS CG  GHNSRTC         +      + LFGV+L+    N    S+    + 
Sbjct  1    MSRTCSQCGNNGHNSRTCTEAAGTGGGAAPAENGIMLFGVRLVTEQGNAFRKSASMNNLS  60

Query  764  ksfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLV--CGNLPEKKRGVP  591
            +    D LP                L D N     P  GY SD +V   GN  E+KRGV 
Sbjct  61   QY---DQLP----------------LHDSN-----PDAGYASDDVVHASGNRRERKRGVA  96

Query  590  WSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSL  411
            W+EEEHR+ L+GL+K+G+GDWRGISR+FV TRTPTQ+ASHAQKYFLR N+ +  +RR SL
Sbjct  97   WTEEEHRLVLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKYFLRRNNHNRRRRRSSL  156

Query  410  FDL  402
            FD+
Sbjct  157  FDI  159



>emb|CDM81667.1| unnamed protein product [Triticum aestivum]
Length=300

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 72/88 (82%), Gaps = 1/88 (1%)
 Frame = -2

Query  656  GCGYISDGLVCGNLPEKKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIA  477
            G GY+SDGL+ G   E+K+GVPW+E+EHR FL GLEKLG+GDWRGISRHFVTTRTPTQ+A
Sbjct  96   GQGYLSDGLM-GRAQERKKGVPWTEDEHRRFLGGLEKLGKGDWRGISRHFVTTRTPTQVA  154

Query  476  SHAQKYFLRHNSLHSTKRRRSLFDLAWK  393
            SHAQKYFLR   L   KRR SLFD+  K
Sbjct  155  SHAQKYFLRQAGLAQKKRRSSLFDVVEK  182



>ref|XP_008376363.1| PREDICTED: myb-like protein J isoform X2 [Malus domestica]
Length=347

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 80/184 (43%), Positives = 106/184 (58%), Gaps = 28/184 (15%)
 Frame = -2

Query  932  RKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkksfS  753
            RKCS  G  GHNSRTCN+ +  +    G  +KLFGVK++   ++    S     ++   +
Sbjct  7    RKCSHGGHNGHNSRTCNHGHGNK----GVCLKLFGVKIMEKEEDSIKKSYSMGNLQADST  62

Query  752  DDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGN----LPEKKRGVPWS  585
             D                     + N        GY+SDGL+         E+K+G PW+
Sbjct  63   GDH--------------------NNNAAAADHDAGYLSDGLIHNKRHKATHERKKGRPWT  102

Query  584  EEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFD  405
            EEEHR+FL GL+KLG+GDWRGI+R+FVTTRTPTQ+ASHAQKYFLR  +    KRR SLFD
Sbjct  103  EEEHRVFLAGLKKLGKGDWRGIARNFVTTRTPTQVASHAQKYFLRQATNDKRKRRSSLFD  162

Query  404  LAWK  393
            + +K
Sbjct  163  MHFK  166



>gb|KDO57294.1| hypothetical protein CISIN_1g048263mg [Citrus sinensis]
Length=207

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 99/182 (54%), Gaps = 24/182 (13%)
 Frame = -2

Query  932  RKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkksfS  753
            RKCS CG  GHNSRTC+           G  KLFGV ++   Q+  S            +
Sbjct  2    RKCSHCGHNGHNSRTCHAK---------GCFKLFGVNILDQIQDLPSMKKSVKKSYSVGN  52

Query  752  DDCLPaasysfadssfgssgFLFDE--NFDGKVPGCGYISDGLVCGNLPEKKRGVPWSEE  579
               L                   DE   FDG V   GY+SDG +     E+KRG PW+E 
Sbjct  53   LQSLGGEFNGH-----------VDEGREFDGDVDE-GYLSDGPI-HTKHERKRGKPWTEA  99

Query  578  EHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFDLA  399
            EHR+FL GL+ LG+GDW+GIS++FVTTRTPTQ+ASHAQKYFLR  S     RR SLFD+ 
Sbjct  100  EHRVFLEGLKLLGKGDWKGISKNFVTTRTPTQVASHAQKYFLRQASSDKKNRRTSLFDMP  159

