BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c17820_g1_i2 len=711 path=[689:0-16 706:17-481 1171:482-710]

Length=711
                                                                      Score     E

emb|CDP06353.1|  unnamed protein product                                262   2e-82   
ref|XP_009801689.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    261   2e-81   
ref|XP_009606107.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    261   2e-81   
ref|XP_010036047.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    261   3e-81   
ref|XP_007140015.1|  hypothetical protein PHAVU_008G077100g             261   3e-81   
ref|XP_011101976.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    260   6e-81   
gb|KDP21814.1|  hypothetical protein JCGZ_00601                         259   1e-80   
ref|XP_004249014.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    258   2e-80   
ref|XP_006362326.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    258   2e-80   
ref|XP_008355786.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    253   2e-80   
gb|EPS71148.1|  hypothetical protein M569_03610                         257   3e-80   
ref|XP_002519980.1|  Ethanolamine-phosphate cytidylyltransferase,...    258   3e-80   Ricinus communis
ref|XP_010036048.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    258   4e-80   
ref|XP_003552337.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    257   8e-80   
ref|XP_006429675.1|  hypothetical protein CICLE_v10011843mg             257   8e-80   
gb|KEH23310.1|  ethanolamine-phosphate cytidylyltransferase             253   2e-79   
ref|XP_010278899.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    256   2e-79   
ref|XP_011018911.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    256   3e-79   
emb|CBI31131.3|  unnamed protein product                                254   4e-79   
ref|XP_002265169.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    254   2e-78   Vitis vinifera
ref|XP_010684667.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    254   2e-78   
emb|CAQ58636.1|  Ethanolamine-phosphate cytidylyltransferase            253   3e-78   Vitis vinifera
ref|XP_003533643.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    253   4e-78   
ref|XP_008244222.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    253   4e-78   
ref|XP_007207330.1|  hypothetical protein PRUPE_ppa006076mg             253   6e-78   
ref|XP_004302493.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    252   8e-78   
ref|XP_009384337.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    252   9e-78   
ref|XP_004492610.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    252   9e-78   
gb|AFK43034.1|  unknown                                                 252   9e-78   
ref|XP_003623695.1|  Ethanolamine-phosphate cytidylyltransferase        252   9e-78   
gb|AES79913.2|  ethanolamine-phosphate cytidylyltransferase             252   1e-77   
ref|XP_009370855.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    251   1e-77   
ref|XP_010529959.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    251   2e-77   
ref|XP_009143367.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    251   2e-77   
ref|XP_008370315.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    251   2e-77   
ref|XP_006293474.1|  hypothetical protein CARUB_v10023288mg             251   3e-77   
ref|XP_008788034.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    250   3e-77   
ref|XP_009337844.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    251   3e-77   
ref|XP_008804653.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    250   5e-77   
ref|XP_004137664.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    250   5e-77   
ref|XP_010931423.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    249   1e-76   
ref|XP_010505515.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    247   1e-76   
gb|KFK36771.1|  hypothetical protein AALP_AA4G168400                    248   2e-76   
ref|XP_008358193.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    248   2e-76   
ref|XP_009410481.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    248   2e-76   
ref|XP_009381352.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    248   2e-76   
ref|XP_008442303.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    248   2e-76   
ref|XP_010922838.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    248   3e-76   
ref|XP_006411085.1|  hypothetical protein EUTSA_v10016709mg             248   4e-76   
ref|NP_181401.1|  ethanolamine-phosphate cytidylyltransferase           248   4e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002879759.1|  hypothetical protein ARALYDRAFT_903103             247   5e-76   
ref|XP_010517175.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    247   8e-76   
ref|XP_006663169.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    239   1e-75   
emb|CDX74894.1|  BnaA05g06400D                                          245   3e-75   
ref|XP_010509160.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    245   4e-75   
ref|XP_006381291.1|  hypothetical protein POPTR_0006s11470g             244   9e-75   
ref|XP_004977412.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    243   3e-74   
gb|EMS66153.1|  Ethanolamine-phosphate cytidylyltransferase             239   4e-74   
gb|EYU26697.1|  hypothetical protein MIMGU_mgv1a007403mg                242   4e-74   
ref|XP_002323699.2|  hypothetical protein POPTR_0016s15020g             242   6e-74   Populus trichocarpa [western balsam poplar]
ref|XP_010553187.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    242   6e-74   
ref|XP_006842638.1|  hypothetical protein AMTR_s00077p00187820          242   8e-74   
ref|XP_008679350.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    242   8e-74   
gb|ABA91254.1|  phosphoethanolamine cytidylyltransferase, putativ...    239   1e-73   Oryza sativa Japonica Group [Japonica rice]
gb|EMT02889.1|  Ethanolamine-phosphate cytidylyltransferase             239   2e-73   
gb|EEE51553.1|  hypothetical protein OsJ_32765                          239   2e-73   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003577861.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    241   2e-73   
ref|XP_002450173.1|  hypothetical protein SORBIDRAFT_05g001470          240   3e-73   Sorghum bicolor [broomcorn]
gb|AAO43227.1|  phosphoethanolamine cytidylyltransferase                240   4e-73   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK04174.1|  predicted protein                                      240   4e-73   
ref|XP_008442304.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    238   4e-73   
gb|EEC67567.1|  hypothetical protein OsI_34911                          239   7e-73   Oryza sativa Indica Group [Indian rice]
ref|NP_001066024.1|  Os12g0121300                                       239   9e-73   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001170703.1|  hypothetical protein                               239   1e-72   Zea mays [maize]
ref|XP_004978492.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    238   1e-72   
ref|XP_006664291.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    238   3e-72   
ref|XP_008442302.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    238   8e-72   
ref|XP_003579008.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    236   1e-71   
dbj|BAJ86064.1|  predicted protein                                      236   2e-71   
ref|XP_009133281.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    235   3e-71   
ref|XP_011006223.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    231   9e-70   
ref|XP_009141755.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    231   9e-70   
emb|CBI40665.3|  unnamed protein product                                225   3e-68   
ref|XP_002265606.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    225   3e-67   Vitis vinifera
emb|CDY07710.1|  BnaA03g18010D                                          223   2e-66   
ref|XP_002526236.1|  conserved hypothetical protein                     221   3e-66   Ricinus communis
ref|XP_006587893.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    221   5e-66   
ref|XP_004503546.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    221   5e-66   
emb|CDX91484.1|  BnaC04g06660D                                          220   1e-65   
gb|KDP45833.1|  hypothetical protein JCGZ_17440                         220   2e-65   
gb|KHN29458.1|  Ethanolamine-phosphate cytidylyltransferase             219   3e-65   
ref|XP_002990148.1|  hypothetical protein SELMODRAFT_131236             219   4e-65   
ref|XP_002992541.1|  hypothetical protein SELMODRAFT_162424             219   4e-65   
ref|XP_004163014.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    219   6e-65   
ref|XP_008453525.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    218   1e-64   
emb|CDY18374.1|  BnaA04g22130D                                          217   2e-64   
ref|XP_011017741.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    218   2e-64   
ref|XP_007014459.1|  Phosphorylethanolamine cytidylyltransferase ...    218   2e-64   
ref|XP_010263306.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    218   2e-64   
ref|XP_008223819.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    217   3e-64   
ref|XP_007222601.1|  hypothetical protein PRUPE_ppa006288mg             217   3e-64   
gb|EEC68755.1|  hypothetical protein OsI_37278                          216   5e-64   Oryza sativa Indica Group [Indian rice]
ref|XP_009770718.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    214   2e-63   
ref|XP_004299778.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    213   6e-63   
ref|XP_009783881.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    213   1e-62   
ref|XP_009626648.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    213   1e-62   
ref|XP_002308992.1|  hypothetical protein POPTR_0006s07030g             212   2e-62   Populus trichocarpa [western balsam poplar]
ref|XP_007160226.1|  hypothetical protein PHAVU_002G303400g             212   2e-62   
ref|XP_009342823.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    212   2e-62   
ref|XP_011094065.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    211   4e-62   
ref|XP_011020099.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    211   4e-62   
emb|CCW28789.1|  putative cytidylyltransferase                          211   4e-62   
ref|XP_002325231.2|  hypothetical protein POPTR_0018s13260g             211   5e-62   Populus trichocarpa [western balsam poplar]
ref|XP_009616437.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    211   7e-62   
ref|XP_004240130.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    211   9e-62   
ref|XP_010106955.1|  Ethanolamine-phosphate cytidylyltransferase        209   2e-61   
ref|XP_003525313.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    209   3e-61   
ref|XP_006361583.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    209   3e-61   
ref|XP_003530503.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    209   5e-61   
ref|XP_006360666.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    209   5e-61   
ref|XP_010048543.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    207   2e-60   
gb|ACJ85759.1|  unknown                                                 207   2e-60   Medicago truncatula
ref|XP_003630619.1|  Ethanolamine-phosphate cytidylyltransferase        207   2e-60   
ref|XP_006428518.1|  hypothetical protein CICLE_v10011809mg             207   2e-60   
ref|XP_010688423.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    207   2e-60   
ref|XP_004242864.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    207   2e-60   
ref|XP_003630620.1|  Ethanolamine-phosphate cytidylyltransferase        207   2e-60   
gb|ABX10445.1|  ethanolamine-phosphate cytidylyltransferase 1           206   2e-60   Gossypium hirsutum [American cotton]
gb|EYU25735.1|  hypothetical protein MIMGU_mgv1a007058mg                206   3e-60   
gb|KHG01776.1|  Ethanolamine-phosphate cytidylyltransferase             205   9e-60   
ref|XP_011094071.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    205   1e-59   
emb|CDY14442.1|  BnaC03g21530D                                          204   3e-59   
gb|KDO54355.1|  hypothetical protein CISIN_1g0144871mg                  202   2e-58   
ref|XP_010913784.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    202   2e-58   
ref|XP_009616433.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    201   9e-58   
ref|XP_009151252.1|  PREDICTED: uncharacterized protein LOC103874581    199   2e-56   
ref|XP_001780359.1|  predicted protein                                  196   2e-56   
ref|XP_004972545.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    197   3e-56   
ref|XP_001759318.1|  predicted protein                                  196   3e-56   
ref|XP_010928770.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    196   4e-56   
ref|XP_008781724.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    195   7e-56   
ref|XP_010928769.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    195   8e-56   
ref|XP_006659222.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    194   2e-55   
dbj|BAD03428.1|  putative phosphoethanolamine cytidylyltransferase      194   2e-55   Oryza sativa Japonica Group [Japonica rice]
emb|CDP20190.1|  unnamed protein product                                193   5e-55   
ref|XP_004171635.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    183   5e-55   
ref|XP_010113033.1|  Ethanolamine-phosphate cytidylyltransferase        192   6e-55   
ref|XP_009341732.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    192   9e-55   
ref|XP_008351357.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    191   1e-54   
ref|XP_010505513.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    181   4e-54   
gb|AFW57038.1|  hypothetical protein ZEAMMB73_658422                    190   6e-54   
gb|EEC66861.1|  hypothetical protein OsI_33354                          187   9e-54   Oryza sativa Indica Group [Indian rice]
ref|XP_003573570.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    189   1e-53   
ref|XP_004972543.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    189   4e-53   
ref|XP_008355152.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    178   6e-53   
gb|EAZ15919.1|  hypothetical protein OsJ_31340                          187   9e-53   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001064493.1|  Os10g0387000                                       187   1e-52   Oryza sativa Japonica Group [Japonica rice]
emb|CDY48653.1|  BnaC07g27560D                                          190   2e-52   
dbj|BAJ95410.1|  predicted protein                                      184   7e-52   
ref|XP_009770720.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    184   1e-51   
ref|XP_003564627.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    182   5e-51   
emb|CDM85025.1|  unnamed protein product                                182   5e-51   
ref|XP_009616439.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    182   7e-51   
gb|EMT24851.1|  Ethanolamine-phosphate cytidylyltransferase             181   2e-50   
ref|XP_009616438.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    180   5e-50   
ref|XP_009616436.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    179   7e-50   
gb|EPS64234.1|  hypothetical protein M569_10547                         176   1e-48   
gb|EMT25098.1|  Ethanolamine-phosphate cytidylyltransferase             173   3e-48   
gb|EMS51700.1|  Ethanolamine-phosphate cytidylyltransferase             172   3e-47   
ref|XP_004972544.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    171   3e-46   
ref|XP_004149674.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    160   4e-46   
ref|XP_005647873.1|  CTP-phosphoethanolamine cytidylyltransferase       165   4e-44   
ref|XP_004972546.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    163   1e-43   
ref|XP_004972542.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    163   3e-43   
gb|AFK45455.1|  unknown                                                 152   5e-43   
ref|XP_005845984.1|  hypothetical protein CHLNCDRAFT_25204              153   4e-42   
ref|XP_002950808.1|  hypothetical protein VOLCADRAFT_109104             157   7e-42   
ref|XP_001692963.1|  CDP-Ethanolamine synthase                          156   6e-41   Chlamydomonas reinhardtii
gb|KFM25861.1|  Ethanolamine-phosphate cytidylyltransferase             152   2e-39   
gb|ABX10446.1|  ethanolamine-phosphate cytidylyltransferase 2           150   6e-39   Gossypium hirsutum [American cotton]
gb|KDO54356.1|  hypothetical protein CISIN_1g0144871mg                  148   2e-38   
ref|XP_011006224.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    148   2e-38   
gb|KDO54357.1|  hypothetical protein CISIN_1g0144871mg                  148   2e-38   
ref|XP_005714716.1|  Ethanolamine-phosphate cytidylyltransferase,...    148   5e-38   
ref|XP_005538734.1|  phosphoethanolamine cytidylyltransferase           145   4e-37   
emb|CEI95984.1|  Putative Ethanolamine-phosphate cytidylyltransfe...    135   3e-35   
ref|XP_003623696.1|  Ethanolamine-phosphate cytidylyltransferase        137   2e-34   
gb|AES79914.2|  ethanolamine-phosphate cytidylyltransferase             137   2e-34   
ref|XP_010529960.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    137   3e-34   
emb|CEG75719.1|  Putative Ethanolamine-phosphate cytidylyltransfe...    135   6e-34   
emb|CEG75718.1|  Putative Ethanolamine-phosphate cytidylyltransfe...    135   1e-33   
gb|KDO33642.1|  hypothetical protein SPRG_01610                         136   1e-33   
emb|CEI99016.1|  Putative Ethanolamine-phosphate cytidylyltransfe...    134   1e-33   
ref|XP_008864068.1|  hypothetical protein H310_02362                    136   2e-33   
ref|XP_008615950.1|  ethanolamine-phosphate cytidylyltransferase        135   4e-33   
gb|EIE92478.1|  hypothetical protein RO3G_17000                         132   4e-33   
emb|CEG66905.1|  Putative Ethanolamine-phosphate cytidylyltransfe...    133   4e-33   
emb|CEG84347.1|  Putative Ethanolamine-phosphate cytidylyltransfe...    133   5e-33   
ref|XP_001623420.1|  predicted protein                                  132   1e-32   Nematostella vectensis
ref|XP_008904899.1|  hypothetical protein PPTG_11355                    132   2e-32   
ref|XP_009824288.1|  hypothetical protein H257_02379                    132   2e-32   
gb|EPB89151.1|  ethanolamine-phosphate cytidylyltransferase             130   8e-32   
gb|EFX78214.1|  hypothetical protein DAPPUDRAFT_305267                  129   1e-31   
gb|ETI47683.1|  hypothetical protein F443_08147                         130   1e-31   
ref|XP_002896776.1|  ethanolamine-phosphate cytidylyltransferase,...    130   1e-31   
gb|EPZ32625.1|  Rossmann-like alpha/beta/alpha sandwich fold doma...    129   2e-31   
gb|KDD76579.1|  hypothetical protein H632_c175p1                        130   2e-31   
gb|EIE76135.1|  hypothetical protein RO3G_00839                         129   2e-31   
ref|XP_001008378.1|  cytidyltransferase-related domain containing...    129   3e-31   Tetrahymena thermophila
ref|XP_009513920.1|  hypothetical protein PHYSODRAFT_348782             128   6e-31   
ref|XP_002672471.1|  predicted protein                                  127   7e-31   Naegleria gruberi strain NEG-M
ref|XP_787725.3|  PREDICTED: ethanolamine-phosphate cytidylyltran...    124   8e-31   Strongylocentrotus purpuratus [purple urchin]
ref|XP_002423231.1|  Ethanolamine-phosphate cytidylyltransferase,...    127   1e-30   Pediculus humanus corporis [human body lice]
ref|XP_002611477.1|  hypothetical protein BRAFLDRAFT_113520             127   1e-30   Branchiostoma floridae
ref|XP_003283291.1|  phosphoethanolamine-cytidyltransferase             126   2e-30   
ref|XP_004353870.1|  phosphoethanolamine-cytidyltransferase             126   2e-30   
gb|EPB91886.1|  ethanolamine-phosphate cytidylyltransferase             125   3e-30   
ref|XP_003081234.1|  CTP:ethanolamine cytidylyltransferase (ISS)        125   3e-30   
ref|XP_004368196.1|  CTP:ethanolaminephosphate cytidylyltransferase     125   4e-30   
ref|XP_002767684.1|  Choline-phosphate cytidylyltransferase A, pu...    122   4e-30   Perkinsus marinus ATCC 50983
ref|XP_002600903.1|  hypothetical protein BRAFLDRAFT_263711             125   4e-30   Branchiostoma floridae
gb|EPY30399.1|  ethanolamine-phosphate cytidylyltransferase             124   7e-30   
emb|CEF99073.1|  Rossmann-like alpha/beta/alpha sandwich fold           125   7e-30   
emb|CDS08410.1|  hypothetical protein LRAMOSA09772                      122   1e-29   
emb|CDH58541.1|  ethanolamine-phosphate cytidylyltransferase-like       124   1e-29   
ref|XP_829470.1|  ethanolamine-phosphate cytidylyltransferase           124   1e-29   Trypanosoma brucei brucei TREU927
gb|EPY35339.1|  ethanolamine-phosphate cytidylyltransferase             122   1e-29   
emb|CDS11051.1|  Putative Ethanolamine-phosphatecytidylyltransferase    124   1e-29   
ref|XP_002060439.1|  GJ14912                                            119   1e-29   Drosophila virilis
emb|CDH58540.1|  ethanolamine-phosphate cytidylyltransferase            124   2e-29   
ref|XP_646687.1|  hypothetical protein DDB_G0270298                     123   2e-29   Dictyostelium discoideum AX4
gb|AAK13093.1|AC078839_9  Putative phospholipid cytidylyltransferase    126   2e-29   Oryza sativa Japonica Group [Japonica rice]
gb|KFH72676.1|  ethanolamine-phosphate cytidylyltransferase             123   2e-29   
gb|EFA80421.1|  phosphoethanolamine-cytidyltransferase                  123   3e-29   Heterostelium album PN500
gb|ESA12672.1|  hypothetical protein GLOINDRAFT_347240                  122   4e-29   
gb|KCW80819.1|  hypothetical protein EUGRSUZ_C02186                     122   4e-29   
ref|XP_009027596.1|  hypothetical protein HELRODRAFT_107813             122   5e-29   
emb|CEJ00776.1|  Putative Ethanolamine-phosphate cytidylyltransfe...    121   5e-29   
gb|EXX58968.1|  ethanolamine-phosphate cytidylyltransferase             122   5e-29   
emb|CEG66906.1|  Putative Ethanolamine-phosphate cytidylyltransfe...    121   5e-29   
gb|EPY43438.1|  ethanolamine-phosphate cytidylyltransferase             122   6e-29   
dbj|GAM28819.1|  hypothetical protein SAMD00019534_119950               122   6e-29   
emb|CDS08409.1|  hypothetical protein LRAMOSA09772                      122   8e-29   
ref|XP_004527209.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    122   9e-29   
ref|XP_004527208.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    122   9e-29   
emb|CEJ03656.1|  Putative Ethanolamine-phosphate cytidylyltransfe...    120   9e-29   
emb|CDH52899.1|  ethanolamine-phosphate cytidylyltransferase-like       122   1e-28   
gb|AAL25522.1|  SD08668p                                                117   1e-28   Drosophila melanogaster
gb|EPY23528.1|  ethanolamine-phosphate cytidylyltransferase             121   2e-28   
ref|XP_001851245.1|  ethanolamine-phosphate cytidylyltransferase        120   2e-28   Culex quinquefasciatus
ref|XP_001651208.1|  ethanolamine-phosphate cytidylyltransferase        120   2e-28   Aedes aegypti
gb|ETN61926.1|  ethanolamine-phosphate cytidylyltransferase             120   3e-28   
ref|XP_004559465.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    119   4e-28   
ref|XP_002782885.1|  Ethanolamine-phosphate cytidylyltransferase,...    119   4e-28   Perkinsus marinus ATCC 50983
ref|XP_001988302.1|  GH11091                                            120   4e-28   Drosophila grimshawi
ref|XP_001430341.1|  hypothetical protein                               120   5e-28   Paramecium tetraurelia strain d4-2
ref|XP_003489672.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    119   5e-28   
ref|XP_005181839.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    119   6e-28   
gb|EJK70210.1|  hypothetical protein THAOC_08449                        120   6e-28   
ref|XP_005181838.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    119   6e-28   
ref|XP_009308303.1|  putative ethanolamine-phosphate cytidylyltra...    119   6e-28   
ref|XP_005181836.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    119   6e-28   
ref|XP_005181837.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    119   7e-28   
ref|XP_001969670.1|  GG23821                                            119   7e-28   Drosophila erecta
ref|XP_003400920.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    119   7e-28   
ref|XP_002060442.1|  GJ14914                                            119   8e-28   Drosophila virilis
ref|XP_002155934.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    119   8e-28   
ref|XP_004559464.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    118   9e-28   
ref|XP_002057708.1|  GJ17952                                            119   9e-28   Drosophila virilis
ref|XP_002782897.1|  Choline-phosphate cytidylyltransferase A, pu...    114   1e-27   Perkinsus marinus ATCC 50983
ref|XP_003450120.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    119   1e-27   
ref|XP_009341734.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    118   1e-27   
ref|XP_004559463.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    118   2e-27   
ref|XP_966534.1|  PREDICTED: ethanolamine-phosphate cytidylyltran...    118   2e-27   Tribolium castaneum [rust-red flour beetle]
ref|XP_006621260.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   2e-27   
ref|XP_003701917.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   2e-27   
ref|XP_002002855.1|  GI17607                                            118   2e-27   Drosophila mojavensis
ref|XP_010701782.1|  ethanolamine-phosphate cytidylyltransferase,...    118   2e-27   
ref|XP_008301525.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    118   2e-27   
ref|XP_008327791.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   2e-27   
gb|KFM68067.1|  Ethanolamine-phosphate cytidylyltransferase             117   2e-27   
ref|XP_010728353.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   3e-27   
ref|XP_624319.1|  PREDICTED: ethanolamine-phosphate cytidylyltran...    117   3e-27   
ref|XP_002042126.1|  GM10235                                            117   3e-27   
ref|XP_009861144.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   3e-27   
ref|XP_009861143.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   3e-27   
ref|NP_609613.2|  phosphoethanolamine cytidylyltransferase, isofo...    117   3e-27   
ref|XP_002079297.1|  GD23872                                            117   3e-27   
gb|ENN72223.1|  hypothetical protein YQE_11086                          117   3e-27   
ref|NP_723789.2|  phosphoethanolamine cytidylyltransferase, isofo...    117   3e-27   
ref|NP_723790.2|  phosphoethanolamine cytidylyltransferase, isofo...    117   3e-27   
ref|NP_723791.2|  phosphoethanolamine cytidylyltransferase, isofo...    117   3e-27   
ref|XP_002129881.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   3e-27   
ref|XP_002088547.1|  pect                                               117   3e-27   
ref|XP_009861142.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   4e-27   
ref|XP_001744354.1|  hypothetical protein                               117   4e-27   
ref|XP_001962647.1|  GF15564                                            117   4e-27   
gb|EHJ66000.1|  putative ethanolamine-phosphate cytidylyltransferase    117   4e-27   
ref|XP_819288.1|  ethanolamine-phosphate cytidylyltransferase           117   5e-27   
emb|CCA22080.1|  ethanolaminephosphate cytidylyltransferase putative    118   5e-27   
ref|XP_002294596.1|  phospholid cytidylyltransferase                    117   5e-27   
ref|XP_005801499.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    116   6e-27   
ref|XP_008327790.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    116   6e-27   
ref|XP_004071464.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    116   7e-27   
ref|XP_001567455.1|  ethanolamine-phosphate cytidylyltransferase        116   7e-27   
ref|XP_010769178.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    115   7e-27   
ref|XP_001602017.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    116   8e-27   
gb|KDR12653.1|  Ethanolamine-phosphate cytidylyltransferase             116   8e-27   
ref|XP_002607683.1|  hypothetical protein BRAFLDRAFT_82871              116   8e-27   
ref|XP_004343166.1|  phosphoethanolamine-cytidyltransferase             116   8e-27   
gb|EZA62249.1|  Ethanolamine-phosphate cytidylyltransferase             115   8e-27   
gb|EKF33174.1|  ethanolamine-phosphate cytidylyltransferase, puta...    116   9e-27   
gb|ESL06891.1|  ethanolamine-phosphate cytidylyltransferase             115   1e-26   
ref|XP_005801497.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    116   1e-26   
ref|XP_005801498.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    116   1e-26   
ref|XP_002065671.1|  GK14544                                            115   1e-26   
ref|XP_002021799.1|  GL26305                                            115   1e-26   
gb|EKG04727.1|  ethanolamine-phosphate cytidylyltransferase, puta...    115   1e-26   
emb|CEF71025.1|  Ethanolamine-phosphate cytidylyltransferase            115   1e-26   
gb|EFN64355.1|  Ethanolamine-phosphate cytidylyltransferase             115   1e-26   
ref|XP_004032276.1|  hypothetical protein IMG5_125800                   115   1e-26   
ref|XP_009037496.1|  hypothetical protein AURANDRAFT_2800               115   2e-26   
ref|XP_002184106.1|  predicted protein                                  115   2e-26   
ref|XP_005989106.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    115   2e-26   
gb|ABX10447.1|  ethanolamine-phosphate cytidylyltransferase 3           113   2e-26   
ref|XP_001423999.1|  hypothetical protein                               115   2e-26   
ref|XP_003877932.1|  ethanolamine-phosphate cytidylyltransferase,...    115   2e-26   
ref|XP_010769177.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    115   2e-26   
gb|AET05096.2|  ethanolamine-phosphate cytidylyltransferase             115   2e-26   
gb|ACO12188.1|  Ethanolamine-phosphate cytidylyltransferase             115   2e-26   
ref|XP_010870922.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    115   3e-26   
ref|XP_001011315.1|  cytidyltransferase-related domain containing...    115   3e-26   
ref|XP_010774781.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    114   3e-26   
ref|XP_006635464.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    114   3e-26   
emb|CCC54014.1|  putative ethanolamine-phosphate cytidylyltransfe...    114   3e-26   
ref|XP_010080655.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    112   4e-26   
ref|XP_001419566.1|  predicted protein                                  114   4e-26   
dbj|BAE02335.1|  unnamed protein product                                112   4e-26   
ref|XP_008414452.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    114   4e-26   
ref|XP_008408685.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    114   4e-26   
ref|XP_007570241.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    114   4e-26   
ref|XP_008544243.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    114   5e-26   
emb|CBJ49051.1|  CTP-phosphoethanolamine cytidylyltransferase           115   5e-26   
ref|XP_006621261.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    114   5e-26   
ref|XP_003964731.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    114   5e-26   
ref|XP_006621262.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    113   5e-26   
ref|XP_005597109.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    113   6e-26   
ref|XP_006560066.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    113   6e-26   
ref|XP_006560065.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    113   6e-26   
ref|XP_003697467.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    113   6e-26   
ref|XP_008278508.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    113   8e-26   
ref|XP_005597108.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    113   8e-26   
ref|XP_010143924.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    112   9e-26   
ref|XP_010719650.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    112   1e-25   
ref|XP_008058604.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    112   1e-25   
ref|XP_320056.4|  AGAP009264-PA                                         113   1e-25   
gb|KFB49144.1|  AGAP009263-PA-like protein                              115   1e-25   
ref|XP_007236102.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    111   1e-25   
ref|XP_003211513.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    112   1e-25   
ref|XP_009874095.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    110   1e-25   
ref|XP_011062228.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    112   2e-25   
emb|CCI41645.1|  unnamed protein product                                116   2e-25   
ref|XP_008920033.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    111   2e-25   
ref|XP_007556416.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    112   2e-25   
gb|EFZ19242.1|  hypothetical protein SINV_05990                         112   2e-25   
ref|XP_008058606.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    112   2e-25   
ref|XP_002502198.1|  predicted protein                                  112   2e-25   
gb|EGI60734.1|  Ethanolamine-phosphate cytidylyltransferase             112   2e-25   
ref|XP_003742758.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    112   2e-25   
ref|XP_003059553.1|  predicted protein                                  112   2e-25   
ref|XP_011062227.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    112   2e-25   
ref|XP_008574518.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    111   2e-25   
ref|XP_003742761.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    112   2e-25   
ref|XP_010127567.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    111   2e-25   
ref|XP_010143917.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    112   2e-25   
emb|CEG84348.1|  Putative Ethanolamine-phosphate cytidylyltransfe...    111   2e-25   
ref|XP_010201094.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    109   2e-25   
ref|XP_004861030.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    111   2e-25   
ref|XP_005585334.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    111   2e-25   
ref|XP_005585333.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    112   2e-25   
ref|XP_003742760.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    112   3e-25   
ref|XP_009189750.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    112   3e-25   
ref|XP_004894622.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    111   3e-25   
ref|XP_008939759.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    109   3e-25   
gb|EHH58431.1|  hypothetical protein EGM_08284                          112   3e-25   
ref|XP_003742759.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    112   3e-25   
ref|XP_005350939.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    111   3e-25   
ref|XP_005585331.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    112   3e-25   
ref|XP_002775089.1|  Ethanolamine-phosphate cytidylyltransferase,...    109   3e-25   
gb|EHB09343.1|  Ethanolamine-phosphate cytidylyltransferase             111   3e-25   
ref|XP_001951262.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    111   3e-25   
ref|XP_003931691.2|  PREDICTED: ethanolamine-phosphate cytidylylt...    111   3e-25   
gb|ELU08724.1|  hypothetical protein CAPTEDRAFT_162811                  109   3e-25   
ref|XP_008153350.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    112   3e-25   
ref|XP_008518630.1|  PREDICTED: LOW QUALITY PROTEIN: ethanolamine...    111   3e-25   
ref|XP_008920032.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    111   3e-25   
ref|XP_005011600.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    111   3e-25   
ref|XP_004432926.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    111   4e-25   
ref|XP_010743291.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    111   4e-25   
emb|CDW90365.1|  ethanolamine-phosphate cytidylyltransferase            115   4e-25   
ref|XP_004894621.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    111   4e-25   
ref|XP_003931692.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    111   4e-25   
ref|XP_003786588.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    111   4e-25   
ref|XP_004861028.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    111   4e-25   
ref|XP_009062080.1|  hypothetical protein LOTGIDRAFT_177471             111   4e-25   
ref|XP_005585332.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    111   4e-25   
ref|XP_010127566.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    111   4e-25   
ref|XP_005805135.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    111   4e-25   
ref|XP_003913624.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    111   4e-25   
ref|XP_005144256.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    111   4e-25   
ref|XP_008574516.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    111   4e-25   
ref|NP_001006037.1|  ethanolamine-phosphate cytidylyltransferase        111   4e-25   
ref|XP_005350938.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    111   4e-25   
ref|XP_009080963.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    111   5e-25   
gb|KHN82689.1|  Ethanolamine-phosphate cytidylyltransferase             111   5e-25   
gb|EFN75296.1|  Ethanolamine-phosphate cytidylyltransferase             111   5e-25   
ref|XP_004861027.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    111   5e-25   
ref|XP_007185942.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    110   5e-25   
gb|EJY71172.1|  Phosphoethanolamine-cytidyltransferase                  112   5e-25   
ref|XP_009092525.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    110   5e-25   
ref|XP_001467774.1|  ethanolamine-phosphate cytidylyltransferase        111   5e-25   
ref|XP_005585330.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    111   5e-25   
ref|XP_010282190.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    110   5e-25   
ref|XP_009930965.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    110   6e-25   
ref|XP_008315525.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    111   6e-25   
gb|ERG83522.1|  ethanolamine-phosphate cytidylyltransferase             111   6e-25   
ref|XP_006912211.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    110   6e-25   
ref|XP_005350937.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    111   6e-25   
ref|XP_005144257.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    110   6e-25   
emb|CDW78916.1|  ethanolamine-phosphate cytidylyltransferase-like       110   7e-25   
ref|XP_005530696.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    110   7e-25   
ref|XP_009944224.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    110   7e-25   
ref|NP_001167040.1|  Ethanolamine-phosphate cytidylyltransferase        110   7e-25   
ref|XP_006987734.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    110   7e-25   
ref|XP_010872586.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    110   7e-25   
ref|XP_009642454.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    110   7e-25   
ref|XP_010411684.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    110   7e-25   
ref|XP_005429859.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    110   7e-25   
ref|XP_009465225.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    109   7e-25   
ref|XP_008492788.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    110   7e-25   
ref|XP_003831150.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    110   7e-25   
ref|XP_009485599.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    109   7e-25   
ref|XP_005056300.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    110   8e-25   
ref|XP_010872584.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    110   8e-25   
ref|XP_006940730.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    110   8e-25   
ref|XP_002414532.1|  glycerol-3-phosphate cytidylyltransferase, p...    110   8e-25   
ref|XP_009987641.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    109   8e-25   
ref|XP_006987733.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    110   9e-25   
ref|XP_005495710.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    110   9e-25   
ref|XP_005925137.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    110   9e-25   
ref|XP_003455812.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    110   9e-25   
ref|XP_006790764.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    110   9e-25   
ref|XP_005925138.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    110   9e-25   
ref|XP_004655111.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    110   9e-25   
gb|EHH25308.1|  hypothetical protein EGK_09107                          110   9e-25   
ref|XP_007427843.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    110   9e-25   
ref|XP_009667071.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    109   9e-25   
ref|XP_005495709.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    110   1e-24   
ref|XP_009926038.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    109   1e-24   
emb|CAG06029.1|  unnamed protein product                                110   1e-24   
ref|XP_009574039.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    110   1e-24   
ref|XP_009926039.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    109   1e-24   
ref|XP_010282187.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    110   1e-24   
ref|NP_001243364.1|  ethanolamine-phosphate cytidylyltransferase ...    109   1e-24   
ref|XP_009557287.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    109   1e-24   
dbj|BAG52690.1|  unnamed protein product                                109   1e-24   
ref|XP_006145690.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    110   1e-24   
ref|XP_007427842.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    110   1e-24   
ref|XP_005530695.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    110   1e-24   
ref|XP_010282186.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    110   1e-24   
ref|XP_004040835.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    109   1e-24   
ref|XP_010019461.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    109   1e-24   
ref|XP_004695585.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    110   1e-24   
ref|XP_007185940.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    110   1e-24   
ref|XP_010311275.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    110   1e-24   
ref|NP_001278895.1|  ethanolamine-phosphate cytidylyltransferase        110   1e-24   
ref|XP_006753085.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    109   1e-24   
ref|XP_003831149.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    110   1e-24   
ref|XP_007063441.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    110   1e-24   
ref|XP_006940729.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    110   1e-24   
ref|XP_006145686.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    110   1e-24   
ref|XP_009930949.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    109   1e-24   
ref|XP_006743153.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    109   1e-24   
ref|XP_004539072.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    110   1e-24   
ref|XP_005508410.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    109   1e-24   
ref|XP_009944209.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    109   1e-24   
ref|XP_009926037.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    109   1e-24   
ref|XP_005735765.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    110   1e-24   
ref|XP_007427841.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    110   1e-24   
gb|EFB24230.1|  hypothetical protein PANDA_000699                       109   1e-24   
ref|XP_008826609.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    110   1e-24   
ref|XP_008692086.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    109   1e-24   
ref|XP_005001509.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    108   1e-24   
ref|XP_007125690.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    109   1e-24   
ref|XP_005624050.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    109   1e-24   
ref|XP_005332733.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    109   1e-24   
ref|XP_009465224.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    109   1e-24   
ref|XP_009704648.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    109   1e-24   
dbj|BAH12702.1|  unnamed protein product                                109   1e-24   
ref|XP_004177012.1|  PREDICTED: LOW QUALITY PROTEIN: ethanolamine...    109   1e-24   



>emb|CDP06353.1| unnamed protein product [Coffea canephora]
Length=362

 Score =   262 bits (669),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILRLAR LGDFLLVGIHTDQTVSA RGAHRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  208  HAGHVEILRLARGLGDFLLVGIHTDQTVSANRGAHRPIMNLHERSLSVLACRYVDEVIIG  267

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV+KDMITTF+ISLVVHGTVAE +D+QKE  NPYAVPISMGILK+LESPLDITTSTI
Sbjct  268  APWEVSKDMITTFNISLVVHGTVAEDNDFQKEKSNPYAVPISMGILKLLESPLDITTSTI  327

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIVSNH+AY KRNEKK ESE+RYYE K Y+S D
Sbjct  328  IRRIVSNHEAYQKRNEKKTESERRYYEDKIYVSDD  362


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 54/85 (64%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  ++A +G   P+  L+ER + V A ++VDEVI  
Sbjct  9    HYGHCNALRQARALGDQLVVGVVSDAEITANKGP--PVTPLNERMIMVSAVKWVDEVIPD  66

Query  182  APWEVTKDMITT----FDISLVVHG  244
            AP+ +T+D +      ++I  ++HG
Sbjct  67   APYAITEDFMKKLFDEYNIDYIIHG  91



>ref|XP_009801689.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Nicotiana 
sylvestris]
Length=413

 Score =   261 bits (667),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILRLAR LGDFLLVGIHTDQTVSA RGAHRPIMNLHERSLSVLACRY DEVIIG
Sbjct  259  HAGHVEILRLARGLGDFLLVGIHTDQTVSANRGAHRPIMNLHERSLSVLACRYTDEVIIG  318

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV+KDMITTF+ISLVVHGTVAE +D+QKE  NPYAVPISM I K+L+SPLDITTSTI
Sbjct  319  APWEVSKDMITTFNISLVVHGTVAEDNDFQKEKGNPYAVPISMDIFKILDSPLDITTSTI  378

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIVSNH+AY KRNEKK  SE+RYYEGKSY+SGD
Sbjct  379  IRRIVSNHEAYQKRNEKKAASERRYYEGKSYVSGD  413


 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 53/85 (62%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  + A +G   P+  LHER + V A ++VDEVI  
Sbjct  60   HYGHCNALRQARALGDQLVVGVVSDAEIIANKGP--PVTPLHERMIMVGAVKWVDEVISD  117

Query  182  APWEVTKD----MITTFDISLVVHG  244
            AP+ +T+D    +   ++I  ++HG
Sbjct  118  APYAITEDFMRKLFDEYNIDYIIHG  142



>ref|XP_009606107.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Nicotiana 
tomentosiformis]
Length=413

 Score =   261 bits (667),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILRLAR LGDFLLVGIHTDQTVSA RG HRPIMNLHERSLSVLACRY DEVIIG
Sbjct  259  HAGHVEILRLARGLGDFLLVGIHTDQTVSANRGVHRPIMNLHERSLSVLACRYADEVIIG  318

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV+KDMITTF+ISLVVHGTVAE +D+QKE  NPYAVPISMGI K+L+SPLDITTSTI
Sbjct  319  APWEVSKDMITTFNISLVVHGTVAEDNDFQKEKGNPYAVPISMGIFKILDSPLDITTSTI  378

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIVSNH+AY KRN+KK  SE+RYYEGKSY+SGD
Sbjct  379  IRRIVSNHEAYQKRNDKKAASERRYYEGKSYVSGD  413


 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 53/85 (62%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  + A +G   P+  LHER + V A ++VDEVI  
Sbjct  60   HYGHCNALRQARALGDQLVVGVVSDAEIIANKGP--PVTPLHERMIMVGAVKWVDEVISD  117

Query  182  APWEVTKD----MITTFDISLVVHG  244
            AP+ +T+D    +   ++I  ++HG
Sbjct  118  APYAITEDFMRKLFDEYNIDYIIHG  142



>ref|XP_010036047.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase isoform 
X1 [Eucalyptus grandis]
 gb|KCW47570.1| hypothetical protein EUGRSUZ_K01317 [Eucalyptus grandis]
Length=425

 Score =   261 bits (667),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR+AR LGDFLLVGIHTDQTVSA RGAHRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  271  HAGHVEILRVARGLGDFLLVGIHTDQTVSAKRGAHRPIMNLHERSLSVLACRYVDEVIIG  330

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV++DMITTFDISLVVHGT+AE +D+QK+  NPYAVPISMGI KVLESPLDITT+TI
Sbjct  331  APWEVSRDMITTFDISLVVHGTIAENNDFQKDEGNPYAVPISMGIFKVLESPLDITTTTI  390

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIV+NH+A+LKRNEKK  SEKRYYE K+Y++GD
Sbjct  391  IRRIVANHEAFLKRNEKKAASEKRYYEDKAYVTGD  425


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 49/85 (58%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  +   +G   P+  L ER + V A ++VDEVI  
Sbjct  72   HYGHCNALRQARALGDQLVVGVVSDAEIVVNKGP--PVTPLKERMIMVNAVKWVDEVIPD  129

Query  182  APWEVT----KDMITTFDISLVVHG  244
            AP+ +T    K +   + I  ++HG
Sbjct  130  APYAITEEFMKKLFDEYHIDYIIHG  154



>ref|XP_007140015.1| hypothetical protein PHAVU_008G077100g [Phaseolus vulgaris]
 gb|ESW12009.1| hypothetical protein PHAVU_008G077100g [Phaseolus vulgaris]
Length=421

 Score =   261 bits (666),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILRLAR LGDFLLVGIHTDQTVS TRG+HRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  267  HAGHVEILRLARDLGDFLLVGIHTDQTVSTTRGSHRPIMNLHERSLSVLACRYVDEVIIG  326

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV+KDMITTF+ISLVVHGT+AE +D+QKE  NPYAVPISMG+ K+LESP+DITT+TI
Sbjct  327  APWEVSKDMITTFNISLVVHGTIAENNDFQKEQCNPYAVPISMGVFKLLESPVDITTTTI  386

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            I+RIVSNH+AY KRNEKK ESEKRYYEGK ++SGD
Sbjct  387  IKRIVSNHEAYQKRNEKKGESEKRYYEGKGHVSGD  421


 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 51/85 (60%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  + A +G   P+  LHER + V A ++VDEVI  
Sbjct  65   HYGHCNALRQARALGDQLIVGVVSDAEIIANKGP--PVTPLHERLMMVNAVKWVDEVIPE  122

Query  182  APWEVT----KDMITTFDISLVVHG  244
            AP+ +T    K +   + I  ++HG
Sbjct  123  APYAITEEFMKKLFDEYKIDYIIHG  147



>ref|XP_011101976.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Sesamum 
indicum]
Length=427

 Score =   260 bits (665),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILRLAR LGDFLLVGIHTDQTVSA RGAHRPIMNLHERSLSVLACRY DEVIIG
Sbjct  273  HAGHVEILRLARGLGDFLLVGIHTDQTVSANRGAHRPIMNLHERSLSVLACRYADEVIIG  332

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV+KDMITTF+ISLVVHGTVAE +D+QKE  NPYAVPISMGI K+LESPLDITTSTI
Sbjct  333  APWEVSKDMITTFNISLVVHGTVAEDNDFQKEKRNPYAVPISMGIFKLLESPLDITTSTI  392

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIVSNH+AY KRN+KK +SEK+YYE K+Y+SGD
Sbjct  393  IRRIVSNHEAYQKRNDKKAQSEKKYYEEKTYVSGD  427


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 53/85 (62%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  ++  +G   P+  L+ER + V A ++VDEVI  
Sbjct  74   HYGHCNALRQARALGDQLVVGVVSDAEITVNKGP--PVTPLNERMIMVSAVKWVDEVIPD  131

Query  182  APWEVTKD----MITTFDISLVVHG  244
            AP+ +T+D    +   ++I  ++HG
Sbjct  132  APYAITEDFMRKLFDEYNIDYIIHG  156



>gb|KDP21814.1| hypothetical protein JCGZ_00601 [Jatropha curcas]
Length=417

 Score =   259 bits (662),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR+AR LGDFLLVGIH DQTVSA RGAHRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  263  HAGHVEILRVARGLGDFLLVGIHNDQTVSAKRGAHRPIMNLHERSLSVLACRYVDEVIIG  322

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV+KDMITTF+ISLVVHGTVAE  DY +E  NPYAVPISMGI KVLESPLDITT+TI
Sbjct  323  APWEVSKDMITTFNISLVVHGTVAENIDYAEEKCNPYAVPISMGIFKVLESPLDITTTTI  382

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIV+NH+AY KRNEKK ESE+RYYEGK+YISGD
Sbjct  383  IRRIVANHEAYQKRNEKKAESERRYYEGKTYISGD  417


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 51/85 (60%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  + A +G   P+  +HER + V A ++V EVI  
Sbjct  62   HYGHCNALRQARALGDELVVGVVSDAEIIANKGP--PVTPIHERMIMVNAIKWVHEVIPD  119

Query  182  APWEVT----KDMITTFDISLVVHG  244
            AP+ +T    K +   ++I  ++HG
Sbjct  120  APYAITEEFMKKLFEEYNIDYIIHG  144



>ref|XP_004249014.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Solanum 
lycopersicum]
Length=413

 Score =   258 bits (660),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILRLAR LGDFLLVGIHTDQTVSA RG HRPIMNLHERSLSVLACRY DEVIIG
Sbjct  259  HAGHVEILRLARGLGDFLLVGIHTDQTVSANRGGHRPIMNLHERSLSVLACRYADEVIIG  318

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            AP EV+KDMITTF+ISLVVHGTVAE +D+QKE  NPYAVPISMGI +VL+SPLDITTSTI
Sbjct  319  APGEVSKDMITTFNISLVVHGTVAEDNDFQKETGNPYAVPISMGIFQVLDSPLDITTSTI  378

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIVSNH+AY KRNEKK  SEKRYYEGKSY+SGD
Sbjct  379  IRRIVSNHEAYQKRNEKKAASEKRYYEGKSYVSGD  413