Query  398  WK  393
             K
Sbjct  160  LK  161



>ref|XP_009783628.1| PREDICTED: transcription factor MYB1R1 isoform X1 [Nicotiana 
sylvestris]
Length=336

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 80/187 (43%), Positives = 105/187 (56%), Gaps = 24/187 (13%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            MTR+CS C   GHNSRTC N            +KLFGV+L     +     S S      
Sbjct  1    MTRRCSHCSTNGHNSRTCPNRG----------VKLFGVRLT----DGLIRKSASMGNLTH  46

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLP--EKKRGVPWS  585
            F+    P                    + DG      Y S+  V G+    E+K+GVPW+
Sbjct  47   FASSSGPLNGAVHDSPGNTPDHPAVGGSADG------YASEDFVAGSSSSRERKKGVPWT  100

Query  584  EEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFD  405
            EEEHR+FL+GL+KLG+GDWRGI+R++V +RTPTQ+ASHAQKYF+R +++   KRR SLFD
Sbjct  101  EEEHRMFLLGLQKLGKGDWRGIARNYVISRTPTQVASHAQKYFIRQSNMSRRKRRSSLFD  160

Query  404  LAWKADE  384
            +   ADE
Sbjct  161  IV--ADE  165



>gb|KDO82665.1| hypothetical protein CISIN_1g021351mg [Citrus sinensis]
Length=310

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 81/191 (42%), Positives = 106/191 (55%), Gaps = 32/191 (17%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHG---GSMKLFGVKLIGSHQNysssssysfvm  768
            M+R CS CG  GHNSRTC       +S  G     + LFGV++     ++  S S     
Sbjct  1    MSRSCSQCGNNGHNSRTCAEAGGGGSSGAGSEENGIMLFGVRVTEGSSSFRKSISM----  56

Query  767  kksfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLV--CGNLPEKKRGV  594
                  D L                  FD+  D      GY SD +V   G   E+KRGV
Sbjct  57   ------DNL----------------SQFDQPQDSNA-DAGYASDDIVHASGRSRERKRGV  93

Query  593  PWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRS  414
            PW+E+EHR+FL+GL+K+G+GDWRGISR+FV TRTPTQ+ASHAQKYFLR  + +  +RR S
Sbjct  94   PWTEDEHRLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKYFLRRFNQNKRRRRSS  153

Query  413  LFDLAWKADEC  381
            LFD+   + + 
Sbjct  154  LFDITASSTDT  164



>ref|XP_010529976.1| PREDICTED: protein REVEILLE 8-like [Tarenaya hassleriana]
Length=353

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 78/189 (41%), Positives = 104/189 (55%), Gaps = 40/189 (21%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            MTR+CS C   GHNSRTC N            +KLFGV+L                    
Sbjct  1    MTRRCSHCNLNGHNSRTCPNRG----------VKLFGVRLT-------------------  31

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGK-------VPGCGYISDGLVCG--NLPEK  606
              +  +  ++     S +         N+ G          G GY S+  V G  +  E+
Sbjct  32   --EGSIRKSASMGNLSHYAGGHSGTGSNYPGSPGDTPDHAAGDGYASEDFVSGPSSSRER  89

Query  605  KRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTK  426
            K+G PW+EEEHR+FL+GL+KLG+GDWRGISR++VTTRTPTQ+ASHAQKYF+R +++   K
Sbjct  90   KKGTPWTEEEHRMFLLGLQKLGKGDWRGISRNYVTTRTPTQVASHAQKYFMRQSNVSRRK  149

Query  425  RRRSLFDLA  399
            RR SLFD+ 
Sbjct  150  RRSSLFDMV  158



>ref|XP_010443985.1| PREDICTED: uncharacterized protein LOC104726752 [Camelina sativa]
Length=320

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 79/195 (41%), Positives = 102/195 (52%), Gaps = 30/195 (15%)
 Frame = -2

Query  944  IRMTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmk  765
            +   + CS CG  GHN+RTC       +  + GS+KLFGV +          ++    + 
Sbjct  6    VTTAKTCSHCGHNGHNARTC------LSGVNKGSVKLFGVNISSDPIRPPEVTALRKSLS  59

Query  764  ksfSDDCLPaasysfadssfgssgFLFDENFDG----KVPGCGYISDGLV----CGNLPE  609
                D  L                   D N  G     V   GY SDG +    C    +
Sbjct  60   LGNLDALLAND----------------DSNGSGDPIAAVEDTGYHSDGQIQSKKCKTAHD  103

Query  608  KKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHST  429
            KK+G PW+EEEHR FL+GL KLG+GDWRGI++ FVTTRTPTQ+ASHAQKYF+R N     
Sbjct  104  KKKGKPWTEEEHRNFLIGLNKLGKGDWRGIAKSFVTTRTPTQVASHAQKYFIRLNVNDKR  163

Query  428  KRRRSLFDLAWKADE  384
            KRR SLFD++ +  E
Sbjct  164  KRRASLFDISLEDQE  178



>emb|CDY51681.1| BnaC02g46900D [Brassica napus]
Length=351

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 81/189 (43%), Positives = 103/189 (54%), Gaps = 42/189 (22%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLI-------GSHQNysssssy  780
            MTR+CS C   GHNSRTC N            +KLFGV+L         S  N S  +  
Sbjct  1    MTRRCSHCNHNGHNSRTCPNRG----------VKLFGVRLTEGSIRKSASMGNLSHYTGS  50

Query  779  sfvmkksfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLP---E  609
                  S S   +P                      D    G GY S+  V G+     E
Sbjct  51   GSGGHGSGSPGDVP----------------------DHVAGGDGYASEDFVAGSSSSSRE  88

Query  608  KKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHST  429
            +K+G PW+EEEHR+FL+GL+KLG+GDWRGISR++V TRTPTQ+ASHAQKYF+R +++   
Sbjct  89   RKKGTPWTEEEHRMFLLGLQKLGKGDWRGISRNYVNTRTPTQVASHAQKYFIRQSNVSRR  148

Query  428  KRRRSLFDL  402
            KRR SLFD+
Sbjct  149  KRRSSLFDM  157



>ref|XP_009626131.1| PREDICTED: transcription factor MYB1R1 isoform X1 [Nicotiana 
tomentosiformis]
Length=336

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 80/187 (43%), Positives = 105/187 (56%), Gaps = 24/187 (13%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            MTR+CS C   GHNSRTC N            +KLFGV+L     +     S S      
Sbjct  1    MTRRCSHCSTNGHNSRTCPNRG----------VKLFGVRLT----DGLIRKSASMGNLTH  46

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLP--EKKRGVPWS  585
            F+    P                    + DG      Y S+  V G+    E+K+GVPW+
Sbjct  47   FASSSGPLNGAVHDSPGDTPDHPAVGGSADG------YASEDFVAGSSSSRERKKGVPWT  100

Query  584  EEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFD  405
            EEEHR+FL+GL+KLG+GDWRGI+R++V +RTPTQ+ASHAQKYF+R +++   KRR SLFD
Sbjct  101  EEEHRMFLLGLQKLGKGDWRGIARNYVISRTPTQVASHAQKYFIRQSNMSRRKRRSSLFD  160

Query  404  LAWKADE  384
            +   ADE
Sbjct  161  IV--ADE  165



>gb|AHB59603.1| putative MYB-related protein 17 [Arachis hypogaea]
Length=204

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 85/181 (47%), Positives = 98/181 (54%), Gaps = 27/181 (15%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            M RKCS CG  GHNSRTC       TSS    ++LFG  L+                  S
Sbjct  1    MGRKCSHCGNVGHNSRTC-------TSSSFLGIRLFGTHLLAD--------------PSS  39

Query  758  fSDDCLPaasysfadssfgssgFLF--DENFDGKVPGCGYISDGLVCGNLPEKKRGVPWS  585
             S                  S  LF             GY+SDG       +KK+GV W+
Sbjct  40   SSSSSSATMMTMNNKYFSMDSLTLFPTTTTTTTTAAAIGYLSDG---APPQDKKKGVAWT  96