 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 53/85 (62%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  + A +G   P+  LHER + V A ++VDEVI  
Sbjct  60   HYGHCNALRQARALGDQLVVGVVSDAEIIANKGP--PVTPLHERMIMVGAVKWVDEVISD  117

Query  182  APWEVTKD----MITTFDISLVVHG  244
            AP+ +T++    +   ++I  ++HG
Sbjct  118  APYAITEEFMRKLFDEYNIDYIIHG  142



>ref|XP_006362326.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Solanum 
tuberosum]
Length=414

 Score =   258 bits (660),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILRLAR LGDFLLVGIHTDQTVSA RG HRPIMNLHERSLSVLACRY DEVIIG
Sbjct  260  HAGHVEILRLARGLGDFLLVGIHTDQTVSANRGGHRPIMNLHERSLSVLACRYADEVIIG  319

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            AP EV+KDMITTF+ISLVVHGTVAE +D+QKE  NPYAVPISMGI +VL+SPLDITTSTI
Sbjct  320  APGEVSKDMITTFNISLVVHGTVAEDNDFQKETGNPYAVPISMGIFQVLDSPLDITTSTI  379

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIVSNH+AY KRNEKK  SEKRYYEGKSY+SGD
Sbjct  380  IRRIVSNHEAYQKRNEKKAASEKRYYEGKSYVSGD  414


 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 53/85 (62%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  + A +G   P+  LHER + V A ++VDEVI  
Sbjct  61   HYGHCNALRQARALGDQLVVGVVSDAEIIANKGP--PVTPLHERMIMVGAVKWVDEVISD  118

Query  182  APWEVTKD----MITTFDISLVVHG  244
            AP+ +T++    +   ++I  ++HG
Sbjct  119  APYAITEEFMRKLFDEYNIDYIIHG  143



>ref|XP_008355786.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Malus 
domestica]
Length=249

 Score =   253 bits (646),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  95   HAGHVEILRKARELGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  154

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            +PWE++KDM+TTF+ISLVVHGT+AE S+++KE  NPY VPIS+GI KVL+S LDITTSTI
Sbjct  155  SPWEISKDMLTTFNISLVVHGTIAENSNFEKEEGNPYQVPISLGIFKVLDSSLDITTSTI  214

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIVSNH+AY KRN KK  SEKRYYEGK Y+SGD
Sbjct  215  IRRIVSNHEAYQKRNXKKAASEKRYYEGKXYVSGD  249



>gb|EPS71148.1| hypothetical protein M569_03610, partial [Genlisea aurea]
Length=373

 Score =   257 bits (656),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 145/156 (93%), Gaps = 1/156 (1%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILRLAR LGDFLLVGIHTDQTVS  RGAHRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  218  HAGHVEILRLARGLGDFLLVGIHTDQTVSINRGAHRPIMNLHERSLSVLACRYVDEVIIG  277

Query  182  APWEVTKDMITTFDISLVVHGTVAE-YSDYQKEAENPYAVPISMGILKVLESPLDittst  358
            APWEV+KDMITTF+ISLVVHGTVAE YSD+ K+ +NPYA+P+S+GI K LESPLDITTST
Sbjct  278  APWEVSKDMITTFNISLVVHGTVAEDYSDFHKDKQNPYAIPMSLGIFKQLESPLDITTST  337

Query  359  iirriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            II+RIVSNH+AYLKRNE+K ESE+RYYE K Y+SGD
Sbjct  338  IIKRIVSNHEAYLKRNERKAESERRYYEDKKYVSGD  373


 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 52/85 (61%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  ++  +G   P+  L ER + V A ++VDEVI  
Sbjct  19   HYGHCNALRQARALGDQLVVGVVSDAEITLNKGP--PVTPLDERMIMVSAIKWVDEVIPD  76

Query  182  APWEVTKD----MITTFDISLVVHG  244
            AP+ +T+D    +   +DI  ++HG
Sbjct  77   APYAITEDFMRKLFEEYDIDYIIHG  101



>ref|XP_002519980.1| Ethanolamine-phosphate cytidylyltransferase, putative [Ricinus 
communis]
 gb|EEF42304.1| Ethanolamine-phosphate cytidylyltransferase, putative [Ricinus 
communis]
Length=418

 Score =   258 bits (660),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR+AR LGDFLLVGIH DQTVSA RGAHRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  264  HAGHVEILRVARGLGDFLLVGIHNDQTVSARRGAHRPIMNLHERSLSVLACRYVDEVIIG  323

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV+KDMITTF+I LVVHGTVAE +DYQ+E  NPY VPISMGI +VLESPLDITT+TI
Sbjct  324  APWEVSKDMITTFNIFLVVHGTVAENTDYQEEKSNPYDVPISMGIFQVLESPLDITTTTI  383

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIV+NH+AY KRNEKK ESEKRYYEGK+++SGD
Sbjct  384  IRRIVANHEAYQKRNEKKAESEKRYYEGKTFVSGD  418


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 52/85 (61%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  + A +G   P+  LHER + V A ++VDEVI  
Sbjct  67   HYGHCNALRQARALGDELVVGVVSDAEIIANKGP--PVTPLHERMIMVNAVKWVDEVIPD  124

Query  182  APWEVT----KDMITTFDISLVVHG  244
            AP+ +T    K +   ++I  ++HG
Sbjct  125  APYAITEEFMKKLFEEYNIDYIIHG  149



>ref|XP_010036048.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase isoform 
X2 [Eucalyptus grandis]
Length=425

 Score =   258 bits (659),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR+AR LGDFLLVGIHTDQTVSA RGAHRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  271  HAGHVEILRVARGLGDFLLVGIHTDQTVSAKRGAHRPIMNLHERSLSVLACRYVDEVIIG  330

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV++DMITTFDISLVVHGT+AE +D+QK+  NPYAVPISMGI KVLESPLDITT+TI
Sbjct  331  APWEVSRDMITTFDISLVVHGTIAENNDFQKDEGNPYAVPISMGIFKVLESPLDITTTTI  390

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIV+NH+A+LKR+EKK  SEKRYYE K+Y++GD
Sbjct  391  IRRIVANHEAFLKRSEKKSASEKRYYEDKTYVTGD  425


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 49/85 (58%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  +   +G   P+  L ER + V A ++VDEVI  
Sbjct  72   HYGHCNALRQARALGDQLVVGVVSDAEIVVNKGP--PVTPLKERMIMVNAVKWVDEVIPD  129

Query  182  APWEVT----KDMITTFDISLVVHG  244
            AP+ +T    K +   + I  ++HG
Sbjct  130  APYAITEEFMKKLFDEYHIDYIIHG  154



>ref|XP_003552337.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
1 [Glycine max]
Length=420

 Score =   257 bits (657),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 132/153 (86%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILRLAR LGDFLLVGIHTDQTVSATRG+HRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  266  HAGHVEILRLARDLGDFLLVGIHTDQTVSATRGSHRPIMNLHERSLSVLACRYVDEVIIG  325

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWE++KDM+TTF+ISLVVHGT+AE +D+QKE  NPYAVPISMGI KVLESPLDITT+TI
Sbjct  326  APWEISKDMLTTFNISLVVHGTIAESNDFQKEECNPYAVPISMGIFKVLESPLDITTTTI  385

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYIS  460
            IRRIVSNH+AY  RN+KK ESEKRYYEGKS++S
Sbjct  386  IRRIVSNHEAYQNRNKKKGESEKRYYEGKSHVS  418


 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 51/85 (60%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  + A +G   P+  LHER + V A ++VDEVI  
Sbjct  63   HYGHCNALRQARALGDQLIVGVVSDAEIIANKGP--PVTPLHERLIMVNAVKWVDEVIPE  120

Query  182  APWEVT----KDMITTFDISLVVHG  244
            AP+ +T    K +   + I  ++HG
Sbjct  121  APYAITEEFMKKLFDEYKIDYIIHG  145



>ref|XP_006429675.1| hypothetical protein CICLE_v10011843mg [Citrus clementina]
 ref|XP_006481274.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Citrus 
sinensis]
 gb|ESR42915.1| hypothetical protein CICLE_v10011843mg [Citrus clementina]
Length=416

 Score =   257 bits (656),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR+AR LGDFLLVGIH DQTVSA RGAHRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  262  HAGHVEILRIARGLGDFLLVGIHNDQTVSAKRGAHRPIMNLHERSLSVLACRYVDEVIIG  321

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV+KDMITTF+ISLVVHGTVAE +D+QK+  NPYA+PISM I KVLESPLDITT+TI
Sbjct  322  APWEVSKDMITTFNISLVVHGTVAENNDFQKDDGNPYAIPISMDIFKVLESPLDITTTTI  381

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIVSNH+AY KRNEKK  SEKRYYEGK+++SGD
Sbjct  382  IRRIVSNHEAYQKRNEKKNASEKRYYEGKTFVSGD  416


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 53/85 (62%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  + A +G   P+  LHER + V A ++VDEVI  
Sbjct  64   HYGHCNALRQARALGDQLVVGVVSDAEIIANKGP--PVTPLHERMIMVNAVKWVDEVISD  121

Query  182  APWEVTKDMITT----FDISLVVHG  244
            AP+ +TKD +      ++I  ++HG
Sbjct  122  APYAITKDFMKKLFDEYNIDYIIHG  146



>gb|KEH23310.1| ethanolamine-phosphate cytidylyltransferase [Medicago truncatula]
Length=312

 Score =   253 bits (645),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILRLAR  GDFLLVGIHTDQTVSATRG HRPIM+LHERSLSVLACRYVDEVIIG
Sbjct  158  HAGHVEILRLARDRGDFLLVGIHTDQTVSATRGLHRPIMSLHERSLSVLACRYVDEVIIG  217

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV+KDMITTF+ISLVVHGT AE +D+QKE  NPYAVPIS+GI ++L+SPLDITT+TI
Sbjct  218  APWEVSKDMITTFNISLVVHGTTAENTDFQKEQSNPYAVPISLGIFQILDSPLDITTTTI  277

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIVSNH+AY KRNEKK ESEK+YYE K+++SGD
Sbjct  278  IRRIVSNHEAYQKRNEKKGESEKKYYESKTHVSGD  312



>ref|XP_010278899.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Nelumbo 
nucifera]
Length=418

 Score =   256 bits (653),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILRLAR LGDFLLVGIHTDQTVSA RG HRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  264  HAGHVEILRLARGLGDFLLVGIHTDQTVSANRGTHRPIMNLHERSLSVLACRYVDEVIIG  323

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV+KDMITTF+ISLVVHGTVAE +DYQK   NPY VPISMGI ++LESPLDITT+TI
Sbjct  324  APWEVSKDMITTFNISLVVHGTVAENNDYQKGKCNPYDVPISMGIFRLLESPLDITTTTI  383

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIVSNH+AY KRNEKK ESE+RYYE K+Y++GD
Sbjct  384  IRRIVSNHEAYQKRNEKKAESERRYYEDKTYVAGD  418


 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 53/85 (62%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  + A +G   P+  L+ER + V A ++VDE+I  
Sbjct  65   HYGHCNALRQARALGDQLVVGVVSDAEIIANKGP--PVTPLNERMIMVSAVKWVDEIIPD  122

Query  182  APWEVTKD----MITTFDISLVVHG  244
            AP+ +T+D    +   ++I  ++HG
Sbjct  123  APYAITEDFMNKLFNEYNIDYIIHG  147



>ref|XP_011018911.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Populus 
euphratica]
Length=428

 Score =   256 bits (654),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILRLAR+LGDFLLVGIH+DQ VSA RGAHRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  274  HAGHVEILRLARTLGDFLLVGIHSDQIVSAKRGAHRPIMNLHERSLSVLACRYVDEVIIG  333

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWE++KDMITTF+IS VVHGTVAE  D+QKE +NPYAVPISMGI K+L+SPLDITT+TI
Sbjct  334  APWEISKDMITTFNISSVVHGTVAENDDFQKEQDNPYAVPISMGIFKILDSPLDITTTTI  393

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIVSNH+AY KRN+KK ESEKRYYE K+Y++GD
Sbjct  394  IRRIVSNHEAYQKRNQKKGESEKRYYEDKTYVAGD  428


 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 52/85 (61%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  + A +G   P+  LHER + V A ++VDEVI  
Sbjct  75   HYGHCNALRQARALGDQLVVGVVSDAEIIANKGP--PVTPLHERMIMVNAVKWVDEVISD  132

Query  182  APWEVT----KDMITTFDISLVVHG  244
            AP+ +T    K +   ++I  ++HG
Sbjct  133  APYAITEEFMKKLFDEYNIDYIIHG  157



>emb|CBI31131.3| unnamed protein product [Vitis vinifera]
Length=362

 Score =   254 bits (648),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEIL+LAR LGDFLLVGIHTDQTVSA RGAHRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  208  HAGHVEILKLARGLGDFLLVGIHTDQTVSANRGAHRPIMNLHERSLSVLACRYVDEVIIG  267

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV+KDMITTF+ISLVVHGTVAEY+++ K  E+PYA+PIS+GI + LESPLDITT+TI
Sbjct  268  APWEVSKDMITTFNISLVVHGTVAEYNNFPKGKEDPYAIPISLGIYEQLESPLDITTTTI  327

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIVSNH+AY KRNEKK ESEKRYYE K+++SGD
Sbjct  328  IRRIVSNHEAYQKRNEKKAESEKRYYEDKTFVSGD  362


 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 53/85 (62%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  ++A +G   P+  L+ER + V   ++VDEVI  
Sbjct  9    HYGHCNALRQARALGDQLVVGVVSDAEITANKGP--PVTPLNERMIMVSGVKWVDEVIPD  66

Query  182  APWEVTKDMITT----FDISLVVHG  244
            AP+ +T+D +      ++I  ++HG
Sbjct  67   APYAITEDFMKKLFDEYNIDYIIHG  91



>ref|XP_002265169.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Vitis 
vinifera]
 emb|CAQ58612.1| Ethanolamine-phosphate cytidylyltransferase [Vitis vinifera]
Length=421

 Score =   254 bits (648),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEIL+LAR LGDFLLVGIHTDQTVSA RGAHRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  267  HAGHVEILKLARGLGDFLLVGIHTDQTVSANRGAHRPIMNLHERSLSVLACRYVDEVIIG  326

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV+KDMITTF+ISLVVHGTVAEY+++ K  E+PYA+PIS+GI + LESPLDITT+TI
Sbjct  327  APWEVSKDMITTFNISLVVHGTVAEYNNFPKGKEDPYAIPISLGIYEQLESPLDITTTTI  386

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIVSNH+AY KRNEKK ESEKRYYE K+++SGD
Sbjct  387  IRRIVSNHEAYQKRNEKKAESEKRYYEDKTFVSGD  421


 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 53/85 (62%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  ++A +G   P+  L+ER + V   ++VDEVI  
Sbjct  68   HYGHCNALRQARALGDQLVVGVVSDAEITANKGP--PVTPLNERMIMVSGVKWVDEVIPD  125

Query  182  APWEVTKDMITT----FDISLVVHG  244
            AP+ +T+D +      ++I  ++HG
Sbjct  126  APYAITEDFMKKLFDEYNIDYIIHG  150



>ref|XP_010684667.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Beta 
vulgaris subsp. vulgaris]
Length=422

 Score =   254 bits (648),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILRLAR LGDFLLVGIHTDQTVSA RG+HRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  268  HAGHVEILRLARELGDFLLVGIHTDQTVSAKRGSHRPIMNLHERSLSVLACRYVDEVIIG  327

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV+KD ITTF+ISLVVHGTVAE  D+Q+E +NPYAVPISMGI KV++SPLDITT+TI
Sbjct  328  APWEVSKDTITTFNISLVVHGTVAESDDFQQENDNPYAVPISMGIFKVIDSPLDITTTTI  387

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIV+NH+AY KRNEKK  SE++YYE K+Y+SGD
Sbjct  388  IRRIVANHEAYQKRNEKKATSERKYYEEKTYVSGD  422


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 54/85 (64%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D+ ++A +G   P+  LHER   V A ++VDEVI  
Sbjct  69   HYGHCNALRQARALGDQLVVGVVSDKEITANKGP--PVTPLHERMTMVQAVKWVDEVIPD  126

Query  182  APWEVTKDMITT----FDISLVVHG  244
            AP+ +T+D +      ++I  ++HG
Sbjct  127  APYAITEDFMKKLFDEYNIDYIIHG  151



>emb|CAQ58636.1| Ethanolamine-phosphate cytidylyltransferase [Vitis vinifera]
Length=424

 Score =   253 bits (647),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEIL+LAR LGDFLLVGIHTDQTVSA RGAHRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  270  HAGHVEILKLARGLGDFLLVGIHTDQTVSANRGAHRPIMNLHERSLSVLACRYVDEVIIG  329

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV+KDMITTF+ISLVVHGTVAEY+++ K  E+PYA+PIS+GI + LESPLDITT+TI
Sbjct  330  APWEVSKDMITTFNISLVVHGTVAEYNNFPKGKEDPYAIPISLGIYEQLESPLDITTTTI  389

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIVSNH+AY KRNEKK ESEKRYYE K+++SGD
Sbjct  390  IRRIVSNHEAYQKRNEKKAESEKRYYEDKTFVSGD  424


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 53/85 (62%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  ++A +G   P+  L+ER + V   ++VDEVI  
Sbjct  68   HYGHCNALRQARALGDQLVVGVVSDAEITANKGP--PVTPLNERMIMVSGVKWVDEVIPD  125

Query  182  APWEVTKDMITT----FDISLVVHG  244
            AP+ +T+D +      ++I  ++HG
Sbjct  126  APYAITEDFMKKLFDEYNIDYIIHG  150



>ref|XP_003533643.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Glycine max]
Length=415

 Score =   253 bits (645),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILRLAR LGDFLLVGIHTDQTVSATRG+HRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  261  HAGHVEILRLARDLGDFLLVGIHTDQTVSATRGSHRPIMNLHERSLSVLACRYVDEVIIG  320

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWE++KDM+TTF+ISLVVHGT+AE +D++KE  NPYAVPISMGI KVLES LDITT+TI
Sbjct  321  APWEISKDMLTTFNISLVVHGTIAESNDFKKEECNPYAVPISMGIFKVLESTLDITTTTI  380

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYIS  460
            IRRIVSNH+AY  RN+KK ESEKRYYEGKS++S
Sbjct  381  IRRIVSNHEAYQNRNKKKDESEKRYYEGKSHVS  413


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 51/85 (60%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  + A +G   P+  LHER + V A ++VDEVI  
Sbjct  58   HYGHCNALRQARALGDQLIVGVVSDAEIIANKGP--PVTPLHERLVMVNAVKWVDEVIPE  115

Query  182  APWEVT----KDMITTFDISLVVHG  244
            AP+ +T    K +   + I  ++HG
Sbjct  116  APYAITEEFMKKLFDEYKIDFIIHG  140



>ref|XP_008244222.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Prunus 
mume]
Length=428

 Score =   253 bits (646),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR+AR LGDFLLVGIHTDQTVSA RGAHRPIMNLHERSLSVLACR+VDEVIIG
Sbjct  274  HAGHVEILRIARELGDFLLVGIHTDQTVSAHRGAHRPIMNLHERSLSVLACRHVDEVIIG  333

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWE++KDMITTF+ISLVVHGTVAE +++QKE  NPY VPISMGI KVL SPLDITTSTI
Sbjct  334  APWEISKDMITTFNISLVVHGTVAENNNFQKEQGNPYEVPISMGIFKVLNSPLDITTSTI  393

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIVSNH+AY  RNEKK  SEK+YYEGKSY++GD
Sbjct  394  IRRIVSNHEAYQIRNEKKAASEKKYYEGKSYVTGD  428


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 51/85 (60%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  + A +G   P+  L ER + V A ++VDEVI  
Sbjct  75   HYGHCNALRQARALGDQLVVGVVSDAEIIANKGP--PVTPLDERMIMVNAVKWVDEVIPD  132

Query  182  APWEVT----KDMITTFDISLVVHG  244
            AP+ +T    K +   ++I  ++HG
Sbjct  133  APYAITEEFMKKLFDEYNIDYIIHG  157



>ref|XP_007207330.1| hypothetical protein PRUPE_ppa006076mg [Prunus persica]
 gb|EMJ08529.1| hypothetical protein PRUPE_ppa006076mg [Prunus persica]
Length=428

 Score =   253 bits (645),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR+AR LGDFLLVGIHTDQTVSA RGAHRPIMNLHERSLSVLACR+VDEVIIG
Sbjct  274  HAGHVEILRIARELGDFLLVGIHTDQTVSAHRGAHRPIMNLHERSLSVLACRHVDEVIIG  333

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWE++KD+ITTF+ISLVVHGTVAE +++QKE  NPY VPISMGI KVL+SPLDITTSTI
Sbjct  334  APWEISKDVITTFNISLVVHGTVAENNNFQKEQGNPYEVPISMGIFKVLDSPLDITTSTI  393

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIVSNH+AY  RNEKK  SEK+YYEGKSY+SGD
Sbjct  394  IRRIVSNHEAYQIRNEKKAASEKKYYEGKSYVSGD  428


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 50/85 (59%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  +   +G   P+  L ER + V A ++VDEVI  
Sbjct  75   HYGHCNALRQARALGDQLVVGVVSDAEIIVNKGP--PVTPLDERMIMVNAVKWVDEVIPD  132

Query  182  APWEVT----KDMITTFDISLVVHG  244
            AP+ +T    K +   ++I  ++HG
Sbjct  133  APYAITEEFMKKLFDEYNIDYIIHG  157



>ref|XP_004302493.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=428

 Score =   252 bits (644),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR+AR LGDFLLVGIHTDQTVSA RGAHRPIMNLHERSLSVL CRYVDEVIIG
Sbjct  274  HAGHVEILRVARELGDFLLVGIHTDQTVSANRGAHRPIMNLHERSLSVLGCRYVDEVIIG  333

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWE+TKD+ITTF+ISLVVHGTVAE ++++KE  NPY VPISMGI KVL SPLDITTSTI
Sbjct  334  APWEITKDVITTFNISLVVHGTVAENNNFEKETGNPYEVPISMGIFKVLASPLDITTSTI  393

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIVSNH+AY KRN+KK  SE++YYEGKSY++GD
Sbjct  394  IRRIVSNHEAYQKRNDKKAASEQKYYEGKSYVTGD  428


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 51/85 (60%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  +   +G   P+  L+ER + V A ++VDEVI  
Sbjct  75   HYGHCNALRQARALGDQLVVGVVSDAEIIVNKGP--PVTPLNERMIMVKAVKWVDEVIPD  132

Query  182  APWEVT----KDMITTFDISLVVHG  244
            AP+ +T    K +   +DI  ++HG
Sbjct  133  APYAITEEFMKKLFDEYDIDYIIHG  157



>ref|XP_009384337.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Musa 
acuminata subsp. malaccensis]
Length=421

 Score =   252 bits (643),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVE+LRLAR LGDFLLVGIHTDQT+SAT+G HRPIMNLHERSLSVLACRY DEVIIG
Sbjct  267  HAGHVEVLRLARELGDFLLVGIHTDQTISATQGPHRPIMNLHERSLSVLACRYADEVIIG  326

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV+KDMITTF+ISLVVHGTVAEY D+ KE  NPYAVP++MGI K L SPLDITTSTI
Sbjct  327  APWEVSKDMITTFNISLVVHGTVAEYMDFSKEESNPYAVPMAMGIYKQLNSPLDITTSTI  386

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            I+RIVSNH+AY KRNEKK  SEKRYYE K+Y+SGD
Sbjct  387  IKRIVSNHEAYQKRNEKKEASEKRYYETKTYVSGD  421


 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 56/85 (66%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A++LGD L+VG+ +D  ++A +G   P++ LHER L V A ++VDEVI  
Sbjct  68   HYGHCNALRQAQALGDQLVVGVVSDDEITANKGP--PVIPLHERMLMVGAVKWVDEVIPD  125

Query  182  APWEVTKD----MITTFDISLVVHG  244
            AP+ +T++    + T ++I  ++HG
Sbjct  126  APYAITEEFMNKLFTEYNIDYIIHG  150



>ref|XP_004492610.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Cicer 
arietinum]
Length=418

 Score =   252 bits (643),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILRLAR  GDFLLVGIHTDQTVSATRG HRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  264  HAGHVEILRLARDRGDFLLVGIHTDQTVSATRGLHRPIMNLHERSLSVLACRYVDEVIIG  323

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV++DMITTF+ISLVVHGT AE +D+QKE  NPYAVPISMGI ++L+S LDITT+TI
Sbjct  324  APWEVSRDMITTFNISLVVHGTTAENTDFQKEQSNPYAVPISMGIFQILDSSLDITTTTI  383

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIVSNH+AY KRNEKK ESEK YYEGK++++GD
Sbjct  384  IRRIVSNHEAYQKRNEKKGESEKNYYEGKTHVTGD  418


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 52/85 (61%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  + A +G   P+  LHER + V A ++VDEVI  
Sbjct  65   HYGHCNALRQARALGDQLIVGVVSDAEIIANKGP--PVTPLHERLIMVNAVKWVDEVIPE  122

Query  182  APWEVT----KDMITTFDISLVVHG  244
            AP+ +T    K +   ++I  ++HG
Sbjct  123  APYAITEEFMKKLFDEYNIDYIIHG  147



>gb|AFK43034.1| unknown [Medicago truncatula]
Length=422

 Score =   252 bits (643),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILRLAR  GDFLLVGIHTDQTVSATRG HRPIM+LHERSLSVLACRYVDEVIIG
Sbjct  268  HAGHVEILRLARDRGDFLLVGIHTDQTVSATRGLHRPIMSLHERSLSVLACRYVDEVIIG  327

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV+KDMITTF+ISLVVHGT AE +D+QKE  NPYAVPIS+GI ++L+SPLDITT+TI
Sbjct  328  APWEVSKDMITTFNISLVVHGTTAENTDFQKEQSNPYAVPISLGIFQILDSPLDITTTTI  387

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIVSNH+AY KRNEKK ESEK+YYE K+++SGD
Sbjct  388  IRRIVSNHEAYQKRNEKKGESEKKYYESKTHVSGD  422


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 52/85 (61%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  + A +G   P+  LHER + V A ++VDEVI  
Sbjct  67   HYGHCNALRQARALGDQLIVGVVSDDEIIANKGP--PVTPLHERLIMVNAVKWVDEVIPE  124

Query  182  APWEVT----KDMITTFDISLVVHG  244
            AP+ +T    K +   ++I  ++HG
Sbjct  125  APYTITEEFMKKLFDEYNIDYIIHG  149



>ref|XP_003623695.1| Ethanolamine-phosphate cytidylyltransferase [Medicago truncatula]
Length=419

 Score =   252 bits (643),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILRLAR  GDFLLVGIHTDQTVSATRG HRPIM+LHERSLSVLACRYVDEVIIG
Sbjct  265  HAGHVEILRLARDRGDFLLVGIHTDQTVSATRGLHRPIMSLHERSLSVLACRYVDEVIIG  324

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV+KDMITTF+ISLVVHGT AE +D+QKE  NPYAVPIS+GI ++L+SPLDITT+TI
Sbjct  325  APWEVSKDMITTFNISLVVHGTTAENTDFQKEQSNPYAVPISLGIFQILDSPLDITTTTI  384

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIVSNH+AY KRNEKK ESEK+YYE K+++SGD
Sbjct  385  IRRIVSNHEAYQKRNEKKGESEKKYYESKTHVSGD  419


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 52/85 (61%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  + A +G   P+  LHER + V A ++VDEVI  
Sbjct  64   HYGHCNALRQARALGDQLIVGVVSDDEIIANKGP--PVTPLHERLIMVNAVKWVDEVIPE  121

Query  182  APWEVT----KDMITTFDISLVVHG  244
            AP+ +T    K +   ++I  ++HG
Sbjct  122  APYAITEEFMKKLFDEYNIDYIIHG  146



>gb|AES79913.2| ethanolamine-phosphate cytidylyltransferase [Medicago truncatula]
Length=422

 Score =   252 bits (643),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILRLAR  GDFLLVGIHTDQTVSATRG HRPIM+LHERSLSVLACRYVDEVIIG
Sbjct  268  HAGHVEILRLARDRGDFLLVGIHTDQTVSATRGLHRPIMSLHERSLSVLACRYVDEVIIG  327

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV+KDMITTF+ISLVVHGT AE +D+QKE  NPYAVPIS+GI ++L+SPLDITT+TI
Sbjct  328  APWEVSKDMITTFNISLVVHGTTAENTDFQKEQSNPYAVPISLGIFQILDSPLDITTTTI  387

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIVSNH+AY KRNEKK ESEK+YYE K+++SGD
Sbjct  388  IRRIVSNHEAYQKRNEKKGESEKKYYESKTHVSGD  422


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 52/85 (61%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  + A +G   P+  LHER + V A ++VDEVI  
Sbjct  67   HYGHCNALRQARALGDQLIVGVVSDDEIIANKGP--PVTPLHERLIMVNAVKWVDEVIPE  124

Query  182  APWEVT----KDMITTFDISLVVHG  244
            AP+ +T    K +   ++I  ++HG
Sbjct  125  APYAITEEFMKKLFDEYNIDYIIHG  149



>ref|XP_009370855.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Pyrus 
x bretschneideri]
Length=428

 Score =   251 bits (642),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVGIHTDQTVSA RGAHRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  274  HAGHVEILRKARELGDFLLVGIHTDQTVSANRGAHRPIMNLHERSLSVLACRYVDEVIIG  333

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            +PWE++KDM+TTF+ISLVVHGTVAE S+++KE  NPY VPIS+GI KVL+S LDITTSTI
Sbjct  334  SPWEISKDMLTTFNISLVVHGTVAENSNFEKEEGNPYEVPISLGIFKVLDSSLDITTSTI  393

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIVSNH+AY KRNEKK  SEKRYYEGK+Y+SGD
Sbjct  394  IRRIVSNHEAYQKRNEKKAASEKRYYEGKAYVSGD  428


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 51/85 (60%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  +   +G   P+  L+ER + V A ++VDEVI  
Sbjct  75   HYGHCNALRQARALGDQLVVGVVSDAEIIVNKGP--PVTPLNERMIMVNAVKWVDEVIPD  132

Query  182  APWEVT----KDMITTFDISLVVHG  244
            AP+ +T    K +   ++I  ++HG
Sbjct  133  APYAITEEFMKKLFDEYNIDYIIHG  157



>ref|XP_010529959.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Tarenaya hassleriana]
Length=422

 Score =   251 bits (641),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR+AR LGDFLLVGIH DQT+SA RGAHRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  268  HAGHVEILRVARELGDFLLVGIHNDQTISAKRGAHRPIMNLHERSLSVLACRYVDEVIIG  327

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV+KDMITTF+ISLVVHGTVAE SD+ KE +NPYAVPISMGI  +LESPLD+TTSTI
Sbjct  328  APWEVSKDMITTFNISLVVHGTVAESSDFLKEKDNPYAVPISMGIFTILESPLDLTTSTI  387

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            I+RIV+NH+AY KRN KK  SEKRYYE K+Y++GD
Sbjct  388  IKRIVANHEAYQKRNMKKEASEKRYYEEKTYVTGD  422


 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 53/85 (62%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D+ + A +G   P+  LHER + V A ++VDEVI  
Sbjct  69   HYGHCNALRQARALGDQLVVGVVSDEEIIANKGP--PVTPLHERMIMVKAVKWVDEVIPD  126

Query  182  APWEVTKD----MITTFDISLVVHG  244
            AP+ +T+D    +   + I  ++HG
Sbjct  127  APYAITEDFMKRLFVEYQIDYIIHG  151



>ref|XP_009143367.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Brassica 
rapa]
Length=420

 Score =   251 bits (641),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVGIH DQTVSA RGAHRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  266  HAGHVEILRRARELGDFLLVGIHNDQTVSAKRGAHRPIMNLHERSLSVLACRYVDEVIIG  325

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV+KD ITTFDISLVVHGTVAE  D+Q+E ENPYAVPISMGI +VLESPLDITTSTI
Sbjct  326  APWEVSKDTITTFDISLVVHGTVAESDDFQREEENPYAVPISMGIFQVLESPLDITTSTI  385

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIV+NH+AY KRN KK  SEK+YYE K+++SGD
Sbjct  386  IRRIVANHEAYQKRNLKKEASEKKYYEQKAFVSGD  420


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 51/85 (60%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR LGD L+VG+ +D+ + A +G   P+  LHER + V A ++VDEVI  
Sbjct  66   HYGHCNALRQARVLGDQLVVGVVSDEEIIANKGP--PVTPLHERMIMVKAVKWVDEVISD  123

Query  182  APWEVT----KDMITTFDISLVVHG  244
            AP+ +T    K +   + I  ++HG
Sbjct  124  APYAITEEFMKKLFDEYQIDYIIHG  148



>ref|XP_008370315.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Malus 
domestica]
Length=428

 Score =   251 bits (641),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  274  HAGHVEILRKARELGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  333

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            +PWE++KDM+TTF+ISLVVHGT+AE S+++KE  NPY VPIS+GI KVL+S LDITTSTI
Sbjct  334  SPWEISKDMLTTFNISLVVHGTIAENSNFEKEEGNPYQVPISLGIFKVLDSSLDITTSTI  393

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIVSNH+AY KRN KK  SEKRYYEGK+Y+SGD
Sbjct  394  IRRIVSNHEAYQKRNXKKAASEKRYYEGKAYVSGD  428


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 51/85 (60%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  +   +G   P+  L+ER + V A ++VDEVI  
Sbjct  75   HYGHCNALRQARALGDQLVVGVVSDAEIIVNKGP--PVTPLNERMIMVNAVKWVDEVIPD  132

Query  182  APWEVT----KDMITTFDISLVVHG  244
            AP+ +T    K +   ++I  ++HG
Sbjct  133  APYAITEEFMKKLFDEYNIDYIIHG  157



>ref|XP_006293474.1| hypothetical protein CARUB_v10023288mg [Capsella rubella]
 gb|EOA26372.1| hypothetical protein CARUB_v10023288mg [Capsella rubella]
Length=420

 Score =   251 bits (640),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVGIH DQTVSA RG HRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  266  HAGHVEILRRARELGDFLLVGIHNDQTVSAKRGTHRPIMNLHERSLSVLACRYVDEVIIG  325

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV+KD ITTFDISLVVHGTVAE  D+QKE +NPYAVPISMGI ++LESPLDITTSTI
Sbjct  326  APWEVSKDTITTFDISLVVHGTVAESDDFQKEEDNPYAVPISMGIFQILESPLDITTSTI  385

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIV+NH+AY KRN KK  SEK+YYE KS++SGD
Sbjct  386  IRRIVANHEAYQKRNAKKEASEKKYYEQKSFVSGD  420


 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 52/85 (61%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D+ + A +G   P+  LHER   V A ++VDEVI  
Sbjct  67   HYGHCNALRQARALGDQLVVGVVSDEEIIANKGP--PVTPLHERMTMVKAVKWVDEVISD  124

Query  182  APWEVT----KDMITTFDISLVVHG  244
            AP+ +T    K +   +DI  ++HG
Sbjct  125  APYAITEEFMKKLFDEYDIDYIIHG  149



>ref|XP_008788034.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Phoenix 
dactylifera]
Length=417

 Score =   250 bits (639),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR+AR LGDFLLVGIHTDQT+SATRGAHRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  263  HAGHVEILRIARGLGDFLLVGIHTDQTISATRGAHRPIMNLHERSLSVLACRYVDEVIIG  322

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV+KDMITTF+ISLVVHGT AE  D+ KE  NPYAVP++MGI + +ESPLDI T+TI
Sbjct  323  APWEVSKDMITTFNISLVVHGTFAENMDFLKEKSNPYAVPMAMGIYRQIESPLDIRTTTI  382

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            I+RIVSNH+AY KRNE+K  SE+RYYEGK+++SGD
Sbjct  383  IKRIVSNHEAYQKRNEQKEASERRYYEGKTHVSGD  417


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 53/85 (62%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  ++A +G   P+  L ER + V A ++VDEVI  
Sbjct  64   HYGHCNALRQARALGDQLVVGVVSDDEITANKGP--PVTPLRERMIMVGAVKWVDEVIPD  121

Query  182  APWEVT----KDMITTFDISLVVHG  244
            AP+ +T    K + T ++I  ++HG
Sbjct  122  APYAITEEFMKKLFTEYNIDYIIHG  146



>ref|XP_009337844.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Pyrus 
x bretschneideri]
Length=428

 Score =   251 bits (640),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVGIHTDQTVSA RGAHRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  274  HAGHVEILRKARELGDFLLVGIHTDQTVSANRGAHRPIMNLHERSLSVLACRYVDEVIIG  333

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APW ++KDM+TTF+ISLVVHGTVAE S+++KE  NPY VPI++GI KVLESPLDITTSTI
Sbjct  334  APWVISKDMLTTFNISLVVHGTVAENSNFEKEEGNPYEVPINLGIFKVLESPLDITTSTI  393

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIVSNH+AY KRNEKK  SEKRYYE K Y+SGD
Sbjct  394  IRRIVSNHEAYQKRNEKKAASEKRYYESKGYVSGD  428


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 51/85 (60%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  +   +G   P+  L+ER + V A ++VDEVI  
Sbjct  75   HYGHCNALRQARALGDQLVVGVVSDAEIIVNKGP--PVTPLNERMIMVNAVKWVDEVIPD  132

Query  182  APWEVT----KDMITTFDISLVVHG  244
            AP+ +T    K +   ++I  ++HG
Sbjct  133  APYAITEEFMKKLFDEYNIDYIIHG  157



>ref|XP_008804653.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Phoenix 
dactylifera]
Length=414

 Score =   250 bits (638),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR+AR LGDFLLVGIHTDQT+S+TRGAHRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  260  HAGHVEILRIARGLGDFLLVGIHTDQTISSTRGAHRPIMNLHERSLSVLACRYVDEVIIG  319

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APW+V+KDMITTF+IS+VVHGT+AE  D+ KE  NPYAVP++MGI   +ESPLDITTSTI
Sbjct  320  APWQVSKDMITTFNISMVVHGTIAENMDFLKEKSNPYAVPMAMGIYLQIESPLDITTSTI  379

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIVSNH+AY KRNEKK  SE+RYYEGK+Y+SGD
Sbjct  380  IRRIVSNHEAYQKRNEKKEASERRYYEGKTYVSGD  414


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 55/85 (65%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  ++A +G   P+  LHER + V A ++VDEVI  
Sbjct  61   HYGHCNALRQARALGDELVVGVVSDDEITANKGP--PVTPLHERMIMVGAVKWVDEVIPN  118

Query  182  APWEVTKD----MITTFDISLVVHG  244
            AP+ +T++    + T ++I  ++HG
Sbjct  119  APYAITEEFMNKLFTEYNIDYIIHG  143



>ref|XP_004137664.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Cucumis 
sativus]
 gb|KGN58672.1| hypothetical protein Csa_3G727900 [Cucumis sativus]
Length=431

 Score =   250 bits (639),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEIL+ ARS+GDFLLVGIHTD TVSA RGAHRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  277  HAGHVEILKHARSMGDFLLVGIHTDLTVSANRGAHRPIMNLHERSLSVLACRYVDEVIIG  336

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV+KDMITTF+ISLVVHGTVAE +D+QK   NPYAVPISMGI K+L+SPLDITT+TI
Sbjct  337  APWEVSKDMITTFNISLVVHGTVAEINDFQKRDCNPYAVPISMGIFKILDSPLDITTTTI  396

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIVSNH+AY KRNEKK  SE+RYYE K+YI GD
Sbjct  397  IRRIVSNHEAYQKRNEKKANSERRYYEDKAYILGD  431


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 53/85 (62%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  + A +G   P+  L+ER + V A ++VDEVI  
Sbjct  78   HYGHCNALRQARALGDQLVVGVVSDSEIIANKGP--PVTPLNERMIMVNAVKWVDEVIPN  135

Query  182  APWEVTKD-MITTFD---ISLVVHG  244
            AP+ +T++ M   FD   I  ++HG
Sbjct  136  APYAITEEFMRKLFDEYKIDYIIHG  160



>ref|XP_010931423.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Elaeis 
guineensis]
Length=421

 Score =   249 bits (636),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR+AR LGDFLLVGIHTDQT+S TRGAHRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  267  HAGHVEILRIARGLGDFLLVGIHTDQTISTTRGAHRPIMNLHERSLSVLACRYVDEVIIG  326

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV+KDMITTF+ISLVVHGT+AE  D+ KE  NPYAVP++MGI + +ESPLDITTSTI
Sbjct  327  APWEVSKDMITTFNISLVVHGTIAENMDFLKEKSNPYAVPMAMGIYRQIESPLDITTSTI  386

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIVSNH+AY KRNEKK  SE+RYYEGK+Y+S D
Sbjct  387  IRRIVSNHEAYQKRNEKKEASERRYYEGKTYVSED  421


 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 55/85 (65%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  ++A +G   P+  LHER + V A ++VDEVI  
Sbjct  68   HYGHCNALRQARALGDELVVGVVSDDEITANKGP--PVTPLHERMIMVGAVKWVDEVIPD  125

Query  182  APWEVTKD----MITTFDISLVVHG  244
            AP+ +T++    + T ++I  ++HG
Sbjct  126  APYAITEEFMNKLFTEYNIDYIIHG  150



>ref|XP_010505515.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Camelina 
sativa]
Length=362

 Score =   247 bits (631),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVGIH DQTVSA RG HRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  208  HAGHVEILRRARELGDFLLVGIHNDQTVSAKRGTHRPIMNLHERSLSVLACRYVDEVIIG  267

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV++D ITTFDISLVVHGTVAE  D+QKE +NPYAVPISMGI ++LESPLDITTSTI
Sbjct  268  APWEVSRDTITTFDISLVVHGTVAESDDFQKEEDNPYAVPISMGIFEILESPLDITTSTI  327

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIV+NH+AY KRN KK  SEK+YYE KS++ GD
Sbjct  328  IRRIVANHEAYQKRNAKKEASEKKYYEQKSFVVGD  362


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 51/85 (60%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D+ + A +G   P+  LHER   V A ++VDEVI  
Sbjct  9    HYGHCNALRQARALGDQLVVGVVSDEEIIANKGP--PVTPLHERMTMVKAVKWVDEVISD  66

Query  182  APWEVT----KDMITTFDISLVVHG  244
            AP+ +T    K +   + I  ++HG
Sbjct  67   APYAITEEFMKKLFDEYQIDYIIHG  91



>gb|KFK36771.1| hypothetical protein AALP_AA4G168400 [Arabis alpina]
Length=419

 Score =   248 bits (634),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVGIH DQTVSA RGAHRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  265  HAGHVEILRQARELGDFLLVGIHNDQTVSAKRGAHRPIMNLHERSLSVLACRYVDEVIIG  324

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV++D ITTFDISLVVHGTVAE  D+QKE +NPY+VPISMGI ++LESPLDITTSTI
Sbjct  325  APWEVSRDTITTFDISLVVHGTVAESDDFQKEEDNPYSVPISMGIFQILESPLDITTSTI  384

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIV+NH+AY KRN KK  SEK+YYE KS+++GD
Sbjct  385  IRRIVANHEAYQKRNLKKEASEKKYYEQKSFVTGD  419


 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 54/85 (64%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D+ + A +G   P+  LHER + V A ++VDEVI  
Sbjct  65   HYGHCNALRQARALGDQLVVGVVSDEEIIANKGP--PVTPLHERMIMVKAVKWVDEVISD  122

Query  182  APWEVTKD-MITTFD---ISLVVHG  244
            AP+ +T+D M   FD   I  ++HG
Sbjct  123  APYAITEDFMKKLFDEYQIDYIIHG  147



>ref|XP_008358193.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Malus 
domestica]
Length=428

 Score =   248 bits (634),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVGIHTDQTVSA RGAHRPIMNLHERSLSVLACR+VDEVIIG
Sbjct  274  HAGHVEILRKARELGDFLLVGIHTDQTVSANRGAHRPIMNLHERSLSVLACRHVDEVIIG  333

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APW ++KDM+TTF+ISLVVHGTVAE S+++KE  NPY VPI++GI KVLESPLDITTSTI
Sbjct  334  APWVISKDMLTTFNISLVVHGTVAENSNFEKEEGNPYEVPINLGIFKVLESPLDITTSTI  393

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIVSNH+AY KRNEKK  SEKRYYE K Y+SGD
Sbjct  394  IRRIVSNHEAYQKRNEKKAASEKRYYESKGYVSGD  428


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 51/85 (60%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  +   +G   P+  L+ER + V A ++VDEVI  
Sbjct  75   HYGHCNALRQARALGDQLVVGVVSDAEIIVNKGP--PVTPLNERMIMVNAVKWVDEVIPD  132

Query  182  APWEVT----KDMITTFDISLVVHG  244
            AP+ +T    K +   ++I  ++HG
Sbjct  133  APYAITEEFMKKLFDEYNIDYIIHG  157



>ref|XP_009410481.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Musa 
acuminata subsp. malaccensis]
Length=421

 Score =   248 bits (633),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILRLAR LGDFLLVGIHTDQT+SATRGAHRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  267  HAGHVEILRLARGLGDFLLVGIHTDQTISATRGAHRPIMNLHERSLSVLACRYVDEVIIG  326

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            A WEV+KDMITTF+ISLVVHGTVAE  D+ KE  NPYAVP+ MGI K L+SPLDITTSTI
Sbjct  327  ATWEVSKDMITTFNISLVVHGTVAENMDFLKEESNPYAVPMDMGIYKQLKSPLDITTSTI  386

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            I+RIVSNH++Y KRNEKK  SE+RYYE KSY++GD
Sbjct  387  IKRIVSNHESYQKRNEKKEASERRYYENKSYVAGD  421


 Score = 70.5 bits (171),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 54/85 (64%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  ++A +G   P+  LHER + V A ++VDEVI  
Sbjct  68   HYGHCNALRQARALGDQLVVGVVSDDEITANKGP--PVTPLHERMIMVGAVKWVDEVIPD  125

Query  182  APWEVT----KDMITTFDISLVVHG  244
            AP+ +T    K + T ++I  ++HG
Sbjct  126  APYAITEKFMKKLFTEYNIDYIIHG  150



>ref|XP_009381352.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Musa 
acuminata subsp. malaccensis]
Length=419

 Score =   248 bits (633),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILRLAR LGDFLLVGIHTDQT+SATRGAHRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  265  HAGHVEILRLARELGDFLLVGIHTDQTISATRGAHRPIMNLHERSLSVLACRYVDEVIIG  324