Query  584  EEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLR-HNSLHSTKRRRSLF  408
            EEEHR FLVGLEKLG+GDWRGISR+FVTTRTPTQ+ASHAQKYFLR  N+++  KRR SLF
Sbjct  97   EEEHRRFLVGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKYFLRLANTVNHNKRRSSLF  156

Query  407  D  405
            D
Sbjct  157  D  157



>ref|NP_001266509.1| ZmMybst1 [Zea mays]
 gb|ACG34833.1| ZmMybst1 [Zea mays]
Length=315

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 80/182 (44%), Positives = 104/182 (57%), Gaps = 29/182 (16%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            MTR+CS C   GHNSRTC N            +K+FGV L             +     S
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRG----------VKIFGVHLT---------DGSAIRKSAS  41

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLP---EKKRGVPW  588
              +  L +A  +   +S      L D        G GY SD  V G+     ++K+GVPW
Sbjct  42   MGNLSLLSAGSTSGGASPADGPDLADG-------GGGYASDDFVQGSSSASRDRKKGVPW  94

Query  587  SEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLF  408
            +EEEHR FL+GL+KLG+GDWRGISR+FV +RTPTQ+ASHAQKYF+R +++   KRR SLF
Sbjct  95   TEEEHRRFLLGLQKLGKGDWRGISRNFVVSRTPTQVASHAQKYFIRQSNMSRRKRRSSLF  154

Query  407  DL  402
            D+
Sbjct  155  DM  156



>gb|AIB05106.1| MYB-related transcription factor, partial [Zea mays]
Length=315

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 80/182 (44%), Positives = 104/182 (57%), Gaps = 29/182 (16%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            MTR+CS C   GHNSRTC N            +K+FGV L             +     S
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRG----------VKIFGVHLTDG---------SAIRKSAS  41

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLP---EKKRGVPW  588
              +  L +A  +   +S      L D        G GY SD  V G+     ++K+GVPW
Sbjct  42   MGNLSLLSAGSTSGGASPADGPDLADG-------GGGYASDDFVQGSSSASRDRKKGVPW  94

Query  587  SEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLF  408
            +EEEHR FL+GL+KLG+GDWRGISR+FV +RTPTQ+ASHAQKYF+R +++   KRR SLF
Sbjct  95   TEEEHRRFLLGLQKLGKGDWRGISRNFVVSRTPTQVASHAQKYFIRQSNMSRRKRRSSLF  154

Query  407  DL  402
            D+
Sbjct  155  DM  156



>gb|ACF85648.1| unknown [Zea mays]
 gb|AFW87869.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
Length=315

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 80/182 (44%), Positives = 104/182 (57%), Gaps = 29/182 (16%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            MTR+CS C   GHNSRTC N            +K+FGV L             +     S
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRG----------VKIFGVHLTDG---------SAIRKSAS  41

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLP---EKKRGVPW  588
              +  L +A  +   +S      L D        G GY SD  V G+     ++K+GVPW
Sbjct  42   MGNLSLLSAGSTSGGASPADGPDLADG-------GGGYASDDFVQGSSSASRDRKKGVPW  94

Query  587  SEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLF  408
            +EEEHR FL+GL+KLG+GDWRGISR+FV +RTPTQ+ASHAQKYF+R +++   KRR SLF
Sbjct  95   TEEEHRRFLLGLQKLGKGDWRGISRNFVVSRTPTQVASHAQKYFIRQSNMSRRKRRSSLF  154

Query  407  DL  402
            D+
Sbjct  155  DM  156



>emb|CDY30163.1| BnaC05g36990D [Brassica napus]
Length=355

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 85/187 (45%), Positives = 108/187 (58%), Gaps = 17/187 (9%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLI-GSHQNysssssysfvmkk  762
            MTR+CS C   GHNSRTC   +   +SS   ++KLFGV+L  GS    S+S      +  
Sbjct  1    MTRRCSHCSYNGHNSRTCPTRSASSSSS--AAVKLFGVRLTDGSIIKKSASMGNLSALAV  58

Query  761  sfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISD------GLVCGNLPEKKR  600
                  L         +   +   L D          GY+SD      G +     E+KR
Sbjct  59   HHRLSPL--------ATGNHNDSPLSDHGRYSSQENGGYLSDDPGHGSGSIHHRRVERKR  110

Query  599  GVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRR  420
            GVPW+EEEHR+FLVGL+KLG+GDWRGISR++VT+RTPTQ+ASHAQKYF+RH      KRR
Sbjct  111  GVPWTEEEHRLFLVGLQKLGKGDWRGISRNYVTSRTPTQVASHAQKYFIRHTCSTRRKRR  170

Query  419  RSLFDLA  399
             SLFD+ 
Sbjct  171  SSLFDMV  177



>ref|XP_001775256.1| predicted protein [Physcomitrella patens]
 gb|EDQ59992.1| predicted protein [Physcomitrella patens]
Length=318

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 75/88 (85%), Gaps = 2/88 (2%)
 Frame = -2

Query  656  GCGYISDGLV--CGNLPEKKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQ  483
            G GY+SDGLV    N  E+K+GVPW+EEEHR+FL+GL+KLG+GDWRGISR+FV TRTPTQ
Sbjct  66   GDGYVSDGLVQTSNNTRERKKGVPWTEEEHRLFLLGLQKLGKGDWRGISRNFVQTRTPTQ  125

Query  482  IASHAQKYFLRHNSLHSTKRRRSLFDLA  399
            +ASHAQKYF+R ++++  KRR SLFD+ 
Sbjct  126  VASHAQKYFIRQSNMNKRKRRSSLFDIV  153



>ref|XP_010941064.1| PREDICTED: uncharacterized protein LOC105059464 isoform X2 [Elaeis 
guineensis]
Length=314

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 101/180 (56%), Gaps = 32/180 (18%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLI-GSHQNysssssysfvmkk  762
            MTR+CS CG  GHNSRTC N            +KLFGV+L  GS +  +S  + +     
Sbjct  1    MTRRCSHCGHNGHNSRTCPNRG----------VKLFGVRLTDGSIRKSASMGNLAHYAGS  50

Query  761  sfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKRGVPWSE  582
              +                       D          GY S+  + G+  E+K+GVPW+E
Sbjct  51   GSASPA--------------------DGPHADHGAADGYASEDFIQGSR-ERKKGVPWTE  89

Query  581  EEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFDL  402
             EH++FL+GL+KLG+GDWRGISR+FV TRTPTQ+ASHAQKYF+R  +    KRR SLFD+
Sbjct  90   HEHKMFLLGLQKLGKGDWRGISRNFVVTRTPTQVASHAQKYFIRQTNASRRKRRSSLFDM  149



>ref|NP_001238622.1| MYB transcription factor MYB180 [Glycine max]
 gb|ABH02846.1| MYB transcription factor MYB180 [Glycine max]
Length=316

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 81/196 (41%), Positives = 110/196 (56%), Gaps = 38/196 (19%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLI-GSHQNysssssysfvmkk  762
            MTR+CS C   GHNSRTC N            +KLFGV+L  GS +  +           
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRG----------VKLFGVRLTDGSIRKSA-----------  39

Query  761  sfSDDCLPaasysfadssfgssgFLFDENFDGKVP------GCGYISDGLVCGNLP---E  609
                  +   ++     S      L +    G+ P        GY+S+  V G+     E
Sbjct  40   -----SMGNLTHYAGSGSGPLHTGLNNPGSPGETPDHAAAVADGYLSEDFVPGSSSSSRE  94

Query  608  KKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHST  429
            +K+GVPW+EEEHR+FL+GL+KLG+GDWRGI+R +V +RTPTQ+ASHAQKYF+R +++   
Sbjct  95   RKKGVPWTEEEHRMFLLGLQKLGKGDWRGIARTYVISRTPTQVASHAQKYFIRQSNVSRR  154

Query  428  KRRRSLFDLAWKADEC  381
            KRR SLFD+   ADE 
Sbjct  155  KRRSSLFDIV--ADEA  168



>ref|XP_002274350.1| PREDICTED: transcription factor MYB1R1 [Vitis vinifera]
Length=335