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV+KDMITTF+ISLVVHGT+AE  D+ K+  NPYAVP++M I K LESPLDITTSTI
Sbjct  325  APWEVSKDMITTFNISLVVHGTIAENMDFLKKESNPYAVPMAMAIYKKLESPLDITTSTI  384

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            I+RIVSN++AY KRNEKK  SE+RYYE KS++SGD
Sbjct  385  IKRIVSNNEAYQKRNEKKEASERRYYENKSFVSGD  419


 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 55/85 (65%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  ++A +G   P+  LHER + V A ++VDEVI  
Sbjct  66   HYGHCNALRQARALGDQLVVGVVSDDEITANKGP--PVTPLHERMIMVGAVKWVDEVIPN  123

Query  182  APWEVTKD----MITTFDISLVVHG  244
            AP+ +T++    + T ++I  ++HG
Sbjct  124  APYAITEEFMNKLFTEYNIDYIIHG  148



>ref|XP_008442303.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase isoform 
X2 [Cucumis melo]
Length=430

 Score =   248 bits (634),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEIL+ ARS+GDFLLVGIHTD TVSA RGAHRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  276  HAGHVEILKHARSMGDFLLVGIHTDLTVSANRGAHRPIMNLHERSLSVLACRYVDEVIIG  335

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV+KDMITTF+ISLVVHGTVAE +D+QK   NPYAVPI+MGI K+L+SPLDITT+TI
Sbjct  336  APWEVSKDMITTFNISLVVHGTVAEVNDFQKRDCNPYAVPINMGIFKILDSPLDITTTTI  395

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIVSNH+AY KRNEKK  SE+RYYE K+Y+ GD
Sbjct  396  IRRIVSNHEAYQKRNEKKANSERRYYEDKAYVLGD  430


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  ++A +G   P+  L+ER + V A ++VDEVI  
Sbjct  77   HYGHCNALRQARALGDQLVVGVVSDSEITANKGP--PVTPLNERMIMVNAVKWVDEVIPN  134

Query  182  APWEVTKD-MITTFD---ISLVVHG  244
            AP+ +T+D M   FD   I  ++HG
Sbjct  135  APYAITEDFMRKLFDEYKIDYIIHG  159



>ref|XP_010922838.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Elaeis 
guineensis]
Length=421

 Score =   248 bits (633),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR+AR LGDFLLVGIHTDQT+S+TRGAHRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  267  HAGHVEILRIARELGDFLLVGIHTDQTISSTRGAHRPIMNLHERSLSVLACRYVDEVIIG  326

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APW+V+KDMITTF+IS+VVHGT+AE  D+ KE  NPYAVP+ MGI   +ESPLDITTSTI
Sbjct  327  APWQVSKDMITTFNISMVVHGTIAENMDFLKEKSNPYAVPMDMGIYWQIESPLDITTSTI  386

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            I+RIVSNH+AY KRN+KK  SE+RYYEGK+Y+SGD
Sbjct  387  IKRIVSNHEAYQKRNDKKEASERRYYEGKTYVSGD  421


 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 54/85 (64%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A++LGD L+VG+ +D  ++A +G   P+  LHER + V A ++VDEVI  
Sbjct  68   HYGHCNALRQAQALGDELVVGVVSDDEITANKGP--PVTPLHERMIMVGAVKWVDEVIPN  125

Query  182  APWEVT----KDMITTFDISLVVHG  244
            AP+ +T    K + T ++I  ++HG
Sbjct  126  APYAITEEFMKKLFTEYNIDYIIHG  150



>ref|XP_006411085.1| hypothetical protein EUTSA_v10016709mg [Eutrema salsugineum]
 gb|ESQ52538.1| hypothetical protein EUTSA_v10016709mg [Eutrema salsugineum]
Length=423

 Score =   248 bits (632),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVGIH DQTVSA RGAHRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  269  HAGHVEILRRARELGDFLLVGIHNDQTVSAKRGAHRPIMNLHERSLSVLACRYVDEVIIG  328

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV++D ITTFDISLVVHGTVAE  D+QKE +NPYAVPISMGI ++LESPLDITTSTI
Sbjct  329  APWEVSRDTITTFDISLVVHGTVAESDDFQKEEDNPYAVPISMGIFQILESPLDITTSTI  388

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            I+RIV+NH+AY  RN+KK  SEK+YYE K+++SGD
Sbjct  389  IKRIVANHEAYQIRNKKKEASEKKYYEQKAFVSGD  423


 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 54/85 (64%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D+ + A +G   P+  LHER + V A ++VDEVI  
Sbjct  69   HYGHCNALRQARALGDQLVVGVVSDEEIIANKGP--PVTPLHERMIMVKAVKWVDEVIPD  126

Query  182  APWEVTKD-MITTFD---ISLVVHG  244
            AP+ +T+D M   FD   I  ++HG
Sbjct  127  APYAITEDFMKKLFDEYQIDYIIHG  151



>ref|NP_181401.1| ethanolamine-phosphate cytidylyltransferase [Arabidopsis thaliana]
 sp|Q9ZVI9.1|PECT1_ARATH RecName: Full=Ethanolamine-phosphate cytidylyltransferase; AltName: 
Full=CTP:phosphoethanolamine cytidylyltransferase; AltName: 
Full=Phosphorylethanolamine cytidylyltransferase 1 [Arabidopsis 
thaliana]
 gb|AAC67351.1| putative phospholipid cytidylyltransferase [Arabidopsis thaliana]
 gb|AAM12983.1| putative phospholipid cytidylyltransferase [Arabidopsis thaliana]
 gb|AAM91207.1| putative phospholipid cytidylyltransferase [Arabidopsis thaliana]
 gb|AEC09568.1| ethanolamine-phosphate cytidylyltransferase [Arabidopsis thaliana]
Length=421

 Score =   248 bits (632),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVGIH DQTVSA RGAHRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  267  HAGHVEILRRARELGDFLLVGIHNDQTVSAKRGAHRPIMNLHERSLSVLACRYVDEVIIG  326

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV++D ITTFDISLVVHGTVAE  D++KE +NPY+VPISMGI +VL+SPLDITTSTI
Sbjct  327  APWEVSRDTITTFDISLVVHGTVAESDDFRKEEDNPYSVPISMGIFQVLDSPLDITTSTI  386

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIV+NH+AY KRN KK  SEK+YYE KS++SGD
Sbjct  387  IRRIVANHEAYQKRNAKKEASEKKYYEQKSFVSGD  421


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 53/85 (62%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D+ + A +G   P+  LHER   V A ++VDEVI  
Sbjct  67   HYGHCNALRQARALGDQLVVGVVSDEEIIANKGP--PVTPLHERMTMVKAVKWVDEVISD  124

Query  182  APWEVTKD-MITTFD---ISLVVHG  244
            AP+ +T+D M   FD   I  ++HG
Sbjct  125  APYAITEDFMKKLFDEYQIDYIIHG  149



>ref|XP_002879759.1| hypothetical protein ARALYDRAFT_903103 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56018.1| hypothetical protein ARALYDRAFT_903103 [Arabidopsis lyrata subsp. 
lyrata]
Length=421

 Score =   247 bits (631),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVGIH DQTVSA RGAHRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  267  HAGHVEILRRARELGDFLLVGIHNDQTVSAKRGAHRPIMNLHERSLSVLACRYVDEVIIG  326

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV++D I TFDISLVVHGTVAE  D+QKE +NPY+VPISMGI +VL+SPLDITTSTI
Sbjct  327  APWEVSRDTIMTFDISLVVHGTVAESDDFQKEEDNPYSVPISMGIFQVLDSPLDITTSTI  386

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIV+NH+AY KRN KK  SEK+YYE KS++SGD
Sbjct  387  IRRIVANHEAYQKRNAKKEASEKKYYEQKSFVSGD  421


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 53/85 (62%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D+ + A +G   P+  LHER   V A ++VDEVI  
Sbjct  67   HYGHCNALRQARALGDQLVVGVVSDEEIIANKGP--PVTPLHERMTMVKAVKWVDEVISD  124

Query  182  APWEVTKD-MITTFD---ISLVVHG  244
            AP+ +T+D M   FD   I  ++HG
Sbjct  125  APYAITEDFMKKLFDEYQIDYIIHG  149



>ref|XP_010517175.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Camelina 
sativa]
Length=420

 Score =   247 bits (630),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVGIH DQTVSA RG HRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  266  HAGHVEILRRARELGDFLLVGIHNDQTVSAKRGTHRPIMNLHERSLSVLACRYVDEVIIG  325

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV++D ITTFDISLVVHGTVAE  D+QKE +NPYAVPISMGI ++LESPLDITTSTI
Sbjct  326  APWEVSRDTITTFDISLVVHGTVAESDDFQKEEDNPYAVPISMGIFEILESPLDITTSTI  385

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIV+NH+AY KRN KK  SEK+YYE KS++ GD
Sbjct  386  IRRIVANHEAYQKRNAKKEASEKKYYEQKSFVVGD  420


 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 51/85 (60%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D+ + A +G   P+  LHER   V A ++VDEVI  
Sbjct  67   HYGHCNALRQARALGDQLVVGVVSDEEIIANKGP--PVTPLHERMTMVKAVKWVDEVISD  124

Query  182  APWEVT----KDMITTFDISLVVHG  244
            AP+ +T    K +   + I  ++HG
Sbjct  125  APYAITEEFMKKLFDEYQIDYIIHG  149



>ref|XP_006663169.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Oryza 
brachyantha]
Length=188

 Score =   239 bits (609),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILRLAR LGDFLLVGIHTDQT+S+TRG HRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  34   HAGHVEILRLARELGDFLLVGIHTDQTISSTRGPHRPIMNLHERSLSVLACRYVDEVIIG  93

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APW+V+KDMITTF+ISLVVHGT+AE  D+ K+  NPYAVP +MGI   LESPLDITTSTI
Sbjct  94   APWDVSKDMITTFNISLVVHGTIAENMDFMKDDLNPYAVPRAMGIYCRLESPLDITTSTI  153

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIV+NH+AY KRNEKK  SEK+YY+ KS+++G+
Sbjct  154  IRRIVTNHEAYQKRNEKKEASEKKYYDSKSFVNGE  188



>emb|CDX74894.1| BnaA05g06400D [Brassica napus]
Length=430

 Score =   245 bits (626),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 142/165 (86%), Gaps = 10/165 (6%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVGIH DQTVSA RGAHRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  266  HAGHVEILRRARELGDFLLVGIHNDQTVSAKRGAHRPIMNLHERSLSVLACRYVDEVIIG  325

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV+KD ITTFDISLVVHGTVAE  D+Q+E ENPYAVPISMGI +VLESPLDITTSTI
Sbjct  326  APWEVSKDTITTFDISLVVHGTVAESDDFQREEENPYAVPISMGIFQVLESPLDITTSTI  385

Query  362  irriVSNHDAY----------LKRNEKKVESEKRYYEGKSYISGD  466
            IRRIV+NH+AY          LKRN KK  SEK+YYE K+++SGD
Sbjct  386  IRRIVANHEAYQASCYSCSFILKRNLKKEASEKKYYEQKAFVSGD  430


 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 51/85 (60%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR LGD L+VG+ +D+ + A +G   P+  LHER + V A ++VDEVI  
Sbjct  66   HYGHCNALRQARVLGDQLVVGVVSDEEIIANKGP--PVTPLHERMIMVKAVKWVDEVISD  123

Query  182  APWEVT----KDMITTFDISLVVHG  244
            AP+ +T    K +   + I  ++HG
Sbjct  124  APYAITEEFMKKLFDEYQIDYIIHG  148



>ref|XP_010509160.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Camelina 
sativa]
Length=420

 Score =   245 bits (625),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVGIH DQTVSA RG HRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  266  HAGHVEILRRARELGDFLLVGIHNDQTVSAKRGTHRPIMNLHERSLSVLACRYVDEVIIG  325

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV++D ITTFDISLVVHGTVAE  D++KE +NPYAVPISMGI ++LESPLDITTSTI
Sbjct  326  APWEVSRDTITTFDISLVVHGTVAESDDFRKEEDNPYAVPISMGIFEILESPLDITTSTI  385

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIV+NH+AY KRN KK  SEK+YYE KS++ GD
Sbjct  386  IRRIVANHEAYQKRNAKKEASEKKYYEQKSFVVGD  420


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 51/85 (60%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D+ + A +G   P+  LHER   V A ++VDEVI  
Sbjct  67   HYGHCNALRQARALGDQLVVGVVSDEEIIANKGP--PVTPLHERMTMVKAVKWVDEVISD  124

Query  182  APWEVT----KDMITTFDISLVVHG  244
            AP+ +T    K +   + I  ++HG
Sbjct  125  APYAITEEFMKKLFDEYQIDYIIHG  149



>ref|XP_006381291.1| hypothetical protein POPTR_0006s11470g [Populus trichocarpa]
 gb|ERP59088.1| hypothetical protein POPTR_0006s11470g [Populus trichocarpa]
Length=423

 Score =   244 bits (623),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 141/155 (91%), Gaps = 1/155 (1%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILRLAR+LGDFLLVGIH DQ VS    AHRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  270  HAGHVEILRLARTLGDFLLVGIHNDQIVSLII-AHRPIMNLHERSLSVLACRYVDEVIIG  328

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWE++KDMITTF+IS VVHGTVAE  D+QKE +NPYAVPISMGI KVL+SPLDITT+TI
Sbjct  329  APWEISKDMITTFNISSVVHGTVAENDDFQKEQDNPYAVPISMGIFKVLDSPLDITTTTI  388

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIVSNH+AY KRN+KK ESEKRYYE K+Y++GD
Sbjct  389  IRRIVSNHEAYQKRNQKKAESEKRYYEDKTYVAGD  423


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 52/85 (61%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  + A +G   P+  LHER + V A ++VDEVI  
Sbjct  71   HYGHCNALRQARALGDQLVVGVVSDAEIIANKGP--PVTPLHERMIMVNAVKWVDEVISD  128

Query  182  APWEVT----KDMITTFDISLVVHG  244
            AP+ +T    K +   ++I  ++HG
Sbjct  129  APYAITEEFMKKLFDEYNIDYIIHG  153



>ref|XP_004977412.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Setaria 
italica]
Length=425

 Score =   243 bits (619),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILRLAR LGDFLLVGIHTDQT+S+TRG HRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  271  HAGHVEILRLARELGDFLLVGIHTDQTISSTRGRHRPIMNLHERSLSVLACRYVDEVIIG  330

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APW+V+KDMITTF+ISLVVHGT+AE  D+ ++  NPYAVPI+MGI + LESPLDITTSTI
Sbjct  331  APWDVSKDMITTFNISLVVHGTIAENMDFMEDDSNPYAVPIAMGIYRRLESPLDITTSTI  390

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIV+NH+AY KRNEKK  SEK+YYE KS+++G+
Sbjct  391  IRRIVANHEAYQKRNEKKEASEKKYYESKSFVNGE  425


 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 54/85 (64%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  + A +G   P+  LHER + V A ++VD++I  
Sbjct  72   HYGHCNALRQARALGDELIVGVISDDEIKANKGP--PVTPLHERMIMVRAVKWVDDIIPD  129

Query  182  APWEVTKD----MITTFDISLVVHG  244
            AP+ +T++    + T ++I  ++HG
Sbjct  130  APYAITEEFMNKLFTEYNIDYIIHG  154



>gb|EMS66153.1| Ethanolamine-phosphate cytidylyltransferase [Triticum urartu]
Length=312

 Score =   239 bits (610),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILRLAR LGDFLLVGIHTDQT+S+TRG HRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  158  HAGHVEILRLARGLGDFLLVGIHTDQTISSTRGPHRPIMNLHERSLSVLACRYVDEVIIG  217

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APW+++KDMITTF+ISLVV GT+AE  D+ K+  +PYAVP+ MGI + LESPLDITTSTI
Sbjct  218  APWDISKDMITTFNISLVVQGTIAENMDFAKDESHPYAVPMDMGIFRRLESPLDITTSTI  277

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIVSNH+AY KRNEKK  SEK+YYE K++++G+
Sbjct  278  IRRIVSNHEAYQKRNEKKEASEKKYYESKNFVNGE  312



>gb|EYU26697.1| hypothetical protein MIMGU_mgv1a007403mg [Erythranthe guttata]
 gb|EYU26698.1| hypothetical protein MIMGU_mgv1a007403mg [Erythranthe guttata]
 gb|EYU26699.1| hypothetical protein MIMGU_mgv1a007403mg [Erythranthe guttata]
Length=409

 Score =   242 bits (618),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILRLAR LGDFLLVGIHTDQTVSA RGAHRPIMNLHERSLSVLAC+Y DEVIIG
Sbjct  255  HAGHVEILRLARGLGDFLLVGIHTDQTVSANRGAHRPIMNLHERSLSVLACQYADEVIIG  314

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            AP EV+KDMITTF+ISLVV GTVAE +D+QK+ +NPYA+PIS+GI K+LESPLDITTSTI
Sbjct  315  APREVSKDMITTFNISLVVQGTVAEDNDFQKDKQNPYAIPISLGIFKLLESPLDITTSTI  374

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRI+SNH+AY KRNE+K E E+RYYE K+++S D
Sbjct  375  IRRILSNHEAYQKRNERKAEGERRYYEDKTHVSDD  409


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 52/85 (61%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  ++  +G   P+  L ER + V A ++VDEVI  
Sbjct  56   HYGHCNALRQARALGDQLVVGVVSDAEITVNKGP--PVTPLKERMIMVSAVKWVDEVIPD  113

Query  182  APWEVTKD----MITTFDISLVVHG  244
            AP+ +T+D    +   ++I  ++HG
Sbjct  114  APYAITEDFMRKLFDEYNIDYIIHG  138



>ref|XP_002323699.2| hypothetical protein POPTR_0016s15020g [Populus trichocarpa]
 gb|EEF05460.2| hypothetical protein POPTR_0016s15020g [Populus trichocarpa]
Length=427

 Score =   242 bits (618),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEIL+LAR+LGDFLLVG+H D  VS+ RGAHRPIMNLHERSLSVLAC+YVDEVIIG
Sbjct  273  HAGHVEILKLARALGDFLLVGMHNDHIVSSKRGAHRPIMNLHERSLSVLACQYVDEVIIG  332

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV+KDMITTF+IS VVHGTVAE +D+ KE +NPY VPISMGI +VL+SPLDITT+TI
Sbjct  333  APWEVSKDMITTFNISSVVHGTVAENNDFLKEKDNPYVVPISMGIFQVLDSPLDITTTTI  392

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            I+RIVSNH+AY KRN+KK  SE+RYYE K+Y+SGD
Sbjct  393  IKRIVSNHEAYQKRNQKKAASERRYYEDKAYVSGD  427


 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 53/85 (62%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  + A +G   P+  +HER + V A ++VDEVI  
Sbjct  74   HYGHCNALRQARALGDQLVVGVVSDDEIIANKGP--PVTPVHERMIMVNAVKWVDEVISD  131

Query  182  APWEVTKDMITT----FDISLVVHG  244
            AP+ +T+D +      ++I  ++HG
Sbjct  132  APYAITEDFMKKLFDEYNIDYIIHG  156



>ref|XP_010553187.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Tarenaya 
hassleriana]
Length=421

 Score =   242 bits (617),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR+AR LGDFLLVGIH DQTV A RGAH PIMNLHERSLSVLACRYVDEVIIG
Sbjct  267  HAGHVEILRVARELGDFLLVGIHDDQTVRAERGAHHPIMNLHERSLSVLACRYVDEVIIG  326

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV+KDMITTF+ISLVVHGTVAE +D+ KE +NPYAVPI MGI ++L+SPLDITTSTI
Sbjct  327  APWEVSKDMITTFNISLVVHGTVAESNDFLKEKDNPYAVPIRMGIFRILKSPLDITTSTI  386

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            I+RIV+NH+AY KRN KK  SEKRYYE K+Y++GD
Sbjct  387  IKRIVANHEAYQKRNTKKEASEKRYYEEKTYMTGD  421


 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 53/85 (62%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D+ + A +G   P+  LHER + V A ++VDEVI  
Sbjct  68   HYGHCNALRQARALGDQLVVGVISDEEIIANKGP--PVTPLHERLIMVKAVKWVDEVIPD  125

Query  182  APWEVTKD----MITTFDISLVVHG  244
            AP+ +T+D    +   + I  ++HG
Sbjct  126  APYAITEDFMRRLFDEYQIDYIIHG  150



>ref|XP_006842638.1| hypothetical protein AMTR_s00077p00187820 [Amborella trichopoda]
 gb|ERN04313.1| hypothetical protein AMTR_s00077p00187820 [Amborella trichopoda]
Length=423

 Score =   242 bits (617),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR+AR LGDFLLVGIHTDQTVS  RGAHRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  269  HAGHVEILRVARELGDFLLVGIHTDQTVSTNRGAHRPIMNLHERSLSVLACRYVDEVIIG  328

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APW V+KDMITTF+ISLVVHGTVAE SD+ K  +NPYA PISMGI + +ESPLD+TT+TI
Sbjct  329  APWVVSKDMITTFNISLVVHGTVAENSDFWKVDDNPYAAPISMGIYREIESPLDVTTTTI  388

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIV+NH++Y KRNEKK ESE+RYYE K+Y+  D
Sbjct  389  IRRIVANHESYQKRNEKKAESERRYYEDKTYVCDD  423


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 51/85 (60%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  +   +G   P+  LHER + V A ++VDEVI  
Sbjct  67   HYGHCNALRQARALGDQLVVGVVSDAEIIVNKGP--PVTPLHERMIMVNAVKWVDEVISD  124

Query  182  APWEVTKD----MITTFDISLVVHG  244
            AP+ +T++    +   + I  ++HG
Sbjct  125  APYAITEEFMNKLFNEYQIDYIIHG  149



>ref|XP_008679350.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Zea 
mays]
 gb|AFW64659.1| hypothetical protein ZEAMMB73_095669 [Zea mays]
Length=422

 Score =   242 bits (617),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILRLAR LGDFLLVGIHTDQT+SATRG HRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  268  HAGHVEILRLARELGDFLLVGIHTDQTISATRGRHRPIMNLHERSLSVLACRYVDEVIIG  327

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APW+V+KDMITTF+ISLVVHGT+AE  D+ ++  +PYAVP++MGI + LESPLDITTSTI
Sbjct  328  APWDVSKDMITTFNISLVVHGTIAENMDFTEDDLHPYAVPMAMGIYRRLESPLDITTSTI  387

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIV+NH+AY KRNEKK  SEK+YYEGKS+++G+
Sbjct  388  IRRIVANHEAYQKRNEKKEASEKKYYEGKSFVNGE  422


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 53/85 (62%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  + A +G   P+  LHER + V A ++VD++I  
Sbjct  70   HYGHCNALRQARALGDELVVGVISDDEIKANKGP--PVTPLHERMVMVRAVKWVDDIIPD  127

Query  182  APWEVTKD----MITTFDISLVVHG  244
            AP+ +T++    +   ++I  ++HG
Sbjct  128  APYAITEEFMNKLFNEYNIDYIIHG  152



>gb|ABA91254.1| phosphoethanolamine cytidylyltransferase, putative, expressed 
[Oryza sativa Japonica Group]
Length=344

 Score =   239 bits (609),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILRLAR LGDFLLVGIHTDQT+S+TRG HRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  190  HAGHVEILRLARELGDFLLVGIHTDQTISSTRGPHRPIMNLHERSLSVLACRYVDEVIIG  249

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APW+V+KDMITTF+ISLVVHGT+AE  D+ K+  NPYAVP +MGI + LESPLDITTSTI
Sbjct  250  APWDVSKDMITTFNISLVVHGTIAENMDFMKDDLNPYAVPRAMGIYRRLESPLDITTSTI  309

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIV+NH+AY KRNEKK  SEK+YY+ KS+++G+
Sbjct  310  IRRIVANHEAYQKRNEKKEASEKKYYDSKSFVNGE  344


 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 53/85 (62%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  ++A +G   P+  LHER + V A ++V +VI  
Sbjct  71   HYGHCNALRQARALGDELIVGVVSDHEITANKGP--PVTPLHERLIMVRAVKWVHDVIPD  128

Query  182  APWEVTKD----MITTFDISLVVHG  244
            AP+ +T+D    +   ++I  ++HG
Sbjct  129  APYAITEDFMNKLFNEYNIDYIIHG  153



>gb|EMT02889.1| Ethanolamine-phosphate cytidylyltransferase [Aegilops tauschii]
Length=371

 Score =   239 bits (611),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILRLAR LGDFLLVGIHTDQT+S+TRG HRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  217  HAGHVEILRLARGLGDFLLVGIHTDQTISSTRGPHRPIMNLHERSLSVLACRYVDEVIIG  276

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APW+++KDMITTF+ISLVV GT+AE  D+ K+  +PYAVP+ MGI + LESPLDITTSTI
Sbjct  277  APWDISKDMITTFNISLVVQGTIAENMDFAKDESHPYAVPMDMGIFRRLESPLDITTSTI  336

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIVSNH+AY KRNEKK  SEK+YYE K++++G+
Sbjct  337  IRRIVSNHEAYQKRNEKKEASEKKYYESKNFVNGE  371



>gb|EEE51553.1| hypothetical protein OsJ_32765 [Oryza sativa Japonica Group]
Length=362

 Score =   239 bits (609),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILRLAR LGDFLLVGIHTDQT+S+TRG HRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  208  HAGHVEILRLARELGDFLLVGIHTDQTISSTRGPHRPIMNLHERSLSVLACRYVDEVIIG  267

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APW+V+KDMITTF+ISLVVHGT+AE  D+ K+  NPYAVP +MGI + LESPLDITTSTI
Sbjct  268  APWDVSKDMITTFNISLVVHGTIAENMDFMKDDLNPYAVPRAMGIYRRLESPLDITTSTI  327

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIV+NH+AY KRNEKK  SEK+YY+ KS+++G+
Sbjct  328  IRRIVANHEAYQKRNEKKEASEKKYYDSKSFVNGE  362


 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 53/85 (62%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  ++A +G   P+  LHER + V A ++V +VI  
Sbjct  9    HYGHCNALRQARALGDELIVGVVSDHEITANKGP--PVTPLHERLIMVRAVKWVHDVIPD  66

Query  182  APWEVTKD----MITTFDISLVVHG  244
            AP+ +T+D    +   ++I  ++HG
Sbjct  67   APYAITEDFMNKLFNEYNIDYIIHG  91



>ref|XP_003577861.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Brachypodium 
distachyon]
Length=425

 Score =   241 bits (614),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILRLAR LGDFLLVGIHTDQT+S+TRG HRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  271  HAGHVEILRLARELGDFLLVGIHTDQTISSTRGPHRPIMNLHERSLSVLACRYVDEVIIG  330

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APW+++KDMITTF+ISLVVHGT+AE  DY ++  NPYAVPI+MGI   L+SPLDITTSTI
Sbjct  331  APWDISKDMITTFNISLVVHGTIAENMDYTEDDSNPYAVPIAMGIYHKLDSPLDITTSTI  390

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIVSNH+AY KRNEKK  SEK+YY+ KS+++G+
Sbjct  391  IRRIVSNHEAYQKRNEKKEASEKKYYDSKSFVNGE  425


 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 53/85 (62%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  ++A +G   P+  LHER   V A ++VD+VI  
Sbjct  72   HYGHCNALRQARALGDELVVGVVSDDEITANKGP--PVTPLHERMKMVRAVKWVDDVIPD  129

Query  182  APWEVTKD----MITTFDISLVVHG  244
            AP+ +T+D    +   ++I  ++HG
Sbjct  130  APYAITEDFMNKLFNEYNIDYIIHG  154



>ref|XP_002450173.1| hypothetical protein SORBIDRAFT_05g001470 [Sorghum bicolor]
 gb|EES09161.1| hypothetical protein SORBIDRAFT_05g001470 [Sorghum bicolor]
Length=423

 Score =   240 bits (613),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILRLAR LGDFLLVGIHTDQT+S+TRG HRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  269  HAGHVEILRLARELGDFLLVGIHTDQTISSTRGRHRPIMNLHERSLSVLACRYVDEVIIG  328

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APW+V+KDMITTF+ISLVVHGT+AE  D+ ++  NPYAVP +MGI + LESPLDITTSTI
Sbjct  329  APWDVSKDMITTFNISLVVHGTIAENMDFAEDDSNPYAVPKAMGIYRRLESPLDITTSTI  388

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIV+NH+AY KRNEKK  SEK+YYE KS+++G+
Sbjct  389  IRRIVANHEAYQKRNEKKEASEKKYYESKSFVNGE  423


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 53/85 (62%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  + A +G   P+  LHER + V A ++VD++I  
Sbjct  71   HYGHCNALRQARALGDELVVGVISDDEIKANKGP--PVTPLHERMIMVRAVKWVDDIIPD  128

Query  182  APWEVTKD----MITTFDISLVVHG  244
            AP+ +T++    +   ++I  ++HG
Sbjct  129  APYAITEEFMNKLFNEYNIDYIIHG  153



>gb|AAO43227.1| phosphoethanolamine cytidylyltransferase [Hordeum vulgare subsp. 
vulgare]
Length=421

 Score =   240 bits (612),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILRLAR LGDFLLVGIHTDQT+S+TRG HRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  267  HAGHVEILRLARGLGDFLLVGIHTDQTISSTRGPHRPIMNLHERSLSVLACRYVDEVIIG  326

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APW ++KDM+TTF+ISLVVHGT+AE  DY ++  NPYAVP++MGI   LESPLDITTSTI
Sbjct  327  APWHISKDMVTTFNISLVVHGTIAENMDYTEDDSNPYAVPVAMGIYHKLESPLDITTSTI  386

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIVSNH+AY KRNEKK  SEK+YY+ KS+++G+
Sbjct  387  IRRIVSNHEAYQKRNEKKEASEKKYYDSKSFVNGE  421


 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 53/85 (62%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  ++A +G   P+  LHER   V A ++VD+VI  
Sbjct  68   HYGHCNALRQARALGDELVVGVVSDDEITANKGP--PVTPLHERMKMVRAVKWVDDVIPD  125

Query  182  APWEVTKD----MITTFDISLVVHG  244
            AP+ +T+D    +   ++I  ++HG
Sbjct  126  APYAITEDFMNKLFNEYNIDYIIHG  150



>dbj|BAK04174.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=421

 Score =   240 bits (612),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILRLAR LGDFLLVGIHTDQT+S+TRG HRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  267  HAGHVEILRLARGLGDFLLVGIHTDQTISSTRGPHRPIMNLHERSLSVLACRYVDEVIIG  326

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APW ++KDM+TTF+ISLVVHGT+AE  DY ++  NPYAVP++MGI   LESPLDITTSTI
Sbjct  327  APWHISKDMVTTFNISLVVHGTIAENMDYTEDDSNPYAVPVAMGIYHKLESPLDITTSTI  386

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIVSNH+AY KRNEKK  SEK+YY+ KS+++G+
Sbjct  387  IRRIVSNHEAYQKRNEKKEASEKKYYDSKSFVNGE  421


 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 53/85 (62%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  ++A +G   P+  LHER   V A ++VD+VI  
Sbjct  68   HYGHCNALRQARALGDELVVGVVSDDEITANKGP--PVTPLHERMKMVRAVKWVDDVIPD  125

Query  182  APWEVTKD----MITTFDISLVVHG  244
            AP+ +T+D    +   ++I  ++HG
Sbjct  126  APYAITEDFMNKLFNEYNIDYIIHG  150



>ref|XP_008442304.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase isoform 
X3 [Cucumis melo]
Length=376

 Score =   238 bits (608),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +2

Query  5    AGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIGA  184
             G++ IL+ ARS+GDFLLVGIHTD TVSA RGAHRPIMNLHERSLSVLACRYVDEVIIGA
Sbjct  223  GGYLSILKHARSMGDFLLVGIHTDLTVSANRGAHRPIMNLHERSLSVLACRYVDEVIIGA  282

Query  185  PWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittstii  364
            PWEV+KDMITTF+ISLVVHGTVAE +D+QK   NPYAVPI+MGI K+L+SPLDITT+TII
Sbjct  283  PWEVSKDMITTFNISLVVHGTVAEVNDFQKRDCNPYAVPINMGIFKILDSPLDITTTTII  342

Query  365  rriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            RRIVSNH+AY KRNEKK  SE+RYYE K+Y+ GD
Sbjct  343  RRIVSNHEAYQKRNEKKANSERRYYEDKAYVLGD  376



>gb|EEC67567.1| hypothetical protein OsI_34911 [Oryza sativa Indica Group]
Length=424

 Score =   239 bits (610),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILRLAR LGDFLLVGIHTDQT+S+TRG HRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  270  HAGHVEILRLARELGDFLLVGIHTDQTISSTRGPHRPIMNLHERSLSVLACRYVDEVIIG  329

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APW+V+KDMITTF+ISLVVHGT+AE  D+ K+  NPYAVP +MGI + LESPLDITTSTI
Sbjct  330  APWDVSKDMITTFNISLVVHGTIAENMDFMKDDLNPYAVPRAMGIYRRLESPLDITTSTI  389

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIV+NH+AY KRNEKK  SEK+YY+ KS+++G+
Sbjct  390  IRRIVANHEAYQKRNEKKEASEKKYYDSKSFVNGE  424


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 53/85 (62%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  ++A +G   P+  LHER + V A ++V +VI  
Sbjct  71   HYGHCNALRQARALGDELIVGVVSDDEITANKGP--PVTPLHERLIMVRAVKWVHDVIPD  128

Query  182  APWEVTKD----MITTFDISLVVHG  244
            AP+ +T+D    +   ++I  ++HG
Sbjct  129  APYAITEDFMNKLFNEYNIDYIIHG  153



>ref|NP_001066024.1| Os12g0121300 [Oryza sativa Japonica Group]
 gb|ABA95682.2| Cytidylyltransferase family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF29043.1| Os12g0121300 [Oryza sativa Japonica Group]
 dbj|BAG94236.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE52664.1| hypothetical protein OsJ_35038 [Oryza sativa Japonica Group]
Length=424

 Score =   239 bits (610),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILRLAR LGDFLLVGIHTDQT+S+TRG HRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  270  HAGHVEILRLARELGDFLLVGIHTDQTISSTRGPHRPIMNLHERSLSVLACRYVDEVIIG  329

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APW+V+KDMITTF+ISLVVHGT+AE  D+ K+  NPYAVP +MGI + LESPLDITTSTI
Sbjct  330  APWDVSKDMITTFNISLVVHGTIAENMDFMKDDLNPYAVPRAMGIYRRLESPLDITTSTI  389

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIV+NH+AY KRNEKK  SEK+YY+ KS+++G+
Sbjct  390  IRRIVANHEAYQKRNEKKEASEKKYYDSKSFVNGE  424


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 52/85 (61%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A +LGD L+VG+ +D  ++A +G   P+  LHER + V A ++V +VI  
Sbjct  71   HYGHCNALRQAHALGDELIVGVVSDDEITANKGP--PVTPLHERLIMVRAVKWVHDVIPD  128

Query  182  APWEVTKD----MITTFDISLVVHG  244
            AP+ +T+D    +   ++I  ++HG
Sbjct  129  APYAITEDFMNKLFNEYNIDYIIHG  153



>ref|NP_001170703.1| hypothetical protein [Zea mays]
 gb|ACR34556.1| unknown [Zea mays]
 tpg|DAA39300.1| TPA: hypothetical protein ZEAMMB73_839605 [Zea mays]
Length=424

 Score =   239 bits (610),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILRLAR LGDFLLVGIHTDQT+SATRG HRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  270  HAGHVEILRLARELGDFLLVGIHTDQTISATRGRHRPIMNLHERSLSVLACRYVDEVIIG  329

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APW+V+KDMITTF+ISLVVHGT+AE  D+ ++  +PYAVP++MGI + LESPLDITTSTI
Sbjct  330  APWDVSKDMITTFNISLVVHGTIAENMDFTEDDLHPYAVPMAMGIYRRLESPLDITTSTI  389

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIV+NH+AY KRNEKK  SEK+YYE KS+++G+
Sbjct  390  IRRIVANHEAYQKRNEKKEASEKKYYESKSFVNGE  424


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 53/85 (62%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  + A +G   P+  LHER + V A ++VD++I  
Sbjct  72   HYGHCNALRQARALGDELVVGVISDDEIKANKGP--PVTPLHERMIMVRAVKWVDDIIPD  129

Query  182  APWEVTKD----MITTFDISLVVHG  244
            AP+ +T++    +   ++I  ++HG
Sbjct  130  APYAITEEFMNKLFNEYNIDYIIHG  154



>ref|XP_004978492.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Setaria 
italica]
Length=425

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILRLAR LGDFLLVGIHTDQT+S+TRG HRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  271  HAGHVEILRLARELGDFLLVGIHTDQTISSTRGRHRPIMNLHERSLSVLACRYVDEVIIG  330

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APW+V+KDMITTF+IS VVHGT+AE  D+ ++  NPYAVPI+MGI   LESPLDITTSTI
Sbjct  331  APWDVSKDMITTFNISSVVHGTIAENMDFMEDDSNPYAVPIAMGIYCRLESPLDITTSTI  390

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIV+NH+AY KRNEKK  SEK+YYE KS+++G+
Sbjct  391  IRRIVANHEAYQKRNEKKEASEKKYYESKSFVNGE  425


 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 54/85 (64%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  + A +G   P+  LHER + V A ++VD+VI  
Sbjct  72   HYGHCNALRQARALGDELIVGVISDDEIKANKGP--PVTPLHERMIMVRAVKWVDDVIPD  129

Query  182  APWEVTKD----MITTFDISLVVHG  244
            AP+ +T++    + T ++I  ++HG
Sbjct  130  APYAITEEFMNKLFTEYNIDYIIHG  154



>ref|XP_006664291.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Oryza 
brachyantha]
Length=423

 Score =   238 bits (606),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILRLAR LGDFLLVGIHTDQT+S+TRG HRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  269  HAGHVEILRLARELGDFLLVGIHTDQTISSTRGPHRPIMNLHERSLSVLACRYVDEVIIG  328

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APW+V+KDMITTF+ISLVVHGT+AE  D+ K+  NPYAVP +MGI   LESPLDITTSTI
Sbjct  329  APWDVSKDMITTFNISLVVHGTIAENMDFMKDDLNPYAVPRAMGIYCRLESPLDITTSTI  388

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIV+NH+AY KRNEKK  SEK+YY+ KS+++G+
Sbjct  389  IRRIVTNHEAYQKRNEKKEASEKKYYDSKSFVNGE  423


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 52/85 (61%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A +LGD L+VG+ +D  ++A +G   P+  LHER + V A ++V +VI  
Sbjct  70   HYGHCNALRQAHALGDELIVGVVSDDEITANKGP--PVTPLHERLIMVRAVKWVHDVIPD  127

Query  182  APWEVTKD----MITTFDISLVVHG  244
            AP+ +T++    +   ++I  ++HG
Sbjct  128  APYAITEEFMNKLFNEYNIDYIIHG  152



>ref|XP_008442302.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase isoform 
X1 [Cucumis melo]
Length=493

 Score =   238 bits (608),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +2

Query  5    AGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIGA  184
             G++ IL+ ARS+GDFLLVGIHTD TVSA RGAHRPIMNLHERSLSVLACRYVDEVIIGA
Sbjct  340  GGYLSILKHARSMGDFLLVGIHTDLTVSANRGAHRPIMNLHERSLSVLACRYVDEVIIGA  399

Query  185  PWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittstii  364
            PWEV+KDMITTF+ISLVVHGTVAE +D+QK   NPYAVPI+MGI K+L+SPLDITT+TII
Sbjct  400  PWEVSKDMITTFNISLVVHGTVAEVNDFQKRDCNPYAVPINMGIFKILDSPLDITTTTII  459

Query  365  rriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            RRIVSNH+AY KRNEKK  SE+RYYE K+Y+ GD
Sbjct  460  RRIVSNHEAYQKRNEKKANSERRYYEDKAYVLGD  493


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  ++A +G   P+  L+ER + V A ++VDEVI  
Sbjct  77   HYGHCNALRQARALGDQLVVGVVSDSEITANKGP--PVTPLNERMIMVNAVKWVDEVIPN  134

Query  182  APWEVTKD-MITTFD---ISLVVHG  244
            AP+ +T+D M   FD   I  ++HG
Sbjct  135  APYAITEDFMRKLFDEYKIDYIIHG  159



>ref|XP_003579008.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Brachypodium 
distachyon]
Length=427

 Score =   236 bits (603),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILRLAR LGDFLLVGIHTDQT+S+TRG HRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  273  HAGHVEILRLARGLGDFLLVGIHTDQTISSTRGPHRPIMNLHERSLSVLACRYVDEVIIG  332

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV+KDMITTF+IS+VV GT+AE  D+ K+  +PYAV + MGIL  LESPLDITTSTI
Sbjct  333  APWEVSKDMITTFNISIVVQGTIAENMDFAKDESHPYAVAMEMGILHRLESPLDITTSTI  392

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIVSNH+AY KRNEKK  SEK+YYE K++++G+
Sbjct  393  IRRIVSNHEAYQKRNEKKEASEKKYYESKNFVNGE  427


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 55/85 (65%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  ++A +G   P+  LHER + V A ++VD+VI  
Sbjct  73   HYGHCNALRQARALGDQLVVGVVSDDEITANKGP--PVTPLHERMVMVGAVKWVDDVIPD  130

Query  182  APWEVTKD----MITTFDISLVVHG  244
            AP+ +T+D    + T ++I  ++HG
Sbjct  131  APYAITEDFMKKLFTEYNIDYIIHG  155



>dbj|BAJ86064.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=421

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILRLAR LGDFLLVGIHTDQT+S+TRG HRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  267  HAGHVEILRLARGLGDFLLVGIHTDQTISSTRGPHRPIMNLHERSLSVLACRYVDEVIIG  326

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APW+++KDMI TF+ISLVV GT+AE  D+ K+  +PYAVP+ MGI   LESPLDITTSTI
Sbjct  327  APWDISKDMIATFNISLVVQGTIAENMDFAKDESHPYAVPMDMGIFHRLESPLDITTSTI  386

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            IRRIVSNH+AY KRNEKK  SEK+YYE K++++G+
Sbjct  387  IRRIVSNHEAYQKRNEKKEASEKKYYESKNFVNGE  421


 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 55/85 (65%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  ++A +G   P+  L+ER + V A ++VD+VI  
Sbjct  68   HYGHCNALRQARALGDQLIVGVVSDDEITANKGP--PVTPLNERMVMVGAVKWVDDVIPD  125

Query  182  APWEVTKD----MITTFDISLVVHG  244
            AP+ +T+D    + T ++I  ++HG
Sbjct  126  APYAITEDFMNKLFTEYNIDYIIHG  150



>ref|XP_009133281.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Brassica 
rapa]
Length=418

 Score =   235 bits (599),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVGIH DQTVS  RGA  PIMNLHERSLSVLACRYVDEVIIG
Sbjct  264  HAGHVEILRRARELGDFLLVGIHNDQTVSGKRGAQHPIMNLHERSLSVLACRYVDEVIIG  323

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV+KD ITTFDI  VVHGTVAE  D+QKE  NPYAVP SMGI +VLESPLDI+TSTI
Sbjct  324  APWEVSKDTITTFDIWKVVHGTVAESDDFQKEEGNPYAVPKSMGIFEVLESPLDISTSTI  383

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            I+RIV+NH+AY KRN KK  SEK+YYE KS+++GD
Sbjct  384  IKRIVANHEAYQKRNLKKEASEKKYYEQKSFVTGD  418


 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 52/85 (61%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D+ + A +G   P+  LHER + V A ++VDEVI  
Sbjct  65   HYGHCNALRQARALGDQLVVGVVSDEEIIANKGP--PVTPLHERMIMVNAVKWVDEVIPD  122

Query  182  APWEVT----KDMITTFDISLVVHG  244
            AP+ +T    K +   + I  ++HG
Sbjct  123  APYAITEEFMKRLFDEYQIDYIIHG  147



>ref|XP_011006223.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Populus euphratica]
Length=426

 Score =   231 bits (590),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 138/155 (89%), Gaps = 1/155 (1%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEIL+L R+L DFL V IH DQ VS+ RGAHRPIMNLHERSLSVLAC+YVDEVIIG
Sbjct  273  HAGHVEILKLPRALRDFL-VEIHNDQIVSSKRGAHRPIMNLHERSLSVLACQYVDEVIIG  331

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV+KDMITTF+IS VVHGTVAE +D+ KE +NPY VPISMGI +VL+SPLDITT+TI
Sbjct  332  APWEVSKDMITTFNISSVVHGTVAENNDFLKEKDNPYVVPISMGIFQVLDSPLDITTTTI  391

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            I+RIVSNH+AY KRN+KK  SE+RYYE K+YISGD
Sbjct  392  IKRIVSNHEAYQKRNQKKAASERRYYEDKAYISGD  426


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 51/85 (60%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +   + A +G   P+  +H R + V A ++VDEVI  
Sbjct  74   HYGHCHALRQARALGDQLVVGVVSVDEIIANKGP--PVTPVHVRMIMVHAVKWVDEVISD  131

Query  182  APWEVTKDMITT----FDISLVVHG  244
            AP+ +T+D +      ++I  ++HG
Sbjct  132  APYAITEDFMKKLFDEYNIDYIIHG  156



>ref|XP_009141755.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Brassica 
rapa]
Length=417

 Score =   231 bits (589),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 135/155 (87%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVGIH DQTVSA  GA  PIMNLHERSLSVLACRYVDEVIIG
Sbjct  263  HAGHVEILRRARELGDFLLVGIHNDQTVSARSGARHPIMNLHERSLSVLACRYVDEVIIG  322

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            AP EV+KD ITTFDISLVVHGTVAE   +QKE  NPYAVPISMGI ++LESPLDITTSTI
Sbjct  323  APSEVSKDTITTFDISLVVHGTVAESDAFQKEEGNPYAVPISMGIFQILESPLDITTSTI  382

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            I+RIV+NH+AY KRN KK  SEK+YYE K++++GD
Sbjct  383  IKRIVNNHEAYQKRNLKKEASEKKYYEQKAFVTGD  417


 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 54/85 (64%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D+ + A +G   P+  LHER + V A ++VDEVI  
Sbjct  65   HYGHCNALRQARALGDQLVVGVVSDEEIIANKGP--PVTPLHERMVMVKAVKWVDEVISD  122

Query  182  APWEVTKD-MITTFD---ISLVVHG  244
            AP+ +T+D M   FD   I  ++HG
Sbjct  123  APYAITEDFMKRLFDEYQIDYIIHG  147



>emb|CBI40665.3| unnamed protein product [Vitis vinifera]
Length=362

 Score =   225 bits (574),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEIL+ AR LGDFLLVGIHTDQTVS  RGAH PIM+LHERSLSVLACRYVDEVIIG
Sbjct  208  HAGHVEILKNARQLGDFLLVGIHTDQTVSEHRGAHYPIMHLHERSLSVLACRYVDEVIIG  267

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APW+VTKDMITTF+ISLVVHGTVAE + +   A +PY VP SMGI  +LESP DITT+++
Sbjct  268  APWDVTKDMITTFNISLVVHGTVAESNSFLNGARDPYEVPKSMGIFHMLESPKDITTTSV  327

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
             +RI++NH+AY+KRN KK ESEK+YY  K Y+SG+
Sbjct  328  AQRIIANHEAYMKRNVKKAESEKKYYAEKKYVSGE  362


 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 52/85 (61%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A++LGD L+VG+ +D+ + A +G   P++++ ER + V   ++VDEVI  
Sbjct  9    HYGHANALRQAKALGDELVVGVVSDEEIIANKGP--PVLSMEERLVLVSGLKWVDEVIAN  66

Query  182  APWEVTKDMITTF----DISLVVHG  244
            AP+ +T+  + T      I  ++HG
Sbjct  67   APYAITEQFMDTLFNEHKIDYIIHG  91



>ref|XP_002265606.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Vitis 
vinifera]
 ref|XP_010656673.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Vitis 
vinifera]
 ref|XP_010656675.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Vitis 
vinifera]
Length=431

 Score =   225 bits (573),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEIL+ AR LGDFLLVGIHTDQTVS  RGAH PIM+LHERSLSVLACRYVDEVIIG
Sbjct  277  HAGHVEILKNARQLGDFLLVGIHTDQTVSEHRGAHYPIMHLHERSLSVLACRYVDEVIIG  336

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APW+VTKDMITTF+ISLVVHGTVAE + +   A +PY VP SMGI  +LESP DITT+++
Sbjct  337  APWDVTKDMITTFNISLVVHGTVAESNSFLNGARDPYEVPKSMGIFHMLESPKDITTTSV  396

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
             +RI++NH+AY+KRN KK ESEK+YY  K Y+SG+
Sbjct  397  AQRIIANHEAYMKRNVKKAESEKKYYAEKKYVSGE  431


 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 52/85 (61%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A++LGD L+VG+ +D+ + A +G   P++++ ER + V   ++VDEVI  
Sbjct  78   HYGHANALRQAKALGDELVVGVVSDEEIIANKGP--PVLSMEERLVLVSGLKWVDEVIAN  135

Query  182  APWEVTKDMITTF----DISLVVHG  244
            AP+ +T+  + T      I  ++HG
Sbjct  136  APYAITEQFMDTLFNEHKIDYIIHG  160



>emb|CDY07710.1| BnaA03g18010D [Brassica napus]
Length=439

 Score =   223 bits (568),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 134/176 (76%), Gaps = 21/176 (12%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVGIH DQTVS  RGA  PIMNLHERSLSVLACRYVDEVIIG
Sbjct  264  HAGHVEILRRARELGDFLLVGIHNDQTVSGKRGAQHPIMNLHERSLSVLACRYVDEVIIG  323

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV+KD ITTFDI  VVHGTVAE  D+QKE  NPYAVP SMGI +VLESPLDI+TSTI
Sbjct  324  APWEVSKDTITTFDIWKVVHGTVAESDDFQKEEGNPYAVPKSMGIFEVLESPLDISTSTI  383

Query  362  irriVSNHDAYL---------------------KRNEKKVESEKRYYEGKSYISGD  466
            I+RIV+NH+AY                      KRN KK  SEK+YYE KS+++GD
Sbjct  384  IKRIVANHEAYQASLSSSSSFFYRSSCCFTLANKRNLKKEASEKKYYEQKSFVTGD  439


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 52/85 (61%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D+ + A +G   P+  LHER + V A ++VDEVI  
Sbjct  65   HYGHCNALRQARALGDQLVVGVVSDEEIIANKGP--PVTPLHERMIMVKAVKWVDEVIPD  122

Query  182  APWEVT----KDMITTFDISLVVHG  244
            AP+ +T    K +   + I  ++HG
Sbjct  123  APYAITEEFMKRLFDEYQIDYIIHG  147



>ref|XP_002526236.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF36133.1| conserved hypothetical protein [Ricinus communis]
Length=377

 Score =   221 bits (562),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 129/155 (83%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVGIHTDQ VS  RG H PIM+LHERSLSVLACRYVDEVIIG
Sbjct  223  HAGHVEILRSARQLGDFLLVGIHTDQIVSEHRGEHYPIMHLHERSLSVLACRYVDEVIIG  282

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV+KDMITTF+ISLVVHGTVAE +       +PYAVP SMGI + LESP +I TS++
Sbjct  283  APWEVSKDMITTFNISLVVHGTVAECNSLLAGISDPYAVPKSMGIFRTLESPKNIITSSV  342

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
             +RIV+NH+AY+KRN KK +SEK+YY  K Y+SGD
Sbjct  343  AQRIVANHEAYMKRNSKKAKSEKKYYAEKVYVSGD  377


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 49/85 (58%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A++LGD L+VG+ +D+ + A +G   P++ + ER   V   ++VDEVI  
Sbjct  32   HYGHANALRQAKALGDELVVGVVSDEEIIANKGP--PVLPMEERLALVSGLKWVDEVIAN  89

Query  182  APWEVTKDMITTF----DISLVVHG  244
            AP+ +T+  +        I  ++HG
Sbjct  90   APYAITEQFMNRLFNEHKIDYIIHG  114



>ref|XP_006587893.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X2 [Glycine max]
Length=393

 Score =   221 bits (562),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILRLAR LGDFLLVGIHTDQTVSATRG+HRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  261  HAGHVEILRLARDLGDFLLVGIHTDQTVSATRGSHRPIMNLHERSLSVLACRYVDEVIIG  320

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWE++KDM+TTF+ISLVVHGT+AE +D++KE  NPYAVPISMGI KVLES LDITT+TI
Sbjct  321  APWEISKDMLTTFNISLVVHGTIAESNDFKKEECNPYAVPISMGIFKVLESTLDITTTTI  380

Query  362  irriVSNHDAYLK  400
            IRRIVSNH+AY K
Sbjct  381  IRRIVSNHEAYQK  393


 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 51/85 (60%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  + A +G   P+  LHER + V A ++VDEVI  
Sbjct  58   HYGHCNALRQARALGDQLIVGVVSDAEIIANKGP--PVTPLHERLVMVNAVKWVDEVIPE  115

Query  182  APWEVT----KDMITTFDISLVVHG  244
            AP+ +T    K +   + I  ++HG
Sbjct  116  APYAITEEFMKKLFDEYKIDFIIHG  140



>ref|XP_004503546.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Cicer 
arietinum]
Length=421

 Score =   221 bits (564),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 134/155 (86%), Gaps = 2/155 (1%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVE+L+ AR LGDFLLVGIH+D+TVS  RG H PIM+LHERSLSVLACRYVDEVIIG
Sbjct  269  HAGHVEVLKRARELGDFLLVGIHSDETVSENRGKHYPIMHLHERSLSVLACRYVDEVIIG  328

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWE+TKDMITTF+ISLVVHGTVAE S Y +   +PY VP SMGI ++LESP D+TTS++
Sbjct  329  APWEITKDMITTFNISLVVHGTVAEKSLYSE--TDPYEVPKSMGIFRLLESPRDLTTSSV  386

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
             +RI++NH+AY+KRN KK +SEKRYYE + Y+SGD
Sbjct  387  AQRIMANHEAYVKRNAKKAQSEKRYYEERKYVSGD  421


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 52/85 (61%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A++LGD L+VG+ +D+ + A +G   P++++ ER   V   ++VDEVI  
Sbjct  80   HYGHANALRQAKALGDELVVGLVSDEEIVANKGP--PVLSMDERLALVSGLKWVDEVITD  137

Query  182  APWEVTKDMIT----TFDISLVVHG  244
            AP+ +T+  +      ++I  V+HG
Sbjct  138  APYAITEKFLNRLFHEYNIDYVIHG  162



>emb|CDX91484.1| BnaC04g06660D [Brassica napus]
Length=411

 Score =   220 bits (560),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVGIH DQTVSA RGAHRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  266  HAGHVEILRRARELGDFLLVGIHNDQTVSAKRGAHRPIMNLHERSLSVLACRYVDEVIIG  325

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV+KD ITTFDISLVVHGTVAE  D+Q+E ENPYAVPISMGI +VLESPLDITTSTI
Sbjct  326  APWEVSKDTITTFDISLVVHGTVAESDDFQREEENPYAVPISMGIFQVLESPLDITTSTI  385

Query  362  irriVSNHDAY  394
            IRRIV+NH+AY
Sbjct  386  IRRIVANHEAY  396


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 52/85 (61%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D+ + A +G   P+  LHER + V A ++VDEVI  
Sbjct  66   HYGHCNALRQARALGDQLVVGVVSDEEIIANKGP--PVTPLHERMIMVKAVKWVDEVISD  123

Query  182  APWEVT----KDMITTFDISLVVHG  244
            AP+ +T    K +   + I  ++HG
Sbjct  124  APYAITEEFMKKLFDEYQIDYIIHG  148



>gb|KDP45833.1| hypothetical protein JCGZ_17440 [Jatropha curcas]
Length=425

 Score =   220 bits (560),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 131/155 (85%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVGIHTDQ VS  RG + PIM+LHERSLSVLACRYVDEVIIG
Sbjct  271  HAGHVEILRCARQLGDFLLVGIHTDQIVSEHRGKNYPIMHLHERSLSVLACRYVDEVIIG  330

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV+KDMITTF+ISLVVHGT+AE +       +PYAVP SMGI ++LESP +ITT+++
Sbjct  331  APWEVSKDMITTFNISLVVHGTIAECNSLLAGIPDPYAVPKSMGIFQILESPKNITTTSV  390

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
             +RIV+NH+AY+KRN KK ESEK+YY  K Y+SGD
Sbjct  391  AQRIVANHEAYMKRNAKKAESEKKYYAEKVYVSGD  425


 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 50/85 (59%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A++LGD L+VG+ +D+ + A +G   P++ + ER   V   ++VDEVI  
Sbjct  80   HYGHANALRQAKALGDELVVGVVSDEEIIANKGP--PVLPMEERLALVSGLKWVDEVIAN  137

Query  182  APWEVTKDMITTF----DISLVVHG  244
            +P+ +T+  + T      I  ++HG
Sbjct  138  SPYAITEQFMNTLFNEHKIDYIIHG  162



>gb|KHN29458.1| Ethanolamine-phosphate cytidylyltransferase [Glycine soja]
Length=414

 Score =   219 bits (559),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILRLAR LGDFLLVGIHTDQTVSATRG+HRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  261  HAGHVEILRLARDLGDFLLVGIHTDQTVSATRGSHRPIMNLHERSLSVLACRYVDEVIIG  320

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWE++KDM+TTF+ISLVVHGT+AE +D++KE  NPYAVPISMGI KVLES LDITT+TI
Sbjct  321  APWEISKDMLTTFNISLVVHGTIAESNDFKKEECNPYAVPISMGIFKVLESTLDITTTTI  380

Query  362  irriVSNHDAY  394
            IRRIVSNH+AY
Sbjct  381  IRRIVSNHEAY  391


 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 51/85 (60%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  + A +G   P+  LHER + V A ++VDEVI  
Sbjct  58   HYGHCNALRQARALGDQLIVGVVSDAEIIANKGP--PVTPLHERLVMVNAVKWVDEVIPE  115

Query  182  APWEVT----KDMITTFDISLVVHG  244
            AP+ +T    K +   + I  ++HG
Sbjct  116  APYAITEEFMKKLFDEYKIDFIIHG  140



>ref|XP_002990148.1| hypothetical protein SELMODRAFT_131236 [Selaginella moellendorffii]
 gb|EFJ08708.1| hypothetical protein SELMODRAFT_131236 [Selaginella moellendorffii]
Length=416

 Score =   219 bits (558),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 131/155 (85%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHV IL  A++LGDFLLVGIHTDQTV   RGAH P+MNLHERSLSVL+CRY DE+IIG
Sbjct  262  HAGHVAILERAKALGDFLLVGIHTDQTVRTRRGAHHPVMNLHERSLSVLSCRYADEIIIG  321

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEVTKDM+TTF+ISLVVHGTVAE +D+++   +PYA P  +G  K+LESP +ITTSTI
Sbjct  322  APWEVTKDMVTTFNISLVVHGTVAETTDFKEGDFDPYACPKQLGKFKILESPRNITTSTI  381

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            I RIV+NH+A+ KRNEKK ESE+RYY  K +++GD
Sbjct  382  IARIVANHEAFRKRNEKKAESERRYYANKQFVNGD  416


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 52/85 (61%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  + + +G   P+M++ ER   V + ++VDEVI  
Sbjct  66   HYGHANALRQARALGDELVVGVVSDGEIESNKGP--PVMSMDERMAMVRSVKWVDEVIED  123

Query  182  APWEVTKD----MITTFDISLVVHG  244
            AP+ + ++    + T + I  ++HG
Sbjct  124  APYAINEEFMNKLFTKYRIDYIIHG  148



>ref|XP_002992541.1| hypothetical protein SELMODRAFT_162424 [Selaginella moellendorffii]
 gb|EFJ06479.1| hypothetical protein SELMODRAFT_162424 [Selaginella moellendorffii]
Length=420

 Score =   219 bits (558),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 131/155 (85%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHV IL  A++LGDFLLVGIHTDQTV   RGAH P+MNLHERSLSVL+CRY DE+IIG
Sbjct  266  HAGHVAILERAKALGDFLLVGIHTDQTVRTRRGAHHPVMNLHERSLSVLSCRYADEIIIG  325

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEVTKDM+TTF+ISLVVHGTVAE +D+++   +PYA P  +G  K+LESP +ITTSTI
Sbjct  326  APWEVTKDMVTTFNISLVVHGTVAETTDFKEGDFDPYACPKQLGKFKILESPRNITTSTI  385

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            I RIV+NH+A+ KRNEKK ESE+RYY  K +++GD
Sbjct  386  IARIVANHEAFRKRNEKKAESERRYYANKQFVNGD  420


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 52/85 (61%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  + + +G   P+M++ ER   V + ++VDEVI  
Sbjct  70   HYGHANALRQARALGDELVVGVVSDGEIESNKGP--PVMSMDERMAMVRSVKWVDEVIED  127

Query  182  APWEVTKD----MITTFDISLVVHG  244
            AP+ + ++    + T + I  ++HG
Sbjct  128  APYAINEEFMNKLFTKYRIDYIIHG  152



>ref|XP_004163014.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Cucumis 
sativus]
 gb|KGN65519.1| hypothetical protein Csa_1G434170 [Cucumis sativus]
Length=423

 Score =   219 bits (557),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 131/155 (85%), Gaps = 1/155 (1%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGH+EIL++AR LGDFLLVGIH DQTVS  RG   PIM+LHERSLSVL CRYVDEVIIG
Sbjct  270  HAGHIEILKIARQLGDFLLVGIHNDQTVSNLRGKQFPIMHLHERSLSVLGCRYVDEVIIG  329

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWE+T+DMITTF+ISLVVHGTVAE + +  +++ PYAVP SMGI K+LESP  ITT++I
Sbjct  330  APWEITRDMITTFNISLVVHGTVAENNSFAGDSD-PYAVPKSMGIFKLLESPKTITTTSI  388

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
             +RIV+NHDA+ KRN KKVESEK+YY  K YI GD
Sbjct  389  AKRIVANHDAFKKRNAKKVESEKKYYAEKKYICGD  423


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 49/85 (58%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A++LGD L+VG+ +D+ + A +G   P++ + ER   V   ++VDEVI  
Sbjct  80   HFGHANALRQAKALGDELVVGVVSDEEIIANKGP--PVLPMEERLALVSGLKWVDEVIAN  137

Query  182  APWEVTKDMITTF----DISLVVHG  244
            AP+ +T+  +        I  ++HG
Sbjct  138  APYAITEQFMNRLFNEHKIDYIIHG  162



>ref|XP_008453525.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Cucumis 
melo]
 ref|XP_008453526.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Cucumis 
melo]
 ref|XP_008453527.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Cucumis 
melo]
Length=423

 Score =   218 bits (555),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 131/155 (85%), Gaps = 1/155 (1%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGH+EIL++AR LGDFLLVGIH DQ VS  RG   PIM+LHERSLSVL CRYVDEVIIG
Sbjct  270  HAGHIEILKIARQLGDFLLVGIHNDQIVSKLRGKQFPIMHLHERSLSVLGCRYVDEVIIG  329

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWE+T+DMITTF+ISLVVHGTVAE + +  +++ PYAVP SMGI K+LESP +ITT++I
Sbjct  330  APWEITRDMITTFNISLVVHGTVAENNSFAGDSD-PYAVPKSMGIFKLLESPKNITTTSI  388

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
             +RIV+NHDA+ KRN KKVESEK+YY  K YI GD
Sbjct  389  AKRIVANHDAFKKRNAKKVESEKKYYAEKKYICGD  423


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 49/85 (58%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A++LGD L+VG+ +D+ + A +G   P++ + ER   V   ++VDEVI  
Sbjct  80   HFGHANALRQAKALGDELVVGVVSDEEIIANKGP--PVLPMEERLALVSGLKWVDEVIAN  137

Query  182  APWEVTKDMITTF----DISLVVHG  244
            AP+ +T+  +        I  ++HG
Sbjct  138  APYAITEQFMNRLFNEHKIDYIIHG  162



>emb|CDY18374.1| BnaA04g22130D [Brassica napus]
 emb|CDX93310.1| BnaC04g45860D [Brassica napus]
Length=409

 Score =   217 bits (553),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 121/155 (78%), Gaps = 8/155 (5%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVGIH DQTVSA  GA  PIMNLHERSLSVLACRYVDEVIIG
Sbjct  263  HAGHVEILRRARELGDFLLVGIHNDQTVSARSGARHPIMNLHERSLSVLACRYVDEVIIG  322

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            AP EV+KD ITTFDISLVVHGTVAE  D+QKE  NPYAVPISMGI ++LESPLD      
Sbjct  323  APSEVSKDTITTFDISLVVHGTVAESDDFQKEEGNPYAVPISMGIFQILESPLD------  376

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
                 S     +KRN KK  SEK+YYE K++++GD
Sbjct  377  --ITTSTIIKRIKRNLKKEASEKKYYEQKAFVTGD  409


 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 54/85 (64%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D+ + A +G   P+  LHER + V A ++VDEVI  
Sbjct  65   HYGHCNALRQARALGDQLVVGVVSDEEIIANKGP--PVTPLHERMVMVKAVKWVDEVISD  122

Query  182  APWEVTKD-MITTFD---ISLVVHG  244
            AP+ +T+D M   FD   I  ++HG
Sbjct  123  APYAITEDFMKRLFDEYQIDYIIHG  147



>ref|XP_011017741.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Populus 
euphratica]
 ref|XP_011017742.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Populus 
euphratica]
Length=423

 Score =   218 bits (554),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 129/155 (83%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVGIHTDQ VS  RG   PIM+LHERSLSVLACRYVDEVIIG
Sbjct  269  HAGHVEILRSARQLGDFLLVGIHTDQIVSEHRGKGHPIMHLHERSLSVLACRYVDEVIIG  328

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEVTKDM+TTF+I+LVVHGTVAE +       +PYAVP SMGI ++LESP  ITT+++
Sbjct  329  APWEVTKDMVTTFNITLVVHGTVAEKNSLLAGEPDPYAVPKSMGIFRMLESPKTITTTSV  388

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
             +RIV+NH+AYLKRN KK E+EK+YY  K Y+SGD
Sbjct  389  AQRIVANHEAYLKRNAKKAENEKKYYAEKVYVSGD  423


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 51/85 (60%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A++LGD L+VG+ +D+ + A +G   P++++ ER   V   ++VDEVI  
Sbjct  77   HYGHANALRQAKALGDELVVGVVSDEEIVANKGP--PVLSMEERLALVSGLKWVDEVIAN  134

Query  182  APWEVTKDMITTF----DISLVVHG  244
            AP+ +T+  + +      I  ++HG
Sbjct  135  APYAITEKFMNSLFNEHKIDYIIHG  159



>ref|XP_007014459.1| Phosphorylethanolamine cytidylyltransferase 1 isoform 1 [Theobroma 
cacao]
 ref|XP_007014460.1| Phosphorylethanolamine cytidylyltransferase 1 isoform 1 [Theobroma 
cacao]
 gb|EOY32078.1| Phosphorylethanolamine cytidylyltransferase 1 isoform 1 [Theobroma 
cacao]
 gb|EOY32079.1| Phosphorylethanolamine cytidylyltransferase 1 isoform 1 [Theobroma 
cacao]
Length=424

 Score =   218 bits (554),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEIL+ AR LGDFLLVGIHTDQ VS  RG   P+M+LHER+LSVLACRYVDEVIIG
Sbjct  270  HAGHVEILKRARQLGDFLLVGIHTDQIVSEHRGTPYPVMHLHERNLSVLACRYVDEVIIG  329

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEVTKDMITTF+ISLVVHGTVAE +       +PYAVP SMGI ++LESP  ITTS++
Sbjct  330  APWEVTKDMITTFNISLVVHGTVAESNTLLAGETDPYAVPKSMGIFRLLESPKRITTSSV  389

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
             +RIV+NH+AY+KRN KK++SEK+YYE K+Y++GD
Sbjct  390  AQRIVANHEAYMKRNAKKLQSEKKYYEEKTYVAGD  424


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 51/85 (60%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A++LGD L+VG+ +D+ + A +G   P++ + ER   V   ++VD+VI  
Sbjct  79   HYGHANALRQAKALGDELVVGVVSDEEIIANKGP--PVLAMEERLALVSGLKWVDQVIAN  136

Query  182  APWEVTKDMITTF----DISLVVHG  244
            AP+ +T+  +++      I  ++HG
Sbjct  137  APYAITEQFMSSLFNEHKIDYIIHG  161



>ref|XP_010263306.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Nelumbo 
nucifera]
 ref|XP_010263307.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Nelumbo 
nucifera]
Length=432

 Score =   218 bits (554),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEIL+ AR  GDFLLVGIH+D+TVS  RG   PIM+LHERSLSVLACRYVDEVIIG
Sbjct  278  HAGHVEILKSARQFGDFLLVGIHSDETVSEHRGTQYPIMDLHERSLSVLACRYVDEVIIG  337

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            +PWEVTKDMI TF+ISLVVHGTVAE +++  +  +PYA P SMGI +++ESP DITTS++
Sbjct  338  SPWEVTKDMIITFNISLVVHGTVAESTNFLNDDADPYAAPKSMGIFRMIESPKDITTSSV  397

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
             +RI++NH+ Y KRN KKVESEKRYY  K Y+SGD
Sbjct  398  AKRIIANHEVYKKRNAKKVESEKRYYAEKKYVSGD  432


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 52/85 (61%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A++LGD L+VG+ +D+ + A +G   P++++ ER   V   ++VDEVI  
Sbjct  80   HYGHANALRQAKALGDILVVGVVSDEEIIANKGP--PVLSMEERLTLVSGLKWVDEVITN  137

Query  182  APWEVT-KDMITTFD---ISLVVHG  244
            AP+ +T K M   F+   I  ++HG
Sbjct  138  APYAITEKFMDKLFNEHKIDYIIHG  162



>ref|XP_008223819.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Prunus 
mume]
Length=419

 Score =   217 bits (552),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 131/155 (85%), Gaps = 1/155 (1%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEIL+ AR LGDFLLVGIH D+TVS  RG H PIM+LHERSLSVL CRYVDEVIIG
Sbjct  266  HAGHVEILKNARQLGDFLLVGIHNDETVSEHRG-HHPIMHLHERSLSVLGCRYVDEVIIG  324

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEVT DM+TTF+ISLVVHGTV+EY+       +PY+VP SMGI K+LESP +ITT+++
Sbjct  325  APWEVTMDMVTTFNISLVVHGTVSEYNSLFPGESDPYSVPKSMGIFKLLESPKNITTTSV  384

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
             +RI++NHDAY+KRN KK ESEK+YY  K+Y+SGD
Sbjct  385  SQRIIANHDAYMKRNAKKAESEKKYYAQKTYVSGD  419


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 52/85 (61%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A+ LGD L+VG+ +D+ + A +G   P++++ ER + V   ++VDEVI  
Sbjct  77   HYGHANALRQAKGLGDELVVGVVSDEEIIANKGP--PVLSMEERLVLVSGLKWVDEVIPK  134

Query  182  APWEVTKDMITTF----DISLVVHG  244
            AP+E+T+  ++       I  ++HG
Sbjct  135  APYEITEQFMSRLFNEHKIDYIIHG  159



>ref|XP_007222601.1| hypothetical protein PRUPE_ppa006288mg [Prunus persica]
 gb|EMJ23800.1| hypothetical protein PRUPE_ppa006288mg [Prunus persica]
Length=419

 Score =   217 bits (552),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 131/155 (85%), Gaps = 1/155 (1%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEIL+ AR LGDFLLVGIH D+TVS  RG H PIM+LHERSLSVL CRYVDEVIIG
Sbjct  266  HAGHVEILKNARQLGDFLLVGIHNDETVSEHRG-HHPIMHLHERSLSVLGCRYVDEVIIG  324

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEVT DM+TTF+ISLVVHGTV+EY+       +PY+VP SMGI K+LESP +ITT+++
Sbjct  325  APWEVTMDMVTTFNISLVVHGTVSEYNSLFTGESDPYSVPKSMGIFKLLESPKNITTTSV  384

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
             +RI++NHDAY+KRN KK ESEK+YY  K+Y+SGD
Sbjct  385  SQRIIANHDAYMKRNAKKAESEKKYYAQKTYVSGD  419


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 52/85 (61%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A++LGD L+VG+ +D+ + A +G   P++++ ER   V   ++VDEVI  
Sbjct  77   HYGHANALRQAKALGDELVVGVVSDEEIIANKGP--PVLSMEERLALVSGLKWVDEVIPK  134

Query  182  APWEVTKDMITTF----DISLVVHG  244
            AP+E+T+  ++       I  ++HG
Sbjct  135  APYEITEQFMSRLFNEHKIDYIIHG  159



>gb|EEC68755.1| hypothetical protein OsI_37278 [Oryza sativa Indica Group]
Length=412

 Score =   216 bits (550),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 123/205 (60%), Positives = 141/205 (69%), Gaps = 50/205 (24%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILRLAR LGDFLLVGIHTDQT+S+TRG HRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  208  HAGHVEILRLARELGDFLLVGIHTDQTISSTRGPHRPIMNLHERSLSVLACRYVDEVIIG  267

Query  182  APWEVTK--------------------------------------------------DMI  211
            APW+V+K                                                  DMI
Sbjct  268  APWDVSKDMELLDATASNSSLNMAQLCMHSSKIEHDIYATPAKALLTAIIDFRYRLTDMI  327

Query  212  TTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittstiirriVSNHDA  391
            TTF+ISLVVHGT+AE  D+ K+  NPYAVP +MGI + LESPLDITTSTIIRRIV+NH+A
Sbjct  328  TTFNISLVVHGTIAENMDFMKDDLNPYAVPRAMGIYRRLESPLDITTSTIIRRIVANHEA  387

Query  392  YLKRNEKKVESEKRYYEGKSYISGD  466
            Y KRNEKK  SEK+YY+ KS+++G+
Sbjct  388  YQKRNEKKEASEKKYYDSKSFVNGE  412


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 52/85 (61%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A +LGD L+VG+ +D  ++A +G   P+  LHER + V A ++V +VI  
Sbjct  9    HYGHCNALRQAHALGDELIVGVVSDDEITANKGP--PVTPLHERLIMVRAVKWVHDVIPD  66

Query  182  APWEVTKD----MITTFDISLVVHG  244
            AP+ +T+D    +   ++I  ++HG
Sbjct  67   APYAITEDFMNKLFNEYNIDYIIHG  91



>ref|XP_009770718.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009770719.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Nicotiana sylvestris]
Length=426

 Score =   214 bits (546),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVG++TDQT+S  RG   P+MNLHERSLSVLACRYVDEVIIG
Sbjct  272  HAGHVEILRSARQLGDFLLVGVYTDQTISELRGHQYPLMNLHERSLSVLACRYVDEVIIG  331

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEVT+DM+TTF+IS+VVHGTV+E +    E  +PYAVP +MGI +V+ESP DITT+++
Sbjct  332  APWEVTQDMVTTFNISVVVHGTVSERNSSTGERHDPYAVPKNMGIFRVIESPKDITTTSV  391

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
             +RI++NH+ Y+KRN KK  SEK+YY  K Y+SGD
Sbjct  392  AQRIIANHEIYVKRNAKKEASEKKYYAEKQYVSGD  426


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 50/85 (59%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   +R A++LGD L+VG+ +D+ + A +G   P++ + ER   V   ++VDEVI  
Sbjct  77   HYGHANAIRQAKALGDELVVGVVSDEEIVANKGP--PVLCMEERLALVSGLKWVDEVIAN  134

Query  182  APWEVTKDMITTF----DISLVVHG  244
            AP+ +T+D +        I  ++HG
Sbjct  135  APYAITEDFMNRLFNEHKIDYIIHG  159



>ref|XP_004299778.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=415

 Score =   213 bits (543),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 128/155 (83%), Gaps = 1/155 (1%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEIL+ AR LGDFLLVGIH D TVS  RG H PIM+LHERSL VL CRYVDEVIIG
Sbjct  262  HAGHVEILKNARQLGDFLLVGIHNDYTVSEHRGKH-PIMHLHERSLGVLGCRYVDEVIIG  320

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWE+T DMITTF+ISLVVHGTV+EY+       +PY+VP SMGI +VLESP +ITT+++
Sbjct  321  APWEITMDMITTFNISLVVHGTVSEYNSSFTGESDPYSVPKSMGIFQVLESPKEITTTSV  380

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
             +RI++NHDAYLKRN +K  SEK+YYE K Y+SGD
Sbjct  381  AQRIIANHDAYLKRNARKTASEKKYYEQKKYVSGD  415


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 51/85 (60%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A++LGD L+VG+ +D+ + A +G   P++++ ER   V   ++VD+VI  
Sbjct  77   HYGHANALRQAKALGDELVVGVVSDEEIVANKGP--PVLSMEERLALVSGLKWVDQVIAN  134

Query  182  APWEVTKDMITTF----DISLVVHG  244
            AP+E+T+  +        I  ++HG
Sbjct  135  APYEITEQFMNKLFNEHKIDYIIHG  159



>ref|XP_009783881.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Nicotiana 
sylvestris]
 ref|XP_009783882.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Nicotiana 
sylvestris]
Length=429

 Score =   213 bits (542),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVGI+ DQTVS  RG   P+MNL+ERSLSVLACRYVDEVIIG
Sbjct  275  HAGHVEILRRARQLGDFLLVGIYPDQTVSELRGHQYPLMNLYERSLSVLACRYVDEVIIG  334

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEVT+DMITTF+IS+VVHGTV+E +   +  ++PYAVP SMGI +V+ESP DITT+++
Sbjct  335  APWEVTQDMITTFNISVVVHGTVSESNSSMEGGQDPYAVPKSMGIFQVIESPKDITTTSV  394

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
             +RI++NH+ Y+KRN KK  SEK+YY  + Y+SGD
Sbjct  395  AQRIIANHEIYVKRNTKKAASEKKYYAQRKYVSGD  429


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 54/85 (64%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A++LGD L+VG+ +D+ + AT+G   P++ + ER   V   ++VDEVI  
Sbjct  77   HYGHANALRQAKALGDELVVGVVSDEEIIATKGP--PVLCMEERLALVSGLKWVDEVISS  134

Query  182  APWEVTKD----MITTFDISLVVHG  244
            AP+E+T++    +   ++I  ++HG
Sbjct  135  APYEITEEFMNRLFNEYNIDYIIHG  159



>ref|XP_009626648.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Nicotiana 
tomentosiformis]
 ref|XP_009626649.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Nicotiana 
tomentosiformis]
 ref|XP_009626650.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Nicotiana 
tomentosiformis]
Length=429

 Score =   213 bits (542),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVGI+ DQTVS  RG   P+MNL+ERSLSVLACRYVDEVIIG
Sbjct  275  HAGHVEILRRARQLGDFLLVGIYPDQTVSELRGHQYPLMNLYERSLSVLACRYVDEVIIG  334

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            +PWEVT+DMITTF+ISLVVHGTV+E +   +  ++PYAVP SMGI +V+ESP DITT+++
Sbjct  335  SPWEVTQDMITTFNISLVVHGTVSESNSSMEGGQDPYAVPKSMGIFQVIESPKDITTTSV  394

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
             +RI++NH+ Y+KRN KK  SEK+YY  + Y+SGD
Sbjct  395  AQRIIANHEIYVKRNTKKAASEKKYYAERKYVSGD  429


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 54/85 (64%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A++LGD L+VG+ +D+ + AT+G   P++ + ER   V   ++VDEVI  
Sbjct  77   HYGHANALRQAKALGDELVVGVVSDEEIIATKGP--PVLCMEERLALVSGLKWVDEVISS  134

Query  182  APWEVTKD----MITTFDISLVVHG  244
            AP+E+T++    +   ++I  ++HG
Sbjct  135  APYEITEEFMNRLFNEYNIDYIIHG  159



>ref|XP_002308992.1| hypothetical protein POPTR_0006s07030g [Populus trichocarpa]
 gb|EEE92515.1| hypothetical protein POPTR_0006s07030g [Populus trichocarpa]
Length=395

 Score =   212 bits (539),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVGIHTDQ VS  RG   PIM+LHERSLSVLAC YVDEVIIG
Sbjct  241  HAGHVEILRSARQLGDFLLVGIHTDQIVSEHRGKGHPIMHLHERSLSVLACSYVDEVIIG  300

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEVT+DM+TTF+ISLVVHGTVAE +       +PYAVP SMGI  +L+SP +ITT+++
Sbjct  301  APWEVTRDMVTTFNISLVVHGTVAESNSLLAGEPDPYAVPKSMGIFWMLDSPKNITTTSV  360

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
             +RIV+NH+AYLKRN KK ESEK+YY  K ++SGD
Sbjct  361  AQRIVANHEAYLKRNAKKAESEKKYYAEKVHVSGD  395


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 51/85 (60%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A++LGD L+VG+ +D+ + A +G   P++++ ER   V   ++VDEVI  
Sbjct  77   HYGHANALRQAKALGDELVVGVVSDEEIVANKGP--PVLSMEERLALVSGLKWVDEVIAN  134

Query  182  APWEVTKDMITTF----DISLVVHG  244
            AP+ +T+  + +      I  ++HG
Sbjct  135  APYAITEKFMNSLFNEHKIDYIIHG  159



>ref|XP_007160226.1| hypothetical protein PHAVU_002G303400g [Phaseolus vulgaris]
 ref|XP_007160227.1| hypothetical protein PHAVU_002G303400g [Phaseolus vulgaris]
 gb|ESW32220.1| hypothetical protein PHAVU_002G303400g [Phaseolus vulgaris]
 gb|ESW32221.1| hypothetical protein PHAVU_002G303400g [Phaseolus vulgaris]
Length=420

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 131/155 (85%), Gaps = 2/155 (1%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEIL+ AR LGDFLLVGIH+D+TVS  RG H PIM+LHERSLSVLACRYVDEVIIG
Sbjct  268  HAGHVEILKRARELGDFLLVGIHSDETVSEHRGNHYPIMHLHERSLSVLACRYVDEVIIG  327

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            +PWE+TKDMITTF+ISLVVHGTVAE S      ++PY VP  MGI ++LESP DITT+T+
Sbjct  328  SPWEITKDMITTFNISLVVHGTVAEKS--LNCEQDPYEVPKIMGIFRLLESPKDITTATV  385

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
             +RI++NH+AY+KRN KK  SE+RYYE K ++SGD
Sbjct  386  AQRIMANHEAYVKRNAKKARSEQRYYEEKKFVSGD  420


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 54/85 (64%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A++LGD L+VG+ +D+ ++AT+G   P++++ ER + V   ++VDEVI  
Sbjct  79   HYGHANALRQAKALGDELVVGLVSDEEIAATKGP--PVLSMSERLVLVSGLKWVDEVITD  136

Query  182  APWEVTKDMIT----TFDISLVVHG  244
            AP+ +T+  +      + I  V+HG
Sbjct  137  APYAITEQFLNRLFHEYKIDYVIHG  161



>ref|XP_009342823.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Pyrus 
x bretschneideri]
Length=419

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 130/155 (84%), Gaps = 1/155 (1%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEIL+ AR LGDFLLVGIH D+TVS  RG + PIM+LHERSLSVL CRYVDEVIIG
Sbjct  266  HAGHVEILKNARQLGDFLLVGIHNDETVSEHRGKY-PIMHLHERSLSVLGCRYVDEVIIG  324

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEVT DMITTF+IS VVHGTV+EY+       +PY+VP SMGI K+LESP+ ITT+++
Sbjct  325  APWEVTVDMITTFNISSVVHGTVSEYNFSLTGESDPYSVPKSMGIFKLLESPISITTTSV  384

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
             +RI++NHDAYLKRN KK ESEK+YY  K+Y+SGD
Sbjct  385  SQRIIANHDAYLKRNAKKNESEKKYYAQKTYVSGD  419


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 52/85 (61%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A++LGD L+VG+ +D+ + A +G   P++++ ER   V   ++VD+VI  
Sbjct  77   HYGHANALRQAKALGDELVVGVVSDEEIIANKGP--PVLSMEERLALVSGLKWVDQVITN  134

Query  182  APWEVTKD----MITTFDISLVVHG  244
            AP+E+T+     + +   I  ++HG
Sbjct  135  APYEITEQFMGKLFSEHKIDYIIHG  159



>ref|XP_011094065.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Sesamum 
indicum]
 ref|XP_011094066.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Sesamum 
indicum]
Length=427

 Score =   211 bits (538),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEIL+ AR LGDFLLVGI+ DQTVS  RG H P+MNLHERSLSVLACRYVDEVIIG
Sbjct  273  HAGHVEILKRARQLGDFLLVGIYADQTVSELRGNHFPLMNLHERSLSVLACRYVDEVIIG  332

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEVTKDMITTF+ISLVVHGT+AE +       +PY VP SMGI ++LESP DITT++I
Sbjct  333  APWEVTKDMITTFNISLVVHGTIAEKNPLLNGESDPYVVPKSMGIFQMLESPEDITTTSI  392

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
              RI++NH+ YLKRN KK  SEK+YY  K Y++ D
Sbjct  393  AERIIANHEIYLKRNAKKEASEKKYYAEKKYVAVD  427


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 52/85 (61%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A++LGD L+VG+ +D+ + + +G   P++++ ER   V   ++VDEVI  
Sbjct  77   HYGHANALRQAKALGDELVVGVVSDEEIISNKGP--PVLSMQERLALVSGLKWVDEVIPN  134

Query  182  APWEVTKDMITTF----DISLVVHG  244
            AP+E+T++ +        I  ++HG
Sbjct  135  APYEITEEFMNRLFKEHKIDYIIHG  159



>ref|XP_011020099.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Populus 
euphratica]
Length=423

 Score =   211 bits (538),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVG+HTDQ VS  RG   PIM+LHERSLSVLAC YVDEVIIG
Sbjct  269  HAGHVEILRSARQLGDFLLVGVHTDQIVSEHRGKGHPIMHLHERSLSVLACSYVDEVIIG  328

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEVT+DM+TTF+ISLVVHGTVAE +       +PYAVP SMGI  +L+SP + TT+++
Sbjct  329  APWEVTRDMVTTFNISLVVHGTVAESNSLLAGEPDPYAVPKSMGIFWMLDSPKNTTTTSV  388

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
             +RIV+NH+AYLKRN KK ESEK+YY  K ++SGD
Sbjct  389  AQRIVANHEAYLKRNAKKTESEKKYYAEKVHVSGD  423


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 51/85 (60%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A++LGD L+VG+ +D+ + A +G   P++++ ER   V   ++VDEVI  
Sbjct  77   HYGHANALRQAKALGDELVVGVVSDEEIVANKGP--PVLSMEERLALVSGLKWVDEVIAN  134

Query  182  APWEVTKDMITTF----DISLVVHG  244
            AP+ +T+  + +      I  ++HG
Sbjct  135  APYAITEKFMNSLFNEHKIDYIIHG  159



>emb|CCW28789.1| putative cytidylyltransferase [Arachis duranensis]
Length=400

 Score =   211 bits (536),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 133/156 (85%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEIL+ AR LGDFLLVGIH+D+TVS+ RG H PIM+LHERSLSVLAC YVDEVIIG
Sbjct  248  HAGHVEILKKARQLGDFLLVGIHSDETVSSQRGNHYPIMHLHERSLSVLACGYVDEVIIG  307

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWE+TKDMITTF+IS VVHGTVAE S  ++   +PY VP SMGI  +LESP DITT+++
Sbjct  308  APWEITKDMITTFNISAVVHGTVAEKSLSER---DPYEVPKSMGIFHLLESPKDITTTSV  364

Query  362  irriVSNHDAY-LKRNEKKVESEKRYYEGKSYISGD  466
             +RI++NH+AY +KRN KK +SEKRYYE K+Y++GD
Sbjct  365  AQRIMANHEAYVVKRNAKKAQSEKRYYEEKTYVTGD  400


 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 53/85 (62%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A++LGD L+VG+ +D+ + A +G   P++++ ER   V   ++VDEVI  
Sbjct  59   HYGHANALRQAKALGDELVVGLVSDEEILANKGP--PVLSMEERLTLVSGLKWVDEVITD  116

Query  182  APWEVTKDMIT----TFDISLVVHG  244
            AP+ +T++ +      ++I  V+HG
Sbjct  117  APYAITEEFLNRLFYEYNIDYVIHG  141



>ref|XP_002325231.2| hypothetical protein POPTR_0018s13260g [Populus trichocarpa]
 gb|EEF03796.2| hypothetical protein POPTR_0018s13260g [Populus trichocarpa]
Length=423

 Score =   211 bits (537),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVGIHTDQ VS  RG   PIM+LHERSLSVLACRYVDEVIIG
Sbjct  269  HAGHVEILRSARQLGDFLLVGIHTDQIVSEHRGKGHPIMHLHERSLSVLACRYVDEVIIG  328

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEVTKDM+TTF+I+LVVHGTVAE +       +PYAVP SM I ++L+SP  ITT+++
Sbjct  329  APWEVTKDMVTTFNITLVVHGTVAENNSLLAGEPDPYAVPKSMRIFRMLDSPKTITTTSV  388

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
             +RIV+NH+AY+KRN KK E+EK+YY  K Y+SGD
Sbjct  389  AQRIVANHEAYVKRNAKKAENEKKYYAEKVYVSGD  423


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 51/85 (60%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A++LGD L+VG+ +D+ + A +G   P++++ ER   V   ++VDEVI  
Sbjct  77   HYGHANALRQAKALGDELVVGVVSDEEIVANKGP--PVLSMEERLALVSGLKWVDEVIAD  134

Query  182  APWEVTKDMITTF----DISLVVHG  244
            AP+ +T+  + +      I  ++HG
Sbjct  135  APYAITEKFMNSLFNEHKIDYIIHG  159



>ref|XP_009616437.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X3 [Nicotiana tomentosiformis]
Length=426

 Score =   211 bits (536),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVG++TDQTVS  RG   P+MNLHERSLSVLACRYVDEVIIG
Sbjct  272  HAGHVEILRSARQLGDFLLVGVYTDQTVSELRGHQYPLMNLHERSLSVLACRYVDEVIIG  331

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            +PWEVT+DM+TTF+IS+VVHGTV++ +    E  +PYAVP +MGI +V++SP DITT+++
Sbjct  332  SPWEVTQDMVTTFNISVVVHGTVSDRNTSTGERHDPYAVPKNMGIFRVIDSPKDITTTSV  391

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
             +RI++NH+ Y+KRN KK  SEK+YY  K Y+SGD
Sbjct  392  AQRIIANHEIYVKRNTKKEASEKKYYAEKQYVSGD  426


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 50/85 (59%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   +R A++LGD L+VG+ +D+ + A +G   P++ + ER   V   ++VDEVI  
Sbjct  77   HYGHANAIRQAKALGDELVVGVVSDEEIVANKGP--PVLCMEERLALVSGLKWVDEVIAN  134

Query  182  APWEVTKDMITTF----DISLVVHG  244
            AP+ +T+D +        I  ++HG
Sbjct  135  APYAITEDFMNRLFNEHKIDYIIHG  159



>ref|XP_004240130.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Solanum 
lycopersicum]
 ref|XP_010321543.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Solanum 
lycopersicum]
Length=427

 Score =   211 bits (536),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVG++TD+T+S  RG   P+MNLHERSLSVLACRYVDEVIIG
Sbjct  273  HAGHVEILRSARQLGDFLLVGVYTDETISELRGHQYPLMNLHERSLSVLACRYVDEVIIG  332

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEVT DM+TTF+IS+VVHGTV+E +    E  +PYAVP +MGI +V+ESP DI T+++
Sbjct  333  APWEVTHDMVTTFNISVVVHGTVSERNSSTGEEHDPYAVPKNMGIFRVIESPKDIITTSV  392

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
             +RI++NH+ Y+KRN KK  SEK+YY  K Y+SGD
Sbjct  393  AQRIIANHEIYVKRNTKKEASEKKYYAEKRYVSGD  427


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 50/85 (59%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   +R A+ LGD L+VG+ +D+ + A +G   P++ + ER   V   ++VDEVI  
Sbjct  77   HYGHANAIRQAKELGDELIVGVVSDEEIVANKGP--PVLCMEERLALVSGLKWVDEVIAN  134

Query  182  APWEVTKD----MITTFDISLVVHG  244
            AP+ +T+D    + T   I  ++HG
Sbjct  135  APYAITEDFMNRLFTEHKIDYIIHG  159



>ref|XP_010106955.1| Ethanolamine-phosphate cytidylyltransferase [Morus notabilis]
 gb|EXC12837.1| Ethanolamine-phosphate cytidylyltransferase [Morus notabilis]
Length=421