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 79/199 (40%), Positives = 105/199 (53%), Gaps = 44/199 (22%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQ-----------RTSSHGGSMKLFGVKLIGSHQNyss  792
            MTR+CS C   GHNSRTC N   +           R S+  G++  +     G HQN  S
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRGVKIFGVRLTDGLIRKSASMGNLSHYAGSTSGHHQNGVS  60

Query  791  sssysfvmkksfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLP  612
             ++                                  E  +      GY S+G V G+  
Sbjct  61   GNNSVSP-----------------------------GETPEHGAAADGYASEGFVPGSSS  91

Query  611  --EKKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSL  438
              E+K+G PW+EEEHR+FL+GL+KLG+GDWRGISR++V +RTPTQ+ASHAQKYF+R  ++
Sbjct  92   SRERKKGTPWTEEEHRMFLLGLQKLGKGDWRGISRNYVISRTPTQVASHAQKYFIRQTNV  151

Query  437  HSTKRRRSLFDLAWKADEC  381
               KRR SLFD+   ADE 
Sbjct  152  SRRKRRSSLFDIV--ADES  168



>ref|XP_010518718.1| PREDICTED: uncharacterized protein LOC104798365 [Tarenaya hassleriana]
Length=339

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 102/181 (56%), Gaps = 22/181 (12%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            MTR+CS C   GHNSRTC N                GVKL G      S    + +   S
Sbjct  1    MTRRCSHCNHNGHNSRTCPNR---------------GVKLFGVRLTEGSIRKSASMGNLS  45

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLP--EKKRGVPWS  585
                  P        ++ GS G   D          GY S+  V G+    E+K+G PW+
Sbjct  46   HYTGSRPGGHSGTGSNNPGSPGDTPDH-----AAADGYASEDFVAGSSSSRERKKGTPWT  100

Query  584  EEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFD  405
            EEEHR+FL+GL+KLG+GDWRGISR++VTTRTPTQ+ASHAQKYF+R +++   KRR SLFD
Sbjct  101  EEEHRMFLLGLQKLGKGDWRGISRNYVTTRTPTQVASHAQKYFIRQSNVSRRKRRSSLFD  160

Query  404  L  402
            +
Sbjct  161  M  161



>ref|XP_006477144.1| PREDICTED: transcription factor MYB1R1-like [Citrus sinensis]
Length=333

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 115/188 (61%), Gaps = 27/188 (14%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLI-GSHQNysssssysfvmkk  762
            MTR+CS C   GHNSRTC N            +K+FGV+L  GS +  +S  + S     
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRG----------VKIFGVRLTDGSIRKSASMGNLSHYAGS  50

Query  761  sfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLP--EKKRGVPW  588
            +   +       + A ++  S G   D + DG      Y S+  V G+    E+K+GVPW
Sbjct  51   TSGHN------NNNASNTPDSPGETPDHHADG------YASEDFVPGSSSSRERKKGVPW  98

Query  587  SEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLF  408
            +EEEHR+FL+GL+KLG+GDWRGI+R++V +RTPTQ+ASHAQKYF+R +++   KRR SLF
Sbjct  99   TEEEHRMFLLGLQKLGKGDWRGIARNYVVSRTPTQVASHAQKYFIRQSNVSRRKRRSSLF  158

Query  407  DLAWKADE  384
            D+   ADE
Sbjct  159  DIV--ADE  164



>ref|XP_010941063.1| PREDICTED: uncharacterized protein LOC105059464 isoform X1 [Elaeis 
guineensis]
Length=319

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 101/180 (56%), Gaps = 32/180 (18%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLI-GSHQNysssssysfvmkk  762
            MTR+CS CG  GHNSRTC N            +KLFGV+L  GS +  +S  + +     
Sbjct  1    MTRRCSHCGHNGHNSRTCPNRG----------VKLFGVRLTDGSIRKSASMGNLAHYAGS  50

Query  761  sfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKRGVPWSE  582
              +                       D          GY S+  + G+  E+K+GVPW+E
Sbjct  51   GSASPA--------------------DGPHADHGAADGYASEDFIQGSR-ERKKGVPWTE  89