 Score =   209 bits (533),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEIL+ AR LGDFLLVG+H D TVS  RG H PIM+LHERSLSVLACRYVDEVIIG
Sbjct  267  HAGHVEILKNARQLGDFLLVGMHDDHTVSEHRGKHYPIMHLHERSLSVLACRYVDEVIIG  326

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEVTKD+I TF+ISLVVHGT++E         +PY+VP SMGI ++LESP +ITT+++
Sbjct  327  APWEVTKDVIATFNISLVVHGTISESDSPLTRETDPYSVPKSMGIFQLLESPKNITTTSV  386

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
             +RI++NH+AY KRN KK ESEK+YY  K Y+SGD
Sbjct  387  AQRIIANHEAYTKRNAKKAESEKKYYAEKKYVSGD  421


 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 50/85 (59%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A++LGD L+VG+ +D+ + A +G   P++++ ER   V   ++VDEVI  
Sbjct  77   HYGHANALRQAKALGDELVVGVVSDEEIIANKGP--PVLSMEERLSLVSGLKWVDEVIAN  134

Query  182  APWEVTKDMITTF----DISLVVHG  244
            AP+ +T+  +        I  ++HG
Sbjct  135  APYAITEQFMNKLFNEHKIDYIIHG  159



>ref|XP_003525313.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase isoform 
X1 [Glycine max]
 ref|XP_006580492.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase isoform 
X2 [Glycine max]
 gb|KHM99852.1| Ethanolamine-phosphate cytidylyltransferase [Glycine soja]
Length=420

 Score =   209 bits (532),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 130/155 (84%), Gaps = 2/155 (1%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEIL+ AR LGDFLLVGIH+D+TVS  RG H PIM+LHERSLSVLACRYVDEVIIG
Sbjct  268  HAGHVEILKRARELGDFLLVGIHSDETVSEHRGNHYPIMHLHERSLSVLACRYVDEVIIG  327

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            +PWE+T DMITTF+IS+VVHGTV+E S       +PY +P SMGI ++LESP DITT+T+
Sbjct  328  SPWEITNDMITTFNISVVVHGTVSEKS--LNCELDPYEIPKSMGIFRLLESPKDITTATV  385

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
             +RI++NH+AY+KRN KK  SE+RYYE K Y+SGD
Sbjct  386  AQRIMANHEAYVKRNAKKTRSEQRYYEEKKYVSGD  420


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 51/85 (60%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A++LGD L+VG+ +D+ + A +G   P++++ ER   V   ++VDEVI  
Sbjct  79   HYGHANALRQAKALGDELVVGLVSDEEIVANKGP--PVLSMEERLALVSGLKWVDEVITD  136

Query  182  APWEVTKDMIT----TFDISLVVHG  244
            AP+ +T+  +      + I  V+HG
Sbjct  137  APYAITEQFLNRLFHEYKIDYVIHG  161



>ref|XP_006361583.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006361584.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X2 [Solanum tuberosum]
Length=429

 Score =   209 bits (532),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR  GDFLLVGI+ DQTVS  RG   P+MNL+ERSL VLACRYVDEVIIG
Sbjct  275  HAGHVEILRSARQHGDFLLVGIYPDQTVSELRGHQYPLMNLYERSLGVLACRYVDEVIIG  334

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEVT+DMITTF+ISLVVHGTV+E +   +  ++PYAVP SMGI +V+ESP DITTS++
Sbjct  335  APWEVTQDMITTFNISLVVHGTVSESNSSTEGGQDPYAVPKSMGIFQVIESPKDITTSSV  394

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
             +RI++NH+ Y+KRN KK  SEK+YY  + Y+SGD
Sbjct  395  AQRIIANHEIYVKRNTKKAASEKKYYAERKYVSGD  429


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 52/85 (61%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A++LGD L+VG+ +D+ + AT+G   P++ + ER   V   ++VDEVI  
Sbjct  77   HYGHANALRQAKALGDELVVGVVSDEEIIATKGP--PVLCMEERLALVSGLKWVDEVISS  134

Query  182  APWEVTKD----MITTFDISLVVHG  244
            AP+ +T+D    +   + I  ++HG
Sbjct  135  APYAITEDFMNRLFNEYKIDYIIHG  159



>ref|XP_003530503.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Glycine max]
 ref|XP_006584793.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X2 [Glycine max]
 gb|KHN16693.1| Ethanolamine-phosphate cytidylyltransferase [Glycine soja]
Length=420

 Score =   209 bits (531),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 129/155 (83%), Gaps = 2/155 (1%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEIL+ AR LGDFLLVGIH+D+TVS  RG H PIM+LHERSLSVLACRYVDEVIIG
Sbjct  268  HAGHVEILKRARELGDFLLVGIHSDETVSEHRGNHYPIMHLHERSLSVLACRYVDEVIIG  327

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            +PWE+T DMITTF+IS+VVHGTVAE +       +PY VP SMGI  +LESP DITT+T+
Sbjct  328  SPWEITNDMITTFNISVVVHGTVAEKT--LNCELDPYEVPKSMGIFHLLESPKDITTATV  385

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
             +RI++NH+AY+KRN KK  SE+RYYE K Y+SGD
Sbjct  386  AQRIMANHEAYVKRNAKKTRSEQRYYEEKKYVSGD  420


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 51/85 (60%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A++LGD L+VG+ +D+ + A +G   P++++ ER   V   ++VDEVI  
Sbjct  79   HYGHANALRQAKALGDELVVGLVSDEEIVANKGP--PVLSMEERLALVSGLKWVDEVITD  136

Query  182  APWEVTKDMIT----TFDISLVVHG  244
            AP+ +T+  +      + I  V+HG
Sbjct  137  APYAITEQFLNRLFHEYKIDYVIHG  161



>ref|XP_006360666.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Solanum 
tuberosum]
Length=427

 Score =   209 bits (531),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFL VG++TD+T+S  RG   P++NLHERSLSVLACRYVDEVIIG
Sbjct  273  HAGHVEILRSARQLGDFLFVGVYTDETISELRGHQYPLLNLHERSLSVLACRYVDEVIIG  332

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEVT DM+TTF+IS+VVHGTV+E +    E  +PYAVP +MGI +++ESP DITT+++
Sbjct  333  APWEVTHDMVTTFNISVVVHGTVSERNSSTGEEHDPYAVPKNMGIFRIIESPKDITTTSV  392

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
             +RI++NH+ Y+KRN KK  SEK+YY  K Y+SGD
Sbjct  393  AQRIIANHEIYVKRNSKKEASEKKYYAEKQYVSGD  427


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 50/85 (59%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   +R A+ LGD L+VG+ +D+ + A +G   P++ + ER   +   ++VDEVI  
Sbjct  77   HYGHANAIRQAKELGDELIVGVVSDEEIVANKGP--PVLCMEERLALISGLKWVDEVIAN  134

Query  182  APWEVTKD----MITTFDISLVVHG  244
            AP+ +T+D    + T   I  ++HG
Sbjct  135  APYAITEDFMNRLFTEHKIDYIIHG  159



>ref|XP_010048543.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010048544.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010048545.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010048546.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Eucalyptus 
grandis]
 gb|KCW80818.1| hypothetical protein EUGRSUZ_C02186 [Eucalyptus grandis]
Length=418

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEIL+ AR LGDFLLVG+HTD  VS  RG H PIM+LHERSLSVLACRYVDEVIIG
Sbjct  264  HAGHVEILKRARQLGDFLLVGLHTDYIVSEHRGKHHPIMHLHERSLSVLACRYVDEVIIG  323

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV+KDMITTF+ISLVVHGT+AE +       +PYAVP SMGI ++LES  +ITTS+I
Sbjct  324  APWEVSKDMITTFNISLVVHGTIAESNPLALVGIDPYAVPKSMGIFRLLESSNNITTSSI  383

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
             +RIV+NH+AY+KRN KK E E++YY  K Y++G+
Sbjct  384  AQRIVANHEAYMKRNAKKAEGERKYYAEKKYVAGN  418


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 49/85 (58%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A++LGD L+VG+ +D+ + A +G   P++ + ER   V   ++VDEVI  
Sbjct  78   HYGHANALRQAKALGDELVVGVVSDEEIVANKGP--PVLTMEERLALVSGLKWVDEVIPN  135

Query  182  APWEVT----KDMITTFDISLVVHG  244
            AP+ +T    K +     I  ++HG
Sbjct  136  APYAITEQFMKSLFNEHKIDYIIHG  160



>gb|ACJ85759.1| unknown [Medicago truncatula]
 gb|AFK45819.1| unknown [Medicago truncatula]
Length=418

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 131/155 (85%), Gaps = 2/155 (1%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHV++L+ AR LGDFLLVGIH+D+TVS  RG H PIM+LHERSLSVLA RYVDEVIIG
Sbjct  266  HAGHVQMLKRARELGDFLLVGIHSDETVSENRGNHYPIMHLHERSLSVLASRYVDEVIIG  325

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            AP E+TKDMITTF+ISLVVHGTVAE S      ++PY VP S+GI ++LESP DITT+++
Sbjct  326  APLEITKDMITTFNISLVVHGTVAEKS--LPSEKDPYEVPKSIGIFRLLESPKDITTTSV  383

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
             +RI++NHDAY+KRN KK +SEKRYYE + Y+SGD
Sbjct  384  AQRIMANHDAYVKRNAKKAKSEKRYYEERKYVSGD  418


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 52/85 (61%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A++LGD L+VG+ +D+ + A +G   P++++ ER   V   ++VDEVI  
Sbjct  77   HYGHANALRQAKALGDELVVGLVSDEEIVANKGP--PVLSMDERLALVSGLKWVDEVITD  134

Query  182  APWEVTKDMIT----TFDISLVVHG  244
            AP+ +T+  +      ++I  V+HG
Sbjct  135  APYAITETFLNRLFHEYNIDYVIHG  159



>ref|XP_003630619.1| Ethanolamine-phosphate cytidylyltransferase [Medicago truncatula]
 gb|AET05095.1| ethanolamine-phosphate cytidylyltransferase [Medicago truncatula]
Length=418

 Score =   207 bits (526),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 131/155 (85%), Gaps = 2/155 (1%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHV++L+ AR LGDFLLVGIH+D+TVS  RG H PIM+LHERSLSVLA RYVDEVIIG
Sbjct  266  HAGHVQMLKRARELGDFLLVGIHSDETVSENRGNHYPIMHLHERSLSVLASRYVDEVIIG  325

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            AP E+TKDMITTF+ISLVVHGTVAE S      ++PY VP S+GI ++LESP DITT+++
Sbjct  326  APLEITKDMITTFNISLVVHGTVAEKS--LPSEKDPYEVPKSIGIFRLLESPKDITTTSV  383

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
             +RI++NHDAY+KRN KK +SEKRYYE + Y+SGD
Sbjct  384  AQRIMANHDAYVKRNAKKAKSEKRYYEERKYVSGD  418


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 52/85 (61%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A++LGD L+VG+ +D+ + A +G   P++++ ER   V   ++VDEVI  
Sbjct  77   HYGHANALRQAKALGDELVVGLVSDEEIVANKGP--PVLSMDERLALVSGLKWVDEVITD  134

Query  182  APWEVTKDMIT----TFDISLVVHG  244
            AP+ +T+  +      ++I  V+HG
Sbjct  135  APYAITETFLNRLFHEYNIDYVIHG  159



>ref|XP_006428518.1| hypothetical protein CICLE_v10011809mg [Citrus clementina]
 ref|XP_006491802.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Citrus sinensis]
 ref|XP_006491803.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X2 [Citrus sinensis]
 gb|ESR41758.1| hypothetical protein CICLE_v10011809mg [Citrus clementina]
 gb|KDO54353.1| hypothetical protein CISIN_1g0144871mg [Citrus sinensis]
 gb|KDO54354.1| hypothetical protein CISIN_1g0144871mg [Citrus sinensis]
Length=423

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEIL+ AR LGDFLLVGI+TDQ VS  RG++ PIM+LHERSLSVLACRYVDEVIIG
Sbjct  269  HAGHVEILKKARQLGDFLLVGIYTDQIVSEHRGSYHPIMHLHERSLSVLACRYVDEVIIG  328

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEVTKDMITTF+I LVVHGTV+E +       +PY V  SMGI ++LESP  ITT+++
Sbjct  329  APWEVTKDMITTFNICLVVHGTVSETNTPLTGQSDPYEVAKSMGIFQLLESPKSITTTSV  388

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
             +RI++NH+AY+KRN KK  SEK+YYE K ++SGD
Sbjct  389  AQRIIANHEAYMKRNAKKAVSEKKYYEQKMFVSGD  423


 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 50/85 (59%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A++LGD L+VG+ +D+ + A +G   P++++ ER   V   ++VDEVI  
Sbjct  78   HYGHANALRQAKALGDELVVGVVSDEEIIANKGP--PVLSMEERLALVSGLKWVDEVIAN  135

Query  182  APWEVTKDMITTF----DISLVVHG  244
            AP+ +T+  +        I  ++HG
Sbjct  136  APYAITEQFMNRLFNEHKIDYIIHG  160



>ref|XP_010688423.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Beta 
vulgaris subsp. vulgaris]
Length=428

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVGI+TDQ VS  RG   P+MNLHERSLSVL CRYVDE+I+G
Sbjct  274  HAGHVEILRAARQLGDFLLVGIYTDQAVSDIRGLGYPLMNLHERSLSVLGCRYVDEIIMG  333

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEVTKDMI TF+I LVVHGTV+E +       +PY VP SMGI +++ESP +ITTS++
Sbjct  334  APWEVTKDMIKTFNICLVVHGTVSEANPLVNGDTDPYRVPKSMGIFRMIESPKNITTSSV  393

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
              RI++NH+ Y KRN KKVESEK+YY+ K+Y+SGD
Sbjct  394  AHRIITNHEVYKKRNAKKVESEKKYYDQKTYVSGD  428


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 52/85 (61%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A++LGD L+VG+ +D+ + A +G   P++++ ER   V   ++VDEVI  
Sbjct  77   HYGHANALRQAKALGDELVVGVVSDEEILANKGP--PVLSMEERLALVGGLKWVDEVIPN  134

Query  182  APWEVTKDMITT----FDISLVVHG  244
            AP+ +T+  + T    + I  ++HG
Sbjct  135  APYAITEQFMKTLFKEYKIDYIIHG  159



>ref|XP_004242864.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Solanum 
lycopersicum]
 ref|XP_010323368.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Solanum 
lycopersicum]
Length=429

 Score =   207 bits (526),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEIL+ AR  GDFLLVGI+ DQTVS  RG   P+MNL+ERSL VLACRYVDEVIIG
Sbjct  275  HAGHVEILKSARQHGDFLLVGIYPDQTVSELRGHQYPLMNLYERSLGVLACRYVDEVIIG  334

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEVT+DMITTF+ISLVVHGTV+E +   +  ++PYAVP SMGI +V+ESP DITTS++
Sbjct  335  APWEVTQDMITTFNISLVVHGTVSESNFSTEGGQDPYAVPKSMGIFQVIESPKDITTSSV  394

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
             +RI++NH+ Y+KRN KK  SEK+YY  + Y+SGD
Sbjct  395  AQRIIANHEIYVKRNTKKAASEKKYYAERKYVSGD  429


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 52/85 (61%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A++LGD L+VG+ +D+ + AT+G   P++ + ER   V   ++VDEVI  
Sbjct  77   HYGHANALRQAKALGDELVVGVVSDEEIIATKGP--PVLCMEERLALVSGLKWVDEVISS  134

Query  182  APWEVTKD----MITTFDISLVVHG  244
            AP+ +T+D    +   + I  ++HG
Sbjct  135  APYAITEDFMNHLFNEYKIDYIIHG  159



>ref|XP_003630620.1| Ethanolamine-phosphate cytidylyltransferase [Medicago truncatula]
Length=431

 Score =   207 bits (526),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 131/155 (85%), Gaps = 2/155 (1%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHV++L+ AR LGDFLLVGIH+D+TVS  RG H PIM+LHERSLSVLA RYVDEVIIG
Sbjct  279  HAGHVQMLKRARELGDFLLVGIHSDETVSENRGNHYPIMHLHERSLSVLASRYVDEVIIG  338

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            AP E+TKDMITTF+ISLVVHGTVAE S      ++PY VP S+GI ++LESP DITT+++
Sbjct  339  APLEITKDMITTFNISLVVHGTVAEKS--LPSEKDPYEVPKSIGIFRLLESPKDITTTSV  396

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
             +RI++NHDAY+KRN KK +SEKRYYE + Y+SGD
Sbjct  397  AQRIMANHDAYVKRNAKKAKSEKRYYEERKYVSGD  431


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 52/85 (61%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A++LGD L+VG+ +D+ + A +G   P++++ ER   V   ++VDEVI  
Sbjct  77   HYGHANALRQAKALGDELVVGLVSDEEIVANKGP--PVLSMDERLALVSGLKWVDEVITD  134

Query  182  APWEVTKDMIT----TFDISLVVHG  244
            AP+ +T+  +      ++I  V+HG
Sbjct  135  APYAITETFLNRLFHEYNIDYVIHG  159



>gb|ABX10445.1| ethanolamine-phosphate cytidylyltransferase 1 [Gossypium hirsutum]
Length=384

 Score =   206 bits (523),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEIL+ AR LGDFLLVGIHTD  V   RG   P+M++HERSLSVLACRYVDEVIIG
Sbjct  230  HAGHVEILKKARQLGDFLLVGIHTDHIVREHRGMPYPVMHVHERSLSVLACRYVDEVIIG  289

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEVTKDMITTF+IS+VVHGTVAE +       +PYA P SMGI ++LESP  +TTS++
Sbjct  290  APWEVTKDMITTFNISIVVHGTVAESNSLLPGETDPYAFPKSMGIFRLLESPKSLTTSSV  349

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
             +RIV+NH+AY+KRN KK +SE +YYE K+Y++G+
Sbjct  350  SQRIVANHEAYVKRNAKKAQSEMKYYEEKTYVAGE  384


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 50/85 (59%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A++LGD L+VG+ +D+ + A +G   P++ + ER   V   ++VD+VI  
Sbjct  39   HYGHANALRQAKTLGDELVVGVVSDEEIIANKGP--PVLPMEERLALVSGLKWVDQVIAN  96

Query  182  APWEVTKDMITTF----DISLVVHG  244
            AP+ +T+  + +      I  ++HG
Sbjct  97   APYAITEQFMNSLFNEHKIDYIIHG  121



>gb|EYU25735.1| hypothetical protein MIMGU_mgv1a007058mg [Erythranthe guttata]
 gb|EYU25736.1| hypothetical protein MIMGU_mgv1a007058mg [Erythranthe guttata]
 gb|EYU25737.1| hypothetical protein MIMGU_mgv1a007058mg [Erythranthe guttata]
Length=421

 Score =   206 bits (525),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEIL+ AR LGDFLLVG++ D TVS  RG+H P+MNLHERSLSVLACRYVDEVIIG
Sbjct  267  HAGHVEILKSARQLGDFLLVGVYADHTVSELRGSHFPLMNLHERSLSVLACRYVDEVIIG  326

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEVTKDMITTF+ISLVVHGT++E + +     +PYA+P S GI ++L+SP DIT+++I
Sbjct  327  APWEVTKDMITTFNISLVVHGTISENNPFLNGKSDPYALPKSTGIFQMLDSPKDITSTSI  386

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
             RRI++NH+ Y KRN KK  SEK+YY  K Y+S D
Sbjct  387  ARRIIANHEIYEKRNAKKEASEKKYYAEKKYVSAD  421


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 52/85 (61%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A++LGD L+VG+ +D+ + A +G   P++++ ER   V   ++VDEVI  
Sbjct  77   HYGHANALRQAKALGDELVVGVVSDEEIIANKGP--PVLSMPERLALVSGLKWVDEVIPN  134

Query  182  APWEVTKDMITTF----DISLVVHG  244
            AP+E+T++ +        I  ++HG
Sbjct  135  APYEITEEFMNRLFKEHKIDYIIHG  159



>gb|KHG01776.1| Ethanolamine-phosphate cytidylyltransferase [Gossypium arboreum]
Length=425

 Score =   205 bits (522),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEIL+ AR LGDFLLVGIHTD  V   RG   P+M++HERSLSVLACRYVDEVIIG
Sbjct  271  HAGHVEILKKARQLGDFLLVGIHTDHIVREHRGMPYPVMHVHERSLSVLACRYVDEVIIG  330

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEVTKDMITTF+IS+VVHGTVAE +       +PYA P SMGI ++LESP  +TTS++
Sbjct  331  APWEVTKDMITTFNISIVVHGTVAESNSLLPGETDPYAFPKSMGIFRLLESPKSLTTSSV  390

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
             +RIV+NH+AY+KRN KK +SE +YYE K+Y++G+
Sbjct  391  SQRIVANHEAYVKRNAKKAQSEMKYYEEKTYVAGE  425


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 50/85 (59%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A++LGD L+VG+ +D+ + A +G   P++ + ER   V   ++VD+VI  
Sbjct  80   HYGHANALRQAKALGDELVVGVVSDEEIIANKGP--PVLPMEERLALVSGLKWVDQVIAN  137

Query  182  APWEVTKDMITTF----DISLVVHG  244
            AP+ +T+  + +      I  ++HG
Sbjct  138  APYAITEQFMNSLFNEHKIDYIIHG  162



>ref|XP_011094071.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Sesamum 
indicum]
 ref|XP_011094072.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Sesamum 
indicum]
Length=427

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEIL+ A+ LGDFLLVGI+ D TVS  RG + P+MNLHERSLSVLACRYVDEVIIG
Sbjct  273  HAGHVEILKSAKQLGDFLLVGIYADHTVSELRGINFPLMNLHERSLSVLACRYVDEVIIG  332

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEVTKDMITTF+ISLVVHGT+AE +       +PYAVP +MGI +++ESP DITT++I
Sbjct  333  APWEVTKDMITTFNISLVVHGTIAEKNPLSIGKSDPYAVPKNMGIFQMIESPKDITTTSI  392

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
             RRI++NH+ YLKRN KK  SEK+YY  K Y+  D
Sbjct  393  ARRIIANHEIYLKRNAKKEASEKKYYAEKKYVLAD  427


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 52/85 (61%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A++LGD L+VG+ +D+ + + +G   P++++ ER   V   ++VDEVI  
Sbjct  77   HYGHANALRQAKALGDELVVGVVSDEEIISNKGP--PVLSMQERLALVSGLKWVDEVIPN  134

Query  182  APWEVTKDMITTF----DISLVVHG  244
            AP+E+T+D +        I  ++HG
Sbjct  135  APYEITEDFMNRLFKEHKIDYIIHG  159



>emb|CDY14442.1| BnaC03g21530D [Brassica napus]
Length=426

 Score =   204 bits (519),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVGIH DQTVS  RGA  PIMNLHERSLSVLACRYVDEVIIG
Sbjct  260  HAGHVEILRRARELGDFLLVGIHNDQTVSGKRGAQHPIMNLHERSLSVLACRYVDEVIIG  319

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV+KD ITTFDI  VVHGTVAE  D+QKE  NPYAVP SMGI +VLESPLDI+TSTI
Sbjct  320  APWEVSKDTITTFDIWKVVHGTVAESDDFQKEEGNPYAVPKSMGIFEVLESPLDISTSTI  379

Query  362  irriVSNHDAY  394
            I+RIV+NH+AY
Sbjct  380  IKRIVANHEAY  390


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 52/85 (61%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D+ + A +G   P+  LHER + V A ++VDEVI  
Sbjct  61   HYGHCNALRQARALGDQLVVGVVSDEEIIANKGP--PVTPLHERMIMVKAVKWVDEVIPD  118

Query  182  APWEVT----KDMITTFDISLVVHG  244
            AP+ +T    K +   + I  ++HG
Sbjct  119  APYAITEEFMKRLFDEYQIDYIIHG  143



>gb|KDO54355.1| hypothetical protein CISIN_1g0144871mg [Citrus sinensis]
Length=420

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 127/155 (82%), Gaps = 3/155 (2%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEIL+ AR LGDFLLVGI+TDQ V   RG++ PIM+LHERSLSVLACRYVDEVIIG
Sbjct  269  HAGHVEILKKARQLGDFLLVGIYTDQIV---RGSYHPIMHLHERSLSVLACRYVDEVIIG  325

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEVTKDMITTF+I LVVHGTV+E +       +PY V  SMGI ++LESP  ITT+++
Sbjct  326  APWEVTKDMITTFNICLVVHGTVSETNTPLTGQSDPYEVAKSMGIFQLLESPKSITTTSV  385

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
             +RI++NH+AY+KRN KK  SEK+YYE K ++SGD
Sbjct  386  AQRIIANHEAYMKRNAKKAVSEKKYYEQKMFVSGD  420


 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 50/85 (59%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A++LGD L+VG+ +D+ + A +G   P++++ ER   V   ++VDEVI  
Sbjct  78   HYGHANALRQAKALGDELVVGVVSDEEIIANKGP--PVLSMEERLALVSGLKWVDEVIAN  135

Query  182  APWEVTKDMITTF----DISLVVHG  244
            AP+ +T+  +        I  ++HG
Sbjct  136  APYAITEQFMNRLFNEHKIDYIIHG  160



>ref|XP_010913784.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010913785.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Elaeis guineensis]
Length=424

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 124/155 (80%), Gaps = 3/155 (2%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVG+H DQTVS  RG H P+M+LHERSLSVLACRYVDEVIIG
Sbjct  273  HAGHVEILRCARQLGDFLLVGVHGDQTVSERRGCH-PVMHLHERSLSVLACRYVDEVIIG  331

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEVT+DMITTF+ISLVVHGTVAE S       +PYA P SMGI K + SP +IT++++
Sbjct  332  APWEVTRDMITTFNISLVVHGTVAEGS--CNNEVDPYATPKSMGIFKTIASPKNITSTSV  389

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
             RRI+ NH+AY KRN KK +SE RYY  K ++S D
Sbjct  390  ARRIIDNHEAYKKRNAKKSKSENRYYAEKKFVSED  424


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 55/85 (65%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A++LGD L+VG+ +D+ + A +G   P++++ ER + V   ++VDEVI  
Sbjct  86   HYGHANALRQAKALGDELVVGVVSDEEIVANKGP--PVLSMEERLILVSGLKWVDEVIAN  143

Query  182  APWEVTKDMITT----FDISLVVHG  244
            AP+ +T++ + T    ++I  ++HG
Sbjct  144  APYAITEEFMNTLFNKYNIDYIIHG  168



>ref|XP_009616433.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009616434.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009616435.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Nicotiana tomentosiformis]
Length=442

 Score =   201 bits (510),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 104/171 (61%), Positives = 130/171 (76%), Gaps = 16/171 (9%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVG++TDQTVS  RG   P+MNLHERSLSVLACRYVDEVIIG
Sbjct  272  HAGHVEILRSARQLGDFLLVGVYTDQTVSELRGHQYPLMNLHERSLSVLACRYVDEVIIG  331

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            +PWEVT+DM+TTF+IS+VVHGTV++ +    E  +PYAVP +MGI +V++SP DITT+++
Sbjct  332  SPWEVTQDMVTTFNISVVVHGTVSDRNTSTGERHDPYAVPKNMGIFRVIDSPKDITTTSV  391

Query  362  irriVSNHDAYL----------------KRNEKKVESEKRYYEGKSYISGD  466
             +RI++NH+ Y+                KRN KK  SEK+YY  K Y+SGD
Sbjct  392  AQRIIANHEIYVEVTGSSRGNSLLKKCRKRNTKKEASEKKYYAEKQYVSGD  442


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 50/85 (59%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   +R A++LGD L+VG+ +D+ + A +G   P++ + ER   V   ++VDEVI  
Sbjct  77   HYGHANAIRQAKALGDELVVGVVSDEEIVANKGP--PVLCMEERLALVSGLKWVDEVIAN  134

Query  182  APWEVTKDMITTF----DISLVVHG  244
            AP+ +T+D +        I  ++HG
Sbjct  135  APYAITEDFMNRLFNEHKIDYIIHG  159



>ref|XP_009151252.1| PREDICTED: uncharacterized protein LOC103874581 [Brassica rapa]
Length=533

 Score =   199 bits (506),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 120/147 (82%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHV ILR AR LGDFLLVGIH DQTVSA RG H PIM++ ER LSV ACRYVDEVI G
Sbjct  346  HAGHVGILRRARELGDFLLVGIHNDQTVSAKRGGHPPIMSMQERILSVGACRYVDEVIFG  405

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV+K  IT F ISLVVHGTVAE  ++Q++ ENPYAVPISMGI ++LESPL+ITTSTI
Sbjct  406  APWEVSKITITFFGISLVVHGTVAESDNFQRKEENPYAVPISMGIFQILESPLNITTSTI  465

Query  362  irriVSNHDAYLKRNEKKVESEKRYYE  442
            + RIV+NH+AY KRN KK  S+ +  E
Sbjct  466  MGRIVANHEAYQKRNLKKEASDDKQME  492



>ref|XP_001780359.1| predicted protein [Physcomitrella patens]
 gb|EDQ54813.1| predicted protein [Physcomitrella patens]
Length=393

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 128/155 (83%), Gaps = 2/155 (1%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVE L+ AR++GDFLLVGIH+DQ VSA RG + PIM+LHERSLSVLACRYVDEVIIG
Sbjct  241  HAGHVETLKAARAMGDFLLVGIHSDQIVSANRGLNHPIMHLHERSLSVLACRYVDEVIIG  300

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEVTKDMITTF+ISLVVHG+ AE ++ +    +PY    + GI   ++SP +ITTSTI
Sbjct  301  APWEVTKDMITTFNISLVVHGSCAEENELRN--IDPYKAAKAAGIFAEIKSPRNITTSTI  358

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            I RI++NH+AY KRN+KK ESEK+YY  K+Y++GD
Sbjct  359  ISRILTNHEAYRKRNQKKEESEKQYYLSKTYVNGD  393


 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 53/85 (62%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR LGD L+VG+ +D+ + A +G   P+M++ ER + V + ++VDEVI  
Sbjct  43   HYGHANALRQARVLGDELVVGVISDEEIKANKGP--PVMSMDERVVMVSSVKWVDEVIQD  100

Query  182  APWEVTKD----MITTFDISLVVHG  244
            AP+E+  +    + T + I  ++HG
Sbjct  101  APYEINAEFMNKLFTEYKIDYIIHG  125



>ref|XP_004972545.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X4 [Setaria italica]
Length=466

 Score =   197 bits (501),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 123/155 (79%), Gaps = 3/155 (2%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVG+H DQ++   RG +RPIM+LHER+LSVLACRYVDEVIIG
Sbjct  315  HAGHVEILRSARQLGDFLLVGVHDDQSIRDRRG-YRPIMHLHERTLSVLACRYVDEVIIG  373

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV+KDMITTF+ISLVVHGTVAE +   +   +PYAVP SMGI K + SP  IT+ ++
Sbjct  374  APWEVSKDMITTFNISLVVHGTVAEGNPAGE--IDPYAVPKSMGIFKTITSPKSITSVSV  431

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
              RIV NH+AY KRN KK  SE RYY  K ++SGD
Sbjct  432  ATRIVDNHEAYKKRNLKKKASEDRYYTQKKFVSGD  466


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 53/85 (62%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A+ LGD L+VG+ +D+ + A +G   P++++ ER   V   ++VDEVI  
Sbjct  124  HYGHANALRQAKLLGDQLVVGVVSDEEIVANKGP--PVLSMEERLTLVSGLKWVDEVIPN  181

Query  182  APWEVTKDMITT----FDISLVVHG  244
            AP+E+T++ + T    + I  ++HG
Sbjct  182  APYEITEEFMNTLFNKYSIDYIIHG  206



>ref|XP_001759318.1| predicted protein [Physcomitrella patens]
 gb|EDQ76002.1| predicted protein [Physcomitrella patens]
Length=422

 Score =   196 bits (498),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 105/158 (66%), Positives = 128/158 (81%), Gaps = 3/158 (2%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GHVE L+ AR++GDFLLVGIH+DQ VSA RG + PIM++HERSLSVLACRYVDEVIIG
Sbjct  265  HVGHVETLKAARAMGDFLLVGIHSDQIVSAHRGPNHPIMHVHERSLSVLACRYVDEVIIG  324

Query  182  APWEVTKDMITTFDISLVVHGTVAEYS---DYQKEAENPYAVPISMGILKVLESPLDitt  352
            APWEVTKDMITTF+ISLVVHGT AE +    +++   +PY+   + GI   ++SP DITT
Sbjct  325  APWEVTKDMITTFNISLVVHGTCAEENFVLPWRQGEIDPYSAAKAAGIFSEIKSPRDITT  384

Query  353  stiirriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            STII RI++NHDAY KRN+KK ESEK YY  K+Y++GD
Sbjct  385  STIISRILANHDAYKKRNKKKEESEKNYYLSKTYVNGD  422


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 53/85 (62%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D+ + A +G   P+M++ ER + V + ++VDEVI  
Sbjct  67   HYGHANALRQARALGDELVVGVMSDEEIKANKGP--PVMSMDERVVMVSSVKWVDEVIQD  124

Query  182  APWEVT----KDMITTFDISLVVHG  244
            AP+E+       + T + I  ++HG
Sbjct  125  APYEINVEFMNKLFTEYRIDYIIHG  149



>ref|XP_010928770.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X2 [Elaeis guineensis]
 ref|XP_010928771.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X2 [Elaeis guineensis]
 ref|XP_010928772.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X2 [Elaeis guineensis]
Length=419

 Score =   196 bits (497),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 122/155 (79%), Gaps = 3/155 (2%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVG+++DQTVS  RG H PIM+LHERSLSVLACRYVDEVIIG
Sbjct  268  HAGHVEILRCARQLGDFLLVGVYSDQTVSERRGCH-PIMHLHERSLSVLACRYVDEVIIG  326

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEVT+DMITTF+ISLVVHGTVAE S    +  +PY  P SMGI K + SP +IT +++
Sbjct  327  APWEVTRDMITTFNISLVVHGTVAEGS--CSDEVDPYVTPRSMGIFKTIASPNNITWTSV  384

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
             RRIV NH+ Y KRN KK ESE +YY  K ++  D
Sbjct  385  ARRIVDNHEVYKKRNVKKSESENKYYAEKKFVPED  419


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 55/85 (65%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A+SLGD L+VG+ +D+ + A +G   P++++ ER + V   ++VDEVI  
Sbjct  81   HYGHANALRQAKSLGDELVVGVVSDEEIVANKGP--PVLSMEERLILVSGLKWVDEVIAN  138

Query  182  APWEVTKDMITT----FDISLVVHG  244
            AP+ +T++ + T    ++I  ++HG
Sbjct  139  APYAITEEFMNTLFNKYNIDYIIHG  163



>ref|XP_008781724.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Phoenix 
dactylifera]
 ref|XP_008781725.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Phoenix 
dactylifera]
Length=420

 Score =   195 bits (495),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 123/155 (79%), Gaps = 3/155 (2%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVG+H+DQTVS   G H PIM+LHERSLSVLACRYVDEVIIG
Sbjct  269  HAGHVEILRCARQLGDFLLVGVHSDQTVSERIGCH-PIMHLHERSLSVLACRYVDEVIIG  327

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEVT+DMI+TF+ISLVVHGTVAE S       +PYA+P SMGI K + SP  IT++ +
Sbjct  328  APWEVTRDMISTFNISLVVHGTVAEGS--CNSEVDPYAIPKSMGIFKTIASPKVITSTLV  385

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
             RRI+ NH+AY KRN KK +SE +YY  K ++S D
Sbjct  386  ARRIMDNHEAYKKRNAKKSKSENKYYAEKKFVSED  420


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 55/85 (65%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A++LGD L+VG+ +D+ + A +G   P++++ ER + V   ++VDEVI  
Sbjct  82   HYGHANALRQAKALGDELVVGVVSDEEIVANKGP--PVLSMEERLILVSGLKWVDEVIAN  139

Query  182  APWEVTKDMITT----FDISLVVHG  244
            AP+ +T++ + T    ++I  ++HG
Sbjct  140  APYAITEEFMNTLFNKYNIDYIIHG  164



>ref|XP_010928769.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Elaeis guineensis]
Length=443

 Score =   195 bits (496),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 122/155 (79%), Gaps = 3/155 (2%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVG+++DQTVS  RG H PIM+LHERSLSVLACRYVDEVIIG
Sbjct  292  HAGHVEILRCARQLGDFLLVGVYSDQTVSERRGCH-PIMHLHERSLSVLACRYVDEVIIG  350

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEVT+DMITTF+ISLVVHGTVAE S    +  +PY  P SMGI K + SP +IT +++
Sbjct  351  APWEVTRDMITTFNISLVVHGTVAEGS--CSDEVDPYVTPRSMGIFKTIASPNNITWTSV  408

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
             RRIV NH+ Y KRN KK ESE +YY  K ++  D
Sbjct  409  ARRIVDNHEVYKKRNVKKSESENKYYAEKKFVPED  443


 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 55/85 (65%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A+SLGD L+VG+ +D+ + A +G   P++++ ER + V   ++VDEVI  
Sbjct  105  HYGHANALRQAKSLGDELVVGVVSDEEIVANKGP--PVLSMEERLILVSGLKWVDEVIAN  162

Query  182  APWEVTKDMITT----FDISLVVHG  244
            AP+ +T++ + T    ++I  ++HG
Sbjct  163  APYAITEEFMNTLFNKYNIDYIIHG  187



>ref|XP_006659222.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Oryza 
brachyantha]
Length=429

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 120/155 (77%), Gaps = 3/155 (2%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVG+H DQ +   RG +RPIM+LHER+LSVLACRYVDEVIIG
Sbjct  278  HAGHVEILRSARQLGDFLLVGVHDDQAIRDRRG-YRPIMHLHERTLSVLACRYVDEVIIG  336

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV++DMITTF+ISLVVHGTV E S       +PYAVP SMGI + + SP  ITT ++
Sbjct  337  APWEVSRDMITTFNISLVVHGTVTEGSSVG--GIDPYAVPKSMGIFQTITSPKPITTVSV  394

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
              RI+ NH+AY KRN KK  SE RYY  K ++SGD
Sbjct  395  ATRIIDNHEAYKKRNLKKKASEDRYYTQKKFVSGD  429


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 54/85 (64%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A+ LGD L+VG+ +D+ + A +G   P++++ ER   V   ++VDEVI  
Sbjct  82   HYGHANALRQAKVLGDQLVVGVVSDEEIVANKGP--PVLSMDERLTLVSGLKWVDEVIPN  139

Query  182  APWEVTKDMITT----FDISLVVHG  244
            AP+E+T++ + T    ++I  ++HG
Sbjct  140  APYEITEEFMNTLFNKYNIDYIIHG  164



>dbj|BAD03428.1| putative phosphoethanolamine cytidylyltransferase [Oryza sativa 
Japonica Group]
 gb|EEC83124.1| hypothetical protein OsI_28285 [Oryza sativa Indica Group]
 gb|EEE68256.1| hypothetical protein OsJ_26465 [Oryza sativa Japonica Group]
Length=428

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 120/155 (77%), Gaps = 3/155 (2%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVG+H DQ +   RG +RPIM+LHER+LSVLACRYVDEVIIG
Sbjct  277  HAGHVEILRSARQLGDFLLVGVHDDQAIRDRRG-YRPIMHLHERTLSVLACRYVDEVIIG  335

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV++DMITTF+ISLVVHGTV E S       +PYAVP SMGI + + SP  ITT ++
Sbjct  336  APWEVSRDMITTFNISLVVHGTVTEGSSVV--GIDPYAVPKSMGIFQTITSPKPITTVSV  393

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
              RI+ NH+AY KRN KK  SE RYY  K ++SGD
Sbjct  394  ATRIIDNHEAYKKRNLKKKASEDRYYTQKKFVSGD  428


 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 54/85 (64%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A+ LGD L+VG+ +D+ + A +G   P++++ ER   V   ++VDEVI  
Sbjct  81   HYGHANALRQAKLLGDQLVVGVVSDEEIVANKGP--PVLSMEERLTLVSGLKWVDEVIPN  138

Query  182  APWEVTKDMITT----FDISLVVHG  244
            AP+E+T++ + T    ++I  ++HG
Sbjct  139  APYEITEEFMNTLFNKYNIDYIIHG  163



>emb|CDP20190.1| unnamed protein product [Coffea canephora]
Length=429

 Score =   193 bits (490),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEIL+ AR LG+FLLVGI++D TVS  RG+H P+MNLHERSLSVL+CRYVDEVIIG
Sbjct  275  HAGHVEILKTARQLGEFLLVGIYSDHTVSELRGSHFPLMNLHERSLSVLSCRYVDEVIIG  334

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEVT DMI TF+IS VVHGTVAE S       +PYAVP SMGI +VLESP  ITTS++
Sbjct  335  APWEVTNDMIKTFNISFVVHGTVAESSSALNGKSDPYAVPKSMGIFRVLESPKTITTSSV  394

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
             +RI++NH+ Y+KRN KK  SEK+YYE K Y+SGD
Sbjct  395  AQRIIANHEIYVKRNAKKEASEKKYYEEKKYVSGD  429


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 52/85 (61%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A++LGD L+VG+ +D+ + A +G   P++++ ER   V   ++VDEVI+ 
Sbjct  77   HYGHANALRQAKALGDELVVGVVSDEEIVANKGP--PVLSMEERLALVSGLKWVDEVIVK  134

Query  182  APWEVTKDMITTF----DISLVVHG  244
            AP+ +T++ +        I  ++HG
Sbjct  135  APYAITEEFMNQLFNKHKIDYIIHG  159



>ref|XP_004171635.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Cucumis 
sativus]
Length=117

 Score =   183 bits (465),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = +2

Query  116  MNLHERSLSVLACRYVDEVIIGAPWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYA  295
            MNLHERSLSVLACRYVDEVIIGAPWEV+KDMITTF+ISLVVHGTVAE +D+QK   NPYA
Sbjct  1    MNLHERSLSVLACRYVDEVIIGAPWEVSKDMITTFNISLVVHGTVAEINDFQKRDCNPYA  60

Query  296  VPISMGILKVLESPLDittstiirriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            VPISMGI K+L+SPLDITT+TIIRRIVSNH+AY KRNEKK  SE+RYYE K+YI GD
Sbjct  61   VPISMGIFKILDSPLDITTTTIIRRIVSNHEAYQKRNEKKANSERRYYEDKAYILGD  117



>ref|XP_010113033.1| Ethanolamine-phosphate cytidylyltransferase [Morus notabilis]
 gb|EXC35204.1| Ethanolamine-phosphate cytidylyltransferase [Morus notabilis]
Length=383

 Score =   192 bits (487),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 122/179 (68%), Gaps = 48/179 (27%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTV--------------------------------  85
            HAGHVEILR+A+ LGDFLLVG HTDQTV                                
Sbjct  156  HAGHVEILRVAKELGDFLLVGTHTDQTVRILTYHHASDTDVHGGPLWMAHSGLSRSPLPQ  215

Query  86   ----------------SATRGAHRPIMNLHERSLSVLACRYVDEVIIGAPWEVTKDMITT  217
                             A RGAHRPIMNLHERSLSVLACRYVDEVIIGAPWEV++DMITT
Sbjct  216  RGLEEEHALIPIDITLGAKRGAHRPIMNLHERSLSVLACRYVDEVIIGAPWEVSRDMITT  275

Query  218  FDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittstiirriVSNHDAY  394
            F+ISLVVHGTVAE +D+QKE  NPY VPISMGI K+LESPLDITT+TIIRRIVSNH+AY
Sbjct  276  FNISLVVHGTVAENNDFQKENGNPYDVPISMGIFKILESPLDITTTTIIRRIVSNHEAY  334



>ref|XP_009341732.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009341733.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Pyrus x bretschneideri]
Length=418

 Score =   192 bits (488),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 129/155 (83%), Gaps = 1/155 (1%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEIL+ AR LGDFLLVGIH D+TVS  RG H PIM+LHERSLSVL CRYVDEVIIG
Sbjct  265  HAGHVEILKKARQLGDFLLVGIHNDETVSEHRGKH-PIMHLHERSLSVLGCRYVDEVIIG  323

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEVT DMITTF+IS VVHGTV+EY+       +PY++P SMGI K+LESP  ITTS++
Sbjct  324  APWEVTLDMITTFNISSVVHGTVSEYNSSFTGESDPYSLPKSMGIFKLLESPKSITTSSV  383

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
             +RI++NHDAYL+RN KK ESEK+YY  K+Y+SGD
Sbjct  384  SQRIIANHDAYLRRNAKKKESEKKYYAQKTYVSGD  418


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 51/85 (60%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A++LGD L+VG+ +D+ + A +G   P++++ ER   V   ++VDEVI  
Sbjct  77   HYGHANALRQAKALGDELVVGVVSDEEIIANKGP--PVLSMEERLALVSGLKWVDEVIPN  134

Query  182  APWEVTKDMITTF----DISLVVHG  244
            AP+E+T+  +        I  ++HG
Sbjct  135  APYEITEQFMGRLFNEHKIDYIIHG  159



>ref|XP_008351357.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Malus 
domestica]
 ref|XP_008351358.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Malus 
domestica]
Length=418

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 128/155 (83%), Gaps = 1/155 (1%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEIL+ AR LGDFLLVGIH D+TV   RG H PIM+LHERSLSVL CRYVDEVIIG
Sbjct  265  HAGHVEILKNARQLGDFLLVGIHNDETVCEHRGKH-PIMHLHERSLSVLGCRYVDEVIIG  323

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEVT DMITTF+IS VVHGTV+EY+       +PY+VP SMGI K+LESP  ITTS++
Sbjct  324  APWEVTLDMITTFNISSVVHGTVSEYNSLFTGESDPYSVPKSMGIFKLLESPKSITTSSV  383

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
             +RI++NHDAYL+RN KK ESEK+YY  K+Y+SGD
Sbjct  384  SQRIIANHDAYLRRNAKKKESEKKYYAQKTYVSGD  418


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 51/85 (60%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A++LGD L+VG+ +D+ + A +G   P++++ ER   V   ++VDEVI  
Sbjct  77   HYGHANALRQAKALGDELVVGVVSDEEIIANKGP--PVLSMEERLALVSGLKWVDEVIPN  134

Query  182  APWEVTKDMITTF----DISLVVHG  244
            AP+E+T+  +        I  ++HG
Sbjct  135  APYEITEQFMGRLFNEHKIDYIIHG  159