Query  581  EEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFDL  402
             EH++FL+GL+KLG+GDWRGISR+FV TRTPTQ+ASHAQKYF+R  +    KRR SLFD+
Sbjct  90   HEHKMFLLGLQKLGKGDWRGISRNFVVTRTPTQVASHAQKYFIRQTNASRRKRRSSLFDM  149



>ref|XP_004245787.1| PREDICTED: transcription factor MYB1R1 [Solanum lycopersicum]
Length=342

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 80/187 (43%), Positives = 103/187 (55%), Gaps = 19/187 (10%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            MTR+CS C   GHNSRTC N            +KLFGV+L       S+S          
Sbjct  1    MTRRCSHCSTNGHNSRTCPNRG----------VKLFGVRLTDGLIRKSASMGNLSHFASG  50

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLP--EKKRGVPWS  585
                  P                       G V   GY S+  V G+    E+K+GVPW+
Sbjct  51   SGGGSTPLNGVVHDSPGDTPD---HPAAAGGSV--DGYASEDFVAGSSSSRERKKGVPWT  105

Query  584  EEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFD  405
            EEEHR+FL+GL+KLG+GDWRGI+R++V +RTPTQ+ASHAQKYF+R +++   KRR SLFD
Sbjct  106  EEEHRMFLLGLQKLGKGDWRGIARNYVISRTPTQVASHAQKYFIRQSNMSRRKRRSSLFD  165

Query  404  LAWKADE  384
            +   ADE
Sbjct  166  IV--ADE  170



>ref|XP_011002026.1| PREDICTED: myb-like protein G [Populus euphratica]
Length=337

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 82/188 (44%), Positives = 110/188 (59%), Gaps = 22/188 (12%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLI-GSHQNysssssysfvmkk  762
            MTR+CS C   GHNSRTC N            +KLFGV+L  GS +  +S  + S     
Sbjct  1    MTRRCSHCSHNGHNSRTCPNR----------VVKLFGVRLTDGSIRKSASMGNLSLYTGS  50

Query  761  sfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLP--EKKRGVPW  588
            S     L       A  S      +   +        GY S+  V G+    E+K+GVPW
Sbjct  51   SNMGGPL-------ASGSNNPGSPVDTPDHGAATAADGYASEDFVPGSSSSRERKKGVPW  103

Query  587  SEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLF  408
            +EEEHR+FL+GL+KLG+GDWRGI+R++V +R+PTQ+ASHAQKYF+R +++   KRR SLF
Sbjct  104  TEEEHRMFLLGLQKLGKGDWRGIARNYVISRSPTQVASHAQKYFIRQSNMSRRKRRSSLF  163

Query  407  DLAWKADE  384
            D+   ADE
Sbjct  164  DIV--ADE  169



>emb|CDP09999.1| unnamed protein product [Coffea canephora]
Length=338

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 108/188 (57%), Gaps = 28/188 (15%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLI-------GSHQNysssssy  780
            MTR+CS C + GHNSRTC N            +KLFGV+L         S  N S  SS 
Sbjct  1    MTRRCSHCSQNGHNSRTCPNRG----------VKLFGVRLTDGLIRKSASMGNLSHYSSS  50

Query  779  sfvmkksfSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLP--EK  606
                  +   + L         ++  S G   D          GY S+  V G+    E+
Sbjct  51   GSGSGSATPQNGL---------AAHDSPGDTPDHPSAAAAAADGYASEDFVAGSSSSRER  101

Query  605  KRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTK  426
            K+GVPW+EEEHR+FL+GL+KLG+GDWRGI+R++V +RTPTQ+ASHAQKYF+R +++   K
Sbjct  102  KKGVPWTEEEHRMFLLGLQKLGKGDWRGIARNYVISRTPTQVASHAQKYFIRQSNVSRRK  161