>ref|XP_010505513.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Camelina 
sativa]
Length=117

 Score =   181 bits (459),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = +2

Query  116  MNLHERSLSVLACRYVDEVIIGAPWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYA  295
            MNLHERSLSVLACRYVDEVIIGAPWEV++D ITTFDISLVVHGTVAE  D+QKE +NPYA
Sbjct  1    MNLHERSLSVLACRYVDEVIIGAPWEVSRDTITTFDISLVVHGTVAESDDFQKEEDNPYA  60

Query  296  VPISMGILKVLESPLDittstiirriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            VPISMGI ++LESPLDITTSTIIRRIV+NH+AY KRN KK  SEK+YYE KS++ GD
Sbjct  61   VPISMGIFEILESPLDITTSTIIRRIVANHEAYQKRNAKKEASEKKYYEQKSFVVGD  117



>gb|AFW57038.1| hypothetical protein ZEAMMB73_658422 [Zea mays]
Length=425

 Score =   190 bits (483),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 120/155 (77%), Gaps = 3/155 (2%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVE LR AR LGDFLLVGI+ D+++   RG  RPIM+LHER+L VLACRYVDEVIIG
Sbjct  274  HAGHVEFLRSARQLGDFLLVGIYDDESIRDRRGC-RPIMHLHERTLGVLACRYVDEVIIG  332

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV+KDMITTF+ISLVVHGTVAE +   +   +PYAVP SMGI + + SP  ITT ++
Sbjct  333  APWEVSKDMITTFNISLVVHGTVAEGNSAGE--IDPYAVPKSMGIFQTIRSPKSITTLSV  390

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
              RIV NH+AY KRN KK  SE RYY  K ++SGD
Sbjct  391  ATRIVDNHEAYKKRNLKKKASEDRYYTQKKFVSGD  425


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 53/85 (62%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A+ LGD L+VG+ +D+ + A +G   P++++ ER   V   ++VDEV+  
Sbjct  83   HYGHANALRQAKLLGDQLVVGVVSDEEIVANKGP--PVLSMEERLTLVSGLKWVDEVVPN  140

Query  182  APWEVTKDMITT----FDISLVVHG  244
            AP+E+T++ + T    + I  ++HG
Sbjct  141  APYEITEEFMNTLFNKYSIDYIIHG  165



>gb|EEC66861.1| hypothetical protein OsI_33354 [Oryza sativa Indica Group]
Length=351

 Score =   187 bits (476),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 118/155 (76%), Gaps = 3/155 (2%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVG+H DQ +   RG +RPIM+LHER+LSVLACRYVDEVIIG
Sbjct  200  HAGHVEILRSARQLGDFLLVGVHDDQAIRDRRG-YRPIMHLHERTLSVLACRYVDEVIIG  258

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV++DMITTF+ISLVVHGTV E S       + YAVP SMGI + + S   ITT ++
Sbjct  259  APWEVSRDMITTFNISLVVHGTVTEGSSVV--GIDSYAVPKSMGIFQTITSTKPITTVSV  316

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
              RI+ NH+AY KRN KK  SE RYY  K ++SGD
Sbjct  317  ATRIIDNHEAYKKRNLKKKASEDRYYTQKKFVSGD  351


 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 54/85 (64%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A+ LGD L+VG+ +D+ + A +G   P++++ ER   V   ++VDEVI  
Sbjct  9    HYGHANALRQAKLLGDQLVVGVVSDEEIVANKGP--PVLSMEERLTLVSGLKWVDEVIPN  66

Query  182  APWEVTKDMITT----FDISLVVHG  244
            AP+E+T++ + T    ++I  ++HG
Sbjct  67   APYEITEEFMNTLFNKYNIDYIIHG  91



>ref|XP_003573570.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Brachypodium 
distachyon]
 ref|XP_010234484.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Brachypodium 
distachyon]
Length=416

 Score =   189 bits (479),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 119/155 (77%), Gaps = 3/155 (2%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVG+H DQ +   RG   PIM+LHER+LSVLACRYVDEVIIG
Sbjct  265  HAGHVEILRSARQLGDFLLVGVHDDQAIRERRGCG-PIMHLHERTLSVLACRYVDEVIIG  323

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV++DMITTF+ISLVVHGTVAE S   +   +PYA+P SMGI + + SP  IT+ ++
Sbjct  324  APWEVSRDMITTFNISLVVHGTVAERSSAGE--VDPYALPKSMGIFQTVTSPKTITSVSV  381

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
              RI+ NH+AY KRN KK  SE  YY  K ++SGD
Sbjct  382  ATRIIDNHEAYKKRNLKKKASEDMYYTQKKFVSGD  416


 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 53/85 (62%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A+ LGD L+VG+ +D+ + A +G   P++++ ER   V   ++VDEVI  
Sbjct  82   HYGHANALRQAKLLGDQLVVGVVSDEEIVANKGP--PVLSMEERLTLVSGLKWVDEVIPN  139

Query  182  APWEVTKDMITT----FDISLVVHG  244
            AP+E+T++ +      +DI  ++HG
Sbjct  140  APYEITEEFMNALFNKYDIDYIIHG  164



>ref|XP_004972543.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X2 [Setaria italica]
Length=494

 Score =   189 bits (481),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 125/181 (69%), Gaps = 27/181 (15%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVG+H DQ++   RG +RPIM+LHER+LSVLACRYVDEVIIG
Sbjct  315  HAGHVEILRSARQLGDFLLVGVHDDQSIRDRRG-YRPIMHLHERTLSVLACRYVDEVIIG  373

Query  182  APWEVTKDMITTFDISLVVHGTVAE-------------------------YSDYQKEAE-  283
            APWEV+KDMITTF+ISLVVHGTVAE                           ++  + E 
Sbjct  374  APWEVSKDMITTFNISLVVHGTVAEGNPAVSINELMSKTNLHVVAEFIMKIDEWVLQGEI  433

Query  284  NPYAVPISMGILKVLESPLDittstiirriVSNHDAYLKRNEKKVESEKRYYEGKSYISG  463
            +PYAVP SMGI K + SP  IT+ ++  RIV NH+AY KRN KK  SE RYY  K ++SG
Sbjct  434  DPYAVPKSMGIFKTITSPKSITSVSVATRIVDNHEAYKKRNLKKKASEDRYYTQKKFVSG  493

Query  464  D  466
            D
Sbjct  494  D  494


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 53/85 (62%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A+ LGD L+VG+ +D+ + A +G   P++++ ER   V   ++VDEVI  
Sbjct  124  HYGHANALRQAKLLGDQLVVGVVSDEEIVANKGP--PVLSMEERLTLVSGLKWVDEVIPN  181

Query  182  APWEVTKDMITT----FDISLVVHG  244
            AP+E+T++ + T    + I  ++HG
Sbjct  182  APYEITEEFMNTLFNKYSIDYIIHG  206



>ref|XP_008355152.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Malus 
domestica]
Length=117

 Score =   178 bits (452),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = +2

Query  116  MNLHERSLSVLACRYVDEVIIGAPWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYA  295
            MNLHERSLSVLACR+VDEVIIGAPW ++KDM+TTF+ISLVVHGTVAE S+++KE  NPY 
Sbjct  1    MNLHERSLSVLACRHVDEVIIGAPWVISKDMLTTFNISLVVHGTVAENSNFEKEEGNPYE  60

Query  296  VPISMGILKVLESPLDittstiirriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            VPI++GI KVLESPLDITTSTIIRRIVSNH+AY KRNEKK  SEKRYYE K Y+SGD
Sbjct  61   VPINLGIFKVLESPLDITTSTIIRRIVSNHEAYQKRNEKKAASEKRYYESKGYVSGD  117



>gb|EAZ15919.1| hypothetical protein OsJ_31340 [Oryza sativa Japonica Group]
Length=423

 Score =   187 bits (474),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 118/155 (76%), Gaps = 3/155 (2%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVG+H DQ +   RG +RPIM+LHER+LSVLACRYVDEVIIG
Sbjct  272  HAGHVEILRSARQLGDFLLVGVHDDQAIRDRRG-YRPIMHLHERTLSVLACRYVDEVIIG  330

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV++DMITTF+ISLVVHGTV E S       + YAVP SMGI + + S   ITT ++
Sbjct  331  APWEVSRDMITTFNISLVVHGTVTEGSSVV--GIDSYAVPKSMGIFQTITSTKPITTVSV  388

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
              RI+ NH+AY KRN KK  SE RYY  K ++SGD
Sbjct  389  ATRIIDNHEAYKKRNLKKKASEDRYYTQKKFVSGD  423


 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 54/85 (64%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A+ LGD L+VG+ +D+ + A +G   P++++ ER   V   ++VDEVI  
Sbjct  81   HYGHANALRQAKLLGDQLVVGVVSDEEIVANKGP--PVLSMEERLTLVSGLKWVDEVIPN  138

Query  182  APWEVTKDMITT----FDISLVVHG  244
            AP+E+T++ + T    ++I  ++HG
Sbjct  139  APYEITEEFMNTLFNKYNIDYIIHG  163



>ref|NP_001064493.1| Os10g0387000 [Oryza sativa Japonica Group]
 gb|ABB47464.1| Cytidylyltransferase family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF26407.1| Os10g0387000 [Oryza sativa Japonica Group]
Length=425

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 118/155 (76%), Gaps = 3/155 (2%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVG+H DQ +   RG +RPIM+LHER+LSVLACRYVDEVIIG
Sbjct  274  HAGHVEILRSARQLGDFLLVGVHDDQAIRDRRG-YRPIMHLHERTLSVLACRYVDEVIIG  332

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV++DMITTF+ISLVVHGTV E S       + YAVP SMGI + + S   ITT ++
Sbjct  333  APWEVSRDMITTFNISLVVHGTVTEGSSVV--GIDSYAVPKSMGIFQTITSTKPITTVSV  390

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
              RI+ NH+AY KRN KK  SE RYY  K ++SGD
Sbjct  391  ATRIIDNHEAYKKRNLKKKASEDRYYTQKKFVSGD  425


 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 54/85 (64%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A+ LGD L+VG+ +D+ + A +G   P++++ ER   V   ++VDEVI  
Sbjct  83   HYGHANALRQAKLLGDQLVVGVVSDEEIVANKGP--PVLSMEERLTLVSGLKWVDEVIPN  140

Query  182  APWEVTKDMITT----FDISLVVHG  244
            AP+E+T++ + T    ++I  ++HG
Sbjct  141  APYEITEEFMNTLFNKYNIDYIIHG  165



>emb|CDY48653.1| BnaC07g27560D [Brassica napus]
Length=672

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 115/142 (81%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVGIH DQTVSA RG H PIM++ ERSLSV ACRYVDEVI G
Sbjct  392  HAGHVEILRRARELGDFLLVGIHNDQTVSAKRGGHPPIMSMQERSLSVGACRYVDEVIFG  451

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV+K+ IT F ISLVVHGTVAE  ++Q++ ENPYAVPISMGI ++LESPLDITTSTI
Sbjct  452  APWEVSKNTITFFGISLVVHGTVAESDNFQRKEENPYAVPISMGIFQILESPLDITTSTI  511

Query  362  irriVSNHDAYLKRNEKKVESE  427
            + RI  N       ++K++E E
Sbjct  512  MGRIKRNLKKEATSDDKQMEKE  533



>dbj|BAJ95410.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96704.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=418

 Score =   184 bits (468),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 119/155 (77%), Gaps = 3/155 (2%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVG+H DQ++   RG + PIM+LHER+L VLACRYVDEVIIG
Sbjct  267  HAGHVEILRSARQLGDFLLVGVHDDQSIREKRG-YPPIMHLHERTLGVLACRYVDEVIIG  325

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV++DMITTF+ISLVVHGTV E     +   +PYA+P +MGI +V+ SP  IT+ ++
Sbjct  326  APWEVSRDMITTFNISLVVHGTVTEGGSASE--VDPYALPKNMGIFQVVTSPKTITSVSV  383

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
              RI+ NH+AY KRN KK  SE +YY  K ++ GD
Sbjct  384  ATRIIDNHEAYKKRNLKKKASEDKYYTQKKFVYGD  418


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 54/85 (64%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A+ LGD L+VG+ +D+ + A +G   P++++ ER   V   ++VDEVI  
Sbjct  83   HYGHANALRQAKLLGDQLVVGVVSDEEIVANKGP--PVLSMEERLTLVSGLKWVDEVIPN  140

Query  182  APWEVTKDMITT----FDISLVVHG  244
            AP+E+T++ + T    ++I  ++HG
Sbjct  141  APYEITEEFMNTLFSKYNIDYIIHG  165



>ref|XP_009770720.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X2 [Nicotiana sylvestris]
Length=418

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVG++TDQT+S  RG   P+MNLHERSLSVLACRYVDEVIIG
Sbjct  272  HAGHVEILRSARQLGDFLLVGVYTDQTISELRGHQYPLMNLHERSLSVLACRYVDEVIIG  331

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEVT+DM+TTF+IS+VVHGTV+E +    E  +PYAVP +MGI +V+ESP DITT+++
Sbjct  332  APWEVTQDMVTTFNISVVVHGTVSERNSSTGERHDPYAVPKNMGIFRVIESPKDITTTSV  391

Query  362  irriVSNHDAYL  397
             +RI++NH+ Y+
Sbjct  392  AQRIIANHEIYV  403


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 50/85 (59%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   +R A++LGD L+VG+ +D+ + A +G   P++ + ER   V   ++VDEVI  
Sbjct  77   HYGHANAIRQAKALGDELVVGVVSDEEIVANKGP--PVLCMEERLALVSGLKWVDEVIAN  134

Query  182  APWEVTKDMITTF----DISLVVHG  244
            AP+ +T+D +        I  ++HG
Sbjct  135  APYAITEDFMNRLFNEHKIDYIIHG  159



>ref|XP_003564627.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Brachypodium 
distachyon]
Length=418

 Score =   182 bits (462),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 97/155 (63%), Positives = 119/155 (77%), Gaps = 3/155 (2%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVG+H DQ +   RG   PIM+LHER+LSVLACRYVDEVIIG
Sbjct  267  HAGHVEILRSARQLGDFLLVGVHDDQVIRERRGCC-PIMHLHERTLSVLACRYVDEVIIG  325

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            +P EV++DMITTF+ISLVVHGTVAE S    +  +PYA+P SMGI +++ SP  IT+ ++
Sbjct  326  SPREVSRDMITTFNISLVVHGTVAEGSSV--DEVDPYALPKSMGIFQIITSPKAITSVSV  383

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
              RI+ NH+AY KRN KK  SE +YY  K ++ GD
Sbjct  384  ATRIIDNHEAYKKRNLKKKASEDKYYTQKKFVFGD  418


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 54/85 (64%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A+ LGD L+VG+ +D+ + A +G   P++++ ER   V   ++VDEVI  
Sbjct  83   HYGHANALRQAKLLGDQLVVGVVSDEEIVANKGP--PVLSMEERLTLVSGLKWVDEVIPD  140

Query  182  APWEVTKDMITT----FDISLVVHG  244
            AP+E+T++ + T    ++I  ++HG
Sbjct  141  APYEITEEFMNTLFSKYNIDYIIHG  165



>emb|CDM85025.1| unnamed protein product [Triticum aestivum]
Length=418

 Score =   182 bits (462),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 97/155 (63%), Positives = 119/155 (77%), Gaps = 3/155 (2%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVG+H DQ++   RG + PIM+LHER+L VLACRYVDEVIIG
Sbjct  267  HAGHVEILRSARQLGDFLLVGVHDDQSIREKRG-YPPIMHLHERTLGVLACRYVDEVIIG  325

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            AP EV++DMITTF+ISLVVHGTVAE     +   +PYA+P SMGI +V+ SP  IT+ ++
Sbjct  326  APLEVSRDMITTFNISLVVHGTVAEGGSASE--VDPYALPKSMGIFQVVTSPKTITSVSV  383

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
              RI+ NH+AY KRN KK  SE +YY  K ++ GD
Sbjct  384  ATRIIDNHEAYKKRNLKKKASEDKYYTQKKFVYGD  418


 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 54/85 (64%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A+ LGD L+VG+ +D+ + A +G   P++++ ER   V   ++VDEVI  
Sbjct  83   HYGHANALRQAKLLGDQLVVGVVSDEEIVANKGP--PVLSMEERLTLVSGLKWVDEVIPN  140

Query  182  APWEVTKDMITT----FDISLVVHG  244
            AP+E+T++ + T    ++I  ++HG
Sbjct  141  APYEITEEFMNTLFSKYNIDYIIHG  165



>ref|XP_009616439.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X5 [Nicotiana tomentosiformis]
Length=416

 Score =   182 bits (461),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVG++TDQTVS  RG   P+MNLHERSLSVLACRYVDEVIIG
Sbjct  272  HAGHVEILRSARQLGDFLLVGVYTDQTVSELRGHQYPLMNLHERSLSVLACRYVDEVIIG  331

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            +PWEVT+DM+TTF+IS+VVHGTV++ +    E  +PYAVP +MGI +V++SP DITT+++
Sbjct  332  SPWEVTQDMVTTFNISVVVHGTVSDRNTSTGERHDPYAVPKNMGIFRVIDSPKDITTTSV  391

Query  362  irriVSNHDAYLK  400
             +RI++NH+ Y+K
Sbjct  392  AQRIIANHEIYVK  404


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 50/85 (59%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   +R A++LGD L+VG+ +D+ + A +G   P++ + ER   V   ++VDEVI  
Sbjct  77   HYGHANAIRQAKALGDELVVGVVSDEEIVANKGP--PVLCMEERLALVSGLKWVDEVIAN  134

Query  182  APWEVTKDMITTF----DISLVVHG  244
            AP+ +T+D +        I  ++HG
Sbjct  135  APYAITEDFMNRLFNEHKIDYIIHG  159



>gb|EMT24851.1| Ethanolamine-phosphate cytidylyltransferase [Aegilops tauschii]
Length=418

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 118/155 (76%), Gaps = 3/155 (2%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVG+H DQ++   RG + PIM+LHER+L VLACRYVDEVIIG
Sbjct  267  HAGHVEILRSARQLGDFLLVGVHDDQSIREKRG-YPPIMHLHERTLGVLACRYVDEVIIG  325

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            AP EV++DMITTF+ISLVVHGTV E     +   +PYA+P SMGI +V+ SP  IT+ ++
Sbjct  326  APLEVSRDMITTFNISLVVHGTVVEGGSASE--VDPYALPKSMGIFQVVTSPKTITSVSV  383

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
              RI+ NH+AY KRN KK  SE +YY  K ++ GD
Sbjct  384  ATRIIDNHEAYKKRNLKKKASEDKYYTQKKFVYGD  418


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 53/85 (62%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A+ LGD L+VG+ +D+ +   +G   P++++ ER   V   ++VDEVI  
Sbjct  83   HYGHANALRQAKLLGDQLVVGVVSDEEIVVNKGP--PVLSMEERLTLVSGLKWVDEVIPN  140

Query  182  APWEVTKDMITT----FDISLVVHG  244
            AP+E+T++ + T    ++I  ++HG
Sbjct  141  APYEITEEFMNTLFSKYNIDYIIHG  165



>ref|XP_009616438.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X4 [Nicotiana tomentosiformis]
Length=424

 Score =   180 bits (456),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVG++TDQTVS  RG   P+MNLHERSLSVLACRYVDEVIIG
Sbjct  272  HAGHVEILRSARQLGDFLLVGVYTDQTVSELRGHQYPLMNLHERSLSVLACRYVDEVIIG  331

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            +PWEVT+DM+TTF+IS+VVHGTV++ +    E  +PYAVP +MGI +V++SP DITT+++
Sbjct  332  SPWEVTQDMVTTFNISVVVHGTVSDRNTSTGERHDPYAVPKNMGIFRVIDSPKDITTTSV  391

Query  362  irriVSNHDAYL  397
             +RI++NH+ Y+
Sbjct  392  AQRIIANHEIYV  403


 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 50/85 (59%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   +R A++LGD L+VG+ +D+ + A +G   P++ + ER   V   ++VDEVI  
Sbjct  77   HYGHANAIRQAKALGDELVVGVVSDEEIVANKGP--PVLCMEERLALVSGLKWVDEVIAN  134

Query  182  APWEVTKDMITTF----DISLVVHG  244
            AP+ +T+D +        I  ++HG
Sbjct  135  APYAITEDFMNRLFNEHKIDYIIHG  159



>ref|XP_009616436.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X2 [Nicotiana tomentosiformis]
Length=434

 Score =   179 bits (455),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVG++TDQTVS  RG   P+MNLHERSLSVLACRYVDEVIIG
Sbjct  272  HAGHVEILRSARQLGDFLLVGVYTDQTVSELRGHQYPLMNLHERSLSVLACRYVDEVIIG  331

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            +PWEVT+DM+TTF+IS+VVHGTV++ +    E  +PYAVP +MGI +V++SP DITT+++
Sbjct  332  SPWEVTQDMVTTFNISVVVHGTVSDRNTSTGERHDPYAVPKNMGIFRVIDSPKDITTTSV  391

Query  362  irriVSNHDAYL  397
             +RI++NH+ Y+
Sbjct  392  AQRIIANHEIYV  403


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 50/85 (59%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   +R A++LGD L+VG+ +D+ + A +G   P++ + ER   V   ++VDEVI  
Sbjct  77   HYGHANAIRQAKALGDELVVGVVSDEEIVANKGP--PVLCMEERLALVSGLKWVDEVIAN  134

Query  182  APWEVTKDMITTF----DISLVVHG  244
            AP+ +T+D +        I  ++HG
Sbjct  135  APYAITEDFMNRLFNEHKIDYIIHG  159



>gb|EPS64234.1| hypothetical protein M569_10547, partial [Genlisea aurea]
Length=423

 Score =   176 bits (446),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 122/157 (78%), Gaps = 3/157 (2%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHV+IL+ A+ LGDFLLVG++ DQTVS  RG   P+MNL ERSLSVLAC+YVD++IIG
Sbjct  267  HAGHVKILKKAKQLGDFLLVGLYADQTVSWLRGDRFPLMNLLERSLSVLACQYVDDIIIG  326

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSD---YQKEAENPYAVPISMGILKVLESPLDitt  352
            AP+ VTKDMI+TF+ISLVV G+++E ++   +   A +PY VP  MGI + LESP  ITT
Sbjct  327  APFAVTKDMISTFNISLVVRGSISEDNNPLLWDGAASDPYDVPKGMGIFRNLESPEVITT  386

Query  353  stiirriVSNHDAYLKRNEKKVESEKRYYEGKSYISG  463
            S+I  RI++NH+ YLKRN KK +SEK+YY  K Y++ 
Sbjct  387  SSIAERIIANHEIYLKRNAKKEKSEKQYYAEKKYVAA  423


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 50/85 (59%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A++LGD L+VG+ +D+ +   +G   P++++ ER   V   ++VDEVI  
Sbjct  69   HYGHANALRQAKALGDELVVGVASDEEIILYKGP--PVLSMQERLTLVNGLKWVDEVIPD  126

Query  182  APWEVTKDMITT----FDISLVVHG  244
             P+ +T+D +      + I  +VHG
Sbjct  127  VPYVITEDFMNVLFNEYKIDYIVHG  151



>gb|EMT25098.1| Ethanolamine-phosphate cytidylyltransferase [Aegilops tauschii]
Length=349

 Score =   173 bits (439),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 113/147 (77%), Gaps = 19/147 (13%)
 Frame = +2

Query  83   VSATRGAHRPIMNLHERSLSVLACRYVDEVIIGAPWEVTKDM------------------  208
            +S+TRG HRPIMNLHERSLSVLACRYVDEVIIGAPW ++KDM                  
Sbjct  203  LSSTRGPHRPIMNLHERSLSVLACRYVDEVIIGAPWHISKDMDRLVITCCNFSCQPGYVC  262

Query  209  -ITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittstiirriVSNH  385
             ITTF+ISLVVHGT+AE  DY ++  NPYA PI+MGI   L+SPLDITTSTIIRRIVSNH
Sbjct  263  VITTFNISLVVHGTIAENMDYTEDDSNPYAAPIAMGIYHKLDSPLDITTSTIIRRIVSNH  322

Query  386  DAYLKRNEKKVESEKRYYEGKSYISGD  466
            +AY KRNEKK  SEK+YY+ KS+++G+
Sbjct  323  EAYQKRNEKKEASEKKYYDSKSFVNGE  349



>gb|EMS51700.1| Ethanolamine-phosphate cytidylyltransferase [Triticum urartu]
Length=428

 Score =   172 bits (437),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 117/164 (71%), Gaps = 11/164 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTV---------SATRGAHRPIMNLHERSLSVLAC  154
            HAGHVEILR AR LGDFLLVG+H DQ++            +  + PIM+LHER+L VLAC
Sbjct  267  HAGHVEILRSARQLGDFLLVGVHDDQSIRYHAYENQLCREKRGYPPIMHLHERTLGVLAC  326

Query  155  RYVDEVIIGAPWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLES  334
            RYVDEVIIGAP EV++DMITTF+ISLVVHGTV E     +   +PYA+P SMGI +V+ S
Sbjct  327  RYVDEVIIGAPLEVSRDMITTFNISLVVHGTVVEGGSASE--VDPYALPKSMGIFQVVTS  384

Query  335  PLDittstiirriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            P  IT+ ++  RI+ NH+AY KRN KK  SE +YY  K ++ GD
Sbjct  385  PKTITSVSVATRIIDNHEAYKKRNLKKKASEDKYYTQKKFVYGD  428


 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 54/85 (64%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A+ LGD L+VG+ +D+ + A +G   P++++ ER   V   ++VDEVI  
Sbjct  83   HYGHANALRQAKLLGDQLVVGVVSDEEIVANKGP--PVLSMEERLTLVSGLKWVDEVIPN  140

Query  182  APWEVTKDMITT----FDISLVVHG  244
            AP+E+T++ + T    ++I  ++HG
Sbjct  141  APYEITEEFMNTLFSKYNIDYIIHG  165



>ref|XP_004972544.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X3 [Setaria italica]
Length=476

 Score =   171 bits (432),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 92/135 (68%), Positives = 109/135 (81%), Gaps = 3/135 (2%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVG+H DQ++   RG +RPIM+LHER+LSVLACRYVDEVIIG
Sbjct  315  HAGHVEILRSARQLGDFLLVGVHDDQSIRDRRG-YRPIMHLHERTLSVLACRYVDEVIIG  373

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV+KDMITTF+ISLVVHGTVAE +   +   +PYAVP SMGI K + SP  IT+ ++
Sbjct  374  APWEVSKDMITTFNISLVVHGTVAEGNPAGE--IDPYAVPKSMGIFKTITSPKSITSVSV  431

Query  362  irriVSNHDAYLKRN  406
              RIV NH+AY  R+
Sbjct  432  ATRIVDNHEAYKVRD  446


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 53/85 (62%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A+ LGD L+VG+ +D+ + A +G   P++++ ER   V   ++VDEVI  
Sbjct  124  HYGHANALRQAKLLGDQLVVGVVSDEEIVANKGP--PVLSMEERLTLVSGLKWVDEVIPN  181

Query  182  APWEVTKDMITT----FDISLVVHG  244
            AP+E+T++ + T    + I  ++HG
Sbjct  182  APYEITEEFMNTLFNKYSIDYIIHG  206



>ref|XP_004149674.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Cucumis 
sativus]
Length=116

 Score =   160 bits (406),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 100/117 (85%), Gaps = 1/117 (1%)
 Frame = +2

Query  116  MNLHERSLSVLACRYVDEVIIGAPWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYA  295
            M+LHERSLSVL CRYVDEVIIGAPWE+T+DMITTF+ISLVVHGTVAE + +  +++ PYA
Sbjct  1    MHLHERSLSVLGCRYVDEVIIGAPWEITRDMITTFNISLVVHGTVAENNSFAGDSD-PYA  59

Query  296  VPISMGILKVLESPLDittstiirriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            VP SMGI K+LESP  ITT++I +RIV+NHDA+ KRN KKVESEK+YY  K YI GD
Sbjct  60   VPKSMGIFKLLESPKTITTTSIAKRIVANHDAFKKRNAKKVESEKKYYAEKKYICGD  116



>ref|XP_005647873.1| CTP-phosphoethanolamine cytidylyltransferase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE23329.1| CTP-phosphoethanolamine cytidylyltransferase [Coccomyxa subellipsoidea 
C-169]
Length=461

 Score =   165 bits (417),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 112/153 (73%), Gaps = 0/153 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GHVEIL+LAR+ GDFLLVG+HTD  +   RGAH PIM+LHER+LSVLAC YV+EVIIG
Sbjct  307  HPGHVEILKLARAQGDFLLVGLHTDDDIMERRGAHLPIMDLHERALSVLACCYVNEVIIG  366

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            AP EVT+D++TTF+ISLVV GTV+E           Y VP    I++ L SP DITT+TI
Sbjct  367  APLEVTEDLLTTFNISLVVRGTVSETGAADNADHPRYMVPKQRDIMRTLRSPRDITTATI  426

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYIS  460
            I RIVSN  AY  RN KK +SE  YY+ K +++
Sbjct  427  IHRIVSNRAAYEARNAKKNKSEAAYYQSKQHVT  459


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 50/85 (59%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR LGD L+VG+ +D  + A +G   P+MN  ER   V + ++VDEVI  
Sbjct  96   HYGHANALRQARMLGDQLVVGLISDDEIRAAKGP--PVMNYAERKSLVGSVKWVDEVIDD  153

Query  182  APWEVTKD----MITTFDISLVVHG  244
            AP+ +++D    + T   I  VVHG
Sbjct  154  APYLLSEDFLHELFTKHKIDYVVHG  178



>ref|XP_004972546.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X5 [Setaria italica]
 ref|XP_004972547.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X6 [Setaria italica]
Length=462

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 112/161 (70%), Gaps = 27/161 (17%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVG+H DQ++   RG +RPIM+LHER+LSVLACRYVDEVIIG
Sbjct  273  HAGHVEILRSARQLGDFLLVGVHDDQSIRDRRG-YRPIMHLHERTLSVLACRYVDEVIIG  331

Query  182  APWEVTKDMITTFDISLVVHGTVAEYS-------------------------DYQKEAE-  283
            APWEV+KDMITTF+ISLVVHGTVAE +                         ++  + E 
Sbjct  332  APWEVSKDMITTFNISLVVHGTVAEGNPAVSINELMSKTNLHVVAEFIMKIDEWVLQGEI  391

Query  284  NPYAVPISMGILKVLESPLDittstiirriVSNHDAYLKRN  406
            +PYAVP SMGI K + SP  IT+ ++  RIV NH+AY  R+
Sbjct  392  DPYAVPKSMGIFKTITSPKSITSVSVATRIVDNHEAYKVRD  432


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 53/85 (62%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A+ LGD L+VG+ +D+ + A +G   P++++ ER   V   ++VDEVI  
Sbjct  82   HYGHANALRQAKLLGDQLVVGVVSDEEIVANKGP--PVLSMEERLTLVSGLKWVDEVIPN  139

Query  182  APWEVTKDMITT----FDISLVVHG  244
            AP+E+T++ + T    + I  ++HG
Sbjct  140  APYEITEEFMNTLFNKYSIDYIIHG  164



>ref|XP_004972542.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Setaria italica]
Length=504

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 111/161 (69%), Gaps = 27/161 (17%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVG+H DQ++   RG +RPIM+LHER+LSVLACRYVDEVIIG
Sbjct  315  HAGHVEILRSARQLGDFLLVGVHDDQSIRDRRG-YRPIMHLHERTLSVLACRYVDEVIIG  373

Query  182  APWEVTKDMITTFDISLVVHGTVAE-------------------------YSDYQKEAE-  283
            APWEV+KDMITTF+ISLVVHGTVAE                           ++  + E 
Sbjct  374  APWEVSKDMITTFNISLVVHGTVAEGNPAVSINELMSKTNLHVVAEFIMKIDEWVLQGEI  433

Query  284  NPYAVPISMGILKVLESPLDittstiirriVSNHDAYLKRN  406
            +PYAVP SMGI K + SP  IT+ ++  RIV NH+AY  R+
Sbjct  434  DPYAVPKSMGIFKTITSPKSITSVSVATRIVDNHEAYKVRD  474


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 53/85 (62%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A+ LGD L+VG+ +D+ + A +G   P++++ ER   V   ++VDEVI  
Sbjct  124  HYGHANALRQAKLLGDQLVVGVVSDEEIVANKGP--PVLSMEERLTLVSGLKWVDEVIPN  181

Query  182  APWEVTKDMITT----FDISLVVHG  244
            AP+E+T++ + T    + I  ++HG
Sbjct  182  APYEITEEFMNTLFNKYSIDYIIHG  206



>gb|AFK45455.1| unknown [Medicago truncatula]
Length=115

 Score =   152 bits (385),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 99/117 (85%), Gaps = 2/117 (2%)
 Frame = +2

Query  116  MNLHERSLSVLACRYVDEVIIGAPWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYA  295
            M+LHERSLSVLA RYVDEVIIGAP E+TKDMITTF+ISLVVHGTVAE S      ++PY 
Sbjct  1    MHLHERSLSVLASRYVDEVIIGAPLEITKDMITTFNISLVVHGTVAEKS--LPSEKDPYE  58

Query  296  VPISMGILKVLESPLDittstiirriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
            VP S+GI ++LESP DITT+++ +RI++NHDAY+KRN KK +SEKRYYE + Y+SGD
Sbjct  59   VPKSIGIFRLLESPKDITTTSVAQRIMANHDAYVKRNAKKAKSEKRYYEERKYVSGD  115



>ref|XP_005845984.1| hypothetical protein CHLNCDRAFT_25204, partial [Chlorella variabilis]
 gb|EFN53882.1| hypothetical protein CHLNCDRAFT_25204, partial [Chlorella variabilis]
Length=200

 Score =   153 bits (386),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 108/153 (71%), Gaps = 2/153 (1%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GHVEIL+ A+  GDFLLVG+HTD+ V   RG H PIM LHER+LSVL+CRYVDEV+IG
Sbjct  46   HVGHVEILKKAKQAGDFLLVGVHTDEDVCERRGPHLPIMTLHERALSVLSCRYVDEVVIG  105

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            AP E+ +D++TTF+ISLVV GTV E      E +  YAVP   GI + L+SP  +T++ +
Sbjct  106  APMEIAEDLLTTFNISLVVTGTVHETCSRDSERQR-YAVPQERGIFQRLDSPDTMTSAKL  164

Query  362  irriVSNHDAYLKRNEKKVESEKRYYE-GKSYI  457
            I RI++N   +  R  +KV+SE  YY+  K Y+
Sbjct  165  IERIMANRALFEARQARKVKSEGEYYKTSKQYL  197



>ref|XP_002950808.1| hypothetical protein VOLCADRAFT_109104 [Volvox carteri f. nagariensis]
 gb|EFJ48123.1| hypothetical protein VOLCADRAFT_109104 [Volvox carteri f. nagariensis]
Length=402

 Score =   157 bits (398),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 111/153 (73%), Gaps = 1/153 (1%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GHV+IL+ A++ GDFLLVG+HTD+ V A RG H PIMNLHERSLSVLAC+YVDEVIIG
Sbjct  247  HPGHVKILKAAKAEGDFLLVGLHTDEEVQARRGPHLPIMNLHERSLSVLACKYVDEVIIG  306

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            +P  +T D+I TF+ISLVV G+V+E S      +  Y+VP + GI + L SP ++T   I
Sbjct  307  SPCVMTDDLIKTFNISLVVRGSVSETSMLGPVKQERYSVPRAAGIFRELRSPSEVTARNI  366

Query  362  irriVSNHDAYLKRNEKKVESEKRYY-EGKSYI  457
            I RIV    A+ +RN +KV+ E+ YY E KSY+
Sbjct  367  IHRIVDKRAAFEERNARKVKGEEAYYAEAKSYV  399


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 48/85 (56%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A+++GD L+VG+  D  +   +G   P+MN  ER   V A ++VDE++ G
Sbjct  43   HYGHANALRQAKAVGDELVVGLINDAEILRCKGP--PVMNEEERYTLVEAVKWVDEILRG  100

Query  182  APWEVTKDMI----TTFDISLVVHG  244
             P+++  + I    T   I  ++HG
Sbjct  101  VPYDLNPEFIHELFTKHRIDYIIHG  125



>ref|XP_001692963.1| CDP-Ethanolamine synthase [Chlamydomonas reinhardtii]
 gb|AAO60076.1| CTP:ethanolamine cytidylyltransferase [Chlamydomonas reinhardtii]
 gb|AAP21826.1| CTP-phosphoethanolamine cytidylyltransferase [Chlamydomonas reinhardtii]
 gb|EDP03532.1| CDP-Ethanolamine synthase [Chlamydomonas reinhardtii]
Length=443

 Score =   156 bits (394),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 109/153 (71%), Gaps = 1/153 (1%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GHV+IL+ A++ GDFLLVG+HTD+ V A RG H PIMNLHERSLSVL+C+YVDEV+IG
Sbjct  288  HPGHVKILQAAKAQGDFLLVGLHTDEDVQARRGPHLPIMNLHERSLSVLSCKYVDEVVIG  347

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            +P  +T+D++TTF+IS+VV G+++E S      E  Y VP  MG+   L SP D++   I
Sbjct  348  SPCVITEDLMTTFNISVVVRGSMSETSMLGPVEEERYEVPRRMGLFTELPSPSDVSARNI  407

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEG-KSYI  457
            I RIV    A+  RN KKV+ E+ YY G K Y+
Sbjct  408  IHRIVDKRAAFEARNAKKVKGEEAYYTGAKQYV  440


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 47/85 (55%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A+++GD L+VG+  D  +   +G   P+MN  ER   V A ++VDE++ G
Sbjct  84   HYGHANALRQAKAVGDELVVGLINDAEIMRCKGP--PVMNEEERHTLVEAVKWVDEILTG  141

Query  182  APW----EVTKDMITTFDISLVVHG  244
             P+    E   ++ T   I  ++HG
Sbjct  142  VPYDLNPEFVNELFTKHRIDYIIHG  166



>gb|KFM25861.1| Ethanolamine-phosphate cytidylyltransferase [Auxenochlorella 
protothecoides]
Length=485

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 106/153 (69%), Gaps = 2/153 (1%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GHV+IL+ ARS GDFLLVGIHTD+ V+  RG H+PIMNLHER+LSVLAC+Y DEVIIG
Sbjct  331  HVGHVDILKAARSKGDFLLVGIHTDEDVAERRGPHQPIMNLHERALSVLACKYADEVIIG  390

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            AP  VT+D++TTF I  VV G+V E  D   E    Y VPI+ G  + L SP  +T++T+
Sbjct  391  APQTVTEDLLTTFGIGEVVRGSVHESGDASSE-RGRYEVPIAHGTFRRLASPSPVTSATV  449

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEG-KSYI  457
            IRRIV N   Y  RN KK  SE  YY   K Y+
Sbjct  450  IRRIVDNRAQYEARNAKKGASEASYYAASKQYV  482


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 49/97 (51%), Gaps = 18/97 (19%)
 Frame = +2

Query  2    HAGHVEILRLA------------RSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSV  145
            H GH   LR A            RSLGD L++G+  D  +   +G   PI+N  ER   V
Sbjct  99   HYGHANALRQAKACLWANPVDFGRSLGDQLVLGLIPDSEIRRCKGP--PILNEEERRKLV  156

Query  146  LACRYVDEVIIGAPWEVT----KDMITTFDISLVVHG  244
             + ++VDEVI   P+++T     ++IT   I  V+HG
Sbjct  157  ESVKWVDEVITDVPYDLTPAFLDELITKHKIDYVIHG  193



>gb|ABX10446.1| ethanolamine-phosphate cytidylyltransferase 2 [Gossypium hirsutum]
Length=413

 Score =   150 bits (378),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 107/155 (69%), Gaps = 0/155 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEIL+ AR LGDFL+VGI+ D   S  RG   P+M+L ER+L  LACRYVDEV   
Sbjct  259  HAGHVEILKKARQLGDFLVVGIYPDYIGSEQRGMPYPVMHLLERTLCGLACRYVDEVYRA  318

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
                      T     LVVHGTVAE +       +PYA+P SMGI ++LESP  ITTS++
Sbjct  319  LRRSKAWFTFTFLGGPLVVHGTVAESNSSLPGETDPYAIPKSMGIFRLLESPKSITTSSV  378

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKSYISGD  466
             +RIV+NH+ Y+KRN KK++SEK+YYE K+Y++GD
Sbjct  379  AQRIVTNHEVYMKRNAKKLQSEKKYYEEKAYVAGD  413


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 52/85 (61%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A++LGD L+VG+ +D+ + A +G   PI+++ ER   V   ++VD+VI  
Sbjct  68   HYGHANALRQAKALGDELVVGVVSDEEIIANKGP--PILSMEERLALVSGLKWVDQVIAN  125

Query  182  APWEVTKDMITTF----DISLVVHG  244
            AP+ +T++ + +      I  V+HG
Sbjct  126  APYAITEEFMNSLFNEHKIDYVIHG  150



>gb|KDO54356.1| hypothetical protein CISIN_1g0144871mg [Citrus sinensis]
Length=366

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEIL+ AR LGDFLLVGI+TDQ VS  RG++ PIM+LHERSLSVLACRYVDEVIIG
Sbjct  269  HAGHVEILKKARQLGDFLLVGIYTDQIVSEHRGSYHPIMHLHERSLSVLACRYVDEVIIG  328

Query  182  APWEVTKDMITTFDISLVVHGTVAE  256
            APWEVTKDMITTF+I LVVHGTV+E
Sbjct  329  APWEVTKDMITTFNICLVVHGTVSE  353


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 50/85 (59%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A++LGD L+VG+ +D+ + A +G   P++++ ER   V   ++VDEVI  
Sbjct  78   HYGHANALRQAKALGDELVVGVVSDEEIIANKGP--PVLSMEERLALVSGLKWVDEVIAN  135

Query  182  APWEVTKDMITTF----DISLVVHG  244
            AP+ +T+  +        I  ++HG
Sbjct  136  APYAITEQFMNRLFNEHKIDYIIHG  160



>ref|XP_011006224.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X2 [Populus euphratica]
Length=393

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 81/91 (89%), Gaps = 1/91 (1%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEIL+L R+L DFL V IH DQ VS+ RGAHRPIMNLHERSLSVLAC+YVDEVIIG
Sbjct  273  HAGHVEILKLPRALRDFL-VEIHNDQIVSSKRGAHRPIMNLHERSLSVLACQYVDEVIIG  331

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQK  274
            APWEV+KDMITTF+IS VVHGTVAE +D+ K
Sbjct  332  APWEVSKDMITTFNISSVVHGTVAENNDFLK  362


 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 51/85 (60%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +   + A +G   P+  +H R + V A ++VDEVI  
Sbjct  74   HYGHCHALRQARALGDQLVVGVVSVDEIIANKGP--PVTPVHVRMIMVHAVKWVDEVISD  131

Query  182  APWEVTKDMITT----FDISLVVHG  244
            AP+ +T+D +      ++I  ++HG
Sbjct  132  APYAITEDFMKKLFDEYNIDYIIHG  156



>gb|KDO54357.1| hypothetical protein CISIN_1g0144871mg [Citrus sinensis]
Length=379

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEIL+ AR LGDFLLVGI+TDQ VS  RG++ PIM+LHERSLSVLACRYVDEVIIG
Sbjct  269  HAGHVEILKKARQLGDFLLVGIYTDQIVSEHRGSYHPIMHLHERSLSVLACRYVDEVIIG  328

Query  182  APWEVTKDMITTFDISLVVHGTVAE  256
            APWEVTKDMITTF+I LVVHGTV+E
Sbjct  329  APWEVTKDMITTFNICLVVHGTVSE  353


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 50/85 (59%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A++LGD L+VG+ +D+ + A +G   P++++ ER   V   ++VDEVI  
Sbjct  78   HYGHANALRQAKALGDELVVGVVSDEEIIANKGP--PVLSMEERLALVSGLKWVDEVIAN  135

Query  182  APWEVTKDMITTF----DISLVVHG  244
            AP+ +T+  +        I  ++HG
Sbjct  136  APYAITEQFMNRLFNEHKIDYIIHG  160



>ref|XP_005714716.1| Ethanolamine-phosphate cytidylyltransferase, putative [Chondrus 
crispus]
 emb|CDF34897.1| Ethanolamine-phosphate cytidylyltransferase, putative [Chondrus 
crispus]
Length=453

 Score =   148 bits (373),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 104/145 (72%), Gaps = 0/145 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGH+E LR AR  GDFLLVGIH D TV+A +G++ PIMN+HER+L+VL+CR+VDEVIIG
Sbjct  298  HAGHIETLRKAREQGDFLLVGIHDDATVNARKGSNFPIMNVHERTLAVLSCRHVDEVIIG  357

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APW +++DMI T +IS VVHG+    S Y     +PY VP  M +L  ++S  ++T   +
Sbjct  358  APWCISEDMIKTMNISAVVHGSHRGDSKYVDNFVDPYEVPRQMNLLHKVKSESELTVQVV  417

Query  362  irriVSNHDAYLKRNEKKVESEKRY  436
            + RIV N +A++KRN KK  +E  Y
Sbjct  418  LDRIVQNREAFVKRNVKKEAAEVEY  442


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 50/85 (59%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A++LGD L+VGI+ +  +   +G   P+M   ER ++V + ++VD+V+  
Sbjct  94   HFGHANALRQAKALGDVLVVGINPEVEIRKHKGP--PVMTDEERRIAVSSVKWVDKVLTD  151

Query  182  APWEVTKDMITTF----DISLVVHG  244
             P+ VT + + T      I ++VHG
Sbjct  152  VPYVVTPEFLKTLIEKHKIDIIVHG  176



>ref|XP_005538734.1| phosphoethanolamine cytidylyltransferase [Cyanidioschyzon merolae 
strain 10D]
 dbj|BAM82698.1| phosphoethanolamine cytidylyltransferase [Cyanidioschyzon merolae 
strain 10D]
Length=442

 Score =   145 bits (367),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 103/150 (69%), Gaps = 0/150 (0%)
 Frame = +2

Query  8    GHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIGAP  187
             H+  L+  R LGDFLLVGIH D  V+  RG + PI+NLHER+L VL+ RYVDEVIIGAP
Sbjct  290  AHIRFLKQCRELGDFLLVGIHDDHAVNQHRGRNYPILNLHERTLMVLSIRYVDEVIIGAP  349