Query  425  RRRSLFDL  402
            RR SLFD+
Sbjct  162  RRSSLFDI  169



>emb|CDM83166.1| unnamed protein product [Triticum aestivum]
Length=259

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = -2

Query  650  GYISDGLVCGNLPEKKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASH  471
            GY+SDG     + E+K+GVPWSEEEHR+FLVGLEKLG+GDWRGISR +VTTRTPTQ+ASH
Sbjct  79   GYLSDGPHGRLVQERKKGVPWSEEEHRLFLVGLEKLGKGDWRGISRSYVTTRTPTQVASH  138

Query  470  AQKYFLRHNSLHSTKRRRSLFDLA  399
            AQK+FLR +S+   KRR SLFD+ 
Sbjct  139  AQKFFLRQSSMGKKKRRSSLFDMV  162



>ref|XP_010677080.1| PREDICTED: transcription factor MYB1R1 [Beta vulgaris subsp. 
vulgaris]
Length=341

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 81/185 (44%), Positives = 106/185 (57%), Gaps = 24/185 (13%)
 Frame = -2

Query  938  MTRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkks  759
            MTR+CS C   GHNSRTC N            +KLFGV+L       S+S     + +  
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRG----------VKLFGVRLTDGSIRKSASMGNLSLHQNG  50

Query  758  fSDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKRGVPWSEE  579
               +  PAA     D     +     E+F   VPG     D         +K+G+PW+EE
Sbjct  51   VVGNTSPAAGDLTPDHLNPVADGYASEDF---VPGSSSSRD---------RKKGIPWTEE  98

Query  578  EHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFDLA  399
            EHR+FL+GL+KLG+GDWRGISR++V +RTPTQ+ASHAQKYF+R  ++   KRR SLFD+ 
Sbjct  99   EHRMFLLGLQKLGKGDWRGISRNYVISRTPTQVASHAQKYFIRQCNVSRRKRRSSLFDIV  158

Query  398  WKADE  384
              ADE
Sbjct  159  --ADE  161



>dbj|BAK01725.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90407.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=261

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = -2

Query  650  GYISDGLVCGNLPEKKRGVPWSEEEHRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASH  471
            GY+SDG     + E+K+GVPWSEEEHR+FLVGLEKLG+GDWRGISR +VTTRTPTQ+ASH
Sbjct  80   GYLSDGPHGRLVQERKKGVPWSEEEHRLFLVGLEKLGKGDWRGISRSYVTTRTPTQVASH  139

Query  470  AQKYFLRHNSLHSTKRRRSLFDLA  399
            AQK+FLR +S+   KRR SLFD+ 
Sbjct  140  AQKFFLRQSSMGKKKRRSSLFDMV  163



>ref|XP_009609815.1| PREDICTED: transcription factor MYB1R1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=323

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 75/187 (40%), Positives = 108/187 (58%), Gaps = 21/187 (11%)
 Frame = -2

Query  935  TRKCSSCGKTGHNSRTCNNNNEQRTSSHGGSMKLFGVKLIGSHQNysssssysfvmkksf  756
             RKCS CG+ GHNSRTCN N++         +KLFGV++  ++ ++   +          
Sbjct  5    ARKCSHCGQNGHNSRTCNYNSK--------GIKLFGVRIDDTNNSHHVDTKMKMK-----  51

Query  755  SDDCLPaasysfadssfgssgFLFDENFDGKVPGCGYISDGLVCGNLPEKKRGVPWSEEE  576
                +     +   S    +  + D N    V   GY+SDG +  ++  +K+G  W+EEE
Sbjct  52   ----IVDHESAIRRSKSLGNLEIHDHN---AVVDAGYLSDGPIHSSI-NRKKGTSWTEEE  103

Query  575  HRIFLVGLEKLGRGDWRGISRHFVTTRTPTQIASHAQKYFLRHNSLHSTKRRRSLFDLAW  396
            HR FL+GLEKLG+GDWRGIS+ +V TRTP+Q+ASHAQKYF+R  S    KRR S+FD+  
Sbjct  104  HRSFLIGLEKLGKGDWRGISKSYVPTRTPSQVASHAQKYFIRMASNDKKKRRPSVFDVNL  163

Query  395  KADECRV  375
            K    ++
Sbjct  164  KDSNSQI  170



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2381943541056