Query  188  WEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittstiir  367
            W+VT+DMI T +ISLV+HGT  +  + +   ++PY VP  +GI + + S  D++   II 
Sbjct  350  WKVTEDMIKTMNISLVIHGTHYDELNIRDGDDDPYEVPKRLGIFREIPSSSDLSVPKIIE  409

Query  368  riVSNHDAYLKRNEKKVESEKRYYEGKSYI  457
            RIV N + YL+R ++K   E RYY  K+++
Sbjct  410  RIVRNRERYLERQQRKGTQEARYYADKTHV  439


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 51/85 (60%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   +R A SLGD L+VG+ +D+ ++  +G   P+M   ER  +V A ++VD VI G
Sbjct  72   HYGHANAIRQAASLGDELIVGVCSDEEITKHKGP--PVMTEEERYETVEAVKWVDHVIRG  129

Query  182  APWEVTKDMITT----FDISLVVHG  244
             P+ VT + + T    ++I  VVHG
Sbjct  130  VPYNVTPEFLETLVRDYEIDYVVHG  154



>emb|CEI95984.1| Putative Ethanolamine-phosphate cytidylyltransferase [Rhizopus 
microsporus]
Length=187

 Score =   135 bits (339),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 86/113 (76%), Gaps = 3/113 (3%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH+E L+ A++LGDFL+VGIH DQTV+A +GA+ P+MNLHER+LSVLACRYVDEVIIG
Sbjct  58   HVGHIEFLKRAKALGDFLIVGIHDDQTVNAIKGANYPLMNLHERALSVLACRYVDEVIIG  117

Query  182  APWEVTKDMIT-TFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESP  337
            AP+ VT +++   + +SLVVHGT     D   +  +PY +P  +GI K +E+P
Sbjct  118  APYSVTDEILKGEYKVSLVVHGTTHLEKDV--DGRDPYELPKKLGIYKQIETP  168



>ref|XP_003623696.1| Ethanolamine-phosphate cytidylyltransferase [Medicago truncatula]
Length=355

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILRLAR  GDFLLVGIHTDQTVSATRG HRPIM+LHERSLSVLACRYVDEVIIG
Sbjct  265  HAGHVEILRLARDRGDFLLVGIHTDQTVSATRGLHRPIMSLHERSLSVLACRYVDEVIIG  324

Query  182  APWEVTKDMIT  214
            APWEV+KDM++
Sbjct  325  APWEVSKDMVS  335


 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 52/85 (61%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  + A +G   P+  LHER + V A ++VDEVI  
Sbjct  64   HYGHCNALRQARALGDQLIVGVVSDDEIIANKGP--PVTPLHERLIMVNAVKWVDEVIPE  121

Query  182  APWEVT----KDMITTFDISLVVHG  244
            AP+ +T    K +   ++I  ++HG
Sbjct  122  APYAITEEFMKKLFDEYNIDYIIHG  146



>gb|AES79914.2| ethanolamine-phosphate cytidylyltransferase [Medicago truncatula]
Length=358

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILRLAR  GDFLLVGIHTDQTVSATRG HRPIM+LHERSLSVLACRYVDEVIIG
Sbjct  268  HAGHVEILRLARDRGDFLLVGIHTDQTVSATRGLHRPIMSLHERSLSVLACRYVDEVIIG  327

Query  182  APWEVTKDMIT  214
            APWEV+KDM++
Sbjct  328  APWEVSKDMVS  338


 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 52/85 (61%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D  + A +G   P+  LHER + V A ++VDEVI  
Sbjct  67   HYGHCNALRQARALGDQLIVGVVSDDEIIANKGP--PVTPLHERLIMVNAVKWVDEVIPE  124

Query  182  APWEVT----KDMITTFDISLVVHG  244
            AP+ +T    K +   ++I  ++HG
Sbjct  125  APYAITEEFMKKLFDEYNIDYIIHG  149



>ref|XP_010529960.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X2 [Tarenaya hassleriana]
Length=397

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR+AR LGDFLLVGIH DQT+SA RGAHRPIMNLHERSLSVLACRYVDEVIIG
Sbjct  268  HAGHVEILRVARELGDFLLVGIHNDQTISAKRGAHRPIMNLHERSLSVLACRYVDEVIIG  327

Query  182  APWEVTKDM  208
            APWEV+KDM
Sbjct  328  APWEVSKDM  336


 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 53/85 (62%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+LGD L+VG+ +D+ + A +G   P+  LHER + V A ++VDEVI  
Sbjct  69   HYGHCNALRQARALGDQLVVGVVSDEEIIANKGP--PVTPLHERMIMVKAVKWVDEVIPD  126

Query  182  APWEVTKD----MITTFDISLVVHG  244
            AP+ +T+D    +   + I  ++HG
Sbjct  127  APYAITEDFMKRLFVEYQIDYIIHG  151



>emb|CEG75719.1| Putative Ethanolamine-phosphate cytidylyltransferase [Rhizopus 
microsporus]
Length=354

 Score =   135 bits (340),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 86/113 (76%), Gaps = 3/113 (3%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH+E L+ A++LGDFL+VGIH DQTV+A +GA+ P+MNLHER+LSVLACRYVDEVIIG
Sbjct  198  HVGHIEFLKRAKALGDFLIVGIHDDQTVNAIKGANYPLMNLHERALSVLACRYVDEVIIG  257

Query  182  APWEVTKDMIT-TFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESP  337
            AP+ VT +++   + +SLVVHGT     D   +  +PY +P  +GI K +E+P
Sbjct  258  APYSVTDEILKGEYKVSLVVHGTTHLEKDV--DGRDPYELPKKLGIYKQIETP  308


 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 56/95 (59%), Gaps = 7/95 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A+++GD L+VG+H+D  +   +G    +M   ER  +V AC++ DEV+  
Sbjct  2    HYGHANALRQAKAMGDILVVGVHSDADIEKNKGP--TVMKEDERYAAVAACKWADEVVPN  59

Query  182  APWEVTKDMITTFDISLVVHG----TVAEYSD-YQ  271
            AP+  T +++   +I   VHG    T+A+ +D YQ
Sbjct  60   APYNTTVEILKEHNIDFCVHGDDITTMADGTDCYQ  94



>emb|CEG75718.1| Putative Ethanolamine-phosphate cytidylyltransferase [Rhizopus 
microsporus]
Length=372

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 86/113 (76%), Gaps = 3/113 (3%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH+E L+ A++LGDFL+VGIH DQTV+A +GA+ P+MNLHER+LSVLACRYVDEVIIG
Sbjct  216  HVGHIEFLKRAKALGDFLIVGIHDDQTVNAIKGANYPLMNLHERALSVLACRYVDEVIIG  275

Query  182  APWEVTKDMIT-TFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESP  337
            AP+ VT +++   + +SLVVHGT     D   +  +PY +P  +GI K +E+P
Sbjct  276  APYSVTDEILKGEYKVSLVVHGTTHLEKDV--DGRDPYELPKKLGIYKQIETP  326


 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 56/95 (59%), Gaps = 7/95 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A+++GD L+VG+H+D  +   +G    +M   ER  +V AC++ DEV+  
Sbjct  20   HYGHANALRQAKAMGDILVVGVHSDADIEKNKGP--TVMKEDERYAAVAACKWADEVVPN  77

Query  182  APWEVTKDMITTFDISLVVHG----TVAEYSD-YQ  271
            AP+  T +++   +I   VHG    T+A+ +D YQ
Sbjct  78   APYNTTVEILKEHNIDFCVHGDDITTMADGTDCYQ  112



>gb|KDO33642.1| hypothetical protein SPRG_01610 [Saprolegnia parasitica CBS 223.65]
Length=475

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 100/149 (67%), Gaps = 0/149 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GHV+IL++A++ GD+L+VG+H D  V+  RG + PIMNLHER LSVL CRYVD+V+I 
Sbjct  322  HPGHVDILKMAKAQGDYLIVGVHNDAIVNKHRGLNYPIMNLHERVLSVLGCRYVDDVLID  381

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APW+VTK+MI +  +++VVHG+  +  D     ++ YA     GI + L SP  +    I
Sbjct  382  APWQVTKEMIASLRLAVVVHGSHRDVEDTDAAMDDHYACAREAGIYRELPSPRSLDVKDI  441

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGK  448
            + RI  N + + K+  KK+E+EK YY+ +
Sbjct  442  VDRIAENRERFEKKFVKKMEAEKEYYDDR  470


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 51/85 (60%), Gaps = 5/85 (6%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH+   R A++LG +L+VG++ D++++A +GA  P+M+  ER  SV  C++VDEV   
Sbjct  131  HYGHMNAFRQAKALGTYLVVGVNDDKSITACKGAP-PVMDDDERIASVAGCKFVDEVEPH  189

Query  182  APW----EVTKDMITTFDISLVVHG  244
             P+    E    MI    +  +VHG
Sbjct  190  CPYIMNEEYLTKMIKKHRLDYIVHG  214



>emb|CEI99016.1| Putative Ethanolamine-phosphate cytidylyltransferase [Rhizopus 
microsporus]
Length=345

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 86/113 (76%), Gaps = 3/113 (3%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH+E L+ A++LGDFL+VGIH DQTV+A +GA+ P+MNLHER+LSVLACRYVDEVIIG
Sbjct  216  HVGHIEFLKRAKALGDFLIVGIHDDQTVNAIKGANYPLMNLHERALSVLACRYVDEVIIG  275

Query  182  APWEVTKDMIT-TFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESP  337
            AP+ VT +++   + +SLVVHGT     D   +  +PY +P  +GI K +E+P
Sbjct  276  APYSVTDEILKGEYKVSLVVHGTTHLEKDV--DGRDPYELPKKLGIYKQIETP  326


 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 56/95 (59%), Gaps = 7/95 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A+++GD L+VG+H+D  +   +G    +M   ER  +V AC++ DEV+  
Sbjct  20   HYGHANALRQAKAMGDILVVGVHSDADIEKNKGP--TVMKEDERYAAVAACKWADEVVPN  77

Query  182  APWEVTKDMITTFDISLVVHG----TVAEYSD-YQ  271
            AP+  T +++   +I   VHG    T+A+ +D YQ
Sbjct  78   APYNTTVEILKEHNIDFCVHGDDITTMADGTDCYQ  112



>ref|XP_008864068.1| hypothetical protein H310_02362 [Aphanomyces invadans]
 gb|ETW07975.1| hypothetical protein H310_02362 [Aphanomyces invadans]
Length=486

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 98/149 (66%), Gaps = 0/149 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH++IL+LA+  GD+L+VG+H D  V+  RG + PIMNLHER LSVL CRYVD+V+I 
Sbjct  322  HPGHIDILKLAKGQGDYLIVGVHNDGVVNKHRGLNYPIMNLHERVLSVLGCRYVDDVLID  381

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWE+TK+MI +  +S+VVHG+  E  D   E E  Y      GI   + SP  +  + I
Sbjct  382  APWEITKEMIASLRLSVVVHGSRREGHDNPAEMEVHYKAAREAGIYIEVPSPRTLDVNDI  441

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGK  448
            + RI  N D + K+  KK+E+EK YY+ +
Sbjct  442  VARITENRDRFEKKFVKKMEAEKEYYDDR  470


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 49/85 (58%), Gaps = 5/85 (6%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH+   R A+S+G +L+VG++ D++++  +GA  P+M   ER  SV  C++VD V   
Sbjct  131  HYGHMNAFRQAKSVGTYLVVGVNDDKSITQCKGAP-PVMCDEERIASVAGCKFVDAVEPH  189

Query  182  APWEVTKD----MITTFDISLVVHG  244
             P+ +  +    MI    +  +VHG
Sbjct  190  CPYIMNDEYLLRMIEKHRLDYIVHG  214



>ref|XP_008615950.1| ethanolamine-phosphate cytidylyltransferase [Saprolegnia diclina 
VS20]
 gb|EQC30624.1| ethanolamine-phosphate cytidylyltransferase [Saprolegnia diclina 
VS20]
Length=475

 Score =   135 bits (339),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 100/149 (67%), Gaps = 0/149 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GHV+IL++A++ GD+L+VG+H D  V+  RG + PIMNLHER LSVL CRYVD+V+I 
Sbjct  322  HPGHVDILKMAKAQGDYLIVGVHNDAIVNKHRGLNYPIMNLHERVLSVLGCRYVDDVLID  381

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APW+VTK+MI +  +++VVHG+  +  D     ++ Y      GI + L SP ++    I
Sbjct  382  APWQVTKEMIASLRLAVVVHGSHRDAEDTDAAMDDHYKCAREAGIYRELPSPRNLDVKDI  441

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGK  448
            + RI  N + + K+  KK+E+EK YY+ +
Sbjct  442  VDRIAENRERFEKKFVKKMEAEKEYYDDR  470


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 51/85 (60%), Gaps = 5/85 (6%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH+   R A++LG +L+VG++ D++++A +GA  P+M+  ER  SV  C++VDEV   
Sbjct  131  HYGHMNAFRQAKALGTYLVVGVNDDKSITACKGAP-PVMDDDERIASVAGCKFVDEVEPH  189

Query  182  APW----EVTKDMITTFDISLVVHG  244
             P+    E    MI    +  +VHG
Sbjct  190  CPYIMNEEYLTKMIKKHRLDYIVHG  214



>gb|EIE92478.1| hypothetical protein RO3G_17000 [Rhizopus delemar RA 99-880]
Length=314

 Score =   132 bits (333),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 88/113 (78%), Gaps = 3/113 (3%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH+E L+ A++LGDFL+VGIH DQTV+A +G++ P+MNLHER+LSVLACRYVDEV+IG
Sbjct  161  HVGHIEFLKRAKALGDFLIVGIHDDQTVNAIKGSNYPLMNLHERALSVLACRYVDEVVIG  220

Query  182  APWEVTKDMIT-TFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESP  337
            AP+ VT++++   + +S+VVHGT     D   + ++PY +P  +GI K +++P
Sbjct  221  APYSVTEELLKGEYQVSIVVHGTSHLEKDM--DGKDPYELPKKLGIYKQIDTP  271



>emb|CEG66905.1| Putative Ethanolamine-phosphate cytidylyltransferase [Rhizopus 
microsporus]
Length=364

 Score =   133 bits (335),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 87/113 (77%), Gaps = 3/113 (3%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH+E L+ A+  GDFL+VG+H DQTV+A +G + P+MNLHER+LSVLACRYVDEVIIG
Sbjct  200  HIGHIEFLKRAKEQGDFLVVGVHDDQTVNAIKGINYPLMNLHERALSVLACRYVDEVIIG  259

Query  182  APWEVTKDMITT-FDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESP  337
            AP+ VT+D++ T +++++VVHGT +   D   + ++PY +P S GI K + SP
Sbjct  260  APYSVTEDVLNTEYNVTVVVHGTTSSEPDI--DGKDPYELPKSRGIYKEISSP  310


 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 57/95 (60%), Gaps = 7/95 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A+ +GD L+VG+H+D  +   +G    +M   ER  +V AC++VDEV+  
Sbjct  19   HYGHANALRQAKEMGDILVVGVHSDAEIEKNKGP--TVMKEQERYAAVAACKWVDEVVPN  76

Query  182  APWEVTKDMITTFDISLVVHG----TVAEYSD-YQ  271
            AP+  T +++  ++I   VHG    T+A+ +D YQ
Sbjct  77   APYNTTVEILQKYNIDFCVHGDDITTMADGTDCYQ  111



>emb|CEG84347.1| Putative Ethanolamine-phosphate cytidylyltransferase [Rhizopus 
microsporus]
Length=364

 Score =   133 bits (335),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 87/113 (77%), Gaps = 3/113 (3%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH+E L+ A+  GDFL+VG+H DQTV+A +G + P+MNLHER+LSVLACRYVDEVIIG
Sbjct  200  HIGHIEFLKRAKEQGDFLVVGVHDDQTVNAIKGINYPLMNLHERALSVLACRYVDEVIIG  259

Query  182  APWEVTKDMITT-FDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESP  337
            AP+ VT+D++ T +++++VVHGT +   D   + ++PY +P S GI K + SP
Sbjct  260  APYSVTEDVLNTEYNVTVVVHGTTSSEPDI--DGKDPYELPKSRGIYKEISSP  310


 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 57/95 (60%), Gaps = 7/95 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A+ +GD L+VG+H+D  +   +G    +M   ER  +V AC++VDEV+  
Sbjct  19   HYGHANALRQAKEMGDILVVGVHSDAEIEKNKGP--TVMKEQERYAAVAACKWVDEVVPN  76

Query  182  APWEVTKDMITTFDISLVVHG----TVAEYSD-YQ  271
            AP+  T +++  ++I   VHG    T+A+ +D YQ
Sbjct  77   APYNTTVEILQKYNIDFCVHGDDITTMADGTDCYQ  111



>ref|XP_001623420.1| predicted protein [Nematostella vectensis]
 gb|EDO31320.1| predicted protein [Nematostella vectensis]
Length=373

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/148 (48%), Positives = 100/148 (68%), Gaps = 2/148 (1%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H G ++ L  A++LGD+L+VG+HTDQ V+  +G++ PIMNLHER LSVLACRYVD+VIIG
Sbjct  217  HVGFLDFLEKAKALGDYLIVGLHTDQIVNRYKGSNYPIMNLHERVLSVLACRYVDQVIIG  276

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            AP+ V++++I  F + LVVHG     +D     E+PY +P  +GI K + S   ITT+ I
Sbjct  277  APYSVSQELIDQFKVDLVVHGNTPVMNDVN--GEDPYRIPRKLGIFKTINSESTITTADI  334

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEG  445
            + RI+ N   + +RN KK + E   YE 
Sbjct  335  VARIIRNKLKFEERNRKKEKKEIAAYEA  362


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 46/81 (57%), Gaps = 2/81 (2%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A+++GD+L VG+H+D  ++  +G   P+ N  ER   V A ++VDEVI  
Sbjct  25   HFGHANALRQAKAMGDWLCVGVHSDAEIAHNKGP--PVFNEEERYKMVRAIKWVDEVIEN  82

Query  182  APWEVTKDMITTFDISLVVHG  244
            AP+  T + +        VHG
Sbjct  83   APYTTTLETMDDHGCEFCVHG  103



>ref|XP_008904899.1| hypothetical protein PPTG_11355 [Phytophthora parasitica INRA-310]
 gb|ETN09753.1| hypothetical protein PPTG_11355 [Phytophthora parasitica INRA-310]
Length=470

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 102/152 (67%), Gaps = 11/152 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILRLA+  G FL+VG+H D  V+A RG + PIMNLHER LSVL C+YVD+V+I 
Sbjct  315  HAGHVEILRLAKQQGSFLIVGVHNDSVVNAHRGLNYPIMNLHERVLSVLGCKYVDDVLID  374

Query  182  APWEVTKDMITTFDISLVVHGT------VAEYSDYQKEAENPYAVPISMGILKVLESPLD  343
            APW+VT +MI + +IS+VVHGT      + E+S      E  Y     +GI ++++SP+ 
Sbjct  375  APWQVTPEMIASLNISVVVHGTHRDQHHLPEFS-----LEEHYEHARKVGIFQLIQSPIK  429

Query  344  ittstiirriVSNHDAYLKRNEKKVESEKRYY  439
            +  + I+ RI  N + + K+   K++SE+ YY
Sbjct  430  LDVNDIVARINDNRERFEKKFVSKMKSEEEYY  461


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 53/85 (62%), Gaps = 5/85 (6%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH+   R ARSLG +L+VG++ D++++A +GA  P++N  ER  SV  C++VDEV   
Sbjct  123  HYGHMNAFRQARSLGTYLVVGVNDDESITACKGA-PPVLNNEERIASVEGCKFVDEVEPH  181

Query  182  APWEVTKD----MITTFDISLVVHG  244
             P+ + +D    MI    I  VVHG
Sbjct  182  CPYIMNEDYLQRMIKKHRIDYVVHG  206



>ref|XP_009824288.1| hypothetical protein H257_02379 [Aphanomyces astaci]
 gb|ETV85816.1| hypothetical protein H257_02379 [Aphanomyces astaci]
Length=481

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 97/149 (65%), Gaps = 0/149 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GHV+IL+LA+S GD+L+VG+H D  V+  RG + PIMNLHER LSVL CRYVD+V+I 
Sbjct  322  HPGHVDILKLAKSQGDYLIVGVHNDGVVNKHRGLNYPIMNLHERVLSVLGCRYVDDVLID  381

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWE+TK+MI +  + +VVHG+  +  D   E    Y      GI   + SP  +  + I
Sbjct  382  APWEITKEMIASLRLKVVVHGSRRDGHDDPAEMAVHYKAARDAGIYVEVPSPRTLDVNDI  441

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGK  448
            + RI  N D + K+  KK+E+EK YY+ +
Sbjct  442  VARITENRDRFEKKFVKKMEAEKEYYDDR  470


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 49/85 (58%), Gaps = 5/85 (6%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH+   R A+S+G +L+VG++ D++++  +GA  P+M   ER  SV  C++VD V   
Sbjct  131  HYGHMNAFRQAKSVGTYLVVGVNDDKSITECKGAP-PVMCDEERIASVAGCKFVDAVEPH  189

Query  182  APWEVTKD----MITTFDISLVVHG  244
             P+ +  +    MI    +  +VHG
Sbjct  190  CPYIMNDEYLLRMIEKHRLDYIVHG  214



>gb|EPB89151.1| ethanolamine-phosphate cytidylyltransferase [Mucor circinelloides 
f. circinelloides 1006PhL]
Length=363

 Score =   130 bits (326),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 85/113 (75%), Gaps = 3/113 (3%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH+E L+ A++LGDFL+VG+H DQTV+A +G++ P+MNLHER+LSVLACRYVDEVIIG
Sbjct  204  HVGHIEFLKRAKALGDFLIVGVHDDQTVNAIKGSNYPLMNLHERALSVLACRYVDEVIIG  263

Query  182  APWEVTKDMIT-TFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESP  337
            AP+ VT++++   + ++LV HG      D   +  NPY +P  +GI K +++P
Sbjct  264  APYSVTEEILNGEYKVALVAHGNSVLEKDM--DGRNPYDLPKKLGIYKEIDTP  314


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 57/100 (57%), Gaps = 10/100 (10%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLH-----ERSLSVLACRYVD  166
            H GH   LR A+S+GD L+VG+H+D  +   +G      +++     +R  +V AC++VD
Sbjct  2    HYGHANALRQAKSMGDILVVGVHSDADIEKNKGPTHLKHSIYADDVDDRYAAVAACKWVD  61

Query  167  EVIIGAPWEVTKDMITTFDISLVVHG----TVAEYSD-YQ  271
            EV+  AP+  T + +   +I   VHG    T+A+ +D YQ
Sbjct  62   EVVPNAPYNTTVECLKEHNIDFCVHGDDITTMADGTDCYQ  101



>gb|EFX78214.1| hypothetical protein DAPPUDRAFT_305267 [Daphnia pulex]
Length=367

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/147 (46%), Positives = 98/147 (67%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH++ L  AR+ GD+L+VG+HTD  V+  +GA+ PIMNLHER LSVLACRYV EV+IG
Sbjct  213  HVGHLDFLEKARAQGDYLIVGLHTDPVVNQYKGANYPIMNLHERVLSVLACRYVSEVVIG  272

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            AP+ V+KDM+  F + LVVHG     +D   E  +PY  P       +L+S   +TT  +
Sbjct  273  APYSVSKDMMDHFKVDLVVHGATPVATDVDGEDGDPYEEPKRRNKFMLLDSGNTMTTELL  332

Query  362  irriVSNHDAYLKRNEKKVESEKRYYE  442
            ++RI+SN  ++++RN+KK   E   ++
Sbjct  333  VQRIISNRLSFVERNQKKEAKEANLWK  359


 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 48/81 (59%), Gaps = 2/81 (2%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A+++GD+L+VG+H D+ ++  +G   P+    ER   V   ++VDEVI G
Sbjct  21   HFGHANSLRQAKAMGDYLVVGVHNDEEITKHKGP--PVFTEEERYKMVRGIKWVDEVIEG  78

Query  182  APWEVTKDMITTFDISLVVHG  244
            AP+  T + +  +D    VHG
Sbjct  79   APYVTTLETLDKYDCQFCVHG  99



>gb|ETI47683.1| hypothetical protein F443_08147 [Phytophthora parasitica P1569]
 gb|ETK87618.1| hypothetical protein L915_07974 [Phytophthora parasitica]
 gb|ETL41016.1| hypothetical protein L916_07898 [Phytophthora parasitica]
 gb|ETL94196.1| hypothetical protein L917_07794 [Phytophthora parasitica]
 gb|ETM47424.1| hypothetical protein L914_07862 [Phytophthora parasitica]
 gb|ETO76398.1| hypothetical protein F444_08201 [Phytophthora parasitica P1976]
 gb|ETP17486.1| hypothetical protein F441_08121 [Phytophthora parasitica CJ01A1]
 gb|ETP45518.1| hypothetical protein F442_08086 [Phytophthora parasitica P10297]
Length=470

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 71/152 (47%), Positives = 101/152 (66%), Gaps = 11/152 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILRLA+  G +L+VG+H D  V+A RG + PIMNLHER LSVL C+YVD+V+I 
Sbjct  315  HAGHVEILRLAKQQGSYLIVGVHNDSVVNAHRGLNYPIMNLHERVLSVLGCKYVDDVLID  374

Query  182  APWEVTKDMITTFDISLVVHGT------VAEYSDYQKEAENPYAVPISMGILKVLESPLD  343
            APW+VT +MI + +IS+VVHGT      + E+S      E  Y      GI ++++SP+ 
Sbjct  375  APWQVTPEMIASLNISVVVHGTHRDQHHLPEFS-----LEEHYEHARKAGIFQLIQSPIK  429

Query  344  ittstiirriVSNHDAYLKRNEKKVESEKRYY  439
            +  + I+ RI  N + + K+   K++SE+ YY
Sbjct  430  LDVNDIVARINDNRERFEKKFVSKMKSEEEYY  461


 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 53/85 (62%), Gaps = 5/85 (6%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH+   R ARSLG +L+VG++ D++++A +GA  P++N  ER  SV  C++VDEV   
Sbjct  123  HYGHMNAFRQARSLGTYLVVGVNDDESITACKGA-PPVLNNEERIASVEGCKFVDEVEPH  181

Query  182  APWEVTKD----MITTFDISLVVHG  244
             P+ + +D    MI    I  VVHG
Sbjct  182  CPYIMNEDYLQRMIKKHRIDYVVHG  206



>ref|XP_002896776.1| ethanolamine-phosphate cytidylyltransferase, putative [Phytophthora 
infestans T30-4]
 gb|EEY66711.1| ethanolamine-phosphate cytidylyltransferase, putative [Phytophthora 
infestans T30-4]
Length=470

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 71/152 (47%), Positives = 101/152 (66%), Gaps = 11/152 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILRLA+  G +L+VG+H D  V+A RG + PIMNLHER LSVL C+YVD+V+I 
Sbjct  315  HAGHVEILRLAKQQGSYLIVGVHNDSVVNAHRGLNYPIMNLHERVLSVLGCKYVDDVLID  374

Query  182  APWEVTKDMITTFDISLVVHGT------VAEYSDYQKEAENPYAVPISMGILKVLESPLD  343
            APW+VT +MI + +IS+VVHGT      + E+S      E  Y      GI ++++SP+ 
Sbjct  375  APWQVTPEMIASLNISVVVHGTHRDQHHLPEFS-----LEEHYEHARKAGIFQLIQSPIK  429

Query  344  ittstiirriVSNHDAYLKRNEKKVESEKRYY  439
            +  + I+ RI  N + + K+   K++SE+ YY
Sbjct  430  LDVNDIVARINDNRERFEKKFVSKMKSEEEYY  461


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 51/85 (60%), Gaps = 5/85 (6%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH+   R ARSLG +L+VG++ D++++A +GA  P++N  ER  SV  C++VD V   
Sbjct  123  HYGHMNAFRQARSLGTYLVVGVNDDESITACKGA-PPVLNNEERIASVKGCKFVDVVEPH  181

Query  182  APW----EVTKDMITTFDISLVVHG  244
             P+    E  + MI    I  VVHG
Sbjct  182  CPYIMNEEYLQRMIKKHRIDYVVHG  206



>gb|EPZ32625.1| Rossmann-like alpha/beta/alpha sandwich fold domain-containing 
protein [Rozella allomycis CSF55]
Length=350

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 97/144 (67%), Gaps = 5/144 (3%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH+E+L+ A+ LGD+LLVGIH D+TV+A +G++ PIMN+HER+LSVL+CRYVDEV+IG
Sbjct  201  HVGHIELLKKAKELGDYLLVGIHDDKTVNAIKGSNYPIMNVHERTLSVLSCRYVDEVVIG  260

Query  182  APWEVTKDMITT-FDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittst  358
            AP+ V ++M+T  ++I +VVHG    +S      E+PY  P S+     +E+     T+ 
Sbjct  261  APYSVNEEMMTAIYNIDIVVHGKTEVFS---VNGEDPYKYPKSVSKFIEIETKYSYLTTE  317

Query  359  iirriV-SNHDAYLKRNEKKVESE  427
             +   + +N   Y +RN KK E E
Sbjct  318  CVIERIFNNRKLYEERNRKKEEKE  341


 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 51/81 (63%), Gaps = 2/81 (2%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   +R A+ +GD+L+VG+H+D+ +   +G    +MN  ER  +V AC++VDEV+  
Sbjct  3    HYGHSNAIRQAKEMGDYLIVGVHSDEEIRKHKGP--TVMNQEERYEAVAACKWVDEVVPN  60

Query  182  APWEVTKDMITTFDISLVVHG  244
            AP+  T D++  +D    VHG
Sbjct  61   APYFTTVDILDQYDADFCVHG  81



>gb|KDD76579.1| hypothetical protein H632_c175p1 [Helicosporidium sp. ATCC 50920]
Length=468

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 82/169 (49%), Positives = 109/169 (64%), Gaps = 17/169 (10%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GHV  LR AR+ GDFLLVG+H D+ V+A RG H+PIM++HER+LSVLAC+Y DEVIIG
Sbjct  299  HVGHVAALRAARAAGDFLLVGLHDDEDVAARRGPHQPIMSVHERALSVLACKYADEVIIG  358

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQK---------------EAENPYAVPISMGI  316
            AP  +T D++TTF+IS VV GTV E    Q                EAE  YA   + G+
Sbjct  359  APRVITADLLTTFNISKVVRGTVHETGQVQAAGADRGSLSSVLDDDEAER-YAEAQARGV  417

Query  317  LKVLESPLDittstiirriVSNHDAYLKRNEKKVESEKRYYEG-KSYIS  460
             + L S   +T++ +I RIV+N   +  RN KK++SE  YY G K+++S
Sbjct  418  FERLRSSSRMTSAAVIARIVANRAQFEARNAKKMKSEAEYYAGAKTFVS  466


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 49/85 (58%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR LGD L+VG+  D  +   +G   PI+N  ER   V A ++VD+VI+G
Sbjct  26   HYGHANALRQARVLGDELVVGLIPDSEIERCKGP--PILNEKERLELVRAVKWVDDVIVG  83

Query  182  APWEVTKDMITTF----DISLVVHG  244
             P+++T D ++       I  V+HG
Sbjct  84   VPYDLTPDFLSELFHRHRIDYVIHG  108



>gb|EIE76135.1| hypothetical protein RO3G_00839 [Rhizopus delemar RA 99-880]
Length=365

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 85/113 (75%), Gaps = 3/113 (3%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH+E L+ A+  GDFL+VG+H DQTV+A +G + P+MNLHER+LSVLACRYVDEVIIG
Sbjct  200  HIGHIEFLKRAKEQGDFLVVGVHDDQTVNAIKGINYPLMNLHERALSVLACRYVDEVIIG  259

Query  182  APWEVTKDMI-TTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESP  337
            AP+ VT+D++   + +S+V+HGT +  S+   +  +PY +P S GI K + SP
Sbjct  260  APYSVTEDILDKEYYVSVVIHGTTS--SELDIDGADPYELPKSRGIYKEISSP  310


 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 57/95 (60%), Gaps = 7/95 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A+ +GD L+VG+H+D  +   +G    +M   ER  +V AC++VDEV+  
Sbjct  19   HYGHANALRQAKEMGDILVVGVHSDVEIEKNKGP--TVMKEEERYAAVAACKWVDEVVPN  76

Query  182  APWEVTKDMITTFDISLVVHG----TVAEYSD-YQ  271
            AP+  T +++  ++I   VHG    T+A+ +D YQ
Sbjct  77   APYNTTVEILQEYNIDFCVHGDDITTMADGTDCYQ  111



>ref|XP_001008378.1| cytidyltransferase-related domain containing protein [Tetrahymena 
thermophila]
 gb|EAR88133.1| choline-phosphate cytidylyltransferase [Tetrahymena thermophila 
SB210]
Length=454

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 101/149 (68%), Gaps = 2/149 (1%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH+E L+ A+ LGD+L+VG+H D+TV   +G++ P++ L ER L+VLA +YVDEVIIG
Sbjct  298  HIGHIETLKKAKELGDYLIVGLHDDETVQEKKGSNYPVLTLQERVLNVLAMKYVDEVIIG  357

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEA--ENPYAVPISMGILKVLESPLDitts  355
            APW+ T+ +I  F+IS+VV GT+ +  + + E   ++PY VP  +GI K +ES  D+TT 
Sbjct  358  APWQPTEQLIKQFNISIVVEGTMTKLKENKPEVIEQDPYLVPKKLGIFKQIESSNDMTTD  417

Query  356  tiirriVSNHDAYLKRNEKKVESEKRYYE  442
             I+ RI+ N   +L+    K + +  YYE
Sbjct  418  KIVERIIENRLRFLEIYNVKNKKQDLYYE  446


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/81 (30%), Positives = 45/81 (56%), Gaps = 2/81 (2%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H+GH   +R A+   + L+VG+   + ++  +G   P+++  ER     AC++ DE+   
Sbjct  95   HSGHFNAIRQAKQYCETLVVGVIAQEEITKRKGP--PVLSYEERVGIAKACKWADEICEH  152

Query  182  APWEVTKDMITTFDISLVVHG  244
            AP++ T ++I   + S V HG
Sbjct  153  APYDPTIELIDRLNCSHVAHG  173



>ref|XP_009513920.1| hypothetical protein PHYSODRAFT_348782 [Phytophthora sojae]
 gb|EGZ26645.1| hypothetical protein PHYSODRAFT_348782 [Phytophthora sojae]
Length=469

 Score =   128 bits (322),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 71/152 (47%), Positives = 100/152 (66%), Gaps = 11/152 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILRLA+  G +L+VG+H D  V+A RG + PIMNLHER LSVL C++VD+V+I 
Sbjct  314  HAGHVEILRLAKQQGSYLIVGVHNDSVVNAHRGLNYPIMNLHERVLSVLGCKFVDDVLID  373

Query  182  APWEVTKDMITTFDISLVVHGT------VAEYSDYQKEAENPYAVPISMGILKVLESPLD  343
            APW+VT +MI + +IS+VVHGT      + E+S      E  Y      GI K+++SP  
Sbjct  374  APWQVTPEMIASLNISVVVHGTHRDQHHLPEFS-----LEEHYEHARKAGIFKLIQSPNK  428

Query  344  ittstiirriVSNHDAYLKRNEKKVESEKRYY  439
            +  + I+ RI  N + + K+   K++SE+ YY
Sbjct  429  LDVNDIVGRINDNRERFEKKFVSKMKSEEEYY  460


 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 52/85 (61%), Gaps = 5/85 (6%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH+   R ARSLG +L+VG++ D++++A +GA  P++N  ER  SV  C++VDEV   
Sbjct  123  HYGHMNAFRQARSLGTYLVVGVNDDESITACKGA-PPVLNNEERIASVEGCKFVDEVEPH  181

Query  182  APW----EVTKDMITTFDISLVVHG  244
             P+    E  + MI    I  VVHG
Sbjct  182  CPYIMNEEYLQRMIKKHRIDYVVHG  206



>ref|XP_002672471.1| predicted protein [Naegleria gruberi]
 gb|EFC39727.1| predicted protein [Naegleria gruberi]
Length=371

 Score =   127 bits (319),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 70/143 (49%), Positives = 98/143 (69%), Gaps = 5/143 (3%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH+E L+ A+ LGD+L+VG+H D+ +S  +G H PIMN+HER LSVL+CRYVD+VIIG
Sbjct  224  HTGHIEFLKAAKKLGDYLIVGLHEDKVISQFKGPHHPIMNIHERLLSVLSCRYVDDVIIG  283

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPL-Dittst  358
            AP+ VT+D++    I++VV GTV E     +   +PY +P  +GI   +ESP  ++TT+ 
Sbjct  284  APFIVTQDLVDVMKINIVVSGTVLE----PEVKVDPYELPKKLGIYHQIESPCKELTTTN  339

Query  359  iirriVSNHDAYLKRNEKKVESE  427
            II RI+ N   Y +RN KK   E
Sbjct  340  IINRIIDNAKRYEERNAKKQAKE  362


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 47/83 (57%), Gaps = 4/83 (5%)
 Frame = +2

Query  2    HAGHVEILRLARSL--GDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVI  175
            H GH  ++R A +L     LLVG+H+D+ +   +G    IM  +ER   V +C++VD VI
Sbjct  28   HFGHANVIRQAYNLFPNVKLLVGVHSDEEILRHKGP--TIMKANERYEHVRSCKWVDGVI  85

Query  176  IGAPWEVTKDMITTFDISLVVHG  244
              AP+    +M+  +++   VHG
Sbjct  86   EDAPYVTDLEMLKKYNVDYCVHG  108



>ref|XP_787725.3| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Strongylocentrotus 
purpuratus]
Length=213

 Score =   124 bits (310),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 98/144 (68%), Gaps = 2/144 (1%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH++ L  A  LG++++VG+H DQ V+   G++ PIMNLHER+LSVLACRYVDEV+IG
Sbjct  44   HVGHIDFLEQASKLGNYIIVGLHGDQEVNRYHGSNYPIMNLHERTLSVLACRYVDEVVIG  103

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            AP++VT +++  F++ +VV G    +     +  +PY  P   GIL++++S  +++ S I
Sbjct  104  APYKVTAELLDHFNVDVVVQGKTKIFQG--ADGADPYEEPKKRGILQLVDSGNNMSASKI  161

Query  362  irriVSNHDAYLKRNEKKVESEKR  433
            + RI++N   + KRN+ K E E R
Sbjct  162  VERIITNRIRFQKRNKDKEEKELR  185



>ref|XP_002423231.1| Ethanolamine-phosphate cytidylyltransferase, putative [Pediculus 
humanus corporis]
 gb|EEB10493.1| Ethanolamine-phosphate cytidylyltransferase, putative [Pediculus 
humanus corporis]
Length=434

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/147 (46%), Positives = 99/147 (67%), Gaps = 2/147 (1%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH++ +  AR LGDFL+VG+HTD  V+  +G++ PIMNLHER LSVLA +YV EV+IG
Sbjct  261  HVGHLDFIEKARGLGDFLIVGLHTDPVVNLYKGSNYPIMNLHERVLSVLAFKYVSEVVIG  320

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            AP+ VT++++  F++ +V HG      D   +  +PY VP  MG   +++S  D+TT  I
Sbjct  321  APYSVTRNLMEHFNVDIVCHGNTQIMPDV--DGRDPYLVPKQMGKFVLIDSGNDMTTEKI  378

Query  362  irriVSNHDAYLKRNEKKVESEKRYYE  442
            ++RI+ N   Y +RNEKK + E + YE
Sbjct  379  VKRIIMNRLEYEQRNEKKEKREIKLYE  405


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 47/81 (58%), Gaps = 2/81 (2%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A++LGD+L+VG+H D+ +   +G   P+    ER   V A ++VDEV+ G
Sbjct  52   HFGHANSLRQAKALGDYLVVGVHNDEEIIKHKGP--PVFTQKERYKMVQAIKWVDEVVEG  109

Query  182  APWEVTKDMITTFDISLVVHG  244
            AP+  T + +  +     VHG
Sbjct  110  APYVTTLETLDKYKCDFCVHG  130



>ref|XP_002611477.1| hypothetical protein BRAFLDRAFT_113520 [Branchiostoma floridae]
 gb|EEN67487.1| hypothetical protein BRAFLDRAFT_113520 [Branchiostoma floridae]
Length=382

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/147 (47%), Positives = 99/147 (67%), Gaps = 2/147 (1%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH++ L+ AR  GD+L+VG+HTD  V+  +G++ PIMN+HER+L VLACR+V EV+IG
Sbjct  221  HVGHLDFLQRARQEGDYLIVGLHTDPVVNGYKGSNHPIMNIHERTLCVLACRHVSEVVIG  280

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            AP+ VT++++  F+I LVVHG      D   E  +PY VP  +G  K ++S  D+TT+ I
Sbjct  281  APYTVTEELMEHFNIDLVVHGRTNVIPD--TEGHDPYKVPKGLGKYKQIDSGNDMTTTKI  338

Query  362  irriVSNHDAYLKRNEKKVESEKRYYE  442
            I RI+ N   +  RN+ K E E R +E
Sbjct  339  IERIIRNRLHFEARNKAKEEKEMRAFE  365


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 49/81 (60%), Gaps = 2/81 (2%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A+ +GD+L+VG+H+D+ +S  +G   P+M   ER   V A ++VDEV+  
Sbjct  29   HFGHANALRQAKKMGDYLIVGVHSDEEISKHKGP--PVMTEEERYKMVRAVKWVDEVVEA  86

Query  182  APWEVTKDMITTFDISLVVHG  244
            AP+  T + +  ++    VHG
Sbjct  87   APYVTTIETLDKYNCDYCVHG  107



>ref|XP_003283291.1| phosphoethanolamine-cytidyltransferase [Dictyostelium purpureum]
 gb|EGC40222.1| phosphoethanolamine-cytidyltransferase [Dictyostelium purpureum]
Length=361

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 71/147 (48%), Positives = 97/147 (66%), Gaps = 1/147 (1%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH E L+ A++LGDFL+VG+H D+TV+  +G++ PIMNLHER LSVL+CRYVDEV+IG
Sbjct  213  HVGHTEALKQAKALGDFLIVGVHDDKTVNQQKGSNFPIMNLHERVLSVLSCRYVDEVVIG  272

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            AP+ VTK+MI +  I++VVHG           A +PY +P  MGI K +     +T S I
Sbjct  273  APFSVTKEMIESLHINVVVHGDDPVILGPDNGA-DPYKLPKEMGIYKEIAHTEGLTASEI  331

Query  362  irriVSNHDAYLKRNEKKVESEKRYYE  442
            ++RI+ N   +  RN KK   E  + E
Sbjct  332  VQRIIDNRLQFEARNRKKQAKEIDFIE  358


 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 51/81 (63%), Gaps = 2/81 (2%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR LGD L+VG+HTD+ ++  +G   P+M   ER  +V AC++ DEV  G
Sbjct  22   HFGHANALRQARELGDILVVGVHTDEEITKNKGP--PVMKEQERYKAVRACKWADEVAEG  79

Query  182  APWEVTKDMITTFDISLVVHG  244
            AP+ +T++ + + +    VHG
Sbjct  80   APYTLTEEFLDSQNCDFCVHG  100



>ref|XP_004353870.1| phosphoethanolamine-cytidyltransferase [Dictyostelium fasciculatum]
 gb|EGG14461.1| phosphoethanolamine-cytidyltransferase [Dictyostelium fasciculatum]
Length=363

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 70/147 (48%), Positives = 98/147 (67%), Gaps = 4/147 (3%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH E LR A+ LGDFL+VG+H D+ V+  +G++ PIMNLHER LSVL+CRYVDEVIIG
Sbjct  218  HVGHTEALRQAKELGDFLIVGVHDDKVVNEQKGSNFPIMNLHERVLSVLSCRYVDEVIIG  277

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            AP+ VTK+MI +  I+ VVHG     S       +PY +P  +GI K ++    +T + I
Sbjct  278  APFNVTKEMIESLRINTVVHGDDPVVS----VDADPYKLPKGLGIYKEIKHTEGLTATEI  333

Query  362  irriVSNHDAYLKRNEKKVESEKRYYE  442
            +RRI+ N   +  RN+KK ++E  + +
Sbjct  334  VRRIIENRMQFEARNKKKQQNEVTFIQ  360


 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 49/81 (60%), Gaps = 2/81 (2%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR LGD L+VG+HTD  ++  +G   P+MN  ER  +V AC++ DEV  G
Sbjct  28   HFGHANALRQARELGDILVVGVHTDAEIAKNKGP--PVMNEQERYKAVRACKWADEVAEG  85

Query  182  APWEVTKDMITTFDISLVVHG  244
            AP+  T +++   +    VHG
Sbjct  86   APYTATVELLDQLNCDFCVHG  106



>gb|EPB91886.1| ethanolamine-phosphate cytidylyltransferase [Mucor circinelloides 
f. circinelloides 1006PhL]
Length=373

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 82/113 (73%), Gaps = 3/113 (3%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH+E L+ A+ LGDFL+VG+H DQTV+A +G + P+MNLHER+LSVLACRYVDEVIIG
Sbjct  215  HVGHIEFLKRAKELGDFLIVGVHDDQTVNAIKGINYPLMNLHERALSVLACRYVDEVIIG  274

Query  182  APWEVTKDMITT-FDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESP  337
            AP+ VT+D++   +++++VVHG      D   +  +PY +P    I   +E+P
Sbjct  275  APYSVTEDVLNKEYNVNMVVHGNTPTEPDL--DGSDPYELPKKRNIYVEIENP  325


 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 56/95 (59%), Gaps = 7/95 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A+ +GD L+VG+H+D  +   +G    +M   ER  +V AC++ DEV+  
Sbjct  22   HYGHANALRQAKEMGDILVVGVHSDAEIEKNKGP--TVMKEQERYAAVAACKWADEVVPD  79

Query  182  APWEVTKDMITTFDISLVVHG----TVAEYSD-YQ  271
            AP+  T +++  ++I   VHG    T+A+ +D YQ
Sbjct  80   APYNTTVEILKEYNIDFCVHGDDITTMADGTDCYQ  114



>ref|XP_003081234.1| CTP:ethanolamine cytidylyltransferase (ISS) [Ostreococcus tauri]
Length=361

 Score =   125 bits (314),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 103/152 (68%), Gaps = 5/152 (3%)
 Frame = +2

Query  8    GHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIGAP  187
            GH+++LR A++LGDF+LVG+H D  V + RGA  P++N  ER+LSVLACRY DEV+IGAP
Sbjct  212  GHIDLLRRAKTLGDFVLVGVHADAEVRSRRGADHPVLNEKERALSVLACRYADEVVIGAP  271

Query  188  WEVTKDMITTFDISLVVHGTVAEYSD-YQKEAENPYAVPISMGILKVLESPLDittstii  364
             ++T D++TTF++++V    VAE  D Y    E+  A+ +  G+ + ++   D +  T+ 
Sbjct  272  MKITHDLLTTFNVAVV----VAEDEDEYLIGGEDVNALAMKRGVFRRVDREHDCSVLTVA  327

Query  365  rriVSNHDAYLKRNEKKVESEKRYYEGKSYIS  460
            +RI+ N   +  RN +KV+SE  YY  K++++
Sbjct  328  KRIMENRAEFEARNARKVKSESAYYAQKAHVA  359


 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 40/69 (58%), Gaps = 2/69 (3%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+ GD LLVG+  D  +   +G   P+ +  ER   V AC++VD+VI  
Sbjct  77   HYGHANALRQARACGDVLLVGVVNDAEIRRCKGP--PVCDEVERLEMVRACKWVDDVIED  134

Query  182  APWEVTKDM  208
             P+EVT + 
Sbjct  135  VPYEVTDEF  143



>ref|XP_004368196.1| CTP:ethanolaminephosphate cytidylyltransferase [Acanthamoeba 
castellanii str. Neff]
 gb|ELR25441.1| CTP:ethanolaminephosphate cytidylyltransferase [Acanthamoeba 
castellanii str. Neff]
Length=366

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 105/150 (70%), Gaps = 0/150 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVE L+ AR++ D+L+VG+H+DQ ++ +RG++ PIMNL+ER+L VL+CRYVDEVIIG
Sbjct  210  HAGHVEALKQARAMCDYLMVGVHSDQDINRSRGSNYPIMNLNERALCVLSCRYVDEVIIG  269

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APW +++D +T   ISLV+HG   +       A++PYA    +GI + ++    ++T++I
Sbjct  270  APWGISEDDLTNLRISLVLHGDERDQYYPLPSADDPYAAAKKLGIFQEIKYSQGLSTTSI  329

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGKS  451
            + RI+ +   Y KRN+ +   +++  E ++
Sbjct  330  VDRIIHHRLTYEKRNKDREARDRQIAEQQA  359


 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 49/81 (60%), Gaps = 2/81 (2%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A+ +GD L+VGIH D+ +   +G   P+MN  ER   V AC++VDEV + 
Sbjct  30   HFGHANALRQAKQMGDVLVVGIHPDEEIIRNKGP--PVMNQDERLAVVKACKWVDEVTLD  87

Query  182  APWEVTKDMITTFDISLVVHG  244
            AP++ T   +  F+I   VHG
Sbjct  88   APYQTTLATLDKFNIDFAVHG  108



>ref|XP_002767684.1| Choline-phosphate cytidylyltransferase A, putative [Perkinsus 
marinus ATCC 50983]
 gb|EER00402.1| Choline-phosphate cytidylyltransferase A, putative [Perkinsus 
marinus ATCC 50983]
Length=215

 Score =   122 bits (306),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 102/154 (66%), Gaps = 1/154 (1%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            + GH   L  A++LG +LLVGI  D+TV+  +G + P+MNLHER L+V AC++VDEVIIG
Sbjct  60   NVGHATTLEKAKALGTYLLVGIFDDETVNKMKGGNYPVMNLHERVLNVSACKHVDEVIIG  119

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLD-ittst  358
            AP E+++D+I T +IS+V  G+++ +S   +     + VP  +GIL+ +ES    +T +T
Sbjct  120  APVEISEDLIRTMNISIVAQGSISSFSTQYEILVRLFVVPKRLGILREVESDYPHLTGAT  179

Query  359  iirriVSNHDAYLKRNEKKVESEKRYYEGKSYIS  460
            I  RI+ N   Y+ RN+K+ E E  YY  K +I+
Sbjct  180  IATRIIKNCLTYINRNKKRSEIESEYYCNKQHIA  213



>ref|XP_002600903.1| hypothetical protein BRAFLDRAFT_263711 [Branchiostoma floridae]
 ref|XP_002600908.1| hypothetical protein BRAFLDRAFT_263704 [Branchiostoma floridae]
 gb|EEN56915.1| hypothetical protein BRAFLDRAFT_263711 [Branchiostoma floridae]
 gb|EEN56920.1| hypothetical protein BRAFLDRAFT_263704 [Branchiostoma floridae]
Length=365

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 69/147 (47%), Positives = 100/147 (68%), Gaps = 2/147 (1%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH++ L+ AR  GD+L+VG+HTD  V+  +G++ PIMN+HER+L VLACRYV EV+IG
Sbjct  216  HVGHLDFLQKARQEGDYLIVGLHTDPVVNWYKGSNHPIMNIHERTLCVLACRYVSEVVIG  275

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            AP+ VTK+++  F + +VVHG      D  ++  +PY VP  +   K ++S  D+TTS I
Sbjct  276  APYTVTKELMDHFSVDVVVHGRTPYPPD--RDGSDPYRVPKELEKFKRIDSDNDMTTSKI  333

Query  362  irriVSNHDAYLKRNEKKVESEKRYYE  442
            I+RI+SN   +  RN+ K E E R +E
Sbjct  334  IKRIISNRLNFEARNKAKEEKEIRAFE  360


 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 50/81 (62%), Gaps = 2/81 (2%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A+ +GD+L+VGIH+D+ ++  +G   P+M   ER   V A ++VDEV+ G
Sbjct  24   HFGHANALRQAKKMGDYLVVGIHSDEEITKHKGP--PVMTEQERYKMVGAIKWVDEVVEG  81

Query  182  APWEVTKDMITTFDISLVVHG  244
            +P+  T + +  ++    VHG
Sbjct  82   SPYVTTLETMDKYNCDFCVHG  102



>gb|EPY30399.1| ethanolamine-phosphate cytidylyltransferase [Angomonas deanei]
Length=345

 Score =   124 bits (311),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 100/147 (68%), Gaps = 1/147 (1%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH+ +L+ AR LGD+++VG+H D+TV+  +G + PIMNL+ER L VL+CRYVDEV++G
Sbjct  188  HIGHIRVLQKARELGDYVIVGVHEDKTVNEVKGKNYPIMNLNERVLGVLSCRYVDEVVLG  247

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
             P+ VTKD+I +  + +VV G V +      +A + Y VP  +GI + ++S  ++TT  +
Sbjct  248  VPFNVTKDVIDSLHVDIVVGGKVCDQYP-GGDAGSSYQVPQELGIFREVDSECNLTTDFL  306

Query  362  irriVSNHDAYLKRNEKKVESEKRYYE  442
            I R++ N  A+LKR E+K   +K+  E
Sbjct  307  IERVIQNRAAFLKRQEEKRVKDKKCIE  333


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 54/110 (49%), Gaps = 5/110 (5%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   +R A   G+ L VG HTD+ V   +G   PIM+  ER  ++ AC++VD V+  
Sbjct  10   HFGHCNAIRQAAKFGNELFVGCHTDEEVMRFKGP--PIMHDEERYEALRACKWVDYVVEN  67

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLE  331
             P+      +  F+I  VVHG          +  N Y   I  G LKV++
Sbjct  68   YPYCTRLKDMERFEIDYVVHGDDLSVG---LDGRNSYQEIIDAGKLKVVK  114



>emb|CEF99073.1| Rossmann-like alpha/beta/alpha sandwich fold [Ostreococcus tauri]
Length=404

 Score =   125 bits (313),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 103/152 (68%), Gaps = 5/152 (3%)
 Frame = +2

Query  8    GHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIGAP  187
            GH+++LR A++LGDF+LVG+H D  V + RGA  P++N  ER+LSVLACRY DEV+IGAP
Sbjct  255  GHIDLLRRAKTLGDFVLVGVHADAEVRSRRGADHPVLNEKERALSVLACRYADEVVIGAP  314

Query  188  WEVTKDMITTFDISLVVHGTVAEYSD-YQKEAENPYAVPISMGILKVLESPLDittstii  364
             ++T D++TTF++++V    VAE  D Y    E+  A+ +  G+ + ++   D +  T+ 
Sbjct  315  MKITHDLLTTFNVAVV----VAEDEDEYLIGGEDVNALAMKRGVFRRVDREHDCSVLTVA  370

Query  365  rriVSNHDAYLKRNEKKVESEKRYYEGKSYIS  460
            +RI+ N   +  RN +KV+SE  YY  K++++
Sbjct  371  KRIMENRAEFEARNARKVKSESAYYAQKAHVA  402


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 55/111 (50%), Gaps = 9/111 (8%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR+ GD LLVG+  D  +   +G   P+ +  ER   V AC++VD+VI  
Sbjct  77   HYGHANALRQARACGDVLLVGVVNDAEIRRCKGP--PVCDEVERLEMVRACKWVDDVIED  134

Query  182  APWEV----TKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILK  322
             P+EV    T ++     +  VVHG   +      +  + YA P  +G  K
Sbjct  135  VPYEVTDEFTDELFEKHGVDYVVHG---DDPCLLPDGTDAYAYPKRIGKYK  182



>emb|CDS08410.1| hypothetical protein LRAMOSA09772 [Absidia idahoensis var. thermophila]
Length=269

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 82/113 (73%), Gaps = 3/113 (3%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH+E L+ A++LGDFL+VG+H DQTV+A +G++ P+MNLHER+LSVLACRYVDEVIIG
Sbjct  111  HIGHIEFLKRAKALGDFLIVGVHDDQTVNAIKGSNYPLMNLHERALSVLACRYVDEVIIG  170

Query  182  APWEVTKDMITT-FDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESP  337
            AP+ +T+ ++T  + + +V HG      D   + ++PY +    GI   +E+P
Sbjct  171  APYSITEAVLTKEYKVHIVAHGNTPTEPDL--DGKDPYQLAKDRGIYTEIENP  221



>emb|CDH58541.1| ethanolamine-phosphate cytidylyltransferase-like [Lichtheimia 
corymbifera JMRC:FSU:9682]
Length=377

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 82/113 (73%), Gaps = 3/113 (3%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH+E L+ A++LGDFL+VG+H DQTV+A +GA+ P+MNLHER+LSVLAC+YVDEVIIG
Sbjct  217  HVGHIEFLKRAKALGDFLVVGVHDDQTVNAIKGANHPLMNLHERALSVLACKYVDEVIIG  276

Query  182  APWEVTKDMITT-FDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESP  337
            AP+ VT+D++   + + +V HG  A   D   +  + Y +P   GI   +E+P
Sbjct  277  APYSVTEDVLNKEYKVHVVAHGNTATEPDL--DGSDAYELPKQRGIYVEIENP  327


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 59/95 (62%), Gaps = 7/95 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A+++GD+L+VG+H+D  ++  +G    +M   ER  +V AC++VDEV+  
Sbjct  24   HYGHANALRQAKAMGDYLVVGVHSDAEITKNKGP--TVMREEERYAAVAACKWVDEVVPD  81

Query  182  APWEVTKDMITTFDISLVVHG----TVAEYSD-YQ  271
            AP+  T D++   +I   VHG    T+A+ +D YQ
Sbjct  82   APYFTTVDILRKHNIDFCVHGDDITTMADGTDCYQ  116



>ref|XP_829470.1| ethanolamine-phosphate cytidylyltransferase [Trypanosoma brucei 
brucei TREU927]
 gb|EAN80358.1| ethanolamine-phosphate cytidylyltransferase, putative [Trypanosoma 
brucei brucei TREU927]
 emb|CAX32459.1| CTP-phosphoethanolamine cytidyltransferase [Trypanosoma brucei 
brucei]
 emb|CBH18461.1| ethanolamine-phosphate cytidylyltransferase,putative [Trypanosoma 
brucei gambiense DAL972]
Length=384

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 94/135 (70%), Gaps = 1/135 (1%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGH+  L+ AR+LGD+L+VGIH DQ V  ++G H PIM+L+ER+L VL+CRYVD+V+ G
Sbjct  227  HAGHIRFLQKARALGDYLIVGIHDDQLVRESKGEHFPIMSLNERALGVLSCRYVDDVVFG  286

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            AP  VT++MI   DI +V  GT +E  +  K A + Y VP S+ + KV+ES  D++T  I
Sbjct  287  APRGVTQEMIKILDIKIVACGTSSETRNC-KGAFDVYEVPKSLNLFKVVESGSDLSTDMI  345

Query  362  irriVSNHDAYLKRN  406
            + R+V NH   L+R 
Sbjct  346  VERVVKNHVVLLERQ  360


 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 55/109 (50%), Gaps = 5/109 (5%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR ARS+GD L VG HTD+ +   +G   P M   ER  ++ AC++VD VI G
Sbjct  47   HFGHANALRQARSMGDELFVGCHTDEEIIRHKGP--PSMRQEERYEALRACKWVDAVIEG  104

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVL  328
             P+    + +  F++  VVHG   +         N Y   I  G+ K +
Sbjct  105  YPYVTRVEDMKRFEVDFVVHG---DDISVDLNGRNSYQAIIDAGMFKAV  150



>gb|EPY35339.1| ethanolamine-phosphate cytidylyltransferase [Angomonas deanei]
Length=300

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 100/147 (68%), Gaps = 1/147 (1%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH+ +L+ AR LGD+++VG+H D+TV+  +G + PIMNL+ER L VL+CRYV+EV++G
Sbjct  143  HIGHIRVLQKARELGDYVIVGVHEDKTVNEVKGKNYPIMNLNERVLGVLSCRYVNEVVLG  202

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
             P+ VTKD+I +  + +VV G V +      +A + Y VP  +GI + ++S  ++TT  +
Sbjct  203  VPFNVTKDVIDSLHVDIVVGGKVCDQYP-GGDAGSSYQVPQELGIFREVDSECNLTTDFL  261

Query  362  irriVSNHDAYLKRNEKKVESEKRYYE  442
            I R++ N  A+LKR E+K   +K+  E
Sbjct  262  IERVIQNRAAFLKRQEEKRVKDKKCIE  288



>emb|CDS11051.1| Putative Ethanolamine-phosphatecytidylyltransferase [Absidia 
idahoensis var. thermophila]
Length=379

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 82/113 (73%), Gaps = 3/113 (3%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH+E L+ A++LGDFL+VG+H DQTV+A +GA+ P+MNLHER+LSVLAC+YVDEVIIG
Sbjct  217  HVGHIEFLKRAKALGDFLVVGVHDDQTVNAIKGANHPLMNLHERALSVLACKYVDEVIIG  276

Query  182  APWEVTKDMITT-FDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESP  337
            AP+ VT+D++   + + +V HG  A   D   +  + Y +P   GI   +E+P
Sbjct  277  APYSVTEDVLNKEYKVHVVAHGNTATEPDL--DGSDAYELPKQRGIYVEIENP  327


 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 58/95 (61%), Gaps = 7/95 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A+ +GD+L+VG+H+D  ++  +G    +M   ER  +V AC++VDEV+  
Sbjct  24   HYGHANALRQAKEMGDYLVVGVHSDAEIAKNKGP--TVMREEERYAAVAACKWVDEVVPD  81

Query  182  APWEVTKDMITTFDISLVVHG----TVAEYSD-YQ  271
            AP+  T D++   +I   VHG    T+A+ +D YQ
Sbjct  82   APYFTTVDILRKHNIDFCVHGDDITTMADGTDCYQ  116



>ref|XP_002060439.1| GJ14912 [Drosophila virilis]
 gb|EDW71479.1| GJ14912 [Drosophila virilis]
Length=167

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/148 (44%), Positives = 99/148 (67%), Gaps = 2/148 (1%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH++ L  A  LGD+L+VG+HTD  V++ +G++ PIMNLHER LSVLAC++V+EV+IG
Sbjct  11   HVGHLDFLEKASKLGDYLIVGLHTDPVVNSYKGSNYPIMNLHERVLSVLACKFVNEVVIG  70

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            AP+ VT++++  F I +V HG        +    +PYAVP +  I ++L+S  D+TT  I
Sbjct  71   APYCVTEELLDHFKIDVVCHGRTP--ISLEDGKIDPYAVPKTRAIFELLDSGNDMTTERI  128

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEG  445
            + RI+S+   Y +RN+ K + E   +E 
Sbjct  129  VERIISHRLEYERRNQAKEKKEIEAFEA  156



>emb|CDH58540.1| ethanolamine-phosphate cytidylyltransferase [Lichtheimia corymbifera 
JMRC:FSU:9682]
Length=378

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 82/113 (73%), Gaps = 3/113 (3%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH+E L+ A++LGDFL+VG+H DQTV+A +GA+ P+MNLHER+LSVLAC+YVDEVIIG
Sbjct  218  HVGHIEFLKRAKALGDFLVVGVHDDQTVNAIKGANHPLMNLHERALSVLACKYVDEVIIG  277

Query  182  APWEVTKDMITT-FDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESP  337
            AP+ VT+D++   + + +V HG  A   D   +  + Y +P   GI   +E+P
Sbjct  278  APYSVTEDVLNKEYKVHVVAHGNTATEPDL--DGSDAYELPKQRGIYVEIENP  328


 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 59/95 (62%), Gaps = 7/95 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A+++GD+L+VG+H+D  ++  +G    +M   ER  +V AC++VDEV+  
Sbjct  25   HYGHANALRQAKAMGDYLVVGVHSDAEITKNKGP--TVMREEERYAAVAACKWVDEVVPD  82

Query  182  APWEVTKDMITTFDISLVVHG----TVAEYSD-YQ  271
            AP+  T D++   +I   VHG    T+A+ +D YQ
Sbjct  83   APYFTTVDILRKHNIDFCVHGDDITTMADGTDCYQ  117



>ref|XP_646687.1| hypothetical protein DDB_G0270298 [Dictyostelium discoideum AX4]
 sp|Q55BZ4.1|PCY2_DICDI RecName: Full=Ethanolamine-phosphate cytidylyltransferase; AltName: 
Full=CTP:phosphoethanolamine cytidylyltransferase; AltName: 
Full=Phosphorylethanolamine transferase [Dictyostelium 
discoideum]
 gb|EAL72499.1| hypothetical protein DDB_G0270298 [Dictyostelium discoideum AX4]
Length=360

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/147 (47%), Positives = 97/147 (66%), Gaps = 1/147 (1%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH E L+ AR+LGD+L+VG+H D+ V   +G++ PIMNLHER LSVL+CRYVDEV+IG
Sbjct  212  HVGHTEALKQARALGDYLIVGVHDDRVVHEQKGSNFPIMNLHERVLSVLSCRYVDEVVIG  271

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            AP+ VTKDMI +  I++VVHG   +     +   +PY +P  +GI K ++    +T + I
Sbjct  272  APFSVTKDMIDSLHINVVVHGD-DQVVLGPEGGVDPYKLPRELGIYKEVKHTEGLTATEI  330

Query  362  irriVSNHDAYLKRNEKKVESEKRYYE  442
            ++RI+ N   Y  RN KK   E  + E
Sbjct  331  VKRIIDNRLQYEARNRKKEAKEINFIE  357


 Score = 79.3 bits (194),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 52/81 (64%), Gaps = 2/81 (2%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR AR LGD L+VG+HTD+ ++  +G   P+MN  ER  +V AC++ DEV  G
Sbjct  22   HFGHANALRQARELGDILVVGVHTDEEIAKNKGP--PVMNEQERYKAVRACKWADEVAEG  79

Query  182  APWEVTKDMITTFDISLVVHG  244
            AP+ +T++ + + +    VHG
Sbjct  80   APYTLTEEYLDSLNCDFCVHG  100



>gb|AAK13093.1|AC078839_9 Putative phospholipid cytidylyltransferase [Oryza sativa Japonica 
Group]
Length=742

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 87/131 (66%), Gaps = 23/131 (18%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEILR AR LGDFLLVG+H DQ +   RG +RPIM+LHER+LSVLACRYVDEVIIG
Sbjct  631  HAGHVEILRSARQLGDFLLVGVHDDQAIRDRRG-YRPIMHLHERTLSVLACRYVDEVIIG  689

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            APWEV++DM+                        + YAVP SMGI + + S   ITT ++
Sbjct  690  APWEVSRDMVGI----------------------DSYAVPKSMGIFQTITSTKPITTVSV  727

Query  362  irriVSNHDAY  394
              RI+ NH+AY
Sbjct  728  ATRIIDNHEAY  738


 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 54/85 (64%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A+ LGD L+VG+ +D+ + A +G   P++++ ER   V   ++VDEVI  
Sbjct  425  HYGHANALRQAKLLGDQLVVGVVSDEEIVANKGP--PVLSMEERLTLVSGLKWVDEVIPN  482

Query  182  APWEVTKDMITT----FDISLVVHG  244
            AP+E+T++ + T    ++I  ++HG
Sbjct  483  APYEITEEFMNTLFNKYNIDYIIHG  507



>gb|KFH72676.1| ethanolamine-phosphate cytidylyltransferase [Mortierella verticillata 
NRRL 6337]
Length=376

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 95/143 (66%), Gaps = 3/143 (2%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH+E L+ A+ LGD+LLVGIH DQTV+A +G++ P+MNLHER LSVL+CRYVDEV+IG
Sbjct  215  HTGHIEFLKRAKQLGDYLLVGIHDDQTVNAIKGSNYPVMNLHERVLSVLSCRYVDEVVIG  274

Query  182  APWEVTKDMI-TTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittst  358
            AP+ VT+ ++   + +++VVHG     +D  K+ ++PY +    GI   +++P +  T+ 
Sbjct  275  APYSVTEQVLEKVYKVNVVVHGNTPSLND--KDGQDPYQLAKDRGIYVEIDNPQNSVTTE  332

Query  359  iirriVSNHDAYLKRNEKKVESE  427
             I   +  H    +  +++ E +
Sbjct  333  SIIDRIITHRKVYEERQRRKEQK  355


 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 57/95 (60%), Gaps = 7/95 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A+++GD+L+VG+H+D  +   +G    +M   ER  +V AC++VDEV+  
Sbjct  23   HFGHFNALRQAKAMGDYLVVGVHSDAEIEHHKGP--TVMKEDERYAAVAACKWVDEVVPN  80

Query  182  APWEVTKDMITTFDISLVVHG----TVAEYSD-YQ  271
            AP+  + + +  ++    VHG    T+A+ +D YQ
Sbjct  81   APYLTSIEWMDKYNCDFCVHGDDITTLADGTDCYQ  115



>gb|EFA80421.1| phosphoethanolamine-cytidyltransferase [Polysphondylium pallidum 
PN500]
Length=371

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 72/147 (49%), Positives = 98/147 (67%), Gaps = 3/147 (2%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH E LR A+ LGDFL+VG+H D  V+  +G++ PIMNLHER LSVL+CRYVDEV+IG
Sbjct  226  HVGHTEALRQAKELGDFLIVGVHDDAVVNEQKGSNFPIMNLHERVLSVLSCRYVDEVVIG  285

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            AP+ VTK+MI    I+ VVHG     S   ++  +PY VP  +GI K ++    +TT+ I
Sbjct  286  APFNVTKEMIEGLHINTVVHGDDPVIS---RDGLDPYKVPKELGIYKEIKHTEGLTTTDI  342

Query  362  irriVSNHDAYLKRNEKKVESEKRYYE  442
            IRRI+ N   +  RN+KK + E  + +
Sbjct  343  IRRIIDNRIQFEARNKKKEQKEVTFIQ  369


 Score = 76.3 bits (186),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 49/81 (60%), Gaps = 2/81 (2%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   +R AR LGD L+VG+HTD  ++  +G   P+MN  ER  +V AC++ DEV  G
Sbjct  37   HFGHANAMRQARELGDILVVGVHTDAEIARNKGP--PVMNEQERYKAVRACKWADEVAEG  94

Query  182  APWEVTKDMITTFDISLVVHG  244
            AP+  T +++   +    VHG
Sbjct  95   APYTATVELLKQLNCDFCVHG  115



>gb|ESA12672.1| hypothetical protein GLOINDRAFT_347240 [Rhizophagus irregularis 
DAOM 181602]
Length=344

 Score =   122 bits (306),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 82/113 (73%), Gaps = 3/113 (3%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH+E L+ A+SLG++LLVGIH DQTV+A +G + P+MNLHER LSVLACRYVDEVI+G
Sbjct  193  HVGHIEFLKRAKSLGNYLLVGIHDDQTVNAIKGVNFPLMNLHERVLSVLACRYVDEVILG  252

Query  182  APWEVTKDMIT-TFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESP  337
            AP+ V +++++  + + +V HG      D     ++PY +P ++GI   +E+P
Sbjct  253  APYSVDENVLSKVYKVDIVAHGNTPSLPDVN--GKDPYELPKALGIYVEIENP  303


 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 49/81 (60%), Gaps = 2/81 (2%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A+++GDFL+VG+H+D+ +   +G    +M   ER  +V AC++ D V+  
Sbjct  2    HHGHANALRQAKAMGDFLVVGVHSDEEIEKHKGP--TVMKEEERYTAVEACKWADLVVKD  59

Query  182  APWEVTKDMITTFDISLVVHG  244
            AP+  + +++  ++    VHG
Sbjct  60   APYFTSLEVMEKYNCDFCVHG  80



>gb|KCW80819.1| hypothetical protein EUGRSUZ_C02186 [Eucalyptus grandis]
Length=338

 Score =   122 bits (305),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            HAGHVEIL+ AR LGDFLLVG+HTD  VS  RG H PIM+LHERSLSVLACRYVDEVIIG
Sbjct  264  HAGHVEILKRARQLGDFLLVGLHTDYIVSEHRGKHHPIMHLHERSLSVLACRYVDEVIIG  323

Query  182  APWEVTKDMIT  214
            APWEV+KDM+ 
Sbjct  324  APWEVSKDMVC  334


 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 49/85 (58%), Gaps = 6/85 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A++LGD L+VG+ +D+ + A +G   P++ + ER   V   ++VDEVI  
Sbjct  78   HYGHANALRQAKALGDELVVGVVSDEEIVANKGP--PVLTMEERLALVSGLKWVDEVIPN  135

Query  182  APWEVT----KDMITTFDISLVVHG  244
            AP+ +T    K +     I  ++HG
Sbjct  136  APYAITEQFMKSLFNEHKIDYIIHG  160



>ref|XP_009027596.1| hypothetical protein HELRODRAFT_107813 [Helobdella robusta]
 gb|ESN94545.1| hypothetical protein HELRODRAFT_107813 [Helobdella robusta]
Length=390

 Score =   122 bits (307),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 97/146 (66%), Gaps = 2/146 (1%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH+  L  ARS GD+L+VGIH+D  V+  +G++ PIMNLHER LSVL  RYV EV+IG
Sbjct  222  HLGHLSFLEKARSCGDYLIVGIHSDPVVNRYKGSNNPIMNLHERVLSVLTNRYVSEVVIG  281

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            AP+ VT+D++  F + +V HG  A  +D   +  +PYAVP   G   +++S  D+TT ++
Sbjct  282  APYSVTEDLMDHFSVDIVCHGRTAICAD--DDGVDPYAVPRKRGKFVLIDSECDVTTESL  339

Query  362  irriVSNHDAYLKRNEKKVESEKRYY  439
            I RI+++   +  RN KK E E++ +
Sbjct  340  IERIIAHRVEFEARNRKKEEKERKLF  365


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 47/81 (58%), Gaps = 2/81 (2%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A+ +GD L+VGIH+D+ ++  +G   P+    ER   V + ++VDEV+  
Sbjct  31   HFGHANALRQAKQMGDVLVVGIHSDEEITKHKGP--PVFTEEERYKMVRSIKWVDEVVES  88

Query  182  APWEVTKDMITTFDISLVVHG  244
            AP+  T + +  ++    VHG
Sbjct  89   APYVTTIETLDKYNCDFCVHG  109



>emb|CEJ00776.1| Putative Ethanolamine-phosphate cytidylyltransferase [Rhizopus 
microsporus]
Length=300

 Score =   121 bits (303),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 80/102 (78%), Gaps = 3/102 (3%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH+E L+ A+  GDFL+VG+H DQTV+A +G + P+MNLHER+LSVLACRYVDEVIIG
Sbjct  200  HIGHIEFLKRAKEQGDFLVVGVHDDQTVNAIKGINYPLMNLHERALSVLACRYVDEVIIG  259

Query  182  APWEVTKDMITT-FDISLVVHGTVAEYSDYQKEAENPYAVPI  304
            AP+ VT+D++ T +++++VVHGT +   D   + ++PY V +
Sbjct  260  APYSVTEDVLNTEYNVTVVVHGTTSSEPDI--DGKDPYEVSL  299


 Score = 72.8 bits (177),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 57/95 (60%), Gaps = 7/95 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A+ +GD L+VG+H+D  +   +G    +M   ER  +V AC++VDEV+  
Sbjct  19   HYGHANALRQAKEMGDILVVGVHSDAKIEKNKGP--TVMKEQERYAAVAACKWVDEVVPN  76

Query  182  APWEVTKDMITTFDISLVVHG----TVAEYSD-YQ  271
            AP+  T +++  ++I   VHG    T+A+ +D YQ
Sbjct  77   APYNTTVEILQKYNIDFCVHGDDITTMADGTDCYQ  111



>gb|EXX58968.1| ethanolamine-phosphate cytidylyltransferase [Rhizophagus irregularis 
DAOM 197198w]
Length=364

 Score =   122 bits (306),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 82/113 (73%), Gaps = 3/113 (3%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH+E L+ A+SLG++LLVGIH DQTV+A +G + P+MNLHER LSVLACRYVDEVI+G
Sbjct  213  HVGHIEFLKRAKSLGNYLLVGIHDDQTVNAIKGVNFPLMNLHERVLSVLACRYVDEVILG  272

Query  182  APWEVTKDMIT-TFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESP  337
            AP+ V +++++  + + +V HG      D     ++PY +P ++GI   +E+P
Sbjct  273  APYSVDENVLSKVYKVDIVAHGNTPSLPDVN--GKDPYELPKALGIYVEIENP  323


 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 49/81 (60%), Gaps = 2/81 (2%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A+++GDFL+VG+H+D+ +   +G    +M   ER  +V AC++ D V+  
Sbjct  22   HHGHANALRQAKAMGDFLVVGVHSDEEIEKHKGP--TVMKEEERYTAVEACKWADLVVKD  79

Query  182  APWEVTKDMITTFDISLVVHG  244
            AP+  + +++  ++    VHG
Sbjct  80   APYFTSLEVMEKYNCDFCVHG  100



>emb|CEG66906.1| Putative Ethanolamine-phosphate cytidylyltransferase [Rhizopus 
microsporus]
Length=300

 Score =   121 bits (303),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 80/102 (78%), Gaps = 3/102 (3%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH+E L+ A+  GDFL+VG+H DQTV+A +G + P+MNLHER+LSVLACRYVDEVIIG
Sbjct  200  HIGHIEFLKRAKEQGDFLVVGVHDDQTVNAIKGINYPLMNLHERALSVLACRYVDEVIIG  259

Query  182  APWEVTKDMITT-FDISLVVHGTVAEYSDYQKEAENPYAVPI  304
            AP+ VT+D++ T +++++VVHGT +   D   + ++PY V +
Sbjct  260  APYSVTEDVLNTEYNVTVVVHGTTSSEPDI--DGKDPYEVSL  299


 Score = 72.4 bits (176),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 57/95 (60%), Gaps = 7/95 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A+ +GD L+VG+H+D  +   +G    +M   ER  +V AC++VDEV+  
Sbjct  19   HYGHANALRQAKEMGDILVVGVHSDAEIEKNKGP--TVMKEQERYAAVAACKWVDEVVPN  76

Query  182  APWEVTKDMITTFDISLVVHG----TVAEYSD-YQ  271
            AP+  T +++  ++I   VHG    T+A+ +D YQ
Sbjct  77   APYNTTVEILQKYNIDFCVHGDDITTMADGTDCYQ  111



>gb|EPY43438.1| ethanolamine-phosphate cytidylyltransferase [Angomonas deanei]
Length=379

 Score =   122 bits (306),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 100/147 (68%), Gaps = 1/147 (1%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH+ +L+ AR LGD+++VG+H D+TV+  +G + PIMNL+ER L VL+CRYV+EV++G
Sbjct  222  HIGHIRVLQKARELGDYVIVGVHEDKTVNEVKGKNYPIMNLNERVLGVLSCRYVNEVVLG  281

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
             P+ VTKD+I +  + +VV G V +      +A + Y VP  +GI + ++S  ++TT  +
Sbjct  282  VPFNVTKDVIDSLHVDIVVGGKVCDQYP-GGDAGSSYQVPQELGIFREVDSECNLTTDFL  340

Query  362  irriVSNHDAYLKRNEKKVESEKRYYE  442
            I R++ N  A+LKR E+K   +K+  E
Sbjct  341  IERVIQNRAAFLKRQEEKRVKDKKCIE  367


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 54/110 (49%), Gaps = 5/110 (5%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   +R A   G+ L VG HTD+ V   +G   PIM+  ER  ++ AC++VD V+  
Sbjct  44   HFGHCNAIRQAAKFGNELFVGCHTDEEVMRFKGP--PIMHDEERYEALRACKWVDYVVEN  101

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLE  331
             P+      +  F+I  VVHG          +  N Y   I  G LKV++
Sbjct  102  YPYCTRLKDMERFEIDYVVHGDDLSVG---LDGRNSYQEIIDAGKLKVVK  148



>dbj|GAM28819.1| hypothetical protein SAMD00019534_119950, partial [Acytostelium 
subglobosum LB1]
Length=361

 Score =   122 bits (305),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 69/142 (49%), Positives = 94/142 (66%), Gaps = 3/142 (2%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH E LR A+  GDFL+VG+H D  V+  +G++ PIMNLHER LSVL+CRYVDEVIIG
Sbjct  216  HVGHCEALRQAKEQGDFLIVGVHDDLVVNEQKGSNFPIMNLHERVLSVLSCRYVDEVIIG  275

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            AP+ V+K+ I    I++V HG     +    +  +PY +P  MGI K ++    +TTS I
Sbjct  276  APFTVSKETIEALGINVVCHGDDPVVA---SDGSDPYKIPKQMGIYKEVKHTEGLTTSDI  332

Query  362  irriVSNHDAYLKRNEKKVESE  427
            IRRI+ N + +  RN+KK + E
Sbjct  333  IRRIIENRNQFEARNKKKQQKE  354


 Score = 76.3 bits (186),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 49/81 (60%), Gaps = 2/81 (2%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A+ LGD L+VG+HTD  ++  +G   P+MN  ER  +V AC++ DEV  G
Sbjct  28   HFGHANALRQAKELGDILVVGVHTDAEIARNKGP--PVMNEQERYKAVRACKWADEVAEG  85

Query  182  APWEVTKDMITTFDISLVVHG  244
            AP+  T +++   +    VHG
Sbjct  86   APYTATVELLKELNCDFCVHG  106



>emb|CDS08409.1| hypothetical protein LRAMOSA09772 [Absidia idahoensis var. thermophila]
Length=377

 Score =   122 bits (305),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 82/113 (73%), Gaps = 3/113 (3%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH+E L+ A++LGDFL+VG+H DQTV+A +G++ P+MNLHER+LSVLACRYVDEVIIG
Sbjct  219  HIGHIEFLKRAKALGDFLIVGVHDDQTVNAIKGSNYPLMNLHERALSVLACRYVDEVIIG  278

Query  182  APWEVTKDMITT-FDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESP  337
            AP+ +T+ ++T  + + +V HG      D   + ++PY +    GI   +E+P
Sbjct  279  APYSITEAVLTKEYKVHIVAHGNTPTEPDL--DGKDPYQLAKDRGIYTEIENP  329


 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 58/95 (61%), Gaps = 7/95 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A+++GD L+VG+H+D  +   +G    +M   ER  +V AC++VD+V+  
Sbjct  25   HYGHANALRQAKAMGDVLVVGVHSDAEILKNKGP--TVMKEQERYDAVAACKWVDQVVPN  82

Query  182  APWEVTKDMITTFDISLVVHG----TVAEYSD-YQ  271
            AP+  T +++  +DI   VHG    T+A+ +D YQ
Sbjct  83   APYNTTVEILKEYDIDFCVHGDDITTMADGTDCYQ  117



>ref|XP_004527209.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X2 [Ceratitis capitata]
Length=409

 Score =   122 bits (305),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 100/147 (68%), Gaps = 2/147 (1%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH++ L  A+ LGD+L+VG+HTD  V++ +G++ PIMNLHER LSVLAC+YV+EV+IG
Sbjct  253  HVGHLDFLEKAKELGDYLIVGLHTDPVVNSYKGSNYPIMNLHERVLSVLACKYVNEVVIG  312

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            AP+ VT+D++  F I +V HG      +  K   +PYAVP + GI  +++S   +TT  I
Sbjct  313  APYCVTEDLLDHFKIDVVCHGQTPIALENGK--IDPYAVPKTRGIFTLIDSQNSMTTELI  370

Query  362  irriVSNHDAYLKRNEKKVESEKRYYE  442
            + RI+S+   Y +RN+ K + E   +E
Sbjct  371  VERIISHRLEYERRNKAKEKKECEAFE  397


 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 50/81 (62%), Gaps = 2/81 (2%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A++LGD ++VGIHTD+ ++  +G   P+    ER   V   ++VDEV++G
Sbjct  61   HFGHANSLRQAKALGDKVIVGIHTDEEITKHKGP--PVFTEEERVKMVKGIKWVDEVVLG  118

Query  182  APWEVTKDMITTFDISLVVHG  244
            AP+  T +++  ++    VHG
Sbjct  119  APYVTTLEVLDEYNCDFCVHG  139



>ref|XP_004527208.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Ceratitis capitata]
Length=422

 Score =   122 bits (305),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 100/147 (68%), Gaps = 2/147 (1%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH++ L  A+ LGD+L+VG+HTD  V++ +G++ PIMNLHER LSVLAC+YV+EV+IG
Sbjct  266  HVGHLDFLEKAKELGDYLIVGLHTDPVVNSYKGSNYPIMNLHERVLSVLACKYVNEVVIG  325

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            AP+ VT+D++  F I +V HG      +  K   +PYAVP + GI  +++S   +TT  I
Sbjct  326  APYCVTEDLLDHFKIDVVCHGQTPIALENGK--IDPYAVPKTRGIFTLIDSQNSMTTELI  383

Query  362  irriVSNHDAYLKRNEKKVESEKRYYE  442
            + RI+S+   Y +RN+ K + E   +E
Sbjct  384  VERIISHRLEYERRNKAKEKKECEAFE  410


 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 50/81 (62%), Gaps = 2/81 (2%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A++LGD ++VGIHTD+ ++  +G   P+    ER   V   ++VDEV++G
Sbjct  61   HFGHANSLRQAKALGDKVIVGIHTDEEITKHKGP--PVFTEEERVKMVKGIKWVDEVVLG  118

Query  182  APWEVTKDMITTFDISLVVHG  244
            AP+  T +++  ++    VHG
Sbjct  119  APYVTTLEVLDEYNCDFCVHG  139



>emb|CEJ03656.1| Putative Ethanolamine-phosphate cytidylyltransferase [Rhizopus 
microsporus]
Length=300

 Score =   120 bits (301),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 79/102 (77%), Gaps = 3/102 (3%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH+E L+ A+  GDFL+VGIH DQTV+A +G + P+MNLHER+LSVLACRYVDEVIIG
Sbjct  200  HIGHIEFLKRAKEQGDFLVVGIHDDQTVNAIKGINYPLMNLHERALSVLACRYVDEVIIG  259

Query  182  APWEVTKDMI-TTFDISLVVHGTVAEYSDYQKEAENPYAVPI  304
            AP+ VT+D++ T +++++VVHGT +   D   +  +PY V +
Sbjct  260  APYSVTEDVLDTEYNVAVVVHGTTSSEPDI--DGRDPYEVSL  299


 Score = 72.4 bits (176),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 57/95 (60%), Gaps = 7/95 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A+ +GD L+VG+H+D  +   +G    +M   ER  +V AC++VDEV+  
Sbjct  19   HYGHANALRQAKEMGDILVVGVHSDAKIEKNKGP--TVMKEQERYAAVAACKWVDEVVPN  76

Query  182  APWEVTKDMITTFDISLVVHG----TVAEYSD-YQ  271
            AP+  T +++  ++I   VHG    T+A+ +D YQ
Sbjct  77   APYNTTVEILQKYNIDFCVHGDDITTMADGTDCYQ  111



>emb|CDH52899.1| ethanolamine-phosphate cytidylyltransferase-like [Lichtheimia 
corymbifera JMRC:FSU:9682]
Length=395

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 82/113 (73%), Gaps = 3/113 (3%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH+E L+ A++LGDFL+VG+H DQTV+A +G++ P+MNLHER+LSVLACRYVDEVIIG
Sbjct  237  HIGHIEFLKRAKALGDFLIVGVHDDQTVNAIKGSNYPLMNLHERALSVLACRYVDEVIIG  296

Query  182  APWEVTKDMITT-FDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESP  337
            AP+ +T+ ++T  + + +V HG      D   + ++PY +    GI   +E+P
Sbjct  297  APYSITEAVLTKEYKVHIVAHGNTPTEPDL--DGKDPYQLAKDRGIYTEIENP  347


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 58/95 (61%), Gaps = 7/95 (7%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A+++GD L+VG+H+D  +   +G    +M   ER  +V AC++VD+V+  
Sbjct  43   HYGHANALRQAKAMGDILVVGVHSDAEILKNKGP--TVMKEQERYDAVAACKWVDQVVPD  100

Query  182  APWEVTKDMITTFDISLVVHG----TVAEYSD-YQ  271
            AP+  T +++  ++I   VHG    T+A+ +D YQ
Sbjct  101  APYNTTVEILKEYNIDFCVHGDDITTMADGTDCYQ  135



>gb|AAL25522.1| SD08668p [Drosophila melanogaster]
 gb|ACL88289.1| Pect-PA, partial [synthetic construct]
 gb|ACL92413.1| Pect-PA [synthetic construct]
Length=206

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 101/148 (68%), Gaps = 2/148 (1%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH++ L  A+ LGD+L+VG+HTD  V++ +G++ PIMNLHER LSVLAC++V+EV+IG
Sbjct  50   HVGHLDFLEKAKKLGDYLIVGLHTDPVVNSYKGSNYPIMNLHERVLSVLACKFVNEVVIG  109

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            AP+ VT++++  F I +V HG      +  K   +PYAVP +  I ++++S  ++TT  I
Sbjct  110  APYCVTEELLEHFKIDVVCHGRTPIALENGK--IDPYAVPKTRAIFELIDSGNEMTTERI  167

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEG  445
            + RI+S+   Y +RN+ K + E   +E 
Sbjct  168  VERIISHRLEYERRNQAKEKKEIEAFEA  195



>gb|EPY23528.1| ethanolamine-phosphate cytidylyltransferase [Strigomonas culicis]
 gb|EPY27910.1| ethanolamine-phosphate cytidylyltransferase [Strigomonas culicis]
 gb|EPY33279.1| ethanolamine-phosphate cytidylyltransferase [Strigomonas culicis]
Length=385

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/149 (44%), Positives = 98/149 (66%), Gaps = 1/149 (1%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GHV +L+ AR LGD+L+ GI+ D+ ++  +G + PIMNL+ER L VL+CRYVDEV+IG
Sbjct  228  HIGHVRVLQKARELGDYLIAGIYEDKVINEAKGKNFPIMNLNERVLGVLSCRYVDEVVIG  287

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
             P+ V+K++I    IS+VV G   +     +E   PY +P  MGI + ++S   +TT ++
Sbjct  288  VPFNVSKEIIANLRISIVVSGKCCDQI-ANREFSAPYRIPKEMGIYQEVDSGCVLTTDSL  346

Query  362  irriVSNHDAYLKRNEKKVESEKRYYEGK  448
            I R++ N  A+LKR E+K   +K+  E K
Sbjct  347  IDRVLQNRVAFLKRQEEKKVKDKKSIENK  375


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 34/110 (31%), Positives = 50/110 (45%), Gaps = 5/110 (5%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   +R A  LG    VG H+D+ V   +G   PIM+  ER  ++ AC++VD V+  
Sbjct  50   HFGHANAIRQASKLGTEFFVGCHSDEEVMRFKGP--PIMHAEERYDALRACKWVDFVVEN  107

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLE  331
             P+      +   +I  V HG          +  N Y   I  G  KV++
Sbjct  108  YPYCTRLKDMERLEIDFVAHGDDISVG---LDGRNSYQEIIDAGKFKVVK  154



>ref|XP_001851245.1| ethanolamine-phosphate cytidylyltransferase [Culex quinquefasciatus]
 gb|EDS33301.1| ethanolamine-phosphate cytidylyltransferase [Culex quinquefasciatus]
Length=372

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/147 (46%), Positives = 95/147 (65%), Gaps = 2/147 (1%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH++ L  A++ GD+L+VG+HTD  V+  +G + PIMNLHER LSVLAC+YV+EV+IG
Sbjct  216  HVGHLDFLEKAKTYGDYLIVGLHTDPVVNVYKGGNYPIMNLHERVLSVLACKYVNEVVIG  275

Query  182  APWEVTKDMITTFDISLVVHGTVAEYSDYQKEAENPYAVPISMGILKVLESPLDittsti  361
            AP+ VTKD++  F++ LV HG      D      +PYAVP  MG   +++S   ITT  I
Sbjct  276  APYSVTKDLMEHFNVDLVCHGQTTIAPDVGN--LDPYAVPKQMGKFMLIDSGNPITTEDI  333

Query  362  irriVSNHDAYLKRNEKKVESEKRYYE  442
            + RI+ +   Y  RN KK + E   +E
Sbjct  334  VERIIRHRLEYEARNVKKEKKEIEVFE  360


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 44/81 (54%), Gaps = 2/81 (2%)
 Frame = +2

Query  2    HAGHVEILRLARSLGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIG  181
            H GH   LR A++LG  L+VGIH D+ ++  +G   P+    ER   V   ++VDEV+  
Sbjct  24   HFGHANSLRQAKALGHKLVVGIHNDEDITKNKGP--PVFTQEERYKMVRGIKWVDEVVED  81

Query  182  APWEVTKDMITTFDISLVVHG  244
            AP+  T + +   +    VHG
Sbjct  82   APYVTTLETLDNNNCDFCVHG  102



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1154079434412